Page 1


133. AUKTION GRIECHISCHE BRONZEMÜNZEN - DIE SAMMLUNG FRIEDRICH POPKEN THE FRIEDRICH POPKEN COLLECTION OF GREEK BRONZE COINS ________________________________________________________________

MÜNZEN DER ANTIKEN WELT MIT SPITZENSTÜCKEN AUS PROMINENTEN SAMMLUNGEN ANCIENT COINS HIGHLIGHTED BY MASTERPIECES FROM FAMOUS COLLECTIONS 11. – 12. Oktober 2007 October 11th – 12th 2007 Steigenberger Hotel Remarque Osnabrück Natruper-Tor-Wall 1 Hotel-Telefon (05 41) 60 96 633 Hotel-Fax (05 41) 60 96 634 (nur während der Auktion/only during the auction/ uniquement pendant la vente/solamente durante l'asta)

We sell the Friedrich Popken Collection in cooperation with

CLASSICAL NUMISMATIC GROUP, INC. UNITED STATES OFFICE Post Office Box 479 Lancaster, PA 17608-0479 USA

LONDON OFFICE 14 Old Bond Street London W1S 4PP UK

Tel: +1-717-390-9194 Fax: +1-717-390-9978

Tel: +44-20-7495-1888 Fax: +44-20-7499-5916

www.cngcoins.com email: cng@cngcoins.com

ZEITPLAN AUKTION 133 Donnerstag, den 11. Oktober 2007 GRIECHISCHE BRONZEMÜNZEN DIE SAMMLUNG FRIEDRICH POPKEN

14.00 Uhr - 18.00 Uhr Nr. 7001 bis Nr. 7836

Freitag, den 12. Oktober 2007 MÜNZEN AUS DER ANTIKEN WELT ANCIENT COINS

Detaillierter Zeitplan siehe Seite 5 Besichtigungen siehe Seite 9 Horaire détaillé voir page 5 Exposition des monnaies voir page 9

9.30 Uhr - 13.00 Uhr Nr. 7837 bis Nr. 8494 14.00 Uhr - 18.30 Uhr Nr. 8495 bis Nr. 9368

Detailed timetable view page 5 Viewing of auction good view page 9 Calendario dettagliato veda pagina 5 Esposizione veda pagina 9


UNSERE ADRESSE OUR ADDRESS

Fritz Rudolf Künker e. K. Münzenhandlung Gutenbergstr. 23 · 49076 Osnabrück Telefon: 05 41-96 20 20 Telefax: 05 41-96 20 222 Gebührenfreie Rufnummer: 08 00-58 36 537 International calls: International fax:

+49 (0)5 41-96 20 20 +49 (0)5 41-96 20 222

Während der Auktion/During the auction Steigenberger Hotel Remarque: Telefon: Fax:

+49 (0)5 41-60 96 633 +49 (0)5 41-60 96 634

Ust.-Id.-Nr.: DE 117 620 142 UNSERE GESCHÄFTSZEITEN OPENING HOURS

Montag-Donnerstag Freitag Sonnabend Saturday

9.00 - 17.00 Uhr 9.00 - 15.30 Uhr nach Vereinbarung by prior appointment

Außerhalb unserer Geschäftszeit steht unseren Kunden ein automatischer Anrufbeantworter zur Verfügung. Answering machine available after opening hours.

WWW.KUENKER.DE E-MAIL: INFO@KUENKER.DE

Auf unserer Internetseite haben Sie die Möglichkeit: • die Abbildungen zu vergrößern • Ihre Gebote direkt per Email abzugeben • die Ergebnisse der Auktionen abzurufen On our website you have the possibility: • to zoom all images • to place your bids • to view all auction results

IHRE ANSPRECHPARTNER CONTACT

Abwicklung der Aufträge und Einlieferungen

Gisela Thomas, Prokuristin Telefon: (05 41) 96 20 221 Annahme von Einlieferungen Staff members accepting consignments

Dr. Andreas Kaiser Telefon: (05 41) 96 20 254 Arne Kirsch, Prokurist Telefon: (05 41) 96 20 234 Oliver Köpp, Prokurist Telefon: (05 41) 96 20 229 Dr. Sebastian Steinbach (Münzen des Mittelalters) Telefon: (05 41) 96 20 236 Jens-Ulrich Thormann MA (Antike Münzen) Telefon: (05 41) 96 20 242 Mitglied Verband der Deutschen Münzenhändler e. V. Associaton Internationale des Numismates Professionnels (AINP) 2


HINWEISE FÜR UNSERE BIETENDEN AUKTIONSKUNDEN 1. 2.

Die Auktionsbedingungen finden Sie am Ende dieses Katalogs. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. 3. Das beiliegende Formular macht es Ihnen leicht, ein schriftliches Gebot abzugeben. Falls Sie Ihre Gebote faxen möchten: unser Telefax 0541 96 20 222 steht Ihnen Tag und Nacht zur Verfügung. 4. Die von Ihnen ersteigerten Objekte werden Ihnen innerhalb von acht Tagen nach Beendigung der Auktion zugeschickt. Die Aufträge werden in der Reihenfolge des Eingangs bearbeitet, d. h. die zuerst eingegangenen Aufträge werden auch zuerst bearbeitet. Auch alle Bieter, die keinen Zuschlag erhalten haben, werden von uns nach der Auktion benachrichtigt. 5. Wenn Sie telefonisch bieten möchten, rufen Sie bitte vor der Auktion unseren Kundenservice an. Frau Thomas freut sich auf Ihren Anruf entweder direkt unter 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37. 6. Wenn Sie als neuer Kunde noch nicht bei uns gekauft haben, ist es empfehlenswert, wenn Sie uns Referenzen angeben. Nennen Sie uns eine Münzhandlung, mit der Sie bereits in Geschäftsverbindung stehen. Oder rufen Sie unseren Kundenservice an. Telefon 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37. 7. Unsere Broschüre “DIE KÜNKER-AUKTIONEN: WIE BIETE ICH ERFOLGREICH?“ liegt in jedem Katalog und ist für Sie eine nützliche Hilfe. 8. Die Echtheit aller verkauften Objekte wird auch über die gesetzliche Frist hinaus gewährleistet. 9. Alle Kunden, die als Bieter an einer unserer Auktionen teilnehmen, erhalten innerhalb von zwei Wochen nach der Auktion unsere Ergebnisliste gratis. 10. Sie haben Fragen zu einer bestimmten Münze? Sie möchten persönlich an unserer Auktion teilnehmen? Sie haben andere Fragen? Unser Kundenservice freut sich auf Ihren Anruf, entweder direkt unter 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37.

RENSEIGNEMENTS A L'ATTENTION DE NOS CLIENTS DES VENTES AUX ENCHERES 1.

Vous trouverez les conditions générales de vente aux enchères à la fin de ce catalogue. 2. Veuillez nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. 3. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Si vous souhaitez faxer votre offre, vous pourrez le faire 24 heures sur 24 au +49 (0)541 – 96 20 222. 4. Les objets dont vous serez adjudicataire vous seront envoyés dans les huit jours suivant la fin de la vente aux enchères. Les commandes seront prises en compte dans l’ordre de leur arrivée, c’est-à-dire que les commandes nous parvenant les premières seront d’abord traitées. Après la vente aux enchères, nous préviendrons tous les enchérisseurs n’ayant pas obtenu l’adjudication. 5. Si vous souhaitez faire des enchères par téléphone, veuillez appeler aupravant notre service clientèle. Madame Thomas sera heureuse de vous répondre directement au +49 (0)541 – 96 20 221. 6. Si vous êtes un nouveau client et n’avez encore fait aucune acquisition chez nous, il serait conseillé de nous fournir quelques références. Indiquez nous si vous traitez déjà avec un professionnel du commerce des monnaies. Ou contactez notre service clientèle au +49 (0)541 – 96 20 221. 7. Notre brochure intitulée : »DIE KÜNKER-AUKTIONEN : WIE BIETE ICH ERFOLGREICH?“ (»Les ventes aux enchères de Künker : comment faire une enchère réussie ? « ) jointe dans chaque catalogue vous sera très utile. 8. L’authenticité des pièces vendues sera garantie même au-delà des délais légaux. 9. Tous les clients participant à l’une de nos ventes aux enchères en tant qu’enchérisseurs recevront gratuitement une liste de résultats dans les deux semaines suivant la vente aux enchères. 10. Vous avez des questions concernant une pièce particulière ? Vous désirez prendre part personnellement à notre vente aux enchères ? Vous avez d’autres questions ? Notre service clientèle se fera un plaisir de vous répondre au +49 (0)541 – 96 20 221.

IMPORTANT INFORMATION FOR PLACING BIDS 1.

The terms and conditions of the auction can be found at the end of this catalogue. 2. Please send us your instructions as early as possible. The likelihood of errors occurring increases if we do not receive your instructions until shortly before the auction. 3. The enclosed form makes it simple for you to submit a written bid. Our fax machine +49 (0)541 – 96 20 222 is on standby day and night in case you wish to fax your bids. 4. The objects which you purchase will be delivered to you within eight days of the close of auction. Instructions are processed in the same order as they were received – in other words, the first instructions to be received are the first to be processed. All unsuccessful bidders will be also informed after the auction. 5. If you would like to bid by telephone, please ring our customer service beforehand. Mrs. Thomas will be pleased to speak to you on +49 (0)541 96 20 221. 6. If you are a new customer who has not yet bought anything through us, we recommend that you give us references. Name a coin dealer with whom you have already done business. Or call our customer service on +49 (0)541 – 96 20 221. 7. Our brochure „DIE KÜNKER-AUKTIONEN: WIE BIETE ICH ERFOLGREICH?“ ("The Künker auctions: How to bid successfully?“) is enclosed in every catalogue and will prove useful to you. 8. The genuineness of all sold objects is also warranted beyond the statutory length of time. 9. All customers who participate as bidders in our auction receive our list of results free of charge within two weeks of the close of auction. 10. Do you have questions about a particular coin? Would you like to participate personally in our auction? Do you have any other questions? Our customer service team will be pleased to help you – call on +49 (0)541 96 20 221.

INFORMAZIONI PER GLI OFFERENTI DELLE NOSTRE ASTE 1. 2.

Le condizioni d’asta si trovano alla fine di questo catalogo. Siete pregati di inviarci i vostri ordini il più presto possibile. Se il vostro ordine ci perviene poco tempo prima dell’apertura dell’asta, si possono verificare errori nell’elaborazione dello stesso. 3. Per le vostre offerte scritte potete utilizzare il modulo allegato al catalogo. Nel caso voleste trasmettere le vostre offerte per fax, siete pregati di inviarle al seguente numero: +49 (0)541-96 20 222. 4. Gli oggetti che avete acquistato all’asta vi saranno spediti entro otto giorni dal termine della stessa. Gli ordini vengono evasi in base alla data di ricevimento, quindi hanno precedenza quelli pervenuti prima. Anche gli offerenti che non hanno avuta alcuna aggiudicazione riceveranno una nostra comunicazione al termine dell’asta. 5. Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare prima la consulenza ai clienti. La sig.ra Thomas, raggiungibile al numero diretto +49 (0)541- 96 20 221, sará a vostra disposizione. 6. Se siete clienti nuovi e non avete mai acquistato da noi, vi proponiamo di inviarci delle referenze. Dateci il nome di un negozio di monete presso il quale avete già fatto degli acquisti, oppure chiamate la nostra consulenza ai clienti al numero +49 (0)541 96 20 221. 7. Nel nostro opuscolo « DIE KÜNKER-AUKTIONEN : WIE BIETE ICH ERFOLGREICH?“ („Aste Künker: come avere successo nelle offerte?“), allegato ad ogni catalogo, troverete consigli utili. 8. Il certificato d’autenticità di tutti gli oggetti venduti viene rilasciato anche oltre i termini privisti per legge. 9. Tutti i clienti che hanno partecipato ad una nostra asta riceveranno gratuitamente l´elenco delle aggiudicazioni entro quindici giorni dal termine della stessa. 10. Avete delle domande su una moneta in particolare ? Desiderate partecipare personalmente ad una nostra asta? Avete altre domande? Rivolgetevi al nostro Servizio Clienti al numero +49 (0)541 – 96 20 221.

3


WICHTIGE HINWEISE FÜR UNSERE EINLIEFERER 1.

Unser Expertenteam garantiert Ihnen eine fachgerechte Bearbeitung der von Ihnen eingelieferten Stücke. 2. Die Schätzpreise werden von uns aufgrund unserer hervorragenden Marktkenntnisse sorgfältig festgelegt. Die Stücke werden zu 80% der im Katalog angegebenen Schätzpreise ausgerufen. Durch diese Regelung werden Sie als Einlieferer geschützt. Für nicht verkaufte Objekte werden keine Gebühren erhoben. 3. Der Standard unserer Kataloge ist von hoher Qualität und findet internationale Anerkennung. Wir haben eine der besten Kundendateien, die es weltweit gibt. 4, Von der individuellen Betreuung unserer Kunden profitieren auch Sie als Einlieferer. 5. Als Einlieferer erhalten Sie Ihren Auktionserlös innerhalb von 45 Tagen nach der Auktion. Sonderregelungen sind nach Absprache möglich. 6. Auf Wunsch kann Ihre Einlieferung bei Ihnen zuhause abgeholt werden. Ab € 2.500,-- Einlieferungssumme übernehmen wir die Kosten, ab € 25.000,-können wir unter Umständen an einem vereinbarten Ort Ihre Einlieferung nach Absprache gerne auch persönlich entgegennehmen. Selbstverständlich ist Ihr Versteigerungsgut durch uns versichert. 7. Nicht alle Münzen eignen sich, als Einzelstücke aufgenommen zu werden. Vertrauen Sie auf die Erfahrung unserer Experten, die niedrigpreisige Münzen liebevoll zu interessanten Lots zusammenstellen. 8. Der Schätzwert Ihrer Einlieferung sollte mindestens € 1.000,-- betragen. 9. Ihre Einlieferung wird Ihnen sofort bei Übernahme durch ein Protokoll quittiert. Spätestens fünf Wochen vor der Auktion erhalten Sie eine genaue Auflistung Ihrer Objekte mit den dazugehörenden Katalognummern. 10. Innerhalb einer Woche nach der Auktion erhalten Sie bereits die Ergebnisliste und können alle erzielten Preise feststellen. 11. Profitieren Sie von der Anziehungskraft eines führenden Unternehmens. Bitte wenden Sie sich bei Fragen an unseren Kundenservice unter Leitung von Frau Gisela Thomas direkt unter 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37. 12. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Frau Thomas freut sich auf Ihren Anruf. Telefon: 0541 – 96 20 221 oder gebührenfrei unter 0800 5 83 65 37.

RENSEIGNEMENTS IMPORTANTS A L'ATTENTION DES VENDEURS 1.

Notre équipe d’experts garantit une prise en charge compétente des pièces que vous nous confiez. 2. Notre excellente connaissance du marché nous permet de fixer soigneusement les prix estimés. Les pièces seront mises aux enchères à un prix représentant 80% du prix estimé indiqué dans le catalogue. Cette réglementation vous protège en tant que vendeur. Aucuns frais ne seront prélevés sur les pièces invendues. 3. Nos catalogues ont un niveau qualitatif élevé, reconnu au plan international. Nous disposons d’un des meilleurs fichiers clients du monde. 4. En tant que vendeur, vous profiterez vous aussi du suivi personnalisé que nous offrons à nos clients. 5. Le vendeur recevra le produit de la vente dans les 45 jours qui suivront les enchères. Des dispositions spéciales pourront être prises sur accord préalable. 6. Nous prendrons en charge les frais d´expédition des pièces dont le montant sera supérieur à € 2.500,--: Si leur montant est supérieur à € 25.000,--, l´un de nos employés se poudra charger de prendre la livraison à un lieu concordée. En concertation, notre assurance couvrira tous les risques. 7. Les pièces de monnaie ne se prêtent pas toutes à une vente individuelle. Faites confiance à l’expérience de nos spécialistes qui se chargeront avec plaisir de rassembler les pièces bon marché de manière à constituer des lots intéressants. 8. La valeur estimée des pièces fournies devrait s’élever à un minimum de € 1.000,--. 9. Au moment de la prise en charge, vous recevrez un détail des pièces fournies. Au plus tard cinq semaines avant la vente aux enchères, vous recevrez une liste exacte de vos pièces avec les numéros de catalogue correspondants. 10. Dans la semaine qui suivra la vente aux enchères, vous recevrez déjà la liste de ses résultats et pourrez prendre connaissance des prix obtenus. 11. Profitez de l’attrait du leader du marché. Pour tout renseignement, veuillez-vous adresser à notre service clientèle sous la direction de madame Gisela Thomas : +49 (0)541 – 96 20 221. 12. Vous pouvez demander sans engagement de votre part nos contrats de dépôt de pièces? Vous avez d’autres questions? Madame Thomas sera heureuse de vous répondre au +49 (0)541 – 96 20 221.

4

IMPORTANT INFORMATION FOR OUR CONSIGNERS 1.

Our team of specialists guarantees an expert treatment of the consigned items. 2. The estimates are carefully established by us due to our excellent knowledge of the market. Bidding for the items is then started at 80 % of the estimate price stated in the catalogue. This arrangement protects you as a consigner. Unsold items incur no fees. 3. The standard offered in our catalogue is of the highest quality, and is recognised internationally. We have one of the best clientele lists worldwide. 4. You as a consigner also profit from the individual consultation offered to our customers. 5. As a consigner, you receive the auction proceeds within 45 days of the close of auction. Special arrangements can be made following discussion. 6. For consignments with a value over € 2.500,-- we may bear the transportation costs. For deliveries over € 25.000,-- we may personally collect the items at an arranged place after prior consultation. Upon consultation, the shipping of your goods could be covered by our insurance. 7. Not all coins are suited to be registered as individual items. Trust in our expert´s experience as they carefully combine less-valuable coins into interesting lots. 8. The valuation price of your delivery should be at least € 1.000,--. 9. Your delivery is confirmed in writing immediately on receipt. At least five weeks before the auction, you receive an exact list of your objects with the relevant catalogue numbers. 10. Within a week of the close of auction, you receive a list with the results in order to see what prices were reached for each individual lot. 11. Profit from our position as a leading coin dealer. If you have any questions, please contact our customer service team which is headed by Mrs. Gisela Thomas – directly on +49 (0)541 – 96 20 221. 12. Would you like to receive copies of our contracts for consigner, without making any commitment? Do you have any other questions? Mrs. Thomas will be pleased to help you – please call on +49 (0)541 – 96 20 221.

INFORMAZIONI PER I NOSTRI DEPOSITANTI 1.

Il nostro team di esperti assicura un trattamento accurato dei pezzi che ci avete inviato. 2. Eseguiamo valutazioni finalizzate alla vendita. I prezzi di stima sono frutto della nostra eccezionale conoscenza del mercato e della nostra attenta valutazione. La base d´asta ammonta all´80% del prezzo di stima indicato sul catalogo. Non si addebitano spese per gli oggetti invenduti. 3. I nostri cataloghi sono di alta qualità e sono riconosciuti a livello internazionale. I nostri clienti sono fra i migliori al mondo. 4. Come depositanti potete beneficiare dell’assistenza riservata a ciascuno dei nostri clienti. 5. Come depositanti riceverete gli importi realizzati all’asta entro 45 giorni dal termine della stessa. Si possono concordare condizioni particolari. 6. A partire da un controvalore degli oggetti di € 2.500,--i costi del trasporto sono a nostro carico, mentre a partire da un controvalore di € 25.000 gli oggetti possono essere ritirati personalmente da un nostro incaricato ad un posto concordato. Naturalmente il trasporto dei vostri oggetti puó essere assicurato tramite la nostra assicurazione. 7. Non tutte le monete possono essere negoziate singolarmente. Fidatevi dell´esperienza dei nostri esperti, che raggruppano le monete non molto preziose in lotti di sicuro interesse. 8. Il valore stimato degli oggetti depositati deve ammontare ad almeno € 1.000,--. 9. Nel momento in cui gli oggetti sono presi in consegna, viene rilasciata una ricevuta numerata. Riceverete un elenco preciso degli oggetti che avete depositato con i relativi numeri di catalogo al massimo cinque settimane prima dell’asta. 10. Riceverete l’elenco degli oggetti aggiudicati entro una settimana dalla chiusura dell’asta. Potrete cosi verificare i prezzi realizzati. 11. Approfittate della capacità di un leader di mercato per aumentare il valore dei vostri oggetti. Se avete delle domande, rimaniamo a vostra disposizione per qualsiasi necessità. Rivolgetevi alla nostra consulenza ai clienti diretta dalla sig.ra Gisela Thomas al numero +49 (0)541-91 20 221. 12. Volete ricevere i nostri contratti senza impegno? Avete altre domande? Potete contattare la sig.ra Gisela Thomas al numero +49 (0)541-96 20 221.


DETAILLIERTER ZEITPLAN AUKTIONEN 129-133 AUKTION 129 GEPRÄGTES GOLD AUS MITTELALTER UND NEUZEIT

RUSSISCHE MÜNZEN UND MEDAILLEN AUKTION 130 THE DE WIT COLLECTION OF MEDIEVAL COINS PART II

Montag, den 08. Oktober 2007 11.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 408 Geprägtes Gold: Europa - Übersee 14.00 Uhr - 16.00 Uhr Nr. 409 bis Nr. 815 Geprägtes Gold: Habsburgische Erblande-Österreich, Deutsche Goldmünzen und -medaillen, Lots 16.00 Uhr - 19.00 Uhr Nr. 816 bis Nr. 1371 Dienstag, den 09. Oktober 2007 9.30 Uhr - 13.00 Uhr Nr. 1515 bis Nr. 2161 Deutschland: Sachsenpfennige/Holzkirchenpfennige/OttoAdelheid-Pfennige - Seligenstadt 14.00 Uhr - 18.30 Uhr Nr. 2162 bis Nr. 3034 Deutschland: Hessen - Breisgau, Schweiz, Österreich, Böhmen, Mähren, Ungarn, Schlesien, Polen, Baltikum, Rußland, Goldene Horde

AUKTION 131 MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT MÜNZWAAGEN UND GEWICHTE

AUKTION 132 DEUTSCHE MÜNZEN SEIT 1871 IN GOLD UND SILBER AUKTION 133 GRIECHISCHE BRONZEMÜNZEN DIE SAMMLUNG FRIEDRICH POPKEN MÜNZEN AUS DER ANTIKEN WELT MIT SPITZENSTÜCKEN AUS PROMINENTEN SAMMLUNGEN

BESICHTIGUNGEN

Mittwoch, den 10. Oktober 2007 9.30 Uhr - 13.00 Uhr Nr. 4001 bis Nr. 4684 Europa, Übersee, Habsburgische Erblande-Österreich 14.00 Uhr - 19.00 Uhr Nr. 4685 bis Nr. 5650 Deutsche Münzen und Medaillen, Notmünzen, Papiergeld, Prägewerkzeuge, Münzwaagen, Münzgefäße, Numismatische Literatur, Lots Donnerstag, den 11. Oktober 2007 9.30 Uhr - 13.00 Uhr Nr. 6001 bis Nr. 6800 14.00 Uhr - 18.00 Uhr Nr. 7001 bis Nr. 7836 Freitag, den 12. Oktober 2007 9.30 Uhr - 13.00 Uhr Nr. 7837 bis Nr. 8494 Kelten, Griechen, Römische Republik, Imperatorische Prägungen 14.00 Uhr - 18.30 Uhr Nr. 8495 bis Nr. 9368 Römische Kaiserzeit, Lots, Völkerwanderung, Byzanz, Kreuzfahrer, Orientalen

Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 10.09.2007, nach vorheriger telefonischer Vereinbarung unter Nr. 05 41 - 96 20 221. 5


INHALT AUKTION 133 Nr. GRIECHISCHE BRONZEMÜNZEN DIE SAMMLUNG FRIEDRICH POPKEN Griechische Bronzemünzen Hispania Etruria Umbria Samnium Campania Apulia Calabria Lucania Bruttium Sicilia Sardinia Illyricum Moesia Scythia Thracia Macedonia Thessalia Epirus Corcyra Acarnania Boeotia Euboea Attica Megaris Aegina Peloponnesus Creta Bosporus Pontus Paphlagonia Bithynia Mysia Troas Aeolis Lesbos Ionia Caria Lydia Phrygia Lycia Pamphylia Pisidia Cilicia Galatia 6

Seite

7001

-

7836

11

-

123

7001 7001

-

11 11

-

7015 7022 7028 7030 7066 7117 7308

-

13 14

-

15 21 29

-

7313 7316 7318 7345 7385 7403 7405

-

58 61 66

-

7409 7411

-

69

-

7416 7420 7422 7424 7439 7443 7454 7502 7524 7538 7541 7613 7639 7662 7675 7682 7688 7701

-

7809 7011 7012 7013 7014 7021 7027 7029 7065 7116 7307 7311 7312 7315 7317 7344 7384 7402 7404 7406 7407 7408 7410 7413 7414 7415 7419 7421 7423 7438 7442 7453 7501 7523 7537 7540 7612 7638 7661 7674 7681 7687 7700 7726 7727

71

-

73 75 80 83

-

85 94 97 99 101

-

103 104

-

120 12 12 13 13 14 15 15 20 29 56 57 57 57 58 61 66 68 68 69 69 69 69 70 70 70 70 71 71 73 73 75 80 83 84 84 93 96 99 101 102 102 104 108 108


Nr. Cappadocia Commagene Syria Phoenicia Iudaea Parthia Bactria Aegyptus Cyrenaica Zeugitania

Seite

7730 7768

-

7785

-

7798

-

7728 7729 7767 7781 7782 7783 7784 7796 7797 7809

109 114

-

116

-

118

-

108 108 114 115 115 115 116 118 118 120

Griechische Prägungen unter römischer Herrschaft

7810

-

7836

120

-

123

MÜNZEN DER ANTIKEN WELT

7837

-

9368

124

-

333

Keltische Münzen Britannia Gallia Belgica Germania Bohemia Pannonia

7837 7837 7842 7847 7851 7856

-

7859 7841 7846 7850 7855 7858 7859

124

-

124

-

125

-

126 124 125 125 126 126 126

Griechische Münzen Hispania Gallia Etruria Campania Calabria Lucania Bruttium Sicilia Illyricum Moesia Scythia Thracia Macedonia Paeonia Thessalia Acarnania Aitolia Locris Boeotia Euboea Attica Aegina Corinthia Peloponnesus Creta Bithynia Mysia Troas

7860 7860 7866 7869 7871 7874 7887 7906 7916 7976 7978 7980 7982 8001 8040 8044 8050

-

126 126

-

127

-

128 130 132 134

-

145 146 151 156

-

158

-

8066

-

159

-

8072 8091 8097 8107 8112 8122 8125

-

8308 7865 7868 7870 7873 7886 7905 7915 7975 7977 7979 7981 8000 8039 8043 8049 8063 8064 8065 8070 8071 8090 8096 8106 8111 8119 8124 8139 8140

160

-

163 164 165

-

167

-

192 127 127 128 128 130 132 134 144 145 145 146 150 156 157 157 159 159 159 160 160 162 163 164 165 166 167 169 169 7


8141 8148 8156 8173 8191 8201 8205 8212

Nr. -

8226 8228 8235

-

8241 8243

-

8254

-

8257 8260 8262 8283 8292 8296 8298

-

8147 8155 8172 8190 8200 8204 8211 8223 8224 8225 8227 8234 8238 8239 8240 8242 8252 8253 8255 8256 8259 8261 8282 8291 8295 8297 8308

Römische Münzen Münzen der Römischen Republik Imperatorische Prägungen Münzen der Römischen Kaiserzeit Lots römischer Münzen

8309 8309 8412 8495 9165

-

Völkerwanderung Italia Westgoten Ostgoten

9186

-

9187 9190

-

Aeolis Lesbos Ionia Caria Lydia Lycia Pamphylia Cilicia Cyprus Galatia Cappadocia Syria Phoenicia Iudaea Arabia Felix Babylonia Parthia Persis Persia Sasaniden Bactria India Aegyptus Zeugitania Numidia Axum Lots griechischer Münzen

169 170 171 173 176

Seite -

177 178

-

181

-

183

-

185

-

186 190

-

9185 8411 8494 9164 9185

193 193 206 217 310

-

312 206 217 310 312

9193 9186 9189 9193

312

-

313 312 312 313

313 313

-

330 329 329 330 330 330

331

-

Byzantinische Münzen Byzanz Das Lateinische Kaiserreich von Constantinopel Nicaea Trapezunt Lots

9194 9194

-

9339 9341 9343

-

9345 9337 9338 9340 9342 9345

Kreuzfahrer Orientalische Münzen

9346 9350

-

9349 9368

Ein Stichwortverzeichnis finden Sie am Ende dieses Auktionskataloges.

8

170 171 173 176 177 177 178 180 180 180 181 182 182 182 183 183 184 184 185 185 186 186 190 191 191 191 192

331 333


WICHTIGE HINWEISE FÜR UNSERE TELEFONBIETER Wenn Sie telefonisch bieten möchten, muß das vor der Auktion durch uns genehmigt werden. Voraussetzung für ein telefonisches Mitbieten ist, daß Sie mindestens den Schätzpreis schriftlich bieten. Telefonisches Bieten ist erst ab einem Schätzpreis von ca. 500 Euro pro Los möglich. Bitte rufen Sie Frau Thomas vor der Auktion an unter +49 (0)541 96 20 221 oder gebührenfrei unter 0800 58 36 537. Wir übernehmen keinerlei Haftung, falls die telefonische Verbindung während der Auktion nicht zustande kommt.

INFORMATIONS POUR NOS CLIENTS PARTICIPANT A NOS VENTES AUX ENCHERES PAR TELEPHONE Si vous désirez participer par téléphone à nos ventes aux enchères, veuillez vous mettre en relation avec notre service clientèle quelques jours avant la vente en appelant le numéro +49 (0)541 96 20 233. Une participation téléphonique à la vente sera possible à la condition que vous nous fassiez parvenir aussi votre ordre par écrit. Cet ordre devra être au moins égal au minimum au prix d’estimation et concerner un lot estimé au moins 500 Euros. Nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

IMPORTANT INFORMATION ON TELEPHONE BIDDING If you wish to participate in the auction as a telephone bidder, please let us know several days in advance as we have to approve and schedule all calls. To register for telephone bidding, we require that you submit at least the estimate as a written bid in addition to being called. Telephone bidding is accepted on lot numbers with estimates above 500 Euro. Please call us at +49 (0)541 96 20 233 for more information or to register for telephone bidding. We do not assume liability for telephone bids, should the telephone line be interrupted.

INFORMAZIONI PER LA PARTECIPAZIONE TELEFONICA Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare la Signorina Sonia Russo al numero diretto +49 (0)541 96 20 245 qualche giorno prima dell´asta e di inviarci la vostra offerta, la quale deve ammontare come minimo al prezzo di stima anche per iscritto. Accettiamo una partecipazione telefonica in diretta durante l´asta per oggetti il cui prezzo di stima ammonta come minimo ai 500 Euro. Non assumeremo nessuna responsabilità se la linea telefonica è occupata o se non siete raggiungibili.

__________________________________________

BESICHTIGUNG Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 10. September 2007, nach vorheriger telefonischer Vereinbarung unter +49 (0) 5 41 96 20 221.

EXPOSITION Les monnaies seront visibles à partir du 10 Septembre 2007, Gutenbergstr. 23, 49076 Osnabrück, sur rendezvous téléphonique +49 (0)541 96 20 221.

ON VIEW The auction good can be viewed at our office from September, 10th 2007, Gutenbergstr. 23, 49076 Osnabrück, by prior appointment. Please call +49 (0)541 96 20 221.

ESPOSIZIONE Tutti i lotti sono visionabili a partire dal 10 Settembre 2007 presso la nostra sede, Gutenbergstr. 23, 49076 Osnabrück previo appuntamento telefonico +49 (0)541 96 20 221.

9


 )4+'%*+5%*'$410<'/ª0<'0   &+'5#//.70)(4+'&4+%*212-'0   6*'(4+'&4+%*212-'0%1..'%6+10   1()4''-$410<'%1+05    Die antike griechische Bronzeprägung reflektiert im besonderen Maße die weitgehende Autonomie der zahlreichen ITKGEJKUEJGP5VCFVUVCCVGPKOIGUCOVGP/KVVGNOGGTTCWO&GO5COONGT(TKGFTKEJ2QRMGPKUVGUIGNWPIGPOGJTCNU  $TQP\GOÒP\GP UQNEJGT 2T·IWPIGP \WUCOOGP\WVTCIGP $GUQPFGTGP 9GTV NGIVG (TKGFTKEJ 2QRMGP DGK FKGUGT   5COONWPICWHIWVG'TJCNVWPIGPFKGDGKFGT$TQP\GRT·IWPIPKEJVJ·WHKICP\WVTGHHGPUKPFWPFMQPPVGOGJTHCEJ 5RKV\GPUVÒEMGCWURTQOKPGPVGP5COONWPIGPGTYGTDGP   9KT XGTUVGKIGTP FKG ITKGEJKUEJGP /ÒP\GP FGT 5COONWPI (TKGFTKEJ 2QRMGP IGOGKPUCO OKV FGT (KTOC %NCUUKECN   0WOKUOCVKE)TQWR+PE %0) FKGKP.CPECUVGT2GPPU[NXCPKCWPF.QPFQPCPU·UUKIKUV&KG%0)JCVCNUGKPGFGT YGNVYGKVMQORGVGPVGUVGP/ÒP\GPJCPFNWPIGPKO$GTGKEJFGTCPVKMGP/ÒP\GPKPFGPNGV\VGP,CJTGPDGTGKVUOGJTHCEJ GTHQNITGKEJ5RG\KCNUCOONWPIGPITKGEJKUEJGT$TQP\GOÒP\GPXGTUVGKIGTV   &WTEJFKG-QQRGTCVKQPFGT(KTOGP%0)WPF-ÒPMGTYKTFFKGXQTNKGIGPFG5COONWPIGKPGODTGKVGP(CEJRWDNKMWO WPF FGT 5COONGTUEJCHV KP 'WTQRC #OGTKMC WPF FGP CPFGTGP -QPVKPGPVGP XQTIGUVGNNV 'U KUV WPUGTG HGUVG   ªDGT\GWIWPIFC­FKGU\WGKPGTITÌ­GTGP6TCPURCTGP\WPF5V·TMWPIFGU/CTMVGUHÒTCPVKMG/ÒP\GPDGKVTCIGPYKTF   9KTYÒPUEJGP+JPGPXKGN(TGWFGDGKO5VWFKWOFGU-CVCNQIGUWPFXKGN'THQNIDGKO$KGVGP      1UPCDTÒEMKO#WIWUV (TKV\4WFQNH-ÒPMGT      'CTNKGTVJKU[GCTYJKNGKP1UPCDTWEMHQTVJGHKTUV&G9KV5CNG+JCFVJGRNGCUWTGQHFKUEWUUKPIKFGCUYKVJ(TKV\4WFQNH -ÒPMGTCPF#PFTGCU-CKUGTQPJQYGCEJHKTOOC[DGCDNGVQJGNRVJGQVJGTGZRCPFVJGKPVGTPCVKQPCNEQKPOCTMGVU 9G CNN CITGGF VJCV OCTMGV ITQYVJ YKNN QPN[ TGUWNV HTQO HTKGPFN[ EQORGVKVKQP CPF EQQRGTCVKQP $QVJ %NCUUKECN   0WOKUOCVKE)TQWR+PECPF(TKV\4WFQNH-ÒPMGT/WP\GPJCPFNWPICTGYGNNGUVCDNKUJGFEQKPHKTOUYKVJCEVKXGYGD UKVGU-ÒPMGTJCUDGGPNQQMKPIVQGZRCPFKPVQVJGCPEKGPVOCTMGV%0)ʼnUURGEKCNV[CPF%0)YQWNFNKMGVQHWTVJGT GZRCPFKPVQVJGOGFKGXCNCPFGCTN[OQFGTP'WTQRGCPOCTMGVUYJGTG-ÒPMGTKUCHTQPVTWPPGT6JGTGHQTGOWVWCN CUUQEKCVKQPQPCURGEKCNK\GFUCNGCRRGCTGFVQDGCNQIKECNUVGR6JKUEQQRGTCVKXGGHHQTVYKNNQHHGTDQVJHKTOUʼnENKGPVUCP QRRQTVWPKV[VQRCTVKEKRCVGKPVJKUCWEVKQPQH)TGGMDTQP\GEQKPCIG   6JG(TKGFTKEJ2QRMGP%QNNGEVKQPQH)TGGM$TQP\G%QKPCIGRTGUGPVUCFKXGTUGQHHGTKPIQHEQKPUCUUGODNGFQXGTVJG NCUV[GCTU6JGTGCTGUGNGEVGZCORNGUOCP[QHYJKEJEQOGHTQORTQOKPGPVCWEVKQPUD[0#%5VGTPDGTI// #WHJ·WUGT.GW2GWUCPFQVJGTU0QVCDNGRKGEGUECPDGVTCEGFVQVJGEQNNGEVKQPUQH.CHHCKNNG/QTGVVK2Q\\KCPF 8KT\K6JKUUCNGQHHGTUEQKPUHQTCNNEQNNGEVQTUʼnDWFIGVUYKVJGUVKOCVGUHTQOVQGWTQU   6JKUUCNGYKNNDGCXCKNCDNGHQTXKGYKPICVYYYEPIEQKPUEQOHTQO5GRVGODGTWPVKN1EVQDGTVJGFC[QHVJGUCNG %0)YKNNTGRTGUGPVDKFFGTUQHTGEQTFYJQJCXGUWDOKVVGFDKFUVQ%0)VJTQWIJQWTYGDUKVGD[OCKNQTD[RJQPG   +YKUJCNNQH[QWUWEEGUUKPVJGRWTUWKVQH[QWTEQNNGEVKQP   8KEVQT'PINCPF  5GPKQT&KTGEVQT  %NCUUKECN0WOKUOCVKE)TQWR+PE 

10


GRIECHEN • HISPANIA

1,5:1

7001

1,5:1

*+52#0+# 

#45'5#)7067/“5GZVCPUX%JTI/WUEJGN&GNRJKPTWPVGP5VGTP$WTIQU 50)$/ )TÒPG2CVKPCXQT\ÒINKEJ



7002

1,5:1

1,5:1



%#567.1“5GOKUXQTX%JTI-QRHTOKV&KCFGO5VKGTUVGJVTFCTÒDGT*CND OQPF$WTIQU50)$/ &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



7003

1,5:1



1,5:1

“5GOKU WO  X %JT  I -QRH T OKV .QTDGGTMTCP\5VKGT UVGJV T FCTÒDGT *CNDOQPF   $WTIQU50)$/ )TÒPG2CVKPCXQT\ÒINKEJ



7004 1,5:1



“5GOKU UR·VGU  ,CJTWPFGTV X %JT  I-QRHTOKV&KCFGOFCXQT2CNO\YGKI5VKGTUVGJVT FCTÒDGT*CNDOQPF$WTIQU50)$/ 44&WPMGNITÒPG2CVKPCUGJTUEJÌP

1,5:1



1,5:1

7005



1,5:1

“5GOKU HTÒJGU  ,CJTJWPFGTV X %JT  I -QRH T OKV &KCFGO5VKGT UVGJV T FCTÒDGT *CND   OQPF$WTIQU50)$/ )TÒPG2CVKPCXQT\ÒINKEJ

 11


GRIECHEN • ETRURIA

7006

1,5:1



1,5:1

'$7575“U,CJTJWPFGTVX%JTI5VKGTN$GUXXOKV-GWNGWPF5EJNCPIG$WTIQU 50)$/ 4$TCWPpITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'DWUWU FCU JGWVKIG +DK\C JCV UGKPGP 0COGP 'DWUWU  +PUGN FGU $GU  XQP MCTVJCIKUEJGP -QNQPKUVGP GTJCNVGP FKG   FGP-WNVFGUWTURTÒPINKEJ·I[RVKUEJGP)QVVGU$GUGKPIGHÒJTVJCVVGP

1,5:1

7007

7008

1,5:1



'-7#.#-15 “#U  X %JT  I -QRH T \YKUEJGP \YGK &GNRJKPGP4GKVGT T OKV   .CP\G$WTIQU50)$/ )TÒPG2CVKPCUGJTUEJÌPXQT\ÒINKEJ





)#&'5“UUR·VGU,CJTJWPFGTVX%JTI-QRHFGU*GTCMNGU/GNSCTVKO.ÌYGPHGNNN6JWP HKUEJN$WTIQU50)$/ 44&WPMNG2CVKPCXQT\ÒINKEJ



7010

7009



+.+2'05' “#U  X %JT  I (KUEJ T FCTÒDGT *CNDOQPFJTG $WTIQU    50)$/ )TÒPG2CVKPCUGJTUEJÌP





1$7.%1 “#U UR·VGU  ,CJTJWPFGTV X %JT  I 9GKDNKEJGT -QRH TJTG FCTÒDGT 2HNWI   $WTIQU50)$/ 4&WPMNG2CVKPCXQT\ÒINKEJ



1,5:1



7011

1,5:1

5'-#+5#“5GZVCPUX%JTI-QRHT2HGTFURTKPIVT$WTIQU50)$/  4)TÒPG2CVKPCXQT\ÒINKEJ

1,5:1

7012



1,5:1

'6474+# 

8'67.10+#“5GOWPEKCX%JT ! I-QRHFGU5GVJNWPU 8WNECPWU*GRJCKUVQU T OKV2KNGWU5VGWGTTWFGT ! 4WVVGT*KUVQTKC0WOQTWO8GEEJK6JG%QKPCIGQHVJG4CUPC FKGU 'ZGORNCTCDIGDKNFGV  8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCIWVGUUGJTUEJÌP  'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T +VCNQ8GEEJKMGPPVPGDGPWPUGTGO5VÒEMPWTPQEJGKPYGKVGTGU'ZGORNCTKP(NQTGP\

12




GRIECHEN • UMBRIA

7013

1,5:1

1,5:1

7/$4+# 

67&'4“UX%JTI5KNGPQUMQRHT#FNGTUVGJVN4WVVGT*KUVQTKC0WOQTWO  44&WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T

7014

7015

1,5:1

1,5:1

5#/0+7/ 

#'5'40+#“UX%JTI8WNECPMQRHNOKV2KNGWUFCJKPVGT<CPIG,WRKVGTKP$KICT 4WVVGT*KUVQTKC0WOQTWO50)#05 )TÒPG2CVKPCUGJTUEJÌP



#GUGTPKCYCTWTURTÒPINKEJGKPGUCOPKVKUEJG5VCFVUKGYWTFGCDGTX%JT\WGKPGTTÌOKUEJGP-QNQPKG

%#/2#0+# 

%#.'5“UX%JTI#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO*CJPUVGJVTN5VGTP 4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



%CNGUYWTFGX%JTCNUGTUVGNCVKPKUEJG-QNQPKGKP%CORCPKGPIGITÒPFGV

7016

1,5:1



1,5:1

“U  X %JT  I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO*CJP UVGJV T N 5VGTP 4WVVGT   *KUVQTKC0WOQTWO50)#0550)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌP

7017

1,5:1



7018

1,5:1

1,5:1

1,5:1



0'#21.+5 “U  X %JT  I /·PPGTMQRH N&TGKHW­ 4WVVGT *KUVQTKC 0WOQTWO    5CODQPHH50)#05HH50)/ÒPEJGPHH )TÒPG2CVKPCUGJTUEJÌPXQT\ÒINKEJ





“UX%JTI#RQNNQMQRHT#PFTQMGRJCNG5VKGTRTQVQOGTFCTÒDGT&GNRJKPT4WVVGT *KUVQTKC0WOQTWO5CODQP50)#05XGTIN50)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 13


GRIECHEN • APULIA

7019

1,5:1



1,5:1

“UX%JTI#RQNNQMQRHNOKV.QTDGGTMTCP\FCJKPVGTP#PFTQMGRJCNGT5VKGTTXQP 0KMGDGMT·P\V4WVVGT*KUVQTKC0WOQTWO5CODQPXGTIN50)#0550)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌP 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7020

1,5:1



1,5:1

“U  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\#PFTQMGRJCNGT 5VKGT T XQP 0KMG DG   MT·P\V4WVVGT*KUVQTKC0WOQTWO5CODQP50)#0550)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌP 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7021

1,5:1





1,5:1

57'55##7470%#“UX%JTI/GTEWTMQRHNOKVIGHNÒIGNVGO2GVCUQU*GTEWNGU T GTYÒTIV FGP PGOGKUEJGP .ÌYGP WPVGP -GWNG 4WVVGT *KUVQTKC 0WOQTWO  5CODQP    50)#0550)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7022

7023

7024

#27.+# 



6'#6' “3WKPEWPZ  X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO QDGP HÒPH   9GTVMWIGNP'WNG UVGJV T CWH -CRKVGNN T HÒPH 9GTVMWIGNP WPF *CNDOQPF 4WVVGT *KUVQTKC 0WOQTWO   C50)#0550)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ



“3WKPEWPZX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO'WNGUVGJVTKO#D UEJPKVV HÒPH 9GTVMWIGNP T $NKV\ 4WVVGT *KUVQTKC 0WOQTWO  C 50) #05 #RRGPFKZ     50)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T



14

“3WKPEWPZ  X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO )TGKH CNU *GNO\KGT   'WNGUVGJVXXKO#DUEJPKVVHÒPH9GTVMWIGNPT$NKV\4WVVGT*KUVQTKC0WOQTWOC50)#05 #RRGPFKZ50)/ÒPEJGP )TÒPG2CVKPCHCUVXQT\ÒINKEJ




GRIECHEN • CALABRIA

7026

7025





“0WOOWUX%JTI-QRHFGU<GWUXQP&QFQPCTOKV'KEJGPMTCP\#FNGTUVGJVT CWH$NKV\4WVVGT*KUVQTKC0WOQTWO50)#05#RRGPFKZXCT50)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌP



“0WOOWUX%JTI-QRHFGU<GWUXQP&QFQPCTOKV'KEJGPMTCP\#FNGTUVGJVT CWH$NKV\FCXQT5VGTP4WVVGT*KUVQTKC0WOQTWO50)#05#RRGPFKZ50)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌP



7028

7027



“3WCVTWPZ  X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T.ÌYG T FCTÒDGT -GWNG KO   #DUEJPKVVXKGT9GTVMWIGNP4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0TWPFFGT5COONWPI2TQUEJQYUM[#WMVKQP 4CUOWUUGP-QRGPJCIGP0T

%#.#$4+# 

$470&+5+7/“5GOKU,CJTJWPFGTVX%JTI2QUGKFQPMQRHTFCJKPVGT&TGK\CEMWPF0KMG OKV -TCP\ WPVGP 52JCNCPVQU CWH &GNRJKP N OKV 0KMG WPF .[TC 4WVVGT *KUVQTKC 0WOQTWO    50)#0550)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌP

1,5:1



7029



1,5:1

6#4'06 “U  X %JT  I /WUEJGN6CTCU CWH &GNRJKP N OKV -CPVJCTQU WPF (ÒNNJQTP   4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7031

7030

1,5:1

1,5:1

.7%#0+# 

/'6#2106“1DQNX%JTI&GOGVGTMQRHTJTGNOBOLOST/QJPMWIGN ,QJPUVQP$TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO  4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T &CU5VÒEMVT·IVGKPGXQNNCWUIGUEJTKGDGPG9GTVCPICDG&KGUKUVCW­GTQTFGPVNKEJUGNVGP







“UX%JTI0KMGMQRHTJTGN*GTOG,QJPUVQP$TQP\G%QKPCIGQH/GVCRQPVWO 4WVVGT*KUVQTKC0WOQTWO &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

15


GRIECHEN • LUCANIA

7032 1,5:1



1,5:1

“UWOX%JTIJTG-TGKU,QJPUVQP$TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC 0WOQTWO 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T  'KPYGKVGTGU'ZGORNCTYWTFGKPFGT#WMVKQP,CEQD*KTUEJ/ÒPEJGPWPVGTFGT0TXGTUVGKIGTV,CEQD *KTUEJ OGKPVG CWH FGO #XGTU $WEJUVCDGPTGUVG /'  \W GTMGPPGP YCT UKEJ DGK FKGUGT .GUWPI CDGT MGKPGUYGIU   UKEJGT#WHWPUGTGO5VÒEMKUVMGKPG5EJTKHV\WGTMGPPGP&KG<WYGKUWPIPCEJ/GVCRQPVKUVPKEJVIGUKEJGTV

7034

7033

1,5:1

1,5:1

1,5:1

1,5:1



“U  X %JT  I <GWUMQRH T<YGK JTGP \YKUEJGP FGP &KQUMWTGP ,QJPUVQP $TQP\G   %QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCUGJTUEJÌP





“U  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\JTG T &TGKHW­ ,QJPUVQP $TQP\G   %QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCUGJTUEJÌP



7036

7035

1,5:1

1,5:1



1,5:1

1,5:1

“UX%JTI#VJGPCMQRHXXOKV*GNOJTGT(CEMGN,QJPUVQP$TQP\G%QKPCIG QH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO 44(CUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“U  X %JT  I &KQP[UQUMQRHNOKV'HGWMTCP\JTGT(CEMGN,QJPUVQP$TQP\G%Q KPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCXQT\ÒINKEJ

7037

1,5:1





7038

1,5:1

1,5:1

1,5:1

“UX%JTI#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO&TGKJTGPQDGP(CEMGN,QJP UVQP$TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO  )WV\GPVTKGTVGUXQT\ÒINKEJGU'ZGORNCT



“UX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO&TGKJTGPQDGP(CEMGN,QJP UVQP$TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

16




GRIECHEN • LUCANIA

7040

7039

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JTI-QRHFGU#RQNNQ%CTPGKWUNJTGT(CEMGN,QJPUVQP$TQP\G%QKPCIG QH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCXQT\ÒINKEJ





“UX%JTI*GNKQUMQRHXX&TGKJTGPQDGP(CEMGN,QJPUVQP$TQP\G%QKPCIGQH /GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCXQT\ÒINKEJ



7042

7041

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JTI*GTOGUMQRHTOKV2GVCUQU&TGK)GTUVGPMÌTPGTQDGP(CEMGN,QJPUVQP $TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCXQT\ÒINKEJ





“U  X %JT  I &GOGVGTMQRH T OKV JTGPMTCP\JTG ,QJPUVQP $TQP\G %QKPCIG QH   /GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCUGJTUEJÌP



7043

1,5:1



1,5:1

“UX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNTJTG,QJPUVQP$TQP\G%QKPCIGQH/G VCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7045

7044

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JTI&GOGVGTMQRHTOKVJTGPMTCP\JTGT(NKGIG QFGT$KGPG! ,QJPUVQP $TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCXQT\ÒINKEJ





“UX%JTI&GOGVGTMQRHTOKVJTGPMTCP\JTGT(NKGIG QFGT$KGPG! ,QJPUVQP $TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



7046

1,5:1

“UUR·VGU,CJTJWPFGTVX%JTI#VJGPC#NMKFGOQUUVGJVTOKV5RGGTWPF5EJKNF'WNGUVGJV TCWHJTG,QJPUVQP$TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO  4$TCWPG2CVKPCXQT\ÒINKEJ

 17


GRIECHEN • LUCANIA

7047

1,5:1



1,5:1

“UUR·VGU,CJTJWPFGTVX%JTI#VJGPC#NMKFGOQUUVGJVNOKV5RGGTWPF5EJKNF'WNGUVGJVN CWHJTG,QJPUVQP$TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO  4&WPMNG2CVKPCXQT\ÒINKEJ

7048

1,5:1



7049

1,5:1

1,5:1

1,5:1



“U UR·VGU  ,CJTJWPFGTV X %JT  I &GOGVGTMQRH T OKV JTGPMTCP\<YGK JTGP ,QJPUVQP   $TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO $TCWPG2CVKPCXQT\ÒINKEJ





2#'567/“6TKGPUX%JTI9GKDNKEJGT-QRHTOKV'HGWMTCP\FCJKPVGTXKGT9GTV MWIGNP(ÒNNJQTPNFTGKJTGP4WVVGT*KUVQTKC0WOQTWOXGTIN50)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌP



7051

7050

1,5:1

1,5:1

1,5:1

1,5:1



“5GZVCPUX%JTI9GKDNKEJGT-QRHTFCJKPVGT\YGK9GTVMWIGNP'DGTTFCTWPVGT *CNDOQPFWPF\YGK9GTVMWIGNP4WVVGT*KUVQTKC0WOQTWO50)/ÒPEJGPXGTINHH  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





6*74+1+ “U  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO5VKGT UVÌ­V T KO #D   UEJPKVV(KUEJ4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7052

1,5:1

 18

1,5:1

“U  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO5VKGT UVÌ­V T KO #DUEJPKVV -GT[   MGKQP4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP 4)TÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • LUCANIA

7053

1,5:1



“U PCEJ  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO$WMTCPKQP 4WVVGT *KUVQTKC 0W   OQTWO50)#05XGTIN50)/ÒPEJGPXGTINHH  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ

1,5:1

“UWOX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\#TVGOKUIGJVTOKV(CEMGNWPF2HGKN \WKJTGP(Ò­GP*WPF4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7055

1,5:1





7054

1,5:1



1,5:1



1,5:1

“U WO  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\&TGKHW­ 4WVVGT *KUVQTKC 0WOQTWO   50)#0550)/ÒPEJGP 44)TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7057

7056

1,5:1

1,5:1

1,5:1

1,5:1



“UWOX%JTI#RQNNQMQRHNOKV.QTDGGTMTCP\.[TC4WVVGT*KUVQTKC0WOQTWOC 50)#0550)/ÒPEJGP 5GJTUEJÌPXQT\ÒINKEJ





“U WO  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\)GHNÒIGNVGT $NKV\ 4WVVGT *KUVQTKC 0W   OQTWO50)#0550)/ÒPEJGP .GKEJVMQTTQFKGTVUGJTUEJÌP



1,5:1



7058

1,5:1

“U WO  X %JT  I #RQNNQMQRH T2HGTF URTKPIV T 4WVVGT *KUVQTKC 0WOQTWO    50)#0550)/ÒPEJGPXGTIN (CUVXQT\ÒINKEJ

 19


GRIECHEN • LUCANIA

7059

7060

1,5:1

1,5:1

1,5:1

1,5:1



“U WO  X %JT  I #RQNNQMQRH T2HGTF URTKPIV T 4WVVGT *KUVQTKC 0WOQTWO    50)#0550)/ÒPEJGPXGTIN (CUVXQT\ÒINKEJ





“U WO  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\(ÒNNJQTP 4WVVGT *KUVQTKC 0WOQTWO   50)#0550)/ÒPEJGP 8QT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7061

1,5:1



“U,CJTJWPFGTVX%JT/CIKUVTCV-NGQPI&TCRKGTVG$ÒUVGFGT#TVGOKUTÒDGTFGT5EJWNVGT -ÌEJGT#RQNNQ UVGJV N OKV 2CVGTC WPF .[TC 4WVVGT *KUVQTKC 0WOQTWO  C 50) #05    50)/ÒPEJGP &WPMGNITÒPG2CVKPCUGJTUEJÌP

7062

1,5:1



1,5:1



1,5:1

“U  ,CJTJWPFGTV X %JT  I &GOGVGTMQRH N OKV JTGPMTCP\5VKGT UVÌ­V N 4WVVGT *KUVQTKC   0WOQTWOD50)#0550)/ÒPEJGP 4)TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7063

7064

1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T5VKGTRTQVQOG T 4WVVGT *KUVQTKC   0WOQTWO50)#0550)/ÒPEJGP 448QT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T5VKGTRTQVQOG T 4WVVGT *KUVQTKC   0WOQTWO50)#0550)/ÒPEJGP 448QT\ÒINKEJ



1,5:1

 20

7065

1,5:1

8'.+# *;'.' “U,CJTJWPFGTVX%JTI<GWUMQRHTOKV.QTDGGTMTCP\'WNGUVGJVX X4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCUGJTUEJÌP




GRIECHEN • BRUTTIUM

1,5:1

7066

1,5:1

$4766+7/ 

$4'66++ “6TKQDQN WO  X %JT  I 0KMGMQRH N T (ÒNNJQTP<GWU UVGJV T OKV $NKV\ WPF   <GRVGT4WVVGT*KUVQTKC0WOQTWO &WPMGNITÒPG2CVKPCUGJTUEJÌP



7067

1,5:1



1,5:1

“&KFTCEJOG  X %JT  I #TGUMQRH N OKV *GNO FCJKPVGT \YGK -WIGNP WPVGP JTG   0KMG UVGJV N WPF DGMT·P\V 6TQRJ·G $GK\ (ÒNNJQTP WPF *CNDOQPF 4WVVGT *KUVQTKC 0WOQTWO    5EJGW )N·P\GPFGITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

7068 1,5:1

1,5:1



“&TCEJOG  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\ FCJKPVGT JTG#FNGT N FCXQT   (ÒNNJQTPQDGP*CNDOQPF4WVVGT*KUVQTKC0WOQTWO5EJGW 5GJTUEJÌPXQT\ÒINKEJ



7069 1,5:1

1,5:1



“&TCEJOGX%JTI<GWUMQRHTOKV.QTDGGTMTCP\FCJKPVGTJTG#FNGTNFCXQT(ÒNN JQTPQDGP*CNDOQPF4WVVGT*KUVQTKC0WOQTWO5EJGW $TCWPG2CVKPCUGJTUEJÌP

1,5:1



7070



1,5:1

“U  X %JT  I 0KMGMQRH N FCJKPVGT JTG<GWU UVGJV T OKV $NKV\ WPF <GRVGT FCXQT   (ÒNNJQTP4WVVGT*KUVQTKC0WOQTWO5EJGW )TÒPG2CVKPCUGJTUEJÌP

 21


GRIECHEN • BRUTTIUM

7071

1,5:1



1,5:1

“U  X %JT  I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO'WNG UVGJV T 4WVVGT *KUVQTKC   0WOQTWO5EJGW )TÒPG2CVKPCGVYCUFG\GPVTKGTVHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7072

1,5:1

1,5:1



“&KFTCEJOGX%JTI#TGUMQRHNOKV*GNOWPVGP$NKV\#VJGPCIGJVTOKV5RGGT WPF5EJKNF$GK\HNKGIGPFG'WNG4WVVGT*KUVQTKC0WOQTWO5EJGW )TÒPG2CVKPCXQT\ÒINKEJ



7073

1,5:1



1,5:1

“UX%JTI<GWUMQRHTOKV.QTDGGTMTCP\FCJKPVGT$NKV\-TKGIGTIGJVTOKV*GNO 5EJKNFWPF5RGGTFCXQT9GKPVTCWDG4WVVGT*KUVQTKC0WOQTWO5EJGW  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7075

7074

1,5:1



1,5:1

22

1,5:1

“U  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\-TKGIGT IGJV T OKV *GNO 5EJKNF WPF   5RGGT4WVVGT*KUVQTKC0WOQTWO5EJGWHH )TÒPG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T &GT5EJTÌVNKPIKUVWPIGYÌJPNKEJMNGKPWPFNGKEJV



1,5:1





“U  X %JT  I 0KMGMQRH N OKV &KCFGO FCTWPVGT $NKV\<GWU KP $KIC N FCTWPVGT HNKG   IGPFG'WNG4WVVGT*KUVQTKC0WOQTWO5EJGW )TÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • BRUTTIUM

7076

1,5:1

7078 7077

7077



“&KFTCEJOGX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT#VJGPCIGJVTOKV5RGGTWPF 5EJKNF$GK\2HNWI4WVVGT*KUVQTKC0WOQTWO5EJGW )TÒPDTCWPG2CVKPCHCUVXQT\ÒINKEJ





“UX%JTI0KMGMQRHTWPVGP-GT[MGKQP ! <GWUKP$KICTOKV$NKV\WPF<GRVGT 4WVVGT*KUVQTKC0WOQTWO5EJGW !  &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





“&TCEJOG  X %JT  I +P -TCP\ <GWUMQRH T#FNGT N FCXQT .[TC 4WVVGT *KUVQTKC   0WOQTWO5EJGW &WPMNG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



7079

1,5:1

“U  X %JT  I +P -TCP\ -QRH GKPGT /GGTGUIÌVVKP #ORJKVTKVG!  OKV -TGDUJGNO N   -TGDU4WVVGT*KUVQTKC0WOQTWO5EJGW )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7080 1,5:1



1,5:1

.1-41+ '2+<'2*;4+1+ “U WO  X %JT  I 2GTUGRJQPGMQRH T FCJKPVGT JTG WPF   /QPQITCOO#VJGPC UVGJV N OKV 5RGGT WPF 5EJKNF FCJKPVGT \YGK 5VGTPG 4WVVGT *KUVQTKC 0WOQTWO   50)#0550)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ



7081 1,5:1



1,5:1

“U WO  X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO2GTUGRJQPG UKV\V N OKV -TCP\   WPF <GRVGT \YKUEJGP \YGK 5VGTPGP 4WVVGT *KUVQTKC 0WOQTWO  50) #05  50) /ÒPEJGP    &WPMNG2CVKPCXQT\ÒINKEJ

 23


GRIECHEN • BRUTTIUM

7082 1,5:1



1,5:1

“U PCEJ  X %JT !   I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO FCJKPVGT 'WNG2GICUWU   HNKGIVNFCTWPVGT/QPQITCOO4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP 4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7083 1,5:1



“U PCEJ  X %JT !   I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO FCJKPVGT -TCP\2GICUWU   HNKGIVNFCTÒDGT-GT[MGKQP4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

1,5:1



1,5:1

7084



1,5:1

“UPCEJX%JT ! I*GTCMNGUMQRHKO.ÌYGPHGNNN2GICUWUHNKGIVNWPVGP*CTRC4WVVGT *KUVQTKC0WOQTWO50)#0550)/ÒPEJGP &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



7085 1,5:1

1,5:1



/'&/# “U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\-QRH FGT 0[ORJG   /GUOCXXN*[FTKC4WVVGT*KUVQTKC0WOQTWO 4)TÒPG2CVKPCUGJTUEJÌP



&GT4GXGTU\GKIVFGP-QRHFGT3WGNNP[ORJG/GUOCFKGFGT5VCFVFGP0COGPICD

7086 1,5:1

 24

1,5:1

07%'4+# “U  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\2HGTF UVGJV N FCTWPVGT   2GPVCITCOO4WVVGT*KUVQTKC0WOQTWOHH50)#05XGTINHH 4)TÒPG2CVKPCUGJTUEJÌP




GRIECHEN • BRUTTIUM

7087

1,5:1



1,5:1

2'6'.+#“UPCEJX%JT ! I#RQNNQMQRHTOKV.QTDGGTMTCP\&TGKHW­4WVVGT*KUVQTKC 0WOQTWO50)#0550)/ÒPEJGP )TÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



7089

7088

1,5:1

1,5:1

1,5:1

1,5:1



“UPCEJX%JT ! I#TGUMQRHTOKVMQTKPVJKUEJGO*GNO0KMGIGJVNOKV-TCP\4WVVGT *KUVQTKC0WOQTWO50)#0550)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌP





“U PCEJ  X %JT !   I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO0KMG IGJV N OKV -TCP\   4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP 44&WPMNG2CVKPCXQT\ÒINKEJ



7090

7091

1,5:1

1,5:1

1,5:1

1,5:1



“UPCEJX%JT ! I*GTCMNGUMQRHT-GWNG4WVVGT*KUVQTKC0WOQTWO50)#05 50)/ÒPEJGP 48QT\ÒINKEJ





“U PCEJ  X %JT !   I #TGUMQRH T OKV MQTKPVJKUEJGO *GNO0KMG IGJV N OKV -TCP\ WPF   2CNO\YGKI4WVVGT*KUVQTKC0WOQTWO50)#05XGTIN50)/ÒPEJGP  )TÒPG2CVKPCUGJTUEJÌP



7092

1,5:1



1,5:1

4*')+10“UX%JTI.ÌYGPOCUMGXX+P1NKXGPMTCP\4'%+4WVVGT*KUVQTKC 0WOQTWO 44&WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7093

1,5:1

7094

1,5:1

1,5:1

1,5:1



“1PMKCX%JTI.ÌYGPOCUMGXX1NKXGP\YGKIT2*4WVVGT*KUVQTKC0WOQTWO  )TÒPG2CVKPCXQT\ÒINKEJ





“U  X %JT  I .ÌYGPOCUMG X X#RQNNQMQRH T OKV .QTDGGTMTCP\ 4WVVGT *KUVQTKC   0WOQTWO )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

25


GRIECHEN • BRUTTIUM

7095

1,5:1



1,5:1

“UX%JTI.ÌYGPOCUMGXX#RQNNQMQRHTOKV.QTDGGTMTCP\FCJKPVGT1NKXGPDNCVV 4WVVGT*KUVQTKC0WOQTWO 44&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7096

1,5:1



1,5:1

“UX%JTI#RQNNQMQRHT+P-TCP\*4WVVGT*KUVQTKC0WOQTWO  44)TÒPG2CVKPCHCUVXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7098

7097



“U  X %JT  I .ÌYGPOCUMG X X#RQNNQMQRH T OKV .QTDGGTMTCP\ 4WVVGT *KUVQTKC   0WOQTWOC )TÒPG2CVKPCUGJTUEJÌP





“U  X %JT  I .ÌYGPOCUMG X X#RQNNQMQRH N OKV .QTDGGTMTCP\ FCJKPVGT &GNRJKP   4WVVGT*KUVQTKC0WOQTWOD 5GJTUEJÌPHCUVUGJTUEJÌP



7099

1,5:1

1,5:1

1,5:1

1,5:1



7100

“UX%JTI.ÌYGPOCUMGXX#RQNNQMQRHTOKV.QTDGGTMTCP\FCJKPVGT*GTOG !  4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“U  X %JT  I .ÌYGPOCUMG X X#RQNNQMQRH T OKV .QTDGGTMTCP\ 4WVVGT *KUVQTKC   0WOQTWO )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7101 1,5:1



“U  X %JT  I #RQNNQMQRH N FCJKPVGT 2NGMVTQP&TGKHW­ 4WVVGT *KUVQTKC 0WOQTWO    )TÒPG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

26

1,5:1




GRIECHEN • BRUTTIUM

7102 1,5:1

1,5:1



“U  X %JT  I #TVGOKUMQRH T ÒDGT FGT 5EJWNVGT $QIGP WPF -ÌEJGT.ÌYG IGJV T   4WVVGT*KUVQTKC0WOQTWO &WPMGNITÒPG2CVKPCGVYCUXGTMTWUVGVUQPUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



7103

1,5:1

“UX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\.ÌYGIGJVT4WVVGT*KUVQTKC0WOQTWO  )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7105

7104

1,5:1



7106

1,5:1

“UX%JTI#TVGOKUMQRHT.[TC4WVVGT*KUVQTKC0WOQTWO  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



“6TKGPUX%JTI$ÒUVGPFGU#RQNNQOKV.QTDGGTMTCP\WPFFGT#TVGOKUOKV&KCFGO PGDGPGKPCPFGTTN2CVGTC&TGKHW­TXKGT9GTVMWIGNP4WVVGT*KUVQTKC0WOQTWO  $TCWPG2CVKPCXQT\ÒINKEJ



“6TKGPUX%JTI$ÒUVGPFGU#RQNNQOKV.QTDGGTMTCP\WPFFGT#TVGOKUOKV&KCFGO PGDGPGKPCPFGTT&TGKHW­TXKGT9GTVMWIGNP4WVVGT*KUVQTKC0WOQTWO  ªDGTRT·IWPIUURWTGPUGJTUEJÌPHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



7107

1,5:1

“6TKCUX%JTI-ÌRHGFGT&KQUMWTGPPGDGPGKPCPFGTT*GTOGUUVGJVNOKV<YGKI WPF-GT[MGKQPN++++4WVVGT*KUVQTKC0WOQTWO &WPMNG2CVKPCXQT\ÒINKEJ

 27


GRIECHEN • BRUTTIUM

7108

7109

1,5:1

1,5:1



1,5:1

1,5:1

“6GVTCU  X %JT  I #UMNGRKQUMQRH T*[IKGKC UVGJV N OKV 5EJNCPIG N +++ 4WVVGT   *KUVQTKC0WOQTWO $TCWPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“6GVTCU  X %JT  I #UMNGRKQUMQRH T*[IKGKC UVGJV N OKV 5EJNCPIG N +++ 4WVVGT   *KUVQTKC0WOQTWO $TCWPG2CVKPCUGJTUEJÌP

7110

7111

1,5:1

1,5:1





“6GVTCUX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\FCJKPVGT2CNO\YGKI9QNHUVGJVT 4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



“6GVTCUX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\FCJKPVGT2CNO\YGKI9QNHUVGJVT 4WVVGT*KUVQTKC0WOQTWO &WPMNG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5RKPM6CKUGK<ÒTKEJ0T

1,5:1

7112

7113

7112

1,5:1

7113



“UX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\&KG&KQUMWTGPTGKVGPT4WVVGT*KUVQTKC 0WOQTWO $TCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





“UX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\&KG&KQUMWTGPTGKVGPT4WVVGT*KUVQTKC 0WOQTWO )TÒPG2CVKPCUGJTUEJÌPHCUVXQT\ÒINKEJ



7114 1,5:1



1,5:1

8+$1 8#.'06+# “#U  X %JT  I ,WRKVGTMQRH T OKV .QTDGGTMTCP\ FCJKPVGT +   )GHNÒIGNVGT$NKV\FCTÒDGTNKGIGPFGU+WPF(CEMGN4WVVGT*KUVQTKC0WOQTWO  &WPMNG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T  8KDQ 8CNGPVKC  FCU CNVG *KRRQPKWO  GTJKGNV  X %JT GKPG TÌOKUEJG $ÒTIGTMQNQPKG WPF FCOKV UGKPGP PGWGP   0COGP5EJQPUGKVX%JTJCVVGFKG5VCFVGKPGTÌOKUEJG$GUCV\WPI

28




GRIECHEN • SICILIA

7115 1,5:1



1,5:1

“6TKGPUX%JTI/KPGTXCMQRHTOKVMQTKPVJKUEJGO*GNOFCJKPVGTXKGT9GTVMWIGNP 'WNGUVGJVTFCXQTXKGT9GTVMWIGNPWPF&GNRJKP4WVVGT*KUVQTKC0WOQTWO  )TÒPG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



7116 1,5:1



1,5:1

“6TKGPUX%JTI/KPGTXCMQRHTOKVMQTKPVJKUEJGO*GNOFCJKPVGTXKGT9GTVMWIGNP 'WNGUVGJVTFCXQTXKGT9GTVMWIGNP4WVVGT*KUVQTKC0WOQTWO )TÒPG2CVKPCUGJTUEJÌP

7117

1,5:1



1,5:1

5+%+.+# 

70$'56+//6'/ª0<5666'“UWOX%JTI0[ORJGUVGJVNOKV2CVGTCT<YGKI *GTCMNGUUVGJVTOKV-GWNGWPF.ÌYGPHGNN%CNEKCVKXGTIN *KOGTC  4)TÒPG2CVKPCUGJTUEJÌP



&CU5VÒEMYWTFG YKGCWEJFKGHQNIGPFG/ÒP\G YCJTUEJGKPNKEJKPFGT)GIGPFXQP*KOGTCIGRT·IVCDGTYQJNPKEJV XQP)TKGEJGPUQPFGTPXQPKPFKIGPGT$GXÌNMGTWPI

7118

1,5:1



7119

1,5:1

1,5:1

1,5:1

“UWOX%JTI0[ORJGUVGJVN'DGTTFCTWPVGT'HGWDNCVV%CNEKCVK *KOGTC   4)TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“U,CJTJWPFGTVX%JTI#PFTQMGRJCNG5VKGTRTQVQOGT-TCP\%CNEKCVK

8QT\ÒINKEJ



7120 1,5:1



1,5:1

“U,CJTJWPFGTVX%JTI&TCRKGTVG$ÒUVGFGU*GTOGUTÒDGTFGT5EJWNVGT-GT[MGKQP 5QNFCVUVGJVXXOKV5RGGTWPF5EJKNF%CNEKCVK )TÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 29


GRIECHEN • SICILIA

7121

1,5:1

1,5:1



#);4+10“UX%JTI,WIGPFNKEJGT*GTCMNGUMQRHT2CPVJGTTCPUGKPGT$GWVG PCIGPF%CNEKCVK50)#0550)/ÒPEJGP 44)TÒPG2CVKPCUGJTUEJÌP



'ZGORNCT FGT #WMVKQP .GW  <ÒTKEJ  0T  WPF FGT #WMVKQP /ÒP\GP WPF /GFCKNNGP #)  $CUGN    0T

7122

1,5:1

1,5:1



#+60#+ “U  X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO2HGTF URTKPIV T   FCTÒDGT/%CNEKCVK50)#05#RRGPFKZ50)/ÒPEJGP  &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7123 1,5:1



1,5:1

“U  X %JT  I 2GTUGRJQPGMQRH T2HGTF URTKPIV T FCTÒDGT / %CNEKCVK  50) #05   50)/ÒPEJGP &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7124 1,5:1

 30

1,5:1

#-4#)#55VCFV“6GVTCUX%JTI#FNGTTCWH*CUGP-TGDUWPVGP(NW­MTGDU QDGP/WUEJGN%CNEKCVK50)#0550)/ÒPEJGP 44$TCWPG2CVKPCUGJTUEJÌP




GRIECHEN • SICILIA

7126

7125



“6GVTCU  X %JT  I #FNGT T CWH *CUGP-TGDU WPVGP (NW­MTGDU %CNEKCVK  50)   #0550)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌP





“6GVTCU  X %JT  I #FNGT T CWH *CUGP-TGDU WPVGP (NW­MTGDU %CNEKCVK  50)   #0550)/ÒPEJGP &WPMNG2CVKPCHCUVUGJTUEJÌPUGJTUEJÌP



7127 1,5:1

1,5:1



“*GZCU  X %JT  I #FNGT UVGJV T CWH 8QIGN-TGDU \YKUEJGP \YGK 9GTVMWIGNP ÒDGT   \YGK(KUEJGP%CNEKCVK50)#0550)/ÒPEJGP  44&WPMGNDTCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJGU2TCEJVGZGORNCT

7128



7129

1,5:1

1,5:1



“*GZCUX%JTI#FNGTUVGJVTCWH*CUG-TGDU\YKUEJGP\YGK9GTVMWIGNPÒDGT\YGK (KUEJGP%CNEKCVK50)#0550)/ÒPEJGP 4&WPMNG2CVKPCUGJTUEJÌP





2JKPVKCU  X %JT “U  X %JT  I <GWUMQRH N OKV .QTDGGTMTCP\#FNGT CWH   *CUGPN%CNEKCVK50)#05XGTINHH50)/ÒPEJGPXGTINHH  &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



2JKPVKCUMQPPVGPCEJFGO6QFFGU#ICVJQMNGUXQP5[TCMWUFKG/CEJVKP#ITKIGPVÒDGTPGJOGPWPFFKG5VCFVXQPFGT U[TCMWUCPKUEJGP&QOKPCP\DGHTGKGP

7131

7130

7130 1,5:1

1,5:1

1,5:1



“UX%JTI#RQNNQMQRHNOKV.QTDGGTMTCP\9KNFUEJYGKPN%CNEKCVK50)#05 50)/ÒPEJGP &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





“U  I #RQNNQMQRH N OKV .QTDGGTMTCP\#FNGT UVGJV T \WTÒEMDNKEMGPF %CNEKCVK  50) #05   50)/ÒPEJGP )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

31


GRIECHEN • SICILIA

7132

1,5:1

7133

1,5:1



5VCFV“UX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\<YGK#FNGTCWH*CUGPN%CNEKCVK 50)#05HH50)/ÒPEJGPHH &WPMNG2CVKPCUGJTUEJÌP





“U  X %JT I#RQNNQMQRHNOKV.QTDGGTMTCP\<YGK#FNGTCWH*CUGPN%CNEKCVK 50)#05XGTIN50)/ÒPEJGPXGTIN  4&WPMGNDTCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJGU2TCEJVGZGORNCT



7135

7134

7134



“U  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\-TKGIGT T OKV 5RGGT %CNEKCVK    50)#0550)/ÒPEJGP 4&WPMNG2CVKPCUGJTUEJÌP





#.#+5# “.KVTC  X %JT  I -QRH FGT 5KMGNKC T(CEMGN \YKUEJGP \YGK JTGP   %CNEKCVK50)#0550)/ÒPEJGP 44)TÒPG2CVKPCUGJTUEJÌP



'KPG2T·IWPIWPVGTFGT5[OOCEJKG6KOQNGQPUXQP5[TCMWU

1,5:1



1,5:1

'06'..#“UXQTX%JTI(TCWGPMQRHN$·TVKIGT/·PPGTMQRHT%CNEKCVK50)#05 50)/ÒPEJGP 4(GKPGDTCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJGU2TCEJVGZGORNCT

1,5:1



7136

7137



1,5:1

“1PMKC  X %JT  I -QRH N OKV *GNO .QTDGGT CNU *GNOUEJOWEM2HGTF URTKPIV T   FCTWPVGT*GNOT%CNEKCVK50)#0550)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T

1,5:1



7138

1,5:1

“1PMKC  X %JT  I %CORCPKUEJGT *GNO T2HGTF T %CNEKCVK  50) #05    50)/ÒPEJGP &WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0TWPFFGT5COONWPI'TKEJ$%CJP

32




GRIECHEN • SICILIA

7139

7140 1,5:1

1,5:1

1,5:1

1,5:1



'4;: “U  X %JT  I 9GKDNKEJGT -QRH T2HGTF T %CNEKCVK  50) #05  50)   /ÒPEJGP )TÒPDTCWPG2CVKPCXQT\ÒINKEJUGJTUEJÌP





“UX%JTI-QRHT-TGDU%CNEKCVK50)#0550)/ÒPEJGP  8QPITQ­GT5GNVGPJGKV&WPMNG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



7142

7141

1,5:1

1,5:1



)'.#“6TKCUX%JTI5VKGTUVGJVN-QRHGKPGULWIGPFNKEJGP(NW­IQVVGUT,GPMKPU XGTIN .GKEJVMQTTQFKGTVUGJTUEJÌP





“6TKCUX%JTI5VKGTUVGJVTFCTÒDGT-QTP-QRHGKPGULWIGPFNKEJGP(NW­IQVVGUT FCJKPVGT-QTP,GPMKPU $TCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7143

1,5:1

7144

1,5:1

1,5:1

1,5:1



“6TKCUX%JTI5VKGTUVÌ­VN-QRHGKPGULWIGPFNKEJGP(NW­IQVVGUTFCJKPVGT-QTP ,GPMKPU 5GJTUGNVGPKPFKGUGT'TJCNVWPI.GKEJVDGCTDGKVGVXQT\ÒINKEJGU2TCEJVGZGORNCT





“6TKCUX%JTI5VKGTUVGJVTFCTÒDGT1NKXGP\YGKI-QRHGKPGULWIGPFNKEJGP(NW­ IQVVGUTFCJKPVGT-QTP,GPMKPU 5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ



7145

1,5:1

7146

1,5:1

1,5:1

1,5:1



“6TKCUX%JTI5VKGTUVGJVTFCTÒDGT1NKXGP\YGKI-QRHGKPGULWIGPFNKEJGP(NW­ IQVVGUTFCJKPVGT-QTP,GPMKPU 5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJ





“1PMKCX%JTI5VKGTUVÌ­VN-QRHGKPGULWIGPFNKEJGP(NW­IQVVGUTFCJKPVGT-QTP ,GPMKPU )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

33


GRIECHEN • SICILIA

7147

7148

1,5:1



1,5:1

1,5:1

1,5:1

“1PMKCX%JTI5VKGTUVGJVNFCTÒDGT-QTP-QRHGKPGULWIGPFNKEJGP(NW­IQVVGUT FCJKPVGT-QTP,GPMKPU &WPMNG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T



“6TKCU ! X%JTI&GOGVGTMQRHHCUVXX-QRHGKPGU(NW­IQVVGUN,GPMKPUXGTIN  $TCWPG2CVKPCNGKEJVDGCTDGKVGVHGKPGT5VKNUGJTUEJÌPpXQT\ÒINKEJ

7149

7150



7151



7152

*+/'4#“*GOKNKVTCPCEJX%JTI)QTIQPGKQP5GEJU9GTVMWIGNPQDGPWPFWPVGPLG GKP-GKN%CNEKCVK50)#0550)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“*GOKNKVTCPCEJX%JTI)QTIQPGKQP5GEJU9GTVMWIGNP%CNEKCVK50)#05 50)/ÒPEJGP )TÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





“6GVTCUPCEJX%JTI)QTIQPGKQP&TGK9GTVMWIGNP%CNEKCVK50)#0550) /ÒPEJGP )TÒPG2CVKPCUGJTUEJÌP





“1PMKCPCEJX%JTI)QTIQPGKQP9GTVMWIGNWOJGT'VJPKMQP%CNEKCVK FKGU'ZGO RNCT 50)#0550)/ÒPEJGP 44&WPMNG2CVKPCXQT\ÒINKEJ 

7153

1,5:1



“1PMKC PCEJ  X %JT  I )QTIQPGKQP9GTVMWIGN %CNEKCVK  50) #05  50) /QTEQO   XGTIN50)/ÒPEJGP 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCHCUVXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

34

1,5:1




GRIECHEN • SICILIA







“*GZCUXQTX%JTI,ÒPINKPITGKVGVCWH<KGIGPDQEMTOKV/WUEJGN0KMGHNKGIVNFCXQT \YGK9GTVMWIGNP%CNEKCVKXGTIN50)#0550)/ÒPEJGP  4)TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7156

1,5:1

“*GZCU XQT  X %JT  I ,ÒPINKPI TGKVGV CWH <KGIGPDQEM N OKV /WUEJGN WPVGP -QTP0KMG   HNKGIVNOKV#RJNCUVQPNWPFTLGGKPG9GTVMWIGN%CNEKCVKXGTIN50)#0550)/ÒPEJGP 445GJTUEJÌP 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7157

1,5:1



1,5:1

“*GOKNKVTCXQTX%JTI,ÒPINKPITGKVGVCWH<KGIGPDQEMTOKV/WUEJGNWPVGP)TCUJÒRHGT 0KMGHNKGIVNOKV#RJNCUVQP%CNEKCVK50)#0550)/ÒPEJGPXGTIN  44'VYCUMQTTQFKGTVHCUVUGJTUEJÌP

1,5:1



7155

1,5:1

7154



1,5:1

“*GOKNKVTC PCEJ  X %JT  I 0[ORJGPMQRH N FCXQT UGEJU 9GTVMWIGNP+P .QTDGGTMTCP\   5VGTPWPFUGEJU9GTVMWIGNP%CNEKCVK#50)#0550)/ÒPEJGP 44)TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7159

7158

1,5:1

1,5:1

1,5:1

1,5:1



“*GOKNKVTC PCEJ  X %JT  I 0[ORJGPMQRH N FCXQT UGEJU 9GTVMWIGNP+P .QTDGGTMTCP\   5GEJU9GTVMWIGNP%CNEKCVK50)#0550)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ





“*GOKNKVTC PCEJ  X %JT  I 0[ORJGPMQRH N FCXQT UGEJU 9GTVMWIGNP+P .QTDGGTMTCP\   5GEJU9GTVMWIGNP%CNEKCVK50)#0550)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ



1,5:1

7160

1,5:1

7161



“*GOKNKVTCWOX%JTI0[ORJGPMQRHHCUVXX)CTPGNGNFCTÒDGTUGEJU9GTVMWIGNP %CNEKCVK50)#0550)/ÒPEJGP 4)TÒPG2CVKPCXQT\ÒINKEJ





“6TKCU WO  X %JT  I 0[ORJGPMQRH HCUV X X/WUEJGN N WPF T LG \YGK 9GTVMWIGNP   %CNEKCVK50)#0550)/ÒPEJGP &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ

 35


GRIECHEN • SICILIA

7162

1,5:1



1,5:1

“6GVTCU WO  X %JT  I 0[ORJGPMQRH HCUV X X/WUEJGN FCTÒDGT FTGK 9GTVMWIGNP   %CNEKCVK50)#0550)/ÒPEJGP &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7163

1,5:1



1,5:1

6*'4/#+*+/'4#+#+“UPCEJX%JTI*GTCMQRHT*GTCMNGUMQRHT%CNEKCVKXGTIN 50)#0550)/ÒPEJGP  4.GKEJVDGCTDGKVGVHGKPGT5VKNNGKEJVHNGEMKIGDTCWPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  &KG &CVKGTWPI FGT /ÒP\GP XQP *KOGTC WPF UQOKV CWEJ FGT XQP 6JGTOCK KUV UGJT WOUVTKVVGP UKGJG %JTKUVQH   $QGJTKPIGT%JTKUVQH*KOGTCKO+8,CJTJWPFGTVX%JTKP-TCC[/ÎTMJQNO'UUC[U5HH

7164

1,5:1



1,5:1

“UPCEJX%JTI*GTCMQRHT*GTCMNGUMQRHT%CNEKCVK50)#0550)/ÒPEJGP )TÒPDTCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJGU2TCEJVGZGORNCT



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7165

7166

1,5:1

1,5:1

1,5:1

1,5:1



“UPCEJX%JTI*GTCMQRHT*GTCMNGUMQRHT%CNEKCVK50)#0550)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





“UPCEJX%JTI*GTCMQRHT*GTCMNGUMQRHT%CNEKCVKXGTIN50)#05#RRGPFKZ++ 50)/ÒPEJGP 4&WPMGNITÒPG2CVKPCXQT\ÒINKEJGU'ZGORNCT



7167

7168



“UPCEJX%JTI*GTCMQRHT*GTCMNGUMQRHT%CNEKCVK50)#05#RRGPFKZ++ 50)/ÒPEJGP &WPMNG2CVKPCXQT\ÒINKEJ





“UPCEJX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT6[EJGUVGJVNOKV2CVGTCWPF(ÒNNJQTP %CNEKCVK50)#0550)/ÒPEJGP &WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

36


GRIECHEN • SICILIA

7169 1,5:1

1,5:1



“UPCEJX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNTÒDGTFGT5EJWNVGT-GWNG&TGK0[ORJGPUVGJGP XX%CNEKCVK50)#0550)/ÒPEJGPHH 4.GKEJVDGCTDGKVGVITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7170

1,5:1



1,5:1

*;$.#/')#.'“UPCEJX%JTI-QRHFGT*[DNCKCTOKV-CNCVJQU&KQP[UQUUVGJV NOKV-CPVJCTQUWPF<GRVGTFCXQT2CPVJGT%CNEKCVK50)#0550)/ÒPEJGP  4&WPMGNDTCWPG2CVKPCNGKEJVDGCTDGKVGVUGJTUEJÌP

7172

7171

1,5:1

1,5:1





-#+010 “U WO  X %JTI)TGKHN2HGTFN%CNEKCVK50)#05 #NCKUC 50) /ÒPEJGP #NCKUC  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



&KG -CKPQP  PGWGU )GNF  2T·IWPIGP YWTFGP XGTOWVNKEJ XQP 5ÌNFPGTP KO &KGPUVG XQP 5[TCMWU IGRT·IV &KG   /ÒP\UV·VVGKUVPKEJVDGMCPPVFÒTHVGCDGTKPFGT7OIGDWPIXQP#MTCICU\WUWEJGPUGKP



“U WO  X %JT  I )TGKH N2HGTF N %CNEKCVK  50) #05  #NCKUC  50) /ÒPEJGP    #NCKUC  &WPMNG2CVKPCUGJTUEJÌP

7174

7173

1,5:1



1,5:1

1,5:1

1,5:1



-#/#4+0# “6GVTCU  X %JT  I )QTIQPGKQP'WNGUVGJVTFCXQT'KFGEJUGWPF# 9GUVGTOCTM,GPMKPU $TCWPG2CVKPCXQT\ÒINKEJ





“6GVTCU  X %JT  I )QTIQPGKQP'WNG UVGJV T FCXQT 'KFGEJUG WPF -QTP 9GUVGT   OCTM,GPMKPU &WPMNG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

37


GRIECHEN • SICILIA

7175

1,5:1

1,5:1

 

7176

1,5:1

1,5:1

“6GVTCUX%JTI)QTIQPGKQP'WNGUVGJVTFCXQT'KFGEJUG9GUVGTOCTM,GPMKPU &WPMGNITÒPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



“6GVTCUX%JTI)QTIQPGKQP'WNGUVGJVNFCXQT'KFGEJUG9GUVGTOCTM,GPMKPU &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7178

7177

1,5:1



1,5:1

1,5:1

1,5:1

“6GVTCUX%JTI)QTIQPGKQP'WNGUVGJVNFCXQT'KFGEJUG9GUVGTOCTM,GPMKPU &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



“6GVTCUX%JTI)QTIQPGKQP'WNGUVGJVNFCXQT'KFGEJUG9GUVGTOCTM,GPMKPU )TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



'ZGORNCTFGT#WMVKQP2GWU0CEJH(TCPMHWTVCO/CKP0T

7179

1,5:1



7180

1,5:1

1,5:1

1,5:1

“1PMKCX%JTI)QTIQPGKQP'WNGUVGJVTFCXQT'KFGEJUG9GUVGTOCTM,GPMKPU &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



“1PMKC  X %JT  I )QTIQPGKQP'WNG UVGJV T FCXQT 'KFGEJUG 9GUVGTOCTM,GPMKPU   XGTIN )TÒPG2CVKPCGVYCUMQTTQFKGTVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7182

7181

1,5:1



1,5:1

1,5:1

“6GVTCU  X %JT  I #VJGPCMQRH N OKV CVVKUEJGO *GNO'WNG UVGJV NFCXQT'KFGEJUG 9GUVGTOCTM,GPMKPU $TCWPG2CVKPCXQT\ÒINKEJ

1,5:1



'ZGORNCTFGT#WMVKQP2GWU0CEJH(TCPMHWTVCO/CKP0T

 38

“6GVTCU  X %JT  I #VJGPCMQRH N OKV CVVKUEJGO *GNO'WNG UVGJV NFCXQT'KFGEJUG 9GUVGTOCTM,GPMKPU &WPMNG2CVKPCHCUVXQT\ÒINKEJ




GRIECHEN • SICILIA

7184

7183



1,5:1

1,5:1

1,5:1

1,5:1

“6GVTCU  X %JT  I #VJGPCMQRH N OKV CVVKUEJGO *GNO'WNG UVGJV NFCXQT'KFGEJUG 9GUVGTOCTM,GPMKPU )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



-#/2#01+ “U  X %JT  I -CORCPKUEJGT *GNO/QPQITCOO KP .QTDGGTMTCP\   %CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJ



&KG-CORCPQKYCTGPMCORCPKUEJG5ÌNFPGTFKGUKEJPCEJKJTGT'PVNCUUWPI\GKVYGKUGKO+PPGTP5K\KNKGPUHGUVUGV\VGP

7186

7185

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JTI-CORCPKUEJGT*GNO/QPQITCOOKP.QTDGGTMTCP\%CNEKCVK  &WPMNG2CVKPCUGJTUEJÌP



-#6#0'“6GVTCUX%JTI,WIGPFNKEJGT-QRHFGU(NW­IQVVGU#OGPCPQUN)GHNÒ IGNVGT$NKV\%CNEKCVK &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

1,5:1



7187





1,5:1

“1PMKCX%JTI-QRHFGU(NW­IQVVGU#OGPCPQUN)GHNÒIGNVGT$NKV\%CNEKCVK  4)TÒPG2CVKPCXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7188 1,5:1



1,5:1

“U,CJTJWPFGTVX%JTI*GTOGUMQRHTOKVIGHNÒIGNVGO2GVCUQU0KMGIGJVNOKV-TCP\ WPF2CNO\YGKI%CNEKCVK FKGU'ZGORNCT  &WPMNG2CVKPCHCUVXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



7189



1,5:1

“U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\ FCJKPVGT *GNO#RJTQFKVG   *[DNCKCUVGJVTOKV8QIGN%CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJ

 39


GRIECHEN • SICILIA

7190

1,5:1



1,5:1

-'0614+2#+ “&GMQPMKQP  X %JT  I <GWUMQRH T FCJKPVGT #FNGT)GHNÒIGNVGT   $NKV\%CNEKCVKD\Y 5GJTUGNVGPKPFKGUGT'TJCNVWPI&WPMNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

7191



7192

1,5:1

1,5:1

1,5:1

1,5:1



“*GZCUX%JTI&GOGVGTMQRHTFCJKPVGTJTG2HNWIFCXQT\YGK9GTVMWIGNPT 8QIGN%CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJ





-'2*#.1+&+10 “U  X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T2GICUWU HNKGIV T   %CNEKCVK50)#05#RRGPFKZ50)/ÒPEJGPXGTIN  4&WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



7194

7193

1,5:1



1,5:1

1,5:1

1,5:1

“UX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT2GICUWUHNKGIVTFCTWPVGT- TGVTQITCF  %CNEKCVKXCT50)#05#RRGPFKZXCT50)/ÒPEJGPXGTIN  4&WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



“UX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT2GICUWUHNKGIVTFCTWPVGT-%CNEKCVKXCT 50)#05#RRGPFKZXCT50)/ÒPEJGPXGTIN  4&WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



7195 1,5:1



“U  X %JT  I *GTCMNGUMQRH T OKV .QTDGGTMTCP\-GWNG FCTÒDGT .ÌYGPHGNN FCJKPVGT   -ÌEJGT%CNEKCVK50)#0550)/ÒPEJGP  4&WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJGU'ZGORNCT 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

40

1,5:1




GRIECHEN • SICILIA

7196

7197 1,5:1

1,5:1

1,5:1

1,5:1



.'106+01+ “6GVTCU  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\ N )GTUVGPMQTP   &TGKHW­\YKUEJGP)GTUVGPMÌTPGTP%CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJ





“1PMKCX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\N)GTUVGPMQTP&TGKHW­\YKUEJGP )GTUVGPMÌTPGTP%CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



1,5:1

“U PCEJ  X %JT  I &GOGVGTMQRH N OKV 5EJNGKGT WPF JTGPMTCP\$ÒPFGN XQP XKGT JTGP   %CNEKCVK )TÒPG2CVKPCHCUVXQT\ÒINKEJ

1,5:1



7198

7199



1,5:1

.+.;$#+10“UPCEJX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\.[TC%CNEKCVK  )TÒPDTCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



7200 1,5:1

1,5:1



“UPCEJX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\.[TC%CNEKCVK  (GKPGT5VKNDTCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

1,5:1



7201

1,5:1

.12#&75#“UPCEJX%JTI-TGDU-TGDU%CNEKCVK  4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T &KG<WYGKUWPIKUVPKEJVIGUKEJGTV





41


GRIECHEN • SICILIA

7203

7202

1,5:1

1,5:1

1,5:1

1,5:1



/'0#+010“U,CJTJWPFGTVX%JTI&GOGVGTMQRHTOKV5EJNGKGTWPFJTGPMTCP\<YGK IGMTGW\VG(CEMGNPWPVGPD%CNEKCVK 4&WPMNG2CVKPCUGJTUEJÌP





/'55#0# “*GZCU  X %JT  I ,WIGPFNKEJGT -QRH N+P -TCP\ *CUG URTKPIV T   FCTWPVGT\YGK9GTVMWIGNP%CNVCDKCPQHH 5GJTUEJÌP



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



7204

1,5:1

“*GOKNKVTC  X %JT  I -QRH FGT 0[ORJG 2GNQTKCU N FCXQT \YGK &GNRJKPG FCJKPVGT   /WUEJGN&TGK\CEM\YKUEJGP\YGK&GNRJKPGP\YKUEJGPFGP<CEMGP/WUEJGNP%CNVCDKCPQ  44)TÒPG2CVKPCUGJTUEJÌP 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7205

1,5:1





1,5:1

“*GOKNKVTC  X %JT  I -QRH FGT 0[ORJG 2GNQTKCU N \YKUEJGP \YGK &GNRJKPGP&TGK   \CEMN/WUEJGNT*CUG%CNVCDKCPQ FKGU'ZGORNCTCDIGDKNFGV   4&WPMNG2CVKPCHCUVXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7206

1,5:1

1,5:1

7207

7207 1,5:1



“1PMKCX%JTI0[ORJGPMQRHTFCJKPVGT/WUEJGN&TGK\CEM\YKUEJGP\YGK&GN RJKPGP%CNVCDKCPQ 44)TÒPG2CVKPCHCUVXQT\ÒINKEJ





“.KVTCX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNN.ÌYGTFCTÒDGT-GWNGKO#DUEJPKVV &TGK\CEM%CNVCDKCPQ )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7208 1,5:1

 42

1,5:1

“.KVTCX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNN.ÌYGTFCTÒDGT-GWNGKO#DUEJPKVV (CEMGN%CNVCDKCPQ )TÒPDTCWPG2CVKPCHCUVXQT\ÒINKEJ




GRIECHEN • SICILIA

7210

7209



/#/'46+01+ “3WCFTWRNC  X %JT /GUUCPC  I #TGUMQRH T OKV .QTDGGTMTCP\   FCJKPVGT*GNO#FNGTUVGJVNCWH$NKV\FCXQTF%CNEKCVK )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T



“3WCFTWRNCX%JT/GUUCPCI#TGUMQRHTOKV.QTDGGTMTCP\FCJKPVGT5RGGTURKV\G #FNGTUVGJVNCWH$NKV\%CNEKCVK &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7211 1,5:1



1,5:1

“UX%JTI#TGUMQRHTOKV.QTDGGTMTCP\5VKGTUVÌ­VN%CNEKCVK  )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7212

1,5:1



7213

1,5:1

1,5:1

1,5:1

“1PMKC  X %JT  I #TGUMQRH T OKV .QTDGGTMTCP\ FCJKPVGT $WMTCPKQP5VKGT UVÌ­V N   FCTÒDGT-GWNG%CNEKCVK &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“UWOX%JTI-QRHFGU#FTCPQUNOKVMQTKPVJKUEJGO*GNO*WPFUVGJVT%CNEKCVK  &WPMNG2CVKPCUGJTUEJÌP



#FTCPQUD\Y*CFTCPQUYCTGKPGKP6GKNGP5K\KNKGPUXGTGJTVG)QVVJGKVFKGXQPFGP)TKGEJGPOKV*GRJCKUVQUKFGPVKHK \KGTVYWTFG&GT*WPFYCTFCUJGKNKIG6KGTFGU#FTCPQU

7214

7215



“2GPVQPMKQPX%JTI#TGUMQRHNOKV.QTDGGTMTCP\FCJKPVGT*GNO-TKGIGTUVGJVN OKV5RGGTWPF2HGTF%CNEKCVK &WPMGNITÒPG2CVKPCUGJTUEJÌP





“2GPVQPMKQPX%JTI<GWUMQRHTOKV.QTDGGTMTCP\FCJKPVGT5RGGTURKV\G-TKGIGT IGJVTOKV*GNO5RGGTWPF5EJKNF%CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP

 43


GRIECHEN • SICILIA

7216 1,5:1



1,5:1

/14)#06+0# “U WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO FCJKPVGT 'WNG   .ÌYGTHTK­VCP*KTUEJMQRHFCTWPVGT5EJNCPIG%CNEKCVK 4)TÒPG2CVKPCXQT\ÒINKEJ  'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)<ÒTKEJ0TWPFFGT5COONWPI'TKEJ$%CJP

7217

1,5:1



1,5:1

“UWOX%JTI-QRHFGT5KMGNKCT#FNGTNKPFGP(·PIGP5EJNCPIGT-QTP%CNEKCVKNX 4)TÒPG2CVKPCHCUVXQT\ÒINKEJ

7218



7219

1,5:1

1,5:1

1,5:1

1,5:1



“UWOX%JTI-QRHFGT5KMGNKCT&TGKHW­%CNEKCVK

4)TÒPG2CVKPCXQT\ÒINKEJ





/16;#“UX%JTI9GKDNKEJGT-QRHT-TGDU%CNEKCVK,GPMKPU  8QPITQ­GT5GNVGPJGKV&WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



7220 7221

1,5:1

1,5:1



“1PMKCX%JTI9GKDNKEJGT-QRHHCUVXX-TGDU,GPMKPU+2N  &WPMNG2CVKPCXQT\ÒINKEJ





2#014/15 “*GOKNKVTC PCEJ  X %JT  I *CJP5GEJU 9GTVMWIGNP %CNEKCVK  <+<    ,GPMKPU+2N &WPMNG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1



7222

1,5:1

“U,CJTJWPFGTVX%JTI*GTCMQRHNOKV5VGRJCPG#PFTQMGRJCNGT5VKGTUVGJVNFCTÒDGT 5QPPG%CNEKCVK FKGU'ZGORNCTCDIGDKNFGV<+< ,GPMKPU+2N 4&WPMNG2CVKPCUGJTUEJÌP 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0TWPFFGT5COONWPI6QO8KT\K#WMVKQP .GW<ÒTKEJ0T

44




GRIECHEN • SICILIA

7223

7224

1,5:1



1,5:1

1,5:1

1,5:1

“U  X %JT  I 2HGTF URTKPIV T FCTÒDGT 9GK\GPMQTP#PFTQMGRJCNG 5VKGTRTQVQOG T   %CNEKCVK <K\ ,GPMKPU+2N 4&WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP&T2GWU0CEJH(TCPMHWTVCO/CKP0T



“U  X %JT  I -QRH N OKV .QTDGGTMTCP\2HGTFGRTQVQOG T FCTWPVGT &GNRJKP T   %CNEKCVK <K\  &WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJGU'ZGORNCT

7225

7226

1,5:1





1,5:1

1,5:1

1,5:1

“U  X %JT  I -QRH N OKV .QTDGGTMTCP\2HGTFGRTQVQOG T FCTWPVGT &GNRJKP T   %CNEKCVK <K\  &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP2GWU0CEJH(TCPMHWTVCO/CKP0T



“UPCEJX%JTI&GOGVGTMQRHNOKV5EJNGKGT2TQTCT%CNEKCVK  $TCWPG2CVKPCNGKEJVDGCTDGKVGVHCUVXQT\ÒINKEJ

1,5:1



7227



1,5:1

“UPCEJX%JTI&GOGVGTMQRHNOKV5EJNGKGT+P-TCP\0#51%CNEKCVK  4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7228 1,5:1

1,5:1



“UPCEJX%JTI,CPWUMQRH+P-TCP\-WIGN%CNEKCVK  &WPMGNITÒPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



7229 1,5:1



1,5:1

“UPCEJX%JTI,CPWUMQRH9ÌNHKPTU·WIV4QOWNWUWPF4GOWU%CNEKCVKXGTIN 8QT\ÒINKEJ

'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

 45


GRIECHEN • SICILIA

7230

1,5:1



7231

1,5:1

“UPCEJX%JTI6WTOCWH$CUKU#NVCT%CNEKCVK  7PTGIGNO·­KIGT4CPFIN·P\GPFGITÒPG2CVKPCNGKEJVDGCTDGKVGVUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



“UPCEJX%JTI<GWUMQRH ! NOKV.QTDGGTMTCP\$NKV\N6CWDG ! %CNEKCVKXGTIN# 4)TÒPG2CVKPCHCUVXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7232

1,5:1





1,5:1

2+#-15“*GOKNKVTCX%JTI-QRHGKPGULWIGPFNKEJGP(NW­IQVVGUN*WPFTTGK­V *KTUEJT 44&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP&T2GWU0CEJH(TCPMHWTVCO/CKP0T

7233 1,5:1



1,5:1

5')'56# “*GZCU  X %JT  I 0[ORJGPMQRH T*WPF UVGJV T WOIGDGP XQP XKGT   2WP\GP%CNEKCVK 4)TÒPG2CVKPCUGJTUEJÌP

7234

1,5:1



1,5:1

“1PMKCX%JTI0[ORJGPMQRHT*WPFUVGJVTFCTÒDGT9GTVMWIGN%CNEKCVK  4)TÒPG2CVKPCUGJTUEJÌP

'ZGORNCTFGT#WMVKQP&T2GWU0CEJH(TCPMHWTVCO/CKP0T

1,5:1

7235

1,5:1





7236



“UPCEJX%JTI,ÒPINKPIUMQRHTFCXQT-GT[MGKQP*WPFUVGJVN%CNEKCVK  44&WPMNG2CVKPCXQT\ÒINKEJ





5'.+075 “6TKCU  X %JT  I )QTIQPGKQP'RRKEJDNCVV WOJGT XKGT 9GTVMWIGNP   %CNEKCVK *GNNDTCWPG2CVKPCUGJTUEJÌP



46


GRIECHEN • SICILIA

7237

7238

1,5:1

1,5:1

1,5:1

1,5:1



“*GOKNKVTCX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT-ÌEJGTWPF$QIGP%CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJ





51.175“U,CJTJWPFGTVX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT*KRRQECORT%CNEKCVK &WPMNG2CVKPCNGKEJVMQTTQFKGTVXQT\ÒINKEJ



7239

1,5:1



1,5:1

“U,CJTJWPFGTVX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT*KRRQECORN%CNEKCVK  &WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7240 1,5:1

1,5:1



“*GOKNKVTC  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T)CTPGNG \YKUEJGP UGEJU   9GTVMWIGNP%CNEKCVK FKGU'ZGORNCTCDIGDKNFGV  4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7241

1,5:1



1,5:1

5;4#-75“6GVTCUPCEJX%JTI#TGVJWUCMQRHT\YKUEJGP\YGK&GNRJKPGP1MVQRWU WOIGDGPXQPFTGK9GTVMWIGNP%CNEKCVK  5GNVGPKPFKGUGT'TJCNVWPI$TCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7243

7242

1,5:1

1,5:1

1,5:1

1,5:1



“6GVTCUPCEJX%JTI#TGVJWUCMQRHT\YKUEJGP\YGK&GNRJKPGP1MVQRWUWOIGDGPXQP FTGK9GTVMWIGNP%CNEKCVK )TÒPG2CVKPCGVYCUFG\GPVTKGTVUGJTUEJÌP



“6GVTCUPCEJX%JTI#TGVJWUCMQRHN1MVQRWU%CNEKCVK

)TÒPG2CVKPCXQT\ÒINKEJ

  47


GRIECHEN • SICILIA

7245

7244 1,5:1

1,5:1

1,5:1

1,5:1



“1PMKCPCEJX%JTI(TCWGPMQRHT1MVQRWU%CNEKCVK

)TÒPG2CVKPCUGJTUEJÌP





“1PMKCPCEJX%JTI(TCWGPMQRHTFCJKPVGT&GNRJKP1MVQRWU%CNEKCVK  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7246

7247

1,5:1





1,5:1

“*GOKNKVTCX%JTI#TGVJWUCMQRHNFCJKPVGT 5KIPCVWT! '8KGTIGVGKNVGUYKPFOÒJNGP HNÒIGNCTVKIGU+PEWUWOKO<GPVTWOKPXGTVKGHVGO4WPFCEJVUVTCJNKIGT5VGTP%CNEKCVK  $TCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



“*GOKNKVTCX%JTI#TGVJWUCMQRHN8KGTIGVGKNVGUYKPFOÒJNGPHNÒIGNCTVKIGU+PEWUWOKO <GPVTWOKPXGTVKGHVGO4WPFCEJVUVTCJNKIGT5VGTP%CNEKCVK  )TÒPG2CVKPCGVYCUMQTTQFKGTVHCUVUGJTUEJÌP



7248

1,5:1



1,5:1

1,5:1

1,5:1

“UX%JT5VGORGNXQP2JT[IKNNQUI#TGVJWUCMQRHNFCJKPVGT&GNRJKP4CFKPFGP9KP MGNP'VJPKMQPWPF\YGK&GNRJKPG%CNEKCVK  5GJTUGNVGPKPFKGUGT'TJCNVWPI)TÒPG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



7250

7249

1,5:1

1,5:1

1,5:1

1,5:1



“*GOKNKVTC PCEJ  X %JT  I #TGVJWUCMQRH N&GNRJKP T FCTWPVGT /WUEJGN %CNEKCVK    &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





“6GVTCUPCEJX%JTI#TGVJWUCMQRHHCUVXX1EVQRWU%CNEKCVK  &WPMGNITÒPG2CVKPCJGTTNKEJGT5VKNXQT\ÒINKEJ



1,5:1



7251

“U PCEJ  X %JT  I #TGVJWUCMQRH T FCJKPVGT : FCXQT FTGK :*KRRQECOR T FCTWPVGT   1MVQRWU%CNEKCVK 44DGUQPFGTUKPFKGUGT'TJCNVWPI&WPMGNITÒPG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

48

1,5:1




GRIECHEN • SICILIA

7252

7253

1,5:1

1,5:1

1,5:1

1,5:1



“*GOKNKVTCX%JTI#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO*KRRQECORN%CNEKCVK  $TCWPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJGU2TCEJVGZGORNCT





“*GOKNKVTCX%JTI#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO*KRRQECORN%CNEKCVK  )TÒPG2CVKPCUGJTUEJÌP



7255

7254

1,5:1

1,5:1



“.KVTC  X %JT  I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO \YKUEJGP \YGK &GNRJKPGP   *KRRQECORN%CNEKCVK )TÒPG2CVKPCIWVGUUGJTUEJÌP





“.KVTCX%JTI#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO*KRRQECORN%CNEKCVK  &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7256 1,5:1



1,5:1

“&TCEJOG PCEJ  X %JT  I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO5GGUVGTP \YKUEJGP   \YGK&GNRJKPGP%CNEKCVK &WPMGNITÒPG2CVKPCOKPDGCTDGKVGVXQT\ÒINKEJ

7257



7258



“&TCEJOG PCEJ  X %JT  I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO5GGUVGTP \YKUEJGP   \YGK&GNRJKPGP%CNEKCVK )TÒPG2CVKPCGVYCUMQTTQFKGTVIWVGUUGJTUEJÌP





&KQPX%JT“UI-QRHFGU<GWU'NGWVJGTKQUTOKV.QTDGGTMTCP\$NKV\T)GTUVGP MQTP%CNEKCVK (CUVXQT\ÒINKEJ

 49


GRIECHEN • SICILIA

7259 1,5:1

1,5:1



“UI-QRHFGU<GWU'NGWVJGTKQUTOKV.QTDGGTMTCP\$NKV\T#FNGT%CNEKCVK  $TCWPITÒPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ

1,5:1



7260



1,5:1

6KOQNGQPX%JT“UI#TGVJWUCMQRHN2GICUWURTQVQOGN%CNEKCVK  &WPMNG2CVKPCXQT\ÒINKEJ



7261

1,5:1



1,5:1

“&KNKVTQPI<GWUMQRHNOKV.QTDGGTMTCP\2HGTFN%CNEKCVK

1,5:1



7262

$TCWPG2CVKPCXQT\ÒINKEJ



1,5:1

4GRWDNKMX%JT“UI-QRHNOKV.QTDGGTMTCP\2GICUWUHNKGIVN%CNEKCVK  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7263 1,5:1



#ICVJQMNGUX%JT“UI-QTGMQRHNOKVJTGPMTCP\FCJKPVGT(CEMGN5VKGTUVÌ­VN QDGPWPFWPVGPLGGKP&GNRJKPN%CNEKCVK &WPMGNITÒPG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

50

1,5:1




GRIECHEN • SICILIA

7264

1,5:1



1,5:1

“UI-QRHNOKV&KCFGO5VKGTUVÌ­VNFCTÒDGT-GWNG%CNEKCVK  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7265

7266

1,5:1



1,5:1

“UI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO2GICUQUN%CNEKCVK  )TÒPG2CVKPCHCUVXQT\ÒINKEJ



“UI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO4GKVGTTOKV.CP\G%CNEKCVK



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7267

1,5:1

8QT\ÒINKEJ

7268

1,5:1

1,5:1

1,5:1



“UI#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO$NKV\%CNEKCVK  )TÒPG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP





“UI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO$NKV\%CNEKCVK



)TÒPG2CVKPCUGJTUEJÌP

7271

7269

7270



“UI-QTGMQRHTOKVJTGPMTCP\FCJKPVGT(CEMGN$KICTFCTÒDGT5VGTP%CNEKCVK  $TCWPG2CVKPCXQT\ÒINKEJ



 

“UI-QTGMQRHNOKVJTGPMTCP\$KICT%CNEKCVK “UI-QTGMQRHNOKVJTGPMTCP\$KICT%CNEKCVK

 

)TÒPG2CVKPCUGJTUEJÌP &WPMNG2CVKPCUGJTUEJÌP

51


GRIECHEN • SICILIA

7272

7273

1,5:1



1,5:1

“UI-QTGMQRHNOKVJTGPMTCP\+P-TCP\(CEMGN%CNEKCVK FKGU'ZGORNCT   4&WPMNG2CVKPCHCUVXQT\ÒINKEJ



“UI-QTGMQRHNOKVJTGPMTCP\+P-TCP\(CEMGN%CNEKCVK FKGU'ZGORNCT   44&WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7275

7274

1,5:1

1,5:1



“UI#TVGOKUMQRHTÒDGTFGT5EJWNVGT-ÌEJGT)GHNÒIGNVGT$NKV\%CNEKCVK  &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





“UI#TVGOKUMQRHTÒDGTFGT5EJWNVGT-ÌEJGT)GHNÒIGNVGT$NKV\%CNEKCVK  )TÒPDTCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7276

7277

1,5:1

1,5:1

 

“UI#TVGOKUMQRHTÒDGTFGT5EJWNVGT-ÌEJGT)GHNÒIGNVGT$NKV\%CNEKCVK  )TÒPG2CVKPCNGKEJVGT&QRRGNUEJNCIXQT\ÒINKEJ



“UI<GWUMQRHNOKV.QTDGGTMTCP\$NKV\%CNEKCVK



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1

 52

7278

)TÒPG2CVKPCHCUVXQT\ÒINKEJ

1,5:1

“UI#RQNNQMQRHNOKV.QTDGGTMTCP\*WPFUKV\VNWPFDNKEMVCWH5EJNCPIG\WTÒEM%CNEKCVK 4&WPMNG2CVKPCXQT\ÒINKEJ




GRIECHEN • SICILIA

7279

1,5:1



7280

1,5:1

“UI*GTCMNGUMQRHTFCJKPVGT5VGTP.ÌYGTFCTÒDGT-GWNGKO#DUEJPKVV5RGGT%CNEKCVK &WPMNG2CVKPCHCUVXQT\ÒINKEJ



“UI*GTCMNGUMQRHT.ÌYGTFCTÒDGT-GWNG%CNEKCVK  &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



7281 1,5:1



1,5:1

*KMGVCUX%JT“UI-QRHFGU<GWU*GNNCPKQUNOKV.QTDGGTMTCP\FCJKPVGT$WMTC PKQP#FNGTUVGJVNCWH$NKV\%CNEKCVK $TCWPG2CVKPCXQT\ÒINKEJ

7282



7283

1,5:1

1,5:1



“UI-QRHFGU<GWU*GNNCPKQUNOKV.QTDGGTMTCP\#FNGTUVGJVNCWH$NKV\FCXQT5VGTP%CNEKCVK $TCWPG2CVKPCHCUVXQT\ÒINKEJ





“UI-QRHFGU<GWU*GNNCPKQUTOKV.QTDGGTMTCP\#FNGTNCWH$NKV\%CNEKCVK  $TCWPG2CVKPCXQT\ÒINKEJ



7284

1,5:1



7285

1,5:1

“UI-QRHFGU<GWU*GNNCPKQUTOKV.QTDGGTMTCP\#FNGTUVGJVNCWH$NKV\%CNEKCVK  &WPMNG2CVKPCXQT\ÒINKEJ



“UI-QRHFGU<GWU*GNNCPKQUTOKV.QTDGGTMTCP\#FNGTUVGJVNCWH$NKV\FCXQT#%CNEKCVK )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



53


GRIECHEN • SICILIA

7287

7286

1,5:1

1,5:1



2[TTJQU  X %JT “U  I *GTCMNGUMQRH KO .ÌYGPHGNN N#VJGPC 2TQOCEJQU UVGJV T   %CNEKCVK &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ





“UI*GTCMNGUMQRHKO.ÌYGPHGNNN#VJGPC2TQOCEJQUUVGJVTT'WNG%CNEKCVK  $TCWPG2CVKPCXQT\ÒINKEJ



7289

7288

1,5:1



1,5:1

“UI*GTCMNGUMQRHKO.ÌYGPHGNNT#VJGPC2TQOCEJQUUVGJVT%CNEKCVK  )TÒPDTCWPG2CVKPCHCUVXQT\ÒINKEJ



“UI2JVJKCMQRHNOKV5EJNGKGTFCJKPVGT/QJPDNWOG$NKV\%CNEKCVK  )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



'ZGORNCTFGT#WMVKQP0#%&<ÒTKEJ0T  2JVJKC FKG 6QEJVGT FGU 6JGUUCNGTU /GPQP WPF )CVVKP FGU -ÌPKIU #KCMKFGU XQP 'RKTWU YCT FKG /WVVGT FGU   2[TTJQU

7290

7292

1,5:1

7291

1,5:1



*KGTQP++X%JT“UI-QTGMQRHNOKVJTGPMTCP\5VKGTUVÌ­VNFCTÒDGTWPFFCT WPVGTLGGKP&GNRJKP%CNEKCVK )TÒPG2CVKPCUGJTUEJÌP





“UI-QTGMQRHNOKVJTGPMTCP\5VKGTUVÌ­VNFCTÒDGT-GWNG%CNEKCVK  )TÒPG2CVKPCIWVGUUGJTUEJÌP





“UI-QTGMQRHNOKVJTGPMTCP\5VKGTUVÌ­VNFCTÒDGT-GWNG%CNEKCVK  )TÒPG2CVKPCXQT\ÒINKEJ



54


GRIECHEN • SICILIA

7294

7293

7295



7295

“UI-QRHNOKV&KCFGOFCTWPVGT;4GKVGTTOKV5RGGTWPVGP'%CNEKCVK  5GJTUGNVGPG8CTKCPVG)TÒPG2CVKPCXQT\ÒINKEJ

'ZGORNCTFGT#WMVKQP0#%&<ÒTKEJ0T

 

“UI-QRHNOKV&KCFGO4GKVGTTOKV5RGGT%CNEKCVK “UI-QRHNOKV&KCFGO8KEVQTKCKP$KICT%CNEKCVK

&WPMGNITÒPG2CVKPCUGJTUEJÌP $TCWPITÒPG2CVKPCXQT\ÒINKEJ

  

7296

1,5:1



1,5:1

“UI2QUGKFQPMQRHNOKV&KCFGO&TGK\CEM\YKUEJGP\YGK&GNRJKPGP%CNEKCVK  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



7297

1,5:1

1,5:1



“UI2QUGKFQPMQRHNOKV&KCFGO&TGK\CEM\YKUEJGP\YGK&GNRJKPGP%CNEKCVK  &WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ

7298

1,5:1

7299



1,5:1



“UI2QUGKFQPMQRHNOKV&KCFGO&TGK\CEM\YKUEJGP\YGK&GNRJKPGP%CNEKCVK  &WPMNG2CVKPCUGJTUEJÌP





“UI-QTGMQRHNOKVJTGPMTCP\5VKGTUVÌ­VNFCTÒDGT-GWNG%CNEKCVK  )TÒPG2CVKPCXQT\ÒINKEJ

 55


GRIECHEN • SICILIA



7301

1,5:1

7300

1,5:1

*KGTQP[OQUX%JT“UI-QRHNOKV&KCFGO)GHNÒIGNVGT$NKV\%CNEKCVK  &WPMNG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



4GRWDNKMX%JT“UI2QUGKFQPMQRHTFCJKPVGT*CNDOQPF&TGK\CEM\YKUEJGP\YGK &GNRJKPGP%CNEKCVK )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7302

1,5:1



1,5:1

“U  I $ÒUVG FGT *GNGPC T OKV 5EJNGKGT FCTÒDGT 5VGTP2KNGK FGT &KQUMWTGP FCTÒDGT 5VGTPG   %CNEKCVK 44&WPMNG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7303

7304



“UI<GWUMQRHN8KEVQTKCKP$KICTQDGP*CNDOQPF%CNEKCVK



6#741/'0+7/ “*GOKFTCEJOG PCEJ  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\   #PFTQMGRJCNGT5VKGTUVGJVN%CNEKCVK FKGU'ZGORNCT  )TÒPG2CVKPCUGJTUEJÌP

)TÒPG2CVKPCXQT\ÒINKEJ

 

'ZGORNCTFGT#WMVKQP#FQNRJ*GUU#).W\GTP0TWPFFGT5COONWPI2Q\\K

7305

7306

1,5:1

1,5:1

1,5:1

1,5:1



270+'4“UX%JTI2CNOG2GICUQUHNKGIVNFCTÒDGT-WIGN#NGZCPFTQRQWNQU &WPMNG2CVKPCXQT\ÒINKEJ





“UX%JTI2CNOG2GICUQUHNKGIVN#NGZCPFTQRQWNQU  &WPMNG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

7307 1,5:1

 56

1,5:1

“U  X %JT  I &GOGVGTMQRH T OKV 5EJNGKGT2HGTF URTKPIVTFCJKPVGT2CNOG#NGZCP FTQRQWNQU50)%QR 4)TÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • SARDINIA

7309

7308

5#4&+0+# 

270+'4“&KUEJGMGNX%JTI6CPKVMQRHN2HGTFGMQRHT#NGZCPFTQRQWNQUC )TÒPG2CVKPCHCUVXQT\ÒINKEJ





“&KUEJGMGNX%JTI6CPKVMQRHN2HGTFGMQRHTFCXQT-GT[MGKQP#NGZCPFTQRQW NQUH )TÒPG2CVKPCUGJTUEJÌP



7310

7311



“5EJGMGNX%JTI6CPKVMQRHN2HGTFUVGJVT#NGZCPFTQRQWNQU  )TÒPG2CVKPCXQT\ÒINKEJ





“U  X %JT  I 6CPKVMQRH N&TGK JTGP FCTÒDGT *CNDOQPF #NGZCPFTQRQWNQU    50)%QR )TÒPG2CVKPCXQT\ÒINKEJ



1,5:1

7312

1,5:1

+..;4+%7/ 

-¤0+)4'+%*$CNNCKQUPCEJX%JT“UI-QRHT&GOGVGTUVGJVNOKV(CEMGN$/% $TCWPG2CVKPCXQT\ÒINKEJ

1,5:1

7313



1,5:1

/1'5+# 

&+10;5121.+5 “U  ,CJTJWPFGTV X %JT  I &KQP[UQUMQRH T OKV 'HGWMTCP\9GKP   VTCWDG&TCICPQX6[R 8QT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T FQTVWPVGT2JT[IKGP   $CTENC[ 8 *GCF JCV FKGUG 5VÒEMG KO $/% 2JT[IKC 5    &KQP[UQRQNKU KP 2JT[IKGP\WIGYKGUGP UKGJGCWEJ XQP#WNQEM/ÒP\GPWPF5V·FVG2JT[IKGPU++5 9KTNGIGPFKG/ÒP\GOKV&KOKVCT&TCICPQXPCEJ/QGUKGP

7314

1,5:1

7315



1&'5515 “U  ,CJTJWPFGTV X %JT  I 9GKDNKEJGT -QRH T)QVV &CT\CNCU!  NCIGTV N FCT   ÒDGTWOIGMGJTVG#ORJQTG#/0)XGTIN )TÒPG2CVKPCUGJTUEJÌP





61/+5“UI&TCRKGTVG$ÒUVGFGU6QOQUTOKV&KCFGO*GTCMNGUMQRHN#/0) 4$TCWPG2CVKPCUGJTUEJÌP

 57


GRIECHEN • SCYTHIA

7316

5%;6*+# 

1.$+#“U IGIQUUGP WOX%JTI)QTIQPGKQP#FNGTHNKGIVTOKV&GNRJKP50)$/ 8GEEJK2N+ 4&WPMGNITÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP

7317

7318

1,5:1





1,5:1

1,5:1

1,5:1

-CPKVGU,CJTJWPFGTVX%JT“UI*GTCMNGUMQRHKO.ÌYGPHGNNT-GWNGWPF$QIGP#NTCO 50)$/50)5VCPEQOD 44&WPMNG2CVKPCXQT\ÒINKEJ



6*4#%+# 

#$&'4#“UX%JTI)TGKHUKV\VT+P.KPKGPSWCFTCV-QRHT#/0)  5GJTUEJÌP

7320

7319

1,5:1





7321

1,5:1

#+)15216#/1+ “U WO  X %JT  I &GOGVGTMQRH N OKV 5VGRJCPG<KGIGPDQEM UVGJV N   50)%QR &WPMNG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



#KIQURQVCOQK KUV FWTEJ FKG 0KGFGTNCIG FGT CVJGPKUEJGP (NQVVG KO ,CJT  X %JT DGMCPPV +P FGT 5GGUEJNCEJV DGK   #KIQURQVCOQKIGNCPIGUFGTURCTVCPKUEJGP(NQVVGWPVGT.[UCPFGTFKGCVJGPKUEJG(NQVVGWPVGT-QPQPHCUVXQNNUV·PFKI \WXGTPKEJVGP'KP,CJTUR·VGTOW­VG#VJGPMCRKVWNKGTGP



$;<#06+10“UX%JTI2QUGKFQPMQRHT&TGK\CEM50)$/  4)TÒPG2CVKPCUGJTUEJÌP





“U  ,CJTJWPFGTV X %JT  I #TVGOKUDÒUVG T ÒDGT FGT 5EJWNVGT -ÌEJGT FCXQT $QIGP5VGTP   ÒDGT*CNDOQPF50)$/50)%QR $TCWPG2CVKPCUGJTUEJÌPGU'ZGORNCT



58


GRIECHEN • THRACIA

7322

7323

1,5:1

1,5:1

1,5:1

1,5:1



/#410'+#“UX%JTI2HGTFGRTQVQOGT9GKPVTCWDG5EJÌPGTV)GKUUHH  48QT\ÒINKEJ



“UX%JTI2HGTFGRTQVQOGNFCTWPVGT/QPQITCOO9GKPVTCWDG5EJÌPGTV)GKUU XGTIN 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP

7325

7324

 

7326



“UX%JTI2HGTFURTKPIVT9GKPUVQEMKP.KPKGPSWCFTCV5EJÌPGTV)GKUUHH  &WPMNG2CVKPCXQT\ÒINKEJ





“UX%JTI2HGTFURTKPIVT9GKPUVQEMKP.KPKGPSWCFTCV5EJÌPGTV)GKUUHH  )TÒPG2CVKPCXQT\ÒINKEJ





“UX%JTI2HGTFURTKPIVT9GKPUVQEMKP.KPKGPSWCFTCV5EJÌPGTV)GKUUHH  $TCWPG2CVKPCUGJTUEJÌP



7327

7328

7329

1,5:1

1,5:1



“UX%JTI,WIGPFNKEJGT&KQP[UQUMQRHT&KQP[UQUUVGJVNOKV5RGGTGP QFGT0CTV JGZ5VCPIGP WPF9GKPVTCWDGP5EJÌPGTV)GKUUHH &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





“U  X %JTI,WIGPFNKEJGT&KQP[UQUMQRHT&KQP[UQUUVGJVNOKV5RGGTGP QFGT0CTV JGZ5VCPIGP WPF9GKPVTCWDGP5EJÌPGTV)GKUUXGTINHH &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





/'5'/$4+# “U  ,CJTJWPFGTV X %JT  I &KQP[UQUMQRH T OKV 'HGWMTCP\9GKPVTCWDG   50)#UJOQNGCPXGTIN50)$/ )TÒPG2CVKPCHCUVXQT\ÒINKEJ



7330

1,5:1



1,5:1

2#06+-#2#+10“U,CJTJWPFGTVX%JTI2CPMQRHNOKV'HGWMTCP\$QIGPWPF2HGKN 50)$/ &WPMNG2CVKPCNGKEJVDGCTDGKVGVHCUVXQT\ÒINKEJ

 59


GRIECHEN • THRACIA

7331 1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI2CPMQRHNOKV'HGWMTCP\5VKGTMQRHN50)$/  &WPMNG2CVKPCNGKEJVDGCTDGKVGVUGJTUEJÌPpXQT\ÒINKEJ



7332 1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI2CPMQRHNOKV'HGWMTCP\FCTCWHTWPFGT)GIGPUVGORGN5VGTP .ÌYGPMQRHNFCTWPVGT(KUEJN50)$/ $TCWPG2CVKPCUGJTUEJÌP

7333



7334

1,5:1

1,5:1

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI2CPMQRHN5VKGTMQRHN50)$/  &WPMNG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



“U,CJTJWPFGTVX%JTI2CPMQRHN5VKGTMQRHN50)$/

7335

 &WPMNG2CVKPCUGJTUEJÌP

 

7336

7335 1,5:1



“U,CJTJWPFGTVX%JTI2CPMQRHN$QIGPÒDGT2HGKN50)$/HH  &WPMNG2CVKPCXQT\ÒINKEJ





“UX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\#FNGTUVGJVHCUVXXCWH$NKV\N/QPQ ITCOO50)$/XGTIN &WPMNG2CVKPCNGKEJVDGCTDGKVGVUGJTUEJÌP



1,5:1



60

7337

1,5:1

5#/16*4#-'“UWOX%JT/CIKUVTCV2[VJQ  I&TCRKGTVG$ÒUVGFGT#VJGPCTOKV MQTKPVJKUEJGO*GNO-[DGNGUKV\VNOKV2CVGTCWPF<GRVGT50)%QRXCT  )TÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • MACEDONIA

7338

7339





1,5:1

1,5:1

1,5:1

“U WO  X %JT /CIKUVTCV 2[VJQ    I &TCRKGTVG $ÒUVG FGT #VJGPC T OKV MQTKPVJKUEJGO   *GNO-[DGNGUKV\VNOKV2CVGTCWPF<GRVGT50)%QRXCT  $TCWPG2CVKPCXQT\ÒINKEJUGJTUEJÌP



“U WO  X %JT /CIKUVTCV 2[VJQ    I &TCRKGTVG $ÒUVG FGT #VJGPC T OKV MQTKPVJKUEJGO   *GNO-[DGNGUKV\VNOKV2CVGTCWPF<GRVGT50)%QRXCT 5GJTUEJÌP



7340

1,5:1



1,5:1

1,5:1

5'5615 “U WO  X%JT  I &GOGVGTMQRH N*GTOGU UVGJV N OKV -GT[MGKQP FCXQT #O   RJQTGT)GTUVGPMQTP50)%QR &WPMNG2CVKPCUGJTUEJÌP



7342

7341 1,5:1

1,5:1

1,5:1

1,5:1



-¤0+)4'+%*5CTCVQMQUWOX%JT“UI$·TVKIGT-QRHN9GKPVTCWDG2GVGT5 ;QWTQWMQXC 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





-GVTKRQTKU  X %JT “U  I &KQP[UQUMQRH T OKV 'HGWMTCP\-CPVJCTQU N 6J[TUQU   2GVGT56QRCNQX 4&WPMNG2CVKPCXQT\ÒINKEJp5VGORGNINCP\



1,5:1

7343

7344

1,5:1



5GWVJGU+++X%JT“UI-QRHTOKV&KCFGO4GKVGTT2GVGT56QRCNQX &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





.[UKOCEJQU  X %JT “U  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO.Ì   YGPRTQVQOGTFCJKPVGT-GT[MGKQPWPF/QPQITCOOFCTWPVGT5RGGTURKV\G50)%QR  )TÒPG2CVKPCXQT\ÒINKEJ



1,5:1

7345

1,5:1 7346

/#%'&10+# 

#/2*+21.+5“UX%JTI,ÒPINKPIUMQRHTOKV6CGPKG(CEMGN50)#05  &WPMNG2CVKPCUGJTUEJÌP



#2*;6+5 “U PCEJ  X %JT  I -QRH FGU <GWU #OOQP T#FNGT UVGJV T 50) #05    50)%QR &WPMNG2CVKPCXQT\ÒINKEJ

  61


GRIECHEN • MACEDONIA

7347

7348

1,5:1

1,5:1

1,5:1

1,5:1



$166+-' “U  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\.[TC 50) #05    50)%QR $TCWPG2CVKPCXQT\ÒINKEJ





2#414'+# “U  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\#FNGT UVGJV T CWH $NKV\   #/0)HH /CMGFQPKCWPVGT2JKNKRR8WPF2GTUGWU  &WPMGNITÒPG2CVKPCUGJTUEJÌP



7349

7350

7351

1,5:1

1,5:1



2*+.+22+ “U  X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN N&TGKHW­ N 'HGWDNCVV 50)   #05 &WPMNG2CVKPCUGJTUEJÌP





6*'55#.10+%#“UX%JTI*GTOGUDÒUVGTOKV.QTDGGTMTCP\ÒDGTFGT5EJWNVGT -GT[MGKQP2CPUVGJVN50)#05XGTIN50)%QRXGTIN  &WPMNG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP



“UX%JTI2QUGKFQPMQRHT2TQTCT50)#05XGTIN50)%QR  &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





7352 1,5:1

7353

1,5:1



64#)+.15 “U  X %JT  I *GTOGUMQRH T OKV 2GVCUQU8KGTIGVGKNVGU 3WCFTCV 50)   #05 )TÒPG2CVKPCUGJTUEJÌP





74#0121.+5“UWOX%JTI#EJVUVTCJNKIGT5VGTP#RJTQFKVG7TCPKCUKV\VNCWH)NQ DWUOKV<GRVGT50)#05 )TÒPG2CVKPCUGJTUEJÌP



7354

7354

7355

1,5:1



-¤0+)4'+%* 2JKNKRRQU ++  X %JT “U  I #RQNNQMQRH T OKV 6CGPKG4GKVGT T   FCTWPVGT5RGGTURKV\G50)#05 &WPMNG2CVKPCXQT\ÒINKEJ





“UI#RQNNQMQRHTOKV6CGPKG4GKVGTTFCTWPVGTP50)#05XGTIN



62

5GJTUEJÌP


GRIECHEN • MACEDONIA

7357

7356

1,5:1

1,5:1





1,5:1

1,5:1

#NGZCPFGT+++X%JT“UX%JTOCMGFQPKUEJG/ÒP\UV·VVGI*GTCMNGUMQRH KO.ÌYGPHGNNT#FNGTUVGJVTCWH$NKV\FCTÒDGT'HGWDNCVV2TKEG  4&WPMNG2CVKPCIWVGUUGJTUEJÌP



“U  X %JT OCMGFQPKUEJG /ÒP\UV·VVG  I *GTCMNGUMQRH KO .ÌYGPHGNN T-GWNG ÒDGT   $QIGPKP$QIGPVCUEJG2TKEG $TCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7358

1,5:1

7359

1,5:1

1,5:1

1,5:1



“UX%JTWPDGUVKOOVG MNGKPCUKCVKUEJG! /ÒP\UV·VVGI*GTCMNGUMQRHKO.ÌYGPHGNNT -GWNGÒDGT$QIGPWPF-ÌEJGTQDGP.WPVGPF2TKEG 4)N·P\GPFGITÒPG2CVKPCUGJTUEJÌP





“U  X %JT OCMGFQPKUEJG /ÒP\UV·VVG  I *GTCMNGUMQRH KO .ÌYGPHGNN T$QIGP WPF   -ÌEJGTÒDGT-GWNGWPVGP/CWUT2TKEG 8QT\ÒINKEJ



7360

7361

1,5:1

1,5:1

1,5:1

1,5:1



“U  X %JT OCMGFQPKUEJG /ÒP\UV·VVG  I *GTCMNGUMQRH KO .ÌYGPHGNN T$QIGP WPF   -ÌEJGTÒDGT-GWNG2TKEG 8QT\ÒINKEJ





“UX%JTOCMGFQPKUEJG/ÒP\UV·VVGI/CMGFQPKUEJGT5EJKNFFCTCWH$NKV\/CMGFQ PKUEJGT*GNOFCTWPVGTWPMGPPVNKEJGU$GK\GKEJGP2TKEGXGTINHH )TÒPG2CVKPCXQT\ÒINKEJ



7363

7362

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JTOCMGFQPKUEJG/ÒP\UV·VVGI/CMGFQPKUEJGT5EJKNFFCTCWH$NKV\/CMGFQ PKUEJGT*GNOFCTWPVGT5VGTP2TKEG $TCWPG2CVKPCUGJTUEJÌP





“UX%JTOCMGFQPKUEJG/ÒP\UV·VVGI/CMGFQPKUEJGT5EJKNFFCTCWH$NKV\/CMGFQ PKUEJGT*GNOFCTWPVGT/QPQITCOO2TKEG &WPMNG2CVKPCXQT\ÒINKEJ

 63


GRIECHEN • MACEDONIA

7364

7365

1,5:1

1,5:1

1,5:1

1,5:1



“U  X %JT OCMGFQPKUEJG /ÒP\UV·VVG  I /CMGFQPKUEJGT 5EJKNF FCTCWH -GWNG/CMG   FQPKUEJGT*GNO2TKEG )TÒPG2CVKPCIWVGUUGJTUEJÌP





“URQUVJWOX%JT5CTFGKUI/CMGFQPKUEJGT5EJKNFFCTCWH-GT[MGKQP/CMGFQPK UEJGT*GNO\YKUEJGP4QUGWPF-GT[MGKQP2TKEG 4)TÒPG2CVKPCUGJTUEJÌP



7366

7367

1,5:1

1,5:1

1,5:1

1,5:1



“URQUVJWOX%JT5CNCOKUI/CMGFQPKUEJGT5EJKNFFCTCWH)QTIQPGKQP/CMGFQPK UEJGT*GNON-GT[MGKQP2TKEG )TÒPG2CVKPC4GXGTUNGKEJVMQTTQFKGTVXQT\ÒINKEJ





“URQUVJWOX%JT5CNCOKUI/CMGFQPKUEJGT5EJKNFFCTCWH)QTIQPGKQP/CMGFQPK UEJGT*GNON-GT[MGKQP2TKEG &WPMNG2CVKPCIWVGUUGJTUEJÌP



7368

7369

1,5:1

1,5:1



“U RQUVJWO  X %JT MNGKPCUKCVKUEJG /ÒP\UV·VVG  I *GTCMNGUMQRH KO .ÌYGPHGNN T   $QIGPKP$QIGPVCUEJGÒDGT-GWNGWPVGP(CEMGN2TKEG 8QT\ÒINKEJ





“U RQUVJWO  X %JT MNGKPCUKCVKUEJG /ÒP\UV·VVG  I *GTCMNGUMQRH KO .ÌYGPHGNN T   $QIGPKP$QIGPVCUEJGÒDGT-GWNGWPVGP(CEMGN2TKEG 8QT\ÒINKEJ



7370

1,5:1

1,5:1

7371

7371 1,5:1



2JKNKRRQU+++X%JT“UX%JTOCMGFQPKUEJG/ÒP\UV·VVGI*GTCMNGUMQRH KO.ÌYGPHGNNT4GKVGTTWPVGPTWPFGT)GIGPUVGORGN-GT[MGKQP2TKEG2 8QT\ÒINKEJ





“U  X %JT /KNGV  I #RQNNQMQRH T OKV .QTDGGTMTCP\4GKVGT T FCTÒDGT &QRRGNCZV   WPVGP/QPQITCOO2TKEG2 )TÒPG2CVKPCUGJTUEJÌP



8QP *WIQ )CGDNGT YWTFG FCU 5VÒEM PQEJ KTTVÒONKEJ 2JKNKRRQU +8 FGO 5QJP FGU -CUUCPFTQU \WIGYKGUGP UKGJG   #/0)5

64


GRIECHEN • MACEDONIA

7372

7373

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JT/KNGVI#RQNNQMQRHTOKV6CGPKG4GKVGTT2TKEG2  )TÒPG2CVKPCXQT\ÒINKEJ





#PQP[O “U PCEJ  X %JT  I /CMGFQPKUEJGT 5EJKNF FCTCWH &QRRGNCZV/CMGFQPKUEJGT   *GNO50)%QR )N·P\GPFGFWPMGNITÒPG2CVKPCUGJTUEJÌP



7375

7374

1,5:1

1,5:1

1,5:1

1,5:1



“U PCEJ  X %JT  I /CMGFQPKUEJGT 5EJKNF FCTCWH 5VGTP/CMGFQPKUEJGT *GNO N -GT[   MGKQP50)%QR 5GJTUEJÌPpXQT\ÒINKEJ





-CUUCPFTQUX%JT“UXQTX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT.ÌYGNKGIV TFCTÒDGT5RGGTURKV\GWPF/QPQITCOO50)%QRXGTIN  4&WPMGNITÒPG2CVKPC#XGTUNGKEJVFG\GPVTKGTVIWVGUUGJTUEJÌP



'ZGORNCTFGT5COONWPI&T#8QKTQN

7376

1,5:1

7377

1,5:1



“UPCEJX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT0CEMVGT4GKVGTT50)%QR  )TÒPDTCWPG2CVKPCUGJTUEJÌP





“U PCEJ  X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T.ÌYG N \GTMPKEMV 5RGGT 50) %QR    XGTINHH )TÒPG2CVKPCXQT\ÒINKEJ



1,5:1

7378

1,5:1

7379



&GOGVTKQU 2QNKQTMGVGU  X %JT “U  X %JT 6CTUQU  I #VJGPCMQRH T OKV   MQTKPVJKUEJGO*GNO2TQTCT0GYGNNXGTIN &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





2JKNKRRQU8X%JT“UI-QRHFGU*GTQU2GTUGWUTOKVIGHNÒIGNVGO)TGKHGPJGNO #FNGTUVGJVNCWH2HNWI-QRHT#/0)50)%QR &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



1,5:1



7380

1,5:1

“UI*GTCMNGUMQRHKO.ÌYGPHGNNT4GKVGTT#/0)XGTINHH50)%QR  &WPMNG2CVKPCXQT\ÒINKEJ

 65


GRIECHEN • THESSALIA

7381

7383

7382

1,5:1

1,5:1



“UI2QUGKFQPMQRHT#VJGPCUVGJVTOKV5RGGTWPF5EJKNF#/0)50)%QR  &WPMGNITÒPG2CVKPCUGJTUEJÌP



2GTUGWU  X %JT “U  I -QRH FGU *GTQU 2GTUGWU T OKV )TGKHGPJGNO T *CTRC#FNGT   UVGJVNCWH$NKV\-QRHT#/0) )TÒPG2CVKPCHCUVXQT\ÒINKEJ





“U  I -QRH FGU *GTQU 2GTUGWU T OKV )TGKHGPJGNO ÒDGT FGT 5EJWNVGT *CTRC#FNGT UVGJV N CWH   $NKV\-QRHTWPVGP5VGTP#/0)50)%QR &WPMNG2CVKPCXQT\ÒINKEJ





7384 1,5:1



1,5:1

#PQP[O “U  I 2QUGKFQPMQRH T ÒDGT FGT 5EJWNVGT &TGK\CEM+P -TCP\ -GWNG #/0)    50)%QR &WPMNG2CVKPCXQT\ÒINKEJ

7385 1,5:1

7385

7386

6*'55#.+#



7386 1,5:1



);4610“UX%JTI-QRHFGULWIGPFNKEJGP)[TVQPTFCXQT2HGTFGMQRHT-QRH FGT0[ORJG)[TVQPCT4QIGTU50)%QR 5GJTUEJÌP





“UX%JTI<GWUMQRHTOKV.QTDGGTMTCP\2HGTFIGJVT4QIGTU50)%QR 45GJTUEJÌP



7387

1,5:1

7387

7388

7388 1,5:1



-4#0010 “U  X %JT  I 4GKVGT N5VKGT UVÌ­V T FCTÒDGT &TGK\CEM 4QIGTU    50)%QR $TCWPG2CVKPCUGJTUEJÌP





“UX%JTI4GKVGTT*[FTKCCWH9CIGP4QIGTUXGTINHH50)%QRXGTIN &WPMNG2CVKPCUGJTUEJÌPHCUVUGJTUEJÌP



&KG *[FTKC CWH 9CIGP UVGJV HÒT FGP 9WPUEJ PCEJ 4GIGP $GK ITQ­GT 6TQEMGPJGKV YWTFG FGT 9CIGP FWTEJ FKG   5VTC­GPIG\QIGPWPFFCOKV<GWUWO4GIGPIGDGVGP

66


GRIECHEN • THESSALIA

7389 7390 1,5:1

1,5:1



.#/+#“UX%JTI-QRHFGT0[ORJG.COKCT2JKNQMVGVGUMPKGVDQIGPUEJKG­GPF T4QIGTU50)%QR $TCWPG2CVKPCUGJTUEJÌP



2JKNQMVGVGUYCTGKPGTFGT*GNFGPFGU6TQKCPKUEJGP-TKGIGUWPFDGHCPFUKEJKO$GUKV\FGU$QIGPUWPFFGT2HGKNGFGU *GTCMNGU



.#4+55# “U  X %JT  I 0[ORJGPMQRH HCUV X X4GKVGT T OKV .CP\G 4QIGTU    XGTIN50)%QRXGTIN 445GJTUEJÌPXQT\ÒINKEJ

7391

7393



7392

7394



“UX%JTI0[ORJGPMQRHT2HGTFITCUVT4QIGTU50)%QRXCT  5GJTUEJÌP





“UX%JTI0[ORJGPMQRHT2HGTFITCUVN4QIGTU50)%QRXGTIN  4&WPMNG2CVKPCUGJTUEJÌP





“UX%JTI0[ORJGPMQRHT2HGTFITCUVN4QIGTUXCT50)%QRXGTIN 4(CUVXQT\ÒINKEJ





“UX%JTI0[ORJGPMQRHN2HGTFITCUVT4QIGTU50)%QR



5GJTUEJÌP

7395

1,5:1

7396

1,5:1

1,5:1



/#)0'6'5“UX%JTI<GWUMQRHTOKV.QTDGGTMTCP\&GT-GPVCWT%JKTQPIGJV TOKV<YGKI4QIGTUC50)%QR $TCWPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP





2'44*#+$1+“UX%JTI*GTCMQRHHCUVXX<GWUUVGJVXXOKV$NKV\WPF<GR VGT4QIGTU50)%QR &WPMNG2CVKPCUGJTUEJÌP



1,5:1



7397

1,5:1

2*#.#00# “U  X %JT  I ,WIGPFNKEJGT -QRH FGU #TGU !  T-QRH FGT 0[ORJG   2JCNCPPCT4QIGTU50)%QRXGTIN &WPMNG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 67


GRIECHEN • EPIRUS

1,5:1



1,5:1

“UX%JTI,WIGPFNKEJGT-QRHFGU#TGU ! T-QRHFGT0[ORJG2JCNCPPCT4QIGTU 50)%QRXGTIN &WPMNG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

1,5:1



7398



7399 1,5:1

2*#45#.15“UX%JTI#VJGPCMQRHHCUVXXOKVMQTKPVJKUEJGO*GNO5RGGTWPF 5EJKNF#EJKNNGWUTGKVGVTPGDGPKJOIGJV2CVTQMNQUT.CXXC84 !   4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7402

7401

7400



.+)#X%JT“UI#RQNNQMQRHTOKV.QTDGGTMTCP\#VJGPC+VQPKCUVGJVTOKV5RGGT WPF5EJKNF4QIGTU 5GJTUEJÌP





“U/CIKUVTCV*KRRCVCUI-QRHFGT#VJGPG+VQPKCTOKVMQTKPVJKUEJGO*GNO2HGTFT4QIGTU 5GJTUEJÌP





“U/CIKUVTCV*KRRCVCUI-QRHFGT#VJGPG+VQPKCTOKVMQTKPVJKUEJGO*GNO2HGTFT4QIGTU 5GJTUEJÌP



1,5:1

7403

1,5:1

'2+475 

/1.1551+“UX%JTI4WPFUEJKNFFCTCWH$NKV\+P-TCP\$NKV\(TCPMGHH  )TÒPG2CVKPC4GXGTUNGKEJVFG\GPVTKGTVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

1,5:1

 68

7404

1,5:1

“UX%JTI4WPFUEJKNFFCTCWH$NKV\+P-TCP\$NKV\(TCPMGHH  1NKXITÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • CORCYRA

7405

7406

1,5:1

1,5:1

1,5:1

%14%;4# 

%14%;4# “U  X %JT  I &KQP[UQUMQRH T OKV 'HGWMTCP\-CPVJCTQU $/%    50)%QR &WPMNG2CVKPCIWVGUUGJTUEJÌP





“UX%JT/CIKUVTCV2JKNQPKFCUI2QUGKFQPMQRHTOKV.QTDGGTMTCP\ÒDGTFGT5EJWNVGT &TGK\CEM2TQTCT$/%50)%QR &WPMNG2CVKPCUGJTUEJÌP



7407

1,5:1

1,5:1

#%#40#0+# 

1+0+#&#+ “U  X %JT  I <GWUMQRH T-QRH FGU (NW­IQVVGU #EJGNQQU T FCTÒDGT   &TGK\CEM$/% $TCWPG2CVKPCUGJTUEJÌP

7409

7408

1,5:1

1,5:1

1,5:1



1,5:1

$1'16+# 

-1+010 “U  X %JT  I $QKQVKUEJGT 5EJKNF&TGK\CEM T &GNRJKP WPVGP T WPFGWVNK   EJGU$GK\GKEJGP5NI$%&XGTINHH )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



'7$1'# 

%*#.-+5 “U  X %JT  I *GTCMQRH X X OKV &KCFGO#FNGT T OKV 5EJNCPIG FCXQT   $NKV\2KECTF'O5NI$%&XGTIN 5GJTUEJÌPHCUVUGJTUEJÌP

7410

1,5:1





7411

1,5:1

1,5:1

1,5:1

.+)#“UX%JTI8GTUEJNGKGTVGTYGKDNKEJGT-QRHHCUVXX2TQTCT5NI$%& 9CNNCEG5 $TCWPG2CVKPCUEJÌPpUGJTUEJÌP



#66+%# 

#6*'0“UX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO+P1NKXGPMTCP\'WNG UVGJVN-TQNN9CNMGT $TCWPG2CVKPCUGJTUEJÌP

 69


GRIECHEN • MEGARIS

7412

7413

1,5:1

1,5:1

1,5:1

1,5:1



“U  X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO'WNG UVGJV T T JTG   -TQNN9CNMGT &WPMNG2CVKPCUGJTUEJÌP





'.'75+5 “U WO  X %JT  I 6TKRVQNGOQU N KP 5EJNCPIGPDKIC5EJYGKP UVGJV T CWH   5VCDKO#DUEJPKVV+PUGMV-TQNN9CNMGT )TÒPGWPTGIGNO·­KIG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

7414

7415

1,5:1

1,5:1

1,5:1

1,5:1

/')#4+5 

/')#4# “U X%JTI2TQTCNFCTCWH&TGKHW­QDGP&TGK\CEMN<YGK&GNRJKPG KP2GTNMTGKU-TQNN9CNMGT )TÒPG2CVKPCNGKEJVDGCTDGKVGVUGJTUEJÌP



#')+0# 

#')+0#“UX%JTI#WOJGTFTGK&GNRJKPG(ÒPHHCEJIGVGKNVGU+PEWUWO/KNDCPM 2N+850)%QR50)&GNGRKGTTG 4$TCWPG2CVKPCUGJTUEJÌP



7417 1,5:1

7416

1,5:1

1,5:1

1,5:1

2'.12100'575 

5+%;10+# 5+-;10 “6TKEJCNMQP  X %JT  I 6CWDG T+P 1NKXGPMTCP\ &TGKHW­   $/%XCT5NI$%& 44(CUVXQT\ÒINKEJ





'.+5-'2*#..'0+#2#.'“UWOX%JTI*GTOGUMQRHNOKV2GVCUQU-GT[MGKQP $/%50)%QR5NI$%& 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP



7419

7418

1,5:1



 70

1,5:1

1,5:1

/'55'0+#/'55'0'“6TKEJCNMQPX%JTI/CIKUVTCV0KMCTEJQUI#UMNG RKQUMQRHTOKV.QTDGGTMTCP\5EJNCPIGPUVCD$/%5NI$%&#PO50)%QR  44)TÒPG2CVKPCIWVGUUGJTUEJÌP



#4)1.+5'2+&#7415“6GVTCEJCNMQPUR·VGU,CJTJWPFGTVX%JTI#UMNGRKQUMQRHTOKV .QTDGGTMTCP\'RKQPGUVGJVNOKV)CPU$/%5NI$%& $TCWPG2CVKPCUGJTUEJÌP




GRIECHEN • CRETA

7421

7420

1,5:1

1,5:1

1,5:1

1,5:1

%4'6# 

-;&10+#“U,CJTJWPFGTVX%JTI-QRHT*WPFUKV\VT5XQTQPQU

5GJTUEJÌP



4'6*;/010 “U  ,CJTJWPFGTV X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO&TGK   \CEM5XQTQPQUXGTIN2N::+: (CUVUGJTUEJÌP

-[FQPKCKUVFKG*GKOCVFGT3WKVVGPFKGFGUJCNDM[FQPKUEJGRHGNJKG­GP

 

&GT5VKNFGU&TGK\CEMUYGKEJVXQPFGPDGK5XQTQPQUCDIGDKNFGVGP5VÒEMGPCDFKG<WYGKUWPIKUVPKEJVIGUKEJGTV

7423

7422

$1521475 

-¤0+)4'+%* 5CWTQOCVGU +  “U   I &TCRKGTVG $ÒUVG T OKV &KCFGO0KMG   IGJVNOKV-TCP\WPF2CNO\YGKI(TQNQXC)TWRRG8+ $TCWPG2CVKPCHCUVUGJTUEJÌP





“U   I %WTWNKUEJGT 5VWJN FCTCWH -TCP\ N 5RGGT WPF 5EJKNF T <GRVGT/* KP -TCP\   (TQNQXCXGTIN2N8+++ &WPMNG2CVKPCHCUVUGJTUEJÌP



7425 7424

1,5:1

1,5:1

210675 

70$'56+//6' /ª0<5666' “U  X %JT  I -QRH N OKV .GFGTMCRRG5VGTP   FCPGDGP$QIGP50)$/XGTINHH (CUVXQT\ÒINKEJ



&KG/ÒP\UV·VVGKUVOÌINKEJGTYGKUG#OKUQU



“UX%JTI$QIGPKP$QIGPVCUEJG5VGTP$CNFYKPXGTIN FQTVOKV)GIGPUVGORGN  50)$/ 8QPITQ­GT5GNVGPJGKV&WPMNG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\<GPVTWO-ÌNP0T  &KG/ÒP\UV·VVGKUVOÌINKEJGTYGKUG#OKUQU.CWV-8)QNGPMQ 2QPVKLUMCLCCPQPKOPCLCOGFKP8GUVPKMFTGXPGL KUVQTKK  5 JCPFGNVGUUKEJYCJTUEJGKPNKEJWOGKP&KEJCNMQP$GKFGOXQP)QNGPMQRWDNK\KGTVGP 5VÒEM )TWRRG& YCTFGT$QIGPCWHFGO#XGTUPKEJVUKEJVDCT

7426

1,5:1

1,5:1

7427

7427 1,5:1



#/+575 “U  X %JT  I )GHNÒIGNVGT -QRH T(ÒNNJQTP \YKUEJGP 5VGTPGP WPF 2KNGK   50)$/ &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





“UX%JTI#TGUMQRHTOKV*GNO5EJYGTVKP5EJGKFG50)$/



5GJTUEJÌP

71


GRIECHEN • PONTUS

7429

7428





“UX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO2GTUGWUUVGJVXXOKV*CTRCWPFFGO -QRHFGT/GFWUC\WUGKPGP(Ò­GPFGTGP-ÌTRGT50)$/  $TCWPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



“UX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO2GTUGWUUVGJVXXOKV*CTRCWPFFGO -QRHFGT/GFWUC\WUGKPGP(Ò­GPFGTGP-ÌTRGT50)$/ $TCWPG2CVKPCUGJTUEJÌP



7431

7430



“UX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO2GTUGWUUVGJVXXOKV*CTRCWPFFGO -QRHFGT/GFWUC\WUGKPGP(Ò­GPFGTGP-ÌTRGT50)$/ $TCWPG2CVKPCUGJTUEJÌP



“UX%JTI#GIKU0KMGIGJVTOKV2CNO\YGKI50)$/HH  $TCWPG2CVKPCUGJTUEJÌP

7432

 

7434

7433

1,5:1

1,5:1



“U  X %JT  I -QRH FGU /KVJTCFCVGU 8+ CNU &KQP[UQU T OKV 'HGWMTCP\%KUVC O[UVKEC   FCTCWH2CPVJGTHGNNN6J[TUQU50)$/ )TÒPG2CVKPCXQT\ÒINKEJHCUVXQT\ÒINKEJ





“U  X %JT  I -QRH FGU /KVJTCFCVGU 8+ CNU &KQP[UQU T OKV 'HGWMTCP\%KUVC O[UVKEC   FCTCWH2CPVJGTHGNNN6J[TUQU50)$/ &WPMNG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT





“UX%JTI<GWUMQRHTOKV.QTDGGTMTCP\#FNGTCWH$NKV\N50)$/  $TCWPG2CVKPCXQT\ÒINKEJ

7435

1,5:1



7436

1,5:1

1,5:1

1,5:1



“UX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT.ÌYGPHGNNÒDGT-GWNG50)$/XGTIN (CUVXQT\ÒINKEJXQT\ÒINKEJ





%*#$#-6# “U  X %JT  I #TGUMQRH T OKV *GNO5EJYGTVKP5EJGKFGN5VGTPÒDGT *CNDOQPF50)$/ $TCWPG2CVKPCUGJTUEJÌP



72


GRIECHEN • PAPHLAGONIA

7437



7438

2*#40#-'+# “U  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\#FNGT CWH $NKV\ N 50)   $/ $TCWPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



“UX%JTI<GWUMQRHTOKV.QTDGGTMTCP\#FNGTCWH$NKV\N50)$/XGTIN  $TCWPG2CVKPC4GXGTUFG\GPVTKGTVHCUVXQT\ÒINKEJUGJTUEJÌP



7440

7439

1,5:1

1,5:1

1,5:1

1,5:1

2#2*.#)10+# 

5+012' “U  X %JT  I )GHNÒIGNVGT -QRH T(ÒNNJQTP \YKUEJGP 5VGTPGP WPF 2KNGK   50)$/ )TÒPG2CVKPCUGJTUEJÌP





“UX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\&TGKHW­50)$/50)X#WNQEM &WPMNG2CVKPCUGJTUEJÌP



7441

1,5:1

1,5:1



“UX%JTI<GWUMQRHTOKV.QTDGGTMTCP\#FNGTUVGJVNCWH$NKV\-QRHT50)$/ $TCWPG2CVKPCXQT\ÒINKEJp5VGORGNINCP\

7442

1,5:1



1,5:1

-¤0+)4'+%* 2[NCKOGPGU WO  X %JT “U  I 5VKGTMQRH X X)GHNÒIGNVGU -GT[MGKQP   50)$/ &WPMNG2CVKPCUGJTUEJÌP

7443

1,5:1





7444

1,5:1

1,5:1

1,5:1

$+6*;0+# 

-+15“UX%JTI-QRHFGU/KVJTCUKP6KCTCTOKV.QTDGGTMTCP\#ORJQTGFCTKP <YGKIGOKV9GKPVTCWDGP50)%QR9CFFKPIVQP4GEIGP )TÒPG2CVKPCXQT\ÒINKEJ





“UX%JTI-QRHFGU/KVJTCUKP6KCTCTOKV.QTDGGTMTCP\#ORJQTGFCTKP<YGKIG OKV9GKPVTCWDGP50)%QR9CFFKPIVQP4GEIGP 5GJTUEJÌPpXQT\ÒINKEJ

 73


GRIECHEN • BITHYNIA

7445

1,5:1



1,5:1

-¤0+)4'+%* 2TWUKCU +  X %JT “U  I #RQNNQMQRH N OKV .QTDGGTMTCP\#VJGPC   0KMGUVGJVNOKV-TCP\WPF5EJKNF9CFFKPIVQP4GEIGP &WPMNG2CVKPCXQT\ÒINKEJ

7446

7447

1,5:1





1,5:1

1,5:1

1,5:1

“UI#RQNNQMQRHTOKV.QTDGGTMTCP\.[TC9CFFKPIVQP4GEIGP  $TCWPG2CVKPCUGJTUEJÌP



&KG<WYGKUWPIKUVPKEJVIGUKEJGTVOÌINKEJGTYGKUGYWTFGFCU5VÒEMWPVGT2TWUKCU++IGRT·IV



2TWUKCU++X%JT“UI-QRHTOKVIGHNÒIGNVGO&KCFGO*GTCMNGUUVGJVNOKV-GWNG WPF.ÌYGPHGNN9CFFKPIVQP4GEIGP )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI/CWTKEG.CHHCKNNG#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN

7448

7449

1,5:1

1,5:1

1,5:1

1,5:1



“UI-QRHTOKVIGHNÒIGNVGO&KCFGO*GTCMNGUUVGJVNOKV-GWNGWPF.ÌYGPHGNN9CFFKPIVQP 4GEIGP $TCWPG2CVKPCXQT\ÒINKEJ





“UI&KQP[UQUMQRHTOKV'HGWMTCP\-GPVCWT%JKTQPTOKV.[TC9CFFKPIVQP4GEIGP  )N·P\GPFG2CVKPCXQT\ÒINKEJp5VGORGNINCP\





“UI&KQP[UQUMQRHTOKV'HGWMTCP\-GPVCWT%JKTQPTOKV.[TC9CFFKPIVQP4GEIGP  $TCWPG2CVKPCXQT\ÒINKEJ





“UI&KQP[UQUMQRHTOKV'HGWMTCP\-GPVCWT%JKTQPTOKV.[TC9CFFKPIVQP4GEIGP  &WPMNG2CVKPCUGJTUEJÌP



7450

74

7451


GRIECHEN • MYSIA

7452

1,5:1



1,5:1

“UI&KQP[UQUMQRHTOKV'HGWMTCP\-GPVCWT%JKTQPTOKV.[TC9CFFKPIVQP4GEIGP  $TCWPG2CVKPCUGJTUEJÌP

7453

1,5:1



1,5:1

“UI#FNGTUVGJVT$NKV\9CFFKPIVQP4GEIGP QJPGFKGUGU/QPQITCOO   &WPMGNITÒPG2CVKPCXQT\ÒINKEJ

7454

1,5:1





7455

1,5:1

1,5:1

1,5:1

/;5+# 

#&4#/;66'+10 “U WO  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\2GICUWURTQVQOG T   X(TKV\GKP0QOKUOC8 8QT\ÒINKEJ





“UWOX%JTI<GWUMQRHTOKV.QTDGGTMTCP\2GICUWURTQVQOGTX(TKV\GKP0QOKUOC8 5GJTUEJÌPpXQT\ÒINKEJ



7457

7456

1,5:1

1,5:1

1,5:1

1,5:1



“U WO  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\2GICUWURTQVQOG T FCTWPVGT JTG X   (TKV\GKP0QOKUOC8 8QT\ÒINKEJ





“U WO  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\2GICUWURTQVQOG T FCTWPVGT JTG X   (TKV\GKP0QOKUOC8 5GJTUEJÌPpXQT\ÒINKEJ



7459

7458

1,5:1

1,5:1

1,5:1

1,5:1



“U WO  X %JT  I <GWUMQRH X X OKV .QTDGGTMTCP\#FNGT UVGJV N CWH #NVCT X (TKV\G KP   0QOKUOC8 8QT\ÒINKEJ





“U WO  X %JT  I <GWUMQRH X X OKV .QTDGGTMTCP\#FNGT UVGJV N CWH #NVCT X (TKV\G KP   0QOKUOC8 5GJTUEJÌPUEJÌP

 75


GRIECHEN • MYSIA

7460

7461 1,5:1

1,5:1

1,5:1

1,5:1



“UWOX%JTI<GWUMQRHXXOKV.QTDGGTMTCP\#FNGTUVGJVNCWHTWPFGO)GIGPUVCPF NJTGX(TKV\GKP0QOKUOC8 5GJTUEJÌP





“U,CJTJWPFGTVX%JTI&TCRKGTVG$ÒUVGFGT#VJGPCTOKVMQTKPVJKUEJGO*GNO'WNGUVGJV TOKVIGUEJNQUUGPGP(NÒIGNPX(TKV\GKP0QOKUOC8 5GJTUEJÌP



7463

7462

1,5:1



1,5:1

1,5:1

1,5:1

#56;4#6KUUCRJGTPGU5CVTCRWOX%JT“UX%JTI-QRHT-WNVDKNFFGT #TVGOKU#UV[TGPGXX-NGKP 4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



6KUUCRJGTPGU URKGNVG GKPG DGFGWVGPFG 4QNNG KP FGT RGTUKUEJGP 2QNKVKM 5GKP CW­GPRQNKVKUEJGT 'KPHNW­ JCV \ $ PKEJV   WPYGUGPVNKEJG#WUYKTMWPIGPCWHFGP#WUICPIFGURGNQRQPPGUKUEJGP-TKGIGUIGJCDV+O-TKGIFGU#TVCZGTZGUIGIGP FGP2TKP\GP-[TQUYCT6KUUCRJGTPGUGKPGTFGTXKGT(GNFJGTTGPFGU#TVCZGTZGUWPFJCV\WFGUUGP5KGIKPFGT5EJNCEJV DGK-WPCZCGPVUEJGKFGPFDGKIGVTCIGP :GPQRJQP#PCDCUKU+H X%JTYWTFG6KUUCRJGTPGUJKPIGTKEJVGV YQJNXQTCNNGOYGIGPUGKPGT0KGFGTNCIGPIGIGPFCUURCTVCPKUEJG*GGTFGU#IGUKNCQUKP-NGKPCUKGP



“UX%JTI-QRHT-WNVDKNFFGT#TVGOKU#UV[TGPGXX-NGKP  4&WPMNG2CVKPCMN5EJTÌVNKPIUHGJNGTCWHFGO4GXGTUXQT\ÒINKEJ

7465

7464

1,5:1



1,5:1

1,5:1

1,5:1



“UX%JTI-QRHT-WNVDKNFFGT#TVGOKU#UV[TGPGXX-NGKP  4&WPMNG2CVKPCHCUVXQT\ÒINKEJ





“UX%JTI-QRHT-WNVDKNFFGT#TVGOKU#UV[TGPGXX-NGKP  4)TÒPG2CVKPCUGJTUEJÌP



7467

7466 1,5:1

1,5:1

1,5:1

1,5:1



“UX%JTWPDGUVKOOVGMNGKPCUKCVKUEJG/ÒP\UV·VVGI#VJGPCMQRHTKOCVVKUEJGP*GNO 4GKVGTTOKV5RGGT-NGKP 48QT\ÒINKEJ





“UX%JTWPDGUVKOOVGMNGKPCUKCVKUEJG/ÒP\UV·VVGI#VJGPCMQRHTKOCVVKUEJGP*GNO 4GKVGTTOKV5RGGT-NGKP 4&WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7468 1,5:1

7469 1,5:1

1,5:1



#56;4#“U,CJTJWPFGTVX%JTI#RJTQFKVGMQRHT#ORJQTG$/% %CTKC XGTIN  (CUVXQT\ÒINKEJ



#6#40'75 “U WO  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\2HGTFGRTQVQOG T X   (TKV\G&KGCPVKMGP/ÒP\GP/[UKGPU &WPMNG2CVKPCXQT\ÒINKEJ

76

1,5:1

 


GRIECHEN • MYSIA

7470 1,5:1

7471

1,5:1

1,5:1

1,5:1



)#/$4'+10“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\<YÌNHUVTCJNKIGT 5VGTPX(TKV\G&KGCPVKMGP/ÒP\GP/[UKGPU50)(TCPEG (CUVXQT\ÒINKEJ





“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\5VKGTUVÌ­VNX(TKV\G&KGCPVK MGP/ÒP\GP/[UKGPU50)(TCPEG 5GJTUEJÌP



7472 1,5:1

7473

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\&TGKHW­ X (TKV\G &KG CPVKMGP   /ÒP\GP/[UKGPU50)(TCPEGXGTINHH 8QT\ÒINKEJ





*#42#)+10“UWOX%JTI0[ORJGPMQRH ! T(KUEJTFCTWPVGTJTGX(TKV\G &KGCPVKMGP/ÒP\GP/[UKGPU 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP



7475

7474

1,5:1

1,5:1

1,5:1

1,5:1



+1..#“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV.QTDGGTMTCP\2GICUQURTQVQOGTWPVGP JTG50)(TCPEG $TCWPG2CVKPCXQT\ÒINKEJ





-;<+-15“U,CJTJWPFGTVX%JTI5VKGTMQRHT+P-TCP\'VJPKMQPWPF/QPQITCOO X(TKV\G)TWRRG+++XGTIN 4&WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7476

7477



“U,CJTJWPFGTVX%JTI5VKGTUVÌ­VT(CEMGNX(TKV\G)TWRRG+++  &WPMNG2CVKPCUGJTUEJÌP



“U,CJTJWPFGTVX%JTI-QTGMQRHTOKV'KEJGPMTCP\&TGKHW­X(TKV\G)TWRRG+++ 1NKXITÒPG2CVKPCXQT\ÒINKEJ

 

7479

7478

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI-QTGMQRHTOKV'KEJGPMTCP\&TGKHW­X(TKV\G)TWRRG+++ &WPMNG2CVKPCHCUVUGJTUEJÌP





.#/25#-15“U,CJTJWPFGTVX%JTI,CPWUHÌTOKIGT(TCWGPMQRH#VJGPCMQRHTOKV MQTKPVJKUEJGO*GNO50)%QRXCT 448QT\ÒINKEJ

 77


GRIECHEN • MYSIA

7480

1,5:1

1,5:1



/+.'6121.+5“U,CJTJWPFGTVX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO'WNGXX D\Y\YGK'WNGPOKVGKPGO-QRH50)X#WNQEMXGTIN 4&WPMNG2CVKPCUGJTUEJÌP

7481

1,5:1

1,5:1





2#4+10“U,CJTJWPFGTVX%JTI#NVCTXQP2CTKQPFCTCWH$WMTCPKQPWPVGP6J[TUQU -TCP\50)X#WNQEMXCT50)%QR )TÒPG2CVKPCUGJTUEJÌP



&GT#XGTUUVGNNVRTCEJVXQNNGP#NVCTFCTFGTXQPFGO#TEJKVGMVGP*GTOQMTGQPPCEJFGTªDGTHÒJTWPIFGU*GKNKIVWOU FGU#RQNNQP#MVCKQUXQP#FTCUVGKCPCEJ2CTKQPGTTKEJVGVYQTFGPYCT

7483

7482 1,5:1

1,5:1

1,5:1

1,5:1



2'4)#/105VCFV“UWOX%JTI#VJGPCMQRHTOKV*GNO.QTDGGTCNU*GNOUEJOWEM <YGK5VKGTRTQVQOGGKPCPFGTIGIGPÒDGT50)(TCPEG 448QT\ÒINKEJ





“U  X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T#VJGPCMQRH T OKV CVVKUEJGO *GNO   50)(TCPEG 2TCEJVGZGORNCTOKVIN·P\GPFGTFWPMGNITÒPGT2CVKPCXQT\ÒINKEJ



7484

7485

1,5:1

1,5:1

1,5:1

1,5:1



“U  X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T#VJGPCMQRH T OKV CVVKUEJGO *GNO   50)(TCPEG &WPMNG2CVKPCIWV\GPVTKGTVGUXQT\ÒINKEJGU'ZGORNCT





“U  X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T#VJGPCMQRH T OKV CVVKUEJGO *GNO   50)(TCPEG 8QT\ÒINKEJ



7486 1,5:1

7487 1,5:1



“U  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO<YGK 5VGTPG 50) %QR  50)   (TCPEG &WPMNG2CVKPCXQT\ÒINKEJ





“UPCEJX%JTI#UMNGRKQUMQRHTOKV.QTDGGTMTCP\5EJNCPIGPUVCD50)(TCPEGHH )TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP



&KG <WYGKUWPI FGT 5VÒEMG OKV #UMNGRKQUMQRH5EJNCPIGPUVCD PCEJ 2GTICOQP KUV PKEJV IGUKEJGTV /ÌINKEJGTYGKUG   IGJÌTGPFKG5VÒEMGCWEJPCEJ#PVKQEJKCKP5[TKGPUKGJG-GXKP$WVEJGT%QKPCIGKP4QOCP5[TKC.QPFQP5 

78


GRIECHEN • MYSIA

7488

7489

1,5:1

1,5:1

1,5:1

1,5:1



“UPCEJX%JTI#UMNGRKQUMQRHTOKV.QTDGGTMTCP\5EJNCPIGPUVCD50)(TCPEGHH )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



“UPCEJX%JTI#UMNGRKQUMQRHN5EJNCPIGPUVCD50)(TCPEG  4&WPMNG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



7491

7490

1,5:1

1,5:1



“UPCEJX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO6TQRJ·G50)(TCPEGHH &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



“UPCEJX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO6TQRJ·G50)(TCPEGXGTIN &WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7492





1,5:1

1,5:1

“UPCEJX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO6TQRJ·G50)(TCPEG  &WPMNG2CVKPCXQT\ÒINKEJ



“UPCEJX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO6TQRJ·G50)(TCPEG  &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T





7493

1,5:1

1,5:1



7494

1,5:1

7495

1,5:1



“UPCEJX%JTI#VJGPCMQRHTOKV*GNO'WNGCWH2CNO\YGKIXX50)(TCPEGHH )TÒPG2CVKPCUGJTUEJÌP





“U   I &TCRKGTVG LWIGPFNKEJG 5GPCVUDÒUVG T&TCRKGTVG $ÒUVG FGT 4QOC T OKV /CWGT   MTQPG42% )TÒPDTCWPG2CVKPCXQT\ÒINKEJ

 79


GRIECHEN • TROAS

7496

1,5:1



-ÌPKITGKEJ “U  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO#UMNGRKQU UKV\V N WPF   HÒVVGTV5EJNCPIG50)(TCPEGHH )TÒPG2CVKPCXQT\ÒINKEJ

7497

1,5:1



1,5:1

1,5:1

“UX%JTI#VJGPCMQRHTOKV*GNO5EJNCPIGT50)(TCPEG  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7499

7498

1,5:1

1,5:1

1,5:1

1,5:1





“UX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO$QIGP50)(TCPEGHH  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





2.#-+#“U,CJTJWPFGTVX%JTI-[DGNGMQRHTOKV/CWGTMTQPG.ÌYGTHTK­VCPUGKPGT $GWVGFCTWPVGTJTG50)(TCPEG &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



7501

7500

1,5:1

1,5:1

1,5:1

1,5:1



24+#215 “U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH HCUV X X OKV .QTDGGTMTCP\)CTPGNG   50)%QR50)(TCPEG50)X#WNQEM 4&WPMGNITÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





6*'$' “U  ,CJTJWPFGTV X %JT  I 9GKDNKEJGT -QRH T OKV 5CMMQU6TKUMGNKU   50)(TCPEG 8QT\ÒINKEJ



7502 1,5:1

1,5:1

641#5  80

#.':#0&4+#“U,CJTJWPFGTVP%JTI&TCRKGTVG$ÒUVGFGT6[EJGTOKV/CWGTMTQPG 2HGTFYGKFGVT$GNNKPIGT6TQ[# &WPMGNITÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • TROAS

7504

7503

1,5:1

1,5:1

1,5:1

1,5:1



#06#0&415 “U  X %JT  I -QRH FGT #TVGOKU #UV[TGPG T.ÌYGPMQRH T WPVGP   9GKPVTCWDG50)%QR50)X#WNQEM &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





“U  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\.ÌYGPMQRH T 50) %QR XGTIN    50)X#WNQEMXGTIN &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



7505

7506

1,5:1

1,5:1



#5515 “U  ,CJTJWPFGTV X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO$WMTCPKQP   50)%QR50)X#WNQEM &WPMNG2CVKPCUGJTUEJÌP





$+4;6+5“UWOX%JTI-QRHGKPGU-CDKTGPNOKV2KNGWUQDGPNWPFTLGGKP5VGTP -GWNGKP-TCP\50)%QR50)X#WNQEM )TÒPG2CVKPCHCUVXQT\ÒINKEJ



7508

7507

1,5:1

1,5:1

1,5:1

1,5:1



“U WO  X %JT  I -QRH GKPGU -CDKTGP N OKV 2KNGWU-GWNG KP -TCP\ 50) %QR    50)X#WNQEM )TÒPG2CVKPCHCUVXQT\ÒINKEJ





&#4&#015 “U  ,CJTJWPFGTV X %JT  I 4GKVGT T*CJP T FCTÒDGT #VJGPC 2TQOCEJQU   50)%QR50)X#WNQEM )TÒPG2CVKPCUGJTUEJÌP



7509 1,5:1

7510 1,5:1

1,5:1

1,5:1



)#4)#4# “U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\9KFFGTMQRH N   50)%QR50)X#WNQEMXGTIN 4GXGTU9KFFGTMQRHT  )TÒPG2CVKPCUGJTUEJÌP





“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\2HGTFURTKPIVT50)%QR 50)X#WNQEM 8QT\ÒINKEJ



7511 1,5:1

7512 1,5:1

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\2HGTFURTKPIVT50)%QR 50)X#WNQEM 8QT\ÒINKEJ





“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\2HGTFURTKPIVTFCTWPVGT*CND OQPF50)%QRXGTINHH50)X#WNQEMXGTIN )TÒPG2CVKPCHCUVXQT\ÒINKEJ

 81


GRIECHEN • TROAS

7513

7514

1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\2HGTF URTKPIV T WPVGP 9GKP   VTCWDG50)%QR50)X#WNQEM 8QT\ÒINKEJ





)'4)+5 “U  X %JT  I -QRH FGT 5KD[NNG *GTQRJKNG HCUV X X5RJKPZ UKV\V T   50)%QR50)X#WNQEM .GKEJVFG\GPVTKGTVHCUVXQT\ÒINKEJ



7515

1,5:1



“U  X %JT  I -QRH FGT 5KD[NNG *GTQRJKNG HCUV X X5RJKPZ UKV\V T 50) %QR    50)X#WNQEM (CUVXQT\ÒINKEJ

7516

1,5:1



1,5:1



1,5:1

-'$4'0“U,CJTJWPFGTVX%JTI9KFFGTMQRHTFCTWPVGTJTG#RQNNQMQRHT\YKUEJGP -'50)%QR50)X#WNQEM 4)TÒPG2CVKPCHCUVXQT\ÒINKEJ

7517



7518

1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT  I 9KFFGTMQRH T#RQNNQMQRH T \YKUEJGP =-?' 50) %QR    50)X#WNQEM &WPMNG2CVKPCHCUVXQT\ÒINKEJ





“U,CJTJWPFGTVX%JTI9KFFGTMQRHTFCTWPVGT-#RQNNQMQRHT50)%QR50)X #WNQEM )TÒPG2CVKPCXQT\ÒINKEJ



7519

1,5:1



.#4+55# “U  ,CJTJWPFGTV X %JT  I $·TVKIGT -QRH T#ORJQTG T )GTUVGPMQTP $/%   

.CTKUUC2JTKEQPKU#GQNKU 4QDGTV'VWFGUFGPWOKUOCVKSWGITGESWG2N  44$TCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

1,5:1

 82

1,5:1

7520



1,5:1

0'#0&4'+# “U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\)GTUVGPMQTP   50)%QR50)X#WNQEM 5GJTUEJÌPpXQT\ÒINKEJ




GRIECHEN • AEOLIS

7521

7522



1,5:1

1,5:1

1,5:1

1,5:1

12*4;0+10“UX%JTI-QRHFGU*GMVQT ! HCUVXXOKV*GNO&CU&KQP[UQU MKPFMPKGVTOKV9GKPVTCWDG50)%QR50)X#WNQEM 4&WPMNG2CVKPCUGJTUEJÌP



&KGCNVG5VCFV1RJT[PKQPYWTFGOKVFGOVTQKCPKUEJGP-TKGIWPFDGUQPFGTUOKV*GMVQTFGTFQTVDGITCDGPUGKPUQNN KP8GTDKPFWPIIGDTCEJV&CJGTKUVFKG&GWVWPIFGU-TKGIGTMQRHGUCWHFGO#XGTUCNU*GMVQTPKEJVWPYCJTUEJGKPNKEJ



5-'25+5“U,CJTJWPFGTVX%JTI2GICUWURTQVQOGN(ÌJTGKP3WCFTCV50)%QR &WPMNG2CVKPCUVGORGNIN·P\GPFGU2TCEJVGZGORNCT



“U,CJTJWPFGTVX%JTI2GICUWURTQVQOGN(ÌJTGKP3WCFTCV50)%QR

7523

1,5:1

1,5:1

8QT\ÒINKEJ



7524

1,5:1





#'1.+5

1,5:1

#+)#+“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\<KGIGPMQRHT50)%QR 50)X#WNQEM &WPMNG2CVKPCXQT\ÒINKEJUGJTUEJÌP



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

1,5:1

7525

1,5:1

7526



'.#+# “U PCEJ  X %JT  I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNOJTG KP -TCP\   50)%QR50)X#WNQEM &WPMNG2CVKPCNGKEJVFG\GPVTKGTVUGJTUEJÌP





“U,CJTJWPFGTVX%JTI&GOGVGTMQRHTOKVJTGPMTCP\+P-TCP\(CEMGN50)%QR 50)X#WNQEM )TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP



1,5:1

7527

7528

1,5:1



“U,CJTJWPFGTVP%JTI$ÒUVGFGT#VJGPCTOKV*GNOWPF#GIKU-CNCVJQUOKV/QJPMW IGNP50)%QRXCT50)X#WNQEM &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





-;/'“U,CJTJWPFGTVX%JTI#FNGTUVGJVT\YKUEJGP'S5M[RJQU$/%50)%QR 50)X#WNQEM 4)TÒPG2CVKPCUGJTUEJÌP



1,5:1

7529

1,5:1

7530



“U,CJTJWPFGTVX%JTI#FNGTUVGJVT5M[RJQU$/%50)%QR50)X#WNQEM 4)TÒPGWPTGIGNO·­KIG2CVKPCHCUVXQT\ÒINKEJ





“UPCEJX%JT/CIKUVTCV<QKNQUI&TCRKGTVG$ÒUVGFGT#TVGOKUTÒDGTFGT5EJWNVGT-Ì EJGT5M[RJQU\YKUEJGP\YGK.QTDGGT\YGKIGP$/%50)%QR50)X#WNQEM  (CUVXQT\ÒINKEJ

 83


GRIECHEN • LESBOS

1,5:1

7531

7532

1,5:1



“U PCEJ  X %JT  I 2HGTFGRTQVQOG T$QIGP WPF -ÌEJGT $/%  50) %QR    50)X#WNQEM &WPMGNITÒPG2CVKPCUGJTUEJÌP





“UPCEJX%JTI#TVGOKUWPF-[OGUVGJGPGKPCPFGTIGIGPÒDGTWPFTGKEJGPUKEJFKG*CPF <YGK(KIWTGPKP3WCFTKICT$/%50)%QR50)X#WNQEM 5GJTUEJÌP



7533

1,5:1



1,5:1

.#4+55#2*4+-10+5“U,CJTJWPFGTVX%JTI-QRHGKPGU(NW­IQVVGUHCUVXX5VKGT MQRHT50)/ÒPEJGP 44)TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7535 1,5:1

7534

1,5:1

1,5:1

1,5:1



/;4+0#“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\#ORJQTGT.[TC $/%50)%QR50)X#WNQEM )TÒPG2CVKPCHCUVXQT\ÒINKEJ





0'106'+%*15“U,CJTJWPFGTVX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO'WNGUVGJVT -NGKP50)X#WNQEM 4&WPMGNITÒPG2CVKPCUGJTUEJÌP



1,5:1

7536

7537

1,5:1



6'/015“U,CJTJWPFGTVX%JTI&KQP[UQUMQRHTOKV'HGWMTCP\<YGKIOKV9GKPNCWD WPF9GKPVTCWDG50)%QR50)X#WNQEMXGTIN )TÒPG2CVKPCHCUVXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO-TKGIGT UVGJV T OKV   *GNO5EJKNFWPF.CP\G50)%QR50)X#WNQEM )TÒPG2CVKPCUGJTUEJÌP



1,5:1

1,5:1

7538

7539

.'5$15 

/;6+.'0'“UX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\-CNDUMQRHT$/%XGTIN 5GJTUEJÌP





“U,CJTJWPFGTVX%JTI-QRHFGU<GWU#OOQPTFCTCWHTWPFGT)GIGPUVGORGN-QRHFGU &KQP[UQU6GTOKPWUUVCVWGFGU&KQP[UQU$/% (CUVUGJTUEJÌP



1,5:1



7540

1,5:1

*'-#6100'51+ 0'515 “U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\   2CPVJGTIGJVN\WTÒEMDNKEMGPF$/%50)%QR50)X#WNQEM  448QT\ÒINKEJHCUVXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T  0CEJ5VTCDQP :+++ DGFGWVGV*GMCVQPPGUQK+PUGNPFGU*GMCVQUGKPGCPFGTG&GWVWPIKUV+PUGNP*GMCVQU KUVGKP$GKPCOGFGU#RQNNQPFGUUGP-QRHCWHFGO#XGTUWPUGTGU5VÒEMGUGTUEJGKPV

84




GRIECHEN • IONIA

7541 1,5:1

7542 1,5:1

1,5:1

1,5:1

+10+# 

5RKVJTKFCVGUŎX%JT5CVTCR“UWOX%JTI-QRHTOKV6KCTC2HGTFGRTQVQOGT -NGKP50)X#WNQEM 4)TÒPG2CVKPCIWVGUUGJTUEJÌP



5RKVJTKFCVGUHCPFKPFGT5EJNCEJVCO)TCPKMQUKO-CORHOKV#NGZCPFGTFGO)TQ­GPFGP6QF



“UWOX%JTI-QRHTOKV6KCTC2HGTFGRTQVQOGT-NGKP50)X#WNQEM  4)TÒPG2CVKPCGVYCUFG\GPVTKGTVUGJTUEJÌPpXQT\ÒINKEJ

7543

1,5:1







7544

1,5:1

1,5:1

1,5:1

70$'56+//6' /ª0<5666' 7PDGMCPPVGT 5CVTCR /GOPQP XQP 4JQFQU!  EC  X    %JT “U  X %JT  I )TQ­MÌPKI KO -PKGNCWH T OKV $QIGP WPF 5RGGT<YGK 3WCFTCVG   KPGKPCPFGT50)6ÒDKPIGP50)X#WNQEM &WPMNG2CVKPCXQT\ÒINKEJ



'2*'515 “U  ,CJTJWPFGTV X %JT /CIKUVTCV &GOQUVTCVQU  I $KGPG*KTUEJ MPKGV N \W   TÒEMDNKEMGPFQDGP#UVTCICN*GCF0%50)%QR (CUVXQT\ÒINKEJ



<WT &CVKGTWPI FGT 0TP    UKGJG -KPPU 6JG #VVKE 9GKIJV &TCEJOU QH'RJGUWU#2TGNKOKPCT[5VWF[KP VJG.KIJVQH4GEGPV*QCTFUKP0%5#PO

7545

7546 1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT /CIKUVTCV -QT[NCU  I $KGPG*KTUEJ MPKGV N \WTÒEMDNKEMGPF QDGP   #UVTCICN*GCF0%5 )N·P\GPFGITÒPG2CVKPC#XGTUNGKEJVFG\GPVTKGTVXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT /CIKUVTCV *GIGNQEJQU  I 9GKDNKEJGT -QRH N FCJKPVGT #UVTCICN   $KGPG*GCF0%5 45GJTUEJÌPpXQT\ÒINKEJ



7547 1,5:1

 

7548 1,5:1

1,5:1

“UWOX%JTI9GKDNKEJGT-QRHNOKV/CWGTMTQPG$KGPG$/% “UWOX%JTI9GKDNKEJGT-QRHNOKV/CWGTMTQPG$KGPG$/%

1,5:1

8QT\ÒINKEJ 8QT\ÒINKEJ

  85


GRIECHEN • IONIA

7549

1,5:1





7550

1,5:1

“UWOX%JT/CIKUVTCV#RQNNQFQTQUI$KGPG*KTUEJUVGJVTQDGP-ÌEJGT-KPPU6JG #VVKE9GKIJV&TCEJOUQH'RJGUWU#2TGNKOKPCT[5VWF[KPVJG.KIJVQH4GEGPV*QCTFUKP0% 6[RG# )TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP



“UWOX%JT/CIKUVTCV#RQNNQFQTQUI$KGPG*KTUEJUVGJVTQDGP-ÌEJGT-KPPU6JG #VVKE9GKIJV&TCEJOUQH'RJGUWU#2TGNKOKPCT[5VWF[KPVJG.KIJVQH4GEGPV*QCTFUKP0% 6[RG# )TÒPG2CVKPCUGJTUEJÌP



7552

7551





1,5:1

1,5:1

1,5:1

1,5:1

“U WO  X %JT  I /CIKUVTCV -C[UVTKQU  I $KGPG*KTUEJRTQVQOG T QDGP -ÌEJGT   -KPPU6JG#VVKE9GKIJV&TCEJOUQH'RJGUWU#2TGNKOKPCT[5VWF[KPVJG.KIJVQH4GEGPV*QCTFUKP 0%XGTIN6[RG$ 8QPITQ­GT5GNVGPJGKV5EJGKPVWPGFKGTV&WPMNG2CVKPCXQT\ÒINKEJ “UWOX%JT/CIKUVTCV*GTCKUMQUI$KGPG*KTUEJMQRHTFCJKPVGT-ÌEJGT  8QPITQ­GT5GNVGPJGKV5EJGKPVWPGFKGTV)TÒPG2CVKPCUGJTUEJÌP

1,5:1

7553

1,5:1

“UWOX%JT/CIKUVTCV/KPPQUI$KGPG*KTUEJMQRHTFCJKPVGT-ÌEJGT  8QPITQ­GT5GNVGPJGKV5EJGKPVWPGFKGTV)TÒPG2CVKPCXQT\ÒINKEJ



“U PCEJ  X %JT  I /CIKUVTCV +MGUKQU  I +P .QTDGGTMTCP\ $KGPG*KTUEJ YGKFGV T   -KPPU6JG#VVKE9GKIJV&TCEJOUQH'RJGUWU#2TGNKOKPCT[5VWF[KPVJG.KIJVQH4GEGPV*QCTFUKP 0%6[RG' 5GJTUEJÌP

7556



7554



7555



7557





7558



“U WO  X %JT /CIKUVTCV <QR[TQU  I +P .QTDGGTMTCP\ $KGPG*KTUEJ UVGJV T FCJKPVGT   2CNOG*GCF0%5 #XGTUGVYCUFG\GPVTKGTVUGJTUEJÌPpXQT\ÒINKEJ





“UX%JT/CIKUVTCV&GOGVTKQUI&TCRKGTVG$ÒUVGFGT#TVGOKUTÒDGTFGT5EJWNVGT$QIGP WPF -ÌEJGT*KTUEJRTQVQOG T \WTÒEMDNKEMGPF FCJKPVGT (CEMGN *GCF 0%  XGTIN 5    &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



“UX%JT/CIKUVTCVG&GOGVTKQU-QMQUWPF5QRCVTQUI&TCRKGTVG$ÒUVGFGT#TVGOKUT ÒDGT FGT 5EJWNVGT $QIGP WPF -ÌEJGT<YGK *KTUEJG UVGJGP GKPCPFGT IGIGPÒDGT FC\YKUEJGP (CEMGN   *GCF0%5 &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



“UX%JT/CIKUVTCV+CUQPI#TVGOKUIGJVTOKV$QIGPWPF\KGJVGKPGP2HGKNCWUFGO -ÌEJGTPGDGPKJTURTKPIV*WPFT+P.QTDGGTMTCP\*CJPUVGJVTOKV2CNO\YGKI*GCF0%5 )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ







86


GRIECHEN • IONIA

7560

7559

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JT/CIKUVTCV+CUQPI+P.QTDGGTMTCP\$KGPG*KTUEJUVGJVTOKV$CPFFCJKPVGT (CEMGN*GCF0%5 )TÒPG2CVKPCXQT\ÒINKEJ





“UX%JTI+P.QTDGGTMTCP\$KGPG*KTUEJUVGJVTFCJKPVGT(CEMGN*GCF0% 5 )TÒPG2CVKPCUGJTUEJÌP



7561

7562

1,5:1

1,5:1





1,5:1

1,5:1

'4;6*4#+“U,CJTJWPFGTVX%JT/CIKUVTCV-[DGTPKUI*GTCMNGUMQRHKO.ÌYGPHGNNT -GWNGÒDGT$QIGPKP$QIGPVCUEJG$/%50)%QR50)X#WNQEM  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



“U  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T-ÌEJGT $QIGP WPF -GWNG ÒDGT   -TGW\$/%XGTIN50)%QR50)X#WNQEM )TÒPG2CVKPCUGJTUEJÌP



7563

1,5:1

1,5:1

7564



“UX%JT/CIKUVTCV5VTCVKQVGUI*GTCMNGUMQRHKO.ÌYGPHGNNT-GWNGÒDGT$QIGPKP $QIGPVCUEJG$/%50)%QR50)X#WNQEM )TÒPG2CVKPCXQT\ÒINKEJ





“U,CJTJWPFGTVX%JT/CIKUVTCV#RGNNKCU5QJPFGU&GOGVTKQUI*GTCMNGUMQRHKO.ÌYGP HGNNT$QIGPKP$QIGPVCUEJGÒDGT-GWNG$/%50)%QR50)X#WNQEM  &WPMGNITÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



7565

1,5:1

1,5:1



“U  X %JT /CIKUVTCV /GVTCU 5QJP FGU &COCNQU  I *GTCMNGUMQRH KO .ÌYGPHGNN T   $QIGPKP$QIGPVCUEJGÒDGT-GWNGWPVGP*GTCMNGUMQRHHCUVXXKO.ÌYGPHGNN$/%50)%QR 50)X#WNQEM $TCWPG2CVKPCXQT\ÒINKEJ

1,5:1



7566

1,5:1

1,5:1

7567



1,5:1

*'4#-.'+# “U PCEJ  X %JT  I -GWNG WPF $QIGP KP $QIGPVCUEJG5RGGTURKV\G   50)/ÒPEJGP 4)WVGUUGJTUEJÌP



&KG<WYGKUWPIKUVPKEJVIGUKEJGTV



-.#<1/'0#+“U,CJTJWPFGTVX%JT/CIKUVTCV/PGUKOCEJQUI#VJGPCMQRHNOKVCVVK UEJGO*GNO9KFFGTNCIGTVN$/%/ÒPUVGTDGTI$GCOVGPPCOGP5  50)%QR50)X #WNQEM 4(CUVXQT\ÒINKEJ

 87


GRIECHEN • IONIA

7569

7568 1,5:1

1,5:1

1,5:1

1,5:1



-1.12*10“%JCNMWUX%JTI#RQNNQMQRHTOKV6CGPKG.[TC/KNPG  )N·P\GPFGITÒPG2CVKPCXQT\ÒINKEJ





“&KEJCNMQPX%JT/CIKUVTCV2NCVQPI#RQNNQMQRHTOKV.QTDGGTMTCP\2HGTFGRTQ VQOGT/KNPG &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



7570

1,5:1

1,5:1

7571



“UX%JT/CIKUVTCV#RQNNQFQTQUI#RQNNQMQRHTOKV.QTDGGTMTCP\2HGTFGRTQVQOGT /KNPG 2GTKQFG8+)TWRRG$  44*GNNITÒPG2CVKPCXQT\ÒINKEJ





“U  X %JT /CIKUVTCV #RQNNCU  I *QOGT UKV\V N OKV 5EJTKHVTQNNG#RQNNQ UVGJV T OKV   2CVGTCWPF.[TC/KNPG )TÒPG2CVKPCUGJTUEJÌP



7572

1,5:1



1,5:1

.'7-#+“UX%JT/CIKUVTCV&GOGVTKQUI#RQNNQMQRHNOKV.QTDGGTMTCP\5EJYCP UVGJVNFGP-QRHWPVGTFKG(NÒIGN\WTÒEMIGDQIGP+OJQQH$NWOGT-NGKPCUKCVKUEJG/ÒP\GP5XCT 8QT\ÒINKEJ

7573

7574 1,5:1

1,5:1

1,5:1

1,5:1



“U  X %JT /CIKUVTCV 5VCRJ[NQU  I #RQNNQMQRH N OKV .QTDGGTMTCP\5EJYCP UVGJV N   $/%50)%QR50)X#WNQEM 44&WPMNG2CVKPCHCUVXQT\ÒINKEJ



“UX%JTI#RQNNQMQRHNOKV.QTDGGTMTCP\5EJYCPUVGJVN\WTÒEMDNKEMGPF$/%  8QTFGTUGKVGFG\GPVTKGTVUGJTUEJÌP

7575



88

 

7576

1,5:1





1,5:1

/#)0'5+# “U  X %JT /CIKUVTCV 6TKVQP  I #RQNNQMQRH N OKV .QTDGGTMTCP\2TQ   VQOGGKPGUUVQ­GPFGP5VKGTGUTFCJKPVGT/·CPFGT$/%50)X#WNQEM50)%QR50)/ÒP EJGPXGTIN )TÒPG2CVKPCUGJTUEJÌP



“U  X %JT /CIKUVTCV =?RJQP  I #RQNNQMQRH N OKV .QTDGGTMTCP\2TQVQOG GKPGU   UVQ­GPFGP5VKGTGUTFCJKPVGT/·CPFGT$/%50)X#WNQEM50)%QR50)/ÒPEJGP  &WPMNG2CVKPCUGJTUEJÌPXQT\ÒINKEJ




GRIECHEN • IONIA

7578

7577

1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT /CIKUVTCV &KCIQTCU  I .CP\GPTGKVGT T5VKGT UVÌ­V N WPVGP JTG   $/%50)X#WNQEM50)%QRXGTIN (GKPGITÒPG2CVKPCXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT /CIKUVTCV &KCIQTCU  I .CP\GPTGKVGT T5VKGT UVÌ­V N $/%    50)X#WNQEM50)%QR &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7579

1,5:1

7580

1,5:1



“U  ,CJTJWPFGTV X %JT /CIKUVTCV -[FTQMNGU  I .CP\GPTGKVGT T5VKGT UVÌ­V N $/%    50)X#WNQEM50)%QR 5GJTUEJÌP





“UPCEJX%JT/CIKUVTCV'WMNGU-TCVKPQUI#VJGPCMQRHTOKVCVVKUEJGO*GNO4GKVGTT OKV.CP\G$/%XCT50)X#WNQEM50)%QR )TÒPGWPTGIGNO·­KIG2CVKPCUGJTUEJÌP



7581

1,5:1



7582

1,5:1

“UPCEJX%JT/CIKUVTCVG0KMCPQTWPF<QR[TQUI#TVGOKUMQRHTOKV.QTDGGTMTCP\ÒDGT FGT 5EJWNVGT $QIGP WPF -ÌEJGT-WNVUVCVWG FGT #TVGOKU .GWMQRJT[GPG $/%  50) X #WNQEM    50)%QR &WPMNG2CVKPCHCUVXQT\ÒINKEJ



&GT-WNVFGT#TVGOKU.GWMQRJT[GPGYCTFGT*CWRVMWNV/CIPGUKCU#O'PFGFGU,CJTJWPFGTVUX%JTYWTFGFGT 6GORGN FGT )ÌVVKP KO KQPKUEJGP 5VKN XQP *GTOQIGPGU XQP #NCDCPFC PGW GTTKEJVGV 6GKNG FGU  O NCPIGP (TKGUGU   OKV#OC\QPGPM·ORHGPIGNCPIVGPKPFGP.QWXTGPCEJ$GTNKPWPFPCEJ+UVCPDWN



“UPCEJX%JT/CIKUVTCVG2[TTCNKQP2CORJ[NQUI+P.QTDGGTMTCP\&TCRKGTVG$ÒUVGFGT #TVGOKUTÒDGTFGT5EJWNVGT$QIGPWPF-ÌEJGT-WNVUVCVWGFGT#TVGOKU.GWMQRJT[GPGXX$/% 50)X#WNQEM50)%QR )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7583

1,5:1



7584

1,5:1

1,5:1

1,5:1



“U PCEJ  X %JT /CIKUVTCV /QTKOQU  I 4GKVGT T OKV 5RGGT5VKGT UVGJV T CWH /·CPFGT   $/%50)X#WNQEM50)%QR )TÒPG2CVKPCXQT\ÒINKEJ





/+.'6“UX%JT/CIKUVTCV2JKNCKPG  I#RQNNQMQRHTOKV.QTDGGTMTCP\.ÌYG UVGJVT\WTÒEMDNKEMGPFFCXQT5VGTP&GRRGTV.KRRKV\ 2GTKQFG++ -KPPUKP0%  8QPCNNGTITÌ­VGT5GNVGPJGKV)TÒPG2CVKPCUGJTUEJÌP

 89


GRIECHEN • IONIA

7585

1,5:1



1,5:1

“UWOX%JT/CIKUVTCV5QUVTCVQUI#RQNNQMQRHHCUVXX.ÌYGUVGJVT\WTÒEMDNKEMGPF FCXQT5VGTP&GRRGTV.KRRKV\ 8QT\ÒINKEJ



<WT&CVKGTWPIUKGJG-KPPU0%5WPF5

7586

1,5:1



1,5:1

“UWOX%JT/CIKUVTCV#KUEJ[NKPQUI#RQNNQPXQP&KF[OCUVGJVTOKV*KTUEJWPF$QIGP .ÌYGUKV\VT\WTÒEMDNKEMGPFFCJKPVGT5VGTP&GRRGTV.KRRKV\HH )TÒPG2CVKPCHCUVXQT\ÒINKEJ



<WT&CVKGTWPIUKGJG-KPPU0%5

7588

7587 1,5:1

1,5:1



1,5:1

1,5:1

/;175 “U  X %JT  I +P -TCP\ #RQNNQMQRH TOKV.QTDGGTMTCP\+P/·CPFGTMTGKU )CPUT50)-C[JCP )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T



2*1-#+# “U  X %JT  I 9GKDNKEJGT -QRH N OKV 5RJGPFQPG)TGKHGPMQRH N   50)%QR50)X#WNQEM (CUVXQT\ÒINKEJ

1,5:1



90

1,5:1

5/;40#“UX%JT/CIKUVTCV#W  I#RQNNQMQRHTOKV.QTDGGTMTCP\&TGKHW­ /KNPG2GTKQFG+++g &WPMGNITÒPG2CVKPCXQT\ÒINKEJ

1,5:1



7589

7590





1,5:1

“UX%JT/CIKUVTCV&GOGVTKQUI#RQNNQMQRHTOKV.QTDGGTMTCP\&TGKHW­/KNPG &WPMGNITÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • IONIA

7592

7591

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JT/CIKUVTCV-QPQPI6[EJGMQRHTOKV/CWGTMTQPG#NVCT/KNPG  4)TÒPG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



“UX%JT/CIKUVTCV#RQNNQPKQU0GQ  I#RQNNQMQRHTOKV.QTDGGTMTCP\*CPFKP %CGUVWU\YKUEJGP2CNO\YGKIGP/KNPG (CUVXQT\ÒINKEJ

 

&GT %CGUVWU YCT FKG 5EJNCIXQTTKEJVWPI FGT CPVKMGP (CWUVM·ORHGT FKG WTURTÒPINKEJ FGO 5EJWV\ FGT (CWUV FKGPVG   UKEJKO.CWHFGT<GKVLGFQEJOGJTWPFOGJT\WGKPGOCWHDCTDCTKUEJG8GTYWPFWPIDGTGEJPGVGP6QVUEJN·IGTGPVYKE MGNVG

7594

1,5:1

7593

1,5:1



“U  X %JT /CIKUVTCV 'WOGNQU <QR[TQW  I #RQNNQMQRH T OKV .QTDGGTMTCP\*QOGT   UKV\VNOKV5EJTKHVTQNNGWPF<GRVGT/KNPG &WPMNG2CVKPCUGJTUEJÌP





“U  X %JT /CIKUVTCV 5QRCVTQU %JCTCOQPQW  I #RQNNQMQRH T OKV .QTDGGTMTCP\   %JGN[U/KNPG 4&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



&KG'THKPFWPIFGT%JGN[UFGT5EJKNFMTÌVGPNGKGTUEJTKGDGPFKG)TKGEJGPFGO)QVV*GTOGU\W *QOGTJ/GTE8    'TDGHGUVKIVGPCEJ/C­IGUEJPKVVGPG5EJKNHTQJTUV·DG  +PFGOGTFWTEJFGP4ÒEMGPKPFGP5EJKNFFGT5EJKNFMTÌVGFTCPI  4KPIUWOURCPPVGGT4KPFUJCWVICP\YKGGUKJOUGKP8GTUVCPFGKPICD  WPFGTHÒIVG#TOGCPWPFXGTDCPFUKGOKVGKPCPFGTFWTEJGKP3WGTJQN\  7PFURCPPVGUKGDGP\WUCOOGPMNKPIGPFG5CKVGPCWU5EJCHUFCTO  &CPPCNUGTGUXQNNGPFGVJCVVGPCJOGTFCUNKGDNKEJG5RKGN\GWI  7PFRTÒHVGOKVGKPGO2NGMVTQP)NKGFHÒT)NKGFWPFWPVGTUGKPGT*CPF  'TMNCPIGUIGYCNVKI    5KGJG\WT%JGN[U&&WOQWNKP&KG%JGN[U'KPCNVITKGEJKUEJGU5CKVGPKPUVTWOGPVKP#TEJKXHÒT/WUKMYKUUGPUEJCHV   5WPF5

7595

1,5:1



1,5:1

“UX%JT/CIKUVTCV/GPQRJ  I#RQNNQMQRHTOKV.QTDGGTMTCP\&TGKHW­/KNPG )TÒPG2CVKPCXQT\ÒINKEJ



7597

7596

1,5:1

1,5:1



“UX%JT/CIKUVTCV#KUEJT[QP&KQIGPQWUI#RQNNQMQRHTOKV.QTDGGTMTCP\*QOGT UKV\VNOKV5EJTKHVTQNNGWPF<GRVGT/KNPG &WPMNG2CVKPCHCUVXQT\ÒINKEJ





“UX%JT/CIKUVTCV#RQNNQPKQU/GVTQFQTQWI#RQNNQMQRHTOKV.QTDGGTMTCP\*Q OGTUKV\VNOKV5EJTKHVTQNNGWPF<GRVGT/KNPG 8QT\ÒINKEJ

 91


GRIECHEN • IONIA

7598 1,5:1



1,5:1

“UX%JT/CIKUVTCV0KMKCU.GRVQUI#RQNNQMQRHTOKV.QTDGGTMTCP\*QOGTUKV\VNOKV 5EJTKHVTQNNGWPF<GRVGT/KNPG &WPMNG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

7599

1,5:1





1,5:1

“U  X %JT /CIKUVTCV /QUEJQU /QUEJQW  I 6[EJGMQRH T OKV /CWGTMTQPG#RJTQFKVG   5VTCVQPKMKUUVGJVTFKG.KPMGOKV0KMGCWH5·WNGIGNGIV/KNPG  &WPMNG2CVKPC#XGTUGVYCUFG\GPVTKGTVXQT\ÒINKEJ



7600 1,5:1



1,5:1

“UWOX%JT/CIKUVTCVG*GTOQIGPGUWPF2JTKZQUI-QRH/KVJTCFCVGU8+XQP2QPVWUT 0KMGIGJVTOKV-TCP\WPF2CNO\YGKIFG%CNNCVCÕ2N.+3/KNPG  4$TCWPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7601

1,5:1



1,5:1

“U  X %JT /CIKUVTCVG &KQP[UKQU WPF 5MCOCPFTQU  I 6[EJGMQRH T OKV /CWGTMTQPG   #RJTQFKVG5VTCVQPKMKUUVGJVTFKG.KPMGOKV0KMGCWH5·WNGIGNGIV/KNPG  &WPMNG2CVKPC#XGTUGVYCUFG\GPVTKGTVXQT\ÒINKEJ

7602

1,5:1





7603

1,5:1

1,5:1

1,5:1



6'15“U,CJTJWPFGTVX%JTI)TGKHUKV\VTOKV-GT[MGKQP+O.KPKGPSWCFTCV-CPVJC TQU$/%50)X#WNQEM50)%QRXGTIN (CUVXQT\ÒINKEJUGJTUEJÌP





“U  ,CJTJWPFGTV X %JT /CIKUVTCV &KQP[UQFQTQU  I )TGKH UKV\V T-CPVJCTQU N .[TC   $/%XGTIN50)X#WNQEM50)%QR )TÒPG2CVKPCXQT\ÒINKEJ



92


GRIECHEN • IONIA

7604

7605

1,5:1

1,5:1

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI)TGKHUKV\VT+P.KPKGPSWCFTCV.[TC$/%50)X#WNQEM 50)%QR )TÒPG2CVKPCUGJTUEJÌP





“U,CJTJWPFGTVX%JTI)TGKHUKV\VT+P.KPKGPSWCFTCV.[TC$/%50)X#WNQEM 50)%QR )TÒPG2CVKPCUGJTUEJÌP



7607

7606

1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT /CIKUVTCV .[MQP  I )TGKH UKV\V T9GKPVTCWDG $/%  50) X   #WNQEM50)%QR 44&WPMNG2CVKPCHCUVXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT /CIKUVTCV 1PGUKOQU  I )TGKH URTKPIV T-TCP\ FCTKP 'VJPKMQP   $/%50)X#WNQEM50)%QR )TÒPG2CVKPCHCUVXQT\ÒINKEJ



7608 7609

1,5:1

1,5:1

1,5:1

1,5:1



%*+15“UX%JT/CIKUVTCV<GPQPI5RJKPZUKV\VN#ORJQTG/CXTQIQTFCVQ  &WPMNG2CVKPCUGJTUEJÌP





“U  X %JT /CIKUVTCV *GTOQUVTCVQU  I 5RJKPZ UKV\V N FCXQT 9GKPVTCWDG#ORJQTG   /CXTQIQTFCVQb 44&WPMNG2CVKPCUGJTUEJÌP



7611

7610

1,5:1

1,5:1

1,5:1

1,5:1



5#/15 “U  X %JT  I *GTCMQRH T.ÌYGPUMCNR X X 50) %QR  50) X   #WNQEM &WPMNG2CVKPCUGJTUEJÌPXQT\ÒINKEJ





“UX%JTI*GTCMQRHN.ÌYGPUMCNRXX50)%QR50)X#WNQEM  $TCWPG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



1,5:1



7612

1,5:1

“UX%JTI*GTCMQRHN.ÌYGPUMCNRXX50)%QR50)X#WNQEM  5GJTUEJÌPXQT\ÒINKEJ

 93


GRIECHEN • CARIA

7613 1,5:1



7614

1,5:1

1,5:1

1,5:1

%#4+#

70$'56+//6'/ª0<5666'“UX%JTI*GNKQUMQRHTXQP5VTCJNGPWOIGDGP 4QUG\YKUEJGP/'#UJVQP46JG5QNCT&KUM&TCEJOUQH%CTKCKP0%2N#%  )TÒPG2CVKPCUGJTUEJÌP 'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T



#2*41&+5+#52.#4#5# “U  ,CJTJWPFGTV X %JT  I &QRRGNCZV+P +PEWUWO 2CP\GT   /CEFQPCNF6[R )TÒPG2CVKPCUGJTUEJÌP

7615

 

7616 1,5:1

1,5:1

1,5:1

1,5:1



$#4);.+# “U  ,CJTJWPFGTV X %JT  I 2GICUWURTQVQOG T*KTUEJRTQVQOG T 50) -GEM   OCP )TÒPG2CVKPCXQT\ÒINKEJ





*#.+-#40#5515 “%JCNMWU  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\.[TC   50)-C[JCP )TÒPG2CVKPCXQT\ÒINKEJ



7617

1,5:1



1,5:1

“U,CJTJWPFGTVX%JTI2QUGKFQPMQRHT&TGK\CEM50)-GEMOCPXGTIN50)X #WNQEMXGTIN 5GNVGPKPFKGUGT'TJCNVWPI)TÒPG2CVKPCXQT\ÒINKEJGU'ZGORNCT

7618

1,5:1



1,5:1

+#515 “U  ,CJTJWPFGTV X %JT /CIKUVTCV -NGKVQU  I #RQNNQMQRH T OKV .QTDGGTMTCP\   *GTOKCUUEJYKOOVTOKV&GNRJKP/ÒPUVGTDGTI$GCOVGPPCOGP50)-C[JCPXGTIN  44&WPMGNITÒPG2CVKPCUGJTUEJÌP



7620

7619

1,5:1



1,5:1

1,5:1

1,5:1



-#7015“U,CJTJWPFGTVX%JTI5VKGTUVÌ­VT5RJKPZUKV\VT50)-GEMOCP  5GJTUEJÌPXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT  I 5VKGT UVÌ­V T FCTÒDGT -TCP\5RJKPZ UKV\V T $/%    50)-GEMOCP )TÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



94


GRIECHEN • CARIA

7621

1,5:1



1,5:1

7622

1,5:1

1,5:1

-0+&15“%JCNMWUX%JTI#RJTQFKVGMQRHT2TQTCT$/%50)X#WNQEM 50)%QRXGTIN 44&WPMGNITÒPG2CVKPCXQT\ÒINKEJ



<WT&CVKGTWPIUKGJG#UJVQP6JGNCVGENCUUKECNGCTN[JGNNGPKUVKEFTCEJOUQH-PKFQUKP405



/;.#5#“U,CJTJWPFGTVX%JTI2HGTFT&TGK\CEM#MCTEC50)-GEMOCP )TÒPG2CVKPCUVGORGNHTKUEJ

7623

1,5:1





1,5:1

'WRQNGOQUX%JT“UI&TGKOCMGFQPKUEJG5EJKNFGÒDGTGKPCPFGTNKGIGPF5EJYGTVKP 5EJGKFG50)-GEMOCPHH )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7624



7625

1,5:1

1,5:1

1,5:1

1,5:1



“U  I &TGK OCMGFQPKUEJG 5EJKNFG ÒDGTGKPCPFGTNKGIGPF5EJYGTV KP 5EJGKFG 50) -GEMOCP   XGTINHH &WPMNG2CVKPCXQT\ÒINKEJ





/;0&15“U,CJTJWPFGTVX%JTI$·TVKIGT-QRHTOKV.QTDGGTMTCP\ <GWUQFGT2QUGK FQP! &GNRJKPTÒDGT&TGK\CEM50)-GEMOCP )TÒPG2CVKPCUGJTUEJÌP



&KG<WYGKUWPIKUVPKEJVIGUKEJGTV/ÌINKEJGTYGKUGIGJÌTVFCU5VÒEMPCEJ/[NCUC

7626

1,5:1



1,5:1

0'#21.+5“U,CJTJWPFGTVX%JTI#RQNNQMQRHT.[TC$/%50TXCT  8QPCNNGTITÌ­VGT5GNVGPJGKV)TÒPG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP#WHJ·WUGT/ÒPEJGP0T

7628 1,5:1

7627

1,5:1

1,5:1

1,5:1



564#610+-'+# “U PCEJ  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\2GICUWURTQVQOG T   $/%50)-GEMOCP )TÒPG2CVKPCHCUVXQT\ÒINKEJ





5;#0)'.# “U  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\+P -TCP\ 5RGGTURKV\G   50)-GEMOCP9GPPKPIGT5;CTMKP 44)TÒPG2CVKPCUGJTUEJÌP

 95


GRIECHEN • CARIA

7629

1,5:1



1,5:1

7630

“UX%JTI9GKPVTCWDG+P-TCP\5RGGTURKV\G50)-GEMOCP9GPPKPIGT5 ;CTMKPXGTIN 44)TÒPG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T



-15“UX%JT/CIKUVTCV2JKNKUMQUI&GOGVGTMQRHTOKV5EJNGKGT-TGDU$/% 50)-GEMOCP )TÒPG2CVKPCUGJTUEJÌP

7631



7632

1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH KO .ÌYGPHGNN T-TGDU FCTWPVGT -GWNG   50)-GEMOCPXGTINHH 5GJTUEJÌP





0+5;415“UX%JTI9GKDNKEJGT-QRHTOKV5VGRJCPG&GNRJKPTÒDGT&TGK\CEM $/%50)-GEMOCP )TÒPG2CVKPCIWVGUUGJTUEJÌP



7633

1,5:1

1,5:1

7634



4*1&15“%JCNMWUX%JTI-QRHFGT4JQFQUTOKV&KCFGO4QUG#UJVQP6JG %QKPCIGQH4JQFGUXGTINHH50)-GEMOCPXGTINHH )TÒPG2CVKPCUGJTUEJÌP





“6GVTCEJCNMQPX%JTI<GWUMQRHTOKV.QTDGGTMTCP\4QUG#UJVQP6JG%QKPCIG QH4JQFGU50)-GEMOCP 5GJTUEJÌP



7635

1,5:1

7635

7636

1,5:1

7636



“UHTÒJGU,CJTJWPFGTVX%JTI*GNKQUMQRHTOKV5VTCJNGPDKPFG4QUG#UJVQP6JG%QKPCIG QH4JQFGU50)-GEMOCPHH 5GJTUEJÌP





“UX%JTI*GNKQUMQRHTOKV5VTCJNGPDKPFG+P+PEWUWO4QUG50)-GEMOCPHH 5GJTUEJÌP



7637

1,5:1



7638

1,5:1

1,5:1

1,5:1

“UUR·VGU,CJTJWPFGTVP%JTI&TCRKGTVG$ÒUVGFGU*GNKQUTOKV5VTCJNGPDKPFG9GKDNKEJG )GUVCNV #TVGOKU! UVGJVXXOKV5VTCJNGPDKPFG42% 45GJTUEJÌPHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

 96

“U UR·VGU  ,CJTJWPFGTV P %JT  I &TCRKGTVG $ÒUVG FGU *GNKQU T OKV 5VTCJNGPDKPFG#VJGPC   UVGJVTCWH)CNGGTGWPFUEJNGWFGTV$NKV\42% 4(CUVXQT\ÒINKEJ




GRIECHEN • LYDIA

7639

7640

1,5:1

1,5:1

1,5:1

1,5:1

.;&+# 

)COGTUGUHTÒJGU,CJTJWPFGTVX%JT“UI-QRHFGU)COGTUGUT<GWUUVGJVTOKV<GR VGTWPF#FNGTKO(GNFN5VGTP-NGKP 44)TÒPG2CVKPCXQT\ÒINKEJ



)COGTUGUYQJNGKP'WPWEJ UKGJG0QNN¾KP(GUVUEJTKHV(TCPMG5HH YCTYCJTUEJGKPNKEJ-QOOCPFCPVGKPGT (GUVWPIKPFGP6OQNQU$GTIGP UKGJG-NQUG8QP#NGZCPFGT\W-NGQRCVTC/ÒPEJGP5 



“UI-QRHFGU)COGTUGUT<GWUUVGJVTOKV<GRVGTWPF#FNGTKO(GNFN5VGTP-NGKP  44)TÒPG2CVKPCXQT\ÒINKEJ

7641



7642 1,5:1

1,5:1

1,5:1

1,5:1



“UI-QRHFGU)COGTUGUT<GWUUVGJVTOKV<GRVGTWPF#FNGTKO(GNFN5VGTP-NGKP  44)TÒPG2CVKPCXQT\ÒINKEJ





#WVQRJTCFCVGU5CVTCRWPFX%JT“%JCNMWUI-QRHTOKV6KCTC/QPQU MGNKUNJTG99GKUGT2QTVT·V%JCNMQKXQP#WVQRJTCFCVGU + KP00$5GRVGODGT5  45GJTUEJÌP



7643

1,5:1

1,5:1

1,5:1

7644 1,5:1



“%JCNMWUI-QRHTOKV6KCTC/QPQUMGNKU99GKUGT2QTVT·V%JCNMQKXQP#WVQRJTCFCVGU +  KP00$5GRVGODGT 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





*+'41-#+5#4'+# “U  ,CJTJWPFGTV  I &TCRKGTVG 5GPCVUDÒUVG T*KTUEJ UVGJV T   50)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7645 7646 1,5:1





1,5:1

*;2#+2# “U  ,CJTJWPFGTV 5VTCVGIQU 2QNGOQP !   I *GTCMNGUMQRH T<GWU UVGJV N OKV   #FNGTWPF<GRVGT$/%50)%QR50)/ÒPEJGP50)X#WNQEM  8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCXQT\ÒINKEJ



/#+10+# “U  ,CJTJWPFGTV P %JT  I 6[EJGMQRH N OKV 5EJNGKGT WPF /CWGTMTQPG6[EJG   UVGJVNOKV5VGWGTTWFGTWPF(ÒNNJQTP50)/ÒPEJGP )TÒPG2CVKPCIWVGUUGJTUEJÌP

 97


GRIECHEN • LYDIA

7647

1,5:1

1,5:1

7648



0;5#“U,CJTJWPFGVX%JT/CIKUVTCV.[MQRJTQPI*CFGUMQRHTOKV.QTDGGTMTCP\-QTG UVGJVT50)/ÒPEJGP 4$TCWPG2CVKPCHCUVXQT\ÒINKEJ





2*+.#&'.2*+#“U,CJTJWPFGTVP%JTI&GOQUMQRHTOKV.QTDGGTMTCP\#VJGPCUVGJV XXOKV-CNCVJQU5VCVWGFGT#TVGOKU#PCKVKU5RGGTWPF5EJKNF$/%/KQPPGV50)%QR 50)/ÒPEJGP50)X#WNQEM 4)TÒPG2CVKPCXQT\ÒINKEJ



7649



7650

1,5:1

1,5:1

5#+66# “U  ,CJTJWPFGTV P %JT  I &TCRKGTVG 5GPCVUDÒUVG T(NW­IQVV *GTOQU NCIGTV N   OKV5EJKNHTQJTWPF(ÒNNJQTP50)/ÒPEJGP &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



5#4&'5“UPCEJX%JTI&KQP[UQUMQRHTOKV'HGWMTCP\.ÌYGPRTQVQOGT$/% 50)/ÒPEJGP &WPMGNITÒPG2CVKPCXQT\ÒINKEJ

7651

7652

1,5:1



1,5:1



“UPCEJX%JTI6[EJGMQRHTOKV/CWGTMTQPG.QTDGGTMTCP\WPF5EJNGKGT<GWU.[FKQU UVGJVNOKV#FNGTWPF<GRVGT$/%50)/ÒPEJGP &WPMGNITÒPG2CVKPCUGJTUEJÌP





“UPCEJX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\+P'KEJGPMTCP\-GWNG50)/ÒPEJGP HH )TÒPG2CVKPCXQT\ÒINKEJ



7654

7653

1,5:1

1,5:1



“U UR·VGU HTÒJGU  ,CJTJWPFGTV P %JT  I &TCRKGTVG 5GPCVUDÒUVG T&GOGVGT UVGJV N OKV   <GRVGTJTGPWPF/QJP50)/ÒPEJGP &WPMNG2CVKPCXQT\ÒINKEJ





6*;#6'+4#“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\&QRRGNCZV50) %QR50)X#WNQEM &WPMNG2CVKPCUGJTUEJÌP



1,5:1

7655

1,5:1

7656



“UHTÒJGU,CJTJWPFGTVP%JTI<GWUMQRHT&QRRGNCZV42%



“U,CJTJWPFGTVP%JTI&TCRKGTVG$ÒUVGFGT#TVGOKU$QTGKVGPGNXQTFGT$TWUV$QIGP ÒDGTFGT5EJWNVGT-ÌEJGT#FNGTUVGJVXX-QRHN50)%QR50)X#WNQEM  &WPMNG2CVKPCUGJTUEJÌP

98

48QT\ÒINKEJ

 


GRIECHEN • PHRYGIA

7657

7658

1,5:1

1,5:1

1,5:1

1,5:1



“U,CJTJWPFGTVP%JTI&TCRKGTVG$ÒUVGFGU*GTCMNGUT.ÌYGIGJVT50)%QR 50)X#WNQEMXGTIN#DD )WVGUUGJTUEJÌP





64#..'5#.55'.'7-'+#“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV.QTDGGTMTCP\+P /·CPFGT<GDWUVKGTN$/%+OJQQH$NWOGT.[FKUEJG5VCFVOÒP\GPXCT50)/ÒPEJGP  44&WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

7659

1,5:1



1,5:1

“U,CJTJWPFGTVX%JT/CIKUVTCV#RQNNQPKQUI<GWUMQRHTOKV.QTDGGTMTCP\+P/·CPFGT <GDWUVKGT N $/%  +OJQQH$NWOGT .[FKUEJG 5VCFVOÒP\GP  +OJQQH$NWOGT <WT ITKGEJKUEJGP WPF   TÌOKUEJGP/ÒP\MWPFG ++#DVJGKNWPI KP504:+8  50TXCT50)/ÒPEJGP  44&WPMGNITÒPG2CVKPCXQT\ÒINKEJHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

1,5:1





7660

7661

1,5:1

“U  ,CJTJWPFGTV X %JT /CIKUVTCV #VJGPQFQTQU !   I <GWUMQRH T OKV .QTDGGTMTCP\+P   /·CPFGT<GDWUVKGTN$/%50)/ÒPEJGP+OJQQH$NWOGT.[FKUEJG5VCFVOÒP\GP  44)TÒPG2CVKPCXQT\ÒINKEJ



64+21.+5 “U  ,CJTJWPFGTV P %JT  I &TCRKGTVG $ÒUVG FGU 5CTCRKU T OKV -CNCVJQU+UKU   UVGJVNOKV5KUVTWOWPF5KVWNC50)/ÒPEJGP &WPMNG2CVKPCUGJTUEJÌP



7662

7663 1,5:1

1,5:1

2*4;)+# 

#$$#+6+5“U,CJTJWPFGTVX%JT#PM[TC ! I*GTCMNGUMQRHKO.ÌYGPHGNNT+P-TCP\ .ÌYGPHGNNÒDGT-GWNG$/% &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





#+<#0+5 “U  ,CJTJWPFGTV P %JT  I &TCRKGTVG 5GPCVUDÒUVG T#VJGPC UVGJV N OKV 2CVGTC   WPF5RGGTWPVGP5EJKNF$/%50)%QR50)X#WNQEM  &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

 99


GRIECHEN • PHRYGIA

7664 1,5:1



1,5:1

#2#/'+#“UX%JT/CIKUVTCV#PVKRJQP/GPGMNGQWUI&TCRKGTVG$ÒUVGFGT#VJGPCT OKVMQTKPVJKUEJGO*GNO#FNGTÒDGT/·CPFGTT\YKUEJGP2KNGKFGT&KQUMWTGPWPF5VGTPGP$/% 50)/ÒPEJGP &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



7665 1,5:1

1,5:1



“UX%JT/CIKUVTCV-QMQUI&TCRKGTVG$ÒUVGFGT#VJGPCTOKVMQTKPVJKUEJGO*GNO #FNGTÒDGT/·CPFGTT\YKUEJGP2KNGKFGT&KQUMWTGPWPF5VGTPGP$/%50)/ÒPEJGP  &WPMNG2CVKPCXQT\ÒINKEJ

7666



7667

1,5:1

1,5:1

1,5:1

1,5:1



“UX%JT/CIKUVTCV*GTOQMTCV  I#TVGOKUMQRHTOKV/CWGTMTQPG/CTU[CUIGJVT OKV&QRRGNHNÌVGÒDGT/·CPFGT$CDGNQP+PX9CFFKPIVQP$/%50)/ÒPEJGP 8QT\ÒINKEJ





'7/'0'+#“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV'KEJGPQFGT.QTDGGTMTCP\'VJPK MQPKP'KEJGPMTCP\$/%50)/ÒPEJGP &WPMNG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



7669

7668

1,5:1

1,5:1

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV'KEJGPQFGT.QTDGGTMTCP\'VJPKMQPKP'KEJGP MTCP\$/%50)/ÒPEJGP )TÒPG2CVKPCNGKEJVFG\GPVTKGTVXQT\ÒINKEJUGJTUEJÌP





“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV'KEJGPQFGT.QTDGGTMTCP\'VJPKMQPKP'KEJGP MTCP\$/%50)/ÒPEJGP &WPMNG2CVKPCMPCRRGT5EJTÌVNKPIXQT\ÒINKEJ



1,5:1

 100

7670

1,5:1

“U,CJTJWPFGTVX%JTI&TCRKGTVG$ÒUVGFGU/GPTOKVRJT[IKUEJGT/ÒV\GCWH/QPFUK EJGN#EJVUVTCJNKIGT5VGTP$/%5NI)WVMPGEJV50)/ÒPEJGP 5GJTUEJÌPpXQT\ÒINKEJ




GRIECHEN • LYCIA

7671

1,5:1





7672

1,5:1

“U,CJTJWPFGTVX%JTI&TCRKGTVG$ÒUVGFGT6[EJGTOKV/CWGTMTQPG-CNCVJQU$/% +OJQQH$NWOGT)TKGEJKUEJG/ÒP\GP6H:++50)/ÒPEJGP  44)TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP



.#1&+-'+# “U  ,CJTJWPFGTV X %JT  I 9GKDNKEJGT -QRH T OKV &KCFGO&QRRGNHÒNNJQTP   $/%50)/ÒPEJGP &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



7673

1,5:1

1,5:1

7674



2'.6#+“UXQTX%JTI<GWUMQRHTOKV.QTDGGTMTCP\.ÌYGPHGNNÒDGT-GWNG$/% 50)/ÒPEJGP &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





5'$#56'“U,CJTJWPFGTVP%JTI&GOQUMQRHTOKV.QTDGGTMTCP\NFTCRKGTV6[EJG UVGJVNOKV5VGWGTTWFGTWPF(ÒNNJQTP$/%50)/ÒPEJGP )TÒPG2CVKPCXQT\ÒINKEJ



7676

7677

7675 1,5:1

1,5:1

.;%+# 

7PDGUVKOOVGT&[PCUV“UHTÒJGU,CJTJWPFGTVX%JTI/WUEJGN.ÌYGPUMCNRXX$/% 448QT\ÒINKEJ



2GTKMNG“UX%JTI2CPMQRHN6TKUMGNKU50)X#WNQEM  )TÒPG2CVKPCUEJÌPpUGJTUEJÌP





$7$10 “U  ,CJTJWPFGTV X %JT  I &TCRKGTVG $ÒUVG FGT #TVGOKU T ÒDGT FGT 5EJWNVGT   -ÌEJGT*KTUEJUVGJVT50)X#WNQEM 5GJTUEJÌP





7678 1,5:1



/#5+-;6'5“UUR·VGU,CJTJWPFGTVX%JTHTÒJGU,CJTJWPFGTVP%JTI#RQNNQMQRHT OKV.QTDGGTMTCP\#RQNNQ2CVTQÌUUVGJVNOKV<YGKIWPF$QIGPT<YGKI42%6TQZGNN  )TÒPG2CVKPCHCUVXQT\ÒINKEJ

1,5:1



1,5:1

7679



1,5:1

2*#5'.+5“UX%JTI2TQTCTFCTÒDGT0KMG#VJGPC2TQOCEJQUUVGJVTOKV$NKV\ WPF#GIKU*GKRR6COGT$ )TÒPG2CVKPCUGJTUEJÌP

 101


GRIECHEN • PAMPHYLIA

7680

7681

1,5:1

1,5:1

1,5:1

1,5:1



2+0#4#“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\+P+PEWUWO&TCRKGTVG $ÒUVGFGT#TVGOKUT6TQZGNN 4)TÒPG2CVKPCUGJTUEJÌP





6'./'5515 “U  X %JTI*GNKQUMQRHHCUVXX#RQNNQUKV\VNCWH1ORJCNQUOKV 2HGKNWPF$QIGP$/% 5GJTUEJÌP



7682

1,5:1

1,5:1

2#/2*;.+# 

#52'0&15 “U  ,CJTJWPFGTV X %JT  I 4WPFUEJKNF#VJGPCMQRH T OKV CVVKUEJGO *GNO   50)%QR &WPMGNITÒPG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



7684

7683

1,5:1

1,5:1

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI4WPFUEJKNF#VJGPCMQRHTOKVCVVKUEJGO*GNO50)%QR )TÒPG2CVKPCUGJTUEJÌP





“U,CJTJWPFGTVX%JTI4WPFUEJKNF#VJGPCMQRHTOKVCVVKUEJGO*GNO50)%QR &WPMNG2CVKPCUGJTUEJÌP



1,5:1



7685

1,5:1

2'4)'“U,CJTJWPFGTVX%JTI<YGKU·WNKIGT6GORGNFCTKP-WNVDKNFFGT#TVGOKU2GT ICKC#TVGOKUIGJVTOKV$QIGPWPF(CEMGN50)(TCPEG &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



7686

1,5:1

1,5:1

1,5:1

7687

1,5:1



5+..;10“U,CJTJWPFGTVX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\$NKV\50)%QR 50)(TCPEG 45GJTUEJÌPpXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\<GWU #GVQRJQTQU UKV\V N FCXQT   $NKV\50)%QR50)(TCPEGXGTIN 45GJTUEJÌP



102


GRIECHEN • PISIDIA

7689

7688

1,5:1

1,5:1

1,5:1

1,5:1

2+5+&+# 

'6'00#“U,CJTJWPFGTVX%JTI<YGKPCEMVGCWUUEJTGKVGPFG/·PPGT9GKDNKEJG(KIWT TOKV5EJNCPIGX#WNQEM2KUKFKGP++HH )TÒPG2CVKPCXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT  I <YGK PCEMVG CWUUEJTGKVGPFG /·PPGT9GKDNKEJG (KIWT T OKV   5EJNCPIGX#WNQEM2KUKFKGP++HH )TÒPG2CVKPCUGJTUEJÌP



7691

7690

1,5:1

1,5:1

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT  I 9GKDNKEJG (KIWT T OKV 5EJNCPIG FCJKPVGT WOIGUVÒT\VGT -TWI   5KEJGNHÌTOKIGU/GUUGTX#WNQEM2KUKFKGP++HH )TÒPG2CVKPCXQT\ÒINKEJ





-1/#/#“U,CJTJWPFGTVX%JTI<YGKD·TVKIG/·PPGTMÌRHGPGDGPGKPCPFGTTOKV.QT DGGTMTCP\.ÌYGURTKPIVTX#WNQEMKP,D0WO   5GJTUEJÌP



7693

7692

1,5:1



1,5:1

1,5:1

1,5:1

5'.)' “U  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH T ÒDGT FGT 5EJWNVGT -GWNG$NKV\ WPF   $QIGP$/%50)(TCPEG &WPMNG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



“U  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH T ÒDGT FGT 5EJWNVGT -GWNG$NKV\ WPF $QIGP   $/%50)(TCPEG $TCWPG2CVKPCXQT\ÒINKEJ



7694

1,5:1

1,5:1

7695

7695 1,5:1



“U  ,CJTJWPFGTV X %JT  I *GTCMNGUMQRH T ÒDGT FGT 5EJWNVGT -GWNG$NKV\ WPF $QIGP   $/%50)(TCPEG )TÒPG2CVKPCUGJTUEJÌP





6'4/'5515 “U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\.[TC $/%    50)(TCPEG )WVGUUGJTUEJÌP

 103


GRIECHEN • CILICIA

7696

7697

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV.QTDGGTMTCP\5VKGTUVÌ­VN$/%50)(TCPEG XGTIN &WPMNG2CVKPCUGJTUEJÌP





“U  ,CJTJWPFGTV X %JT  I &TCRKGTVG $ÒUVG FGT #TVGOKU T ÒDGT FGT 5EJWNVGT -ÌEJGT5VKGT   UVGJVN$/%50)(TCPEG )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7698

1,5:1



1,5:1

“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV.QTDGGTMTCP\2HGTFN$/%50)(TCPEG &WPMNG2CVKPCXQT\ÒINKEJ



7700

7699

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV.QTDGGTMTCP\2HGTFN$/%50)(TCPEG )TÒPG2CVKPCXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\2HGTFGRTQVQOG N $/%  HH   50)(TCPEGHH &WPMNG2CVKPCUGJTUEJÌP



1,5:1

7701 1,5:1

%+.+%+# 

#+)'#+ “U  X %JT  I 6[EJGMQRH T OKV /CWGTMTQPG2HGTFGMQRH N $NQGUEJ KP   #05/0  HH $TCWPG2CVKPCXQT\ÒINKEJ



7702 1,5:1

 104

1,5:1

“U  X %JT  I 6[EJGMQRH T OKV /CWGTMTQPG2HGTFGMQRH N $NQGUEJ KP #05/0   

 HH )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ




GRIECHEN • CILICIA

7704

7703

1,5:1

1,5:1



“U  X %JT  I 6[EJGMQRH T OKV /CWGTMTQPG2HGTFGMQRH N FCJKPVGT /QPQITCOO   $NQGUEJKP#05/0  HH )TÒPG2CVKPCHCUVUGJTUEJÌP





“UX%JTI<GWUMQRHT#VJGPC0KMGRJQTQUUVGJVN$NQGUEJKP#05/0  HH &WPMNG2CVKPCUGJTUEJÌP



7705

7706

1,5:1

1,5:1



'.#+755#5'$#56'“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV&KCFGO0KMGIGJVNOKV -TCP\50)(TCPEG50).GXCPVG )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





“U,CJTJWPFGTVX%JTI<GWUMQRHTOKV&KCFGO0KMGIGJVNOKV-TCP\50)(TCPEG 50).GXCPVG )TÒPG2CVKPCHCUVXQT\ÒINKEJ



7708

7707

1,5:1





1,5:1

*+'4#21.+5-#56#$#.#“U,CJTJWPFGTVX%JTI6[EJGMQRHTOKV/CWGTMTQPG )ÌVVKPUKV\VNOKV2JKCNGWPVGTFGO6JTQP#FNGT50)(TCPEGXGTINHH50).GXCPVG XGTIN (CUVXQT\ÒINKEJ



-'.'0&'4+5“U  ,CJTJWPFGTV X %JT  I 6[EJGMQRH T OKV 5EJNGKGT WPF/CWGTMTQPG #RQNNQUVGJVNOKV.QTDGGTMTCP\WPFUVÒV\VUKEJCWHGKPG5·WNGCWHFGTGKP&TGKHW­UVGJV50)(TCPEG 50).GXCPVG &WPMNG2CVKPCXQT\ÒINKEJ



1,5:1



1,5:1

7709

1,5:1

“U,CJTJWPFGTVX%JTI-QRHTOKV&KCFGO<KGIGMPKGVN\WTÒEMDNKEMGPF50)(TCPEG XGTIN50).GXCPVG 44)TÒPG2CVKPCXQT\ÒINKEJ

 105


GRIECHEN • CILICIA

7710

1,5:1

7711

1,5:1



-1412+5515 “U  ,CJTJWPFGTV P %JT  I 5VKGT UVGJVT5VGTPÒDGT*CNDOQPF$/% 50)(TCPEG50).GXCPVGXGTIN 44)TÒPDTCWPG2CVKPCUGJTUEJÌP





-14;-15 “U  ,CJTJWPFGTV X %JT  I 6[EJGMQRH TOKV/CWGTMTQPG*GTOGUUVGJVNOKV 2CVGTCWPF-GT[MGKQP50)(TCPEG50).GXCPVG )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1,5:1

7712





1,5:1

7713

“U,CJTJWPFGTVX%JTI&TCRKGTVG$ÒUVGFGT#TVGOKUTÒDGTFGT5EJWNVGT-ÌEJGT#RQNNQ UVGJVNOKV<YGKICP5·WNGIGNGJPV50)(TCPEGXGTIN50).GXCPVGXGTINHH  )TÒPG2CVKPCUGJTUEJÌP



0#)+&15 “U  X %JT  I 2CPMQRH T-CPVJCTQU 50) (TCPEG   50) .GXCPVG    50).GXCPVG5WRRN 44&WPMNG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI/CWTKEG.CHHCKNNG#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7715

7714

1,5:1

1,5:1



1.$# #LCZ  “U WO  P %JT  I &TCRKGTVG $ÒUVG T OKV -CRRG WPF -GT[MGKQP   6TKUMGNKU42% $TCWPG2CVKPCUGJTUEJÌP





“UWOP%JTI8KGT<GKNGP5EJTKHV$NKV\42%



&WPMNG2CVKPCXQT\ÒINKEJ

7716 1,5:1



1,5:1

/#PVQPKWU2QNGOQ“UI-QRHT$NKV\42%

)TÒPDTCWPG2CVKPCXQT\ÒINKEJ



1D GU UKEJ DGK / #PVQPKWU 2QNGOQ WO 2QNGOQ ++ XQP 2QPVWU JCPFGNV KUV WOUVTKVVGP 5KGJG 42% 5  WPF ,   4CKNNCTF2QNGOQPXQP2QPVWUWPF#PVQPKWU2QNGOQPXQP1NDCKP0<  5

7717 1,5:1

 106

1,5:1

5'.'7-'+# “U  ,CJTJWPFGTV X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO0KMG   IGJVNOKV-TCP\50)(TCPEG50).GXCPVG &WPMNG2CVKPCXQT\ÒINKEJ




GRIECHEN • CILICIA

7718

7719

1,5:1

1,5:1



“U,CJTJWPFGTVX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO0KMGIGJVNOKV-TCP\ 50)(TCPEG50).GXCPVG &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





“U,CJTJWPFGTVX%JTI#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO0KMGIGJVNOKV-TCP\ 50)(TCPEG50).GXCPVG 1NKXITÒPG2CVKPCXQT\ÒINKEJ



7720

7720

7721

7721

1,5:1

1,5:1



“U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T2HGTFGRTQVQOG T 50) (TCPEG   50)   .GXCPVG50).GXCPVG5WRRN (CUVXQT\ÒINKEJXQT\ÒINKEJ





“U  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T2HGTFGRTQVQOG T 50) (TCPEG   50) .G   XCPVG50).GXCPVG5WRRN &WPMNG2CVKPCXQT\ÒINKEJ



1,5:1



7722

1,5:1

“U  ,CJTJWPFGTV X %JT  I -QRH GKPGT )ÌVVKP T OKV 5VGRJCPG<YGKI 50) (TCPEG     XGTIN50).GXCPVGXGTIN50).GXCPVG5WRRN &WPMNG2CVKPCXQT\ÒINKEJ



7723

1,5:1



1,5:1

51.1+ “U  ,CJTJWPFGTV X %JT  I #GIKU OKV IGHNÒIGNVGO )QIQPGKQP KP FGT /KVVG   #RJTQFKVGTGKVGVTCWH5VKGTFCXQT'WNG50)(TCPEG50).GXCPVG  )TÒPG2CVKPCXQT\ÒINKEJ

 107


GRIECHEN • GALATIA

7724 1,5:1



1,5:1

“U  ,CJTJWPFGTV X %JT  I *GNKQUMQRH T OKV 5VTCJNGPDKPFG#VJGPC 0KMGRJQTQU UKV\V N   50)(TCPEG50).GXCPVG &WPMNG2CVKPCXQT\ÒINKEJ

1,5:1

7725

7726



1,5:1



6#4515 “U PCEJ  X %JT  I 6[EJGMQRH T OKV 5EJNGKGT WPF /CWGTMTQPG5CPFCPJGKNKI   VWO50)(TCPEG50).GXCPVG &WPMNG2CVKPCUGJTUEJÌP





“U PCEJ  X %JT  I 6[EJGMQRH T OKV /CWGTMTQPG5CPFCP CWH <KGIG T 50) (TCPEG    50).GXCPVG &WPMNG2CVKPCIWVGUUGJTUEJÌP



7727

1,5:1

1,5:1

)#.#6+# 

-¤0+)4'+%*#O[PVCUX%JT“UI*GTCMNGUMQRHTOKV-GWNG.ÌYGT42% 1NKXITÒPG2CVKPCXQT\ÒINKEJGU'ZGORNCT

1,5:1

7728



1,5:1

%#22#&1%+# 

-¤0+)4'+%*#TKCTCVJGU+X%JT“UI5CVTCRCNU$QIGPUEJÒV\GT5VGKPDQEMT #NTCO 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP)KGUUGPGT/ÒP\JCPFNWPI/ÒPEJGP0T FQTVKTTVÒONKEJCNU2CORJ[NKC#URGP FQUDGUEJTKGDGP 

7729 1,5:1

1,5:1

%1//#)'0'  108

-¤0+)4'+%* #PVKQEJQU +8  “U -KGVKU  I &TCRKGTVG $ÒUVG T OKV &KCFGO5MQT   RKQP42% 4)TÒPG2CVKPCHCUVXQT\ÒINKEJ




GRIECHEN • SYRIA

7730

1,5:1

1,5:1

7731

7731 1,5:1

5;4+# 



-¤0+)4'+%*5GNGWMQU+X%JT“UX%JT5CTFGKUI)GHNÒIGNVGU)QT IQPGPJCWRVT5VKGTUVÌ­VT*QWIJVQP.QTDGT0GYGNN95/50)5RCGT  $TCWPG2CVKPCUGJTUEJÌP



“UWOX%JT#PVKQEJKCI)GHNÒIGNVGU)QTIQPGPJCWRVT5VKGTUVÌ­VT*QWIJVQP.QTDGT XGTIN0GYGNN95/XGTIN50)5RCGTXGTIN  2T·IGUEJY·EJGCO4CPFUGJTUEJÌPpXQT\ÒINKEJ



7733

7732

1,5:1

1,5:1







1,5:1

#PVKQEJQU+X%JT“U5CTFGKUQFGT5O[TPCI#VJGPCDÒUVGXXOKVCVVKUEJGO *GNO0KMG IGJV N OKV -TCP\ WPF 2CNO\YGKI *QWIJVQP.QTDGT  C 0GYGNN 95/    50)5RCGT &WPMNG2CVKPCXQT\ÒINKEJGU'ZGORNCT



“U5CTFGKUQFGT5O[TPCI#VJGPCDÒUVGXXOKVCVVKUEJGO*GNO0KMGIGJVNOKV-TCP\WPF 2CNO\YGKI*QWIJVQP.QTDGTC0GYGNN95/50)5RCGT  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



1,5:1



1,5:1

7734

1,5:1

7735

“U/CIPGUKCCF/CGCPFTWOI#VJGPCDÒUVGXXOKVCVVKUEJGO*GNO0KMGIGJVNOKV-TCP\ WPF2CNO\YGKINUGNGWMKFKUEJGT#PMGT*QWIJVQP.QTDGT0GYGNN95/50)5RCGT 4#XGTUGVYCUFG\GPVTKGTVUGJTUEJÌP



“U#PVKQEJKCI<GWUMQRHTOKV.QTDGGTMTCP\$NKV\QDGP'DGTMKGHGTWPF/QPQITCOOWPVGP 'DGTMKGHGT*QWIJVQP.QTDGT0GYGNN95/50)5RCGT  &WPMGNITÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



7736

1,5:1 7737

1,5:1





7737

1,5:1

“U#PVKQEJKCI-QRHTOKV&KCFGO#RQNNQUKV\VNCWH1ORJCNQUOKV2HGKNWPF$QIGP*QWIJ VQP.QTDGT0GYGNN95/50)5RCGT  &WPMNG2CVKPCDTGKVGUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGO2QTVT·V



#PVKQEJQU ++  X %JT “U 5CTFGKU  I #RQNNQMQRH X X&TGKHW­ *QWIJVQP.QTDGT   XGTIN0GYGNN'5/50)5RCGT 445GJTUEJÌP

 109


GRIECHEN • SYRIA

7738

7739

1,5:1





1,5:1

“U5CTFGKUI#RQNNQMQRHTOKV.QTDGGTMTCP\&TGKHW­FCTWPVGTUGNGWMKFKUEJGT#PMGT*QWIJ VQP.QTDGT0GYGNN95/50)5RCGTXGTIN  &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



“U5CTFGKUI#RQNNQMQRHTOKV.QTDGGTMTCP\&TGKHW­FCTWPVGTUGNGWMKFKUEJGT#PMGT*QWIJ VQP.QTDGT0GYGNN95/50)5RCGTXGTIN )TÒPG2CVKPCXQT\ÒINKEJ



7740

7741

1,5:1





1,5:1

1,5:1



“UX%JT5CTFGKUI#VJGPCMQRHTOKVCVVKUEJGO*GNO#RQNNQUVGJVNOKV2HGKNWPF $QIGP*QWIJVQP.QTDGT0GYGNN95/50)5RCGT 1NKXITÒPG2CVKPCHCUVXQT\ÒINKEJ





110

1,5:1

1,5:1

“UX%JT5CTFGKUI#VJGPCMQRHTOKVCVVKUEJGO*GNO#RQNNQUVGJVNOKV2HGKNWPF $QIGP*QWIJVQP.QTDGT0GYGNN95/XGTIN50)5RCGT  $TCWPG2CVKPCMN4CPFHGJNGTXQT\ÒINKEJ



5GNGWMQU+++X%JT“U#PVKQEJKCI&TCRKGTVG$ÒUVGFGT#TVGOKUTÒDGTFGT5EJWNVGT -ÌEJGT#RQNNQUKV\VNCWH1ORJCNQUOKV2HGKNWPF$QIGP*QWIJVQP.QTDGT  -PCRRGT5EJTÌVNKPIUGJTUEJÌP



1,5:1



7743

1,5:1

1,5:1



1,5:1

5GNGWMQU++X%JT“UX%JT5CTFGKUI*GTCMNGUMQRHKO.ÌYGPHGNNT #RQNNQ UKV\V N CWH 1ORJCNQU OKV 2HGKN WPF $QIGP *QWIJVQP.QTDGT  !  0GYGNN 95/    50)5RCGT 44)TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7742



1,5:1

1,5:1

7744

1,5:1

7745

#EJCKQU  X %JT “U 5CTFGKU  I #RQNNQMQRH T OKV .QTDGGTMTCP\#FNGT UVGJV T OKV   -TCP\KPFGP(·PIGP*QWIJVQP.QTDGT0GYGNN95/XGTIN50)5RCGTXGTIN  44)TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP



#PVKQEJQU+++X%JT“UX%JT5CTFGKU ! I#RQNNQMQRHTOKV.QTDGGT MTCP\&TGKHW­*QWIJVQP.QTDGT0GYGNN95/50)5RCGT  &WPMNG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT




GRIECHEN • SYRIA

7746

1,5:1

7747

1,5:1



“U5CTFGKUI#RQNNQMQRHTOKV.QTDGGTMTCP\'NGHCPVUVGJVN*QWIJVQP.QTDGT0GYGNN 95/50)5RCGT 4&WPMNG2CVKPCIWVGUUGJTUEJÌP





#PVKQEJQU+8X%JT“UWOX%JT#PVKQEJKCI-QRHTOKV5VTCJNGPDKPFG <GWUUVGJVXXOKV-TCP\-QRHNN&TGKHW­*QWIJVQP50)5RCGT  $TCWPG2CVKPCUGJTUEJÌP



7748

1,5:1

7749

1,5:1



“U 5GNGWMGKC CF 6KITKO  I -QRH T OKV 5VTCJNGPDKPFG)ÌVVKP UKV\V N OKV 0KMG FCXQT 8QIGN   50)5RCGT &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP





&GOGVTKQU+X%JT“U,CJTUGNGWMKFKUEJGTTC X%JT 6[TQUI -QRHTOKV&KCFGO5EJKHHUJGEMN0GYGNN6[TG50)5RCGT $TCWPG2CVKPCUGJTUEJÌP



1,5:1

7750

7751

1,5:1



“U,CJTUGNGWMKFKUEJGTTC X%JT 6[TQUI-QRHTOKV&KCFGO5EJKHHUJGEMN 0GYGNN6[TG50)5RCGT &WPMGNITÒPG2CVKPCUGJTUEJÌP





“U ,CJT  UGNGWMKFKUEJGT TC   X %JT  6[TQU  I -QRH T OKV &KCFGO2CNOG   0GYGNN6[TG50)5RCGTHH &WPMNG2CVKPCUGJTUEJÌP



1,5:1



7752

1,5:1

#NGZCPFGT +  X%JT “U.CQFKMGKCKP-CPCCP $GT[VQU I-QRHTOKV&KCFGO &GNRJKPWO&TGK\CEM4QWXKGT 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



7753 1,5:1



1,5:1



1,5:1

#PVKQEJQU 8+  X %JT “U  X %JT #PVKQEJKC  I -QRH T OKV &KCFGO WPF   5VTCJNGPDKPFG'NGHCPVIGJVNOKV(CEMGNFCJKPVGT(ÒNNJQTP*QWIJVQP50)5RCGT  4)TÒPDTCWPG2CVKPCUGJTUEJÌP

7754



1,5:1

6T[RJQP  X %JT “U #PVKQEJKC  I -QRH T OKV &KCFGO/CMGFQPKUEJGT *GNO N OKV   +DGZ*QTPN<YGKI50)5RCGT )TÒPG2CVKPCXQT\ÒINKEJ

 111


GRIECHEN • SYRIA

7755

1,5:1



“U #PVKQEJKC  I -QRH T OKV &KCFGO/CMGFQPKUEJGT *GNO N OKV +DGZ*QTP 50) 5RCGT    XGTINHH 5GJTUGNVGPG8CTKCPVG)TÒPG2CVKPCHCUVXQT\ÒINKEJXQT\ÒINKEJ

7756

1,5:1



1,5:1

1,5:1

-NGQRCVTC6JGCWPF#PVKQEJQU8+++X%JT“U,CJTUGNGWMKFKUEJGTTC X %JT  #MG2VQNGOCKU  I -QRH T OKV 5VTCJNGPDKPFG-QRHUEJOWEM FGT +UKU 0GYGNN .5/    50)5RCGT )TÒPG2CVKPCXQT\ÒINKEJGU'ZGORNCT

7757

1,5:1





7758

1,5:1



“U,CJTUGNGWMKFKUEJGTTC X%JT #MG2VQNGOCKUI-QRHTOKV5VTCJNGPDKPFG -QRHUEJOWEMFGT+UKU0GYGNN.5/50)5RCGT 5GJTUEJÌP





#PVKQEJQU8+++4GIKGTWPIX%JT“U#PVKQEJKCI-QRHTOKV&KCFGO&QRRGN HÒNNJQTP50)5RCGTXGTINHH -PCRRGT5EJTÌVNKPIUGJTUEJÌP



1,5:1



7759

1,5:1

#PVKQEJQU +:  X %JT “U ,CJT  UGNGWMKFKUEJGT TC   X %JT  WPDGUVKOOVG  

RJÌPK\KUEJG! /ÒP\UV·VVGI'TQUMQRHT0KMGIGJVNOKV-TCP\WPF2CNO\YGKI*QWIJVQP 50)5RCGT &WPMNG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

1,5:1

 112

7760

1,5:1

“U #PVKQEJKC !   I <GWUMQRH T6[EJG UVGJV N CWH 2TQTC OKV (ÒNNJQTP *QWIJVQP    50)5RCGT 4)TÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • SYRIA

7761

7762

1,5:1

1,5:1



#06+1%*+# “U  ,CJTJWPFGTV X ,CJTJWPFGTV P %JT  I 6[EJGMQRH T OKV 5EJNGKGT WPF   /CWGTMTQPG9KFFGT URTKPIV T \WTÒEMDNKEMGPF FCJKPVGT 5VGTP WPF *CNDOQPF $/%  $WVEJGT    50)%QR .QEJWPIUXGTUWEJUQPUVUGJTUEJÌPpXQT\ÒINKEJ





#2#/'+#“U,CJTUGNGWMKFKUEJGTTC X%JT I<GWUMQRHTOKV.QTDGGTMTCP\ 'NGHCPVUVGJVT$/%50)/ÒPEJGP  8QPCNNGTITÌ­VGT5GNVGPJGKV9QJNWPGFKGTV&WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5VÒEMGOKVFGT&CVKGTWPI,CJTUGNTCYCTGPDKUJGTPKEJVDGMCPPVUKGJGFKG#WHNKUVWPIFGTDGMCPPVGP,CJTGKO 42%+5

7763

1,5:1



1,5:1

%*#.-+52VQNGOCKQU+X%JT“U,CJTUGNGWMKFKUEJGTTC X%JT I <GWUMQRH T OKV .QTDGGTMTCP\<YGK -TKGIGT FKG &KQUMWTGP!  OKV LG GKPGO 5RGGT WPF GKPGO 5EJYGTV   UVGJGPGKPCPFGTIGIGPÒDGT-KPFNGT &WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7764



7765

1,5:1

1,5:1

1,5:1

1,5:1



*'.+121.+5 “U  ,CJTJWPFGTV P %JT  I /CTU[CU IGJV T OKV 9GKPUEJNCWEJ+P-TCP\ 'VJPKMQP.KPFITGP%QNN 4)TÒPG2CVKPCXQT\ÒINKEJ





.#1&+-'+##&/#4'“U,CJTJWPFGTVX%JTI#TVGOKUMQRHNÒDGTFGT5EJWNVGT-Ì EJGT'DGTMQRHN50)%QR $TCWPG2CVKPCUGJTUEJÌP



1,5:1



7766

1,5:1

5'.'7-'+#2+'4+#“U,CJTWPNGUGTNKEJ WOX%JT I<GWUMQRHTOKV.QTDGGTMTCP\ +P.QTDGGTMTCP\$NKV\50)/ÒPEJGPXGTINHH &WPMNG2CVKPCXQT\ÒINKEJ

 113


GRIECHEN • PHOENICIA

7767 1,5:1



1,5:1

“U,CJTUGNGWMKFKUEJGTTC X%JT I<GWUMQRHTOKV.QTDGGTMTCP\+P.QT DGGTMTCP\$NKV\50)/ÒPEJGP )TÒPG2CVKPCUGJTUEJÌP

7768

1,5:1

1,5:1



7769

2*1'0+%+# 

#-'261.'/#+5“U,CJTUGNGWMKFKUEJGTTC !X%JT I-ÌRHGFGT&KQU MWTGPT(ÒNNJQTP-CFOCPXGTINHH &WPMNG2CVKPCUGJTUEJÌP





#4#&15 “U  X %JT  I /GGTGUIQVV N OKV -TCP\ WPF &GNRJKP)CNGGTG T $/%    50)%QR &WPMNG2CVKPCHCUVXQT\ÒINKEJ



7770

7771

1,5:1



1,5:1

1,5:1

1,5:1

“U ,CJT    X %JT   I <GWUMQRH T OKV .QTDGGTMTCP\2TQTC N $/% XGTIN    $TCWPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT5COONWPI/CWTKEG.CHHCKNNG#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



“U,CJT X%JT I-ÌRHGFGU<GWUWPFFGT*GTCPGDGPGKPCPFGTT2TQTCN FCTCWH#VJGPCNOKV5RGGTWPF5EJKNF$/% &WPMNG2CVKPCUGJTUEJÌP



7773

7772



“U,CJT X%JT I6[EJGMQRHTOKV/CWGTMTQPG2QUGKFQPUKV\VNOKV-TCP\ WPF&TGK\CEMCWH2TQTCN$/% )TÒPDTCWPG2CVKPCUGJTUEJÌP





“U,CJT X%JT I6[EJGMQRHTOKV/CWGTMTQPG2QUGKFQPUKV\VNOKV-TCP\ WPF&TGK\CEMCWH2TQTCN$/% 5GJTUEJÌPXQT\ÒINKEJ



1,5:1

7774

1,5:1

7775



$'4;615 “U  ,CJTJWPFGTV X ,CJTJWPFGTV P %JT  I 0KMG IGJV N OKV -TCP\.KVWWU N   $/%XGTINHH50)%QRXCT )TÒPG2CVKPCHCUVXQT\ÒINKEJ





“U,CJTJWPFGTVP%JTI/CTU[CUUVGJVN2TQTCT$/%HH50)%QR  )TÒPG2CVKPCUGJTUEJÌP



114


GRIECHEN • JUDAEA

7776

1,5:1



1,5:1

5+&10 #DFB#UJVCTV +  X %JT “U ,CJT     X %JT   I -QRH T OKV   -TQPG)CNGGTGN$GVN[QPKP#05/0   8QPITQ­GT5GNVGPJGKV(CUVXQT\ÒINKEJ



$GVN[QPMGPPVFCU5VÒEMPKEJVOKVFKGUGO4GIKGTWPIULCJT

7777

7778

1,5:1

1,5:1

1,5:1

1,5:1



5VCFV “U  X %JT  I 6[EJGMQRHTOKV5EJNGKGTWPF/CWGTMTQPG2TQTCNFCTCWH#UV CTVG$/%XGTINH 5GJTUEJÌP





“U ,CJT      I 6[EJGMQRH T OKV 5EJNGKGT WPF /CWGTMTQPG FCJKPVGT #RJNCUVQP   )CNGGTGN$/% 5GJTUEJÌPpXQT\ÒINKEJ



7779

7780

1,5:1

1,5:1

1,5:1

1,5:1



6;415 “U ,CJT      I 6[EJGMQRH T OKV 5EJNGKGT WPF /CWGTMTQPG ÒDGT FGT   5EJWNVGT2CNO\YGKI2CNOG$/%50)%QR 45EJYCT\G2CVKPCUGJTUEJÌP





“U ,CJT     I 6[EJGMQRH T OKV 5EJNGKGT WPF /CWGTMTQPG2CNOG $/%    50)%QR 45EJYCT\G2CVKPCXQT\ÒINKEJ



7781

7782

1,5:1

1,5:1



1,5:1

1,5:1

“U,CJT  I6[EJGMQRHTOKV5EJNGKGTWPF/CWGTMTQPGÒDGTFGT5EJWNVGT2CNO \YGKI)CNGGTGNFCTCWH#UVCTVGN$/%50)%QR &WPMNG2CVKPCXQT\ÒINKEJ



+7&#'# 

#ODKDWNWU2TQMWTCVQT“U,CJTFGU#WIWUVWU  IJTG2CNOG/GUJQTGT 6TGCUWT[ 5GJTUEJÌP

1,5:1

7783



1,5:1

2#46*+# 

1TQFGU ++  X %JT “%JCNMWU 'MDCVCPC  I -QRH N OKV 6KCTC5EJCH N 5GNNYQQF    5JQTG 5GJTUEJÌPpXQT\ÒINKEJ

 115


GRIECHEN • BACTRIA

7784

1,5:1

1,5:1

$#%64+# 

&GOGVTKQU +  X %JT “&KEJCNMQP 2CPLJKT  I *GTCMNGUMQRH T OKV -GWNG#TVGOKU   UVGJVXXOKV$QIGP$0$CEV&/KVEJKPGT+PFQITGGMF50)#05  4$TCWPG2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

1,5:1

7785



1,5:1

#');2675 

2VQNGOCKQU ++  X %JT “&KEJCNMQP  X %JT #NGZCPFTKC  I -QRH FGU <GWU   #OOQPTOKV6CGPKG#FNGTUVGJVNCWH$NKV\50)%QR5XQTQPQU9GKUGT  $TCWPG2CVKPCUGJTUEJÌP



7786 1,5:1



1,5:1

“1DQNXQTX%JT#NGZCPFTKCI<GWUMQRHTOKV.QTDGGTMTCP\#FNGTUVGJVNCWH$NKV\ FCXQT5EJKNFTF50)%QR5XQTQPQU9GKUGT  -CDKPGVVUVÒEM+PFKGUGT'TJCNVWPI·W­GTUVUGNVGP&WPMNG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



7787 1,5:1



“1DQNXQTX%JTWPDGMCPPVG/ÒP\UV·VVGI<GWUMQRHTOKV.QTDGGTMTCP\#FNGTUVGJVN CWH$NKV\50)%QR5XQTQPQU9GKUGT  2TCEJVGZGORNCTXQPHGKPGO5VKN/KPDGCTDGKVGV5VGORGNINCP\XQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

116

1,5:1




GRIECHEN • AEGYPTUS

7788

7790

1,5:1

7789

1,5:1



“1DQN PCEJ  X %JT 6[TQU  I -QRH FGU <GWU #OOQP T OKV 6CGPKG#FNGT UVGJV N CWH   $NKV\FCXQT-GWNG50)%QR5XQTQPQU9GKUGT )TÒPG2CVKPCXQT\ÒINKEJ





“1DQN PCEJ  X %JT 6[TQU  I -QRH FGU <GWU #OOQP T OKV 6CGPKG#FNGT UVGJV N CWH   $NKV\FCXQT-GWNG50)%QR5XQTQPQU9GKUGT $TCWPG2CVKPCUGJTUEJÌP





“&KEJCNMQPPCEJX%JT6[TQUI-QRHFGU<GWU#OOQPTOKV6CGPKG#FNGTUVGJVNCWH $NKV\FCXQT-GWNG50)%QR5XQTQPQU9GKUGT &WPMNG2CVKPCIWVGUUGJTUEJÌP



7791

1,5:1



1,5:1

2VQNGOCKQU+++X%JT“&KQDQN ! #NGZCPFTKCI&TCRKGTVG$ÒUVGTOKV.QT DGGTMTCP\#FNGTUVGJVNCWH$NKV\FCXQT(ÒNNJQTP50)%QR5XQTQPQU9GKUGT  8QPITQ­GT5GNVGPJGKV)TÒPUEJYCT\G2CVKPCXQT\ÒINKEJ 'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T 2VQNGO·KUEJG2QTVT·VOÒP\GPKPUDGUQPFGTGKP$TQP\GUKPFCW­GTQTFGPVNKEJUGNVGP





7793

7792





7792

“&TCEJOGX%JT#NGZCPFTKCI-QRHFGU<GWU#OOQPTOKV6CGPKG#FNGTUVGJVN FCXQT(ÒNNJQTP50)%QR5XQTQPQU9GKUGT  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP$TCWPG2CVKPCHCUVXQT\ÒINKEJ



2VQNGOCKQU8X%JT“UX%JT#NGZCPFTKCI9KFFGTUVGJVT#FNGTUVGJVN CWH$NKV\FCXQT5VGTP50)%QR5XQTQPQU9GKUGT 5GJTUEJÌP

 117


GRIECHEN • CYRENAICA

7794

7795

7796



“1DQN  X %JT 5CNCOKU  I -QRH FGU <GWU #OOQP T OKV 6CGPKG-WNVDKNF FGT M[   RTKUEJGP#RJTQFKVG50)%QR5XQTQPQU9GKUGT )TÒPG2CVKPCXQT\ÒINKEJUGJTUEJÌP





“6TKJGOKQDGNKQPX%JT#NGZCPFTKCI*GTCMNGUMQRHKO.ÌYGPHGNNT#FNGTUVGJVN OKV-GT[MGKQP\WTÒEMDNKEMGPF50)%QR5XQTQPQU9GKUGT $TCWPG2CVKPCUGJTUEJÌP





2VQNGOCKQU8+X%JT“6GVTQDQNX%JT#NGZCPFTKCI&TCRKGTVG$ÒUVGFGT +UKU T OKV JTGPMTCP\#FNGT UVGJV N CWH $NKV\ FCXQT /QPQITCOO 50) %QR  5XQTQPQU    9GKUGT $TCWPG2CVKPCWPTGIGNO·­KIGT5EJTÌVNKPIUGJTUEJÌP



7797

1,5:1

1,5:1

%;4'0#+%# 

-1+010 “U WO  X %JT  I -QRH FGU <GWU #OOQP T5KNRJKWO $/%  50) %QR   XGTIN $TCWPG2CVKPCUGJTUEJÌP



7799

7798

1,5:1

1,5:1

1,5:1

1,5:1

<'7)+6#0+# 

-#46*#)1“UX%JTI6CPKVMQRHN2HGTFURTKPIVT#NGZCPFTQRQWNQU  $TCWPG2CVKPCOKPDGCTDGKVGVXQT\ÒINKEJGU'ZGORNCTXQPHGKPGO5VKN



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T



“UX%JTI6CPKVMQRHN2HGTFURTKPIVT#NGZCPFTQRQWNQU  &WPMNG2CVKPCNGKEJVDGCTDGKVGVHGKPGT5VKN4GXGTUNGKEJVFG\GPVTKGTVXQT\ÒINKEJHCUVXQT\ÒINKEJ

1,5:1

 118

7800



1,5:1

“UX%JTI6CPKVMQRHN2HGTFURTKPIVT#NGZCPFTQRQWNQU  )TÒPG2CVKPCXQT\ÒINKEJ




GRIECHEN • ZEUGITANIA

7801

1,5:1



7802

1,5:1

1,5:1

1,5:1

“UX%JTI6CPKVMQRHNFCTCWHTWPFGT)GIGPUVGORGN5VGTP2HGTFURTKPIVT#NGZ CPFTQRQWNQU )TÒPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“UX%JT ! I6CPKVMQRHT2HGTFURTKPIVT#NGZCPFTQRQWNQU  44)TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7803

1,5:1



7804

1,5:1

1,5:1

1,5:1



“UX%JTI6CPKVMQRHN2HGTFUVGJVTFCJKPVGT2CNOG#NGZCPFTQRQWNQU  $TCWPG2CVKPCXQT\ÒINKEJUGJTUEJÌP





“UX%JTI6CPKVMQRHN2HGTFUVGJVTFCJKPVGT2CNOG#NGZCPFTQRQWNQU  )TÒPG2CVKPCHCUVXQT\ÒINKEJ



7805 1,5:1



“UX%JTI6CPKVMQRHN2HGTFUVGJVTFCJKPVGT2CNOG#NGZCPFTQRQWNQUO  &WPMNG2CVKPCXQT\ÒINKEJ

1,5:1



1,5:1



7806 1,5:1

“UX%JTI6CPKVMQRHN2HGTFGMQRHT#NGZCPFTQRQWNQU  $TCWPITÒPG2CVKPCNGKEJVDGCTDGKVGVXQT\ÒINKEJ



7807 1,5:1



1,5:1

“UX%JTI6CPKVMQRHN2HGTFGMQRHT#NGZCPFTQRQWNQU  $TCWPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌPpXQT\ÒINKEJ

 119


PRÄGUNGEN UNTER RÖM. HERRSCHAFT

7808

7808

7809

1,5:1



“U,CJTJWPFGTVX%JTWPDGMCPPVG/ÒP\UV·VVGI6CPKVMQRHN2HGTFUVGJVN#NGZCPFTQRQW NQU $TCWPG2CVKPCHCUVUGJTUEJÌP





“5EJGMGNX%JTI6CPKVMQRHN2HGTFUVGJVTFCJKPVGT2CNOG#NGZCPFTQRQWNQUC $TCWPG2CVKPCHCUVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

)4+'%*+5%*'24)70)'0706'4 4¤/+5%*'4*'445%*#(6

7810



7811

#WIWUVWU  X P %JT “U 2JKNKRRK /CEGFQPKC  I8KEVQTKCIGJVNOKV-TCP\WPF2CNO \YGKI&TGK(GNF\GKEJGP42% 5GJTUEJÌP



&CU5VÒEMKUVOÌINKEJGTYGKUGGTUVWPVGT%NCWFKWUQFGT0GTQIGRT·IVYQTFGPUKGJG42%5



“U2JKNKRRK /CEGFQPKC I8KEVQTKCIGJVNOKV-TCP\WPF2CNO\YGKI&TGK(GNF\GKEJGP42% 5GJTUEJÌP



7812

1,5:1



1,5:1

“&WRQPFKWUX%JT-TCIQU6NQU .[EKC I#RQNNQMQRHTOKV.QTDGGTMTCP\+P-TCP\ &TGKHW­42% 8QPITQ­GT5GNVGPJGKV&WPMGNITÒPG2CVKPCNGKEJVMQTTQFKGTVXQT\ÒINKEJ



6TQZGNN 0T MCPPVGPWTGKP'ZGORNCT

7814

7813

7814



“U,CJTFGT5KGIGU·TCXQP#EVKWO  #PVKQEJKC 5[TKC .GICV3%CGEKNKWU/GVGNNWU%TG VKEWU5KNCPWUI<GWUMQRHTOKV.QTDGGTMTCP\9KFFGTURTKPIVT\WTÒEMDNKEMGPFFCTÒDGT5VGTP 42% )TÒPG2CVKPCUGJTUEJÌP



“UWPDGMCPPVG/ÒP\UV·VVGI-QRHT(KUEWU5VWJN*CUVG42%

120

45EJÌPpUGJTUEJÌP

 


PRÄGUNGEN UNTER RÖM. HERRSCHAFT

7815

7816

1,5:1

1,5:1



 WPF #ITKRRC “#U JCNDKGTV   0GOCWUWU  I -QRH FGU #ITKRRC N-TQMQFKN CP 2CNOG   IGMGVVGVT4+%w42% )TÒPG2CVKPCUGJTUEJÌP





WPF4JQKOGVCNMGUXQP$QURQTWU“UI-QRHFGU#WIWUVWUT-QRHFGU4JQKOGVCNMGUTOKV &KCFGO42% $TCWPG2CVKPCXQT\ÒINKEJ



7817

7819

7818



“UI-QRHFGU#WIWUVWUT-QRHFGU4JQKOGVCNMGUTOKV&KCFGO42%  $TCWPG2CVKPCUGJTUEJÌP



OKV4JQKOGVCNMGUWPF2[VJQFQTKUXQP$QURQTWU“UXP%JTI-QRHFGU#WIWUVWUT -ÌRHGFGU4JQKOGVCNMGUWPFFGT2[VJQFQTKUT42% )TÒPG2CVKPCIWVGUUGJTUEJÌP



6KDGTKWUHÒT.KXKC“U6TKRQNKU .[FKC I-QRHN-GWNG42%  &WPMNG2CVKPCUGJTUEJÌP

1,5:1



7820

1,5:1

 

1,5:1

%NCWFKWU“U#K\CPKU 2JT[IKC I&TCRKGTVG5GPCVUDÒUVGTOKV&KCFGO&TCRKGTVG$ÒUVG FGT#TVGOKUTÒDGTFGT5EJWNVGT-ÌEJGT42% 4&WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ

7821



7822



1,5:1



“U,CJT  #KIGCK %KNKEKC I6[EJGMQRHTOKV/CWGTMTQPG2HGTFGMQRHN42% 5GJTUEJÌP





0GTQ“UWO5CTFGKU .[FKC 5VTCVGIQU6KDGTKQU-NCWFKQU/PCUGCUI&TCRKGTVG$ÒUVG FGU*GTCMNGUTOKV.QTDGGTMTCP\0KMGUVGJVNOKV-TCP\WPF2CNO\YGKI42%  &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



1,5:1



7823

1,5:1

“U ,CJT  FGT ECGUCTKCPKUEJGP TC    #PVKQEJKC 5[TKC   I #RQNNQMQRH T.QTDGGT   \YGKI42% &WPMNG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 121


PRÄGUNGEN UNTER RÖM. HERRSCHAFT

7824

1,5:1



“U,CJTFGTECGUCTKCPKUEJGPTC  #PVKQEJKC 5[TKC I6[EJGMQRHTOKV5EJNGKGT WPF/CWGTMTQPG#NVCT42% &WPMNG2CVKPCXQT\ÒINKEJ

7825

1,5:1



1,5:1



1,5:1

HÒT#ITKRRKPCHKNKC“UWO*KGTCRQNKU 2JT[IKC /CIKUVTCV/CI[VGUI&TCRKGTVG$ÒUVGT &GOGVGTUKV\VNOKVJTGPWPF/QJPMWIGNP42% 445EJYCT\G2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

7827

7826



)CNDC“U6CXKQP !)CNCVKC I&TCRKGTVG$ÒUVGFGU/GPNOKVRJT[IKUEJGT/ÒV\GCWH /QPFUKEJGN5GEJU·WNKIGT6GORGN42% &WPMNG2CVKPCUGJTUEJÌP





8GURCUKCPWU“U,CJTFGTECGUCTKCPKUEJGPTC  #PVKQEJKC 5[TKC I6[EJG MQRHTOKV5EJNGKGTWPF/CWGTMTQPG#NVCT50)/ÒPEJGP $TCWPG2CVKPCHCUVUGJTUEJÌP



7828

7829

1,5:1

1,5:1



&QOKVKCPWU“U2JKNKRRQRQNKU 6JTCEKC I-QRHTOKV5VTCJNGPDKPFG#TGUUVGJVN OKV*GNO5EJKNFWPF5RGGT42% &WPMGNITÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





WPF&QOKVKC“U'RJGUQU +QPKC I$GKFGT$ÒUVGPGKPCPFGTIGIGPÒDGT0KMGIGJVNOKV-TCP\ WPF<YGKI42% )TÒPG2CVKPCHCUVXQT\ÒINKEJ



7830 1,5:1



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

122

1,5:1

6TCKCPWU“U%CGUCTGC %CRRCFQEKC I-QRHTOKV.QTDGGTMTCP\-QRHFGU <GWU#OOQPT5[FGPJCOXCT 4$TCWPG2CVKPCXQT\ÒINKEJ




PRÄGUNGEN UNTER RÖM. HERRSCHAFT

1,5:1



7831

1,5:1

#PVQPKPWU + 2KWU  “U /CKQPKC .[FKC   I *GTCMNGUMQRH T1ORJCNG UVGJV T OKV   -GWNGWPF.ÌYGPHGNN$/%HH &WPMNG2CVKPCXQT\ÒINKEJ



'KP 1TCMGNURTWEJ JCVVG *GTCMNGU XGTRHNKEJVGV UKEJ HÒT FTGK ,CJTG CNU 5MNCXG \W XGTMCWHGP WPF FGP -CWHRTGKU FGO   8CVGTFGUXQPKJOGTUEJNCIGPGP+RJKVQU\WIGDGP*GTCMNGUXGTMCWHVGUKEJCP1ORJCNGFKG-ÌPKIKP/·QPKGPU#NU 1ORJCNG GTMCPPVG YGT KJT 5MNCXG YCTICDUKGKJOFKG(TGKJGKV\WTÒEMWPFJGKTCVGVGKJP1ORJCNGNGIVG*GTCMNGU (TCWGPMNGKFGTCPWPFVTWIUGNDUVUGKPG-GWNGWPFUGKP.ÌYGPHGNN

7832

1,5:1

1,5:1



“U,CJT  #PC\CTDQU %KNKEKC I-QRHTOKV5VTCJNGPDKPFG6[EJGUKV\VNWPVGP UEJYKOOGPFGT(NW­IQVV2[TCOQU50)(TCPEG50).GXCPVG  &WPMGNITÒPG2CVKPCXQT\ÒINKEJ



7834

7833





7833

#PVQPKPWU +++ %CTCECNNC  “U#PVKQEJKC 2KUKFKC I-QRHTOKV.QTDGGT MTCP\9ÌNHKPTU·WIV4QOWNWUWPF4GOWU-T\[\CPQYUMC#X:::+84X  &WPMNG2CVKPCUGJTUEJÌP



#PVQPKPWU +8 'NCICDCN  “U $GT[VWU 2JQGPKEKC   I &TCRKGTVG $ÒUVG T OKV .QTDGGT   MTCP\/CTU[CUUVCVWGKP#GFKEWNCTFCTÒDGT.ÌYGPTGKVGTT$/% $TCWPG2CVKPCUGJTUEJÌP



7835

7836



)QTFKCPWU+++“U*CFTKCPQRQNKU 6JTCEKC I&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\ #VJGPCIGJVTOKV5RGGTWPF5EJKNFFCXQT5EJNCPIG8CTDCPQX )TÒPG2CVKPCUGJTUEJÌP





2JKNKRRWU+WPF1VCEKNKC5GXGTC“U/GUGODTKC 6JTCEKC I$GKFGT$ÒUVGPGKPCPFGT IGIGPÒDGT&GOGVGTUVGJVNOKVJTGPWPF(CEMGN8CTDCPQX 4&WPMNG2CVKPCUGJTUEJÌP

 123


KELTISCHE MÜNZEN



/ª0<'0&'4#06+-'09'.6 /+652+6<'056ª%-'0#75241/+0'06'05#//.70)'0 #0%+'06%1+05 *+)*.+)*6'&$;/#56'42+'%'5(41/(#/175%1..'%6+105



-'.6+5%*'/ª0<'0

7838

7837

1,5:1

1,5:1

$4+6#00+# 

#64'$#6'5 Ô5VCVGT  X %JT %CNNGXC 5KNEJGUVGT   I #RQNNQMQRH T2HGTF T OKV   .GPMGTFCTWPVGT4CFXCP#TUFGNN 5GJTUEJÌP





8GTKEC  Ô 5VCVGT   I +P XGTVKGHVGO 4GEJVGEM %1/(2HGTF UVGJV T XCP #TU   FGNN 8QT\ÒINKEJ



7841

7839

7840

1,5:1

1,5:1



&74164+)'5 Ô5VCVGT  X %JT  I 5VKNKUKGTVGT -QRH T5VKNKUKGTVGU 2HGTF N FCTWPVGT   UVKNKUKGTVGT-TGDUXCP#TUFGNN 5GJTUEJÌP





64+018#06'5#FFGFQOCTQUÔ5VCVGTX%JTI<YGK-T·P\GÒDGT-TGW\OKV\YGK JCNDOQPFHÌTOKIGP)GDKNFGPOKV+PPGP\GKEJPWPIFGMQTKGTV2HGTFTFCTWPVGT-WIGNWPF4CFFCTÒDGT 2WPMVKP-TGKUXCP#TUFGNN 5GJTUEJÌP



&KGJCNDOQPFHÌTOKIGP)GDKNFGOKVKJTGT+PPGP\GKEJPWPIGTKPPGTPCP/WUEJGNP



6CUEKQXCPWUX%JTÔ5VCVGTX%JTI<YGK-T·P\GÒDGT-TGW\KPFGT/KVVG FTGK2WPMVG\YKUEJGP\YGK*CNDOQPFGP4GKVGTTFCJKPVGTWPFKO#DUEJPKVV4CFXCP#TUFGNN 9KP\-TCV\GTHCUVXQT\ÒINKEJ 

7842 7844

7843 1,5:1

1,5:1

)#..+# 

#'&7+ Õ3WKPCT -CNGVGFQW5GTKG  ,CJTJWPFGTV X %JT  I -QRH N OKV *GNO2HGTF N   &GNGUVT¾G6CEJG 5GJTUEJÌP





#7.'4%+&+#$.+06'5'N5VCVGT,CJTJWPFGTVX%JTI-QRHTXQP2GTNUEJPÒTGPOKV -ÌRHGP WOIGDGP5VKNKUKGTVGT 'KPUR·PPGT OKV CPFTQMGRJCNGO 2HGTF T ÒDGT NKGIGPFGT )GUVCNV T &G   NGUVT¾G6CEJG 45EJÌP



%#4076'5Õ&TCEJOG,CJTJWPFGTVX%JTI-QRHNOKV.QTDGGTMTCP\*WPFCWH2HGTF TWPVGP6TKUMGNKU&GNGUVT¾G6CEJG 5GJTUEJÌP



 124


KELTISCHE MÜNZEN

7845

1,5:1



'.75#6'5 Õ&TCEJOG  ,CJTJWPFGTV X %JT  I 5VCTM UVKNKUKGTVGT #RQNNQMQRH N2GICUQU   UVGJVN&GODUMK )WVGUUGJTUEJÌP

7846



1,5:1

7846

1,5:1

5'010'5Ô5VCVGT,CJTJWPFGTVX%JTI-TGW\)NCVV&GNGUVT¾G6CEJG  5GJTUEJÌP &KG<WYGKUWPIKUVPKEJVIGUKEJGTV/ÌINKEJGTYGKUGYWTFGFGT5VCVGTXQPFGP%CTPWVGUIGRT·IV

7847





7849

7848

$'.)+%# 

#/$+#0+ Ô5VCVGT  X %JT  I 5VKNKUKGTVGT -QRH T5VKNKUKGTVGU 2HGTF T \YKUEJGP   2WPMVGPWPF*CNDOQPFGP&GNGUVTG¾6CEJGXGTIN 5GJTUEJÌP





Ô5VCVGT  X %JT  I $WEMGN5VKNKUKGTVGU 2HGTF T \YKUEJGP 2WPMVGP WPF *CNDOQPFGP   &GNGUVTG¾6CEJGXGTINHH (CUVXQT\ÒINKEJ





Ô5VCVGT  X %JT  I $WEMGN5VKNKUKGTVGU 2HGTF T \YKUEJGP 2WPMVGP WPF *CNDOQPFGP   &GNGUVTG¾6CEJGXGTINHH #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



1,5:1

7850



7850

/'.&+4QXGEC“UX%JTI-QRHNOKV*GNO.ÌYGURTKPIVT&GNGUVT¾G6CEJG &WPMGNITÒPG2CVKPCUGJTUEJÌP



7852 1,5:1

7851

1,5:1

1,5:1

1,5:1

)'4/#0+# 

#010;/ Õ3WKPCT  ,CJTJWPFGTV X %JT  I 6CP\GPFGU /·PPNGKP OKV 6QTSWGU WPF   5EJNCPIG2HGTFT-QRH\WTÒEMIGYCPFV%CUVGNKP<ÒTKEJHH&GODUMK  *GTXQTTCIGPF\GPVTKGTVGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ





Õ*GOKQDQN,CJTJWPFGTVX%JTI-QRHTFKG*CCTGCNU*CNDDÌIGPCPIGFGWVGV2WPMVCWIG -TGW\KPFGP9KPMGNP4KPIGNOKVWPFGWVNKEJGP#W­GPRWPMVGP&TGKGEMOKV2WPMVGPFGP9 QFGT /  OKV FTGK 2WPMVGP CP FGP WPVGTGP 'PFGP  ! -GNNPGT  XGTIN .6 XGTIN4ÒEMUGKVG  5NI.CP\5./ 45GJTUEJÌP



-GNNPGTXGTOWVGVFGPO·JTKUEJGP6[R.C6QWT#NNGOCIPGFW5WFWPF5EJGGTUKO%QORNGOGPV¯N #VNCUFG /QPPCKGU )CWNQKUGU PWT +PEGTVCKPGU KOKVCVKQPU FG /CTUGKNNG /KV 5KEJGTJGKV YGKUGP FCU &TGKGEM WPF FGT   $WEJUVCDG CNU 4GUVG XQP /# CWH GKP 8QTDKNF CWU /CTUGKNNG JKP &GT (WPFQTV FGU -GNNPGTUEJGP 5VÒEMGU  

2QNNCPVGP PÌTFNKEJ XQP +PIQNUVCFV  N·­V CWH GKPG GKPFGWVKI UÒFFGWVUEJG OÌINKEJGTYGKUG XKPFGNKMKUEJG *GTMWPHV   UEJNKG­GP

125


HISPANIA

7853



7855

7854

Õ&GPCT  I 5VKNKUKGTVGT -QRH T \YKUEJGP *CNDOQPF WPF 5VGTP)CKWU WPF .WEKWU %CGUCTGU   UVGJGPXXOKV5RGGTGPWPF5EJKNFGP 5GJTUEJÌP



&KGUGDCTDCTKUEJGXGTOWVNKEJIGTOCPKUEJG2T·IWPIKOKVKGTVFKG)CKWU.WEKWU&GPCTGFGU#WIWUVWU 4+%wHH 



8+0&'.+-'4Ô5VCVGT 4GIGPDQIGPUEJÒUUGNEJGP ,CJTJWPFGTVX%JTI8QIGNMQRHN \YKUEJGP\YGK-WIGNPFCXQT&TGKXKGTVGNMTCP\6QTSWGUOKV-WIGNP-GNNPGT6[R++& 5GJTUEJÌP





Ô5VCVGT  ,CJTJWPFGTV X %JT  I 6TKUMGNKU KP $N·VVGTMTCP\&TGK &QRRGNTKPIG WPF XKGT   2WPMVTKPIGKP<KEM\CEMGKPHCUUWPI-GNNPGT6[R+:$ 5GJTUEJÌP



ex 7857

7856

7858

$1*'/+# 

$1+'4Ô5VCVGT #NGZCPFTGKGT ,CJTJWPFGTVX%JTI#VJGPCMQRHTKPMQTKPVJKUEJGO*GNO 0KMGUVGJVNOKV-TCP\WPF5V[NKUN$NKV\&GODUMKXGTINHH2CWNUGPXGTIN6H  2WP\GCWHFGO#XGTUHCUVUGJTUEJÌPUEJÌP



Ô 5VCVGT  ,CJTJWPFGTV X %JT  I $WEMGN#VJGPC UVGJV N OKV 5RGGT WPF 5EJKNF   &GODUMK XGTIN  HH 2CWNUGP XGTIN  HH &C\W GKP \YGKVGU 'ZGORNCT UQYKG GKP Ô 5VCVGT  

$WEMGN6&GODUMK2CWNUGP &GODUMKXGTINHH2CWNUGPXGTIN 5VÒEM5GJTUEJÌP



.CWVDGKNKGIGPFGT$GUEJTGKDWPIUMCTVGFGT(KTOC&T$WUUQ2GWUYWTFGFCU5VÒEMWOKP6JÒTKPIGPIGHWPFGP





Ô5VCVGT  ,CJTJWPFGTV X %JT  I $WEMGN FCTCWH TGEJVGEMKIG 8GTVKGHWPI*CNDOQPFHÌTOK   IGT$WEMGN&GODUMK2CWNUGPXGTIN 45GJTUEJÌP 

7859

7859 1,5:1

2#0010+# 

Õ6GVTCFTCEJOG 6[R 4GKVGTUVWORH-TQKUDCEJ 'PFG  ,CJTJWPFGTV X %JT  I -QRH T OKV   FTGKHCEJGO2GTNFKCFGO4GKVGTCWHIGRWPMVGVGT$QFGPNKPKGN&GODUMKXGTINHH)ÌDN1UVMGNVGP -QUVKCNXGTIN #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

)4+'%*+5%*'/ª0<'0

7861

7860 7861

*+52#0+# 

$#45%70'5Õ&GPCTX%JTI/·PPGTMQRHT4GKVGTTOKV5EJYGTV$WTIQU 50)$/ (GKPG2CVKPCIWVGUUGJTUEJÌP





$+.$+.+5 “#U WO  X %JT  I ,ÒPINKPIUMQRH T OKV 2GTNGPMGVVG4GKVGT T OKV .CP\G   $WTIQU50)$/ )TÒPG2CVKPCIWVGUUGJTUEJÌP



126


ETRURIA

7862

7863

7865

7864



%#567.1 “#U UR·VGU  ,CJTJWPFGTV X %JT  I -QRH T OKV &KCFGO T *CPF5RJKPZ T   FCXQT5VGTP$WTIQU50)$/HH )TÒPG2CVKPCUGJTUEJÌP





-106'4$+#-#4$+-#Õ&GPCTUR·VGU,CJTJWPFGTVX%JTI/·PPGTMQRHT4GKVGTT OKV.CP\G$WTIQU50)$/ 45GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





5#+6+5#'6#$+“#UWOX%JTI-QRHTOKV&KCFGOFCJKPVGT2CNO\YGKI4GKVGT TOKV.CP\G$WTIQU50)$/ 4$TCWPG2CVKPCIWVGUUGJTUEJÌPUGJTUEJÌP





5'%1$+4+%'5Õ&GPCTX%JTI/·PPNKEJGT-QRHT4GKVGTTOKV.CP\G$WTIQU 50)$/ (GKPG2CVKPCUGJTUEJÌP



1,5:1

7866

1,5:1

)#..+# 

/#55#.+# Õ1DQN  X %JT  I #RQNNQMQRH N8KGTURGKEJKIGU 4CF FCTKP /#   &GRG[TQV 8QT\ÒINKEJ

1,5:1



1,5:1

Õ6GVTQDQNX%JTI&TCRKGTVG$ÒUVGFGT#TVGOKUTÒDGTFGT5EJWNVGT-ÌEJGT.ÌYG T&GRG[TQV 2T·IGUEJY·EJGPUQPUVIWVGUXQT\ÒINKEJ

2:1



7867



7868



2:1

0'/#7575 Õ1DQN WO  X %JT  I &TCRKGTVG $ÒUVG T OKV *GNO+P -TCP\ 0'/%1.   42% 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVJGTTNKEJGT2CVKPC



0GOCWUWU GKPG CNVG MGNVKUEJG 5KGFNWPI GTJKGNV XGTOWVNKEJ  X %JT FGP 5VCVWU GKPGT -QNQPKG NCVKPKUEJGP   4GEJVU#WIWUVWUXGTNKGJFGT5VCFVDGKFGT#PUKGFNWPIXQP8GVGTCPGPX%JTFCUXQNNGTÌOKUEJG4GEJV

7869

2:1

7869

'6474+# 

2127.10+#Õ#U ! X%JT ! I1MVQRWU)NCVV4WVVGT*KUVQTKC0WOQTWO 8GEEJK6JGEQKPCIGQHVJG4CUPC 448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI &KG<WYGKUWPIKUVPKEJVIGUKEJGTV

 127


CALABRIA

7870



7871

7871 1,5:1

Õ #UUGU PCEJ  X %JT  I )QTIQPGKQP)NCVV 4WVVGT *KUVQTKC 0WOQTWO  8GEEJK   6JGEQKPCIGQHVJG4CUPC++ #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

%#/2#0+# 

0'#21.+5Õ&KFTCEJOGWOX%JTI0[ORJGPMQRHTXQPXKGT&GNRJKPGPWOIGDGP #PFTQMGRJCNGT5VKGTTXQP0KMGDGMT·P\VFCTWPVGTDIFCXQTQ='?4WVVGT*KUVQTKC0WOQTWO 5CODQP50)#0550)/ÒPEJGP  4-PCRRGT5EJTÌVNKPIXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPCWPFXQPHGKPGO5VKN 

1,5:1

7872





7873

1,5:1

Õ&KFTCEJOGX%JTI0[ORJGPMQRHNFCJKPVGT*GNO#PFTQMGRJCNGT5VKGTTXQP 0KMGDGMT·P\VFCTWPVGT#4WVVGT*KUVQTKC0WOQTWO5CODQP50)#0550)/ÒPEJGP (CUVUGJTUEJÌP



2*+56'.+# Õ1DQN  X %JT  I /·PPGTMQRH HCUV X X&GNRJKP ÒDGT )GTUVGPMQTP   WPF/WUEJGN4WVVGT*KUVQTKC0WOQTWO5CODQP 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



7874

7875

7876

1,5:1

1,5:1

%#.#$4+# 

6#4'06 Õ&KFTCEJOG  X %JT  I 6CTCU CWH &GNRJKP T WPVGP /WUEJGN1KMKUVGU   UKV\VNOKV5RKPFGN(KUEJGT$QUUGTV4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO  4(GKPG2CVKPCMN-TCV\GTCWHFGO4GXGTUUGJTUEJÌP



Õ&KFTCEJOGX%JTI0CEMVGT4GKVGTNOKV5EJKNFWPF2GKVUEJG6CTCUCWH&GNRJKP N(KUEJGT$QUUGTV4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO  .GKEJVFG\GPVTKGTVHCUVXQT\ÒINKEJUGJTUEJÌP



Õ&KFTCEJOGX%JTI0CEMVGT4GKVGTNOKV5EJKNF6CTCUCWH&GNRJKPNOKVMQTKPV JKUEJGO*GNO(KUEJGT$QUUGTVXGTIN4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO  4/KPMQTTQFKGTVHCUVXQT\ÒINKEJ



6CTGPVFKGGKP\KIG2HNCP\UVCFV5RCTVCUYWTFGFGT5CIGPCEJCPFGT5VGNNGIGITÒPFGVYQGKP&GNRJKPFGPUEJKHHDTÒ EJKIGP6CTCUGKPGP5QJPFGU2QUGKFQPWPFFGT5CV[TCCP.CPFDTCEJVG&GT&GNRJKPTGKVGTYKTFUQCWEJXQP#TKUVQ VGNGUCNU6CTCUKFGPVKHK\KGTVGKPG&GWVWPIFKGJGWVGCPIG\YGKHGNVYKTF5QJCPFGNVGUUKEJ\WOKPFGUVDGKFGPHTÒJGP 2T·IWPIGP NCWV 9QNHICPI (KUEJGT$QUUGTV GKPFGWVKI WO 2JCNCPVQU 9KT DG\GKEJPGP FGP &GNRJKPTGKVGT JKGT WPF KO   (QNIGPFGPFGT6TCFKVKQPHQNIGPFCNU6CTCU  &KG 1KMKUVGU2T·IWPIGP UVGJGP XGTOWVNKEJ OKV GKPGT /CEJVGKPDW­G FGT #TKUVQMTCVKG PCEJ FGT 0KGFGTNCIG 6CTGPVU   IGIGPFKG/GUUCRKGTKO,CJTX%JTKP<WUCOOGPJCPI





$GKO4GXGTUUVGORGNYWTFGQHHGPDCTFCU+WPVGTFGO&GNRJKP\WGKPGOTGVTQITCFGP-IG·PFGTV (KUEJGT$QUUGTV  PCEJFGOWPUGT5VÒEMIGRT·IVYQTFGPKUV

128


CALABRIA

7877

7878

1,5:1

1,5:1





Õ&KFTCEJOG  X %JT  I 0CEMVGT 4GKVGT T OKV *GNO 5RGGT WPF 5EJKNF6CTCU CWH   &GNRJKPNOKV8CUGWPVGP9GNNGP(KUEJGT$QUUGTV4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO (GKPG2CVKPC5EJTÌVNKPIUTK­UGJTUEJÌP



Õ&KFTCEJOG  X %JT  I 4GKVGT T UGKP 2HGTF DGMT·P\GPF FCTWPVGT -GWNG6CTCU CWH   &GNRJKPNOKV-CPVJCTQU5EJKNFWPF&TGK\CEM(KUEJGT$QUUGTV4CXGN8NCUVQ4WVVGT*KUVQTKC 0WOQTWO 'VYCU(WPFDGNCIUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7880 7879





2:1

2:1

Õ&KFTCEJOGX%JTI0CEMVGT4GKVGTTOKV5RGGTGPWPF5EJKNF6CTCUCWH&GNRJKPT OKV*GNO(KUEJGT$QUUGTV)TWRRG 84 4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO 5GJTUEJÌP



Õ6TKVGOQTKQPX%JTI2HGTFGMQRHT2HGTFMQRHTFCXQT&TGKHW­4CXGN8NCUVQ 4WVVGT*KUVQTKC0WOQTWO 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

7881

7882

7883

7884

7882 1,5:1



Õ&KFTCEJOG  X %JT  I 4GKVGT T UGKP 2HGTF DGMT·P\GPF6CTCU CWH &GNRJKP N OKV   &TGKHW­4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO (GKPG6ÌPWPIXQT\ÒINKEJ



Õ&KFTCEJOG  X %JT  I 5CV[TCMQRH N0CEMVGT 4GKVGT T UGKP 2HGTF DGMT·P\GPF   FCJKPVGT&GNRJKPWPVGP#PMGT4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO  44GXGTUNGKEJVFG\GPVTKGTVXQT\ÒINKEJGU2TCEJVGZGORNCT 



Õ&KFTCEJOG  X %JT  I 0CEMVGT 4GKVGT T OKV *GNO .CP\G WPF 5EJKNF6CTCU CWH   &GNRJKPNOKV0KMGWPF(ÒNNJQTPFCJKPVGT$NKV\4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO  .GKEJVFG\GPVTKGTVHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&KFTCEJOGX%JTI0CEMVGT4GKVGTTUGKP2HGTFDGMT·P\GPF6CTCUCWH&GNRJKPN OKV*GNO\YKUEJGP\YGK5VGTPGP4CXGN8NCUVQHH4WVVGT*KUVQTKC0WOQTWO 5GJTUEJÌP







129


LUCANIA

7885

7887

1,5:1

1,5:1





7886

Õ&KFTCEJOGX%JTI0CEMVGT4GKVGTNUGKP2HGTFDGMT·P\GPF6CTCUCWH&GNRJKPN OKV&TGK\CEMFCJKPVGT'WNG4CXGN8NCUVQHH4WVVGT*KUVQTKC0WOQTWO  .GKEJVFG\GPVTKGTVOKPMQTTQFKGTVUGJTUEJÌPpXQT\ÒINKEJ



Õ&KFTCEJOG  X %JT /CIKUVTCV -CNNKMTCVGU  I 4GKVGT T XQP 0KMG DGMT·P\V6CTCU   TGKVGVNCWH&GNRJKPOKV&TGK\CEMWPF0KMG4CXGN8NCUVQ4WVVGT*KUVQTKC0WOQTWO  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



.7%#0+# 

*'4#-.'+# Õ&KFTCEJOG  X %JT /CIKUVTCV #TKUVQFCOQU  I #VJGPCMQRH HCUV X   XOKV MQTKPVJKUEJGO *GNO 5M[NNC CNU *GNO\KGT*GTCMNGU UVGJV N OKV 5M[RJQU (ÒNNJQTP .ÌYGPHGNN   WPF-GWNGFCXQT#NVCT4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC 

7889

7888



/'6#2106Õ5VCVGTX%JTIJTGJTGKPEWU0QëXGTIN4WVVGT*KUVQTKC 0WOQTWO 5GJTUEJÌP





“1DQNX%JTI*GTOGUUVGJVNOKV2CVGTCWPF-GT[MGKQPN6J[OKCVGTKQPJTGN OBOLOS,QJPUVQP$TQP\G%QKPCIGQH/GVCRQPVWO4WVVGT*KUVQTKC0WOQTWO  44&WPMGNITÒPG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0TWPFFGT5COONWPI/CIPCIWVK#WMVKQP5CPVCOCTKC4QO 0T  &CU5VÒEMVT·IVGKPGXQNNCWUIGUEJTKGDGPG9GTVCPICDG&KGUKUVCW­GTQTFGPVNKEJUGNVGP

7890

7891

7893

7892

7893 1,5:1



Õ&KFTCEJOG  X %JT  I &GOGVGTMQRH NJTG T 'HGWDNCVV 0QG,QJPUVQP  4WV   VGT*KUVQTKC0WOQTWO #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Õ&KFTCEJOG  X %JT  I &GOGVGTMQRH NJTG N <CPIG ,QJPUVQP %  4WVVGT   *KUVQTKC0WOQTWO 5GJTUEJÌP





Õ&KFTCEJOG  X %JT  I &GOGVGTMQRH TJTG T 0KMG ,QJPUVQP %  4WVVGT   *KUVQTKC0WOQTWO 5GJTUEJÌPXQT\ÒINKEJ





Õ&KFTCEJOG  X %JT  I &GOGVGTMQRH NJTG N #NVCT ,QJPUVQP %  4WVVGT   *KUVQTKC0WOQTWO -N5VGORGNDTWEJCWHFGO#XGTUCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

130


LUCANIA

7895

7894



Õ&KFTCEJOGX%JTI&GOGVGTMQRHTJTGNHNÌVGPURKGNGPFGT5CV[T,QJPUVQP& 4WVVGT*KUVQTKC0WOQTWO -N2T·IGUEJY·EJGUQPUVIWVGUUGJTUEJÌP





Õ&KFTCEJOGX%JTI&GOGVGTMQRHTJTGN-CPFGNCDGTT6J[TUQU,QJPUVQP& 4WVVGT*KUVQTKC0WOQTWO (GKPG6ÌPWPIMN2T·IGUEJY·EJGPUQPUVXQT\ÒINKEJ



7896



1,5:1

7896

Õ&KFTCEJOG  X %JT  I &GOGVGTMQRH TJTG N #OGKUG T (ÒNNJQTP OKV JTGP   ,QJPUVQP&4WVVGT*KUVQTKC0WOQTWO  5GJTUGNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC 

7898

7897

7897



215'+&10+# Õ5VCVGT  X %JT  I 2QUGKFQP UVGJV T OKV &TGK\CEM5VKGT UVGJV N   4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP (CUVUGJTUEJÌP



5;$#4+5 Õ5VCVGT  X %JT  I 5VKGT N -QRH \WTÒEMIGYCPFV+PEWU 4WVVGT *KUVQTKC   0WOQTWO50)#0550)/ÒPEJGP -N5EJTÌVNKPIUTK­UGJTUEJÌP 



)GO·­ FGT UEJTKHVNKEJGP ªDGTNKGHGTWPI YWTFG 5[DCTKU CNU ·NVGUVG ITKGEJKUEJG 2HNCP\UVCFV  X %JT IGITÒPFGV   8QPFGTJQJGP$NÒVG\WYGNEJGTFKGUG5VCCVGP /GVCRQPVWPF5[DCTKU KPWPINCWDNKEJMWT\GT<GKVIGFKGJGP\GWIGP CO NGDGPFKIUVGP FKG GKP\KIGPCWHWPUIGMQOOGPGP-WPUVYGTMGFKGUGTKVCNKUEJGP#EJ·GTKJTG/ÒP\GPXQPUVTGPIGT CNVGTVÒONKEJ UEJÌPGT #TDGKV ÒDGTJCWRV FKG HTÒJGUVGP &GPMO·NGT XQP -WPUV WPF 5EJTKHV KP +VCNKGP FGTGP 2T·IWPI   GTYGKUNKEJKO,F5V 4QOX%JT DGTGKVUDGIQPPGPJCVVG&KGUG/ÒP\GP\GKIGPFC­FKG#EJ·GTFGU 9GUVGPUPKEJVDNQ­VGKNPCJOGPCPFGTGDGPWOFKGUG<GKVKO/WVVGTNCPFGJGTTNKEJUKEJGPVYKEMGNPFGP$KNFPGTMWPUV UQPFGTPKPFGT6GEJPKMFGOUGNDGPYQJNICTÒDGTNGIGPYCTGPFGPPUVCVVFGTFKEMGPQHVPWTGKPUGKVKIIGRT·IVGPWPF TGIGNO·­KIUEJTKHVNQUGP5KNDGTUVÒEMGYGNEJGWOFKGUG<GKVKPFGOGKIGPVNKEJGP)TKGEJGPNCPFYKGDGKFGPKVCNKUEJGP &QTGTPÒDNKEJYCTGPUEJNWIGPFKGKVCNKUEJGP#EJ·GTOKVITQ­GTWPFUGNDUV·PFKIGT)GUEJKEMNKEJMGKVCWU\YGKINGKEJ CTVKIGPVGKNUGTJCDGPWPFVGKNUXGTVKGHVIGUEJPKVVGPGP5VGORGNPITQ­GFÒPPGUVGVUOKV#WHUEJTKHVXGTUGJGPG5KNDGTOÒP \GPFGTGPUQTIH·NVKIXQTFGT(CNUEJOÒP\GTGKLGPGT<GKV2NCVVKGTWPIIGTKPIGP/CVGTKCNUOKVFÒPPGP5KNDGTDN·VVGTP UKEJUEJÒV\GPFG2T·IYGKUGFGPYQJNIGQTFPGVGP-WNVWTUVCCVXGTT·V /QOOUGP4ÌO)GUEJ+5 

7899 1,5:1

1,5:1

7900



Õ1DQN  X %JT  I 5VKGT N -QRH \WTÒEMIGYCPFV)TQ­GU / ÒDGT 8 WOJGT 2WPMVG   4WVVGT*KUVQTKC0WOQTWO50)#0550)/ÒPEJGP 5GJTUEJÌP



6*74+1+Õ&KFTCEJOGX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO.QTDGGTMTCP\ CNU *GNO\KGT5VKGT UVGJV N KO #DUEJPKVV 6JWPHKUEJ 4WVVGT *KUVQTKC 0WOQTWO  50) #05   XGTIN50)/ÒPEJGP 8QPHGKPGO5VKN8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT6ÌPWPI 



+O ,CJTG  X %JT YWTFG OKV *KNHG #VJGPU 5[DCTKU +8 IGITÒPFGV 5VTCDQP     &KG 5VCFV PCJO CD  X   %JT YGKVGTG -QNQPKUVGP CWH FKG  X %JT FKG WTURTÒPINKEJGP $GYQJPGT XGTVTKGDGP &KGUG ITÒPFGVGP FCTCWHJKP   5[DCTKU8Y·JTGPF5[DCTKU+8KP6JWTKQKWODGPCPPVYWTFG&GT#XGTUWPUGTGU5VÒEMGUDG\KGJVUKEJCWHFKG4QNNG #VJGPUDGKFGT)TÒPFWPIFGT5VCFVY·JTGPFCWHFGO4GXGTUFGT5VKGTXQP5[DCTKUGTUEJGKPV

131


BRUTTIUM

7901

1,5:1

1,5:1



Õ&KFTCEJOGX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO5E[NNCCNU*GNO\KGT5VKGT UVGJV N FCTWPVGT 8QIGN KO #DUEJPKVV (KUEJ 4WVVGT *KUVQTKC 0WOQTWO  50) #05    50)/ÒPEJGP #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

7902

7903



Õ&KUVCVGT  X %JT  I #VJGPCMQRH N OKV CVVKUEJGO *GNO 5E[NNC CNU *GNO\KGT5VKGT   UVÌ­VTKO#DUEJPKVV(KUEJ0Që(4WVVGT*KUVQTKC0WOQTWO 5GJTUEJÌP





Õ&KUVCVGT  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO 5E[NNC CNU *GNO\KGT5VKGT   UVÌ­VTKO#DUEJPKVV(KUEJ0Që(4WVVGT*KUVQTKC0WOQTWO 5GJTUEJÌP



7904

7905 7905 1,5:1



8'.+# *;'.' Õ&TCEJOGX%JTI0[ORJGPMQRHT'WNGCWH<YGKIN4WVVGT *KUVQTKC0WOQTWO9KNNKCOU -N-TCV\GTUGJTUEJÌP



9KNNKCOUUEJTGKDV\WO0[ORJGPMQRHCWHFGO#XGTUFGU5VÒEMGU#JGCFQHEJCTOKPIUV[NG



Õ&KFTCEJOGWOX%JTI#VJGPCMQRHNOKVCVVKUEJGO*GNO)TGKHCNU*GNO\KGT.ÌYGN UEJN·IV*KTUEJN4WVVGT*KUVQTKC0WOQTWO9KNNKCOU  5GJTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

7906

7907



7908

7906 1,5:1

$4766+7/ 

270+'4706'4*#00+$#.Õ5EJGMGNX%JT-CTVJCIQ ! I6CPKVMQRHN OKV JTGPMTCP\2HGTF T FCTÒDGT 5QPPGPUEJGKDG OKV 7TCGK FCTWPVGT RWPKUEJGT $WEJUVCDG 4WVVGT   *KUVQTKC0WOQTWO 44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  &KGUG/ÒP\GPYWTFGKP-CTVJCIQIGRT·IVWPFIGNCPIVGPÒDGTFKG*·HGP$TWVVKWOU\WFGP6TWRRGPKP+VCNKGP



Õ 5EJGMGN  X %JT -CTVJCIQ  I 6CPKVMQRH N OKV JTGPMTCP\2HGTF UVGJV T 4WV   VGT*KUVQTKC0WOQTWO )WVGUUGJTUEJÌP





Õ 5EJGMGN  X %JT .QMTKU !   I 6CPKVMQRH N OKV JTGPMTCP\2HGTF T FCJKPVGT   2CNOG4WVVGT*KUVQTKC0WOQTWO 44-N5EJTÌVNKPIUTK­NGKEJVMQTTQFKGTVIWVGUUGJTUEJÌP



132


BRUTTIUM

7909



7910

7911

-41610 Õ5VCVGT WO  X %JT  I &TGKHW­ N &GNRJKP+PEWU #FNGT HNKGIV N #WMVKQP   %NCUUKECN 0WOKUOCVKE )TQWR  .CPECUVGT  0T  4WVVGT *KUVQTKC 0WOQTWO  50) #05    50)/ÒPEJGP 8QPITQ­GT5GNVGPJGKV-TCV\GTCWHFGO#XGTUIWVGUUGJTUEJÌP



'UJCPFGNVUKEJOÌINKEJGTYGKUGWOFCU2TQFWMVGKPGT*KNHUOÒP\UV·VVGKP-TQVQPCWUFGTªDGTICPIU\GKV\YKUEJGPFGP DTGKVGPFÒPPGP5VCVGTGPOKVKPEWUGT4ÒEMUGKVGWPFFGPMNGKPGPFKEMGP5VCVGTGPOKVKPEWUGT4ÒEMUGKVG



Õ5VCVGTX%JTI&TGKHW­T4GKJGT&TGKHW­KPEWU4WVVGT*KUVQTKC0WOQTWO 50)#05XGTINHH50)/ÒPEJGPXGTIN (GKPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Õ5VCVGT  X %JT  I &TGKHW­+PEWU #FNGT HNKGIV T 4WVVGT *KUVQTKC 0WOQTWO    50)#05XGTIN50)/ÒPEJGPXGTIN  4$TGKVGT5EJTÌVNKPINGKEJVMQTTQFKGTVIWVGUUGJTUEJÌP 



7912 1,5:1



Õ5VCVGT  X %JT  I &TGKHW­+PEWU #FNGT HNKGIV N 4WVVGT *KUVQTKC 0WOQTWO    50)#0550)/ÒPEJGP 5GJTUEJÌPpXQT\ÒINKEJ

1,5:1



1,5:1



7913 1,5:1

.1-41+ '2+<'2*;4+1+ Õ5VCVGT  X %JT  I 2GICUWU N FCTWPVGT $NKV\#VJGPC   MQRHNOKVMQTKPVJKUEJGO*GNO%CNEKCVK2GICUK4WVVGT*KUVQTKC0WOQTWO  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI  .QMTKUYWTFGKOHTÒJGP,CJTJWPFGTVX%JTXQP.QMTGTPCWU)TKGEJGPNCPFIGITÒPFGVOÌINKEJGTYGKUGOKV*KNHG XQP5[TCMWU.QMTKUDNKGD5[TCMWULGFGPHCNNURQNKVKUEJUVGVUGPIXGTDWPFGPWPFRHNGIVGCWEJYKEJVKIG*CPFGNUDG\KG JWPIGP OKV 5K\KNKGP &KGU HÒJTVG CWEJ \WT #WURT·IWPI FGT 2GICUK CNU FKGUG KP 5K\KNKGP KO <WIG FGT MQTKPVJKUEJGP   7PVGTUVÒV\WPIXQP5[TCMWUFWTEJ6KOQNGQPFQTVGKPIGHÒJTVYWTFGP

7914



1,5:1

7914

4*')+10Õ&TCEJOGX%JTI.ÌYGPOCUMGXX-CNDUMQRHN%CNVCDKCPQ5GTKGC 4WVVGT*KUVQTKC0WOQTWO 5GJTUEJÌP

 133


SICILIA

7915

1,5:1

1,5:1



Õ6GVTCFTCEJOG  X %JT  I .ÌYGPOCUMG X X#RQNNQMQRH T OKV .QTDGGTMTCP\   FCJKPVGT1NKXGP\YGKI*GT\HGNFGT4WVVGT*KUVQTKC0WOQTWO  +PFKGUGT'TJCNVWPI·W­GTUVUGNVGP8QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC  'ZGORNCTFGT#WMVKQP$CPM.GW<ÒTKEJ0T  7O·PFGTVG4JGIKQPFKG&CTUVGNNWPICWHFGO4GXGTUUGKPGT/ÒP\GP\GKIVGPUKG\WXQT+QMCUVQUFGP5VCFVITÒP FGTUQKUVCDGKP#RQNNQMQRHFCTIGUVGNNVFGT\WFGPUEJÌPUVGP#RQNNQMÌRHGPFGTITKGEJKUEJGP/ÒP\MWPUV\·JNV 'KPG#DMGJTXQPFGT&CTUVGNNWPIFGUUKV\GPFGP1KMKUVGUN·­VUKEJWOCWEJKP6CTGPVHGUVUVGNNGP

7917 7916

7918

5+%+.+# 

#-4#)#5 Õ&KFTCEJOG  X %JT  I #FNGT UVGJV N-TGDU 50) #05    50)/ÒPEJGP (CUVUGJTUEJÌPUGJTUEJÌP





Õ&KFTCEJOGWOX%JTI#FNGTUVGJVN-TGDUWPVGP'850)#05 #XGTU 

4GXGTU 50)/ÒPEJGP 5GJTUEJÌP





Õ&KFTCEJOGX%JTI#FNGTUVGJVT-TGDUFCTWPVGTO·PPNKEJGT-QRH50)#05 50)/ÒPEJGP UVGORGNINGKEJ  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



7919

7919 1,5:1



Õ6GVTCFTCEJOGWOX%JTI#FNGTNCWH*CUGP-TGDUFCTWPVGT(KUEJNN/WUEJGN 4K\\QXGTIN6CX+5GNVOCP6JG'PITCXGTUQHVJG#MTCICPVKPG&GECFTCEJOUKP0%2N+K 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP  7O  X %JT ICDGP XKGNG 2QNGKU KJTGP /ÒP\GP OQFGTPGTG &CTUVGNNWPIGP UKGJG CWEJ FKG #POGTMWPI \W 0T     #WEJ #MTCICU GPICIKGTVG DGICDVG -ÒPUVNGT FKG JGTTNKEJG 5VGORGN UEJWHGP FKG XQP FGT \WXQT UVCTTGP #F   NGT-TGDU&CTUVGNNWPI FGT HTÒJGTGP 5VÒEMG CDYKEJGP 7PUGT 5VÒEM UVCOOV CWU FGT GTUVGP #WUICDG FKGUGT PGWGP   6GVTCFTCEJOGPWPF\GKEJPGVUKEJDGUQPFGTUFWTEJFKGNGDGPFKIGPWPFPCVWTIGVTGWGP6KGTFCTUVGNNWPIGPCWU

134


SICILIA

7920



)'.# Õ6GVTCFTCEJOG  X %JT  I 3WCFTKIC T 0KMG DGMT·P\V 2HGTFG#PFTQMG   RJCNG5VKGTRTQVQOGTXQP5QUKRQNKUDGMT·P\V,GPMKPU  44)GUVCNVFGT5QUKRQNKUCWHFGO4GXGTUÒDGTCTDGKVGVUGJTUEJÌP



5QUKRQNKU FKG 5VCFVDGUEJÒV\GPFG KUV WPVGTUEJKGFNKEJ IGFGWVGV YQTFGP 5Q \ $ CNU 0[ORJG WPF 6[EJG 5KG GT   UEJGKPVCWEJCWHX%JTIGRT·IVGP)QNFOÒP\GPFGT5VCFV ,GPMKPU *KGTUVGJVFCU'TUEJGKPGPFGT 5QUKRQNKU YQJN OKV GKPGO 5KGI FGT 5[TCMWUCPGT WPF KJTGT 8GTDÒPFGVGP ÒDGT FKG 5KMWNGT KP <WUCOOGPJCPI )GNC   \·JNVGUKEJGT\WFGP8GTDÒPFGVGPXQP5[TCMWUWPFJCVVGUQOKVFWTEJCWU#PNC­FKGUGP5KGI\WHGKGTP

7921

7922 7922 1,5:1



*+/'4#Õ&TCEJOGX%JTI*CJPUVGJVT+P+PEWUWO*GPPGT-TCC[)TWRRG 8C1 5GJTUEJÌP



Õ&KFTCEJOG  X %JT  I *CJP UVGJV N-TGDU 9GUVGTOCTM *KOGTC 6JG %QKPU QH   #MTCICPVKPGV[RG 5GJTUEJÌPGU'ZGORNCT 



7923

1,5:1

1,5:1



Õ6GVTCFTCEJOG  X %JT  I 3WCFTKIC T 0KMG DGMT·P\V .GPMGT0[ORJG UVGJV X X   WPFQRHGTVOKVFGT4GEJVGPÒDGT#NVCTTUVGJV5CV[TTXQT$TWPPGPDCUUKPOKV.ÌYGPMQRHCNU9CUUGT URGKGTTQDGP)GVTGKFGMQTP#TPQNF$KWEEJK)WVOCPP5EJYCDCEJGT  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  &GT4GXGTU\GKIVFKG5VCFVP[ORJGFKGCO#NVCTFGU*CWRVIQVVGUFGT5VCFV YQJNFGT*GKNIQVV#UMNGRKQU QRHGTVWPF GKPGPMNGKPGP5CV[TFGTKO9CUUGTFGTYCTOGP*GKNSWGNNGPXQP*KOGTCDCFGV

7924





1,5:1

7925

1,5:1

“*GOKNKVTCPCEJX%JTI0CEMVGT4GKVGTCWH<KGIGPDQEMTFCTWPVGT*GNO0KMGUVGJVN OKV#RJNCUVQPFCXQTUGEJU9GTVMWIGNP%CNEKCVK50)#0550)/ÒPEJGP  4)TÒPG2CVKPCUGJTUEJÌP



6*'4/#+ *+/'4#+#+ “U PCEJ  X %JT  I *GTCMQRH T*GTCMNGUMQRH T %CNEKCVK    50)#0550)/ÒPEJGP )TÒPG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP

 135


SICILIA

7926

7926 1,5:1



-#/#4+0#Õ6GVTCFTCEJOGX%JTI#VJGPCKP3WCFTKICNXQP0KMGDGMT·P\V KO#DUEJPKVV5EJYCP*GTCMNGUMQRHKO.ÌYGPHGNNN9GUVGTOCTM,GPMKPU FKGU'ZGORNCT   448QPJGTXQTTCIGPFGO5VKN (GKPG2CVKPC#XGTUUGJTUEJÌPXQPXGTDTCWEJVGO5VGORGNFGT4GXGTUXQT\ÒINKEJGTJCNVGP



'ZGORNCT FGT )CTTGVV %QNNGEVKQP 2CTV ++ #WMVKQP $CPM .GW0WOKUOCVKE (KPG #TVU <ÒTKEJ  0T  WPF FGT   #WMVKQP5CODQP%CPGUUC0T

7927

7928



Õ&KFTCEJOG  X %JT  I -QRH FGU (NW­IQVVGU *KRRCTKU N OKV 6CGPKG0[ORJG   -COCTKPCCWH5EJYCPN9GUVGTOCTM,GPMKPU 'VYCUMQTTQFKGTVMN-TCV\GTUGJTUEJÌP



-#6#0' Õ6GVTCFTCEJOG WO  X %JT  I #PFTQMGRJCNGT 5VKGT T FCTÒDGT <YGKI KO   #DUEJPKVV (KUEJ0KMG KP NCPIGO %JKVQP IGJV N OKV 6CGPKG WPVGP -#6#0' #TPQNF$KWEEJK 4CP   FC\\Q*QCTF#05054K\\QXGTIN6CX+:50)#05XGTIN  45GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI 



&GT5VKGTCWHFGT8QTFGTUGKVGXGTMÌTRGTVFGP(NW­IQVV#OGPCPQU

7930

7929

1,5:1



1,5:1

Õ6GVTCFTCEJOGX%JTI3WCFTKICT#RQNNQMQRHTOKV.QTDGGTMTCP\4K\\Q6CX: 50)#05XGTIN50)/ÒPEJGP  45GJTCVVTCMVKXGU'ZGORNCTXQPHGKPGOHTÒJMNCUUKUEJGP5VKN 5EJÌPG6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ



'ZGORNCT FGT #WMVKQP $CPM .GW  <ÒTKEJ  0T  FGT 5COONWPI 9CNVGT 0KIIGNGT #WMVKQP $CPM   .GW/ÒP\GP WPF /GFCKNNGP #) $CUGN  0T  FGT #WMVKQP #TU %NCUUKEC  .W\GTP  0T  WPF   FGT5COONWPI/CIPCIWVK



Õ6GVTCFTCEJOG  X %JT 5VGORGN XQO /CGUVTQ FGNNC HQINKC  I 3WCFTKIC T 0KMG   DGMT·P\V2HGTFG#RQNNQMQRHTOKV.QTDGGTMTCP\N$NCVV4K\\Q6CX:++50)#0550) /ÒPEJGP #VVTCMVKXGU'ZGORNCTXQPJGTXQTTCIGPFGO5VKN445GJTUEJÌPpXQT\ÒINKEJ  &CU$NCVVKUVFKG5KIPCVWTGKPGUPCOGPVNKEJPKEJVDGMCPPVGP-ÒPUVNGTU

136


SICILIA

7932

7931



.'106+01+ Õ6GVTCFTCEJOG  X %JT  I 3WCFTKIC T 0KMG DGMT·P\V 2HGTFG.Ì   YGPMQRHTXQPXKGT)GTUVGPMÌTPGTPWOIGDGP4K\\QXGTIN6CX::++  2T·IGUEJY·EJGCO4CPFUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI  +P GKPGO WO  X %JT XGTDQTIGPGP *QTV HCPFGP UKEJ \YGK 6GVTCFTCEJOGP OKV UVGORGNINGKEJGT 8QTFGTUGKVG   &GT4GXGTUFGU5VÒEMGU\GKIVCNUURTGEJGPFGU9CRRGPGKPGP.ÌYGPMQRHWOIGDGPXQP)GTUVGPMÌTPGTPFKGCWHFGP )GVTGKFGTGKEJVWOFGT%CORK.GQPVKPKJKPYGKUGP



Õ&KFTCEJOG  X %JT  I 4GKVGT T.ÌYGPMQRH T XQP XKGT )GTUVGPMÌTPGTP WOIGDGP   4K\\QXGTIN6CX::++50)#0550)/ÒPEJGP 445GJTUEJÌPHCUVUGJTUEJÌP

1,5:1



7933



1,5:1

Õ.KVTC WO  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\)GTUVGPMQTP 50) #05    50)/ÒPEJGP 8QT\ÒINKEJ



&CVKGTWPIPCEJ%JT$QGJTKPIGT

7934

7935

7934 1,5:1





Õ6GVTCFTCEJOGX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\.ÌYGPMQRHTXQPXKGT )GTUVGPMÌTPGTPWOIGDGP4K\\QXGTIN6CX::+++  #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIUGJTUEJÌPXQT\ÒINKEJ



Õ6GVTCFTCEJOGX%JTI#RQNNQMQRHTOKV.QTDGGTMTCP\.ÌYGPMQRHTXQPXKGT )GTUVGPMÌTPGTPWOIGDGP4K\\QXGTIN6CX::+++ #XGTUUVGORGNINGKEJ  5GJTUEJÌP



7936 1,5:1



1,5:1

Õ6GVTCFTCEJOG WO  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\.ÌYGPMQRH N XQPFTGK )GTUVGPMÌTPGTPWPFGKPGO$NCVVWOIGDGP4K\\Q6CX::+8 UVGORGNINGKEJ   +PFKGUGT'TJCNVWPIUGJTUGNVGP8QT\ÒINKEJGU2TCEJVGZGORNCT  'UJCPFGNVUKEJWPUGTGU'TCEJVGPUWOGKPGUFGTCODGUVGPGTJCNVGPGP'ZGORNCTG

137


SICILIA

7937



Õ6GVTCFTCEJOG WO  X %JT  I #RQNNQMQRH N OKV .QTDGGTMTCP\.ÌYGPMQRH N XQPFTGK )GTUVGPMÌTPGTPWPFGKPGO$NCVVWOIGDGP4K\\Q6CX::+8 UVGORGNINGKEJ  4(CUVXQT\ÒINKEJ

7938





7939

/'55#0# Õ6GVTCFTCEJOG  X %JT  I /CWNVKGTDKIC T KO #DUEJPKVV $NCVV*CUG   URTKPIVT%CNVCDKCPQ FKGU'ZGORNCTCDIGDKNFGV  5GJTUEJÌP



'ZGORNCTFGT#WMVKQP*KTUEJ0CEJH/ÒPEJGP0T



Õ6GVTCFTCEJOGX%JTI/CWNVKGTDKICT0KMGDGMT·P\V2HGTFGKO#DUEJPKVV$NCVV *CUGURTKPIVTFCTÒDGT#%CNVCDKCPQ 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



7940 1,5:1

1,5:1



Õ6GVTCFTCEJOGX%JTI#WTKICUVGJVKP/CWNVKGTDKICTKO#DUEJPKVV\YGK&GN RJKPGIGIGPGKPCPFGT*CUGURTKPIVTÒDGT&GNRJKPT%CNVCDKCPQ  48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

7942

7941

1,5:1

1,5:1



Õ6GVTCFTCEJOG  X %JT  I /CWNVKGTDKIC N 0KMG DGMT·P\V .GPMGTKP KO #DUEJPKVV   \YGK&GNRJKPGIGIGPGKPCPFGT*CUGURTKPIVTFCTWPVGT&GNRJKP%CNVCDKCPQ  4#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 



5'.+075Õ&KFTCEJOGWOX%JTI'RRKEJDNCVV8KGNHCEJIGVGKNVGU+PEWUWO50)#05 XGTIN #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

138




SICILIA

7943 1,5:1



1,5:1

5;4#-75 Õ6GVTCFTCEJOG  X %JT  I 3WCFTKIC T 0KMG DGMT·P\V 2HGTFG   #TGVJWUCMQRHTXQPXKGT&GNRJKPGPWOIGDGP$QGJTKPIGT  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

7944

7945 7944 1,5:1



Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V2HGTFG#TGVJWUCMQRHTXQP XKGT&GNRJKPGPWOIGDGP$QGJTKPIGT #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCIWVGUUGJTUEJÌP





Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V2HGTFG#TGVJWUCMQRHTXQP XKGT&GNRJKPGPWOIGDGP$QGJTKPIGT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



7947 7946

7948



Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V2HGTFG#TGVJWUCMQRHTXQP XKGT&GNRJKPGPWOIGDGP$QGJTKPIGT 5GJTUEJÌPGU'ZGORNCT





Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V.GPMGTKO#DUEJPKVV-GVQU #TGVJWUCMQRHTXQPXKGT&GNRJKPGPWOIGDGP$QGJTKPIGT 5GJTUEJÌP





Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V2HGTFG#TGVJWUCMQRHTXQP XKGT&GNRJKPGPWOIGDGP$QGJTKPIGT 5GJTUEJÌP



7949

7950



Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V2HGTFG#TGVJWUCMQRHTXQP XKGT&GNRJKPGPWOIGDGP$QGJTKPIGT 5EJTÌVNKPIUHGJNGTCWHFGO#XGTUUGJTUEJÌP





Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V2HGTFG#TGVJWUCMQRHTXQP XKGT&GNRJKPGPWOIGDGP$QGJTKPIGT 8GTTQUVGVGT#XGTUUVGORGNNGKEJVFG\GPVTKGTVUGJTUEJÌP

 139


SICILIA

7952

7951

7952 1,5:1



Õ6GVTCFTCEJOGX%JTI3WCFTKICT0KMGDGMT·P\V.GPMGT#TGVJWUCMQRHTXQP XKGT&GNRJKPGPWOIGDGP$QGJTKPIGT 5VCTMXGTDTCWEJVGT#XGTUUVGORGNUGJTUEJÌP



Õ6GVTCFTCEJOG  X %JT WPUKIPKGTV 5VGORGN XQP 5QUKQP !   I 3WCFTKIC N 0KMG   DGMT·P\V.GPMGTKO#DUEJPKVV\YGK&GNRJKPG#TGVJWUCMQRHNXQPXKGT&GNRJKPGPWOIGDGP6WFGGT 44/KPMQTTQFKGTVUGJTUEJÌP 

1,5:1



7953



1,5:1

“6GVTCUPCEJX%JTI#TGVJWUCMQRHHCUVXX1EVQRWU%CNEKCVK  $TCWPG2CVKPCJGTTNKEJGT5VKN#XGTUFG\GPVTKGTVXQT\ÒINKEJ



7954

1,5:1



1,5:1

Õ&GMCFTCEJOGPCEJX%JT9GTMFGU/GKUVGTITCXGWTU-KOQP WPUKIPKGTV I3WCFTKIC KO )CNQRR N OKV UVCTM XQTIGDGWIVGO 9CIGPNGPMGT XQP 0KMG DGMT·P\V +O #DUEJPKVV 9CHHGP <YGK   $GKPUEJKGPGP2CP\GTWPF*GNO#TGVJWUCMQRHNXQPXKGT&GNRJKPGPWOIGDGP,QPIMGGU 8U$4UJ  48QPHGKPGO5VKN5VGORGNTK­WPFMN#DURNKVVGTWPICWHFGT4ÒEMUGKVG FGPPQEJUGJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  &KGDGTÒJOVG\YGKVG#WUICDGXQP&GMCFTCEJOGPCO'PFGFGU,CJTJWPFGTVUX%JTGTHQNIVGPCEJFGO5KGIÒDGT FCUCVJGPKUEJG'ZRGFKVKQPUJGGTWPVGT0KMKCUX%JTKOITQ­GP*CHGPWPFCO#UUKPCTQU<WO)GFGPMGPCPFGP 5KGIUVKHVGVGPFKG5[TCMWUCPGTFKGCUUKPCTKUEJGP5RKGNGFKG\WOGTUVGP/CNX%JTIGHGKGTVYWTFGP<WFKGUGO #PNC­ YWTFGP FKG GTUVGP &GMCFTCEJOGP PCEJ FGO &GOCTGVGKQP IGRT·IV &KG 2HGTFG YGTFGP KP FGO /QOGPV   IG\GKIVCNUFGT9CIGPNGPMGTUKGKPGKPGPGWG4KEJVWPI\YKPIGPYKNN(TCPMGUEJTGKDVFC\Wō-KOQPJCVCWHUGKPGP 6GVTCFTCEJOGP IGTCFG FKGUGP #WIGPDNKEM FGU 9CIGPTGPPGPU VTQV\ FGT IGTKPIGP KJO \WT 8GTHÒIWPI UVGJGPFGP   4GNKGHJÌJG OGKUVGTJCHV GTHC­V WPF IGUVCNVGVŋ &KG 9CHHGP KO #DUEJPKVV FÒTHVGP FGP 5KGIGURTGKU FGU 9CIGPTGPPGPU   FCTUVGNNGPWPFUKPFOÌINKEJGTYGKUGCWUFGP$GWVGYCHHGPIGUVKHVGVYQTFGP

140


SICILIA

7955

1,5:1

1,5:1



Õ&GMCFTCEJOGPCEJX%JTUKIPKGTVXQP'WCKPGVQUI3WCFTKICKO)CNQRRNFGT.GPMGT XQPHNKGIGPFGT0KMGDGMT·P\VUVTGEMVFGP6TGKDUVCDYGKVXQTKO#DUEJPKVV9CHHGPITWRRGDGUVGJGPFCWU 5EJKNF 2CP\GT $GKPUEJKGPGP WPF *GNO#TGVJWUCMQRH N XQP XKGT &GNRJKPGP WOIGDGP )CNNCVKP &   ++4+: 0TFKGU'ZGORNCT 9CTF)TGGM%QKPUCPFVJGKT2CTGPV%KVKGU FKGU'ZGORNCT   5GJTCVVTCMVKXGU'ZGORNCTXQPHGKPGO5VKN (GKPG6ÌPWPIWPDGFGWVGPFG-QTTQUKQPKO4CPFDGTGKEJHCUVXQT\ÒINKEJ  'ZGORNCTFGU(WPFGUXQP5CPVC/CTKCFK.KEQFKCWPFFGT5COONWPI,QJP9CTF#WMVKQP5QVJGD[ UKO#WHVTCIFGU /GVTQRQNKVCP/WUGWOQH#TV0GY;QTM<ÒTKEJ0T  5KT#TVJWT'XCPUJCVFKGUGU5VÒEMKP%CVCPKCCWUFGO(WPFXQP5CPVC/CTKCFK.KEQFKCCNUFCUUEJÌPUVG'ZGORNCT HÒTUGKPGP(TGWPF,QJP9CTFCWUIGY·JNV UKGJG9CTF)TGGM%QKPUCPFVJGKT2CTGPV%KVKGU.QPFQP5   &KG \YGK DGTÒJOVGUVGP 5VGORGNUEJPGKFGT CWU FGT <GKV WO  X %JT UKPF -KOQP WPF 'WCKPGVQU FGT FCU   XQTNKGIGPFG 5VÒEM IGUVCNVGV JCV /CP MCPP UKEJ FCTÒDGT UVTGKVGP YGNEJGT FKGUGT DGKFGP JQEJDGICDVGP -ÒPUVNGT FGT   DGFGWVGPFGTGKUV)-,GPMKPU %QKPUQH)TGGM5KEKN[5 UEJ·V\VLGFGPHCNNUFKG9GTMGFGU'WCKPGVQUJÌJGTGKP CNUFKGFGU-KOQPWPFWPUGTJGTTNKEJGU5VÒEMURTKEJVHÒTUKEJ9CTGPCWHFGTGTUVGPU[TCMWUCPKUEJGP&GMCFTCEJOG FGODGTÒJOVGP&GOCTGVGKQPFKG2HGTFGFGT3WCFTKICPQEJKPTWJKIGO5EJTGKVGPFCTIGUVGNNVUQD·WOGPUKGUKEJCWH WPUGTGO 5VÒEM VGORGTCOGPVXQNN CWH &GP #TGVJWUCMQRH FGT 4ÒEMUGKVG JCV 'WCKPGVQU DKU KPU HGKPUVG &GVCKN IGUVCNVGV   5GNDUV FKG MQPXGPVKQPGNN FCTIGUVGNNVGP &GNRJKPG FKG FGP -QRH WOIGDGP YKTMGP JKGT FWTEJ KJTG CU[OOGVTKUEJG   #PQTFPWPI PGW DGNGDV WPF GTJÌJGP FKG NGDGPFKIG 5RCPPWPI FGU $KNFGU &KG 9CHHGP KP 8GTDKPFWPI OKV FGO 9QTV   aqla 2TGKUG KO#DUEJPKVVFGT8QTFGTUGKVGGKPKIGT&GMCFTCEJOGPUKPFXGTOWVNKEJGKP*KPYGKUCWHGKPGP5KGIFGT 5[TCMWUCPGT +O ,CJTG  X %JT GTITKHH 5[TCMWU KO -TKGI \YKUEJGP 5GNKPWU WPF 5GIGUVC 2CTVGK HÒT 5GNKPWU   5GIGUVCYCPFVGUKEJFCTCWHJKPOKVFGT$KVVGWOOKNKV·TKUEJG7PVGTUVÒV\WPICP#VJGP&KGPWP\YKUEJGP5[TCMWUWPF #VJGP CWUDTGEJGPFGP MTKGIGTKUEJGP *CPFNWPIGP GPFGVGP OKV GKPGO 5KGI FGT 5[TCMWUCPGT KO ,CJTG  X %JT CO   (NW­ #UUKPCTQU #DGPVGWGT FGU #NMKDKCFGU  <WT 'TKPPGTWPI CP FKGUGP 5KGI UVKHVGVGP FKG 5[TCMWUCPGT FKG   CUUKPCTKUEJGP5RKGNG

7957

7956

7957 1,5:1





Õ6GVTCFTCEJOG  X %JT WPUKIPKGTV  I 3WCFTKIC N 0KMG DGMT·P\V .GPMGT KO #D   UEJPKVVJTG#TGVJWUCMQRHNXQPXKGT&GNRJKPGPWOIGDGP*CCTKP5RJGPFQPG6WFGGT  5GJTUEJÌPGU'ZGORNCTOKVCVVTCMVKXGT2CVKPC



Õ6GVTCFTCEJOGX%JTWPUKIPKGTV5VGORGNXQP'WMNGKFCU ! I3WCFTKICN0KMG DGMT·P\V.GPMGTKO#DUEJPKVV&GNRJKP#TGVJWUCMQRHNXQPXKGT&GNRJKPGPWOIGDGP6WFGGT  44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

 141


SICILIA

7958



Õ6GVTCFTCEJOGX%JTWPUKIPKGTV5VGORGNXQP'WMNGKFCU ! I3WCFTKICN0KMG DGMT·P\V.GPMGTKO#DUEJPKVV&GNRJKP#TGVJWUCMQRHNXQPXKGT&GNRJKPGPWOIGDGP6WFGGT  444CPFGVYCUDGHGKNVHGKPG-TCV\GTUGJTUEJÌP



7959 2:1

2:1



Ô.KVTGPX%JTI#TGVJWUCMQRHN*CCTGKP5RJGPFQPGFCJKPVGT#*GTCMNGUT GTYÒTIVFGPPGOGKUEJGP.ÌYGP50)#05 448QPHGKPUVGO5VKNXQT\ÒINKEJGU2TCEJVGZGORNCT  &GT 5VGORGNUEJPGKFGT FGT UKEJ JKPVGT FGT +PKVKCNG # XGTDKTIV KUV DKUJGT WPDGMCPPV &GT 6[R UEJNKG­V UKEJ FGT XQP   -KOQPIGUEJCHHGPGP&CTUVGNNWPICP*GTCMNGUFGTFQTKUEJG*GTQU5[TCMWUYCTGKPGFQTKUEJG)TÒPFWPIDGUKGIV FGP.ÌYGPFGTJKGTYCJTUEJGKPNKEJ#HTKMCU[ODQNKUKGTV&CU5VÒEMDG\KGJVUKEJYQJNCWHFKG-·ORHG&KQP[UKQU+ OKV -CTVJCIQ &KG #WUICDG FKGUGT /ÒP\GP GTHQNIVG RCTCNNGN \W FGP &GMCFTCEJOGP XQP -KOQP WPF 'WCKPGVQU 'KP   .KVTGP5VÒEMKP)QNFGPVURTCEJ\YGK&GMCFTCEJOGP

7960

7960 1,5:1



&KQP  X %JT “U  I -QRH FGU<GWU'NGWVJGTKQUTOKV.QTDGGTMTCP\$NKV\T#FNGT %CNEKCVK &WPMNG2CVKPCHCUVXQT\ÒINKEJ

7961 1,5:1





1,5:1

4GRWDNKM  X %JT Õ5VCVGT  X %JT  I 2GICUWU HNKGIV N#VJGPCMQRH T OKV   MQTKPVJKUEJGO*GNO%CNEKCVK2GICUK 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI  /ÌINKEJGTYGKUGYWTFGFCU5VÒEMCWEJWPVGT6KOQNGQPIGRT·IV

7962

 142

#ICVJQMNGU  X %JT Õ5VCVGT  X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO   *GNO)TGKHCNU*GNO\KGT2GICUWUHNKGIVNFCTWPVGT6TKUMGNKU%CNEKCVK2GICUK 5GJTUEJÌP




SICILIA

7963



Õ6GVTCFTCEJOGX%JTI#TGVJWUCMQRHNXQPFTGK&GNRJKPGPWOIGDGP3WCFTKICN QDGP6TKUMGNKU+GTCTFK50)#0550)/ÒPEJGPXGTIN  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC

7964

7965

1,5:1

1,5:1



1,5:1

1,5:1



'N .KVTGP  X %JT  I #RQNNQMQRH N FCJKPVGT -CPVJCTQU&TGKHW­ ,GPMKPU KP 'UUC[U   4QDKPUQP14 )WVGUUGJTUEJÌP



'N .KVTGP  X %JT  I #RQNNQMQRH N FCJKPVGT .CORG&TGKHW­ ,GPMKPU KP 'UUC[U   4QDKPUQP14 -N5EJTÌVNKPIUHGJNGTCWHFGO#XGTUUGJTUEJÌPpXQT\ÒINKEJ 

7966



1,5:1



7966

Õ6GVTCFTCEJOG  X %JT  I 2GTUGRJQPGMQRH T0KMG T GTTKEJVGV 6TQRJ·G WPVGP N   6TKUMGNKU+GTCTFK50)#05XGTIN50)/ÒPEJGPXGTIN )WVGUUGJTUEJÌP 

7967

7968

1,5:1

7968



“UI#TVGOKUMQRHTÒDGTFGT5EJWNVGT-ÌEJGT)GHNÒIGNVGT$NKV\%CNEKCVK  &WPMNG2CVKPCCO4CPFNGKEJVMQTTQFKGTVUQPUVXQT\ÒINKEJ



*KMGVCU  X %JT Ô&GMCFTCEJOG  X %JT  I 2GTUGRJQPGMQRH N OKV JTGP   MTCP\ FCJKPVGT (CEMGN0KMG KP $KIC T $WVVTG[ W C /QTICPVKPC 5VWFKGU  C 50) #05    50)/ÒPEJGP )WVGUUGJTUEJÌP 

7969



1,5:1



7969

*KGTQP ++  X %JT HÒT 2JKNKUVKU Õ .KVTGP  I 8GTUEJNGKGTVGT -QRH N FCJKPVGT   6J[TUQU0KMG KP 3WCFTKIC  T FCXQT # $/%  $WTPGVV 'PPC JQCTF KP 504      50)#0550)/ÒPEJGP #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI

 143


SICILIA

7970 1,5:1

1,5:1



4GRWDNKM  X %JT Õ .KVTGP  I #VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO)GHNÒIGNVGT   $NKV\ $WTPGVV 'PPC JQCTF KP 504   2N  &  50) #05  50) /ÒPEJGP    8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT2CVKPC

7972

7971

1,5:1

1,5:1





270+'4Õ6GVTCFTCEJOGX%JT.CIGTOÒP\UV·VVGI-QTGMQRHTXQPFTGK&GNRJK PGP WOIGDGP N <GKEJGP FGT 6CPKV2HGTF UVGJV T FCJKPVGT 2CNOG T -GT[MGKQP ,GPMKPU +++    #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

&KG-CTVJCIGTKFGPVKHK\KGTVGPKJTG)ÌVVKP6CPKVOKVFGTITKGEJKUEJGP-QTG



Õ6GVTCFTCEJOG  X %JT .CIGTOÒP\UV·VVG  I #TGVJWUCMQRH N XQP XKGT &GNRJKPGP   WOIGDGP2HGTFGMQRHNFCJKPVGT2CNOG,GPMKPU+++  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

7973

7974

7975

7975 1,5:1



Õ6GVTCFTCEJOG  X %JT .CIGTOÒP\UV·VVG  I #TGVJWUCMQRH N XQP XKGT &GNRJKPGP   WOIGDGP2HGTFGMQRHNFCJKPVGT2CNOG,GPMKPU+++ )WVGUUGJTUEJÌP





Õ6GVTCFTCEJOG WO  X %JT /*5$/ 3W·UVQTGPOÒP\UV·VVG   I *GTCMNGUMQRH KO .Ì   YGPHGNNT2HGTFGMQRHNFCXQT-GT[MGKQPFCJKPVGT2CNOG,GPMKPU+8  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



&GT 2HGTFGMQRH IGJÌTV \WT )TÒPFWPIUUCIG XQP -CTVJCIQ UQ UEJTGKDV 8GTIKN&QTV \WGTUV XQP 9GNNGP WPF 9KPF   CPU7HGTIGYQTHGPITWDGPGKP<GKEJGPFKG2WPKGTCWU&KG*GTTUEJGTKP,WPQ\GKIVGGUCPGKPGU5VTGKVTQUUGU*CWRV UQYGTFGFGPP-TKGIUTWJO\KGTGPFCU8QNMLCJTJWPFGTVGNCPIWPF(ÒNNGFGU.GDGPU&KG8QTFGTUGKVGKOKVKGTV6GVTC FTCEJOGP#NGZCPFGTUFGU)TQ­GP

 144

Õ6GVTCFTCEJOG WO  X %JT /*5$/ 3W·UVQTGPOÒP\UV·VVG   I *GTCMNGUMQRH KO .Ì   YGPHGNNT2HGTFGMQRHNFCJKPVGT2CNOG,GPMKPU+8 (CUVXQT\ÒINKEJ 


SCYTHIA

7976

7977 7976 1,5:1

+..;4+%7/ 

&;44*#%*+7/ Õ5VCVGT  X %JT  I -WJ N U·WIV -CND#NMKPQQUI·TVGP KO   #DUEJPKVV-GWNG/CKGTKP0< #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



Õ5VCVGTX%JTI-WJTU·WIV-CNDQDGPG#NMKPQQUI·TVGPKO#DUEJPKVV-GWNG /CKGTKP0< 5GJTUEJÌP

7978



7979 1,5:1

/1'5+# 

+56415Õ&TCEJOG,CJTJWPFGTVX%JTI<YGK-ÌRHGXXIGIGPGKPCPFGTXGTUGV\V5GGCFNGT CWH&GNRJKPNWPVGP/QPQITCOOTD#/0) (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





-#..#6+5Ô5VCVGTX%JTI&KCFGOKGTVGT-QRHFGUXGTIÌVVNKEJVGP#NGZCPFGTTOKV #OOQPUJQTP#VJGPC0KMGRJQTQUUKV\VNFCTWPVGT&TGK\CEM#/0)FG%CNNCVC[&4  5GJTUEJÌP



'ZGORNCTFGT5COONWPI-NCWU/CTQYUM[#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  &GT -QRH FGT 8QTFGTUGKVG \GKIV FKG <ÒIG /KVJTCFCVGU 8+ UQ YKG UKG XQP UGKPGP MNGKPCUKCVKUEJGP 6GVTCFTCEJOGP   DGMCPPV UKPF &KGUG )QNFRT·IWPI UVGJV KO <WUCOOGPJCPI OKV FGO $GHTGKWPIUMTKGI /KVJTCFCVGU 8+ IGIGP FKG   4ÌOGT

7980

5%;6*+# 

1.$+#“U IGIQUUGP WOX%JTI)QTIQPGKQP#FNGTHNKGIVTOKV&GNRJKP50)$/ 8GEEJK2N+ 4$TCWPG2CVKPCIWVGUUGJTUEJÌP



'KPG5GTKGXQPHÒPHYGKVGTGP$TQP\GUVÒEMGPXQP1NDKCHKPFGP5KGWPVGT0T

145


THRACIA

7981

1,5:1



1,5:1

-QUQPECX%JTÔ5VCVGTX%JT1NDKCI/CIKUVTCVUEJTGKVGVN\YKUEJGP\YGK .KMVQTGPFCXQT/QPQITCOO#FNGTNOKV-TCP\WPF<GRVGT42%# 8QT\ÒINKEJ



&KGUG KPVGTGUUCPVG)QNFOÒP\GKUVUGKVDGMCPPVCNU'TCUOWUXQP4QVVGTFCOUKG\WGTMN·TGPXGTUWEJVG'UH·NNV UQHQTV CWH FC­ FKGUGT /ÒP\V[R TÌOKUEJG &GPCTG FGT UR·VGP 4GRWDNKM PCEJCJOV &KG 8QTFGTUGKVG KUV PCEJ GKPGO   &GPCT IGUVCNVGV FGP / +WPKWU $TWVWU  X %JT \WT 'TKPPGTWPI CP FKG 8GTVTGKDWPI FGT 6CTSWKPKGT FWTEJ UGKPGP   8QTHCJTGP . +WPKWU $TWVWU RT·IGP NKG­ %TCYHQTF  UKGJG 0T   &KG 4ÒEMUGKVG JCV GKPGP &GPCT FGU 3   2QORQPKWU4WHWU\WO8QTDKNFIGRT·IVX%JT %TCYHQTF &KGUG0CEJCJOWPITÌOKUEJTGRWDNKMCPKUEJGT /ÒP\GP IGUEJCJ PKEJV \WH·NNKI 5Q JCV OCP NCPIG CPIGPQOOGP FC­ -QUQP GKP 8GTDÒPFGVGT FGU %CGUCT/ÌTFGTU   $TWVWUKO$ÒTIGTMTKGIIGIGP/CTE#PVQPWPF1EVCXKCP #WIWUVWU IGYGUGPKUV-QUQPFGTUGKPGP0COGPU\WICWH FKG 8QTFGTUGKVG WPUGTGT /ÒP\G RT·IGP NKG­ YWTFG NCPIG CNU -ÌPKI FGT 6JTCMGT CPIGUGJGP /CZ XQP $CJTHGNFV   URTCEJ XQP GKPGO &CMGTMÌPKI -QUQP KP $GTNKPGT /ÒP\DN·VVGT   -QUQP YWTFG CDGT CWEJ HÒT FKG 5E[VJGP KP   #PURTWEJ IGPQOOGP &KG 8GTDKPFWPI \W FGP &CMGTP FGO JGWVKIGP 4WO·PKGP IGPCWGT 5KGDGPDÒTIGP  JCV   1 +NKGUEW GTCTDGKVGV KP 3WCFGTPK 6KEKPGUK   &CU CWH GKPKIGP 5VÒEMGP CWH FGT 8QTFGTUGKVG \W HKPFGPFG   /QPQITCOONKGUV+NKGUEWWPUGTGT/GKPWPIPCEJ\WVTGHHGPFCNU$#HÒTBASILEUS -ÌPKI Y·JTGPFCPFGTGGUCNU $4 HÒT $TWVWU \W FGWVGP XGTUWEJV JCDGP &CU 0QOKPCN OKV GKPGO &WTEJUEJPKVVUIGYKEJV XQP  I KUV UKEJGT MGKP   TÌOKUEJGT #WTGWU UQPFGTP GKP ITKGEJKUEJGT )QNFUVCVGT &KG /ÒP\UV·VVG 1NDKC XGTDKTIV UKEJ YQJN PKEJV KP FGO   /QPQITCOO YKG *GCF WPF CPFGTG INCWDVGP UQPFGTP UKG GTIKDV UKEJ CWU FGO 4ÒEMUGKVGPV[R FGT PKEJV PWT FGP   4WHWU&GPCT\WO8QTDKNFJCVUQPFGTPCWEJ\W1NDKCRC­V

7982

6*4#%+# 

#$&'4# Õ6GVTCFTCEJOG  X %JT /CIKUVTCV &KQRJCPVQU  I )TGKH UKV\V T#RQNNQ   MQRHTOKV.QTDGGTMTCP\/C[ (CUVUGJTUEJÌP

7983



7984

7984 1,5:1

7983 1,5:1



#+015 Õ6GVTCFTCEJOG  X %JT  I *GTOGUMQRH T OKV 2GVCUQU<KGIGPDQEM T   FCXQT-GT[MGKQP/C[ 44GXGTUNGKEJVFG\GPVTKGTVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



Õ6GVTCFTCEJOG  X %JT  I *GTOGUMQRH X X OKV 2GVCUQU<KGIGPDQEM T FCXQT   .QTDGGTMTCP\/C[ 45GJTUEJÌPGU'ZGORNCTOKVJGTTNKEJGT2CVKPC 

7985

 146

$;<#06+10 Õ6GVTCFTCEJOG .[UKOCEJGKGT  PCEJ  X %JT  I #NGZCPFGTMQRH T OKV   &KCFGOWPF#OOQPUJQTP#VJGPC0KMGRJQTQUUKV\VN/ÒNNGT50)%QR 5GJTUEJÌP




THRACIA

1,5:1



7986

1,5:1

&+-#+#Õ6TKQDQNX%JTI*GTCMNGUMQRHKO.ÌYGPHGNNT+P+PEWUWO*CJPUVGJVT /C[6JG%QKPCIGQH&KMCKCD[#DFGTC 5GJTUEJÌP



7987

1,5:1



1,5:1

/#410'+# Õ5VCVGT  X %JT /CIKUVTCV *GDGUCU  I 2HGTF URTKPIV N FCTÒDGT   #UVTCICN9GKPUVQEM$GK\GKEJGP-GT[MGKQP5EJÌPGTV)GKUU  44#VVTCMVKXGU'ZGORNCTXQT\ÒINKEJUGJTUEJÌPpXQT\ÒINKEJ 

7988

7988 1,5:1



Õ5VCVGTX%JT/CIKUVTCV/GVTQRJCPGUI2HGTFURTKPIVN9GKPUVQEMN#UVTCICN 5EJÌPGTV)GKUU #XGTUUVGORGNINGKEJ  5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



7989



1&'5515Õ6GVTCFTCEJOG #NGZCPFTGKGT <GKV/KVJTCFCVGU8+X%JTI*GTCMNG UMQRHKO.ÌYGPHGNNT<GWU#GVQRJQTQUUKV\VN2TKEG 5GJTUEJÌP



7990

7990 1,5:1



6*#515 Õ5VCVGT  X %JT  I 5CV[T XGTUEJNGRRV 0[ORJG T #8KGTIGVGKNVGU +PEW   UWO$/%50)%QR -N5EJTÌVNKPIUTK­HGKPGT5VKNIWVGUUGJTUEJÌP  147


THRACIA

7991

1,5:1



1,5:1

-¤0+)4'+%*.[UKOCEJQUX%JTÕ6GVTCFTCEJOGX%JT.CORUCMQUI #NGZCPFGTMQRH T OKV &KCFGO WPF #OOQPUJQTP#VJGPC 0KMGRJQTQU UKV\V N FCXQT (CEMGN CWH FGO   6JTQP*CNDOQPF6JQORUQPKP'UUC[U4QDKPUQP  2T·EJVKIGU2QTVT·VXQPHGKPUVGO5VKN8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC  'ZGORNCT FGT 5COONWPI FGU DGTÒJOVGP FGWVUEJGP &KEJVGTU )GTJCTV *CWRVOCPP #WMVKQP #WEVKQPGU #)  $CUGN   0T  )GTJCTV *CWRVOCPP   \·JNV \W FGP DGTÒJOVGUVGP FGWVUEJGP &KEJVGTP 5GKPGT 1TKGPVKGTWPI CP )QGVJG   GPVURTGEJGPFVTWIFGT0QDGNRTGKUVT·IGTXQPCWEJGKPGCWUIG\GKEJPGVGDGKURKGNJCHVG5COONWPICPVKMGT/ÒP\GP \WUCOOGP CWU FGT FKG XQTNKGIGPFG GTUVMNCUUKIG 6GVTCFTCEJOG FGU .[UKOCEJQU UVCOOV +P UGKPGT 5COONWPI YKTF   XQT CNNGO )GTJCTV *CWRVOCPPU +PVGTGUUG HÒT )ÌVVGTDKNFGT UKEJVDCT +P UGKPGO 6CIGDWEJ XQP  KUV \W NGUGP    -QOOVKPFKGUGP*CNDMTGKU  FGT$GNKEJVWPI  -QOOV  &WPMNGT9GKP.CORGCWUUGP  KPPGTG5QPPG  +JTCNNGOGKPG-KPFGT  )TKGEJGPTWPFGU5KNDGT  OKV-ÌRHGPWPF)ÌVVGTP  )ÌVVGTP  'KPGU,CJTVCWUGPFU!  0GKPXKGNGT,CJTVCWUGPFG  &KGUGKFKJTWOOKEJ  XQTOGKPGO  #WIG   +PFGO'RQU$NCWG$NWOGXQPJGK­VGU   1)TKGEJGPYKGXKGNYWPFGTXQNNG-ÒPUVG  +P'T\WPF/CTOQTÒDVGGWTG*CPF  &GT5EJÌPJGKV)NCP\DGUKGIVG(KGDGTFÒPUVG  +JTVGKNVGVOKVFGP*KOONKUEJGPFCU.CPF  #WHLGFGT/ÒP\GFKGFGT2T·IUVQEMOÒP\VG  FGT)QVVFKG)ÌVVKPKJTGP5RKGIGNHCPF  7PFJCVVGYGTGKP9GK\GPDTQV\W\CJNGP  FKG)QVVJGKVDNKV\VGCWHOKVUGN IGP5VTCJNGP   )GTJCTV*CWRVOCPPDG\QIUGKPG/ÒP\GPKOYGUGPVNKEJGPXQPFGO$GTNKPGT0WOKUOCVKMGT&T2JKNKRR.GFGTGTFGT CO/·T\KP<WUCOOGPJCPIOKVGKPGO/ÒP\CPIGDQVUEJTKGD&GPUEJÌPGP.[UKOCEJQUFGP5KGLCMGPPGP JCDGKEJOKEJGPVUEJNQUUGPDGK\WIGDGPYGKNKEJYGK­FC­GT+JPGPUQNEJGP'KPFTWEMOCEJVG#O/·T\DG\QI UKEJ .GFGTGT KP GKPGO $TKGH PQEJOCNU CWH FKGUG /ÒP\G &GO GKP\KICTVKIGP .[UKOCEJQU YKTF PQEJ OCPEJGU /CN   PCEJIGHTCIVWPFIGUGWH\V  &KG5COONWPI)GTJCTV*CWRVOCPPYWTFGCO,WPKXQPFGT(KTOC#WEVKQPGU#)KP$CUGNXGTUVGKIGTVCWU FGTGP-CVCNQIFKGXQTNKGIGPFGP6GZVUVGNNGPUVCOOGP

148


THRACIA

7992



Õ6GVTCFTCEJOGX%JT.CORUCMQUI#NGZCPFGTMQRHTOKV&KCFGOWPF#OOQPU JQTP#VJGPC0KMGRJQTQUUKV\VNFCXQT/QPQITCOO6JQORUQPKP'UUC[U4QDKPUQP  5GJTUEJÌPXQT\ÒINKEJ

7993



7994

1,5:1



Õ6GVTCFTCEJOGX%JT.CORUCMQUI#NGZCPFGTMQRHTOKV&KCFGOWPF#OOQPU JQTP#VJGPC 0KMGRJQTQU UKV\V N FCXQT /QPQITCOO KO #DUEJPKVV *CNDOQPF 6JQORUQP KP 'UUC[U   4QDKPUQP  5EJÌPGU2QTVT·V#VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCHCUVXQT\ÒINKEJIWVGUUGJTUEJÌP 



Õ6GVTCFTCEJOGX%JT.CORUCMQUI#NGZCPFGTMQRHTOKV&KCFGOWPF#OOQPU JQTP#VJGPC 0KMGRJQTQU UKV\V N FCXQT /QPQITCOO KO #DUEJPKVV *CNDOQPF 6JQORUQP KP 'UUC[U   4QDKPUQP (GKPG2CVKPCUGJTUEJÌP

7995



7996

1,5:1





Õ6GVTCFTCEJOGX%JT.CORUCMQUI#NGZCPFGTMQRHTOKV&KCFGOWPF#OOQPU JQTP#VJGPC 0KMGRJQTQU UKV\V N FCXQT /QPQITCOO WPF *GTOG 6JQORUQP KP 'UUC[U 4QDKPUQP    #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



Õ6GVTCFTCEJOGX%JT/CIPGUKCCF/CGCPFTWOI#NGZCPFGTMQRHTOKV&KCFGO WPF #OOQPUJQTP#VJGPC 0KMGRJQTQU UKV\V N FCXQT (CEMGN KO #DUEJPKVV /CGCPFGT 6JQORUQP KP   'UUC[U4QDKPUQP 5GJTUEJÌP

 149


THRACIA

1,5:1



7997

1,5:1

Õ&TCEJOG  X %JT 'RJGUQU  I #NGZCPFGTMQRH T OKV &KCFGO WPF #OOQPUJQTP   #VJGPC0KMGRJQTQUUKV\VNFCXQT$KGPG6JQORUQPKP'UUC[U4QDKPUQP  5GNVGPKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

7998



Õ6GVTCFTCEJOGPCEJX%JTWPDGUVKOOVGVJTCMKUEJG/ÒP\UV·VVGI#NGZCPFGTMQRHTOKV &KCFGO WPF #OOQPUJQTP#VJGPC 0KMGRJQTQU UKV\V N FCXQT WPF KO #DUEJPKVV LG GKP /QPQITCOO   /ÒNNGT6JQORUQPKP'UUC[U4QDKPUQP 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



7999

1,5:1



1,5:1

Ô5VCVGTRQUVJWO ! WPDGUVKOOVG/ÒP\UV·VVGI#NGZCPFGTMQRHTOKV&KCFGOWPF#OOQPU JQTP#VJGPC0KMGRJQTQUUKV\VN/ÒNNGT50)%QR6JQORUQPKP'UUC[U4QDKPUQP  -N-TCV\GTXQT\ÒINKEJ 

8000

8000 1,5:1



5MQUVQMQUWOX%JTÕ6GVTCFTCEJOGXQTX%JTWPDGMCPPVGVJTCMKUEJG/ÒP\UV·VVG  I #NGZCPFGTMQRH T OKV &KCFGO WPF #OOQPUJQTP#VJGPC 0KMGRJQTQU UKV\V N FCXQT -WNVRHGK   NGTOKVMWIGNKIGO-QRH(KUEJGT$QUUGTV 84C  8QPITQ­GT5GNVGPJGKV(CUVXQT\ÒINKEJ  9KG 9QNHICPI (KUEJGT$QUUGTV IG\GKIV JCV UKPF FKG .[UKOCEJGKGT FGU 5MQUVQMQU YQJN \GKVINGKEJ OKV LGPGP CWU FGT   .GDGPU\GKVFGU.[UKOCEJQUGPVUVCPFGP5MQUVQMQUFÒTHVGCNUQYQJNKPGKPGO#DJ·PIKIMGKVUXGTJ·NVPKU\W.[UKOCEJQU IGUVCPFGP JCDGP &KG CNVG 8GTOWVWPI FKGUG 2T·IWPIGP UGKGP KP #KPQU GPUVCPFGP KUV YCJTUEJGKPNKEJ HCNUEJ 5KGJG   (KUEJGT$QUUGTV&KG.[UKOCEJGKGTFGU5MQUVQMQUKP4$0  5  7PUGT 5VÒEM \GKIV GTUVOCNU GKPG 5VGORGNMQRRNWPI GKPGT 5MQUVQMQU8QTFGTUGKVG OKV 9QNHICPI (KUEJGT$QUUGTVU   )TWRRG#FKG\YCTFCU$GK\GKEJGPCDGTPKGFGP0COGPFGU5MQUVQMQUVT·IV

150


MACEDONIA

8002

8001 8001 1,5:1

/#%'&10+# 

#-#06*15 Õ6GVTQDQN XQT  X %JT  I 5VKGTRTQVQOG N \WTÒEMDNKEMGPF FCTÒDGT   #MCPVJQUDNÒVG8KGTIGVGKNVGU+PEWUWO50)#05XGTIN50)%QR (CUVXQT\ÒINKEJ 



Õ6GVTQDQN  X %JT  I 5VKGTRTQVQOG N \WTÒEMDNKEMGPF FCTÒDGT P WPF 5YCUVKMC   8KGTIGVGKNVGU+PEWUWO50)#0550)%QR (CUVXQT\ÒINKEJ



8004 8003

8003



&'4410'5 Õ&QFGMCFTCEJOG PCEJ  X %JT  I 1EJUGPDKIC N .GPMGT OKV GTJQDGPGT   2GKVUEJGFCTÒDGTMQTKPVJKUEJGT*GNO6TKUMGNKU#/0)50)#055XQTQPQU2N++  44-N-TCV\GTCWHFGO#XGTUUGJTUEJÌP 



.'6' ! Õ5VCVGT,CJTJWPFGTVX%JTI5CV[TTJ·NVHNKGJGPFG0[ORJGCO#TO\WTÒEM +PEWUWO50)#05 5GJTUEJÌP



8005 1,5:1

1,5:1



1.;06*15%JCNMKFKUEJGT$WPFÕ6GVTCFTCEJOGX%JT/CIKUVTCV#RQNNQFQTQUI #RQNNQMQRHNOKV.QTDGGTMTCP\-KVJCTC#/0)50)#05  44#VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIXQT\ÒINKEJ



8006

8007

8007 1,5:1





-¤0+)4'+%* 2JKNKRRQU ++  X %JT Õ&TCEJOGX%JT#ORJKRQNKUI *GTCMNGUMQRHKO.ÌYGPHGNNT4GKVGTNOKV<YGKI.G4KFGT2N  44/KPMQTTQFKGTVUGJTUEJÌPGU'ZGORNCT



Õ6GVTCFTCEJOG  X %JT 2GNNC  I <GWUMQRH T OKV .QTDGGTMTCP\4GKVGT T WPVGP   $NKV\.G4KFGT2N *GTTNKEJGT5VKN#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC  'ZGORNCTFGT#WMVKQP-TG­/ÒPEJGP0T

151


MACEDONIA

8008

8008 1,5:1



Õ6GVTCFTCEJOG  X %JT #ORJKRQNKU  I <GWUMQRH T OKV .QTDGGTMTCP\4GKVGT T   WPVGPLWPF2TQTC.G4KFGTXGTIN2NHH &4  8QT\ÒINKEJ

8009

8010

8011

8011 1,5:1

8010 1,5:1





Ô5VCVGTX%JT2GNNCI#RQNNQMQRHTOKV.QTDGGTMTCP\$KICTFCTWPVGT$NKV\.G 4KFGT6H (CUUWPIUURWTGPUQPUVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



2JKNKRR ++ FGT 8CVGT #NGZCPFGTU FGU )TQ­GP IGNCPIVG  CP FKG 4GIKGTWPI $CNF PCEJ UGKPGO 4GIKGTWPIUCPVTKVV   IGNCPIGUKJOFCUIQNFWPFUKNDGTTGKEJG2CPICKQPIGDKGVWPVGTUGKPG-QPVTQNNG\WDTKPIGPFGUUGP,CJTGUGTVTCI 6CNGPVG DGVTWI WPF KJO FKG #WURT·IWPI FGT UEJÌPGP )QNFUVCVGTG KP FGT #PVKMG 2JKNKRRGKQK IGPCPPV GTOÌINKEJVG   &KG 8QTFGTUGKVG WPUGTGU 5VÒEMGU \GKIV FGP -QRH #RQNNU FGU FGNRJKUEJGP )QVVGU \W FGO 2JKNKRRQU GKPG DGUQPFGTG   $G\KGJWPI JCVVG +O  *GKNKIGP -TKGI JCVVG 2JKNKRR UKEJ IGIGP FKG 2JQMGT IGYCPFV YGNEJG FKG 6GORGNUEJ·V\G KP   &GNRJK IGTCWDV JCVVGP &KG 4ÒEMUGKVG URKGNV CWH GKPGP 5KGI 2JKNKRRU  X %JT DGK FGP 1N[ORKUEJGP 5RKGNGP CP  

UKGJG 2NWVCTEJ #NGZ   +PFGO 2JKNKRRQU ++ CWH FKGUGO 5VÒEM UQYQJN GKPG 8GTDKPFWPI \W &GNRJK CNU CWEJ \W   1N[ORKC UEJWH \YGK 1TVGP FKG CNNGP )TKGEJGP JGKNKI YCTGP DTCEJVG GT CWEJ UGKP RCPJGNNGPKUEJGU RQNKVKUEJGU 2TQ   ITCOO\WO#WUFTWEM&GT2JKNKRRGKQUYCTGKPGFGT9GNVOÒP\GPFGT#PVKMG



Ô5VCVGT  X %JT 2GNNC  I #RQNNQMQRH T OKV .QTDGGTMTCP\$KIC T FCTWPVGT-CPVJC TQU.G4KFGT6H 5GJTUEJÌPpXQT\ÒINKEJ 



Ô5VCVGT  X %JT #ORJKRQNKU  I #RQNNQMQRH T OKV .QTDGGTMTCP\$KIC T FCTWPVGT   *CNDOQPF.G4KFGT6H )WVGUUGJTUEJÌP 

8013

8012 1,5:1

1,5:1

1,5:1

1,5:1



Ô 5VCVGT  X %JT 2GNNC  I *GTCMNGUMQRH KO .ÌYGPHGNN T-GWNG FCTÒDGT $QIGP   WPF-CPVJCTQU.G4KFGT2N -N-TCV\GTUGJTUEJÌP





Ô5VCVGTX%JT2GNNCI*GTCMNGUMQRHKO.ÌYGPHGNNT&TGK\CEM.G4KFGT2N 5GJTUEJÌP



1,5:1



8014

1,5:1

Ô5VCVGT RQUVJWO  X %JT #D[FQU  I #RQNNQMQRH T OKV .QTDGGTMTCP\0KMG KP $KIC   T WPVGP /QPQITCOO 6JQORUQP KP 5VWFKQ 2CWNQ 0CUVGT 1DNCVC  6JQORUQP #NGZCPFGT U &TCEJO   /KPVU++ 4(GKPGT5VKNIWVGUUGJTUEJÌP  &KGUGRQUVJWOGP2JKNKRRGKGTYWTFGPPCEJFGO6QF#NGZCPFGTU+++XQPMÌPKIUVTGWGP-T·HVGPIGRT·IVFKGUQFCTCP GTKPPGTPYQNNVGPFC­2JKNKRRQU+++#TTJKFCKQUGKP5QJPFGU2JKNKRRQU++WPFUQOKVTGEJVO·­KIGT6JTQPHQNIGTYCT

152


MACEDONIA

8015

8015

8016

8016

1,5:1





1,5:1

Ô5VCVGTRQUVJWOX%JT/CIPGUKCI#RQNNQMQRHTOKV.QTDGGTMTCP\0KMGKP$KIC TWPVGP6J[TUQU6JQORUQPKP5VWFKQ2CWNQ0CUVGT1DNCVC5  $TGKVGT5EJTÌVNKPIHGKPGT5VKNCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Ô5VCVGTRQUVJWOX%JT/CIPGUKCI#RQNNQMQRHTOKV.QTDGGTMTCP\0KMGKP$KIC TWPVGP(ÒNNJQTP6JQORUQPKP5VWFKQ2CWNQ0CUVGT1DNCVC5 (GKPGT5VKNUGJTUEJÌP



8018

8017

1,5:1

1,5:1

1,5:1

1,5:1



Ô5VCVGT RQUVJWO  #ORJKRQNKU  I #RQNNQMQRH T OKV .QTDGGTMTCP\$KIC T WPVGP   &TGK\CEM.G4KFGT2N )WVCWUIGRT·IVGUXQT\ÒINKEJGU'ZGORNCT 



Ô5VCVGT RQUVJWO  #ORJKRQNKU  I #RQNNQMQRH T OKV .QTDGGTMTCP\$KIC T WPVGP   &TGK\CEM.G4KFGT2N 8QPHGKPGO5VKNWPFXQT\ÒINKEJGTJCNVGP 

8019

8020

1,5:1

8021

1,5:1



Õ6GVTCFTCEJOG RQUVJWO  X %JT #ORJKRQNKU  I <GWUMQRH T OKV .QTDGGTMTCP\   4GKVGTTOKV<YGKIWPVGP#RJNCUVQPWPFP.G4KFGT2N 8QT\ÒINKEJ





Õ6GVTCFTCEJOG RQUVJWO  X %JT #ORJKRQNKU  I <GWUMQRH T OKV .QTDGGTMTCP\   4GKVGTTOKV<YGKIWPVGP&GNRJKPWPFP.G4KFGT2N (CUVXQT\ÒINKEJ





Õ6GVTCFTCEJOG RQUVJWO  X %JT #ORJKRQNKU  I <GWUMQRH T OKV .QTDGGTMTCP\   4GKVGTTOKV<YGKIWPVGP&GNRJKPWPFP.G4KFGT2N )WVGUUGJTUEJÌP



1,5:1



8022

1,5:1

#NGZCPFGT +++  X %JT Õ&TCEJOG  X %JT 5CNCOKU  I *GTCMNGUMQRH KO   .ÌYGPHGNNT<GWU#GVQRJQTQUUKV\VNFCXQT$QIGP2TKEG 5EJÌPG2CVKPCIWVGUUGJTUEJÌP

 153


MACEDONIA

1,5:1



8023 1,5:1

Ô&KUVCVGTX%JT#ORJKRQNKUI#VJGPCMQRHT0KMGUVGJVNOKV-TCP\WPF5V[NKUN &TGK\CEM2TKEG 44#VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ 

8024

8026 1,5:1

8025



Õ6GVTCFTCEJOGX%JT$[DNQUI*GTCMNGUMQRHKO.ÌYGPHGNNT<GWU#GVQRJQTQU UKV\VNFCXQT/QPQITCOO2TKEG 5GJTUEJÌP



Ô5VCVGT  X %JT .CORUCMQU  I #VJGPCMQRH T KP MQTKPVJKUEJGO *GNO0KMG UVGJV N   OKV-TCP\WPF5V[NKUFCXQT\YGKXGTGKPVG2HGTFGRTQVQOGNWPVGP/QPQITCOO2TKEG  8QT\ÒINKEJ 



Õ6GVTCFTCEJOGX%JT#TCFQUI*GTCMNGUMQRHKO.ÌYGPHGNNT<GWU#GVQRJQTQU UKV\VNN-GT[MGKQP2TKEG .GKEJVMQTTQFKGTVUGJTUEJÌP





8027

1,5:1



1,5:1

Õ&TCEJOGX%JT/KNGVI*GTCMNGUMQRHKO.ÌYGPHGNNT<GWU#GVQRJQTQUUKV\VN FCXQT/QPQITCOOWPVGTFGO6JTQP5VGTP2TKEG -CDKPGVVUVÒEM(CUV5VGORGNINCP\



8028 1,5:1



154

1,5:1

Õ6GVTCFTCEJOG  X %JT RQUVJWO #ORJKRQNKU  I *GTCMNGUMQRH KO .ÌYGPHGNN T   <GWU#GVQRJQTQUUKV\VNN/QPQITCOO2TKEGXGTIN6TQZGNN5VWFKGUKPVJG/CEGFQPKCP%QKPCIG QH#NGZCPFGTVJG)TGCV0GY;QTM)TWRRG+ 8QT\ÒINKEJGU2TCEJVGZGORNCT 


MACEDONIA

8029

8030 1,5:1





Ô5VCVGT RQUVJWO  X %JT $CD[NQP  I #VJGPCMQRH T KP MQTKPVJKUEJGO *GNO0KMG   UVGJVNOKV-TCP\WPF5V[NKUN/QPQITCOOKP-TCP\WPVGPGKPYGKVGTGU/QPQITCOO2TKEG  5GJTUEJÌP



Õ&TCEJOGRQUVJWOX%JT/KNGVI*GTCMNGUMQRHKO.ÌYGPHGNNT<GWU#GVQRJQ TQUUKV\VNFCXQT/QPQITCOO2TKEG $TGKVGUXQT\ÒINKEJGU'ZGORNCT



8031

8032

8032 1,5:1





2JKNKRRQU+++X%JTÕ6GVTCFTCEJOGX%JT$CD[NQPI*GTCMNGUMQRHKO .ÌYGPHGNNT<GWU#GVQRJQTQUUKV\VNN/CWHFGO6JTQPLU2TKEG2  (GKPG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



&GOGVTKQU 2QNKQTMGVGU  X %JT Õ&TCEJOG  X %JT 6CTUQU  I 0KMG OKV   5CNRKPZNCWH2TQTC2QUGKFQPUVGJVNOKV&TGK\CEM0GYGNN 45GJTUEJÌP



&KG&CTUVGNNWPICWHFGT8QTFGTUGKVGGTKPPGTVCPFKG0KMGXQP5COQVJTCMGKO.QWXTG

8034

8033



#PVKIQPQU)QPCVCUX%JTÕ6GVTCFTCEJOGI-QRHFGU2CPNCWHOCMGFQPKUEJGO 5EJKNF#VJGPC#NMKFGOQUNOKV5EJKNFWPF$NKV\NOCMGFQPKUEJGT*GNOT/QPQITCOO#/0) 50)%QR 5GJTUEJÌP

&KG 8QTFGTUGKVG FGU 5VÒEMGU GTKPPGTV CP FKG 5EJNCEJV XQP .[UKOCEJGKC KO ,CJTG  X %JT +P FKGUGT 5EJNCEJV   IGNCPI GU #PVKIQPQU )QPCVCU FKG DKUNCPI KP QHHGPGT (GNFUEJNCEJV WPIGUEJNCIGPGP )CNCVGT FKG FCU OCMGFQPKUEJG   -ÌPKITGKEJ \GTUVÌTV JCVVGP \W DGUKGIGP &GT FWTEJ FKGUGP 5KGI GTYQTDGPG 4WJO HÒJTVG \WT 9CJN FGU #PVKIQPQU   )QPCVCU \WO -ÌPKI FGT /CMGFQPGP &GT )QVV 2CP UQNN KP FGT 5EJNCEJV XQP .[UKOCEJGKC GTUEJKGPGP UGKP WPF FKG   )CNCVGT KP #PIUV WPF 5EJTGEMGP XGTUGV\V JCDGP FKGU GTMN·TV FCU DGUQPFGTG 8GTJ·NVPKU FGU #PVKIQPQU \W 2CP &KG   #VJGPC #NMKFGOQU FGT 4ÒEMUGKVG YCT OÌINKEJGTYGKUG FKG 5VCFVIÌVVKP XQP 2GNNC UKGJG $TGVV KP #05/0 +8     5HH 





#PVKIQPQU&QUQPX%JTÕ6GVTCFTCEJOG2GNNC ! I2QUGKFQPMQRHT#RQNNQUKV\VN CWH2TQTCOKV$QIGP/GTMGTKP#05/0+:5 )WVGUUGJTUEJÌP  .CWV/GTMGTHGKGTVFKG4ÒEMUGKVGFGP5GGUKGIFGU&QUQPÒDGT2VQNGOCKQU+++DGK#PFTQUKO,CJTX%JT

8035 1,5:1



1,5:1

2JKNKRRQU8X%JTÕ&KFTCEJOGI-QRHTOKV&KCFGO+P-TCP\-GWNG$CNFYKP $TGVV$QUVQP#/0)50)#UJOQNGCP50)%QR50).QEMGVV  449KP\-TCV\GTCWHFGO#XGTUXQT\ÒINKEJ

 155


PAEONIA

8036

1,5:1



1,5:1

2GTUGWU  X %JT Õ&TCEJOG PCEJ TJQFKUEJGO 6[R  X %JT /CIKUVTCV *GTOKCU   I*GNKQUMQRHHCUVXX4QUGWPVGPZW2TKEG6JG.CTKUUC*QCTFKP-TCC[/ÎTMJQNO 'UUC[U2N.850)-GEMOCP 8QT\ÒINKEJ



2GTUGWU NKG­ KP UGKPGO -TKGI IGIGP 4QO FKGUG 5VÒEMG \WT $G\CJNWPI MTGVKUEJGT 5ÌNFPGT RT·IGP 'T Y·JNVG FGP   TJQFKUEJGP 6[R FC UQNEJG 5VÒEMG FGP -TGVGTP DGMCPPV YCTGP WPF XQP KJPGP CM\GRVKGTV YWTFGP &GT /CIKUVTCV   *GTOKCU YCT OÌINKEJGTYGKUG FGT 5QJP FGU CNVGP /ÒP\FKTGMVQTU FGU 2GTUGWU <QKNQU UKGJG #UJVQP KP 0%  5    8KGNNGKEJVUVGJGPFKG$WEJUVCDGPZWCWHFGO4GXGTUCDGTCWEJHÒT<QR[TQUFGUUGP/QPQITCOOCWHCPFGTGP RUGWFQTJQFKUEJGP&TCEJOGPGTUEJGKPV UKGJG#UJVQPKP0%5 

8037

8037 1,5:1



Õ6GVTCFTCEJOGX%JTI-QRHTOKV&KCFGO#FNGTUVGJVTCWH$NKV\/COTQVJD 9KP\5EJTÌVNKPIUTK­HCUVXQT\ÒINKEJGU'ZGORNCT



0CEJFGO$GIKPPFGU-TKGIGUIGIGP4QONKG­2GTUGWUFCU)GYKEJVFGT6GVTCFTCEJOGPWOGVYCJGTCDUGV\GP WO)GNF\WIGYKPPGP5QGTMN·TVUKEJFCU)GYKEJVFKGUGU5VÒEMGU

8038

1,5:1

1,5:1 8039

8039



#PQP[OÕ6GVTQDQNX%JTI/·PCFGPMQRHT2TQTCT#/0)50)%QR (GKPG2CVKPCIWVGUUGJTUEJÌP





4¤/+5%*'2418+0<Õ6GVTCFTCEJOGX%JTI&TCRKGTVG#TVGOKUDÒUVGTOKV $QIGP WPF -ÌEJGT CWH OCMGFQPKUEJGO 5EJKNF-GWNG KP -TCP\ N $NKV\ 50) #UJOQNGCP    50)%QR 8QT\ÒINKEJ



8041

8040 1,5:1

2#'10+# 

-¤0+)4'+%* .[MMGKQU  X %JT Õ6GVTCFTCEJOG  I <GWUMQRH T*GTCMNGU GT   YÒTIVFGPPGOGKUEJGP.ÌYGP#/0)50)#05 (GKPGT5VKNXQT\ÒINKEJ





Õ5VCVGT  I <GWUMQRH T*GTCMNGU GTYÒTIV FGP PGOGKUEJGP .ÌYGP T -ÌEJGT WPF $QIGP   50)#05 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



156


THESSALIA

8042 1,5:1



1,5:1

2CVTCQU  X %JT Õ6GVTCFTCEJOG  I #RQNNQMQRH T OKV .QTDGGTMTCP\4GKVGT T GT   UVKEJVIGUVÒT\VGP)GIPGT50)#05 4GXGTUUVGORGNINGKEJ   (GKPGT5VKN#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

8043



Õ6GVTCFTCEJOG  I #RQNNQMQRH T OKV .QTDGGTMTCP\4GKVGT T GTUVKEJV IGUVÒT\VGP )GIPGT   50)#05 5VGORGNDTWEJCWHFGO#XGTUXQT\ÒINKEJIWVGUUGJTUEJÌP

1,5:1

8044

1,5:1



8045

6*'55#.+# 

-+'4+10 Õ6TKJGOKQDQN  X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\&KG 0[ORJG   #TPGMPKGVTWPFURKGNVOKV#UVTCICNQK$/%50)%QR 445GJTUEJÌP





.#4+55# Õ&TCEJOG  X %JT  I 0[ORJGPMQRH HCUV X X2HGTF ITCUV T WPVGP   2HNCP\G*GTTOCPP6H8 5GJTUEJÌPXQT\ÒINKEJ



8048

8046

1,5:1

8047

1,5:1



Õ&TCEJOG  X %JTI0[ORJGPMQRHHCUVXX5VWVGWPF(QJNGPUVGJGPPGDGPGKPCP FGTT*GTTOCPP6H8+HH 5GJTUEJÌP





Õ&TCEJOG  X %JTI0[ORJGPMQRHHCUVXX5VWVGWPF(QJNGPUVGJGPPGDGPGKPCP FGTT*GTTOCPP6H8+ 5GJTUEJÌP





Õ&TCEJOGX%JTI0[ORJGPMQRHHCUVXX2HGTFITCUVT*GTTOCPP6H8++ 8QT\ÒINKEJ



1,5:1



8049

1,5:1

.+)#X%JTÕ*GOKFTCEJOGX%JT/CIKUVTCV2QN[  I-QRHFGU<GWU XQP &QFQPC T OKV 'KEJGPMTCP\#VJGPC +VQPKC UVGJV T OKV 5RGGT WPF 5EJKNF $/%  50) #UJOQ   NGCPXGTIN50)%QR (CUVXQT\ÒINKEJ

 157


ARCANANIA

8050

8051

8052

8053

#%#40#0+# 

#0#-614+10 Õ5VCVGT  X %JT  I 2GICUWU HNKGIV N#VJGPCMQRH N OKV MQTKPVJK   UEJGO*GNOFCJKPVGT&TGKHW­KP-TCP\%CNEKCVK2GICUK 5GJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT 1ORJCNQU%CNEKCVK2GICUK 5GJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT .[TC%CNEKCVK2GICUK #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT $WMTCPKQP%CNEKCVK2GICUK #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



8054

8056

8055

8057



Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT $WMTCPKQP%CNEKCVK2GICUK #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





#4)15#/2*+.1%*+-10Õ5VCVGTX%JTI2GICUWUHNKGIVNFCTWPVGTFGT-QRH GKPGU /QNQUUGTJWPFGU#VJGPCMQRH N OKV MQTKPVJKUEJGP *GNO FCJKPVGT MQTKPVJKUEJGT *GNO %CNEKCVK   2GICUK #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Õ5VCVGT  X %JT  I 2GICUWU HNKGIV N#VJGPCMQRH NOKVMQTKPVJKUEJGP*GNOFCJKPVGT MQTKPVJKUEJGT*GNO%CNEKCVK2GICUK 5GJTUEJÌP





Õ5VCVGT  X %JT  I 2GICUWU HNKGIV N#VJGPCMQRH NOKVMQTKPVJKUEJGP*GNOFCJKPVGT 5RGGT%CNEKCVK2GICUK )WVGUUGJTUEJÌP



8058

8059

8060



.'7-#5Õ5VCVGTX%JTI2GICUWUHNKGIVN= L? EUKADIWN#VJGPCMQRHNOKV MQTKPVJKUEJGO*GNO$/%%CNEKCVK2GICUK 4UUVGORGNINGKEJ  45GJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT /CUV%CNEKCVK2GICUK 5GJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT #PMGT%CNEKCVK2GICUK #XGTUNGKEJVMQTTQFKGTVHCUVXQT\ÒINKEJXQT\ÒINKEJ



158


BOEOTIA

8061

8063

8062

1,5:1

1,5:1



6*;44*'+10 Õ5VCVGT  X %JT  I 2GICUWU HNKGIV N#VJGPCMQRH N OKV MQTKPVJK   UEJGO*GNOFCJKPVGT4J[VQP%CNEKCVK2GICUK )WVGUUGJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT 1JTTKPI%CNEKCVK2GICUK (CUVXQT\ÒINKEJ





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT DQKQVKUEJGT5EJKNF%CNEKCVK2GICUK )WVGUUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

1,5:1

8064

8065

1,5:1

#+61.+# 

.KIC  X %JT Õ5VCVGT  X %JT  I /·PPNKEJGT -QRH T OKV 'KEJGPMTCP\   -TKGIGT UVGJV N OKV 5RGGT WPF 2CTC\QPKWO (W­ CWH (GNUGP FCXQT /QPQITCOO 5EJGW KP 0%    5 42T·IGUEJY·EJGCWHFGO#XGTUUGJTUEJÌPHCUVXQT\ÒINKEJ



&KGUG 5VCVGTG UKPF PCEJ FGO (W­ XQP %QTE[TC IGRT·IV WPF GPVURTCEJGP XKGT MQTKPVJKUEJGP &TCEJOGP 5EJGY   0%5HH #WUGKPGO$ÒPFPKUXGTVTCI\YKUEJGP#ECTPCPKGPWPF#KVQNKGPCWUFKGUGT<GKVYKUUGPYKTFC­ GKP*QRNKV\YGK&TCEJOGPCO6CICNU5QNFGTJKGNV

.1%4+5 

.1-4+512706+#Õ*GOKFTCEJOGX%JT1RQWUI&GOGVGTMQRHT#LCZIGJV TOKV5EJYGTVWPF5EJKNFWPVGP.CP\G$/%50)%QR 5GJTUEJÌP

8066

8067

1,5:1



8068

1,5:1

$1'16+# 

6*'$'0 Õ5VCVGT  X %JT  I $QGQVKUEJGT 5EJKNF#ORJQTG \YKUEJGP KALLI   $/%5NI$%& (CUVXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC





Õ5VCVGT  X %JT  I $QGQVKUEJGT 5EJKNF#ORJQTG \YKUEJGP KALL =+? $/%    5NI$%& 5GJTUEJÌP





Õ5VCVGT  X %JT  I $QGQVKUEJGT 5EJKNF#ORJQTG \YKUEJGP ('RG $/%    5NI$%& 5GJTUEJÌP

 159


ATTICA

8069



-1+010Õ*GOKFTCEJOGX%JTI$QKQVKUEJGT5EJKNF-CPVJCTQUFCTÒDGT-GWNGT *CNDOQPF$/%5NI$%& FKGU'ZGORNCT  (CUVXQT\ÒINKEJGU'ZGORNCT

8070

1,5:1





1,5:1

Õ&TCEJOG WO  X %JT 6JGDGP !   I &GOGVGTMQRH HCUV X X OKV JTGPMTCP\2QUGKFQP   UVGJVTOKV&TGK\CEMWPF&GNRJKPFCXQTDIWPFDQKQVKUEJGT5EJKNF$/%5NI$%& FKGU'ZGO RNCT  8QT\ÒINKEJ



8071

8071 1,5:1

'7$1'# 

'4'64+# Õ5VCVGT  X %JT  I -WJ UVGJV T CO *KPVGTJWH NGEMGPF FCTWPVGT '   1MVQRWUT'5NI$%& 44ªDGTRT·IVUGJTUEJÌP 

8072 1,5:1

8074

8073 1,5:1

1,5:1

1,5:1

1,5:1

1,5:1

#66+%# 

#6*'0 Õ*GOKQDQN  X %JT ŋ9CRRGPOÒP\GŌ  I 4CF+PEWUWO 5GNVOCP 2N +8   aa5XQTQPQUXGTIN2N+HH 1DQNG  5GJTUEJÌP





Õ1DQN  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO+P +PEWUWO 'WNG T FCJKPVGT   1NKXGP\YGKI50)/ÒPEJGPH 5GJTUEJÌP



#TKUVQRJCPGUUEJTGKDVKPFGP8ÌIGNP&GPPYGTFGPGWEJ FKG#VJGPGT FKG'WNGPPKGXGTNCUUGPFKGXQP.CW TKQP 0GKP UKG YGTFGP UKEJ JKGT PKGFGTNCUUGP WPF KP FGP $ÌTUGP GKPPKUVGP WO CWU\WDTÒVGP MNGKPGU 9GEJUGNIGNF   &GT1DQNUKGJVCWUYKGGKPG/KPKCVWTVGVTCFTCEJOG



Õ1DQN  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO+P +PEWUWO 'WNG T FCJKPVGT   1NKXGP\YGKI50)/ÒPEJGPHH 5EJÌPpUGJTUEJÌP



8075 2:1



Õ&TCEJOG PCEJ  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO+P +PEWUWO 'WNG T FC   JKPVGT1NKXGP\YGKI5VCTT2N::++ FKGU'ZGORNCT   (GKPGT5VKN8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT2CVKPC 'ZGORNCTFGT#WMVKQP*GUU.GW<ÒTKEJ0T

160

2:1




ATTICA

8076 1,5:1



1,5:1

Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::++ /KPMQTTQFKGTVXQT\ÒINKEJ

8077



8078



8079

Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::++  $TGKVGT5EJTÌVNKPIRGTHGMV\GPVTKGTVGT4GXGTUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::++ )WVGUUGJTUEJÌP





Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::++ 5GJTUEJÌPpXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

8080

8081

8082

8083



Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::++ 4GXGTUNGKEJVFG\GPVTKGTVUGJTUEJÌP





Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::++ 9KP\2TÒHUVGNNGCO4CPFIWVGUUGJTUEJÌP





Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::+++  #WHDTGKVGO5EJTÌVNKPIJGTXQTTCIGPF\GPVTKGTVGU'ZGORNCTUGJTUEJÌPXQT\ÒINKEJ



Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::+++ 5GJTUEJÌP





161


ATTICA

8085 8086

8084



Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::+++ )WVGUUGJTUEJÌP





Õ6GVTCFTCEJOG WO  X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO'WNG T FCJKPVGT   1NKXGP\YGKIWPF/QPFUKEJGN5VCTTXGTIN2N::+++ 5GJTUEJÌP





Õ6GVTCFTCEJOGX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO'WNGUVGJVTFCJKPVGT 1NKXGP\YGKIWPF/QPFUKEJGN50)/ÒPEJGPXGTINHH 2TÒHRWP\GPCWHFGO#XGTUHCUVUGJTUEJÌP



8087



Õ6GVTCFTCEJOG6JCTIGNKQP /CK,WPK X%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO +P-TCP\'WNGCWH#ORJQTGOKVLXXT#FNGT6JQORUQP 5GJTUEJÌPXQT\ÒINKEJ



&KG0GWUVKNRT·IWPIGPUKPFPCEJ%JT$QGJTKPIGTFCVKGTV

8088 1,5:1



1,5:1

Õ6GVTCFTCEJOG )COGNKQP  ,CPWCT(GDTWCT   X %JT  I #VJGPCMQRH T OKV CVVKUEJGO   *GNO+P-TCP\'WNGCWH#ORJQTGOKV*XXN-GWNG.ÌYGPHGNNWPF$QIGP6JQORUQP  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

8089



8090



Õ6GVTCFTCEJOG 2QUGKFQPKQP  &G\GODGT,CPWCT   X %JT  I #VJGPCMQRH T OKV   CVVKUEJGO*GNO+P-TCP\'WNGCWH#ORJQTGOKV<XXNIGHNÒIGNVGT$NKV\6JQORUQP  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 



Õ6GVTCFTCEJOG6JCTIGNKQP /CK,WPK X%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO+P -TCP\'WNGCWH#ORJQTGOKVLXXT#TVGOKUOKV(CEMGN6JQORUQP 5GJTUEJÌP

162




CORINTHIA

8093

8092

8091

8094

8092 1,5:1

#')+0# 

#')+0# Õ5VCVGT  X %JT  I 5GGUEJKNFMTÌVG/GJTHCEJ IGVGKNVGU +PEWUWO   50)&GNGRKGTTGXGTINHH 4GXGTUGVYCUFG\GPVTKGTVGVYCUMQTTQFKGTVUGJTUEJÌP



Õ5VCVGT  X %JT  I .CPFUEJKNFMTÌVG FCTCWH 2WP\G(ÒPHHCEJ IGVGKNVGU +PEWUWO   50)&GNGRKGTTGXGTIN )WV\GPVTKGTVGUHCUVXQT\ÒINKEJGU'ZGORNCT 



Õ5VCVGT  X %JT  I .CPFUEJKNFMTÌVG(ÒPHHCEJ IGVGKNVGU +PEWUWO 50) &GNGRKGTTG   XGTIN #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



Õ5VCVGT  X %JT  I .CPFUEJKNFMTÌVG FCTCWH 2WP\G(ÒPHHCEJ IGVGKNVGU +PEWUWO   50)&GNGRKGTTGXGTIN (CUVXQT\ÒINKEJ

8095





8096 8096 1,5:1



Õ5VCVGT  X %JT  I .CPFUEJKNFMTÌVG FCTCWH 2WP\G(ÒPHHCEJ IGVGKNVGU +PEWUWO   50)&GNGRKGTTGXGTIN 5GJTUEJÌP



Õ5VCVGT  ,CJTJWPFGTV X %JT  I .CPFUEJKNFMTÌVG(ÒPHHCEJ IGVGKNVGU +PEWUWO FCTKP #IGI   WPF&GNRJKP/KNDCPM2GTKQFG8+2N+++50)&GNGRKGTTGXGTIN  4#VVTCMVKXGUIWVCWUIGRT·IVGU'ZGORNCTOKVJGTTNKEJGT2CVKPCHCUVXQT\ÒINKEJ 

8099

8097

1,5:1



8098

1,5:1

%14+06*+# 

-14+06* Õ5VCVGT  X %JT  I 2GICUWU HNKGIV N+P +PEWUWO #VJGPCMQRH T OKV   MQTKPVJKUEJGO*GNO%CNEKCVK2GICUK4CXGNXGTINHH 5GJTUEJÌP





Õ5VCVGT  X %JT  I 2GICUWU HNKGIV N+P +PEWUWO #VJGPCMQRH T OKV MQTKPVJKUEJGO   *GNO%CNEKCVK2GICUK4CXGNXGTINHH 5GJTUEJÌP





Õ5VCVGT  X %JT  I 2GICUWU HNKGIV T+P +PEWUWO #VJGPCMQRH T OKV MQTKPVJKUEJGO   *GNO%CNEKCVK2GICUKXGTIN4CXGN )WVGUUGJTUEJÌP

 163


PELOPONNESUS

8102

8100

1,5:1



8101

1,5:1

Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT #UVTCICN%CNEKCVK2GICUK4CXGN /KPMQTTQFKGTVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT -TCP\%CNEKCVK2GICUK)4 #DD 4CXGN 4GXGTUNGKEJVFG\GPVTKGTVUGJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT 'WNG%CNEKCVK2GICUK4CXGN #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



8103

8104

8105

8106

8106



Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO.QTDGGT CNU*GNO\KGTFCJKPVGT#GIKU%CNEKCVK2GICUK4CXGN .GKEJVFG\GPVTKGTVUGJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNO.QTDGGT CNU*GNO\KGTFCJKPVGT2HNWI%CNEKCVK2GICUK4CXGN 5GJTUEJÌP





Õ5VCVGTX%JTI2GICUWUHNKGIVN#VJGPCMQRHNOKVMQTKPVJKUEJGO*GNOFCJKPVGT #TVGOKUOKV(CEMGN%CNEKCVK2GICUK4CXGN 4GXGTUNGKEJVFG\GPVTKGTVXQT\ÒINKEJ





Õ6GVTCFTCEJOGPCEJCVVKUEJGO6[RX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO)TGKH WPF3WCFTKICCNU*GNO\KGT+P-TCP\'WNGCWH#ORJQTGOKV#XX6JQORUQP  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



2NWVCTEJ GTY·JPV FKG 2T·IWPI XQP 0GWUVKNVGVTCFTCEJOGP FWTEJ . .WEWNNWUKPFGT2GNQRQPPGU\WT(KPCP\KGTWPIFGU /KVJTCFCVKUEJGP -TKGIGU .WE ++   5QICT FKG 6GORGNUEJ·V\G XQP 'RKFCWTQU 1N[ORKC WPF &GNRJK YWTFGP XGT   OÒP\V&GTYCJTUEJGKPNKEJUVG1TVFGT2T·IWPIKUV#MTQMQTKPVJFKG$WTIXQP-QTKPVJUKGJG$QGJTKPIGT5

8107

1,5:1

1,5:1

8108

2'.12100'575 

2*.+#5+# 2*.+75 Õ1DQN  X %JT  I 5VKGTRTQVQOG NF XQP XKGT 2WPMVGP   WOIGDGP5NI$%&HH50)%QR 4-N4CPFCWUDTWEJIWVGUUGJTUEJÌP



'.+5 1.;/2+# Õ5VCVGT  1N[ORKCFG  X %JT *GTCVGORGN  I *GTCMQRH T OKV   5VGRJCPG+P1NKXGPMTCP\$NKV\5GNVOCP5NI$%&XGTIN  48QTFGTUGKVGNGKEJVFG\GPVTKGTVUGJTUEJÌP 

164




CRETA

8109

8110 8110 1,5:1



Õ*GOKFTCEJOGX%JTI<GWUMQRHTOKV.QTDGGTMTCP\+P-TCP\$NKV\$/% 5NI$%& FKGU'ZGORNCT  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





Õ&TCEJOGX%JTI#FNGTTCWH*CUGP$NKV\$/%5NI$%& FKGU'ZGO RNCT  (GKPG6ÌPWPIHCUVXQT\ÒINKEJ



1,5:1



8111

1,5:1

#4%#&+#/')#.121.+5Õ6TKQDQNWOX%JTI<GWUMQRHNOKV.QTDGGTMTCP\ 2CPUKV\VNOKV.CIQDQNQPFCXQT#FNGT&GPICVG+UUWG5NI$%& (GKPG2CVKPCXQT\ÒINKEJ

8112

8114

1,5:1



8113

1,5:1

%4'6# 

#26'4#Õ5VCVGTWOX%JTI-QRHFGT#TVGOKUXQP#RVGTCN2VQNKQKMQUUVGJVNOKV 5EJKNFWPF5RGGTFCXQT$CWO.G4KFGT2N::8+++5XQTQPQU  8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP





)146;0# Õ5VCVGT PCEJ  X %JT  I 'WTQRC UKV\V T CWH $CWO5VKGT UVGJV T \WTÒEM   DNKEMGPF.G4KFGT2N:8HH5XQTQPQUHH 4$TGKVGTNGKEJVQXCNGT5EJTÌVNKPIUGJTUEJÌP 



Õ5VCVGT PCEJ  X %JT  I 'WTQRC UKV\V T CWH $CWO5VKGT UVGJV T \WTÒEMDNKEMGPF .G   4KFGT2N:85XQTQPQUXGTIN )WVGUUGJTUEJÌP

1,5:1



8115



1,5:1

Õ&TCEJOG  X %JT  I -QRH FGU <GWU QFGT /KPQU!  N0CEMVGT -TKGIGT )QTV[U !    UVGJVNOKV5EJKNFWPF.CP\GN-TCP\50)%QR5XQTQPQU  5GNVGPKPFKGUGT'TJCNVWPI-N5EJTÌVNKPIUTK­XQT\ÒINKEJGU'ZGORNCT  165


PONTUS

8116

8118

8117



-015515 Õ&TCEJOG WO  X %JT  I *GTCMQRH N OKV 2QNQU.CD[TKPVJ \YKUEJGP #2   5XQTQPQU 44(GKPGT5VKNUGJTUEJÌP



.CD[TKPVJ DGFGWVGV WTURTÒPINKEJ GVYC *CWU FGT &QRRGN·ZVG  FKGUG YCTGP GKP YGKV XGTDTGKVGVGU 5[ODQN FGT OK   PQKUEJGP-WNVWTWPFFKGMTGVKUEJGP2CN·UVGYCTGPÒRRKIFCOKVCWUIGUEJOÒEMV&GPHTÒJGP)TKGEJGPOW­FGT2CNCUV XQP-PQUUQUKPUGKPGT)TÌ­GCDGTWPJGKONKEJGTUEJKGPGPUGKPUQFC­FGT$GITKHH.CD[TKPVJUGKPGJGWVKIG$GFGWVWPI

+TTICTVGP CPPCJO



2*#+5615Õ5VCVGT,CJTJWPFGTVX%JTI*GTCMNGUUVGJVXXOKV-GWNGWPF$QIGPN .ÌYGPHGNNÒDGT$CWO+PTWPFGO+PEWUWO5VKGTMQRH.G4KFGT2N::+5XQTQPQU2N::+++ 44'VYCUMQTTQFKGTVUEJÌPUGJTUEJÌP



24#+515 Õ5VCVGT  X %JT  I <GWU #GVQRJQTQU UKV\V N5VKGT UVÌ­V T .G 4KFGT   XGTIN2N8+++5XQTQPQUXCT 45GJTUEJÌP 

1,5:1



8119



1,5:1

4*#7-15Õ&TCEJOG,CJTJWPFGTVX%JTI,ÒPINKPIUMQRHHCUVXX+P+PEWUWO\YGK UEJYKOOGPFG&GNRJKPG5XQTQPQU 445GJTUEJÌP



'ZGORNCTFGT5COONWPI*CIGP6TQPPKGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0TFGT5COO NWPI $GOGPV #WMVKQP #TU %NCUUKEC 8++ )GPH  0T  FGT 5COONWPI 5KT * 9GDGT 0T  WPF FGT   5COONWPI)GPGTCN/QQTG5QVJGD[  &KG<WYGKUWPIKUVPKEJVIGUKEJGTV

8120

210675 

#/+575 Õ&TCEJOG  ,CJTJWPFGTV X %JT /CIKUVTCV #RJTQ    I*GTCMQRH N OKV   5VGRJCPG'WNGCWH5EJKNFXX50)$/ 5GJTUEJÌP



8121

8121 1,5:1



-¤0+)4'+%* /KVJTCFCVGU 8+  X %JT Õ6GVTCFTCEJOG ,WPK FGU ,CJTGU  DKVJ[PQ   RQPVKUEJGTTC X%JT I-QRHTOKV&KCFGO*KTUEJYGKFGVNKP'HGWMTCP\FG%CN NCVC[5 .GKEJVGT&QRRGNUEJNCICWHFGO4GXGTUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  /KVJTCFCVGU8+FGTNGV\VGITQ­G)GIPGTFGT4ÌOGT\GKIVCWHUGKPGP/ÒP\GPGKP2QTVT·VOKVHNKGIGPFGP*CCTGPXQP HCUVDCTQEMGO5VKN

166


MYSIA

8123

8122

8122

$+6*;0+# 

-¤0+)4'+%*0KMQOGFGU++X%JTÕ6GVTCFTCEJOG,CJT X%JT   I -QRH T OKV &KCFGO<GWU UVGJV N OKV <GRVGT FGP 0COGP FGU -ÌPKIU DGMT·P\GPF FCXQT   #FNGTCWH$NKV\N9CFFKPIVQP4GEIGP #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVJGTTNKEJGT2CVKPC 



0KMQOGFGU+8X%JTÕ6GVTCFTCEJOG,CJT X%JT I-QRHTOKV&KC FGO<GWUUVGJVNOKV<GRVGTFGP0COGPFGU-ÌPKIUDGMT·P\GPFFCXQT#FNGTCWH$NKV\N9CFFKPI VQP4GEIGP QJPGFKGUGU/QPQITCOO  (CUVXQT\ÒINKEJXQT\ÒINKEJ



8124

1,5:1



1,5:1

Õ6GVTCFTCEJOG ,CJT    X %JT   I -QRH T OKV &KCFGO<GWU UVGJV N OKV <GRVGT   FGP0COGPFGU-ÌPKIUDGMT·P\GPFFCXQT#FNGTCWH$NKV\N9CFFKPIVQP4GEIGP  8QT\ÒINKEJGU2TCEJVGZGORNCT 

1,5:1

8125

1,5:1

/;5+# 

-+56*'0'1TQPVCU5CVTCRÕ6GVTQDQNX%JTI*QRNKVMPKGVNOKV*GNO5RGGT WPF5EJKNF2TQVQOGGKPGUIGHNÒIGNVGP'DGTUT6TQZGNN1TQPVGU 45GJTUEJÌP

2:1



8126



2:1

-;<+-15 'N 5VCVGT  X %JT  I 6JWPHKUEJMQRH T OKV IGÌHHPGVGO /CWN8KGTIG   VGKNVGU+PEWUWOX(TKV\G9CIIQPGT4QUGP%QNN )WVGUUGJTUEJÌP

 167


MYSIA

8127

8128

8129



'N5VCVGT  X %JT  I ,ÒPINKPI MPKGV N KP LGFGT *CPF GKPGP 6JWPHKUEJ8KGTIGVGKNVGU   +PEWUWOX(TKV\G50)(TCPEG 45GJTUEJÌP 



'N5VCVGT  X %JT  I )TGKH N CWH 6JWPHKUEJ8KGTIGVGKNVGU +PEWUWO X (TKV\G    50)(TCPEG 45GJTUEJÌP 



'N5VCVGT  X %JT  I -TKGIGT T OKV *GNO 5EJKNF WPF 6JWPHKUEJ8KGTIGVGKNVGU +PEW   UWOX(TKV\G50)(TCPEG 45GJTUEJÌP 

8130



8131

8130

1,5:1

1,5:1

8131

'N*GMVG  5VCVGT   X %JT  I 'DGT UVGJV N CWH 6JWPHKUEJ8KGTIGVGKNVGU +PEWUWO   X(TKV\G50)(TCPEG 5GJTUEJÌP



'ZGORNCT FGT #WMVKQP 2GWU 0CEJH  (TCPMHWTV CO /CKP  0T  WPF FGT #WMVKQP #WEVKQPGU  $CUGN   0T



'N*GMVG  5VCVGT   X %JT  I *WPF N CWH 6JWPHKUEJ8KGTIGVGKNVGU +PEWUWO   X(TKV\G50)(TCPEG #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

8132

8133

8132 2:1

8133 2:1



'N*GMVG 5VCVGT X%JTI0KMGKO-PKGNCWHNOKV6JWPHKUEJ8KGTIGVGKNVGU+PEW UWOX(TKV\G50)(TCPEG #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



'N*GMVG  5VCVGT   X %JT  I 6TKVQP N ÒDGT 6JWPHKUEJ N8KGTIGVGKNVGU +PEWUWO   X(TKV\G50)(TCPEG (CUVXQT\ÒINKEJ



'ZGORNCT5COONWPI-NCWU/CTQYUM[#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  6TKVQP GKP XQTRQUGKFQPKUEJGT /GGTIQVV YKTF DGK *GUKQF 6JGQI  HH  \WO 5QJP FGU 2QUGKFQP WPF FGT   #ORJKVTKVG

8134



2:1

8134

'N 5VCVGT  X %JT  I ,ÒPINKPI MPKGV N OKV 6JWPHKUEJ8KGTIGVGKNVGU +PEWUWO   X(TKV\G50)(TCPEGXGTIN 5VCVGT  44)WVGUUGJTUEJÌP



'ZGORNCTFGT#WMVKQP5$8$CUGN0T

8135 1,5:1

 168

1,5:1

Õ6GVTCFTCEJOG  ,CJTJWPFGTV X %JT  I -QRH FGT -QTG 5QVGKTC N OKV JTGPMTCP\ WPF   5EJNGKGT.ÌYGPMQRHNFCTWPVGT6JWPHKUEJX(TKV\G 45GJTUEJÌPGU'ZGORNCT 


AEOLIS

8136

8136

1,5:1



.#/25#-15'N5VCVGTWOX%JTI2GICUWURTQVQOGNWOIGDGPXQPGKPGT9GKPTCPMG 8KGTIGVGKNVGU+PEWUWO$CNFYKP2GTKQFG++Y FKGU'ZGORNCT  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP$TÒFGT'IIGT9KGP0T  .CORUCMQUCOPÌTFNKEJGP'KPICPI\WO*GNNGURQPVIGNGIGPYCT\WUCOOGPOKV-[\KMQUGKPGTFGT8QTQTVGHÒTFGP *CPFGN OKV FGP 4CPFXÌNMGTP FGU 5EJYCT\GP /GGTGU &KGUG DGXQT\WIVGP 'N/ÒP\GP WPF FGUJCND YWTFGP KP   .CORUCMQUPQEJNCPIG'N5VCVGTGIGRT·IVCNUUKGKP-NGKPCUKGPUEJQPN·PIUVCW­GT)GDTCWEJIGMQOOGPYCTGP

8137

8139 8138

1,5:1

1,5:1



2#4+10 Õ&TCEJOG WO  X %JT  I )QTIQPGKQP+P +PEWUWO CWU .KPKGP IGHQTOVGU   -TGW\9CIIQPGT4QUGP%QNN 2TÒHGKPJKGDUGJTUEJÌP





2'4)#/10 5VCFV “U PCEJ  X %JT  I #VJGPCMQRH T OKV MQTKPVJKUEJGO *GNO6TQ   RJ·G50)(TCPEG &WPMGNITÒPG2CVKPCUGJTUEJÌP





241-100'515 Õ*GOKFTCEJOG  ,CJTJWPFGTV X %JT  I 9GKDNKEJGT -QRH N1KPQ   EJQG50)X#WNQEM 45GJTUEJÌP



1,5:1

8140

1,5:1

641#5 

+.+10 “U UR·VGU  QFGT HTÒJGU  ,CJTJWPFGTV P %JT  I #GPGCU IGJVTVT·IVUGKPGP8CVGT #PEJKUGU WPF HÒJTV UGKPGP 5QJP #UECPKWU#VJGPCMQRH N OKV MQTKPVJKUEJGO *GNO ÒDGT FGT 5EJWNVGT   5RGGTWOFGPGKPG5EJNCPIGIGYWPFGPKUV$GNNKPIGT6TQ[6 45GJTUEJÌP



<WT&CVKGTWPIUKGJG42%++

8141

8142

#'1.+5 



-;/' Õ6GVTCFTCEJOG PCEJ  X %JT /CIKUVTCV /GVTQRJCPGU  I -QRH FGT #OC\QPG   -[OGTOKV6CGPKG+P.QTDGGTMTCP\2HGTFUVGJVTFCXQT5M[RJQU1CMNG[KP#05/0 5GJTUEJÌPpXQT\ÒINKEJ



Õ6GVTCFTCEJOGPCEJX%JT/CIKUVTCV-CNNKCUI-QRHFGT#OC\QPG-[OGTOKV6CGPKG +P.QTDGGTMTCP\2HGTFUVGJVTFCXQT5M[RJQU1CMNG[KP#05/0 )WVGUUGJTUEJÌP

 169


LESBOS

8143





8144

Õ6GVTCFTCEJOGPCEJX%JT/CIKUVTCV#ORJ[MVKQPI-QRHFGT#OC\QPG-[OGTOKV 6CGPKG+P.QTDGGTMTCP\2HGTFUVGJVTFCTWPVGT5M[RJQU1CMNG[KP#05/0  5GJTUEJÌP



/;4+0# Õ6GVTCFTCEJOG  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T+P .QTDGGTMTCP\   #RQNNQXQP)T[PGKQPUVGJVTOKV2CVGTCWPF.QTDGGT\YGKIOKVJGTCDJ·PIGPFGP6CGPKGPFCXQT1ORJC NQUWPF-CPVJCTQU5CEMU 5GJTUEJÌP



&GT#RQNNQXQP)T[PGKQPJCVYKG8GTIKNKPFGT#GPGKUCPIKDVFGO#GPGCUPCEJFGO(CNNXQP6TQLCDGHQJNGPPCEJ +VCNKGP\WGKNGP







8147

8146

8145

Õ6GVTCFTCEJOG  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T+P .QTDGGTMTCP\ #RQNNQ XQP   )T[PGKQP UVGJV T OKV 2CVGTC WPF .QTDGGT\YGKI OKV JGTCDJ·PIGPFGP 6CGPKGP FCXQT 1ORJCNQU WPF   -CPVJCTQU5CEMU 5GJTUEJÌPIWVGUUGJTUEJÌP



Õ6GVTCFTCEJOG  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T+P .QTDGGTMTCP\ #RQNNQ XQP   )T[PGKQP UVGJV T OKV 2CVGTC WPF .QTDGGT\YGKI OKV JGTCDJ·PIGPFGP 6CGPKGP FCXQT 1ORJCNQU WPF   -CPVJCTQU5CEMU 5GJTUEJÌP



Õ6GVTCFTCEJOG  ,CJTJWPFGTV X %JT  I #RQNNQMQRH T+P .QTDGGTMTCP\ #RQNNQ XQP   )T[PGKQP UVGJV T OKV 2CVGTC WPF .QTDGGT\YGKI OKV JGTCDJ·PIGPFGP 6CGPKGP FCXQT 1ORJCNQU WPF   -CPVJCTQU5CEMU 5GJTUEJÌP



8148

8148 1,5:1

.'5$15 

170

70$'-#006' /ª0<5666' $5VCVGT WO  X %JT  I <YGK -CNDUMÌRHG GKPCPFGT   IGIGPÒDGT FC\YKUEJGP 1NKXGPDCWO+PEWUWO 50) %QR  50) /ÒPEJGP  50) X #WNQEM   9CIIQPGT4QUGP%QNN 4&WPMGNIGVÌPVUGJTUEJÌPpXQT\ÒINKEJ 


IONIA

8150

8149 1,5:1



1,5:1

1,5:1

1,5:1

/;6+.'0' 'N*GMVG  5VCVGT   X %JT  I .ÌYGPMQRH T+PEWUGT -CNDUMQRH T   $QFGPUVGFV )WVGUUGJTUEJÌP



&KGUG'OKUUKQPFKGPVG\WT&GEMWPIFGUGTJÌJVGP)GNFDGFCTHGUY·JTGPFFGUKQPKUEJGP#WHUVCPFGU



'N*GMVG 5VCVGT X%JTI.ÌYGPMQRHT+PEWUGT-CNDUMQRHT$QFGPUVGFV  )WVGUUGJTUEJÌP



8152

8151 1,5:1

1,5:1

1,5:1

1,5:1



'N*GMVG  5VCVGT   X %JT  I &KQP[UQUMQRH T OKV 'HGWMTCP\-QRH GKPGU ,ÒPINKPIU   TOKV*CCTDCPFWPF*ÌTPEJGP$QFGPUVGFV 5GJTUEJÌP





'N*GMVG  5VCVGT   X %JT  I /·PPNKEJGT -QRH T OKV 6CGPKG WPF *QTP0[ORJGP   MQRHT$QFGPUVGFV  -N2TÒHUVGNNGCWHFGO#XGTUUQPUVJGTXQTTCIGPF\GPVTKGTVGU'ZGORNCTIWVGUUGJTUEJÌP



&GT ,ÒPINKPIUMQRH FÒTHVG FKG INGKEJG O[VJQNQIKUEJG (KIWT FCTUVGNNGP YKG FGT -QRH CWH FGT 4ÒEMUGKVG FGU XQTJGTIG   JGPFGP5VÒEMGU

8154

8153 1,5:1

1,5:1

1,5:1

1,5:1



'N*GMVG  5VCVGT   X %JT  I <GWUMQRH T OKV .QTDGGTMTCP\5EJNCPIGPRTQVQOG T   CWHIGTKEJVGV$QFGPUVGFV .GKEJVFG\GPVTKGTVUGJTUEJÌP





'N*GMVG  5VCVGT   X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\ FCJKPVGT 5EJNCPIG   #TVGOKUMQRHT$QFGPUVGFV$ 5GJTUEJÌP





Õ5VCVGT  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\+P .KPKGPSWCFTCV .[TC N   6J[TUQU$/% 44(GKPG2CVKPCUGJTUEJÌP 

8155

8156

1,5:1

8156

8157

1,5:1

8157

8158

1,5:1

8158

8159

2:1

8159

+10+# 

70$'56+//6'/ª0<5666''N5VCVGT,CJTJWPFGTVX%JTI.ÌYGPOCUMGX X+PEWUWO50)-C[JCP 5GJTUEJÌP





'N5VCVGT,CJTJWPFGTVX%JTI.ÌYGPOCUMGXX+PEWUWO8GTIN50)X#WNQEM XGTIN50)-C[JCP 5GJTUEJÌP





'N 5VCVGT  ,CJTJWPFGTV X %JT  I 8KGT -WIGNP WO GKPG \GPVTCNG -WIGN+PEWUWO   50)-C[JCP9CIIQPGT4QUGP%QNNXGTIN 5VCVGT  5GJTUEJÌP





'N5VCVGT,CJTJWPFGTVX%JTI'TJCDGPGU3WCFTCV+PEWUWO50)-C[JCP9CI IQPGT4QUGP%QNN 45GJTUEJÌP 'KPGWOHCPITGKEJG5RG\KCNUCOONWPIXQPHTÒJGPKQPKUEJGP'NGMVTQPRT·IWPIGPHKPFGP5KGWPVGT0T

 171


IONIA

8160

8161

1,5:1





'2*'515 Õ&TCEJOG WO  X %JT /CIKUVTCV %JCTOKPQU  I $KGPG*KTUEJ UVGJV T   FCJKPVGT 2CNOG -KPPU 6JG #VVKE 9GKIJV &TCEJOU QH 'RJGUWU # 2TGNKOKPCT[ 5VWF[ KP VJG .KIJV QH   4GEGPV*QCTFUKP0%5 1DX  4(CUVXQT\ÒINKEJ



*'4#-.'+#Õ6GVTCFTCEJOG,CJTJWPFGTVX%JTI#VJGPCMQRHTOKVCVVKUEJGO*GNO +P -TCP\ -GWNG FCTWPVGT 0KMG OKV -TCP\ N \YKUEJGP \YGK /QPQITCOOGP 50) X #WNQEM    50).QEMGVV 2T·IGUEJY·EJGPHCUVXQT\ÒINKEJ



8163

8162

8162 1,5:1



Õ6GVTCFTCEJOG  ,CJTJWPFGTV X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO+P -TCP\   -GWNGFCTWPVGT'WNG\YKUEJGP\YGK/QPQITCOOGP50)X#WNQEM50).QEMGVVXGTIN  #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 



Õ6GVTCFTCEJOG  ,CJTJWPFGTV X %JT  I #VJGPCMQRH T OKV CVVKUEJGO *GNO+P -TCP\   -GWNGFCTWPVGT'WNG\YKUEJGP\YGK/QPQITCOOGP50)X#WNQEM50).QEMGVVXGTIN  2T·IGUEJY·EJGPCO4CPFUQPUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC 

8165

8164 1,5:1

8164

8165



-1.12*10 Õ&TCEJOG WO  X %JT  I #RQNNQMQRH T OKV 6CGPKG+P +PEWUWO   .[TC/KNPG 'VYCUMQTTQFKGTVUGJTUEJÌP





/#)0'5+#Õ6GVTCFTCEJOGPCEJX%JT/CIKUVTCV'TCUKRRQU 5QJPFGU #TKUVGQUI #TVGOKUDÒUVG T OKV $QIGP WPF -ÌEJGT+P -TCP\ 0CEMVGT #RQNNQ UVGJV N CWH /·CPFGT CP &TGKHW­   IGNGJPVCWHFKGUGO-ÌEJGT$/%50)X#WNQEM50)%QR  -N4CPFHGJNGT2T·IGUEJY·EJGCWHFGO4GXGTUXQT\ÒINKEJ



/ÌINKEJGTYGKUG YCTGP FKG CWH FGP OCIPGUKUEJGP /ÒP\GP IGPCPPVGP +PFKXKFWGP MGKPG #OVUVT·IGT UQPFGTP TGKEJG   /·PPGT FKG GKPG .GKVWTIGKC GKP 9GTM HÒT FGP 5VCCV KP FKGUGO (CNN GKPG 5RGPFG FKG FKG 2T·IWPI FGT /ÒP\GP   GTOÌINKEJVG XQNNDTCEJVGPWPFCWUFKGUGO)TWPFFWTEJFKG0GPPWPIKJTGU0COGPUCWHFGP/ÒP\GPIGGJTVYWTFGP 5KGJG,QPGU9TGCVJGF6GVTCFTCEJOGUQH/CIPGUKCKP#05/0  5HH

172


CARIA

8166

1,5:1

8166

8167

1,5:1

8168

8167

8168

1,5:1



2*1-#+# 'N*GMVG  5VCVGT   X %JT  I 9KFFGTMQRH N FCTWPVGT 4QDDG8KGTIG   VGKNVGU+PEWUWO$QFGPUVGFV #XGTUGVYCUFG\GPVTKGTVUGJTUEJÌP



'N*GMVG  5VCVGT   X %JT  I -QRH GKPGU <KGIGPDQEMGU N FCJKPVGT 4QDDG8KGTIG   VGKNVGU+PEWUWO$QFGPUVGFV 44)WVGUUGJTUEJÌP 



'N*GMVG  5VCVGT   X %JT  I /·FEJGPMQRH N OKV *CCTPGV\8KGTIGVGKNVGU +PEWUWO   $QFGPUVGFV 5GJTUEJÌP

8169





8170

8169 2:1



6'15Õ6TKQDQNX%JTI)TGKHUKV\VT8KGTIGVGKNVGU+PEWUWO$CNEGTKP504 XGTIN 4#VVTCMVKXGUJGTXQTTCIGPF\GPVTKGTVGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ 



Õ5VCVGT  X %JT  I )TGKH UKV\V T FCXQT #UVTCICN8KGTIGVGKNVGU +PEWUWO $CNEGT KP   504 'VYCUMQTTQFKGTVIWVGUUGJTUEJÌP



8172

8171

8171 1,5:1



Õ5VCVGTX%JTI)TGKHUKV\VTFCXQT9GKPVTCWDGWPF$NCVV8KGTIGVGKNVGU+PEWUWO $CNEGTKP504 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 



%*+15Õ&KFTCEJOGX%JTI5RJKPZUKV\VNFCXQT#ORJQTG8KGTIGVGKNVGU+PEW UWO$CNFYKPXGTINHH/CXTQIQTFCVQXGTIN (CUVUGJTUEJÌP &CVKGTWPIPCEJ0KEJQNCU*CTFYKEM





8174

8173 8173 1,5:1

%#4+# 

*GMCVQOPQUX%JT5CVTCRÕ6GVTCFTCEJOGI<GWU.CDTCWPFQUUVGJVTOKV<GR VGTWPF&QRRGNCZV.ÌYGT50)-GEMOCP50)X#WNQEM  #VVTCMVKXGU'ZGORNCT(GKPG2CVKPCHCUVXQT\ÒINKEJXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



Õ6GVTCFTCEJOG  I <GWU .CDTCWPFQU UVGJV T OKV <GRVGT WPF &QRRGNCZV.ÌYG T 50) -GEM   OCP50)X#WNQEM 5GJTUEJÌP

 173


CARIA

8175

8176

8176



Õ*GOKQDQN/[NCUC ! I.ÌYGPMQRHN.ÌYGPMQRHXX-NGKP  8QNN\GPVTKGTV#XGTUUEJYCEJCWUIGRT·IVUGJTUEJÌP



/CWUUQNQU  X %JT 5CVTCR Õ6GVTCFTCEJOG  I #RQNNQMQRH HCUV X X<GWU   .CDTCWPFQUUVGJVTOKV<GRVGTWPF&QRRGNCZV$/%50)X#WNQEMXCT 5GJTUEJÌP

 

8177 1,5:1



*KFTKGWU  X %JT 5CVTCR Õ6GVTCFTCEJOG  I #RQNNQMQRH HCUV X X<GWU   .CDTCWPFQUUVGJVTOKV<GRVGTWPF&QRRGNCZVWPVGP'50)X#WNQEM  2TCEJVGZGORNCTXQPHGKPUVGO5VKNWPFOKVJGTTNKEJGT6ÌPWPI 7PDGFGWVGPFGT&QRRGNUEJNCICWHFGT4ÒEMUGKVGXQT\ÒINKEJGTJCNVGP 

1,5:1



1,5:1

8178

1,5:1

2KZQFCTQUX%JT5CVTCRÕ&KFTCEJOGI#RQNNQMQRHHCUVXX<GWU.CDTCWPFQU UVGJVTOKV<GRVGTWPF&QRRGNCZV50)X#WNQEM 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC  2KZQFCTQU YCT FGT LÒPIUVG 5QJP FGU *GMCVQOPQU PCEJ FGO 6QF UGKPGU $TWFGTU *KFTKGWU XGTFT·PIVG GT FGUUGP   )GOCJNKP#FCXQPFGT4GIKGTWPI&GT4GXGTUFGU5VÒEMGU\GKIVLGPGP)QVVFGUUGP-WNVUKEJFKG*GMCVQOPKFGP\W KJTGO (COKNKGPMWNV GTMQTGP JCVVGP <GWU .CDTCWPFQU &CU *GKNKIVWO FGU )QVVGU NCI KP .CDTCPFC D\Y .CDTCWPFC   GKPGO5VCFKGPXQP/[NCUCGPVHGTPVGP1TV&CU&QRRGNDGKNUQNNFGT-WNVNGIGPFGPCEJLGPGUUGKPYGNEJGU*GTCMNGU FGT#OC\QPGPMÌPKIKP*KRRQN[VGCDIGTWPIGPWPFFGT1ORJCNGIGUEJGPMVJCVVGXQPFKGUGTUQNNGUCPCPFKGN[FKUEJGP -ÌPKIGÒDGTIGICPIGPUGKPUEJNKG­NKEJUQNNGUXQP)[IGUCNU8QVKXCPFCU*GKNKIVWOFGU<GWU.CDTCWPFQUÒDGTIGDGP YQTFGPUGKP

8180

8181

8179



#.#$#0&# Õ6GVTCFTCEJOG  X %JT  I #RQNNQMQRH T OKV .QTDGGTMTCP\2GICUWU   HNKGIVT9CIIQPGTKP-TCC[/QTMQNO'UUC[U2N 8UUVGORGNINGKEJ   44#VVTCMVKXGU'ZGORNCTUGJTUEJÌPHCUVXQT\ÒINKEJ





-0+&15 Õ&TCEJOG  X %JT  I .ÌYGPRTQVQOG T+P +PEWUWO #RJTQFKVGMQRH T   %CJP 5GJTUEJÌP





Õ&TCEJOGX%JTI.ÌYGPRTQVQOGT+P+PEWUWO#RJTQFKVGMQRHTN-%CJP

FKGU'ZGORNCTCDIGDKNFGV  5GJTUEJÌP



174


CARIA

8183

8182





+05'.0 814 %#4+# -15 Õ6GVTCFTCEJOG  X %JT /CIKUVTCV :GPQFKMQU  I   *GTCMNGUMQRH KO .ÌYGPHGNN N+P 2GTNSWCFTCV -TGDU FCTWPVGT -GWNG #UJVQP W C 6JG *GECVQOPWU   *QCTFC FKGU'ZGORNCT  #XGTUNGKEJVFG\GPVTKGTVIWVGUUGJTUEJÌP



Õ6GVTCFTCEJOG  X %JT /CIKUVTCV #VJCOCU  I *GTCMNGUMQRH KO .ÌYGPHGNN T   9GKDNKEJGT-QRHNOKV5EJNGKGT#UJVQPWC6JG2KZQFCTWU*QCTF 'VYCUMQTTQFKGTVUGJTUEJÌP



1,5:1



8184

1,5:1

Õ&KFTCEJOG  X %JT /CIKUVTCV $KVQP  I *GTCMNGUMQRH KO .ÌYGPHGNN T9GKDNKEJGT   -QRHNOKV5EJNGKGT#UJVQPWC6JG2KZQFCTWU*QCTFE FKGU'ZGORNCT   #XGTUNGKEJVFG\GPVTKGTVXQT\ÒINKEJGU'ZGORNCTXQPJGTTNKEJGO5VKN



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

1,5:1

8185



8185

-#/+415Õ5VCVGTX%JTI(GKIGPDNCVV<YGKIGVGKNVGU+PEWUWO50)-GEMOCP 9CIIQPGT4QUGP%QNN *GTTNKEJG2CVKPCIWVGUUGJTUEJÌP



'ZGORNCTFGT5COONWPI2Q\\K#WMVKQP#TU%NCUUKEC)GPH0T  -COKTQU NCI KO HTWEJVDCTGP 0QTFYGUVGP XQP 4JQFQU&CU(GKIGPDNCVVGTUEJGKPVYQJNCWHITWPFFGTTGKEJGP'TVT·IG CP(GKIGPFKGGUFQTVCWEJJGWVGPQEJIKDVCWHFGO#XGTUFGT/ÒP\GPXQP-COKTQU-COKTQUUEJNQ­UKEJX %JTOKV+CN[UQUWPF.KPFQU\WTPGWGP5VCFV4JQFQU\WUCOOGP

8186 1,5:1



1,5:1

4*1&15 Õ6GVTCFTCEJOG  X %JT  I *GNKQUMQRH HCUV X X4QUG N F T 'HGW   DNCVV WPF $GGTGP #UJVQP W C 6JG *GECVQOPWU *QCTF #RRGPFKZ   FKGU 'ZGORNCT  #UJVQP 6JG   %QKPCIGQH4JQFGU$GTGPF FKGU'ZGORNCT   5GNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

8187

8188



Õ&KFTCEJOG  X %JT /CIKUVTCV #PVKRCVTQU  I *GNKQUMQRH HCUV X X4QUG N JTG   #UJVQP6JG%QKPCIGQH4JQFGU50)-GEMOCP 5GJTUEJÌP





Õ&KFTCEJOGX%JT/CIKUVTCV/PCUKOCEJQUI*GNKQUMQRHHCUVXX4QUGNUVGJV #VJGPC#UJVQP6JG%QKPCIGQH4JQFGU50)-GEMOCP 5GJTUEJÌP

 175


LYDIA

8189

8190 1,5:1



Õ6GVTCFTCEJOG  X %JT /CIKUVTCV #OGKPKCU  I *GNKQUMQRH HCUV X X4QUG N   2TQTC#UJVQP6JG%QKPCIGQH4JQFGU50)-GEMOCP 45GJTUEJÌP



Õ6GVTCFTCEJOGX%JT/CIKUVTCV'WMTCVGUI*GNKQUMQRHHCUVXX4QUGN$NKV\ #UJVQP6JG%QKPCIGQH4JQFGU50)-GEMOCP 5GNVGPKPFKGUGT'TJCNVWPI(CUVXQT\ÒINKEJ 

8192



8193 8191

8191 2:1

.;&+# 

#N[CVVGUX%JT'N5VCVGTX%JT5CTFGKU ! I.ÌYGPMQRHNN5EJTKHV +PEWUWO9GKFCWGTXGTIN 445GJTUEJÌP



&KG .GIGPFG CWH FGO #XGTU KUV N[FKUEJ 9CNYGN D\Y 9CNYGV &KGU KUV WPVGTUEJKGFNKEJ CWHIGNÌUV YQTFGP YKT   HQNIGP 5VGHCP -CTYKGUG FGT 9CNYGV VGU  OKV #N[CVVGU KFGPVKHK\KGTV 5KGJG JKGT\W -CTYKGUG 5VGHCP 6JG #TVGOKUKWO   %QKP*QCTFCPFVJGHKTUV%QKPUQH'RJGUWUKP4$0%:::8++  5



'N5VCVGTX%JT5CTFGKUI.ÌYGPMQRHT+PEWUWO50)X#WNQEM9CI IQPGT4QUGP%QNN9GKFCWGTXGTINHH 5GJTUEJÌP



'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T  &KG<WUEJTGKDWPI\W#N[CVVGUKUVFKGVTCFKVKQPGNNG&KGUGU5VÒEMUVCOOVUKEJGTCWU.[FKGPWPFIGJÌTVKPFKG<GKVXQT -TQKUQU



'N5VCVGTX%JT5CTFGKUI.ÌYGPMQRHT+PEWUWO50)X#WNQEM9CI IQPGT4QUGP%QNN9GKFCWGTXGTINHH 5GJTUEJÌP



'ZGORNCTFGT#WMVKQP)KGUUGPGT/ÒP\JCPFNWPI/ÒPEJGP0T

8194

8195

1,5:1



8196 2:1 1,5:1

-TQKUQU  X %JT Ô5VCVGT UEJYGTGT 5VCPFCTF  5CTFGKU  I .ÌYGP WPF 5VKGTRTQVQOG   GKPCPFGTIGIGPÒDGT<YGK+PEWUC50)%QR50)X#WNQEM9CIIQPGT4QUGP%QNNXGTIN 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 

'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  -TQKUQU FGT 5QJP FGU #N[CVVGU CWU FGO )GUEJNGEJV FGT /GTOPCFGP YCT FGT NGV\VG -ÌPKI XQP .[FKGP 'U IGNCPI   -TQKUQU FCU YGUVNKEJG -NGKPCUKGP DKU CP FGP *CN[U \W WPVGTYGTHGP OKV #WUPCJOG XQP .[EKGP WPF %KNKEKGP &GT   4GKEJVWOFGUN[FKUEJGP-ÌPKIUYCTWPFKUVURTKEJYÌTVNKEJ-TQKUQUJCVGKPWOHCUUGPFGUDKOGVCNNKUEJGU/ÒP\U[UVGO GPVYQTHGPFCUCWHGKPGOUEJYGTGPUGNVGPGP)QNFUVCVGTXQPIWPFGKPGONGKEJVGP)QNFUVCVGTXQPIUQYKG GKPGO5KNDGTUVCVGTXQPIDGKGKPGO8GTJ·NVPKUXQP5KNDGT\W)QNFXQPDGTWJVG'UICD5VÒEMGNWPIGP FGT5VCVGTGDKUJKPCD\WO5VCVGT&CUOGKUVGTJCHVG9·JTWPIUU[UVGOFGU-TQKUQUOKVXGTUEJKGFGP0QOKPCNGP HCPFKPFGT#PVKMGPKGYKGFGTUGKPGUINGKEJGP



Ô5VCVGT NGKEJVGT 5VCPFCTF  5CTFGKU  I .ÌYGP WPF 5VKGTRTQVQOG GKPCPFGT IGIGPÒDGT<YGK   +PEWUC50)X#WNQEM 44(CUVXQT\ÒINKEJ 



Ô 5VCVGT UEJYGTGT 5VCPFCTF  5CTFGKU  I .ÌYGP WPF 5VKGTRTQVQOG GKPCPFGT IGIGPÒDGT   +PEWUWO50)/ÒPEJGPXGTIN50)X#WNQEM9CIIQPGT4QUGP%QNN 445GJTUEJÌP

176




PAMPHYLIA

8198

8197



Õ5VCVGT 5CTFGKU  I .ÌYGP WPF 5VKGTRTQVQOG GKPCPFGT IGIGPÒDGT<YGK +PEWUC 50) X   #WNQEM 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC 



Õ5VCVGT 5CTFGKU  I .ÌYGP WPF 5VKGTRTQVQOG GKPCPFGT IGIGPÒDGT<YGK +PEWUC 50) X   #WNQEM 5GJTUEJÌP 

8200

8199





64#..'5 Õ%KUVQRJQT PCEJ  X %JT  I %KUVC O[UVKEC KP 'HGWMTCP\<YGK 5EJNCPIGP   WO -ÌEJGT N TRAL QDGP TIME T -WNVUVCVWG FGT #TVGOKU #PCKVKU $/%  50) %QR    50)X#WNQEM 5GJTUEJÌP



Õ%KUVQRJQT,CJT X%JT I%KUVCO[UVKECKP'HGWMTCP\<YGK5EJNCPIGPWO-ÌEJGTN TRAL QDGP 'WPFPTOLT&KQP[UQUOKV5KNGPUOCUMG$/%50)%QR50)X#WNQEM 5GJTUEJÌP



8202

8201

1,5:1

.;%+# 

8QTF[PCUVKUEJG2T·IWPIGPÕ5VCVGTX%JTI'DGTRTQVQOGN+PEWUWO8KUOCTC++ 5GJTUEJÌP





(TÒJF[PCUVKUEJG2T·IWPIGPÕ5VCVGTX%JTI2GICUWUTCWH4WPFUEJKNF6TKUMGNKU 50)X#WNQEM 5GJTUEJÌP



8204

8203



-JKPCMJC !  Õ5VCVGT  X %JT  I 2GICUWU N CWH 4WPFUEJKNF FCTWPVGT -WIGN+P   +PEWUWO6TKUMGNKUKP2GTNMTGKU50)X#WNQEM8KUOCTC++XCT 5GJTUEJÌP





Õ5VCVGT  X %JT  I 2GICUWU NCWH4WPFUEJKNFFCTWPVGT-WIGN+P+PEWUWO6TKUMGNKU KP2GTNMTGKU50)X#WNQEM8KUOCTC++XCT  -N5EJTÌVNKPIUHGJNGTWPFGVYCU(WPFDGNCICWHFGO#XGTUUGJTUEJÌP



1,5:1

8205 1,5:1

2#/2*;.+# 

#52'0&15 Õ5VCVGT  X %JT  I <YGK 4KPIGT5EJNGWFGTGT T FCXQT 6TKUMGNKU   50)%QR50)(TCPEG50)X#WNQEM 8QT\ÒINKEJ

 177


CILICIA

8206

8206 1,5:1



Õ5VCVGT  X %JT  I <YGK 4KPIGT5EJNGWFGTGT T FCXQT 6TKUMGNKU 50) %QR    50)(TCPEG50)X#WNQEM #VVTCMVKXGU'ZGORNCTUGJTUEJÌPpXQT\ÒINKEJ



8208

8207



Õ5VCVGTX%JTI<YGK4KPIGT5EJNGWFGTGTTFCXQT6TKUMGNKU50)%QR50) (TCPEG50)X#WNQEM 5GJTUEJÌP





Õ5VCVGT  X %JT  I <YGK 4KPIGT5EJNGWFGTGT T FCXQT 6TKUMGNKU #WMVKQP (TKV\   4WFQNH-ÒPMGT1UPCDTÒEM0T50)%QR50)(TCPEG50)X#WNQEM  5GJTUEJÌP



1,5:1



8211

8210

8209

1,5:1

5+&' Õ5VCVGT  X %JT  I )TCPCVCRHGN ÒDGT &GNRJKP N+P +PEWUWO #VJGPCMQRH T   OKVCVVKUEJGO*GNO#VNCPXGTINHH50)%QRXCT )WVGUUGJTUEJÌP



'ZGORNCT FGT 5COONWPI 2TQH &T *CIGP 6TQPPKGT #WMVKQP (TKV\ 4WFQNH -ÒPMGT  1UPCDTÒEM  0T    &GT 4ÒEMUGKVGPUVGORGN IKDV FGT #VJGPC GKPGP +TQMGUGP.QQM 'U JCPFGNV UKEJ OÌINKEJGTYGKUG WO GKPGP N[MKUEJGP   $GKUEJNCI



Õ5VCVGTX%JTI)TCPCVCRHGNFCTÒDGT.ÌYGPMQRH+P+PEWUWO#VJGPCMQRHTOKV MQTKPVJKUEJGO*GNO#VNCP #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Õ5VCVGTX%JTI)TCPCVCRHGNFCTÒDGT.ÌYGPMQRH+P+PEWUWO#VJGPCMQRHTOKV MQTKPVJKUEJGO*GNO#VNCP .GKEJVGT&QRRGNUEJNCICWHFGO4GXGTUUGJTUEJÌP



8212

8213

%+.+%+# 

-'.'0&'4+5Õ5VCVGT  X %JT I4GKVGTUGKVY·TVUN<KGIGTFGP-QRH\WTÒEM IGYCPFV50).GXCPVGXGTINHH -PCRRGT5EJTÌVNKPIUGJTUEJÌP





0#)+&15 Õ5VCVGT  X %JT  I #RJTQFKVG UKV\V N OKV 2CVGTC FCJKPVGT 'TQU FCXQT   #NVCT&KQP[UQUUVGJVNOKV4GDGPWPF6J[TUQU.GFGTGT  5VGORGNDTWEJ4GXGTUNGKEJVFG\GPVTKGTVIWVGUUGJTUEJÌPHCUVXQT\ÒINKEJ



178


CILICIA

8214

8214 1,5:1



51.1+ Õ5VCVGT PCEJ  X %JT  I &TCRKGTVG $ÒUVG FGU *GTCMNGU T5CVTCRGPMQRH T OKV   RGTUKUEJGT6KCTC50)(TCPEGXGTIN50).GXCPVG .GKEJVMQTTQFKGTVUGJTUEJÌP



8215 1,5:1



1,5:1

6#4515 2JCTPCDC\QU  X %JT Õ5VCVGT  I $CCNVCTU UKV\V N OKV .QVQU\GRVGT-QRH   GKPGU-TKGIGTUNOKV*GNO50)(TCPEG50).GXCPVG (GKPG2CVKPCXQT\ÒINKEJ



8217

8216 8217 1,5:1



Õ5VCVGTI$CCNVCTUUKV\VNOKV.QVQU\GRVGT-QRHGKPGU-TKGIGTUNOKV*GNO50)(TCPEG 50).GXCPVG .GKEJVFG\GPVTKGTVXQT\ÒINKEJIWVGUUGJTUEJÌP





Õ5VCVGT  I *GTCMNGUMQRH HCUV X X KO .ÌYGPHGNN-QRH GKPGU -TKGIGTU N OKV CVVKUEJGO *GNO   50)(TCPEG50).GXCPVG5WRRN  44&WPMNG2CVKPCOKPMQTTQFKGTVUGJTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



8218 1,5:1



1,5:1

&CVCOGUX%JT5CVTCRÕ5VCVGTI(TCWGPMQRHXX-QRHGKPGU-TKGIGTUTOKV *GNO50)(TCPEG50).GXCPVGXGTIN (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



&GT8QTFGTUGKVGPV[RFÒTHVGXQPU[TCMWUCPKUEJGP/ÒP\GPOKVFGO#TGVJWUCMQRHGPHCEGKPURKTKGTVUGKP

8219



Õ5VCVGTI(TCWGPMQRHXX-QRHGKPGU-TKGIGTUTOKV*GNONTGEJVGEMKIGT)GIGPUVGORGN 5VKGT50)(TCPEG50).GXCPVGXGTIN 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI

 179


GALATIA

8220 1,5:1



1,5:1

/C\CKQUX%JT5CVTCRÕ5VCVGTI$CCNVCTUUKV\VNOKV#FNGTWPF<GRVGT.ÌYGN UEJN·IV5VKGTN50).GXCPVG 8QT\ÒINKEJ



&CU$KNFFGU-CORHGU\YKUEJGP.ÌYGWPF5VKGTYCTKOCNVGP1TKGPVUGJTXGTDTGKVGVWPFU[ODQNKUKGTVGWTURTÒPINKEJ FGPJGNKCMNKUEJGP7PVGTICPIFGU5VGTPDKNFU6CWTWUFGT\WP·EJUVOKVFGO6GTOKPFGT(TÒJNKPIUCWUUCCVCWHITWPFFGT 2T·\GUUKQP \WT <GKV FGT #UU[TGT WPF FGT HTÒJGP #EJ·OGPKFGP LGFQEJ GVYC OKV FGO (TÒJNKPIURWPMV \WUCOOGPHKGN   &CXKF 7NCPUG[ N·­VFKG(TCIGQHHGPQDFCU5[ODQNFGU.ÌYG5VKGT-CORHGUCWHFGPVCTUKUEJGP/ÒP\GPKPFKGUGO 5KPPG GKPG CUVTQPQOKUEJG $GFGWVWPI JCVVG QFGT \W GKPGO JGTCNFKUEJGP 'ODNGO QJPG DGUQPFGTGP $G\WI IGYQTFGP   YCTIGJVLGFQEJFCXQPCWUFC­FKGUGU5VKGTVÌVWPIUDKNFGKP'NGOGPVKPFGO2TQ\GUUIGYGUGPKUVKPFGUUGP8GTNCWH FKG/KVJTCUXGTGJTGTFKG6CWTQMVQPKGU\GPGCNU5[ODQNHÒTFKG2T·\GUUKQPCWUY·JNVGP UKGJGJKGT\WWPF\WTWOUVTKVVG PGP &GWVWPI FGU /KVJTCUMWNVDKNFGU CNU 5[ODQN FGT XQP *KRRCTEJ GPVFGEMVGP 2T·\GUUKQP FGT SWKPQMVKGP 7NCPUG[   &KG7TURTÒPIGFGU/KVJTCUMWNVGU-QUOQNQIKGWPF'TNÌUWPIKPFGT#PVKMG5VWVVICTV 

8223 8221

8222

1,5:1

1,5:1



Õ5VCVGT  I $CCNVCTU UKV\V N OKV #FNGT JTG 9GKPVTCWDG WPF <GRVGT.ÌYG N UEJN·IV 5VKGT N   50)(TCPEGXCT50).GXCPVGXCT (GKPG6ÌPWPIXQT\ÒINKEJ





Õ5VCVGT  I $CCNVCTU UKV\V N OKV #FNGT JTG 9GKPVTCWDG WPF <GRVGT.ÌYG N UEJN·IV 5VKGT N   50).GXCPVG (CUVXQT\ÒINKEJXQT\ÒINKEJ





$CNCMTQU  X %JT 5CVTCR Õ1DQN  I #VJGPCMQRH T OKV CVVKUEJGO *GNO5EJKNF   50)(TCPEG50).GXCPVG 5GJTUEJÌP



1,5:1

8224

1,5:1

%;2475 

#/#6*154JQKMQUÕ6GVTQDQNWOX%JTI.ÌYGPMQRHT.ÌYGPRTQVQOGT$/% 6\KCODC\KU )WVGUUGJTUEJÌP



8225 1,5:1

1,5:1

)#.#6+# 

-¤0+)4'+%* #O[PVCU  X %JT Õ6GVTCFTCEJOG ,CJT    X %JT  5KFG  

2CORJ[NKC I#VJGPCMQRHTOKVMQTKPVJKUEJGO*GNO0KMGIGJVNOKVIGUEJOÒEMVGO<GRVGT 42% 4(GKPG6ÌPWPIIWVGUUGJTUEJÌP  'ZGORNCTFGT#WMVKQP/ÒP\<GPVTWO-ÌNP0T

180


SYRIA

8226 1,5:1

%#22#&1%+# 

1,5:1

-¤0+)4'+%*#TKCTCVJGU8++X%JTÕ6GVTCFTCEJOG'WUGDGKC6[CPCI-QRHT OKV&KCFGO+P-TCP\#VJGPC0KMGRJQTQUUVGJVNFG%CNNCVC[2N:.+82 UVGORGNINGKEJ 1/ÎTM JQNO6JG%QKPCIGUQH#TKCTCVJGU8+CPF#TKCTCVJGU8++QH%CRRCFQEKCKP504  2N

UVGORGNINGKEJ 5KOQPGVVCXGTIN5#PO  445GJTCVVTCMVKXGU2QTVT·VMN*QTPUKNDGTCDNCIGTWPIXQT\ÒINKEJ



&CU 5VÒEM ·JPGNV UVCTM UGNGWMKFKUEJGP 6GVTCFTCEJOGP 8GTOWVNKEJ YWTFGP FKG 5VGORGN XQP GKPGO U[TKUEJGP 5VGO   RGNUEJPGKFGTIGUEJPKVVGP

8227

8229

8228



#TKCTCVJGU :  X %JT Õ&TCEJOG  X %JT  I-QRHTOKV&KCFGO#VJGPCUVGJVN OKV0KMG5EJKNFWPF5RGGTKO(GNFN6TQRJ·G5KOQPGVVC 445GJTUEJÌP



5;4+# 



#PVKQEJQU++X%JTÕ6GVTCFTCEJOGPCEJX%JT5GNGWMGKCCF6KITKOI-QRH #PVKQEJQU+TOKV&KCFGO#RQNNQUKV\VNCWH1ORJCNQUOKV2HGKNWPF$QIGP*QWIJVQP.QTDGT 0GYGNN'5/50)5RCGT 5GJTUEJÌP



&GOGVTKQU +  X %JT Õ6GVTCFTCEJOG ,CJT  UGNGWMKFKUEJGT TC   X %JT    #PVKQEJKCI-QRHTOKV&KCFGO6[EJGUKV\VNOKV<GRVGTWPF(ÒNNJQTP0GYGNN#PVKQEJ 50)5RCGT )WVGUUGJTUEJÌP



8230

8231

8232



6T[RJQP  X %JT Õ6GVTCFTCEJOG #PVKQEJKC  I -QRH T OKV &KCFGO+P -TCP\   *GNOOKV+DGZ*QTPN0GYGNN#PVKQEJ50)5RCGT 4'VYCUMQTTQFKGTVUGJTUEJÌP 



#PVKQEJQU8++X%JTÕ5EJGMGN,CJTUGNGWMKFKUEJGTTC X%JT 6[TQU  I -QRH T OKV &KCFGO#FNGT OKV 2CNO\YGKI CWH 2TQTC N FCXQT -GWNG WPF /QPQITCOO 0G   YGNN6[TG50)5RCGT )GNQEJVUQPUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





-NGQRCVTC 6JGC WPF #PVKQEJQU 8+++  X %JT Õ6GVTCFTCEJOG ,CJT    X   %JT &COCUMQUI$GKFGT$ÒUVGPT<GWU0KMGRJQTQUUKV\VN0GYGNN.5/50)5RCGT 5GJTUEJÌP

 181


IUDAEA

8233

8234



#PVKQEJQU:X%JTÕ6GVTCFTCEJOG#PVKQEJKCI-QRHTOKV&KCFGO<GWU0KMG RJQTQUUKV\VN50)5RCGTXGTINHH 5GJTUEJÌP





2JKNKRRQU +  X %JT Õ6GVTCFTCEJOG #PVKQEJKC  I -QRH T OKV &KCFGO<GWU 0KMG   RJQTQUUKV\VN0GYGNN#PVKQEJ50)5RCGT 5GJTUEJÌP



8235 1,5:1

1,5:1

8236

2*1'0+%+# 

#4#&15 Õ 5VCVGT 1DQN   X %JT  I -QRH FGU &CIQP QFGT /GNMCTVJ !  T   )CNGGTGTÒDGT9GNNGP-NGKP #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



Õ&TCEJOG  ,CJTJWPFGTV X %JT  I $KGPG*KTUEJ UVGJV T XQT 2CNOG $/% XGTIN  HH   50)%QRXGTINH #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC

8237



8237 1,5:1



5+&10 #DFB#UJVCTV +  X %JT Õ&QRRGNUEJGMGN  I )CNGGTG N ÒDGT FGO *GEM   5VGTP)TQ­MÌPKIWPF9CIGPNGPMGTKP6TKICNFCJKPVGT#DFy#UJVCTV+KP·I[RVKUEJGT QFGTU[TKUEJGT  6TCEJVOKVMWNVKUEJGO<GRVGTWPF8QVKX8CUG$GVN[QPKP#05/0   45GJTUEJÌP  &GT4GXGTU\GKIVFC­5KFQP\WO#EJ·OGPKFGPTGKEJIGJÌTVGWPFFGT-ÌPKIXQP5KFQPFGO)TQ­MÌPKI7PVGTVCPYCT

8238

8239

8239

8238

1,5:1



6;415 Õ5EJGMGN ,CJT    X %JT   I /GNSCTVMQRH T OKV .QTDGGTMTCP\#FNGT   UVGJVNOKV2CNO\YGKI(W­CWH2TQTCFCXQT-GWNG$/%50)%QR 45GJTUEJÌP



&KG V[TKUEJGP 5EJGMGN YGTFGP KP FGT $KDGN OGJTHCEJ GTY·JPV 5Q DGVTWI FKG 6GORGNUVGWGT GKPGP JCNDGP V[TKUEJGP   5EJGMGN 'ZQFWU   ,GUWU YKGU 5KOQP 2GVTWU CP FKG 6GORGNUVGWGT OKV GKPGO 5VCVGT CNUQ GKPGO UEJYGTGP   V[TKUEJGP5EJGMGNYKGWPUGTGO5VÒEM \WDG\CJNGPFGPGTKO/CWNGKPGU(KUEJGUHKPFGPUQNNVG /CVVJ·WU FCU 7OUVQ­GP FGT 6KUEJG FGT )GNFYGEJUNGT KO 6GORGN /CVVJ·WU  /CTEWU    YCT UKEJGT CWEJ FWTEJ FKG   &CTUVGNNWPIFGUV[TKUEJGP)QVVGU*GTCMNGU/GNSCTVCWHFKGUGP/ÒP\GPOQVKXKGTV#WEJFKG5KNDGTNKPIGFGU,WFCU YCTGPUKEJGTV[TKUEJG5EJGMGN

+7&#'# 

 #WHUVCPF $CT -QMJDC  Õ&TCEJOG   I 5EJKOyQP 9GKPVTCWDG(ÒT   FKG(TGKJGKV,GTWUCNGOU.[TC/KNFGPDGTI 8QT\ÒINKEJ 'KPGMNGKPG5COONWPIKWFCGKUEJGT$TQP\GOÒP\GPHKPFGP5KGWPVGT0T

182




PARTHIA

8240

8242 8241

8241 1,5:1

#4#$+#('.+: 

5#$'4Õ&TCEJOG,CJTJWPFGTVX%JTI#VJGPCMQRHTCWHFGT9CPIG:'WNGT $/%HH50)#05 -N4CPFCWUDTWEJUGJTUEJÌP



$#$;.10+# 

$#$;.10Ô&CTGKMGPCEJX%JTI)TQ­MÌPKIKO-PKGNCWHTOKV$QIGPWPF5RGGT +PEWUWOOKV9GNNGP/KVEJKPGT+PFQITGGMUXGTIN0KEQNGV2KGTTGXGTINHH 445GJTUEJÌP



Ô&CTGKMGPCEJX%JTI)TQ­MÌPKIKO-PKGNCWHTOKV$QIGPWPF5RGGTFCJKPTVGTFWPF L+PEWUWO OKV 9GNNGP /KVEJKPGT +PFQITGGMU  XGTIN  0KEQNGV2KGTTG 'OKUUKQP  FQTV PWT   &QRRGNFCTGKMGP  44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

8243

8244



8244

2#46*+# 

/KVJTCFCVGU +  X %JT Õ&TCEJOG *GMCVQOR[NQU  I -QRH N OKV $CUJNKM#TUCMGU   UKV\VTOKV$QIGP5GNNYQQF5JQTG 45GJTUEJÌP





$CICUKU  X %JT Õ6GVTCFTCEJOG 5GNGWMGKC  I -QRH T OKV &KCFGO6[EJG UKV\V N   OKV0KMGWPF(ÒNNJQTP5GNNYQQF5JQTG 5GJTUEJÌP



8246

8245





#TVCDCPQU+X%JTÕ6GVTCFTCEJOG,CJT X%JT 5GNGWMGKCI&TC RKGTVG$ÒUVGTOKV&KCFGO)ÌVVKPUKV\VNOKV0KMGWPF(ÒNNJQTP5GNNYQQF5JQTG  (CUVXQT\ÒINKEJ



/KVJTCFCVGU++X%JTÕ6GVTCFTCEJOG5GNGWMGKCI&TCRKGTVG$ÒUVGNOKV&KCFGO #TUCMGUUKV\VTOKV$QIGP5GNNYQQF5JQTG 5GJTUEJÌPXQT\ÒINKEJ



8247



1,5:1

8247

Õ6GVTCFTCEJOG 5GNGWMGKC  I &TCRKGTVG $ÒUVG N OKV &KCFGO#TUCMGU UKV\V T OKV $QIGP T   2CNO\YGKIKO#DUEJPKVV685GNNYQQF5JQTG  8QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTXQTTCIGPFGO2QTVT·V

 183


PERSIS

8248



8250

8249

8251

Õ6GVTCFTCEJOG 5GNGWMGKC  I &TCRKGTVG $ÒUVG N OKV &KCFGO#TUCMGU UKV\V T OKV $QIGP T   2CNO\YGKIKO#DUEJPKVV685GNNYQQF5JQTG  9KP\2TÒHJKGDCWHFGO#XGTUMN2T·IGUEJY·EJGXQT\ÒINKEJ





Õ6GVTCFTCEJOG 5GNGWMGKC  I &TCRKGTVG $ÒUVG N OKV &KCFGO#TUCMGU UKV\V T OKV $QIGP N   /QPQITCOOT2CNO\YGKI5GNNYQQF5JQTG 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ6GVTCFTCEJOG 5GNGWMGKC  I &TCRKGTVG $ÒUVG N OKV &KCFGO#TUCMGU UKV\V T OKV $QIGP T   2CNO\YGKI KO #DUEJPKVV /QPQITCOO #WMVKQP %0)  .CPECUVGT  0T  UVGORGNINGKEJ    5GNNYQQF5JQTG 44(CUVXQT\ÒINKEJ



Õ6GVTCFTCEJOG 5GNGWMGKC  I &TCRKGTVG $ÒUVG N OKV &KCFGO#TUCMGU UKV\V T OKV $QIGP KO   #DUEJPKVV68#WMVKQP6TKVQP:0GY;QTM0T5GNNYQQF5JQTG  44#XGTUNGKEJVFG\GPVTKGTVHCUVXQT\ÒINKEJ





8252

8252 1,5:1



2JTCCVGU+++X%JTÕ&TCEJOG4JCICGI&TCRKGTVG$ÒUVGXXOKV&KCFGO#TUC MGUUKV\VTOKV$QIGP5GNNYQQF5JQTG  5GJTCVVTCMVKXGU'ZGORNCT(GKPG2CVKPCIWVGUUGJTUEJÌP



'ZGORNCTFGT#WMVKQP.GW<ÒTKEJ0T

8253

8253 1,5:1

2'45+5 

184

8CFHTCFCF+ECX%JTÕ6GVTCFTCEJOGI-QRHTOKV-[TDCUKC-ÌPKIQRHGTVCP (GWGTCNVCTT5VCPFCTVGQDGP#JWTC/C\FC#NTCO  4#XGTUNGKEJVFG\GPVTKGTVIWVGUUGJTUEJÌPUGJTUEJÌP




BACTRIA

8254

2'45+# 

8255

#EJ·OGPKFGPÔ&CTGKMG,CJTJWPFGTVX%JTI)TQ­MÌPKIKO-PKGNCWHTOKV$QIGPWPF 5RGGT+PEWUWO50)$GTT[ )WV\GPVTKGTVGUWPFCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  &KG RGTUKUEJG &CTGKMG KUV PCEJ &CTGKQU + FGO )TQ­GP DGPCPPV FGT FKGUG 5VÒEMG \WGTUV RT·IVG 'U YCTGP FKG DG   MCPPVGUVGP )QNFOÒP\GP KJTGT <GKV DKU PCEJ FGT <GTUEJNCIWPI FGU 2GTUGTTGKEJGU FKG )QNFUVCVGTG #NGZCPFGTU FGU   )TQ­GPCPKJTG5VGNNGVTCVGP&CUJKGTCPIGDQVGPG5VÒEMIGJÌTV\WFGPHTÒJGP&CTGKMGPWPFFÒTHVGFGOPCEJY·JTGPF FGT 2GTUGTMTKGIG \WT $G\CJNWPI RGTUKUEJGT 5QNFCVGP IGFKGPV JCDGP /KV FGP &CTGKMGP YWTFG 9GNVIGUEJKEJVG IG   UEJTKGDGP UQ DGTKEJVGV 2NWVCTEJ FC­ FGT 5RCTVCPGTMÌPKI #IGUKNCQU FGT UGKV  X %JT KP -NGKPCUKGP UGJT GTHQNI   TGKEJ -TKGI IGIGP FKG 2GTUGT HÒJTVG FWTEJ IQNFGPG &CTGKMGP OKV FGPGP UGKPG )GIPGT KP )TKGEJGPNCPF DGUVQEJGP   YWTFGP IGIGP KJP -TKGI \W HÒJTGP \WO #DDTWEJ FGU -TKGIGUKP-NGKPCUKGPIGPÌVKIVYWTFG#IGUKNCQUUQNNIGUCIV JCDGPFC­KJPRGTUKUEJG$QIGPUEJÒV\GPCWU#UKGPXGTVTKGDGPJ·VVGP&KG$QIGPUEJÒV\GP 6QZQVCK UVGJGPHÒT FKG&CTGKMGP FKGLCCWHFGO#XGTUGKPGP$QIGPUEJÒV\GP\GKIGP OKVFGPGPFKG2QNKVKMGTKP#VJGPWPF6JGDGP\WO -TKGIIGIGP5RCTVCCPIGUVCEJGNVYWTFGP



Ô&CTGKMG,CJTJWPFGTVX%JTI)TQ­MÌPKIKO-PKGNCWHTOKV$QIGPWPF5RGGT+PEWUWO 50)$GTT[ (CUUWPIUURWTGPUGJTUEJÌP



8256 1,5:1

1,5:1

5#5#0+&'0 

8CJTCP++Ô&KPCTI&TCRKGTVG$ÒUVGTOKV-TQPG(GWGTCNVCT\YKUEJGP\YGK#UUK UVGP\HKIWTGP)ÌDN 442TÒHUVGNNGPCO4CPFXQT\ÒINKEJ



8257

$#%64+# 

'WMTCVKFGU+X%JTÕCVVKUEJG6GVTCFTCEJOG$CNMJ ! I&TCRKGTVG$ÒUVGTOKV *GNO&KQUMWTGPTGKVGPT$0$CEV5GTKG/KVEJKPGT+PFQITGGM6[R50)#05  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI



&CU /QPQITCOO CWH FGO 4GXGTU UEJGKPV KP FKGUGT (QTO WPRWDNK\KGTV 'U UEJGKPV CDGT GKPG 8CTKCPVG FGU KP $CNMJ   XGTYGPFGVGP/QPQITCOOU /KVEJKPGTG \WUGKP

8258

8258 1,5:1



ÕCVVKUEJG 6GVTCFTCEJOG 2WUJMCNCXCVK  I &TCRKGTVG $ÒUVG T OKV *GNO&KQUMWTGP TGKVGP T   $0$CEV'/KVEJKPGT+PFQITGGMGG50)#05 8QT\ÒINKEJ  185


AEGYPTUS

8259



ÕCVVKUEJG 6GVTCFTCEJOG 2WUJMCNCXCVK  I &TCRKGTVG $ÒUVG T OKV *GNO&KQUMWTGP TGKVGP T   $0$CEV'/KVEJKPGT+PFQITGGMGG50)#05 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

8260

+0&+# 



8261

#TEJGDKQUX%JTÕKPFKUEJG&TCEJOGX%JT2CPLJKTI&TCRKGTVG$ÒUVGTOKV&KC FGO<GWUUVGJVXXOKV$NKV\WPF<GRVGT$0$CEV%/KVEJKPGT+PFQITGGMD50)#05 45GJTUEJÌP



-UJCJCTCVCU 0CJCRCPC  ÕKPFKUEJG &TCEJOG  I &TCRKGTVG $ÒUVG T OKV &KCFGO   2HGKNWPF$NKV\/KVEJKPGT+PFQITGGM 5GJTUEJÌP



8262

8263

#');2675 



2VQNGOCKQU+X%JTÕ6GVTCFTCEJOGX%JT#NGZCPFTKCI#NGZCP FGTMQRH T OKV 'NGHCPVGPUMCNR#VJGPC #NMKFGOQU T FCXQT \YGK /QPQITCOOG WPF #FNGT FCJKPVGT   /QPQITCOO50)%QR5XQTQPQU 5GJTUEJÌP



Õ6GVTCFTCEJOGX%JT#NGZCPFTKCI#NGZCPFGTMQRHTOKV'NGHCPVGPUMCNR#VJGPC #NMKFGOQUTFCXQT*GNO/QPQITCOOWPF#FNGT50)%QR5XQTQPQU  -N&TWEMUVGNNGPUGJTUEJÌP



8264



Ô2GPVCFTCEJOGX%JT#NGZCPFTKCI-QRHTOKV&KCFGO#FNGTNCWH$NKV\50) %QR5XQTQPQU -N-TCV\GTCWHFGO#XGTUUGJTUEJÌP 2VQNGOCKQU + 5QVGT YCT \WP·EJUV GKPGT FGT DGFGWVGPFUVGP )GPGTCNG #NGZCPFGTU FGU )TQ­GP 0CEJ FGO 6QFG #NGZ   CPFGTU UVGNNVG UKEJ FKG (TCIG FGT 0CEJHQNIG #NGZCPFGT JCVVG NGFKINKEJ GKPGP PQEJ WPIGDQTGPGP 5QJP WPF GKPGP   JCNDXGTTÒEMVGP $TWFGT JKPVGTNCUUGP DGKFG YWTFGP \W -ÌPKIGP GTJQDGP 5KG URKGNVGP CDGT RTCMVKUEJ MGKPG 4QNNG   UGNDUV KJT GKIGPGT )GPGTCN 'WOGPGU URTCEJ KJPGP RTCMVKUEJ LGFG #WVQTKV·V CD YKG FKG 'TTKEJVWPI FGU 6JTQPU XQP   -[KPFCDGNGIV&KGYKTMNKEJG/CEJVKO4GKEJJCVVGPFKG5CVTCRGPCNUQFKG\W8GTYCNVGTPFGT2TQXKP\GPFGU4GKEJGU CWHIGUVKGIGPGP GJGOCNKIGP )GPGTCNG #NGZCPFGTU &KGUGDGICPPGPDCNFWOFKG/CEJVKO4GKEJ\WM·ORHGP2VQNG OCKQU FGT MGKPGUYGIU FKG /CEJV ÒDGT FCU 4KGUGPTGKEJ #NGZCPFGTU UQPFGTP PWT ÒDGT I[RVGP CPUVTGDVG IKPI   ·W­GTUVIGUEJKEMVXQT5QNKG­GTFGP.GKEJPCO#NGZCPFGTUFGPGTFGP6TWRRGPFGU2GTFKMMCUIGTCWDVJCVVGPKEJV DGKFGT1CUG5KYCYKGXQPFGOVQVGP*GTTUEJGTIGYÒPUEJVUQPFGTPKP/GORJKUFGTCNVGP*CWRVUVCFVFGU·I[RVK UEJGP4GKEJGUDGUVCVVGPXQT%JTJCVVG2VQNGOCKQUUGKPG/CEJVUQYGKVIGHGUVKIVFC­GTFGP-ÌPKIUVKVGNCPPGJ OGP MQPPVG 'T UVCTD KO ,CJTG  XQT %JTKUVWU GKPGU PCVÒTNKEJGP 6QFGU  GT YCT FGT GKP\KIG FGT &KCFQEJGP FGT   PKEJV GKPGU IGYCNVUCOGP 6QFGU UVCTD &KG XQP 2VQNGOCKQU + 5QVGT DGITÒPFGVG &[PCUVKG JGTTUEJVG KPUIGUCOV    ,CJTG ÒDGT I[RVGP DKU -NGQRCVTC 8++ FKG )GNKGDVG %CGUCTU WPF FGU /CTEWU #PVQPKWU KO ,CJTG  X %JT FGP   (TGKVQFY·JNVGWOPKEJVKO6TKWORJ1EVCXKCPUXQTIGHÒJTV\WYGTFGP8QP2VQNGOCKQU+DKU\W-NGQRCVTC8++YCT FGT4GXGTU6[RWPUGTGT/ÒP\GFGT#FNGTCWHFGO$NKV\KO2VQNGO·GTTGKEJIGDT·WEJNKEJ)QNFGPG2GPVCFTCEJOGP YWTFGP PWT XQP 2VQNGOCKQU + WPF UGKPGO 0CEJHQNIGT 2VQNGOCKQU ++ IGRT·IV &KG \GKVIGPÌUUKUEJG $G\GKEJPWPI   6TKEJT[UQP DGNGIV FC­ FKGUG 5VÒEMG  5KNDGTFTCEJOGP GPVURTCEJGP FC FGT #WUFTWEM %JT[UQWU UGKV FGP <GKVGP   #NGZCPFGTUFGU)TQ­GPIGPGTGNNGKP)QNFUVÒEMKO9GTVXQP5KNDGTFTCEJOGPDG\GKEJPGVG

186




AEGYPTUS

8265 1,5:1

1,5:1



Ô2GPVCFTCEJOGX%JT#NGZCPFTKCI-QRHTOKV&KCFGO#FNGTNCWH$NKV\50)%QR 5XQTQPQU 5GJTUEJÌP



2VQNGOCKQU ++  X %JT “&TCEJOG  X %JT #NGZCPFTKC  I -QRH FGU <GWU   #OOQPTOKV6CGPKG#FNGTUVGJVNFCXQT(ÒNNJQTP50)%QR5XQTQPQU9GKUGT  5GJTUEJÌP

8267





8267 1,5:1



 HÒT #TUKPQë ++ Õ&GMCFTCEJOG  X %JT #NGZCPFTKC  I -QRH T OKV &KCFGO WPF   5EJNGKGTFCJKPVGT;&QRRGNHÒNNJQTPOKV6CGPKG50)%QR5XQTQPQU  44#DURNKVVGTWPIGPCO4CPFHCUVXQT\ÒINKEJ  &CVKGTWPIPCEJ6TQZGNN#TUKPQGyU0QP'TCKP#05/0  5HH

1,5:1



8268

1,5:1

“UMNGKPCUKCVKUEJG/ÒP\UV·VVGI-QRHTOKV5EJNGKGT#FNGTN-NGKP0QGUMG50)%QR 5XQTQPQUXGTIN9GKUGT 44(CUVXQT\ÒINKEJ



8269 1,5:1



1,5:1

2VQNGOCKQU +++  X %JT HÒT 2VQNGOCKQU ++ #TUKPQG ++ 2VQNGOCKQU + WPF $GTGPKMG +    Ô1MVQFTCEJOG#NGZCPFTKCI$ÒUVGPFGU2VQNGOCKQU++WPFFGT#TUKPQG++TFCJKPVGT5EJKNF $ÒUVGPFGU2VQNGOCKQU+WPFFGT$GTGPKMG+T50)%QR5XQTQPQU  44-N-TCV\GTCWHFGO#XGTUHCUVXQT\ÒINKEJ  &KGUGKPVGTGUUCPVGP1MVQFTCEJOGPYWTFGPYCJTUEJGKPNKEJ\WOITÌ­VGP6GKNWPVGT2VQNGOCKQU+++IGRT·IVFGTFCOKV UGKPG8QTHCJTGPGJTV'KPMNGKPGT6GKNKUVCDGTOÌINKEJGTYGKUGDGTGKVUWPVGT2VQNGOCKQU++IGRT·IVYQTFGPFGOFKG 5VÒEMGCWEJDGK5XQTQPQU\WIGYKGUGPYGTFGP

187


AEGYPTUS

8270 1,5:1



Ô6GVTCFTCEJOG#NGZCPFTKCI$ÒUVGPFGU2VQNGOCKQU++WPFFGT#TUKPQG++TFCJKPVGT5EJKNF $ÒUVGPFGU2VQNGOCKQU+WPFFGT$GTGPKMG+T50)%QR5XQTQPQU  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

8271



1,5:1

1,5:1



8272

8271

2VQNGOCKQU+8X%JTHÒT#TUKPQG+++“%JCNMWU2CRJQUI&TCRKGTVG$ÒUVGTOKV 5VGRJCPG&QRRGNHÒNNJQTP50)%QR5XQTQPQU9GKUGT )TÒPG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP2GWU0CEJH(TCPMHWTV/CKP0T FQTVKTTVÒONKEJCNU-NGQRCVTC8++DGUEJTKGDGP 



2VQNGOCKQU8+X%JTÕ&KFTCEJOG,CJT X%JT #TCFQUI-QRH 2VQNGOCKQU+T#FNGTCWH$NKV\N50)%QR5XQTQPQU  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



8273

1,5:1



1,5:1

2VQNGOCKQU8+++X%JTHÒT#TUKPQG++Ô1MVQFTCEJOG /PCKQP #NGZCPFTKCI -QRHTOKV&KCFGOWPF5EJNGKGTFCJKPVGT-&QRRGNHÒNNJQTPOKV6CGPKG50)%QR5XQTQPQU 8QT\ÒINKEJGU2TCEJVGZGORNCT  &KGUGUITQ­GCPVKMG)QNFPQOKPCNYWTFG\WGTUVWPVGT2VQNGOCKQU++ X%JT PCEJX%JTCWUIGRT·IV CNU GT UGKPG 5EJYGUVGTIGOCJNKP #TUKPQG ++ PCEJ KJTGO 6QF \W IÌVVNKEJGP 'JTGP CWHUVGKIGP NKG­ &KGUGT 6[R YWTFG   KOOGTYKGFGTCWHIGITKHHGPUQCWEJWPVGT2VQNGOCKQU8+++0CEJ5XQTQPQUUQNNGPFKG)GUKEJVU\ÒIGFGTFCTIGUVGNNVGP 2GTUQPCWHFGT8QTFGTUGKVG-NGQRCVTC+++YKGFGTIGDGP5KGYCTUGKPG5VKGHVQEJVGTFKGGTX%JTJGKTCVGVG

8274





188

ex 8275

-NGQRCVTC+++WPF2VQNGOCKQU:X%JTÕ6GVTCFTCEJOG,CJTWPF,CJT  X %JT  #NGZCPFTKC  I -QRH 2VQNGOCKQU + T OKV &KCFGO#FNGT CWH $NKV\ N 50) %QR    5XQTQPQU (GKPGT5VKNXQT\ÒINKEJ



-NGQRCVTC8++X%JTÕ6GVTCFTCEJOG,CJT X%JT #NGZCPFTKCI-QRH 2VQNGOCKQU+TOKV&KCFGO#FNGTCWH$NKV\NFCXQT-TQPGFGT+UKU50)%QR5XQTQPQU &C\W-NGQRCVTC+++WPF2VQNGOCKQU:Õ6GVTCFTCEJOG50)%QR5XQTQPQU  5VÒEM(CUVUGJTUEJÌP




AEGYPTUS

8276

8276

3:1



“UX%JT1TVJQUKCI&TCRKGTVG$ÒUVGTOKV&KCFGO$CCNXQP1TVJQUKCKP)TGKHGPDKICT 42% 5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI $TCWPG2CVKPCRT·EJVKIGU2QTVT·VFGT-NGQRCVTCHCUVXQT\ÒINKEJ



&KG4GIGPVKPKUVFKGDGTÒJOVG-NGQRCVTCFKG)GNKGDVG%CGUCTUWPF/CTE#PVQPUX%JTY·JNVG-NGQRCVTC8++ FGP (TGKVQF FWTEJ )KHV LGFQEJ YKG %JTKUVQRJ 5EJ·HGT PCEJIGYKGUGP JCV PKEJV FWTEJ FGP $K­ GKPGT )KHVUEJNCPIG    WOPKEJVKO6TKWORJ\WI1EVCXKCPUOKVIGHÒJTV\WYGTFGP-NGQRCVTCJCVVGXGTCPNC­VFC­KJT.GKDCT\V1N[ORQUFKG .GIGPFGXGTDTGKVGVGUKGUGKFWTEJFGP$K­GKPGT-QDTCIGUVQTDGPWOUQCNU0GC+UKUXGTGJTV\WYGTFGP<WO6QF FGT-NGQRCVTCUKGJG5EJ·HGT%JTKUVQRJ-NGQRCVTC&CTOUVCFV5HH  *CPU4QNCPF$CNFWU 'KPPGWGU5R·VRQTVT·VFGT-NGQRCVTCCWU1TVJQUKCKP,0)::+++  5H UEJTGKDV\W FGO -NGQRCVTCRQTVT·V FKGUGU #XGTUUVGORGNU &CU PGWG QTVJQUKUEJG -NGQRCVTCRQTVT·V XQP  X %JT   GT   UEJGKPV WPU FCOKV PKEJV PWT CNU GKPGU FGT PCEJ 5VKN WPF DGUQPFGTU %JCTCMVGTKUKGTWPI KJTGT 2GTUÌPNKEJMGKV DGUVGP   5R·VDKNFPKUUG ÒDGTJCWRV UQPFGTP CNU FCULGPKIG WPVGT FGP FGT\GKV DGMCPPVGP /ÒP\RQTVT·VU FCU KJTG #NVGTU\ÒIG CO   VTGWGUVGPYKGFGT\WURKGIGNPUEJGKPV  &CU 2QTVT·V GPVURTKEJV YGFGT XÌNNKI FGO CNGZCPFTKPKUEJGP 2QTV·VV[RWU UKGJG 0T    DGK FGO -NGQRCVTC   RJ[UKQIPQOKUEJG'KIGPJGKVGPFGTRVQNGO·KUEJGP&[PCUVKGWPPCVÒTNKEJJGTXQTJGDGPNKG­PQEJFGOU[TKUEJTÌOKUEJGP 2QTVT·VV[RWU FGT -NGQRCVTC \WYGKNGP CNU YGKDNKEJGP /CTEWU #PVQPKWU \GKIV 9GPP ÒDGTJCWRV /ÒP\GP GKP PCVWT   IGVTGWGU 2QTVT·V FGT ITQ­GP 2VQNGO·GTKP \GKIGP FCPP UKPF GU FKG QTVJQUKUEJGP )GRT·IG FKG OKV FGO #XGTUUVGORGN   WPUGTGU5VÒEMGUIGRT·IVYWTFGP  &KGUGU WPF FKG HQNIGPFGP \YGK 5VÒEMG UVCOOGP CWU 5V·FVGP FKG FWTEJ FKG UQIGPCPPVGP .CPFUEJGPMWPIGP WPVGT   RVQNGO·KUEJG8GTYCNVWPIMCOGP+PFGTUEJTKHVNKEJGPªDGTNKGHGTWPI FKGHTGKNKEJFKG5KEJVFGU#WIWUVWUYKGFGTIKDV  YGTFGP FKG .CPFUEJGPMWPIGP CNU YKGFGTTGEJVNKEJGU 8GTUEJGPMGP TÌOKUEJGP )GDKGVGU IGDTCPFOCTMV 6CVU·EJNKEJ   CDGT UVCPFGP FKG )GDKGVU\WYGKUWPIGP OKV FGO (NQVVGPDCWRTQITCOO FGU #PVQPKWU KP <WUCOOGPJCPI FGT FKG 8GT   CPVYQTVWPI FCHÒT CP -NGQRCVTC ÒDGTVTCIGP JCVVG WPF KJT PWP FKG FCHÒT PÌVKIGP 4GUUQWTEGP \WT 8GTHÒIWPI UVGNNVG   5KGJG\WFGPUQIGPCPPVGP.CPFUEJGPMWPIGP5EJ·HGT%JTKUVQRJ-NGQRCVTC&CTOUVCFV5HH

8277

8278



“UX%JT1TVJQUKCI&TCRKGTVG$ÒUVGTOKV&KCFGO$CCNXQP1TVJQUKCKP)TGKHGPDKICT 42%XGTIN ªDGTCTDGKVGVUGJTUEJÌP





“U,CJT X%JT 6TKRQNKUI&TCRKGTVG$ÒUVGTOKV&KCFGO2TQTCTFCTCWHUVGJV 0KMGTOKV-TCP\WPF2CNO\YGKI42% 4&WPMNG2CVKPCUEJÌP



8279

8280



“&KQDQN #NGZCPFTKC  I &TCRKGTVG $ÒUVG T#FNGT N CWH $NKV\ FCXQT &QRRGNHÒNNJQTP   50)%QR5XQTQPQU9GKUGT 4$TCWPG2CVKPCUEJÌP





“&KQDQN #NGZCPFTKC  I &TCRKGTVG $ÒUVG T#FNGT N CWH $NKV\ FCXQT &QRRGNHÒNNJQTP   50)%QR5XQTQPQU9GKUGT 4$TCWPG2CVKPCFG\GPVTKGTVUEJÌP

 189


ZEUGITANIA

8282

8281



“&KQDQN #NGZCPFTKC  I &TCRKGTVG $ÒUVG T#FNGT N CWH $NKV\ FCXQT &QRRGNHÒNNJQTP   50)%QR5XQTQPQU9GKUGT 4$TCWPG2CVKPCHCUVUEJÌPIGTKPIGTJCNVGP



“1DQN#NGZCPFTKCI&TCRKGTVG$ÒUVGT#FNGTCWH$NKV\NFCXQT&QRRGNHÒNNJQTP50)%QR 5XQTQPQU9GKUGT 44)TÒPG2CVKPCUEJÌPIGTKPIGTJCNVGP

 

'KPGKPVGTGUUCPVG5RG\KCNUCOONWPIRVQNGO·KUEJGT$TQP\GOÒP\GPHKPFGP5KGWPVGT0T

2:1

8283

2:1

<'7)+6#0+# 

-#46*#)1Ô5VCVGTX%JTI2CNOG2HGTFGMQRHT,GPMKU.GYKUXGTIN (CUVXQT\ÒINKEJ

1,5:1



8284

1,5:1

'N5VCVGTX%JTI6CPKVMQRHNOKVJTGPMTCP\2HGTFUVGJVT,GPMKPU.GYKU)TWRRG8 #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT

8285

'N5VCVGTX%JTI6CPKVMQRHNOKVJTGPMTCP\2HGTFUVGJVT,GPMKPU.GYKU)TWRRG8 5GJTUEJÌP



“UX%JTI6CPKVMQRHN2HGTFGMQRHT#NGZCPFTQRQWNQU  &WPMNG2CVKPCNGKEJVIGIN·VVGVHCUVXQT\ÒINKEJ



190

 

8288

“5EJGMGNX%JTI6CPKVMQRHN2HGTFUVGJVTFCJKPVGT2CNOG#NGZCPFTQRQWNQU $TCWPG2CVKPCXQT\ÒINKEJ



“5EJGMGNX%JTI6CPKVMQRHN2HGTFUVGJVTFCJKPVGT2CNOG#NGZCPFTQRQWNQUD $TCWPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP*CWEMWPF#WHJ·WUGT/ÒPEJGP0T





8286



8287




AXUM

8289

8290



$  5EJGMGN TGFW\KGTV   X %JT  I 6CPKVMQRH N2HGTF T -QRH \WTÒEMIGYCPFV   #NGZCPFTQRQWNQU (CUVXQT\ÒINKEJ





$  5EJGMGN TGFW\KGTV   X %JT  I 6CPKVMQRH N2HGTF T -QRH \WTÒEMIGYCPFV   WPVGP-WIGN#NGZCPFTQRQWNQU 5GJTUEJÌP



8291



$&QRRGNUEJGMGN TGFW\KGTV   X %JT  I 6CPKVMQRH N2HGTF T FCTÒDGT #LKP #NGZCP   FTQRQWNQUXGTINI50)%QRXGTIN 8QPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌP 

8292

8293

8294

8295

8294 1,5:1

07/+&+# 

,WDC +  X %JT Õ&GPCT  I &TCRKGTVG $ÒUVG T OKV <GRVGT#EJVU·WNKIGT 6GORGN /C   \CTF50)%QR 4(GKPG6ÌPWPIXQT\ÒINKEJ





,WDC++XP%JTÕ&GPCTWOP%JTI-QRHTOKV&KCFGO(ÒNNJQTPXQT<GRVGT TQDGP*CNDOQPF/C\CTF50)%QR 5GJTUEJÌP





Õ&GPCTP%JTI-QRHTKO.ÌYGPHGNNÒDGTFGT5EJWNVGT-GWNG5EJTKHVKP-TCP\/C\CTF 50)%QR 448QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC





 WPF -NGQRCVTC 5GNGPG Õ&GPCT  P %JT  I -QRH T OKV &KCFGO-TQPG FGT +UKU WPF   5KUVTWO/C\CTFXGTIN50)%QR -N4CPFHGJNGTUGJTUEJÌP



-NGQRCVTC 5GNGPG YCT FKG 6QEJVGT FGU /CTE #PVQP WPF FGT -NGQRCVTC WPF YWTFG XGTOWVNKEJ  X %JT IGDQTGP   #WIWUVWUFGTUKGKPUGKPGO6TKWORJX%JTOKVHÒJTVGXGTJGKTCVGVGUKGX%JTOKV,WDC++

8296

8297 8296 1,5:1

#:7/ 



'DCPCWOÔ6TGOKUUKUI&TCRKGTVG$ÒUVGTOKV-TQPG\YKUEJGP\YGKJTGP&TCRKGTVG $ÒUVGTOKV-QRHVWEJ\YKUEJGP\YGKJTGP/WPTQ*C[,WGN,GPUGP6[R  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



0G\QQNWOÔ6TGOKUUKUI&TCRKGTVG$ÒUVGTOKV-TQPG\YKUEJGP\YGKJTGP&TCRKGTVG $ÒUVGTOKV-QRHVWEJ\YKUEJGP\YGKJTGP/WPTQ*C[,WGN,GPUGP6[R  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 191


LOTS GRIECHEN

.165)4+'%*+5%*'4/ª0<'0 

7OHCPITGKEJG5COONWPIHTÒJGT'NGMVTQPRT·IWPIGPCWUWPDGUVKOOVGPKQPKUEJGP/ÒP\UV·VVGP&KG 5COONWPIGPVJ·NV'NWPF5VCVGTG\$GKPGP'N5VCVGTXKGT-WIGNPWOGKPG\GP VTCNG-WIGN+PEWUWO4QUGP%QNN'UUKPF\CJNTGKEJG6[RGPKPXGTUEJKGFGPGP0QOKPCNGPXGTVTG VGPFCJGTGKIPGVUKEJFCU1DLGMVJGTXQTTCIGPFCNU)TWPFUVQEMHÒTFGP#WHDCWGKPGT5COONWPIHTÒJGT 'NGMVTQPRT·IWPIGP CDGT CWEJ \WO #WUDCW GKPGT DGUVGJGPFGP 5COONWPI *QEJKPVGTGUUCPVGU 1DLGMV   DKVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM<WO6GKNUGNVGP/GKUVUGJTUEJÌP 



1NDKC &TGK IGIQUUGPG “U Z )QTIQPGKQP4CF 50) $/    Z )QTIQPGKQP#FNGT CWH   &GNRJKP 50)$/HH &C\W\YGKIGRT·IVG“U 50)$/HH50)$/HH   5VÒEM(CUVUGJTUEJÌP



8300



)TKGEJKUEJG5KNDGTOÒP\GP8GNKC&KFTCEJOG6CTGPV&KFTCEJOG4JQFQU&TCEJOG  5VÒEM/GKUVUGJTUEJÌP



5RG\KCNUCOONWPIRVQNGO·KUEJGT$TQP\GOÒP\GP&KGJQEJKPVGTGUUCPVG5COONWPIGPVJ·NVRVQNGO·KUEJG /ÒP\GP XQP 2VQNGOCKQU + DKU \WO 'PFG FGT &[PCUVKG FCTWPVGT \CJNTGKEJG UGNVGPGTG WPF KPVGTGUUCPVG   2T·WPIGP*QEJKPVGTGUUCPVGU1DLGMVFCUUKEJJGTXQTTCIGPFCNU)TWPFUVQEMHÒTGKPG5COONWPIRVQNGO·K UEJGT/ÒP\GPGKIPGV$KVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM<WO6GKNUGNVGP/GKUVUEJÌPpUGJTUEJÌP 



.QV ITKGEJKUEJGT 5KNDGTOÒP\GP 'PVJCNVGP UKPF HÒPH &KFTCEJOGP XQP 6CTGPV GKPG 6GVTCFTCEJOG WPF   GKPG &TCEJOG #NGZCPFGTU FGU )TQ­GP GKPG &TCEJOG XQP .CTKUUC UGEJU CGIKPGVKUEJG 5VCVGTG Z 5GG   UEJKNFMTÌVG Z .CPFUEJKNFMTÌVG  CEJV N[MKUEJG 5VCVGTG Z 2GICUWU6TKUMGNKU Z \YGK &GNRJKPG ÒDGT   #WIG6TKUMGNKU GKPG*GOKFTCEJOGFGTN[MKUEJGP.KIC\YGKHTÒJG5VCVGTGXQP5KFG XGTIN#VNCP  GKPG MCRRCFQMKUEJG &TCEJOG UKGDGP U[TKUEJG 6GVTCFTCEJOGP WPF GKP RGTUKUEJGT 5KINQU *QEJKPVGTGU   UCPVGU1DLGMVDKVVGWPDGFKPIVDGUKEJVKIGP  5VÒEM<WO6GKNUGNVGP/GKUVUGJTUEJÌPGKPKIGUEJY·EJGT 



.QVITKGEJKUEJGT/ÒP\GP&CU.QVGPVJ·NVITKGEJKUEJG5KNDGTOÒP\GPFCTWPVGT5VCVGTGXQP-QTKPVJ

OGJTHCEJ  #PCMVQTKQP .GWMCU FTGK 6GVTCFTCEJOGP WPF OGJTGTG &TCEJOGP #NGZCPFGTU FGU )TQ­GP   GKPG 6GVTCFTCEJOG XQP #VJGP GKPG *GOKFTCEJOG XQP #MTCICU RCTVJKUEJG WPF MCRRCFQMKUEJG &TCEJ   OGP RGTUKUEJG 5KINQK GVE&C\WGKPKIG$TQP\GPUQYKGGKPGMGNVKUEJG6GVTCFTCEJOGWPF\YGKTÌOKUEJG 2TQXKP\KCNRT·IWPIGP*QEJKPVGTGUUCPVGU1DLGMVDKVVGWPDGFKPIVDGUKEJVKIGP  5VÒEM<WO6GKNUGNVGP5EJÌPpUGJTUEJÌP 



%KUVQRJQTGP&CUKPVGTGUUCPVG.QVGPVJ·NVKPUIGUCOV%KUVQRJQTGPCWU2GTICOQP'RJGUQUWPF6TCNNGKU $KVVGDGUKEJVKIGP 5VÒEM5GJTUEJÌP





.QV ITKGEJKUEJGT 5KNDGT WPF $TQP\GOÒP\GP 'PVJCNVGP UKPF \YGK RCTVJKUEJG &TCEJOGP GKPG RCTVJK   UEJG$TQP\GOÒP\GGKPG$TQP\GOÒP\GFGU2TWUKCUGKPG$TQP\GOÒP\GCWU-GNGPFGTKUUQYKGUGEJU$TQP \GOÒP\GPCWU,WFCGC+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP







-NGKPG5COONWPIITKGEJKUEJGT/ÒP\GPKP5KNDGTWPF$TQP\G&KG5COONWPIGPVJ·NV5KNDGTOÒP \GP FCTWPVGT  6GVTCFTCEJOGP /CEGFQPKC #NGZCPFGT +++ 5[TKC 5GNGWMQU + 4GXGTU 'NGHCPVGP   SWCFTKIC &GOGVTKQU +   5VCVGTG -TQVQP 6JCUQU 6JGUUCNKUEJG .KIC -QTKPVJ  GKPG &KFTCEJOG  

0GCRQNKU%CORCPKCG UQYKGMNGKPGTG0QOKPCNG WC1N[PVJQU-[\KMQU*KUVKCKCUQYKG\YGK-GNVGP  (GTPGT UKPF  VGKNU UGJT JÒDUEJG $TQP\GOÒP\GP GPVJCNVGP XQP 7PVGTKVCNKGP \ $ %CORCPKC %CNGU    ÒDGT5K\KNKGP \$)GNC-COCTKPC5[TCMWU WPF-NGKPCUKGPDKUKPFGPITKGEJKUEJGP1UVGP&WTEJFKG \CJNTGKEJGPJÒDUEJGP'TJCNVWPIGPUQYKGFKGITQ­G<CJNFGTXGTVTGVGPGP2QNGKUD\Y-ÌPKIGGKIPGVUKEJ FCU1DLGMVJGTXQTTCIGPFCNU)TWPFUVQEMHÒTFGP#WHDCWGKPGT)TKGEJGPUCOONWPICDGTCWEJ\WO#WU DCWGKPGTDGUVGJGPFGP5COONWPI$KVVGWPDGFKPIVDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌPGKPKIGDGUUGT 



)GOKUEJVGU.QVITKGEJKUEJGTWPFTÌOKUEJGT/ÒP\GP&CU.QVGPJ·NVITKGEJKUEJGWPFTÌOKUEJG/ÒP \GPKP$TQP\GWPF5KNDGT&KGITKGEJKUEJGP2T·IWPIGPUKPFVGKNUFGO5EJYCT\OGGTIGDKGV \$2CPVKMC RCKQP-ÌPKITGKEJ$QURQTWUGVE \W\WQTFPGPCDGTCWEJGKPG&KFTCEJOGXQP/GVCRQPVGKPGRCTVJKUEJG &TCEJOGGVEUKPFGPVJCNVGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



$TQP\GOÒP\GPCWU+WFCGC#NGZCPFGT,CPPCGWU Z *GTQFGU#TEJGNCQU#ITKRRC+#ODKDWNWU Z  2QPVKWU2KNCVWU#PVQPKWU(GNKZ(GUVWU#WHUVCPF Z $CT-QMJDC 5VÒEM/GKUVUGJTUEJÌP



 192


RÖMISCHE REPUBLIK

4¤/+5%*'/ª0<'0

8310 8309

8309

/ª0<'0&'44¤/+5%*'04'27$.+- 

“5GZVCPU  X %JT 4QO CPQP[O  I &KQUMWTGPMQRH T FCJKPVGT \YGK 9GTVMWIGNP   &KQUMWTGPMQRHNFCJKPVGT\YGK9GTVMWIGNP$/%%TCYH5[F (CUVUGJTUEJÌP





Õ&KFTCEJOG  X %JT 4QO CPQP[O  I ,CPWUMQRH,WRKVGT OKV $NKV\ WPF <GRVGT KP   3WCFTKICTXQP8KEVQTKCIGNGPMVWPVGPCWH$QFGPKO4CJOGP41/#$/%%TCYH5[F 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



8311 1,5:1



1,5:1

Õ&KFTCEJOG  X %JT 4QO CPQP[O  I ,CPWUMQRH,WRKVGT OKV $NKV\ WPF <GRVGT KP   3WCFTKICTXQP8KEVQTKCIGNGPMVWPVGPCWH$QFGPXGTVKGHV41/#$/%XGTIN%TCYH5[F $TGKVGT5EJTÌVNKPIRGTHGMV\GPVTKGTVIWVGUUGJTUEJÌP

8313

8312







Õ&KFTCEJOG  X %JT 4QO CPQP[O  I ,CPWUMQRH,WRKVGT OKV $NKV\ WPF <GRVGT KP   3WCFTKICTXQP8KEVQTKCIGNGPMVWPVGPCWH$QFGPXGTVKGHV41/#$/%%TCYH5[F  5GJTUEJÌPHCUVUGJTUEJÌP



Õ&KFTCEJOG  X %JT WPDGUVKOOVG /ÒP\UV·VVG CPQP[O  I ,CPWUMQRH,WRKVGT OKV   $NKV\ WPF <GRVGT KP 3WCFTKIC T XQP 8KEVQTKC IGNGPMV WPVGP CWH $QFGP XGTVKGHV 41/# $/%    %TCYH5[FD 5GJTUEJÌP



8314



“#U  X%JT4QO CPQP[OI$·TVKIGT,CPWUMQRHWPVGP9GTVCPICDG+ NKGIGPF  2TQTCTFCTÒDGT+$/%%TCYH5[F *GTTNKEJGITÒPG2CVKPCIWVGUUGJTUEJÌP  'KPG/ÒP\GKOTGFW\KGTVGP.KDTCN(W­&KGUG“U5GTKGIGJÌTV\WFGP,CPWUMQRH&KFTCEJOGP



193


RÖMISCHE REPUBLIK

8315



“#U  X%JT4QO CPQP[OI$·TVKIGT,CPWUMQRHWPVGP9GTVCPICDG+ NKGIGPF  2TQTCTFCTÒDGT+$/%%TCYH5[F &WPMGNITÒPG2CVKPCUGJTUEJÌP 

8316



“#U  X%JT4QO CPQP[OI$·TVKIGT,CPWUMQRHWPVGP9GTVCPICDG+ NKGIGPF  2TQTCTFCTÒDGT+$/%%TCYH5[F &WPMGNITÒPG2CVKPCHCUVUGJTUEJÌP



8317

1,5:1

1,5:1



“3WCFTCPUX%JT4QOCPQP[OI*GTEWNGUMQRHKO.ÌYGPHGNNNWPVGPFTGK9GTV MWIGNP2TQTCNWPVGPFTGK9GTVMWIGNP%TCYHC5[F 8QT\ÒINKEJGU2TCEJVGZGORNCT



'ZGORNCTFGT#WMVKQP5VGTPDGTI:+++<ÒTKEJ0T

8318

 194

Õ3WKPCT PCEJ  X %JT 4QO CPQP[O  I 4QOCMQRH T OKV IGHNÒIGNVGO FCJKPVGT 8&KG   &KQUMWTGPTGKVGPTWPVGPCWH$CNMGP41/#$/%%TCYH5[F 5GJTUEJÌP




RÖMISCHE REPUBLIK

1,5:1



8319

1,5:1

Õ3WKPCT  X %JT CRWNKUEJG /ÒP\UV·VVG CPQP[O  I 4QOCMQRH T OKV IGHNÒIGNVGO   *GNOFCJKPVGT8&KG&KQUMWTGPTGKVGPT$/%%TCYHC5[F  -NGKPGT5EJTÌVNKPIUTK­XQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

8320







8321

Õ&GPCTX%JT4QO3/CTEKWU.KDQI4QOCMQRHTOKVIGHNÒIGNVGO*GNOFCXQT: &KG&KQUMWTGPTGKVGPT$CD$/%%TCYH5[F  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP



Õ&GPCTX%JT4QOCPQP[OI4QOCMQRHTOKVIGHNÒIGNVGO*GNOFCJKPVGT:&KCPC KP*KTUEJDKICTOKV(CEMGNWPVGP*CNDOQPF$/%%TCYH5[F  -PCRRGT5EJTÌVNKPIHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



8322

8323

8324

8325

8322 1,5:1



Õ&GPCT  X %JT 4QO % /KPWEKWU #WIWTKPWU  I 4QOCMQRH T OKV IGHNÒIGNVGO *GNO   FCXQT:5·WNGFCTCWH5VCVWGGKPGU6QICVWUOKV<GRVGTCPFGT$CUKU.ÌYGPMÌRHGOKVJTGPN6QIC VWUT#WIWT$CD$/%%TCYH5[F 4(GKPG2CVKPCHCUVXQT\ÒINKEJ



&KG5·WNGKUVFKG%QNWOPC/KPWEKCGKP'JTGPOCNHÒT./KPWEKWUFGTKO,CJTGX%JTHÒTGKPG)GVTGKFGXGT VGKNWPI\WUV·PFKIYCT.KPMUKUVGKPYGKVGTGT#JPJGTTFGU/ÒP\OGKUVGTUGKPGTFGT-QPUWNPFGT,CJTGQFGT X%JTFCTIGUVGNNVT//KPWEKWU(CGUWUFGTGTUVGRNGDGKUEJG#WIWT



Õ&GPCTX%JT4QO/8CTIWPVGKWUI4QOCMQRHTOKVIGHNÒIGNVGO*GNO,WRKVGTKP 3WCFTKICT$CD$/%%TCYH5[F 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC





Õ&GPCTX%JT4QO.%CGEKNKWU/GVGNNWU&KCFGOCVWU ! I4QOCMQRHTOKVIGHNÒIGN VGO *GNO)ÌVVKP KP $KIC T OKV -TCP\ WPF <YGKI FCTWPVGT 'NGHCPVGPMQRH T $CD  $/%    %TCYH5[F (GKPG2CVKPCIWVGUUGJTUEJÌP



Õ&GPCT  X %JT 4QO % %CGEKNKWU /GVGNNWU  I 4QOCMQRH T OKV RJT[IKUEJGO *GNO   ,WRKVGTKP'NGHCPVGPDKICNXQP8KEVQTKCDGMT·P\V$CD$/%%TCYH5[F  45GJTUEJÌP





&CU 5VÒEM HGKGTV FGP 5KGI FGU . %CGEKNKWU /GVGNNWU ÒDGT *CUFTWDCN DGK 2CPQTOQU KO ,CJT  X %JT WPF FKG   'TQDGTWPIFGT'NGHCPVGPFGU-CTVJCIGTU

8326

8327

8328



Õ&GPCTX%JT4QO%(QPVGKWUI,CPWUHÌTOKIGT-QRHFGT&KQUMWTGP)CNGGTGN $CD$/%%TCYH5[F 5GJTUEJÌP





Õ&GPCTX%JT4QO2.KEKPKWU0GTXCI4QOCMQRHNOKV*GNO5RGGTWPF5EJKNF FCTÒDGT *CNDOQPF FCXQT 5VGTP9CJNU\GPG $ÒTIGT GTJ·NV 5VKOOVCHGN XQP MPKGPFGT (KIWT T $ÒTIGT   DGKO9·JNGP$CD$/%%TCYH5[F 5GJTUEJÌP



Õ&GPCTX%JT4QO./CTEKWU2JKNKRRWUI-QRH2JKNKRRU8XQP/CEGFQPKGPT OKV*GNOWPF&KCFGO4GKVGTUVCVWGT$CD$/%%TCYH5[F 5GJTUEJÌP





195


RÖMISCHE REPUBLIK

8329

8330

8331

8332



Õ&GPCT  X %JT 4QO 6 &KFKWU  I 4QOCMQRH T OKV IGHNÒIGNVGO *GNO-CORH   \YGKGT)NCFKCVQTGP$CD$/%%TCYH5[F 45GJTUEJÌP





Õ&GPCTX%JT4QO.8CNGTKWU(NCEEWUI$ÒUVGFGT8KEVQTKCT/CTUIGJVNOKV 5RGGTWPF6TQRJ·GFCXQT#RGZFCJKPVGTJTG$CD$/%%TCYH5[F  (GKPG6ÌPWPIUGJTUEJÌP



&KG4ÒEMUGKVGYGKUVFCTCWHJKPFC­FGT8CVGTFGU/ÒP\OGKUVGTUFCU#OVGKPGU(NCOGP/CTVKCNKUKPPGJCVVG



Õ&GPCT  X %JT 4QO / *GTGPPKWU  I 2KGVCUMQRH T#ORJKPQOWU VT·IV UGKPGP   8CVGTT$CD$/%%TCYHD5[FC (GKPG6ÌPWPIUGJTUEJÌP



#ORJKPQOWUWPF#PCRKCUYCTGP\YGK$TÒFGTCWU-CVCPKCFKGDGKGKPGO#GVPC#WUDTWEJKJTG'NVGTPTGVVGVGP*KGT UGJGPYKT2KGVCU FGT8QTFGTUGKVG KP#MVKQP



Õ&GPCT 5GTTCVWU   X %JT 4QO % 5WNRKEKWU  I -ÌRHG FGT 2GPCVGP N<YGK 5QNFCVGP   UVGJGPGKPCPFGTOKV5RGGTGPIGIGPÒDGTWPF\GKIGPCWHGKP5EJYGKP$CD$/%%TCYH 5[F 5GJTUEJÌP



5QYQJN 8QTFGT CNU CWEJ 4ÒEMUGKVG FGU 5VÒEMGU DG\KGJGP UKEJ XGTOWVNKEJ CWH FKG *GTMWPHV FGU /ÒP\OGKUVGTU CWU   .CXKPKWO#GPGCUJCVFKGUG5VCFVFQTVIGITÒPFGVYQGTWPVGTGKPGT'KEJGGKPGYGK­G5CWOKVFTGK­KI(GTMGNPHCPF #WH FGO (QTWO XQP .CXKPKWO UVCPF GKPG $TQP\GUVCVWG FGT 5CW KJT -ÌTRGT YWTFG XQP FGP 2TKGUVGTP KP 5CN\NCMG   MQPUGTXKGTV&GP2GPCVGPFGU\GTUVÌTVGP6TQKCICD#GPGCUKP.CXKPKWOGKPGPGWG*GKOCV

8333

8334

8335

8336

8336 1,5:1



Õ&GPCTX%JT4QO.6JQTKWU$CNDWUI-QRHFGTNCXKPKUEJGP,WPQT5VKGTURTKPIVT QDGP-$CD$/%%TCYH5[F (CUVXQT\ÒINKEJ





Õ&GPCTX%JT4QO.6JQTKWU$CNDWUI-QRHFGTNCXKPKUEJGP,WPQT5VKGTURTKPIVT QDGP.$CD$/%%TCYH5[F 5GJTUEJÌP





Õ&GPCT  X %JT 4QO . #RRWNGKWU 5CVWTPKPWU  I 4QOCMQRH N OKV IGHNÒIGNVGO *GNO   5CVWTPKP3WCFTKICT$CD$/%XCT%TCYHD5[FC (GKPG6ÌPWPIXQT\ÒINKEJ





Õ&GPCT  X %JT 4QO 3 /KPWEKWU 6JGTOWU  I /CTUMQRH N5QNFCV XGTVGKFKIV GKPGP   IGUVÒT\VGP-COGTCFGPXQTGKPGO$CTDCTGP$CD$/%%TCYH5[F  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



'KPINGKEJPCOKIGT8QTHCJTGFGU/ÒP\OGKUVGTUJCVVGUKEJDGK-·ORHGPKP.KIWTKGPDGUQPFGTUCWUIG\GKEJPGV

8337

8338



Õ&GPCT  X %JT 4QO . %CUUKWU %CGKEKCPWU  I %GTGUMQRH N<YGK 1EJUGP N $CD    $/%%TCYH5[F (CUVXQT\ÒINKEJ





Õ&GPCTX%JT4QO2WD%QTPGNKWU.GPVWNWUI*GTMWNGUDÒUVGKO.ÌYGPHGNNXQPJKPVGP IGUGJGP T OKV -GWNG FCJKPVGT 5EJKNF ÒDGT 84QOC UVGJV X X XQP )GPKWU DGMT·P\V FC\YKUEJGP 8   WOJGT.QTDGGTMTCP\$CD$/%%TCYHC5[F 4)WVGUUGJTUEJÌP



196


RÖMISCHE REPUBLIK

8339

8341

8340

8342

8339 1,5:1









Õ&GPCTX%JT4QO2WD%QTPGNKWU.GPVWNWUI*GTMWNGUDÒUVGKO.ÌYGPHGNNXQPJKPVGP IGUGJGP T OKV -GWNG FCJKPVGT 5EJKNF FCXQT '4QOC UVGJV X X XQP )GPKWU DGMT·P\V WOJGT .QT   DGGTMTCP\N'$CD$/%%TCYHF5[F  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&GPCTX%JT4QO.%CNRWTPKWU2KUQ%CGUQPKWUWPF35GTXKNKWU%CGRKQI5CVWTP MQRHTFCJKPVGT*CTRCWPVGP&TGK\CEM<YGK3WCGUVQTGPUKV\GPN\YKUEJGPJTGP$CD$/% %TCYHC5[F #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Õ&GPCTX%JT4QO.%CNRWTPKWU2KUQ(TWIKI#RQNNQMQRHTOKV.QTDGGTMTCP\FCJKP VGT2WPMVG4GKVGTTOKV2CNO\YGKIQDGP'$CD$/%%TCYH5[FG  5GJTUEJÌP



Õ&GPCT  X %JT 4QO . 6KVWTKWU 5CDKPWU  I -QRH FGU -ÌPKIU 6CVKWU T<YGK 5QNFCVGP   UVGJGPGKPCPFGTOKVLGGKPGT5CDKPGTKPIGIGPÒDGT$CD$/%%TCYHC5[F  5GJTUEJÌP



&KG4ÒEMUGKVGUVGNNVFGPDGTÒJOVGP4CWDFGT5CDKPGTKPPGPFCT

8343

8345

8344

8346

8345 1,5:1





Õ&GPCTX%JT4QO.6KVWTKWU5CDKPWUI-QRHFGU-ÌPKIU6CVKWUTFCXQT2CNO\YGKI <YGK5QNFCVGPUVGJGPGKPCPFGTOKVLGGKPGT5CDKPGTKPIGIGPÒDGT$CD$/%%TCYHD 5[FC #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&GPCTX%JT4QO.6KVWTKWU5CDKPWUI-QRHFGU-ÌPKIU6CVKWUTFCXQT2CNO\YGKI 6CTRGKCYKTFXQP\YGK5QNFCVGPOKV5EJKNFGPDGFGEMV$CD$/%%TCYHD5[F 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



&KG 8GUVCNKP 6CTRGKC GKPG 6QEJVGT FGU 5RWTKWU 6CTRGKWU JCVVG 4QO CP FKG 5CDKPGT XGTTCVGP KPFGO UKG KJPGP FKG   5VCFVVQTGÌHHPGVG#NU$GNQJPWPIHÒTKJTGP8GTTCVUQNNVGUKGXQPFGP5CDKPGTPFCUGTJCNVGPYCULGPGCPKJTGP#TOGP VTWIGP 5KG DGMCO GU CWEJ CNNGTFKPIU GTJKGNV UKG PKEJV FGP IQNFGPGP 5EJOWEM FGT 5CDKPGT UQPFGTP YWTFG OKV FGP   5EJKNFGPDGYQTHGPWPFXQPGKPGO(GNUGPIGUVÒT\V&KGUGT(GNUGPYWTFGXQPPWPCPCNUVCTRGKUEJGT(GNUGPDG\GKEJ PGVWPF*QEJXGTT·VGTYWTFGPXQPFQTVKPFGP6QFIGUVÒT\V



Õ&GPCTX%JT.CIGTOÒP\UV·VVG.%QTPGNKWU5WNNCI.58..#8GPWUMQRHTFCXQT UVGJV %WRKFQ N OKV 2CNO\YGKI FGU 5KGIGU -CPPG WPF .KVWWU \YKUEJGP \YGK 6TQRJ·GP $CD    $/%%TCYH5[F 48GTDTCWEJVGT#XGTUUVGORGNIWVGUUGJTUEJÌPXQT\ÒINKEJ



5WNNC DGHCPF UKEJ KO -TKGI IGIGP /KVJTCFCVGU 8+ 0CEJ UGKPGO 5KGI DGK %JCKTQPGKC  X %JT FÒTHVG FKG GTUVG   KORGTCVQTKUEJG#MMNCOCVKQPGTHQNIVUGKPX%JTPCEJ1TEJQOGPQUFKG\YGKVG



Õ&GPCTX%JT.CIGTOÒP\UV·VVG.%QTPGNKWU5WNNCI.58..#8GPWUMQRHTFCXQT UVGJV %WRKFQ N OKV 2CNO\YGKI FGU 5KGIGU -CPPG WPF .KVWWU \YKUEJGP \YGK 6TQRJ·GP $CD    $/%%TCYH5[F 45GJTUEJÌP

 197


RÖMISCHE REPUBLIK

8347

8349

1,5:1







8348

1,5:1

Õ&GPCT 5GTTCVWU X%JT4QO3#PVQPKWU$CNDWUI,WRKVGTMQRHTOKV.QTDGGTMTCP\ FCXQT#8KEVQTKCKP3WCFTKICT$CD$/%%TCYHE5[FC  (GKPG6ÌPWPIHCUVXQT\ÒINKEJ



Õ&GPCTX%JT4QO2%TGRWUKWUI#RQNNQMQRHTOKV.QTDGGTMTCP\WPF<GRVGTFCJKPVGT2 FCXQT'KFGEJUG4GKVGTT$CD$/%%TCYHE5[FC  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&GPCT 5GTTCVWU   X %JT 4QO % /COKNKWU .KOGVCPWU  I /GTEWTDÒUVG T ÒDGT FGT   5EJWNVGT %CFWEGWU FCJKPVGT /1F[UUGWU IGJV T OKV 5VCD FCXQT UVGJV UGKP *WPF #TIWU N $CD    $/%%TCYH5[F 48QT\ÒINKEJGU2TCEJVGZGORNCT



&KG 4ÒEMUGKVG UVGNNV FGP #WIGPDNKEM FCT CNU 1F[UUGWU XQP UGKPGP +TTHCJTVGP PCEJ +VJCMC JGKOMGJTGPF XQP UGKPGO   CNVGP*WPF#TIWUGTMCPPVYKTF&KG(COKNKG/COKNKCDGJCWRVGVGXQP6GNGIQPWUFGO5QJPFGU1F[UUGWUWPFFGT %KTEGCD\WUVCOOGP

8350

8351

1,5:1

1,5:1







8352

Õ&GPCT 5GTTCVWU X%JT4QO%/COKNKWU.KOGVCPWUI/GTEWTDÒUVGTÒDGTFGT5EJWN VGT%CFWEGWUFCJKPVGT+1F[UUGWUIGJVTOKV5VCDFCXQTUVGJVUGKP*WPF#TIWUN$CD$/% %TCYH5[F 4(CUVXQT\ÒINKEJ



Õ&GPCT  X %JT 4QO 3 (CDKWU /CZKOWU  I #RQNNQMQRH T OKV .QTDGGTMTCP\ FCXQT   5VGTPWPF.[TC+P-TCP\(ÒNNJQTPXQT$NKV\$CD$/%%TCYH5[F  (CUVXQT\ÒINKEJ



Õ&GPCT 5GTTCVWU   X %JT 4QO # 2QUVWOKWU #NDKPWU  I -QRH FGT *KURCPKC T6QICVWU   UVGJVNFCXQT#FNGTCWH5VCPIGFCJKPVGT(CUEGU$CD$/%%TCYH5[F  49KP\-TCV\GTCWHFGO#XGTUUGJTUEJÌP



&KG4ÒEMUGKVGVJGOCVKUKGTVFCU+ORGTKWOUGKPGU8QTHCJTGP.2QUVWOKWUKP5RCPKGP

1,5:1



8353

1,5:1

Õ&GPCT  X %JT PQTFKVCNKUEJG /ÒP\UV·VVG 3 %CGEKNKWU /GVGNNWU 2KWU  I 2KGVCUMQRH T   FCXQT5VQTEJ'NGHCPVIGJVN$CD$/%%TCYH5[F 48QT\ÒINKEJGU'ZGORNCT &GP$GKPPCOGP2KWUWPFFCJGTFKG2KGVCUCWHFGT8QTFGTUGKVGGTJKGNV/GVGNNWUYGKNGTFCUTÌOKUEJG8QNMÒDGT \GWIVGUGKPGP8CVGTCWUFGO'ZKN\WTÒEM\WTWHGP

198




RÖMISCHE REPUBLIK

8354







Õ&GPCT  X %JT PQTFKVCNKUEJG /ÒP\UV·VVG 3 %CGEKNKWU /GVGNNWU 2KWU  I 2KGVCUMQRH T   FCXQT5VQTEJ'NGHCPVIGJVN$CD$/%%TCYH5[F  45EJÌPG2CVKPCMN5VGORGNDTWEJCWHFGO#XGTUXQT\ÒINKEJ



Õ&GPCT 5GTTCVWU X%JT4QO%/CTKWU%CRKVQI%GTGUMQRHTFCXQT8CUGQDGP%:: 2HNÒIGTOKV1EJUGPIGURCPPNQDGP%::$CD$/%%TCYHE5[FD  5GJTUEJÌP



Õ&GPCT 5GTTCVWU X%JT4QO%2QDNKEKWUI4QOCDÒUVGTQDGP$*GTCMNGUNGTYÒTIV FGPPGOGKUEJGP.ÌYGPWPVGP-GWNGN-ÌEJGTOKV2HGKNGPWPF$QIGPVCUEJGN$$CD$/% %TCYH5[F (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



8357

1,5:1



1,5:1

Õ&GPCT 5GTTCVWU X%JT4QO%2QDNKEKWUI4QOCDÒUVGTQDGP:*GTCMNGUNGTYÒTIV FGPPGOGKUEJGP.ÌYGPWPVGP-GWNGN-ÌEJGTOKV2HGKNGPWPF$QIGPVCUEJGN:$CD$/% %TCYH5[F 8QT\ÒINKEJ

8359

1,5:1

Õ&GPCT 5GTTCVWU   X %JT 4QO . 2CRKWU  I -QRH FGT ,WPQ 5QURKVC T KO <KGIGPHGNN   FCJKPVGT*CTRC)TGKHURTKPIVTFCTWPVGTIGHNÒIGNVGT2GVCUWU$CD$/%%TCYH5[F 8QT\ÒINKEJ



Õ&GPCT 5GTTCVWU   X %JT 4QO . 2CRKWU  I -QRH FGT ,WPQ 5QURKVC T KO <KGIGPHGNN   FCJKPVGT#ORJQTG)TGKHURTKPIVTFCTWPVGT*[FTKC$CD$/%%TCYH5[F  )WVGUUGJTUEJÌP



Õ&GPCT 5GTTCVWU   X %JT 4QO . 2CRKWU  I -QRH FGT ,WPQ 5QURKVC T KO <KGIGPHGNN   FCJKPVGT#ORJQTG)TGKHURTKPIVTFCTWPVGT*[FTKC$CD$/%%TCYH5[F  5GJTUEJÌP



&KG(COKNKGUVCOOVGCWU.CPWXKWOFCJGTKUVFKG,WPQ5QURKVCFCTIGUVGNNV





8361







8360

8358

1,5:1



8356

8355

8362

Õ&GPCT 5GTTCVWU   X %JT 4QO . 2CRKWU  I -QRH FGT ,WPQ 5QURKVC T KO <KGIGPHGNN   FCJKPVGT#ORJQTG)TGKHURTKPIVTFCTWPVGT&TGKHW­$CD$/%%TCYH5[F  5GJTUEJÌP



Õ&GPCT 5GTTCVWU   X %JT 4QO . 2CRKWU  I -QRH FGT ,WPQ 5QURKVC T KO <KGIGPHGNN   FCJKPVGT5EJOGVVGTNKPI)TGKHURTKPIVTFCTWPVGT(NKGIG$CD$/%%TCYH5[F (GKPG6ÌPWPIIWVGUUGJTUEJÌP

 199


RÖMISCHE REPUBLIK

8363





8364

8365

8366

8367

Õ&GPCT 5GTTCVWU   X %JT 4QO . 2CRKWU  I -QRH FGT ,WPQ 5QURKVC T KO <KGIGPHGNN   FCJKPVGT5·WNGPDCUKU)TGKHURTKPIVTFCTWPVGT-CRKVGNNGKPGTMQTKPVJKUEJGP5·WNG$CD$/% %TCYH5[F #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&GPCT 5GTTCVWU   X %JT 4QO . 2CRKWU  I -QRH FGT ,WPQ 5QURKVC T KO <KGIGPHGNN   FCJKPVGT /ÒP\UVGORGN)TGKH URTKPIV T FCTWPVGT /ÒP\UVGORGN $CD  $/%  %TCYH    5[F #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'KPG5RG\KCNUCOONWPIXQP&GPCTGPFGU.WEKWU2CRKWUOKVFKXGTUGP$GK\GKEJGP2CCTGPFKGUGTKPVGTGUUCPVGP5GTKG HKPFGP5KGWPVGT0T



Õ&GPCTX%JT4QO/8QNVGKWUI*GTEWNGUMQRHKO.ÌYGPHGNNT'T[OCPVJKUEJGT'DGTT $CD$/%%TCYH5[F 4)WVGUUGJTUEJÌP



Õ&GPCTX%JTURCPKUEJG/ÒP\UV·VVG !  %P%QTPGNKWU.GPVWNWUI-QRHFGU)GPKWU 2QRWNK 4QOCPK T)NQDWU \YKUEJGP DGMT·P\VGO <GRVGT WPF 5VGWGTTWFGT $CD  $/%  %TCYH   D5[FC )WVGUUGJTUEJÌP



'ZGORNCTFGT#WMVKQP6JG0GY;QTM5CNG:+80GY;QTM0T  &GTYKNFG'DGTNGDVGCO$GTI'T[OCPVJQUKP#TMCFKGP*GTEWNGUGTJKGNVFKG#WHICDGKJPGKP\WHCPIGP&KGUIGNCPI KJOUEJNKG­NKEJCNUFCU6KGTKO5EJPGGGTOÒFGVG'TDTCEJVGFGP'DGTNGDGPFUGKPGO#WHVTCIIGDGT'WT[UVJGWUFGT UKEJFCTCWHJKPCWU#PIUVKPGKPGOGKUGTPGP(C­XGTUVGEMVG



%P.GPVWNWUYCT%WTCVQTFGPCTKQTWOHNCPFQTWO



Õ&GPCTX%JT4QO%2QUVWOKWUI&KCPCDÒUVGTOKV$QIGPWPF-ÌEJGT*WPFN·WHVT WPVGP5RGGT$CD$/%%TCYHC5[F (CUVXQT\ÒINKEJ

8369

8368



8370



Õ&GPCTX%JT4QO%2QUVWOKWUI&KCPCDÒUVGTOKV$QIGPWPF-ÌEJGT*WPFN·WHVT WPVGP5RGGT$CD$/%%TCYHC5[F 5GJTUEJÌP





Õ&GPCT  X %JT 4QO . %QUUWVKWU  I /GFWUGPMQRH N$GNNGTQRJQP TGKVGV CWH 2GICUWU T   OKV5RGGT$CD$/%%TCYH5[F 44(CUVXQT\ÒINKEJ





Õ&GPCT 5GTTCVWU X%JT4QO/P#SWKNNKWUI8KTVWUMQRHTOKV*GNO-TKGIGTGTJGDV 5KEKNKC$CD$/%%TCYH5[F 5GJTUEJÌP



&GT)TQ­XCVGTFGU/ÒP\OGKUVGTU/P#SWKNNKWU-QPUWNX%JTJCVVGUKEJWO5K\KNKGPXGTFKGPVIGOCEJV

1,5:1



8371 1,5:1

Õ&GPCT 5GTTCVWU   X %JT 4QO 3 (WHKWU %CNGPWU WPF 2 /WEKWU 5ECGXQNC %QTFWU  I   -ÌRHG FGT *QPQU WPF FGT 8KTVWU T+VCNKC WPF 4QOC TGKEJGP UKEJ FKG *CPF $CD  $/%    %TCYH5[F /KPFG\GPVTKGTVFGPPQEJXQT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI &GT%GPUWUFGU,CJTGUX%JTUQNNVG+VCNKGPWPF4QOXGTUÌJPGP'UKUVWPIGYÌJPNKEJFC­CWHGKPGT/ÒP\GFGT 4ÌOKUEJGP4GRWDNKMCWHGKPCMVWGNNGU'TGKIPKUCPIGURKGNVYKTF

200




RÖMISCHE REPUBLIK

8373

8372

8374

1,5:1







1,5:1

Õ&GPCT 5GTTCVWU   X %JT 4QO 3 (WHKWU %CNGPWU WPF 2 /WEKWU 5ECGXQNC %QTFWU  I   -ÌRHG FGT *QPQU WPF FGT 8KTVWU T+VCNKC WPF 4QOC TGKEJGP UKEJ FKG *CPF $CD  $/%    %TCYH5[F 'VYCU$GNCIUGJTUEJÌP



Õ&GPCTX%JT4QO%*QUKFKWU)GVCI&TCRKGTVG$ÒUVGFGT&KCPCTOKV&KCFGOÒDGT FGT 5EJWNVGT $QIGP WPF -ÌEJGT'DGT T XQPGKPGO5RGGTXGTYWPFGVWPFXQPGKPGO*WPFCVVCEMKGTV $CD$/%%TCYH5[F  #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCIWVGUUGJTUEJÌP



Õ&GPCTX%JT4QO%%CNRWTPKWU2KUQI#RQNNQMQRHN4GKVGTOKVTOKV2CNO\YGKI $CD$/%%TCYHD5[F 8QT\ÒINKEJ



&GT/ÒP\OGKUVGTYCT%KEGTQU5EJYKGIGTUQJP

8375

1,5:1



1,5:1

Õ&GPCT 5GTTCVWU X%JT4QO.4QUEKWU(CDCVWUI-QRHFGT,WPQ5QURKVCTKO<KGIGP HGNNFCJKPVGT*CPFT/·FEJGPUVGJVTFCXQT5EJNCPIGFCJKPVGT5RWNG ! $CD $GK\ $CPVK $/%%TCYH5[F 8QT\ÒINKEJ

#PN·­NKEJFGUL·JTNKEJYKGFGTMGJTGPFGP(GUVGUFGT,WPQ5QURKVCKP.CPWXKWOOW­VGGKPG,WPIHTCWFKGKO-GNNGTFGU 6GORGNU NGDGPFG 5EJNCPIG HÒVVGTP 9GPP FCU /·FEJGP MGWUEJ YCT DNKGD GU FCDGK WPXGTUGJTV CPUQPUVGP YWTFG GU   XQPFGT5EJNCPIGIGVÌVGV

8376

8377

8378



8379



Õ&GPCTX%JT4QO.%CUUKWU.QPIKPWUI8GTUEJNGKGTVG8GUVCDÒUVGNFCXQT5FCJKPVGT -[NKZ6QICVWUUVGJVNWPFYKTHV5VKOOUVGKPOKV8KP7TPG$CD$/%%TCYH5[F #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Õ&GPCT  X %JT 4QO . (WTKWU $TQEEJWU  I %GTGUMQRH T \YKUEJGP JTG WPF -QTP   %WTWNKUEJGT5VWJN\WDGKFGP5GKVGP(CUEGU$CD$/%%TCYH5[FC  -N-TCV\GTCWHFGO#XGTUIWVGUUGJTUEJÌP



&GT6[RDG\KGJVUKEJCWHFKGEWTCCPPQPCGWOFKGUKEJFKGFKNG\WMÒOOGTPJCVVGP



Õ&GPCTX%JT4QO/0QPKWU5WHGPCUI-QRHFGU5CVWTPTFCJKPVGT*CTRCWPFMQPKUEJGU 1DLGMV4QOCUKV\VNOKV5RGGTWPF5EJYGTVXQP8KEVQTKCDGMT·P\V$CD$/%%TCYH 5[F 5GJTUEJÌP



&KG 4ÒEMUGKVGP7OUEJTKHV NCWVGV 5':VWU 010+WU 24CGVQT .WFQU 8KEVQTKCG 2TKOWU (GEKV WPF DG\KGJV UKEJ CWH FKG   'KPHÒJTWPI FGT .WFK 8KEVQTKCG PCEJ 5WNNCU 5KGICO%QNKPKUEJGP6QTX%JT&GT5VGKPCWHFGT8QTFGTUGKVGYCT XGTOWVNKEJFGTLGPKIGFGPOCP5CVWTPCP5VGNNGXQP<GWUWPVGTUEJQD'TYWTFGKP&GNRJKIG\GKIVWPFXGTGJTV



Õ&GPCTX%JT4QO/#GOKNKWU5ECWTWUWPF22NCWVKWU*[RUCGWUI-COGNTFCXQT MPKGV#TGVCU3WCFTKICNFCXQT5EQTRKQP$CD$/%%TCYHD5[F  (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC &GT0CDCV·GTMÌPKI#TGVCUWPVGTYCTHUKEJ/#GOKNKWU

 201


RÖMISCHE REPUBLIK

8380

8381

8382

8380 1,5:1

8382 1,5:1



Õ&GPCTX%JT4QO/#GOKNKWU5ECWTWUWPF22NCWVKWU*[RUCGWUI-COGNTFCXQT MPKGV#TGVCU3WCFTKICNFCXQT5EQTRKQP$CD$/%%TCYHD5[F 5GJTUEJÌP





Õ&GPCTX%JT4QO/#GOKNKWU5ECWTWUWPF22NCWVKWU*[RUCGWUI-COGNTFCXQT MPKGV#TGVCU3WCFTKICNFCXQT5EQTRKQP$CD$/%%TCYHD5[F 5GJTUEJÌP





Õ&GPCTX%JT4QO%5GTXGKNKWU%HI(NQTCMQRHTFCJKPVGT.KVWWU<YGK5QNFCVGP RCTCFKGTGPXQTGKPCPFGTOKVIG\QIGPGP5EJYGTVGTP$CD$/%%TCYH5[F  4#XGTUGVYCUFG\GPVTKGTVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



&GT/ÒP\OGKUVGTJCV(NQTCCDIGDKNFGVFCGKPGTUGKPGT#JPGPFGTGTUVG(NCOGP(NQTCNKUYCT

8384

8383

1,5:1

1,5:1



1,5:1

1,5:1

Õ&GPCTX%JT4QO%%QPUKFKWU0QPKCPWUI$ÒUVGFGT8GPWU'T[EKPCT6GORGNCWH $GTIKP/CWGTTKPI$CD$/%%TCYH5[F 4(GKPG6ÌPWPIUGJTUEJÌP



Õ&GPCT  X %JT 4QO . /CTEKWU 2JKNKRRWU  I -QRH FGU #PEWU /CTEKWU T OKV &KCFGO   FCJKPVGT .KVWWU4GKVGTUVCVWG T CWH #SW·FWMV CWU FGO GKPG $NWOG Y·EJUV $CD  $/%    %TCYH5[F 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



&CTIGUVGNNVKUVFGT8GPWUVGORGNCWHFGO$GTI'T[ZKO9GUVGP5K\KNKGPU



3/CTEKWU4GZFGTFWTEJFCU5VCPFDKNFIGGJTVYWTFGXQNNGPFGVGFKG9CUUGTNGKVWPI#SWC/CTEKCFKG\WO-CRKVQN HÒJTVG

8387

8385

1,5:1



8386

1,5:1

Õ&GPCT  X %JT 4QO (CWUVWU %QTPGNKWU 5WNNC  I &KCPCDÒUVG T FCJKPVGT .KVWWU5WNNC   UKV\VN\YKUEJGPMPKGGPFGO$QEEJWUOKV1NKXGP\YGKIWPFIGHGUUGNVGO,WIWTVJC$CD$/% %TCYH5[F 445GJTUEJÌP



&KG4ÒEMUGKVGPU\GPGFGT7PVGTYGTHWPI,WIWTVJCUYCTCWH5WNNCU5KGIGNTKPIFCTIGUVGNNV



Õ&GPCT  X %JT 4QO 3 %CUUKWU .QPIKPWU  I 8GTUEJNGKGTVG 8GUVCDÒUVG T8GUVCVGORGN   FCTKPMWTWNKUEJGT5VWJN\YKUEJGP5VKOOWTPGWPF5VKOOVCHGNOKV#%$CD$/%%TCYH 5[F 4(GKPG6ÌPWPICVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Õ&GPCTX%JT4QO3%CUUKWU.QPIKPWUI.KDGTVCUMQRHT8GUVCVGORGNFCTKPMWTWNK UEJGT5VWJN\YKUEJGP5VKOOWTPGWPF5VKOOVCHGNOKV#%$CD$/%%TCYH5[F 48QT\ÒINKEJGU2TCEJVGZGORNCTOKVJGTTNKEJGT2CVKPC



#WH FGP 5VKOOVCHGNP UVGJV # DUQNXQ  D\Y % QPFGOPQ  &GT 8QTICPI FÒTHVG UKEJ CWH GKPGP 8GUVCNKPPGPRTQ\G­    X%JTDG\KGJGP



202


RÖMISCHE REPUBLIK

8388



8390

8389

8391

8392

Õ&GPCTX%JT4QO#2NCWVKWUI-[DGNGMQRHT/CPPMPKGVTOKV<ÒIGNPWPF2CNO \YGKITXQT-COGNT$CD$/%%TCYH5[F 5GJTUEJÌP



$GK FGT 2GTUQP CWH FGO 4GXGTU JCPFGNV GU UKEJ OÌINKEJGTYGKUG WO FGP *QJGPRTKGUVGT #TKUVQDWNQU UKGJG -TCHV KP   ,0)5HH 



Õ&GPCTX%JT4QO#2NCWVKWUI-[DGNGMQRHT/CPPMPKGVTOKV<ÒIGNPWPF2CNO \YGKITXQT-COGNT$CD$/%%TCYH5[F 5GJTUEJÌP





Õ&GPCT  X %JT 4QO %P 2NCPEKWU  I $ÒUVG FGT /CEGFQPKC !  TOKV%CWUKC-TGVKUEJG <KGIGTFCJKPVGT$QIGPWPF-ÌEJGT$CD$/%%TCYH5[F  (GKPG6ÌPWPIUGJTUEJÌPXQT\ÒINKEJ



Õ&GPCTX%JT4QO/,WPKWU$TWVWUI.KDGTVCUDÒUVGT&GT-QPUWN.,WPKWU$TWVWU IGJV\YKUEJGP\YGK.KMVQTGPNFCXQT#EEGPUWU$CD$/%%TCYH5[F  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



&GT/ÒP\OGKUVGTJCVVGUQYQJNKP/CMGFQPKGPCNUCWEJKP-TGVCIGFKGPV



3 %CGRKWU $TWVWU  UGKV UGKPGT #FQRVKQP / ,WPKWU $TWVWU YCT GKPGT FGT UR·VGTGP %CGUCTOÌTFGT WPF DGIGIPGV   &CPVGCNUUQNEJGTCWHUGKPGO9GIFWTEJFKG*ÌNNG&KG4ÒEMUGKVG\GKIVFGP8QTHCJTGPFGU/ÒP\OGKUVGTUFGTX %JT FGT 6TCFKVKQP PCEJ FGP NGV\VGP -ÌPKI 6CTSWKPKWU 5WRGTDWU CWU 4QO XGTVTKGD WPF FCOKV FKG 4GRWDNKM DGITÒP   FGVG&KG4ÒEMUGKVGKUVFCU8QTDKNFHÒTFKG)QNFUVCVGTGFGU-QUQP -CVCNQIPT 



Õ&GPCTX%JT4QO/,WPKWU$TWVWUI.KDGTVCUDÒUVGT&GT-QPUWN.,WPKWU$TWVWU IGJV\YKUEJGP\YGK.KMVQTGPNFCXQT#EEGPUWU$CD$/%%TCYH5[F  #XGTUNGKEJVFG\GPVTKGTVWPFCO4CPFOKPMQTTQFKGTVUGJTUEJÌP

8393

8394

1,5:1







8395

1,5:1

Õ&GPCTX%JT4QO/,WPKWU$TWVWUI.KDGTVCUDÒUVGT&GT-QPUWN.,WPKWU$TWVWU IGJV\YKUEJGP\YGK.KMVQTGPNFCXQT#EEGPUWU$CD$/%%TCYH5[F  -N2TÒHUVGNNGCO4CPF$GNCICWHFGT4ÒEMUGKVGUGJTUEJÌP



Õ&GPCT  X %JT 4QO / ,WPKWU $TWVWU  I -QRH FGU . ,WPKWU $TWVWU T-QRH FGU %   5GTXKNKWU#JCNCT$CD$/%%TCYH5[F  #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIUGJTUEJÌPpXQT\ÒINKEJ



&GT/ÒP\OGKUVGTKUVFGTUR·VGTG%CGUCTOÌTFGT'T\GKIVJKGTFWTEJFKG$KNFGT\YGKGT8QTHCJTGPUGKPGUVTGPITGRW DNKMCPKUEJG )GUKPPWPI \WO GKPGP . ,WPKWU $TWVWU FGT FKG VCTSWKPKUEJGP -ÌPKIG XGTVTKGD WPF \WO CPFGTGP %   5GTXKNKWU#JCNCFGTFGP5VCCVXQT5RWTKWU/CGNKWUTGVVGVG



Õ&GPCTX%JT4QO32QORGKWU4WHWUI%WTWNKUEJGT5VWJN\YKUEJGP2HGKNWPF.QTDGGT \YGKI%WTWNKUEJGT 5VWJN \YKUEJGP .KVWWU WPF -TCP\ $CD  $/%  %TCYH  5[F    #NVG+PXGPVCTPWOOGTUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



&KG/ÒP\GHGKGTVFKGDGKFGP)TQ­X·VGTFGU/ÒP\OGKUVGTUGKPOCN32QORGKWU4WHWU:XKT 2HGKNWPF<YGKI WPF 5WNNC#WIWT .KVWWU FKG\WUCOOGPKO,CJTX%JT-QPUWNPYCTGP&GT/QPGVCTYQNNVGUKEJFCOKVHÒTJÌJGTG #WHICDGPGORHGJNGPFGPPGKPGXQTPGJOGTG#DMWPHVCNUXQP\YGK%QPUWNCTGPYCTMCWOOÌINKEJ

203


RÖMISCHE REPUBLIK

1,5:1



8396

1,5:1

Õ&GPCT  X %JT 4QO % %QGNKWU %CNFWU  I -QRH FGU -QPUWNU % %QGNKWU %CNFWU T   5QNMQRHTFCTWPVGT4WPFUEJKNFFCJKPVGT.CPIUEJKNF$CD$/%%TCYHC5[F  48QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



&KGDGKFGP5EJKNFG GKPICNNKUEJGTWPFGKPOCMGFQPKUEJGT \GKIGPCPFC­FGT8QTHCJTFGU/ÒP\OGKUVGTUCWHDGKFGP -TKGIUUEJCWRN·V\GPGTHQNITGKEJIGM·ORHVJCV

8397

8398

8397 1,5:1



8399

8398 1,5:1

Õ&GPCTX%JT4QO2%QTPGNKWU.GPVWNWU/CTEGNNKPWUI-QRHFGU/%NCWFKWU/CTEGN NWU T FCJKPVGT 6TKUMGNKU/ %NCWFKWU /CTEGNNWU RNC\KGTV 6TQRJ·G KP XKGTU·WNKIGO 6GORGN $CD    $/%%TCYH5[F 45GJTUEJÌP



&CU5VÒEMRTGKUVFKG6CVGPFGUDGTÒJOVGUVGP8QTHCJTGPFGU/ÒP\OGKUVGTU/%NCWFKWU/CTEGNNWUJCVVGKO\YGKVGP RWPKUEJGP-TKGI5[TCMWUGTQDGTVCWHFKGUG6CVYGKUVFKG6TKUMGNKUCWHFGO#XGTUJKP&GT4GXGTUHGKGTVFKG2NCV\KG TWPIFGTURQNKCQRKOCFGTXQPGKPGOTÌOKUEJGP*GGTHÒJTGTFGOIGIPGTKUEJGP#PHÒJTGTKO<YGKMCORHCDIGTWPIG PGP 9CHHGP KO 6GORGN FGU ,WRKVGT (GTGVTKWU /CTEGNNWU HÒJTVG -TKGI IGIGP FKG +PUWDTGT WPF MQPPVG FGTGP -ÌPKI   8KTKFQOCTWU KO <YGKMCORH DGUKGIGP &KGUG *GNFGPVCV YWTFG XQP 0CGXKWU KP FGT HCDWNC RTCGVGZVC %NCUVKFKWO   DGUWPIGP



Õ&GPCT  X %JT 4QO /P #EKNKWU  I 5CNWUMQRH T8CNGVWFQ UVGJV N OKV 5EJNCPIG CWH   5·WNGIGUVÒV\V$CD$/%%TCYHC5[F  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



5CNWU WPF 8CNGVWFQ UVGJGP HÒT FKG IWVG )GUWPFJGKV &GT /ÒP\OGKUVGT YKNN FCOKV \WO #WUFTWEM DTKPIGP FC­ FGT   IGPU#EKNKCFCU8GTFKGPUVFGT'KPHÒJTWPICPUV·PFKIGTOGFK\KPKUEJGT8GTUQTIWPIKP4QO\WMQOOV+O,CJTGX %JT JCVVG FGT ITKGEJKUEJG #T\V #TEJCICVJWU CP GKPGT PCEJ FGT IGPU #EKNKC DGPCPPVGP 5VTC­GPMTGW\WPI GKPG 2TCZKU   GKPIGTKEJVGV



Õ&GPCT  X %JT 4QO /P #EKNKWU  I 5CNWUMQRH T8CNGVWFQ UVGJV N OKV 5EJNCPIG CWH   5·WNGIGUVÒV\V$CD$/%%TCYHC5[F  9KP\-TCV\GTFGPPQEJCVVTCMVKXGU'ZGORNCTHCUVXQT\ÒINKEJUGJTUEJÌP

1,5:1



8400

1,5:1

Õ&GPCT  X %JT 4QO . *QUVKNKWU 5CUGTPC  I -QRH GKPGU ICNNKUEJGP -TKGIGTU YQJN FGU   8GTEKPIGVQTKZ T)CNNKUEJGT-TKGIGTUVGJVNOKV5EJKNFWPF5RGGTKPTHCJTGPFGO5VTGKVYCIGP$CD $/%%TCYHC5[F  44*GTXQTTCIGPF\GPVTKGTVGU'ZGORNCTOKVHGKPGT2CVKPCHCUVXQT\ÒINKEJ  8GTEKPIGVQTKZYCTFGT(ÒJTGTFGUITQ­GP)CNNKGTCWHUVCPFGUIGIGP%CGUCTKO,CJTGX%JT0CEJFGO(CNN#NGUKCU OW­VG8GTEKPIGVQTKZUKEJGTIGDGP&KGDGTÒJOVGENGOGPVKC%CGUCTKUYWTFGKJOPKEJV\WVGKNPCEJUGEJU,CJTGP*CHV YWTFG GT KO 6WNNKCPWO JKPIGTKEJVGV &GT 4GXGTU \GKIV GKPGP ICNNKUEJGP 5VTGKVYCIGP 'UUGFWO  OKV 9CIGPM·ORHGT  

'UUGFCTKWU WPF.GPMGT #WTKIC &KG5VTGKVYCIGPYWTFGPXQTCNNGOIGIGPFKG-CXCNNGTKGGKPIGUGV\V

204




RÖMISCHE REPUBLIK

8401

8403

8402

8404

8401 1,5:1



Õ&GPCTX%JT4QO%#PVKWU4GUVKQI-QRHFGU%#PVKWU4GUVKQT*GTEWNGUIGJVT OKV-GWNGWPF6TQRJ·G$CD$/%%TCYH5[F  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



#WHFGO#XGTUFGU5VÒEMGUKUVFGT8CVGTFGU/ÒP\OGKUVGTUCDIGDKNFGVFGTKO,CJTX%JT8QNMUVTKDWPYCT X%JTHCPFUKEJWPUGT/ÒP\OGKUVGTCWHFGP2TQUETKRVKQPUNKUVGPFGT6TKWOXKTPYKGFGTWPFHNQJ\W5GZVWU2QORGKWU PCEJ5K\KNKGP



Õ&GPCTX%JT4QO/P%QTFKWU4WHWUI'WNGCWHMQTKPVJKUEJGO*GNOT#GIKUOKV /GFWUGPJCWRVXGT\KGTV$CD$/%%TCYH5[F (GKPG6ÌPWPIUGJTUEJÌP





Õ&GPCT  X %JT 4QO 6 %CTKUKWU  I &TCRKGTVG $ÒUVG FGT ,WPQ /QPGVC T/ÒP\YGTM   \GWIG1DGTWPF7PVGTUVGORGN<CPIGWPF*COOGT$CD$/%%TCYH5[FD 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI



Õ&GPCT  X %JT 4QO .QNNKWU 2CNKMCPWU  I -QRH FGT .KDGTVCU T4QUVTC FCTCWH 5WDUGN   NKWO$CD$/%%TCYH5[F  (GKPG2CVKPC-TCV\GTCWHFGO4GXGTUHCUVXQT\ÒINKEJ





8406

8405

8405 1,5:1



8407

8407 1,5:1

Õ&GPCTX%JT4QO2#EEQNGKWU.CTKUEQNWUI-QRHFGT&KCPC0GOQTGPUKUT&TGKHC EJG-WNVUVCVWGFGT&KCPC0GOQTGPUKUXX &KCPC*GECVG5GNGPG $CD$/%%TCYH 5[F 4(GKPG2CVKPCIWVGUUGJTUEJÌP



&KG(COKNKGFGU/ÒP\OGKUVGTUUVCOOVGCWU#TKEKCYQUKEJ6GORGNWPFJGKNKIGT*CKPFGT&KCPC0GOQTGPUKUDGHCP FGP&GT2TKGUVGTFGT)ÌVVKPFGT4GZ0GOQTGPUKUYCTGKPGPVHNQJGPGT5MNCXGFGTUGKPGP8QTI·PIGTKO<YGKMCORH IGVÌVGV JCDGP OW­VG 1EVCXKCPU/WVVGTUVCOOVGGDGPHCNNUCWU#TKEKCWPFOÌINKEJGTYGKUGJCV1EVCXKCP'KPHNW­CWH FKG9CJNFGU/ÒP\V[RUIGJCDV





Õ&GPCTX%JT4QO..KXKPGKWU4GIWNWUI-QRHFGU2TCGVQTU..KXKPGKWU4GIWNWUT %WTWNKUEJGT5VWJN\YKUEJGPLGFTGK(CUEGU$CD$/%%TCYH5[F  45GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&GPCT  X %JT 4QO . .KXKPGKWU 4GIWNWU  I -QRH FGU 2TCGVQTU .KXKPGKWU 4GIWNWU T   %WTWNKUEJGT5VWJN\YKUEJGPLGFTGK(CUEGU$CD$/%%TCYH5[F  47PTGIGNO·­KIGT5EJTÌVNKPICVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



1,5:1



8408 1,5:1

Õ&GPCTX%JT4QO..KXKPGKWU4GIWNWUI-QRHFGU2TCGVQTU..KXKPGKWU4GIWNWUT /QFKWU\YKUEJGP\YGKJTGP$CD$/%%TCYH5[F  44#VVTCMVKXGU'ZGORNCTIWVGUUGJTUEJÌP



&CU2QTVT·V\GKIVFGP8CVGTFGU/ÒP\OGKUVGTU&KG4ÒEMUGKVGDG\KGJVUKEJCWHFKG-QTPXGTVGKNWPIFKGFKGUGTFWTEJ \WHÒJTGPJCVVG

205


IMPERATORISCHE PRÄGUNGEN

8409

8410

8409 1,5:1



8411

8411 1,5:1

Õ&GPCTX%JT4QO..KXKPGKWU4GIWNWUI-QRHFGU2TCGVQTU..KXKPGKWU4GIWNWUT )NCFKCVQT N KO -CORH OKV GKPGO .ÌYGP KO *KPVGTITWPF )NCFKCVQT N KO -CORH OKV GKPGO 2CPVGT N   XGTYWPFGVGT'DGT$CD$/%%TCYH5[F 45GJTUEJÌP



/ÌINKEJGTYGKUG YQNNVG FGT /ÒP\OGKUVGT OKV FGT 4GXGTUFCTUVGNNWPI CWH FKG 5RKGNG JKPYGKUGP FKG GT XGTCPUVCNVGV   J·VVGYGPPGT\WO#GFKNIGY·JNVYQTFGPY·TG





Õ&GPCTX%JT4QO..KXKPGKWU4GIWNWUI-QRHFGU2TCGVQTU..KXKPGKWU4GIWNWUT )NCFKCVQT N KO -CORH OKV GKPGO .ÌYGP KO *KPVGTITWPF )NCFKCVQT N KO -CORH OKV GKPGO 2CPVGT N   XGTYWPFGVGT'DGT$CD$/%%TCYH5[F 45EJÌPpUGJTUEJÌP



Õ&GPCTX%JT4QO.5GTXKWU4WHWUI-QRHTOKVFGP)GUKEJVU\ÒIGPFGU$TWVWU&KG &KQUMWTGPUVGJGPHCUVXX$CD$/%%TCYH5[F  2T·IGUEJY·EJGMN-TCV\GTIWVGUUGJTUEJÌP



&GT /ÒP\OGKUVGT YQNNVG XGTOWVNKEJ FCFWTEJ FC­ GT FGO 2QTVT·V CWH FGO #XGTU FGU 5VÒEMGU FKG <ÒIG FGU $TWVWU   XGTNKGJUGKPG5[ORCVJKGHÒTFKG5CEJGFGT%CGUCTOÌTFGT\WO#WUFTWEMDTKPIGP

8412

1,5:1

1,5:1

+/2'4#614+5%*'24)70)'0 

%P 2QORGKWU /CIPWU OCKQT Ŏ  X %JT Õ&GPCT  X %JT MNGKPCUKCVKUEJG /ÒP\UV·VVG 3   5KEKPKWU WPF % %QRQPKWU  I #RQNNQMQRH T OKV &KCFGO FCTWPVGT 5VGTP-GWNG FCTÒDGT .ÌYGP   HGNNN2HGKNT$QIGP$CD$/%%TCYHC5GCT5[F  2GTHGMV\GPVTKGTVGUXQT\ÒINKEJGU2TCEJVGZGORNCT

8414

8413

1,5:1





8415

1,5:1

Õ&GPCTX%JTITKGEJKUEJG/ÒP\UV·VVG2TQSWCGUVQT6GTGPVKWU8CTTQI,WRKVGTDÒUVGT <GRVGT\YKUEJGP&GNRJKPWPF#FNGT$CD$/%%TCYHC5GCT5[F 45EJÌP



&GT 2TQSWCGUVQT 6GTGPVKWU 8CTTQ KUV PKEJV OKV FGO DGTÒJOVGP 7PKXGTUCNIGNGJTVGP INGKEJGP 0COGPU KFGPVKUEJ FGT     $ÒEJGTCWHCNNGP9KUUGPUIGDKGVGPXGTHC­VJCDGPUQNN



% ,WNKWU %CGUCT Ŏ  X %JT Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKG   UVGTIGT·VG$CD$/%%TCYH5GCT5[F  5VGORGNHTKUEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI  &KG 4ÒEMUGKVG \GKIV %CGUCTU #OV CNU 2QPVKHGZ OCZKOWU CP FKG GKP\KIG QHHK\KGNNG 5VGNNWPI FKG GT \W $GIKPP FGU   $ÒTIGTMTKGIGUDGMNGKFGVG

 206

Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKGUVGTIGT·VG $CD  $/%    %TCYH5GCT5[F #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI




IMPERATORISCHE PRÄGUNGEN

8416

8418

8417

8419

8420



Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKGUVGTIGT·VG $CD  $/%    %TCYH5GCT5[F #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKGUVGTIGT·VG $CD  $/%    %TCYH5GCT5[F 'VYCUFG\GPVTKGTVIWVGUUGJTUEJÌP





Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKGUVGTIGT·VG $CD  $/%    %TCYH5GCT5[F 4GXGTUGVYCUFG\GPVTKGTVIWVGUUGJTUEJÌP





Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKGUVGTIGT·VG $CD  $/%    %TCYH5GCT5[F .GKEJVFG\GPVTKGTVHGKPG2CVKPCUGJTUEJÌP





Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKGUVGTIGT·VG $CD  $/%    %TCYH5GCT5[F #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



8422

8421

8423



Õ&GPCT  X %JT .CIGTOÒP\UV·VVG  I 'NGHCPV T2TKGUVGTIGT·VG $CD  $/%    %TCYH5GCT5[F 5GJTUEJÌP





Õ&GPCTX%JT.CIGTOÒP\UV·VVGI-QRHFGT%NGOGPVKC ! T6TQRJ·GCWUICNNKUEJGP 9CHHGPT#ZV$CD$/%%TCYH5GCT5[F  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Õ&GPCTX%JTUK\KNKUEJG/ÒP\UV·VVG#WNWU#NNKGPWUI&TCRKGTVG$ÒUVGFGT8GPWUTOKV &KCFGO6TKPCETWUUVGJVN(W­CWH2TQTC$CD$/%%TCYH5GCT5[F  445EJÌPpUGJTUEJÌP





%CGUCTDGHCPFUKEJX%JTCWH5K\KNKGPDGXQTGTPCEJ#HTKMCCWHDTCEJWOFKG2QORGKCPGT\WDGM·ORHGP#WNWU #NNKGPWUY·JNVGHÒTFKG8QTFGTUGKVGFGU5VÒEMGUGKPV[RKUEJGU/QVKXFGT2TQRCICPFC%CGUCTUFKG)ÌVVKP8GPWUCDGT HÒT FGP 4GXGTU GKPG CW­GTIGYÌJPNKEJG URG\KGNN CWH 5K\KNKGP DG\QIGPG &CTUVGNNWPI 6TKPCETWU 6TKPCETWU D\Y 6JTK   PCMQU KUV GKP O[VJKUEJGT -ÌPKI XQP 5K\KNKGP PCEJ FGO FKG +PUGN KJTGP CNVGP 0COGP 6JTKPCMTKC DGK *QOGT YKTF   5K\KNKGP6JTKPCMKGIGPCPPV GTJCNVGPJCDGPUQNN

1,5:1



8424

1,5:1

8425

Õ&GPCT  X %JT .CIGTOÒP\UV·VVG KP #HTKEC  I 8GPWUMQRH T#GPGCU N VT·IV UGKPGP   8CVGT#PEJKUGUWPFFCU2CNNCFKWO CWUFGODTGPPGPFGP6TQLC $CD$/%%TCYH5GCT 5[F #VVTCMVKXGU'ZGORNCTOKVJGTTNKEJGT2CVKPCIWVGUUGJTUEJÌP



%CGUCTUVGNNVGKPUGKPGT2TQRCICPFCKOOGTYKGFGTUGKPG#DUVCOOWPIXQPFGPCWHFKGUGT/ÒP\GFCTIGUVGNNVGPO[VJK UEJGP 8QTHCJTGP JGTCWU #UECPKWU+WNWU FGT 5QJP FGU #GPGCU IKNV CNU 5VCOOXCVGT FGT ,WNKGT #GPGCU YKGFGTWO   UVCOOVG XQP 8GPWU CD *KGT XGTDKPFGV UKEJ FKG )TÒPFWPIUUCIG 4QOU U[ODQNKUKGTV FWTEJ FCU 2CNNCFKWO OKV FGO   7TURTWPIFGTIGPU+WNKC



Õ&GPCT  X %JT .CIGTOÒP\UV·VVG KP #HTKEC  I 8GPWUMQRH T#GPGCU N VT·IV UGKPGP   8CVGT#PEJKUGUWPFFCU2CNNCFKWO CWUFGODTGPPGPFGP6TQLC $CD$/%%TCYH5GCT 5[F (GKPG6ÌPWPIUGJTUEJÌPIWVGUUGJTUEJÌP

 207


IMPERATORISCHE PRÄGUNGEN

8426







Õ&GPCT  X %JT .CIGTOÒP\UV·VVG KP #HTKEC  I 8GPWUMQRH T#GPGCU N VT·IV UGKPGP   8CVGT#PEJKUGUWPFFCU2CNNCFKWO CWUFGODTGPPGPFGP6TQLC $CD$/%%TCYH5GCT 5[F #XGTUNGKEJVFG\GPVTKGTVUGJTUEJÌPHCUVXQT\ÒINKEJ



Õ&GPCT  X %JT .CIGTOÒP\UV·VVG KP #HTKEC  I 8GPWUMQRH T#GPGCU N VT·IV UGKPGP   8CVGT#PEJKUGUWPFFCU2CNNCFKWO CWUFGODTGPPGPFGP6TQLC $CD$/%%TCYH5GCT 5[F )WVGUUGJTUEJÌP



Õ&GPCT  X %JT .CIGTOÒP\UV·VVG KP #HTKEC  I 8GPWUMQRH T#GPGCU N VT·IV UGKPGP   8CVGT#PEJKUGUWPFFCU2CNNCFKWO CWUFGODTGPPGPFGP6TQLC $CD$/%%TCYH5GCT 5[F 5GJTUEJÌP



8429



8428

8427

8430

8429 1,5:1

Õ&GPCTX%JTURCPKUEJG/ÒP\UV·VVGI-QRHFGT8GPWU)GPGVTKZTFCJKPVGT%WRKFQ 6TQRJ·G FCTWPVGT \YGK ICNNKUEJG )GHCPIGPG $CD  $/%  %TCYH  5GCT  5[F    )WVGUUGJTUEJÌP



Õ&GPCTX%JTURCPKUEJG/ÒP\UV·VVGI-QRHFGT8GPWU)GPGVTKZTFCJKPVGT%WRKFQ 6TQRJ·G FCTWPVGT \YGK ICNNKUEJG )GHCPIGPG $CD  $/%  %TCYH  5GCT  5[F    )WVGUUGJTUEJÌP



&KGUGU 5VÒEM YWTFG \WT $G\CJNWPI FGT 8GVGTCPGP %CGUCTU Y·JTGPF FGU -CORHGU IGIGP FKG 2QORGKCPGTKP5RCPKGP IGRT·IV &KG )GHCPIGPGP CWH FGT 4ÒEMUGKVG UKPF GKPG VTCWGTPFG (TCW WPF GKP IGHGUUGNVGT /CPP FGUUGP -QRH FGO   6[RFGU8GTEKPIGVQTKZGPVURTKEJV



1,5:1



8431 1,5:1

Ô#WTGWU  X %JT 4QO . /WPCVKWU 2NCPEWU  I &TCRKGTVG $ÒUVG FGT 8KEVQTKC T%CRKU   $CD$/%%CNKEQ%TCYHC5GCT5[FC 5GJTUEJÌP 

. /WPCVKWU 2NCPEWU GKPG FGT UEJKNNGTPFUVGP )GUVCNVGP CWU FGT 'PFRJCUG FGT 4GRWDNKM YCT \WP·EJUV GKP GPIGT   8GTVTCWVGT%CGUCTUFGTUGKPG-CTTKGTGHÌTFGTVGWPFKJOCWEJ\WO#OVFGU2TCGHGEVWUWTDKXGTJCNH/KVFKGUGO#OV HKGNKJOCWEJFKG/ÒP\RT·IWPI\WWPFWPVGTUGKPGT2TCGHGEVWTYWTFGKPFGTXQP%CGUCTPGWGKPIGTKEJVGVGP/ÒP\ UV·VVG CO ,CPKEWNWO JGWVG )KCPKEQNQ  WPUGTG /ÒP\G IGRT·IV 0CEJ FGO 6QFG %CGUCTU UEJNWI UKEJ 2NCPEWU CWH FKG   5GKVG FGT /ÌTFGT UGKPGU 9QJNV·VGTU YCPFVG UKEJ CDGT KO ,CJTG  X %JT FGO #PVQPKWU \W &QEJ CWEJ FKGUGP   XGTTKGV GT WPF UEJNWI UKEJ CWH FKG 5GKVG FGU 1EVCXKCPWU 'U YCT . /WPCVKWU 2NCPEWU FGT KO ,CJTG  X %JT KO   5GPCVFKG8GTNGKJWPIFGU6KVGNU#WIWUVWUCP1EVCXKCPWUDGCPVTCIVG

8432

8433

8433 1,5:1





208

“&WRQPFKWUX%JT4QO%%NQXKWUI&TCRKGTVG$ÒUVGFGT8KEVQTKCT/KPGTXCIGJVN OKV6TQRJ·G5RGGTWPF5EJKNFFCXQT5EJNCPIGN$CD$/%%TCYHC5GCT5[F $TCWPG2CVKPCOKPFG\GPVTKGTVIWVGUUGJTUEJÌP



Õ&GPCT  X %JT 4QO . #GOKNKWU $WEC  I -QRH %CGUCTU T OKV -TCP\ N *CNDOQPF   8GPWUUVGJVNOKV8KEVQTKCWPF<GRVGT$CD$/%%TCYH5GCT5[F  445GJTUEJÌP




IMPERATORISCHE PRÄGUNGEN

8434

8435

8435

8434

1,5:1

1,5:1



Õ&GPCTX%JT4QO25GRWNNKWU/CEGTI-QRH%CGUCTUTOKV.QTDGGTMTCP\FCJKPVGT CEJVUVTCJNKIGT 5VGTP8GPWU UVGJV N OKV 8KEVQTKC WPF <GRVGT $CD  $/%  %TCYH  D   5GCTC5[F  4(GKPG2CVKPCMNGKPG2T·IGUEJY·EJGPUQPUVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Õ&GPCTX%JT4QO25GRWNNKWU/CEGTI-QRH%CGUCTUTOKV.QTDGGTMTCP\FCJKPVGT CEJVUVTCJNKIGT 5VGTP8GPWU UVGJV N OKV 8KEVQTKC WPF <GRVGT $CD  $/%  %TCYH  D   5GCTC5[F 4(GKPG2CVKPCUGJTUEJÌP



%CGUCTVT·IVJKGTFKGEQTQPCCWTGCFGU6TKWORJCVQTUYKGDGKO.WRGTECNKGP(GUVX%JT&GT5VGTPKUVCNU<GKEJGP FGUGTYCTVGVGPPGWGP<GKVCNVGTUCP\WUGJGP



8436

8436

8437

8437

1,5:1





1,5:1

Õ&GPCTX%JT4QO25GRWNNKWU/CEGTI-QRH%CGUCTUTOKV.QTDGGTMTCP\FCJKPVGT CEJVUVTCJNKIGT 5VGTP8GPWU UVGJV N OKV 8KEVQTKC WPF <GRVGT $CD  $/%  %TCYH  D   5GCTC5[F 42TÒHRWP\GCWHFGO#XGTUHCUVUGJTUEJÌP



Õ&GPCT  X %JT 4QO . $WEC  I -QRH %CGUCTU T OKV -TCP\(CUEGU WPF IGHNÒIGNVGT   %CFWEGWUIGMTGW\VQDGP)NQDWUN*CPFUEJNCIWPVGP#ZV$CD$/%%TCYH5GCT 5[F 442TÒHRWP\GPCWHFGO#XGTUUGJTUEJÌP



8438





8439

1,5:1

Õ&GPCT   X %JT 4QO 2 5GRWNNKWU /CEGT  I -QRH %CGUCTU T OKV -TCP\8GPWU UVGJV N   OKV8KEVQTKCWPF<GRVGT$CD$/%%TCYH5GCTD5[F  44GRCTKGTVUGJTUEJÌP



Õ&GPCT  X %JT 4QO 2 5GRWNNKWU /CEGT  I -QRH %CGUCTU T OKV -TCP\ WPF 5EJNGKGT   8GPWUUVGJVNOKV8KEVQTKC<GRVGTWPF5EJKNF$CD$/%%TCYH5GCTF5[F 442T·IGUEJY·EJGCO4CPFUGJTUEJÌP



&KGUG'OKUUKQPIGJÌTV\WFGPNGV\VGPXQTFGP+FGPFGU/·T\&GT5EJNGKGTKUVGKP*KPYGKUCWHFCU#OVFGU2QPVKHGZ /CZKOWU

1,5:1



8440

1,5:1

/+WPKWU$TWVWUÕ&GPCTX%JTMNGKPCUKCVKUEJG/ÒP\UV·VVG 5O[TPC! 2%QTPGNKWU.GPVWNWU 5RKPVJGT  I 5KORWNWO \YKUEJGP #ZV WPF /GUUGT-CPPG WPF .KVWWU $CD  $/%  %TCYH   5GCT5[F 4(GKPG2CVKPCUGJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT  209


IMPERATORISCHE PRÄGUNGEN

8442

8441



Õ&GPCT  X %JT N[MKUEJG /ÒP\UV·VVG  I .KDGTVCUMQRH T.[TC \YKUEJGP -ÌEJGT WPF .QT   DGGT\YGKI$CD$/%%TCYH5GCT5[F 4)WVGUUGJTUEJÌP





Õ&GPCT  X %JT .CIGTOÒP\UV·VVG KP -NGKPCUKGP QFGT 0QTFITKGEJGPNCPF .GICV 2GFCPKWU %QUVC    I .')%156# #RQNNQMQRH T OKV .QTDGGTMTCP\+/2$48685 6TQRJ·G $CD  $/%    %TCYH5GCT5[F 445GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



2GFCPKWU%QUVCYCTGKPGTFGT.GICVGPFGU$TWVWUKO-CORHIGIGPFKG6TKWOXKTP

1,5:1



8443

1,5:1

5GZVWU2QORGKWUŎX%JTÕ&GPCTX%JTUK\KNKUEJG/ÒP\UV·VVGI-QRHFGU2QO RGKWU OCIPWU T N %CRKU T .KVWWU0GRVWP UVGJV N \YKUEJGP #PCRKCU WPF #ORJKPQOWU FKG KJTG   'NVGTPVTCIGP$/%$CD%TCYHC5GCT5[F  44*GTTNKEJGU2QTVT·V#XGTUNGKEJVFG\GPVTKGTVMN2T·IGUEJY·EJGP HCUVXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC  &KG $TÒFGT #PCRKCU WPF #ORJKPQOWU JCVVGP KJTG 'NVGTP Y·JTGPF GKPGU #WUDTWEJGU FGU #GVPC KP 5KEJGTJGKV IG   DTCEJV +P FKGUGT 4GXGTUFCTUVGNNWPI YKTF CNUQ RTCMVK\KGTVG 2KGVCU IG\GKIV YCU OKV FGT #PPCJOG FGU 6KVGNU 2KWU   FWTEJ5GZVWU2QORGKWUKP<WUCOOGPJCPIUVGJGPFÒTHVG

8446 1,5:1

8445 1,5:1







Õ&GPCT  X %JT UK\KNKUEJG /ÒP\UV·VVG  I -QRH FGU 2QORGKWU OCIPWU T N %CRKU T   .KVWWU0GRVWP UVGJV N \YKUEJGP #PCRKCU WPF #ORJKPQOWU FKG KJTG 'NVGTP VTCIGP $/%  $CD    %TCYHC5GCT5[F 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVJGTTNKEJGT2CVKPC



Õ&GPCT  X %JT UK\KNKUEJG /ÒP\UV·VVG  I -QRH FGU 2QORGKWU OCIPWU T N %CRKU T   .KVWWU0GRVWP UVGJV N \YKUEJGP #PCRKCU WPF #ORJKPQOWU FKG KJTG 'NVGTP VTCIGP $/%  $CD    %TCYHC5GCT5[F 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&GPCT  X %JT UK\KNKUEJG /ÒP\UV·VVG  I -QRH FGU 2QORGKWU OCIPWU T N %CRKU T   .KVWWU0GRVWP UVGJV N \YKUEJGP #PCRKCU WPF #ORJKPQOWU FKG KJTG 'NVGTP VTCIGP $/%  $CD    %TCYHC5GCT5[F 445GJTUEJÌP



8447



 210

8446

8445

8444

1,5:1

8448

1,5:1

Õ&GPCT  X %JT UK\KNKUEJG /ÒP\UV·VVG  I 2JCTQU XQP /GUUKPC OKV 0GRVWPUVCVWG FCXQT   )CNGGTGOKV.GIKQPUCFNGTKO$WIWPF<GRVGTKO*GEM5E[NNC$CD$/%%TCYHXGTINC 5GCT5[F 45GJTUEJÌP



/CTEWU #PVQPKWU Ŏ  X %JT Õ3WKPCT  X %JT .WIFWPWO  I 8KEVQTKCMQRH OKV FGP   <ÒIGP(WNXKCU! T.ÌYGT$CD$/%%TCYH5GCT5[F 5GJTUEJÌP




IMPERATORISCHE PRÄGUNGEN

8450

8449

1,5:1



8451

1,5:1

Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.')++.GIKQPUCFNGT\YKUEJGP\YGK5VCPFCT VGP$CD$/%%TCYH5GCT5[F  (GKPG2CVKPCHCUVXQT\ÒINKEJIWVGUUGJTUEJÌP



'UFÒTHVGFKG.GIKQ++#WIWUVCIGOGKPVUGKP5KGYCTUR·VGTKP/QIQPVKCEWO /CKP\ UVCVKQPKGTVCDKP)NQXGU

)NQWEGUVGT KP$TKVCPPKGP



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') +++ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F )WVGUUGJTUEJÌP



'UJCPFGNVUKEJYQJNWOFKGNGIKQ+++)CNNKEC



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') +++ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F  -N-TCV\GTWPF2TÒHRWP\GPGVYCU$GNCIUGJTUEJÌP

8452



8453



8454

Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') +8 .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F  2TÒHRWP\GCWHFGO#XGTUUGJTUEJÌP



&KGUG CNVG ECGUCTKUEJG .GIKQP FKGPVG PCEJ FGO $ÒTIGTMTKGI \WP·EJUV KP 5RCPKGP FCPP JCVVG UKG UGKV  P %JT KJT   5VCPFNCIGTKP/CKP\5KGUEJNQ­UKEJ8KVGNNKWUCPWPFYWTFGFGUJCNDXQP8GURCUKCPWUPCEJUGKPGO5KGICWHIGNÌUV



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.')8.GIKQPUCFNGT\YKUEJGP\YGK5VCPFCT VGP$CD$/%%TCYH5GCT5[F  9KP\-TCV\GTCWHFGO#XGTUCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP0#%0<ÒTKEJ0T  &KG .GIKQ 8 #NCWFCG YWTFG XQP %CGUCT CWHIGUVGNNV 7PVGT #WIWUVWU MCO UKG CP FGP 4JGKP WPF YWTFG KP %CUVTC   8GVGTC :CPVGP  UVCVKQPKGTV 5KG UEJNQ­ UKEJ 8KVGNNKWU CP 0CEJ FGT 0KGFGTNCIG IGIGP 8GURCUKCP YWTFG UKG PCEJ   /QGUKGPIGUEJKEMVYQUKGKPGKPGOHTÒJGP&CMGTMTKGIWPVGTIKPI



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.')8.GIKQPUCFNGT\YKUEJGP\YGK5VCPFCT VGP$CD$/%%TCYH5GCT5[F  9KP\2WP\GPCWHFGO#XGTUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC

1,5:1



8455

1,5:1



8456

Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') 8+ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F  #VVTCMVKXGU'ZGORNCTOKVHGKPGT6ÌPWPIIWVGUUGJTUEJÌP



#WU GKPGT CNVGP .GIKQ 8+ %CGUCTU IKPIGP \YGK .GIKQPGP JGTXQT FKG .GIKQ 8+ (GTTCVC CWH FGT 5GKVG FGU /CTEWU   #PVQPKWU WPF FKG XQP 1EVCXKCP CWHIGUVGNNVG .GIKQ 8+ 8KEVTKZ UR·VGT W C KP 0QXCGUKWO0GWUU WPF %CUVTC 8G   VGTC:CPVGPUVCVKQPKGTV 



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') 8++ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$/%%TCYH5GCT5[F 2TÒHRWP\GPCWHFGO#XGTUUGJTUEJÌP



&KG .GIKQ 8++ %NCWFKC YCT WPVGT %CGUCT KP )CNNKGP UVCVKQPKGTV WPF YWTFG PCEJ FGO $ÒTIGTMTKGI PCEJ /QGUKGP   XGTNGIVYQKJT#D\GKEJGPFGT5VKGTPQEJKO,CJTJWPFGTVCWH/ÒP\GPXQP8KOKPCEKWOGTUEJGKPV

211


IMPERATORISCHE PRÄGUNGEN

8457

8459

1,5:1







8458

1,5:1

Õ&GPCT  X %JT 2CVTCU !   I )CNGGTGT.')8+++.GIKQPUCFNGT\YKUEJGP\YGK5VCP FCTVGP$CD$/%%TCYH5GCT5[F  4GXGTUGVYCUFG\GPVTKGTVUQPUVIWVGUUGJTUEJÌP



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') +: .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F  2TÒHRWP\GCWHFGO#XGTUUGJTUEJÌP



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.'):.GIKQPUCFNGT\YKUEJGP\YGK5VCPFCT VGP$CD$/%%TCYH5GCT5[F )WVGUUGJTUEJÌP



&KG.GIKQ:YWTFGWTURTÒPINKEJX%JTCWHIGUVGNNVWPFYCTFKG.KGDNKPIUNGIKQP%CGUCTUX%JTYWTFGUKG GTPGWV CWHIGUVGNNV WPF YCT PCEJ FGO $ÒTIGTMTKGI \WP·EJUV KP *KURCPKC WNVGTKQT UVCVKQPKGTV IGNCPIVG KP PGTQPKUEJGT   <GKV PCEJ %CTPWPVWO YWTFG CDGT  P %JT YKGFGT PCEJ 5RCPKGP IGUCPFV YQ UKG KO ,CJT  HÒT 8KVGNNKWU 2CTVGK   GTITKHH 5EJNKG­NKEJ YWTFG UKG CWEJ PQEJ KP *CTGPCVKWO 4KPFGTP  0QXKQOCIWU $CVCXQTWO 0KLOGIGP  #SWKPEWO  

$WFCRGUV WPFUEJNKG­NKEJ8KPFQDQPC 9KGP UVCVKQPKGTV

8461

8460



8462

Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :+ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F  4GXGTUNGKEJVFG\GPVTKGTVUGJTUEJÌP



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :++ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F  2TÒHRWP\GCWHFGO#XGTUUGJTUEJÌP



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.'):++#06+37#'.GIKQPUCFNGT\YKUEJGP \YGK5VCPFCTVGP$CD$/%%TCYH5GCT5[F 5GJTUEJÌP



&KG.GIKQ:+YWTFGX%JTXQP%CGUCTCWHIGUVGNNVFGTX%JTFKG8GVGTCPGPGPVNKG­WPFKP$QXKCPWOCPUKG FGNVG1EVCXKCPUVGNNVGFKG.GIKQPGTPGWVCWH



&KG \YÌNHVG .GIKQP YCT KO 1UVGP UVCVKQPKGTV \WP·EJUV KP I[RVGP FCPP KP 5[TKGP CD FGO ,CJTG  P %JT KP   -CRRCFQMKGP ªDGT FKGUG .GIKQP DGTKEJVGV CWEJ FKG EJTKUVNKEJG .GIGPFG KO -TKGI FGU /CTEWU #WTGNKWU OKV FGP   3WCFGP IGTKGV FCU TÌOKUEJG *GGT KP GKPG 0QVNCIG CNU DGK ITQ­GT *KV\G FCU 6TKPMYCUUGT MPCRR YWTFG &KG #TOGG   YWTFG FWTEJ GKP RNÌV\NKEJGU )GYKVVGT IGTGVVGV WPF DGUKGIVG FKG (GKPFG XQNNUV·PFKI &CU )GYKVVGT UQNN FWTEJ FKG   )GDGVGFGTEJTKUVNKEJGP\YÌNHVGP.GIKQPJGTXQTIGTWHGPYQTFGPUGKP5QFGWVGV\WOKPFGUV'WUGDKWU JKUVGEEN8  FCU4GIGPYWPFGTFGT3WCFGPUEJNCEJV



1,5:1



8463

1,5:1

Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :+++ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[FC  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC &KG.GIKQ:+++YWTFGX%JTXQP%CGUCTCWUIGJQDGP5KGM·ORHVGKO)CNNKUEJGP-TKGI WCDGK)GTIQXKC #O  ,CPWCT  X %JT ÒDGTUEJTKVV %CGUCT OKV FKGUGT .GIKQP FGP 4WDKEQP  UKG DNKGD KJO Y·JTGPF FGU IGUCOVGP   $ÒTIGTMTKGIGUVTGWWPFM·ORHVGWCDGK&[TTJCEJKWO2JCTUCNQU6JCRUWUWPF/WPFC0CEJ/WPFCNÌUVG%CGUCT FKG .GIKQP CWH #WIWUVWU UVGNNVG UKG LGFQEJ  X %JT GTPGWV HÒT FGP -CORH IGIGP 5GZVWU 2QORGKWU CWH +P FGT   -CKUGT\GKVYCTUKGKP$WTPWO -PKP 'OQPC .LWDNLCPC #WIWUVC8KPFGNKEQTWO #WIUDWTI 2QGVQXKQ 2VWL 8KP FQDQPC 9KGP WPF#RWNWO -CTNUDWTI UVCVKQPKGTV

212




IMPERATORISCHE PRÄGUNGEN

8464





8465

8466

8467

Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :+++ .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[FC  2TÒHRWP\GWPF)TCHHKVKCWHFGO#XGTUUGJTUEJÌPHCUVUGJTUEJÌP



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.'):+8.GIKQPUCFNGT\YKUEJGP\YGK5VCP FCTVGP$CD$/%%TCYH5GCT5[F  (GKPG6ÌPWPI4GXGTUNGKEJVFG\GPVTKGTVIWVGUUGJTUEJÌP



&KG.GIKQ:+8YWTFGX%JTXQP#WIWUVWUCWHIGUVGNNV5KGYCTUGKVP%JTKP/QIWPVKCEWO /CKP\ UVCVKQ PKGTV WPF M·ORHVG UR·VGT WPVGT %NCWFKWU KP $TKVCPPKGP YQ UKG  QFGT  P %JT JCNH $QWFKEEC PKGFGT\WYGTHGP   5R·VGT YCT FKG .GIKQP W C KP 8KPFQDQPC 9KGP  WPF %CTPWPVWO UVCVKQPKGTV 5KG YCT CP FGP 7UWTRCVKQPGP FGU   5CVWTPKPWUWPF4GICNKCPWUDGVGKNKIV



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :8 .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F 5GJTUEJÌP



&KG.GIKQ:8XQP1EVCXKCPWUIGITÒPFGVYCTPCEJFGO$ÒTIGTMTKGIKP+NN[TKGPUVCVKQPKGTV



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.'):8+.GIKQPUCFNGT\YKUEJGP\YGK5VCP FCTVGP$CD$/%%TCYH5GCT5[F 5GJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  &KG.GIKQ:8+YCTDKU\WO,CJTGKP/QIWPVKCEWO /CKP\ UVCVKQPKGTVUKGYWTFGFCPPKPFCUPKGFGTTJGKPKUEJG *GGTGKPIGTGKJV

8468



8469

8470

8471

Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :8++ %.#55+%#' .GIKQPUCFNGT \YK   UEJGP\YGK5VCPFCTVGP$CD$/%%TCYH5GCT5[F  2TÒHRWP\GPCWHFGO#XGTUHCUVUGJTUEJÌP



&KG .GIKQ :8++ YWTFG XQP 1EVCXKCP YKGFGT CWHIGUVGNNV WPF  X %JT CP FGP 4JGKP XGTNGIV +O ,CJTG  P %JT   IKPIUKGKPFGT8CTWUUEJNCEJVWPVGT





Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.'):8++.GIKQPUCFNGT\YKUEJGP\YGK5VCP FCTVGP$CD$/%%TCYH5GCT5[F  -N-TCV\GTUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.'):8+++.;$+%#'.GIKQPUCFNGT\YKUEJGP \YGK5VCPFCTVGP$CD$/%%TCYH5GCT5[F  -N2TÒHRWP\GCWHFGO#XGTUHCUVUGJTUEJÌP



&KG .GIKQ :8+++ IKPI KO ,CJTG  P %JT KP FGT 8CTWUUEJNCEJV KP -CNMTKGUG DGK 1UPCDTÒEM WPVGT &KGUG 5EJNCEJV   XGTNQT 2 3WKPEVKNKWU 8CTWU IGIGP GKPG -QCNKVKQP IGTOCPKUEJGT 5V·OOG WPVGT FGT (ÒJTWPI FGU %JGTWUMGTHÒTUVGP   #TOKPKWUGVYCTÌOKUEJG5QNFCVGPHCPFGPFGP6QF<WFGP6QVGPIGJÌTVGCWEJ/%CGNKWUGKP%GPVWTKQFGT  .GIKQPFGUUGPKP:CPVGPIGHWPFGPGT)TCDUVGKPDKUJGWVGFGPGKP\KIGPGRKITCRJKUEJGP$GNGIHÒTFKG8CTWUMCVC UVTQRJGFCTUVGNNV  &GP#FNGTFGT.GIKQ:8+++MQPPVGPTÌOKUEJG6TWRRGPGKPKIG,CJTGUR·VGTGPVYGFGTXQPFGP/CTUGTP 6CE#PP++  QFGTFGP%JCWMGTP %CUU&KQ.: \WTÒEMIGYKPPGP



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :8+++ .GIKQPUCFNGT \YKUEJGP \YGK   5VCPFCTVGP$CD$/%%TCYH5GCT5[F (CUVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

213


IMPERATORISCHE PRÄGUNGEN

8473

8472



8474

8476

8475

Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.'):+:.GIKQPUCFNGT\YKUEJGP\YGK5VCPFCT VGP$CD$/%%TCYH5GCT5[F  2TÒHRWP\GCWHFGT4ÒEMUGKVGUGJTUEJÌP



&KG .GIKQ :+: IKPI KP FGT 8CTWUUEJNCEJV KO ,CJTG  P %JTWPVGT&GP#FNGTFGT.GIKQPMQPPVGUR·VGTGKPGXQP )GTOCPKEWUIGIGPFKG$TWEVGTGTIGUCPFVGNGKEJVG*GGTGUCDVGKNWPIWPVGT.5VGTVKPKWU\WTÒEMIGYKPPGP



Õ&GPCT  X %JT 2CVTCU !   I )CNGGTG T.') :: .GIKQPUCFNGT \YKUEJGP \YGK 5VCP   FCTVGP$CD$/%%TCYH5GCT5[F 5GJTUEJÌP



&KG.GIKQ::YKTFXQP1EVCXKCPYKGFGTGTTKEJVGV0CEJFGT8CTWUUEJNCEJVYKTFUKG\WGTUVPCEJ1RRKFWO7DKQTWO FGOUR·VGTGP%QNQPKC#ITKRRKPC -ÌNP FCPPPCEJ0QXCGUKWO 0GW­ XGTNGIV#DP%JTKUVUKGKP$TKVCPPKGP \WHKPFGP



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.')::+.GIKQPUCFNGT\YKUEJGP\YGK5VCP FCTVGP$CD$/%%TCYH5GCT5[F  #XGTUGVYCUFG\GPVTKGTVNGKEJVMQTTQFKGTVUQPUVHCUVXQT\ÒINKEJ



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.')::++.GIKQPUCFNGT\YKUEJGP\YGK5VCP FCTVGP$CD$/%%TCYH5GCT5[F (CUVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



&KG .GIKQ ::++ &GKCVQTKCPC DGUVCPF \WP·EJUV CWU FGP 4GUVGP GKPGT WTURTÒPINKEJ  /CPP UVCTMGP #TOGG FGU   ICNCVKUEJGP -ÌPKIU &GKQVCTWU #WIWUVWU XGTNGIVG FKG .GIKQP PCEJ I[RVGP 5KG YWTFG OÌINKEJGTYGKUG KO $CT   -QEJDC#WHUVCPFXGTPKEJVGV



Õ&GPCTX%JT2CVTCU ! I)CNGGTGT.')::+++.GIKQPUCFNGT\YKUEJGP\YGK5VCP FCTVGP$CD$/%%TCYH5GCT5[F 5GJTUEJÌP

8477

1,5:1





8478

1,5:1

Õ&GPCT  X %JT #EVKWO & 6WTWNNKWU  I -QRH T+O .QTDGGTMTCP\ 8KEVQTKC UVGJV N OKV   -TCP\WPF2CNO\YGKITWPVGP/QPQITCOOFGU6WTWNNKWU$CD$/%%TCYH5GCT 5[F 445GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI



&KGUGNGV\VG'OKUUKQPXQP2QTVT·VFGPCTGPFGU/CTEWU#PVQPKWUNKG­&6WTWNNKWUDGK#EVKWOUEJNCIGP6WTWNNKWUYCT GKPGT FGT DGKFGP \W FKGUGO <GKVRWPMV PQEJ NGDGPFGP %CGUCTOÌTFGT 0CEJ #EVKWO YWTFG GT XQP 1EVCXKCPWU IGHCP   IGPIGPQOOGPWPF\WT*KPTKEJVWPIPCEJ-QUIGDTCEJVYQGTGKPKIG,CJTGXQTJGTWPVGTFGO-QOOCPFQFGU%CUUKWU .QPIKPWU FGO #UMNGRKQU IGYGKJVG $·WOG JCVVG H·NNGP NCUUGP /KV UGKPGO 6QF YWTFG UQOKV UQYQJN FKG 'TOQTFWPI   %CGUCTUCNUCWEJFGT(TGXGNIGUÒJPV



Õ&GPCT  X %JT #EVKWO & 6WTWNNKWU  I -QRH T+O .QTDGGTMTCP\ 8KEVQTKC UVGJV N OKV   -TCP\WPF2CNO\YGKITWPVGP/QPQITCOOFGU6WTWNNKWU$CD$/%%TCYH5GCT 5[F 445GJTUEJÌP

1,5:1



214

8479



1,5:1

WPF%,WNKWU%CGUCTÕ&GPCTX%JT.CIGTOÒP\UV·VVGKPFGT)CNNKC%KUCNRKPCI-QRH FGU/CTEWU#PVQPKWUTFCJKPVGT.KVWWU-QRH%CGUCTUTOKV-TCP\FCJKPVGT%CRKU$CD$/% %TCYH5GCT5[FC 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT




IMPERATORISCHE PRÄGUNGEN

8481

8480

1,5:1



8482

1,5:1

WPF1EVCXKCPWUÕ&GPCTX%JT'RJGUWU/$CTDCVKWUI$GKFGTUGKVU-QRHT$CD $/%%TCYH5GCT5[F #VVTCMVKXGU'ZGORNCTUGJTUEJÌP



&GT/ÒP\OGKUVGTVT·IVFGPWPIGYÌJPNKEJGP6KVGN32 SWCGUVQTRTQRTCGVQTG 



Õ&GPCTX%JT'RJGUWU/$CTDCVKWUI$GKFGTUGKVU-QRHT$CD$/%%TCYH 5GCT5[F 4GXGTUNGKEJVFG\GPVTKGTVHGKPG6ÌPWPIIWVGUUGJTUEJÌP





Õ&GPCTX%JT'RJGUWU/$CTDCVKWUI$GKFGTUGKVU-QRHT$CD$/%XGTIN %TCYH5GCT5[F 5GJTUEJÌP



8CTKCPVGOKV  4#4$#6  &GT/ÒP\OGKUVGTVT·IVFGPWPIGYÌJPNKEJGP6KVGN32 SWCGUVQTRTQRTCGVQTG 

1,5:1



8483

1,5:1

Õ&GPCT  X %JT .CIGTOÒP\UV·VVGKP-NGKPCUKGP .)GNNKWU2QRNKEQNCI-QRHFGU/CTEWU #PVQPKWU T FCJKPVGT %CRKU-QRH FGU 1EVCXKCPWU T FCJKPVGT .KVWWU $CD  $/%  %TCYH   5GCT5[F 44#VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  . )GNNKWU 2QRNKEQNC UVCPF KO $ÒTIGTMTKGI \WP·EJUV CWH FGT 5GKVG FGT %CGUCTOÌTFGT NKGH CDGT \W /CTEWU #PVQPKWU   ÒDGT +O ,CJT  X %JT YCT GT %QPUWN $GK #EVKWO MQOOCPFKGTVG GT FGP TGEJVGP (NÒIGN FGT (NQVVG FGU /CTEWU   #PVQPKWU

8484



WPF1EVCXKC“&WRQPFKWUX%JTITKGEJKUEJG/ÒP\UV·VVG 2KT·WU! /1RRKWU%CRKVQI $GKFGT$ÒUVGPGKPCPFGTIGIGPÒDGT<YGK)CNGGTGPPGDGPGKPCPFGTTFCTÒDGT2KNGKFGT&KQUMWTGP$CD $/%HH42%5GCT5[F 8QPITQ­GT5GNVGPJGKV5EJÌPUGJTUEJÌP



'ZGORNCTFGT#WMVKQP6JG0GY;QTMUCNG:+80GY;QTM0T

1,5:1



8485

1,5:1

 WPF -NGQRCVTC Õ&GPCT  X %JT #NGZCPFTKC  I -QRH T FCJKPVGT CTOGPKUEJG 6KCTC   &TCRKGTVG$ÒUVGTOKV&KCFGOFCXQT2TQTC$CD$/%%TCYH5GCT5[F 445GJTUEJÌP  -NGQRCVTC8++FKGNGV\VG-ÌPKIKPI[RVGPUWPFFKG)GNKGDVGFGU/CTEWU#PVQPKWUVT·IVCWHFKGUGO5VÒEMFGP6KVGN -ÌPKIKPFGT-ÌPKIG&KGUGT6KVGNFGTFGO-CKUGTVKVGNGPVURTKEJVWPFFGPXQTJGTGKIGPVNKEJPWTFKG#EJCGOGPKFGP IGVTCIGP JCVVGP YWTFG -NGQRCVTC YGPKIG 6CIG PCEJ FGO IGYCNVKIGP 6TKWORJ\WI CPN·­NKEJ FGU 5KGIGU ÒDGT #TOG   PKGP FGT \WT ITQ­GP 'PVTÒUVWPI FGT 4ÌOGT KP #NGZCPFTKC UVCVVHCPF XQP /CTEWU #PVQPKWU XGTNKGJGP #WEJ FKG   -KPFGT FGT -NGQRCVTC YWTFGP DGK FKGUGT )GNGIGPJGKV \W -ÌPKIGP GTJQDGP FKGU YKTF CWEJ CWH FGT /ÒP\G GTY·JPV   &KG2TQTCCWHFGO4GXGTUXGTYGKUVCWHFKG<WUV·PFKIMGKVFGT-NGQRCVTCHÒTFCU(NQVVGPDCWRTQITCOOFGU#PVQPKWU  X %JT Y·JNVG -NGQRCVTC 8++ FGP (TGKVQF FWTEJ )KHV LGFQEJ YKG %JTKUVQRJ 5EJ·HGT PCEJIGYKGUGP JCV PKEJV   FWTEJ FGP $K­ GKPGT )KHVUEJNCPIG  WO PKEJV KO 6TKWORJ\WI 1EVCXKCPU OKVIGHÒJTV \W YGTFGP -NGQRCVTC JCVVG XGT   CPNC­V FC­ KJT .GKDCT\V 1N[ORQU FKG .GIGPFG XGTDTGKVGVG UKG UGK FWTEJ FGP $K­ GKPGT -QDTC IGUVQTDGP WO UQ CNU   0GC+UKUXGTGJTV\WYGTFGP<WO6QFFGT-NGQRCVTCUKGJG5EJ·HGT%JTKUVQRJ-NGQRCVTC&CTOUVCFV5HH

215


IMPERATORISCHE PRÄGUNGEN

8486

1,5:1



8487

8488

1,5:1

/#GOKNKWU.GRKFWUŎX%JTWPF1EVCXKCPWUÕ&GPCTX%JTKVCNKUEJG.CIGTOÒP\UV·VVG  I -QRH FGU .GRKFWU T-QRH FGU 1EVCXKCPWU T $CD  $/%  %TCYH  C 5GCT    5[F 8QPITQ­GT5GNVGPJGKV5GJTUEJÌP  &C/CTE#PVQPU0COGHGJNVKUVCWEJUEJQPGKPGUR·VGTG&CVKGTWPIWPFGKPGCHTKMCPKUEJG/ÒP\UV·VVGXQTIGUEJNCIGP YQTFGP



Õ&GPCTX%JTKVCNKUEJG.CIGTOÒP\UV·VVGI-QRHFGU.GRKFWUT-QRHFGU1EVCXKCPWUT $CD$/%%TCYHC5GCT5[F 8QPITQ­GT5GNVGPJGKV5EJÌPpUGJTUEJÌP



&C/CTE#PVQPU0COGHGJNVKUVCWEJUEJQPGKPGUR·VGTG&CVKGTWPIWPFGKPGCHTKMCPKUEJG/ÒP\UV·VVGXQTIGUEJNCIGP YQTFGP



1EVCXKCPWUÕ&GPCTX%JTKVCNKUEJG/ÒP\UV·VVG.%QTPGNKWU$CNDWUI-QRHT-GWNG $CD$/%%TCYH5GCT5[FC  4#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPC(CUVXQT\ÒINKEJIWVGUUGJTUEJÌP

8489



8490



8491

Õ&GPCT  X %JT KVCNKUEJG /ÒP\UV·VVG  I -QRH T8KGTU·WNKIGT 6GORGN FGU&KXWU,WNKWUX X FCTKP 5VCVWG FGU &KXWU ,WNKWU KO 2GFKOGPV -QOGV UKFWU +WNKWO  N #NVCT $CD  $/%    %TCYH5GCT5[F 5GJTUEJÌP



&GTCWHFGO4GXGTUFCTIGUVGNNVG6GORGNYCT\WT<GKVFGT2T·IWPIFGT/ÒP\GPQEJPKEJVHGTVKIIGUVGNNV&GT-QOGV KO2GFKOGPVFGU6GORNWO&KXK+WNKKUVFGTUKFWU,WNKWUªDGTFKGUGP-QOGVGPUEJTGKDV2NKPKWU PCV++ 0WTCP GKPGO GKP\KIGP 1TV FGT 'TFG P·ONKEJ KP 4QO YKTF GKP -QOGV KP GKPGO 6GORGN XGTGJTV YGKN KJP FGT &KXWU #W   IWUVWU CNU UGJT IÒPUVKIGU <GKEJGP HÒT UKEJ GTMN·TVG 'T VTCV P·ONKEJ \W $GIKPP UGKPGT 4GIKGTWPI KP 'TUEJGKPWPI   Y·JTGPFFGT5RKGNGFKGGT\W'JTGPFGT8GPWU)GPGVTKZMWT\PCEJFGO6QFGUGKPGU8CVGTU%CGUCTKPFGOPQEJXQP FKGUGOGKPIGUGV\VGP-QNNGIKWOCDJKGNV/KVHQNIGPFGP9QTVGP·W­GTVGGTFCTÒDGTUGKPG(TGWFG)GTCFGCPFGP 6CIGPOGKPGT5RKGNGYWTFGGKP*CCTUVGTPUKGDGP6CIGNCPICOPÌTFNKEJGP6GKNFGU*KOOGNUGTDNKEMVGTIKPIWOFKG GNHVG 6CIGUUVWPFG CWH YCT UGJT NGWEJVGPF WPF KP CNNGP .·PFGTP UKEJVDCT &CU 8QNM INCWDVG FWTEJ FKGUGP 5VGTP   YGTFG FKG #WHPCJOG FGT 5GGNG %CGUCTU WPVGT FKG WPUVGTDNKEJGP )ÌVVGT CPIG\GKIV WO FGUUGPVYKNNGP YWTFG FKGUGU   5VGTP\GKEJGPCO#DDKNFUGKPGU-QRHGUCPIGDTCEJVFCUUR·VGTCWHFGO(QTWOIGYGKJVYWTFG 5QURTCEJGTUKEJ ÌHHGPVNKEJCWUKPUGKPGO+PPGTPCDGTYCTGTOKV(TGWFGÒDGT\GWIVFC­FGT5VGTPHÒTKJPCWHIGICPIGPUGKWPFFC­GT OKVKJOCWHIGJGWPF\YCTYGPPYKTFKG9CJTJGKVUCIGPYQNNGP\WO*GKNGFGT9GNV





Õ&GPCT  X %JT KVCNKUEJG /ÒP\UV·VVG  I -QRH T8KGTU·WNKIGT 6GORGN FGU&KXWU,WNKWUX X FCTKP 5VCVWG FGU &KXWU ,WNKWU KO 2GFKOGPV -QOGV UKFWU +WNKWO  N #NVCT $CD  $/%    %TCYH5GCT5[F 5GJTUEJÌP



Õ&GPCT  X %JT KVCNKUEJG /ÒP\UV·VVG  I -QRH T8KGTU·WNKIGT 6GORGN FGU&KXWU,WNKWUX X FCTKP 5VCVWG FGU &KXWU ,WNKWU KO 2GFKOGPV -QOGV UKFWU +WNKWO  N #NVCT $CD  $/%    %TCYH5GCT5[F 2TÒHRWP\GCWHFGO#XGTUHCUVUGJTUEJÌP



1,5:1



8492

1,5:1

Õ&GPCTX%JTKVCNKUEJG/ÒP\UV·VVGI-QRHT/GTEWTUKV\VTCWH(GNUGPOKV2GVCUWU WPF.[TC$/%%QJ4+%w 4#VVTCMVKXGU'ZGORNCTIWVGUUGJTUEJÌP <W &CVKGTWPI WPF 4GXGTUFCTUVGNNWPI UKGJG 5GCT 6JG *KUVQT[ CPF %QKPCIG QH VJG 4QOCP +ORGTCVQTU  $%   .QPFQP0T

216




RÖMISCHE KAISERZEIT

8493

8494

8494



Õ&GPCTX%JTKVCNKUEJG/ÒP\UV·VVGI-QRHT/GTEWTUKV\VTCWH(GNUGPOKV2GVCUWU WPF.[TC$/%%QJ4+%w 45GJTUEJÌP





WPF&KXWU,WNKWU%CGUCT“&WRQPFKWUWOX%JT8KGPPCI-QRH%CGUCTUNWPF-QRH 1EVCXKCPUT2TQTCT42%5GCT $TCWPG2CVKPCMN4CPFCWUDTWEJUGJTUEJÌP



8496

8495 8496 1,5:1

/ª0<'0&'44¤/+5%*'0-#+5'4<'+6 

#WIWUVWUXP%JTÕ&GPCTX%JTWPDGUVKOOVGKVCNKUEJG/ÒP\UV·VVGI8KEVQTKC OKV-TCP\WPF<YGKICWH2TQTCT-CKUGTKP3WCFTKICTOKV<YGKI$/%%QJ4+%w  4/KPMQTTQFKGTVHCUVUGJTUEJÌP <WT&CVKGTWPIUKGJG5GCT6JG%QKPCIGQHVJG4QOCP+ORGTCVQTU$%.QPFQP0T &KG8QTFGTUGKVGDG\KGJVUKEJCWHFGP5KGIDGK#EVKWOFGT4GXGTUCWHUKGITGKEJGP'KP\WIKP#NGZCPFTKC







Õ&GPCTX%JTKVCNKUEJG/ÒP\UV·VVGI-QRHT(TQPVCNCPUKEJVFGT%WTKC,WNKC$/% %QJ4+%w #XGTUNGKEJVFG\GPVTKGTVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



<WT &CVKGTWPI UKGJG 5GCT 6JG *KUVQT[ CPF %QKPCIG QH VJG 4QOCP +ORGTCVQTU  $% .QPFQP  0T    &KG %WTKC *QUVKNKC YCT  X %JT CDIGDTCPPV CNU FKG .GKEJG FGU 2 %NQFKWU 2WNEJGT XGTDTCPPV YWTFG %CGUCT   HKPCP\KGTVGFKGPGWG%WTKC,WNKCFKGX%JTFWTEJ#WIWUVWUGKPIGYGKJVYWTFG

8498

8497 8497 1,5:1





Õ&GPCTX%JTKVCNKUEJG/ÒP\UV·VVGI$ÒUVGFGU#WIWUVWUCNU6GTOKPWUTOKV.QTDGGT MTCP\FCJKPVGT$NKV\-CKUGTUKV\VNOKV8KEVQTKCCWHEWTWNKUEJGO5VWJN$/%%QJ4+%w 4GXGTUGVYCUFG\GPVTKGTVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Õ&GPCT  X %JT KVCNKUEJG /ÒP\UV·VVG  I -QRH T OKV .QTDGGTMTCP\5VCPFDKNF CWH   4QUVTCNU·WNG$/%%QJ4+%w 5GJTUEJÌP



<WT&CVKGTWPIUKGJG5GCT6JG%QKPCIGQHVJG4QOCP+ORGTCVQTU$%.QPFQP0T  +O4+%YKTFFKG8QTFGTUGKVGCNU#RQNNQMQRHDGUEJTKGDGPCDGTFKGJPNKEJMGKVOKVFGOINGKEJ\GKVKIGP#WIWUVWURQT VT·VKUVUQITQ­FC­JÌEJUVGPU#WIWUVWUCNU#RQNNQFCTIGUVGNNVUGKPMCPP&CMGKPG7OUEJTKHVXQTJCPFGPKUVOW­FKG $GXÌNMGTWPIFCOCNUFGP-QRHCNUFGPFGU#WIWUVWUCPIGUGJGPJCDGP

1,5:1



8499

1,5:1

Õ3WKPCTX%JTKVCNKUEJG/ÒP\UV·VVGI-QRHT8KEVQTKCUVGJVNOKV-TCP\WPF2CNO \YGKICWH%KUVCO[UVKEC\YKUEJGP\YGK5EJNCPIGP$/%%QJ4+%w  #VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP

 217


RÖMISCHE KAISERZEIT

8500

8501

1,5:1



1,5:1

Õ&GPCT  X %JT KVCNKUEJG /ÒP\UV·VVG  I -QRH N FCJKPVGT .KVWWU#');261%#26#   -TQMQFKNT$/%%QJ4+%wD 44.GKEJVMQTTQFKGTVGVYCURQTÌUGT5EJTÌVNKPIUGJTUEJÌP



&CU 5VÒEM HGKGTV FKG 'TQDGTWPI I[RVGPU <W FKGUGT <GKV ICD GU PQEJ -TQMQFKNG KO 0KN  UKG MQOOGP JGWVG KP   I[RVGP CW­GTKO0CUUGT5VCWUGG PKEJVOGJTXQT-TQMQFKNGOÒUUGPHÒTFKG4ÌOGTCDGTUEJQPGKPUGNVGPGU-WTKQ UWOIGYGUGPUGKPUQPUVY·TGFCU$KNFPKEJVCWHFKG/ÒP\GIGUGV\VYQTFGP



Õ&GPCTX%JT'OGTKVC2%CTKUKWUI-QRHT5VCFVOCWGTFCTCWH'/'4+6#$/% %QJ4+%wC 44(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌP

8502



8503 8502 1,5:1



Õ&GPCTX%JT%QNQPKC2CVTKEKC ! I-QRHN5GEJUU·WNKIGT6GORGNFGU,WRKVGT6QPCPU XXFCTKPUVGJV,WRKVGTNOKV$NKV\WPF<GRVGT$/%#PO%QJ4+%w  44*ÒDUEJG2CVKPCYKP\-TCV\GTCWHFGO4GXGTUUGJTUEJÌPpXQT\ÒINKEJ



#WIWUVWUJCVVGX%JTFGP$CWFGU6GORGNUIGNQDVCO5GRVGODGTX%JTYWTFGFCU*GKNKIVWOIGYGKJV



Õ&GPCTX%JT%QNQPKC2CVTKEKC ! I-QRHN5GEJUU·WNKIGT6GORGNFGU,WRKVGT6QPCPU XXFCTKPUVGJV,WRKVGTNOKV$NKV\WPF<GRVGT$/%#PO%QJ4+%w  44-N2WP\GPCWHFGO#XGTUUGJTUEJÌP

8505

8504

1,5:1







8506

1,5:1

Õ&GPCTX%JT %QNQPKC2CVTKEKC! I-QRHTOKV.QTDGGTMTCP\8KGTU·WNKIGT6GORGNFGU /CTU7NVQTFCTKPUVGJV/CTUNOKV.GIKQPUCFNGTWPF6TQRJ·G$/%%QJ4+%wC  5GJTUEJÌP Õ&GPCTX%JT%QNQPKC2CVTKEKC ! I-QRHT1$%+8+55'48#615KP-TCP\ EQTQPC EKXKEC $/%%QJ4+%wC 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI

 

&KGEQTQPCEKXKEC HÒTFKG'TTGVVWPIXQP$ÒTIGTP YWTFG#WIWUVWUKO,CJTFWTEJ5GPCVUDGUEJNW­\WGTMCPPV TGU IGUVCG8+ 'UJCPFGNVUKEJIGYKUUGTOC­GPWOFGPJÌEJUVGP1TFGP4QOU

 218

Õ&GPCTX%JT%QNQPKC2CVTKEKC ! I-QRHT1$%+8+55'48#615KP-TCP\ EQTQPC EKXKEC $/%%QJ4+%wC 5GJTUEJÌP




RÖMISCHE KAISERZEIT

8507

1,5:1



1,5:1

Õ&GPCT  X %JT 4QO 2 2GVTQPKWU 6WTRKNKCPWU  I (GTQPKCDÒUVG T-PKGPFGT 2CTVJGT T   RT·UGPVKGTV5VCPFCTVG$/%%QJ4+%w 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



&KGXQP%TCUUWUX%JTCPFKG2CTVJGTXGTNQTGPGP(GNF\GKEJGPJCDGPFKG4ÌOGTX%JTCWHFKRNQOCVKUEJGO 9GIG \WTÒEMIGYKPPGP MÌPPGP /KV FGO KJO GKIGPGP TQDWUVGP 5GNDUVDGYW­VUGKP UVGNNVG #WIWUVWU FKGU KP UGKPGO   6CVGPDGTKEJV   UQ FCT &KG 2CTVJGT JCDG KEJ IG\YWPIGP FKG $GWVG WPF (GNF\GKEJGP FTGKGT TÌOKUEJGT *GGTG   \WTÒEM\WIGDGPWPFFKG(TGWPFUEJCHVFGU4ÌOKUEJGP8QNMGU\WGTHNGJGP

8509

8508



8510

8511

Õ&GPCT  X %JT4QO 22GVTQPKWU6WTRKNKCPWUI.KDGTMQRHTOKV'HGWMTCP\-CKUGTKP 'NGHCPVGPDKICNOKV.QTDGGT\YGKIWPF<GRVGT$/%#PO%QJ4+%w  8QPITQ­GT5GNVGPJGKV-N-TCV\GTCWHFGO#XGTUNGKEJVMQTTQFKGTVUGJTUEJÌP



&KG 4GXGTUFCTUVGNNWPI XGTYGKUV CWH FKG 5KGIJCHVKIMGKV FGU #WIWUVWU &KG 5KGIGUU[ODQNKM FÒTHVG UKEJ CDGT CWH FKG   URCPKUEJGP 5KGIG #ITKRRCU WPF FKG 4ÒEMICDG FGT (GNF\GKEJGP CWU FGP 2CTVJGTMTKGIGP DG\KGJGP 5KGJG 9KGIGNU   3WQF XKCG OWPKVCG UWPV  *KUVQTKUEJG #POGTMWPIGP \W GKPGO #WTGWU CWU -CNMTKGUG KP 9KGIGNU 4 *TUI  &KG   (WPFOÒP\GPXQP-CNMTKGUGWPFFKGHTÒJMCKUGT\GKVNKEJG/ÒP\RT·IWPI/ÌJPGUGG5



Õ&GPCTX%JT4QO34WUVKWUI$ÒUVGPFGT(QTVWPC8KEVTKZWPFFGT(QTVWPC(GNKZT #NVCTFCTCWH(144'$/%%QJ4+%w  4&WPMNG6ÌPWPIMN2TÒHRWP\GWPF5EJTÌVNKPIUTK­UGJTUEJÌP



'KPG2T·IWPICWHFKGINÒEMNKEJG4ÒEMMGJTFGU-CKUGTUCWU5[TKGP



Õ&GPCTX%JTWPDGUVKOOVGURCPKUEJG/ÒP\UV·VVG %QNQPKC%CGUCTCWIWUVC! I-QRHT OKV.QTDGGTMTCP\5EJKNF\YKUEJGP\YGK.QTDGGTD·WOGP$/%%QJ4+%wC 5GJTUEJÌP



Õ&GPCTX%JTWPDGUVKOOVGURCPKUEJG/ÒP\UV·VVG %QNQPKC%CGUCTCWIWUVC! I-QRHT OKV.QTDGGTMTCP\5EJKNF\YKUEJGP\YGK.QTDGGTD·WOGP$/%%QJ4+%wC  2TÒHRWP\GCWHFGO#XGTU5VGORGNHGJNGTCWHFGO4GXGTUUGJTUEJÌP



&GT4GXGTU\GKIVFGPENKRGWUXKTVWVKU\YKUEJGP\YGK.QTDGGTD·WOGP<WOENKRGWUXKTVWVKUJGK­VGUKPFGPTGUIGUVCG FKXK #WIWUVK 'KP IQNFGPGT 5EJKNF YWTFG KP FGT %WTKC ,WNKC CWHIGUVGNNV FGP OKT FGT 5GPCV WPF FCU TÌOKUEJG 8QNM   IGYGKJV JCDGP YGIGP OGKPGT 6CRHGTMGKV WPF /KNFG OGKPGT )GTGEJVKIMGKV WPF *KPICDG YKG GU FKG #WHUEJTKHV CWH   FKGUGO 5EJKNF DG\GWIV <W FGP .QTDGGTD·WOGP JGK­V GU (ÒT FKGUGU OGKP 8GTFKGPUV YWTFG KEJ FWTEJ 5GPCVUDG   UEJNW­#WIWUVWUIGPCPPVCPOGKPGP6ÒTRHQUVGPYWTFGPXQP5VCCVUYGIGP\YGK.QTDGGTD·WOGCPIGDTCEJV  



1,5:1



8512

1,5:1

Õ&GPCTX%JTWPDGUVKOOVGURCPKUEJG/ÒP\UV·VVG %QNQPKC%CGUCTCWIWUVC! I-QRHT OKV'KEJGPMTCP\-QOGV$/%%QJXGTIN4+%wC  4(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI

&GT-QOGVKUVFGTUKFWU,WNKWUªDGTFKGUGP-QOGVGPUEJTGKDV2NKPKWU PCV++ 0WTCPGKPGOGKP\KIGP1TVFGT 'TFG P·ONKEJ KP 4QO YKTF GKP -QOGV KP GKPGO 6GORGN XGTGJTV YGKN KJP FGT &KXWU #WIWUVWU CNU UGJT IÒPUVKIGU   <GKEJGPHÒTUKEJGTMN·TVG'TVTCVP·ONKEJ\W$GIKPPUGKPGT4GIKGTWPIKP'TUEJGKPWPIY·JTGPFFGT5RKGNGFKGGT\W 'JTGP FGT 8GPWU )GPGVTKZ MWT\ PCEJ FGO 6QFG UGKPGU 8CVGTU %CGUCT KP FGO PQEJ XQP FKGUGO GKPIGUGV\VGP -QNNG   IKWO CDJKGNV /KV HQNIGPFGP 9QTVGP ·W­GTVG GT FCTÒDGT UGKPG (TGWFG )GTCFG CP FGP 6CIGP OGKPGT 5RKGNG YWTFG   GKP*CCTUVGTPUKGDGP6CIGNCPICOPÌTFNKEJGP6GKNFGU*KOOGNUGTDNKEMVGTIKPIWOFKGGNHVG6CIGUUVWPFGCWHYCT UGJTNGWEJVGPFWPFKPCNNGP.·PFGTPUKEJVDCT&CU8QNMINCWDVGFWTEJFKGUGP5VGTPYGTFGFKG#WHPCJOGFGT5GGNG %CGUCTU WPVGT FKG WPUVGTDNKEJGP )ÌVVGT CPIG\GKIV WO FGUUGPVYKNNGP YWTFG FKGUGU 5VGTP\GKEJGP CO #DDKNF UGKPGU   -QRHGU CPIGDTCEJV FCU UR·VGT CWH FGO (QTWO IGYGKJV YWTFG 5Q URTCEJ GT UKEJ ÌHHGPVNKEJ CWU KP UGKPGO +PPGTP   CDGTYCTGTOKV(TGWFGÒDGT\GWIVFC­FGT5VGTPHÒTKJPCWHIGICPIGPUGKWPFFC­GTOKVKJOCWHIGJGWPF\YCT YGPPYKTFKG9CJTJGKVUCIGPYQNNGP\WO*GKNGFGT9GNV



219


RÖMISCHE KAISERZEIT

8513

8515

1,5:1



8514

1,5:1

Õ&GPCTX%JT%QNQPKC2CVTKEKC ! I6QICRKEVCÒDGTVWPKECRCNOCVC\YKUEJGP#FNGTWPF -TCP\3WCFTKICT$/%%QJ4+%w  4#VVTCMVKXGU'ZGORNCTOKVUEJÌPGT6ÌPWPIUGJTUEJÌPXQT\ÒINKEJ





Õ&GPCTX%JT%QNQPKC2CVTKEKC ! I6QICRKEVCÒDGTVWPKECRCNOCVC\YKUEJGP#FNGTWPF -TCP\3WCFTKICT$/%%QJ4+%w 42TÒHRWP\GCWHFGO4GXGTUUGJTUEJÌP





Õ&GPCTX%JTWPDGUVKOOVGURCPKUEJG/ÒP\UV·VVG %QNQPKC2CVTKEKC! I-QRHNOKV.QTDGGT MTCP\6TKWORJYCIGPOKV.GIKQPUCFNGTWPFXKGT/KPKCVWTRHGTFGPKPXKGTU·WNKIGO6GORGNT$/% %QJ4+%w 8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC



1,5:1



8516

1,5:1

Õ&GPCTX%JT %QNQPKC2CVTKEKC! I-QRHT%CRTKEQTPOKV(ÒNNJQTPTJ·NV)NQDWU $/%%QJ4+%w 45GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



#WH FGO 4GXGTU KUV YKG 5WGVQP UEJTGKDV #WI    FCU 5VGTP\GKEJGP %CRTKEQTP 5VGKPDQEM  CDIGDKNFGV WPVGT   FGO#WIWUVWUIGDQTGPYWTFG&KGUG#WUUCIG5WGVQPUUVGJVKPGKPGOUEJGKPDCTGP9KFGTURTWEJ\WO)GDWTVUVCIFGU #WIWUVWU WPVGT$GTÒEMUKEJVKIWPIFGUTGRWDNKMCPKUEJGP-CNGPFGTUWPFCPFGTGT(CMVQTGPFGTQFGT5GRVGODGT  X %JT  FGPP FKG 5QPPG UVCPF GPVYGFGT YGPP OCP FGP (TÒJNKPIURWPMV KP  )TCF 9KFFGT CPPKOOV  KP FGT   ,WPIHTCWQFGTCDGTKPFGT9CCIG YGPPOCPPCEJGKPGTEJCNF·KUEJGP/GVJQFGFGT$GTGEJPWPIFGU*QTQUMQRGUFGP (TÒJNKPIURWPMV KP  )TCF 9KFFGT CPPKOOV  5Q KUV XGTOWVGV YQTFGP FC­ 5WGVQP FCU 0CVKXKV·VU\GKEJGP FCU 5VGTP   \GKEJGP FGT )GDWTV  OKV FGO -QP\GRVKQPU\GKEJGP FGO 5VGTP\GKEJGP FGT <GWIWPI  FGU #WIWUVWU XGTYGEJUGNV JCV  

\WNGV\V-C['JNKPI9GTYKTFLGV\VPQEJCP5EJKEMUCNUGTHQTUEJWPIWPF*QTQUMQRINCWDGP! 'RJTCKOF5[TGT  $GOGTMWPIGP\W,WNKCPU5VKGTOÒP\GPWPFFGO)GDWTVUFCVWOFGU-CKUGTUKP,0)  5   'U YKTF CDGT DGK /CPKNKWU GDGPHCNNU FGT %CRTKEQTP CNU )GDWTVU\GKEJGP FGU #WIWUVWU DG\GKEJPGV #UVTQPQOKEC   ++   /CPKNKWU PGPPV CWEJ FCU )GDWTVU\GKEJGP FGU 6KDGTKWU FKG 9CCIG #UVTQPQOKEC +8   $GKFGT)GDWTV FGU 6KDGTKWU CO  0QXGODGT  X %JT UVCPF FKG 5QPPG CNNGTFKPIU KO 5MQTRKQP  JKGT NKGIV FGTUGNDG UEJGKPDCTG   9KFGTURTWEJ YKG DGK #WIWUVWU XQT FGT CDGT MGKPGUHCNNU FCFWTEJ CWH\WNÌUGP KUV FC­ OCP FCU )GDWTVU\GKEJGP \W   GKPGO-QP\GRVKQPU\GKEJGPWOFGWVGV GUUGKFGPPOCPIGJVXQPGKPGOOGFK\KPKUEJGP9WPFGTCWU6KDGTKWUOÒ­VG GKPGP/QPCVXQTUGKPGT)GDWTVIG\GWIVYQTFGPUGKP 'UIKDVGKPGCPFGTG.ÌUWPI(ÒTFCU5VGTP\GKEJGPFGT)GDWTV KUVPKEJVFGT5VCPFFGT5QPPGUQPFGTPFGTFGU/QPFGUTGNGXCPV.GIVOCPFKGUG#WHHCUUWPI\WITWPFGUQUVKOOVFKG #WUUCIG FGT 3WGNNGP \W FGP 0CVKXKV·VU\GKEJGP FGT -CKUGT UQYQJN DGK #WIWUVWU CNU CWEJ DGK 6KDGTKWU &GT 4GXGTU   WPUGTGU5VÒEMGU\GKIVCNUQLGPGU6KGTMTGKU\GKEJGPKPFGODGKO<GKVRWPMVFGT)GDWTVFGU#WIWUVWUFGT/QPFUVCPF 5KGJG 5EJÒV\ &GT %CRTKEQTP CNU 5VGTP\GKEJGP FGU #WIWUVWU KP #PVKMG WPF #DGPFNCPF    5  WPF   6JQTOCPP-QP\GRVKQPU\GKEJGPCWHCPVKMGP/ÒP\GP! KP8QTDGTGKVWPI 

1,5:1



8517

1,5:1

Õ&GPCTX%JTWPDGUVKOOVG/ÒP\UV·VVG %[\KEWU! I-QRHTKP'KEJGPMTCP\-CPFGNC DGT KP GKPGO OKV \YGK 2CVGTCG WPF \YGK $WETCPKC IGUEJOÒEMVGP -TCP\ $/%  %QJ  )CKWU   %CGUCT 4+%w 44'VYCUMQTTQFKGTVUGJTUEJÌP 'UYKTFIGNGIGPVNKEJCWEJJGWVGPQEJFKG#WHHCUUWPI%QJGPUXGTVTGVGPFCU2QTVT·VFGT8QTFGTUGKVGUVGNNGFGP'PMGN FGU#WIWUVWU)CKWU%CGUCTFCTQDYQJNFKGUG&GWVWPIUQYQJNKO$/%KO%$0CNUCWEJKO4+%wN·PIUVYKFGTNGIV KUV &CU 2QTVT·V FGT 8QTFGTUGKVG KUV UKEJGT LWIGPFNKEJ GKP FTGKL·JTKIGT -PCDG )CKWU %CGUCT YWTFG KO #WIWUV QFGT   5GRVGODGT  X %JT IGDQTGP  KUV CDGT DGUVKOOV PKEJV FCTIGUVGNNV &CU 5VÒEM HGKGTV FKG NWFK UCGEWNCTGU FKG KP FGT   0CEJV\WO,WPKX%JTGTÌHHPGVYWTFGPWPFFTGK6CIGWPFFTGK0·EJVGFCWGTVGPFGT-CPFGNCDGTDG\KGJVUKEJ UKEJGTCWHFKGP·EJVNKEJGP(GKGTPFGT-TCP\OKVFGP2CVGTCGWPF$WETCPKCURKGNVOÌINKEJGTYGKUGCWHFKG(GKGTPCO 6CIGCPFGPP4KPFGTYWTFGPXQP#WIWUVWUWPF#ITKRRCPWTCOWPF,WPKVCIUÒDGTIGQRHGTV XGTIN5WVJGTNCPF 6JGFCVGCPFVJGUKIPKHKECPEGQHVJGECPFGNCDTWOEQKPUQH#WIWUVWUKP%NCUUKECN4GXKGY5HH 

220




RÖMISCHE KAISERZEIT

8519

8518

1,5:1



8520

1,5:1

Õ&GPCTX%JTWPDGUVKOOVG/ÒP\UV·VVG %[\KEWU! I-QRHTKP'KEJGPMTCP\-CPFGNC DGT KP GKPGO OKV \YGK 2CVGTCG WPF \YGK $WETCPKC IGUEJOÒEMVGP -TCP\ $/%  %QJ  )CKWU   %CGUCT 4+%w 44'VYCUMQTTQFKGTV4CPFGVYCUDGHGKNVUGJTUEJÌP





Õ&GPCT  X %JT .WIFWPWO  I -QRH T#WIWUVWU UKV\V N CWH 2QFKWO WPF GORH·PIV   <YGKIGXQP\YGK5QNFCVGP$/%%QJ4+%wC 4(GKPG2CVKPCIWVGUUGJTUEJÌP





Õ&GPCT  X %JT .WIFWPWO  I -QRH T#WIWUVWU UKV\V N CWH 2QFKWO WPF GORH·PIV   <YGKIGXQP\YGK5QNFCVGP$/%%QJ4+%wC  4(GKPG2CVKPCIWVGUUGJTUEJÌPUGJTUEJÌP



8521

8522

8521 1,5:1

8523

8523 1,5:1



Õ&GPCTX%JT.WIFWPWOI-QRHT5VKGTUVÌ­VT$/%%QJ4+%wC )WVGUUGJTUEJÌP





Õ&GPCTX%JT.WIFWPWOI-QRHT5VKGTUVÌ­VT$/%%QJ4+%wC 2TÒHRWP\GCWHFGO4GXGTUUGJTUEJÌP





Õ&GPCTX%JT.WIFWPWOI-QRHT#RQNNQUVGJVNOKV2NGEVTWOWPF.[TC$/% %QJ4+%wC 9KP\-TCV\GTCWHFGO#XGTUHCUVXQT\ÒINKEJIWVGUUGJTUEJÌP



#RQNNQJCV#WIWUVWUKO,CJTX%JTFGP5KGIÒDGT/CTEWU#PVQPKWUWPF%NGQRCVTCKPFGT5EJNCEJVDGK#EVKWO IGUEJGPMV#PFKGUGU'TGKIPKUGTKPPGTVFKG/ÒP\G

8524

8525

8526



Õ&GPCTX%JT.WIFWPWOI-QRHT#RQNNQUVGJVNOKV2NGEVTWOWPF.[TC$/% %QJ4+%wC #XGTUNGKEJVFG\GPVTKGTVUGJTUEJÌP





“#U  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\#TC .WIFWPGPUKU $/%    %QJ4+%w $TCWPG2CVKPCUGJTUEJÌP



#O  #WIWUV LGFGP ,CJTGU HGKGTVGP FKG  EKXKVCVGU FGT FTGK )CNNKGP CP FKGUGO #NVCT GKP (GUV OKV FGO UKG KJTG   4GKEJUVTGWGDGUV·VKIVGP&GT#NVCTYCTKO,CJTGX%JTXQP&TWUWUGTTKEJVGVYQTFGP



Õ&GPCT  X %JT 4QO % /CTKWU  I -QRH T FCJKPVGT .KVWWU3WCFTKIC T FCTKP 2CNO   \YGKI$/%%QJ4+%w 8QTFGTUGKVGNGKEJVIGIN·VVGVUGJTUEJÌP

 221


RÖMISCHE KAISERZEIT

8527



8529

8528

Õ&GPCT  X %JT 4QO % #PVKUVKWU 4GIKPWU  I -QRH T5KORWNWO .KVWWU &TGKHW­ WPF   2CVGTC$/%%QJ4+%w 42TÒHRWP\GCWHFGO#XGTUHCUVUGJTUEJÌPUGJTUEJÌP



&GT4GXGTUUVGNNVFKG/KVINKGFUEJCHVFGU#WIWUVWUKPDGFGWVGPFGP2TKGUVGTMQNNGIKGPJGTCWUGTYCT2QPVKHGZ#WIWT 3WKPFGEKOXKTUHWPFIGJÌTVGFGO-QNNGIKWOFGT5GRVGOXKTK'RWNQPGUCP



Ô#WTGWU  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\)CKWU %CGUCT TGKVGV T OKV   5RGGT WPF 5EJKNF FCJKPVGT .GIKQPUCFNGT \YKUEJGP \YGK 5VCPFCTVGP $/%  %CNKEQ  %QJ    4+%w 4(CUVUGJTUEJÌP  )CKWU%CGUCTGKPGTFGT'PMGNFGU#WIWUVWUYWTFGXQPUGKPGO)TQ­XCVGTCNU0CEJHQNIGTCWUGTMQTGP+O,CJTX %JT PCJO )CKWU %CGUCT GTUVOCNU CP OKNKV·TKUEJGP 1RGTCVKQPGP VGKN YKG FGT 4GXGTU WPUGTGU #WTGWU GKPFTWEMUXQNN   \GKIVX%JTXGTVGKNVG#WIWUVWUCWEJ)GNFIGUEJGPMGCPFKG5QNFCVGPFGPGPOKVFKGUGP5VÒEMGPMNCTFKGOKNKV·TK UEJG-CTTKGTGUGKPGU'PMGNUXQT#WIGPIGHÒJTVYWTFG



Õ&GPCT  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\)CKWU %CGUCT TGKVGV T OKV   5EJYGTVWPF5EJKNFFCJKPVGT.GIKQPUCFNGT\YKUEJGP\YGK5VCPFCTVGP$/%%QJ4+%w  5GJTUEJÌP

8531



8532

8530

8531 1,5:1



8532 1,5:1

Ô#WTGWU  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\)CKWU WPF .WEKWU %CGUCTGU   UVGJGPXXOKV5RGGTGPWPF5EJKNFGPFCTÒDGT5KORWNWOWPF.KVWWU$/%%CNKEQD%QJ 4+%w 5EJÌPpUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  &GTXQTNKGIGPFG6[RMCPPPCEJPGWGTGT(QTUEJWPIGZCMVGTFCVKGTVYGTFGPCNUFKGUKO4+%IGOCEJVYWTFG X P%JT &KG5VÒEMGYWTFGPX%JTIGRT·IVYKGUKEJCWUFGT6CVUCEJGGTIKDVFC­)CKWU%CGUCTKO,CJTP %JTFGP-QPUWNCVKPPGJCVVGWPFUQOKVPKEJVOGJTFGUKIPKGTVGT-QPUWNYCT -GJPG<WT&CVKGTWPIFGT(WPFOÒP\GP CWU -CNMTKGUG KP 9KGIGNU 4CKPGT *TUI  &KG (WPFOÒP\GP XQP -CNMTKGUG WPF FKG HTÒJMCKUGT\GKVNKEJG /ÒP\RT·   IWPI /ÌJPGUGG  5  H  5KGJG \WT &CVKGTWPI WPF \WT &GWVWPI FGU 4GXGTUGU CWEJ 9QNVGTU )CKWU WPF   .WEKWU %CGUCTGU CNU FGUKIPKGTVG -QPUWNP WPF RTKPEKRGU KWXGPVWVKU &KG NGZ 8CNGTKC %QTPGNKC WPF 4+% +w  HH KP   %JKTQP  5HH





Õ&GPCT  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\)CKWU WPF .WEKWU %CGUCTGU   UVGJGPXXOKV5RGGTGPWPF5EJKNFGPFCTÒDGT5KORWNWOWPF.KVWWU$/%%QJ4+%w  (GKPG2CVKPCUGJTUEJÌP



Õ&GPCT  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\)CKWU WPF .WEKWU %CGUCTGU   UVGJGPXXOKV5RGGTGPWPF5EJKNFGPFCTÒDGT5KORWNWOWPF.KVWWU$/%%QJ4+%w  5GJTUEJÌP



8533





222

8534

Õ&GPCT  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\)CKWU WPF .WEKWU %CGUCTGU   UVGJGPXXOKV5RGGTGPWPF5EJKNFGPFCTÒDGT5KORWNWOWPF.KVWWU$/%%QJ4+%w  5GJTUEJÌP



Õ&GPCT  X %JT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\)CKWU WPF .WEKWU %CGUCTGU   UVGJGPXXOKV5RGGTGPWPF5EJKNFGPFCTÒDGT.KVWWUWPF5KORWNWO$/%%QJ4+%w  .GKEJVMQTTQFKGTVUGJTUEJÌP




RÖMISCHE KAISERZEIT

1,5:1



8535

1,5:1

Õ&GPCT  .WIFWPWO QFGT 4QO  I -QRH T OKV .QTDGGTMTCP\)CKWU WPF .WEKWU %CGUCTGU   UVGJGPXXOKV5RGGTGPWPF5EJKNFGPFCTÒDGT5KORWNWO.KVWWUWPF:$/%%QJ4+%w 4)WVGUUGJTUEJÌP



&CU5VÒEMHGKGTVYKG4GKPJCTF9QNVGTUPCEJYGKUGPMQPPVGFKGNGZ8CNGTKC%QTPGNKCWPFYWTFGP%JTGPVYGFGT KP .WIFWPWO HÒT GKP UVCFVTÌOKUEJGU 2WDNKMWO QFGT OÌINKEJGTYGKUG UQICT KP 4QO UGNDUV IGRT·IV &CU )GUGV\ DG   UVKOOVGFKG'KPTKEJVWPIXQP9CJN\GPVWTKGP\WT8QTYCJNFGT-QPUWNPWPF2T·VQTGP&CU:CWHFGO4GXGTUWPF FKG 9CJN FGU )CKWU.WEKWU6[RU PQEJ PCEJ FGO 6QFG FGT 'PMGN FGU #WIWUVWU GTMN·TV UKEJ FCFWTEJ FC­ FKG    <GPVWTKGPPCEJ)CKWUWPF.WEKWU%CGUCTGUDGPCPPVYWTFGP5KGJG\WT&CVKGTWPI&GWVWPIWPF/ÒP\UV·VVG9QNVGTU )CKWU WPF .WEKWU %CGUCTGU CNU FGUKIPKGTVG -QPUWNP WPF RTKPEKRGU KWXGPVWVKU &KG NGZ 8CNGTKC %QTPGNKC WPF 4+% +w   HHKP%JKTQP  5HH

8536

1,5:1



1,5:1

Õ%KUVQRJQTPCEJX%JTMNGKPCUKCVKUEJG/ÒP\UV·VVGI-QRHT5RJKPZOKVCWUIGDTGKVGVGP 5EJYKPIGPUKV\VT42%  8QPITQ­GT5GNVGPJGKV/KPMQTTQFKGTVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



&GT4GXGTU\GKIVXGTOWVNKEJLGPG5RJKPZFKGCWEJFCUGTUVG5KGIGNFGU#WIWUVWU\KGTVG 5WGVQP#WI 9GPPGT )GNGKVUEJTGKDGP ÌHHGPVNKEJG $GMCPPVOCEJWPIGP WPF $TKGHG UKGIGNVG DGPWV\VG GT CPHCPIU FC\W GKP 5KGIGN OKV GKPGT   5RJKPZ  

8537



ex 8538

Õ%KUVQRJQTPCEJX%JTMNGKPCUKCVKUEJG/ÒP\UV·VVGI-QRHNFCXQT.KVWWU$ÒPFGNXQP UGEJUJTGP42% 4(GKPG6ÌPWPIUGJTUEJÌP 'ZGORNCTFGT.CIGTNKUVG/ÒP\GPWPF/GFCKNNGP#)$CUGN0T &KGU'ZGORNCTKUVDGK5WVJGTNCPF 0T GTY·JPV





8539





“U WO  X %JT MNGKPCUKCVKUEJG /ÒP\UV·VVG  I -QRH T%# KP GKPGO OKV 4QUVTGP IG   UEJOÒEMVGP-TCP\42%&C\W8GURCUKCPWUHÒT&QOKVKCPWU“#U 4GX(GNKEKVCU 4+%C 5VÒEM(CUVUGJTUEJÌP



Õ%KUVQRJQTX%JT2GTICOQP /[UKC I-QRHT5GEJUU·WNKIGT6GORGN42% -N-TCV\GTUGJTUEJÌP



'ZGORNCTFGT#WMVKQP-TKEJGNFQTH5VWVVICTV0T

223


RÖMISCHE KAISERZEIT

8540 1,5:1



1,5:1

Õ%KUVQRJQTX%JT'RJGUWU +QPKC I-QRHTOKV.QTDGGTMTCP\2CZUVGJVNCWH2CTC \QPKWOOKV%CFWEGWUFCJKPVGT%KUVCO[UVKECOKV5EJNCPIG42%  4*GTTNKEJG2CVKPCOKP-TCV\GTCWHFGT8QTFGTUGKVGUGJTUEJÌPpXQT\ÒINKEJ 

8541 1,5:1



1,5:1

Õ%KUVQRJQT  X %JT 'RJGUWU +QPKC   I -QRH T+O .QTDGGTMTCP\ %CRTKEQTP T OKV   (ÒNNJQTP42% #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



#WH FGO 4GXGTU KUV YKG 5WGVQP UEJTGKDV #WI    FCU 5VGTP\GKEJGP %CRTKEQTP 5VGKPDQEM  CDIGDKNFGV WPVGT   FGO#WIWUVWUIGDQTGPYWTFG&KGUG#WUUCIG5WGVQPUUVGJVKPGKPGOUEJGKPDCTGP9KFGTURTWEJ\WO)GDWTVUVCIFGU #WIWUVWU WPVGT$GTÒEMUKEJVKIWPIFGUTGRWDNKMCPKUEJGP-CNGPFGTUWPFCPFGTGT(CMVQTGPFGTQFGT5GRVGODGT  X %JT  FGPP FKG 5QPPG UVCPF GPVYGFGT YGPP OCP FGP (TÒJNKPIURWPMV KP  )TCF 9KFFGT CPPKOOV  KP FGT   ,WPIHTCWQFGTCDGTKPFGT9CCIG YGPPOCPPCEJGKPGTEJCNF·KUEJGP/GVJQFGFGT$GTGEJPWPIFGU*QTQUMQRGUFGP (TÒJNKPIURWPMV KP  )TCF 9KFFGT CPPKOOV  5Q KUV XGTOWVGV YQTFGP FC­ 5WGVQP FCU 0CVKXKV·VU\GKEJGP OKV FGO   -QP\GRVKQPU\GKEJGP FGU #WIWUVWU XGTYGEJUGNV JCV \WNGV\V -C[ 'JNKPI 9GT YKTF LGV\V PQEJ CP 5EJKEMUCNUGTHQT   UEJWPIWPF*QTQUMQRINCWDGP! 'RJTCKOF5[TGT $GOGTMWPIGP\W,WNKCPU5VKGTOÒP\GPWPFFGO)GDWTVU FCVWOFGU-CKUGTUKP,0)  5 'UYKTFCDGTDGK/CPKNKWUGDGPHCNNUFGT%CRTKEQTPCNU )GDWTVU\GKEJGP FGU #WIWUVWU DG\GKEJPGV #UVTQPQOKEC ++   /CPKNKWU PGPPV CWEJ FCU )GDWTVU\GKEJGP FGU 6KDG   TKWUFKG9CCIG #UVTQPQOKEC+8 $GKFGT)GDWTVFGU6KDGTKWUCO0QXGODGTX%JTUVCPFFKG5QPPG CNNGTFKPIU KO 5MQTRKQP  JKGT NKGIV UEJGKPDCT FGTUGNDG 9KFGTURTWEJ YKG DGK #WIWUVWU XQT FGT CDGT MGKPGUHCNNU FC   FWTEJ CWH\WNÌUGP KUV FC­ OCP FCU )GDWTVU\GKEJGP \W GKPGO -QP\GRVKQPU\GKEJGP WOFGWVGV GU UGK FGPP OCP IGJV   XQP GKPGO OGFK\KPKUEJGP 9WPFGT CWU  'U IKDV GKPG CPFGTG .ÌUWPI (ÒT FCU 5VGTP\GKEJGP FGT )GDWTV KUV PKEJV FGT   5VCPFFGT5QPPGUQPFGTPFGTFGU/QPFGUTGNGXCPV.GIVOCPFKGUG#WHHCUUWPI\WITWPFGUQUVKOOVFKG#WUUCIGFGT 3WGNNGP\WFGP0CVKXKV·VU\GKEJGPFGT-CKUGTUQYQJNDGK#WIWUVWUCNUCWEJDGK6KDGTKWU&GT4GXGTUWPUGTGU5VÒM MGU \GKIV CNUQ LGPGU 6KGTMTGKU\GKEJGP KP FGO DGKO <GKVRWPMV FGT )GDWTV FGU #WIWUVWU FGT /QPF UVCPF 5KGJG   5EJÒV\&GT%CRTKEQTPCNU5VGTP\GKEJGPFGU#WIWUVWUKP#PVKMGWPF#DGPFNCPF  5WPF6JQTOCPP -QP\GRVKQPU\GKEJGPCWHCPVKMGP/ÒP\GP! KP8QTDGTGKVWPI 

8543 8542

8544



Õ%KUVQRJQT  X %JT 'RJGUWU +QPKC   I -QRH T+O .QTDGGTMTCP\ %CRTKEQTP T OKV   (ÒNNJQTP42% .GKEJVMQTTQFKGTVUGJTUEJÌP





Õ%KUVQRJQT  X %JT 'RJGUWU +QPKC   I -QRH T+O .QTDGGTMTCP\ %CRTKEQTP T OKV   (ÒNNJQTP42% .GKEJVMQTTQFKGTVUGJTUEJÌP





Õ%KUVQRJQTX%JT'RJGUWU +QPKC I-QRHT)GUEJOÒEMVGT#NVCT42%  5GJTUEJÌP



224


RÖMISCHE KAISERZEIT

8545 1,5:1



1,5:1

Õ%KUVQRJQT  X %JT 'RJGUWU +QPKC   I -QRH T4WPFVGORGN FGU /CTU 7NVQT FCTKP   5VCPFCTVG42% 42T·EJVKIGU2QTVT·VJGTTNKEJG2CVKPCIWVGUUGJTUEJÌP 

8546



Õ%KUVQRJQT  X %JT 'RJGUWU +QPKC   I -QRH T4WPFVGORGN FGU /CTU 7NVQT FCTKP   5VCPFCTVG42% 4(GKNURWTGPCO4CPFUGJTUEJÌP



8547

1,5:1



1,5:1

Õ6GVTCFTCEJOG,CJT P%JT #PVKQEJKC 5[TKC I-QRHTOKV.QTDGGTMTCP\6[EJG UKV\VTWPVGPUEJYKOOGPFGT1TQPVGU2TKGWT4+%w  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC

'ZGORNCTFGT#WMVKQP5VGTPDGTI8+++<ÒTKEJ0T  &KG 4ÒEMUGKVG FKGUGU 5VÒEMGU \GKIV FKG DGTÒJOVG 5VCVWG FGT 6[EJG XQP #PVKQEJKC FKG 'WV[EJKFGU GKP 5EJÒNGT FGU   .[UKRRQUIGUEJCHHGPJCVVG

8548



8549

8548

WPF#ITKRRC“#UX%JT0GOCWUWUI$GKFGT-ÌRHGPCEJCW­GPDNKEMGPF-TQMQ FKNCP2CNOGIGMGVVGVNTWPFGT)GIGPUVGORGN2CNO\YGKI\YKUEJGP&&4+%w42%)GIGP UVGORGN*QYIGIQ42% CWHGKPGO“UXQP%QUUWTC 4+%w42%  5EJÌP)GIGPUVGORGNUGJTUEJÌP



6KDGTKWUÕ&GPCT.WIFWPWOI-QRHTOKV.QTDGGTMTCP\-CKUGTKP3WCFTKICT OKV<YGKIWPF#FNGT\GRVGT$/%%QJ4+%w 45GJTUEJÌP



#ITKRRCFGT(TGWPFWPF)GPGTCNFGU#WIWUVWUYCTDGTGKVUX%JTIGUVQTDGP&CU-TQMQFKNJCVVGPYQJN5QNFC VGP XQO ·I[RVKUEJGP (GNF\WI FGU ,CJTGU  X %JT OKVIGDTCEJV XGTOWVNKEJ YCTGP UKG CNU 8GVGTCPGP KP 0GOCWUWU   CPIGUKGFGNVYQTFGP





'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

225


RÖMISCHE KAISERZEIT

8550

1,5:1



1,5:1

“#U4QOI-QRHN.KXKCUKV\VTOKV2CVGTCWPF(CEMGN$/%%QJ4+%w 5GJTIWVGU2QTVT·V$TCWPG2CVKPCCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT5COONWPI'IQP$GEMGPDCWGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

8552 8551

8551



“5GUVGT\  4QO  I (TQPVCNCPUKEJV FGU %QPEQTFKCVGORGNU CWH FGO (QTWO 4QOCPWO   5GEJUU·WNKIGT6GORGNKO+PPGTGP-WNVUVCVWGFGT%QPEQTFKCXQTFGO6GORGN5VCVWGPFGU*GTEWNGUWPF FGU/GTEWTCWHFGO2GFKOGPV,WRKVGT\YKUEJGP,WPQWPF/KPGTXCHNCPMKGTVXQPYGKVGTGP)QVVJGKVGP 5%$/%%QJ4+%w 4$TCWPG2CVKPCUEJÌPpUGJTUEJÌP



Ô#WTGWU.WIFWPWOI-QRHTOKV.QTDGGTMTCP\.KXKCCNU2CZUKV\VTOKV<YGKIWPF<GRVGT $/%%CNKEQC%QJ4+%w 2WP\GCWHFGO#XGTUUEJÌPpUGJTUEJÌP



+O%QPEQTFKCVGORGNJCVVGPY·JTGPFFGT4GRWDNKM\GKVYGKUG5GPCVUUKV\WPIGPUVCVVIGHWPFGPUQJKGNVJKGT%KEGTQUGKPG DGTÒJOVGXKGTVG4GFGIGIGP%CVKNKPC



'ZGORNCTFGT#WMVKQP)KGUUGPGT/ÒP\JCPFNWPI/ÒPEJGP0T  /ÒP\UVGORGN FKGUGU 6[RU OKV .KXKC CNU 2CZ CWH FGO 4GXGTU CNUQ FGO 6[R FGU DGTÒJOVGP 6TKDWVG 2GPP[U FGT   $KDGN  YWTFGP MÒT\NKEJ KO .GIKQPUNCIGT 8KPFQPKUUC JGWVG 9KPFKUEJ  GPVFGEMV 0CEJ FGO CTEJ·QNQIKUEJGP $GHWPF   KUV FCXQP CWU\WIGJGP FC­ KP 8KPFQPKUUC GKPG QHHK\KGNNG /ÒP\UV·VVG GZKUVKGTV JCV &KGUG UGPUCVKQPGNNG 'PVFGEMWPI   UVGNNV XKGNG /ÒP\UV·VVGP\WYGKUWPIGP FGT HTÒJGP -CKUGT\GKV KP (TCIG FGPP GU KUV FCXQP CWU\WIGJGP FC­ CWEJ KP   CPFGTGP.GIKQPUNCIGTP/ÒP\UV·VVGPGZKUVKGTVJCDGP

1,5:1



226

1,5:1

Ô#WTGWU.WIFWPWOI-QRHTOKV.QTDGGTMTCP\.KXKCCNU2CZUKV\VTOKV<YGKIWPF<GRVGT $/%%CNKEQ%QJ4+%w 8QT\ÒINKEJGU'ZGORNCTOKVJGTXQTTCIGPFGO2QTVT·V 

1,5:1



8553

8554

1,5:1

Ô#WTGWU.WIFWPWOI-QRHTOKV.QTDGGTMTCP\.KXKCCNU2CZUKV\VTOKV<YGKIWPF<GRVGT $/%%CNKEQ%QJ4+%w 5GJTUEJÌP 


RÖMISCHE KAISERZEIT

8555

1,5:1

1,5:1



8557

8556

Õ&GPCT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\.KXKC CNU 2CZ UKV\V T $/%  %QJ    4+%w DTGKVGU'ZGORNCTMN-TCV\GTCWHFGO#XGTUUGJTUEJÌPpXQT\ÒINKEJ



&GT5KNDGTNKPIFGT$KDGN 6TKDWVG2GPP[ 



Õ&GPCT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\.KXKC CNU 2CZ UKV\V T $/%  %QJ    4+%w 2T·EJVKIGU2QTVT·VXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ&GPCT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\.KXKC CNU 2CZ UKV\V T $/%  %QJ    4+%w 5GJTUEJÌP



8559

8558

ex 8560



Õ&GPCT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\.KXKC CNU 2CZ UKV\V T $/%  %QJ    4+%w 5GJTUEJÌP





Õ&GPCT .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\.KXKC CNU 2CZ UKV\V T $/%  %QJ    4+%w 5GJTUEJÌP





Õ&GPCT.WIFWPWOI-QRHTOKV.QTDGGTMTCP\.KXKCCNU2CZUKV\VT$/%%QJ4+%w &C\WGKP\YGKVGU'ZGORNCTXQPXCTKKGTGPFGO5VKN 5VÒEM5GJTUEJÌP



8561

8562

8563

8564

8565



“U %QNQPKC %CGUCTCWIWUVC *KURCPKC   I -QRH N OKV .QTDGGTMTCP\5VKGT UVGJV T ÒDGT FGO   -QRH2GFKOGPV42% 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCHCUVXQT\ÒINKEJ





“U5GIQDTKIC *KURCPKC I-QRHT+P-TCP\'VJPKMQP42%





“U#ORJKRQNKU /CEGFQPKC I-QRHNOKV.QTDGGTMTCP\#TVGOKU6CWTQRQNQUCWH5VKGTT42% )TÒPG2CVKPCUGJTUEJÌPGU'ZGORNCT





“U  $GT[VWU 2JQGPKEKC   I -QRH T8GTUEJNGKGTVG )GUVCNV RHNÒIV T OKV \YGK 1EJUGP   42% &WPMNG2CVKPCUGJTUEJÌP





 HÒT &KXWU #WIWUVWU “#U  4QO  I -QRH N OKV 5VTCJNGPDKPFG FCTÒDGT 5VGTP FCXQT   $NKV\(TCWUKV\VTOKV2CVGTCWPF<GRVGT$/%XCT%QJ4+%w  4&WPMGNITÒPG2CVKPCUGJTUEJÌP



)TÒPG2CVKPCUGJTUEJÌP

227


RÖMISCHE KAISERZEIT

8566



“&WRQPFKWU4QOI-QRHNOKV5VTCJNGPDKPFG+P'KEJGPMTCP\5%$/%%QJ 4+%w &WPMGNITÒPG2CVKPCUGJTUEJÌP

8567



8566

1,5:1

8568

“5GUVGT\4QOI#WIWUVWUOKV.QTDGGT\YGKIWPF<GRVGTKP'NGHCPVGPSWCFTKICN5% $/%%QJ4+%w 44)TÒPDTCWPG2CVKPCNGKEJVMQTTQFKGTV(GNFGTIGIN·VVGVUGJTUEJÌP



“5GUVGT\4QOI#WIWUVWUOKV.QTDGGT\YGKIWPF<GRVGTKP'NGHCPVGPSWCFTKICN5% $/%%QJ4+%w $TCWPG2CVKPCNGKEJVMQTTQFKGTVHCUVUGJTUEJÌP



/KVFGT'NGHCPVGPSWCFTKICCWHFGO#XGTUYKNN6KDGTKWUDGUQPFGTUFKG5KGIJCHVKIMGKVFGU&KXWU#WIWUVWUJGTCWUUVGN NGP 5KGJG 9KGIGNU 3WQF XKCG OWPKVCG UWPV  *KUVQTKUEJG #POGTMWPIGP \W GKPGO #WTGWU CWU -CNMTKGUG KP 9KG   IGNU4 *TUI &KG(WPFOÒP\GPXQP-CNMTKGUGWPFFKGHTÒJMCKUGT\GKVNKEJG/ÒP\RT·IWPI/ÌJPGUGG5HH





'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T

8569

8570



“5GUVGT\4QOI#WIWUVWUOKV.QTDGGT\YGKIWPF<GRVGTKP'NGHCPVGPSWCFTKICN5% $/%%QJ4+%w $TCWPG2CVKPCHCUVUGJTUEJÌPUEJÌP





HÒT,WNKC“5GUVGT\4QOI5234+8.+#'#8)856%CTRGPVWOTXQP\YGK/CWN VKGTGPIG\QIGP5%$/%%QJ4+%w 4$TCWPGGVYCUHNGEMKIG2CVKPCHCUVUGJTUEJÌP



&GP MCKUGTNKEJGP &COGP YWTFGP FKG 2TKXKNGIKGP XQP 8GUVCNKPPGP XGTNKGJGP HTGKNKEJ QJPG KJPGP FGTGP 2HNKEJVGP   CWH\WGTNGIGP  W C 5CETQUCPEVKVCU FCU KWU VTKWO NKDGTQTWO YGNEJGU KJPGP LWTKUVKUEJG 7PCDJ·PIKIMGKV WPF FKG   /ÌINKEJMGKV KJTGP $GUKV\ UGNDUV \W XGTYCNVGP XGTNKGJ  WPF UEJNKG­NKEJ FCU CW­GTIGYÌJPNKEJG 4GEJV KP GKPGO %CT   RGPVWO\WHCJTGPYCUCWHFGO#XGTUWPUGTGT/ÒP\GJGTCWUIGUVGNNVYKTF

8571

8572



HÒT.KXKC“&WRQPFKWU4QOI&TCRKGTVG$ÒUVGFGT.KXKC ! CNU+WUVKVKCTOKV&KCFGO 5%$/%%QJ4+%w $TCWPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTXQPHGKPGO5VKN





“&WRQPFKWU  4QO  I &TCRKGTVG $ÒUVG FGT .KXKC !  CNU +WUVKVKC T OKV &KCFGO5%   $/%%QJ4+%w $TCWPG2CVKPC5EJTÌVNKPIUHGJNGTCWHFGO4GXGTUUGJTUEJÌP



'ZGORNCTFGT.CIGTNKUVG/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

228


RÖMISCHE KAISERZEIT

8573 1,5:1

1,5:1



“&WRQPFKWU  4QO  I &TCRKGTVG $ÒUVG FGT .KXKC CNU 5CNWU T5% $/%  %QJ    4+%w +PFKGUGT'TJCNVWPIXQPITÌ­VGT5GNVGPJGKV5GJTHGKPGU2QTVT·V &WPMNG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT  'ZGORNCTFGT5COONWPI'IQP$GEMGPDCWGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

8575

8574



 HÒT &TWUWU “5GUVGT\  4QO  I $ÒUVGP \YGKGT -KPFGT CWH (ÒNNJÌTPGTP FC\YKUEJGP   IGHNÒIGNVGT%CFWEGWU5%$/%%QJ &TWUWU 4+%w )TÒPDTCWPG2CVKPCUGJTUEJÌP



#WHFGO(ÒNNJQTPUKPFFKG$ÒUVGPFGTDGKFGP<YKNNKPIUUÌJPGFGU&TWUWUCWUFGT'JGOKVFGT·NVGTGP.KXKNNC6KDG TKWU)GOGNNWUWPFFGTPCEJUGKPGODGTÒJOVGP1PMGNDGPCPPVG)GTOCPKEWUFCTIGUVGNNV



“#U4QOI-QRHN5%$/%%QJ4+%w

8576

)TÒPG2CVKPCUGJTUEJÌP



8577



“#U4QOI-QRHN5%$/%%QJ4+%w  &WPMGNITÒPG2CVKPCHCUVUGJTUEJÌP





“#U4QOI-QRHN5%$/%%QJ4+%w



$TCWPG2CVKPCHCUVUGJTUEJÌP

8578

1,5:1



1,5:1

HÒT&TWUWUWPF.KXKC“&WRQPFKWU4QOI8GTUEJNGKGTVG$ÒUVGFGT.KXKCCNU2KGVCUT 5%$/%%QJ4+%w $TCWPG2CVKPC4GXGTUOKPMQTTQFKGTVHCUVXQT\ÒINKEJGU'ZGORNCT

 229


RÖMISCHE KAISERZEIT

8579 8580

8580



OKV&TWUWUWPF.KXKC“U6CTTCEQ *KURCPKC I-QRHFGU6KDGTKWUTOKV.QTDGGTMTCP\ -ÌRHGFGU&TWUWUWPFFGT.KXKCGKPCPFGTIGIGPÒDGT42% $TCWPG2CVKPCUGJTUEJÌP





)CKWU %CNKIWNC  “5GUVGT\  4QO  I -QRH N OKV .QTDGGTMTCP\-CKUGT UVGJV N   WPFITÒ­VHÒPH5QNFCVGP$/%%QJ4+%w  4&WPMGNITÒPG2CVKPCMN5EJTÌVNKPIUHGJNGT4GXGTUGVYCUMQTTQFKGTVUGJTUEJÌP



'ZGORNCTFGT5COONWPI2GVGT*COOGTKEJ#WMVKQP2GWU0CEJH(TCPMHWTVCO/CKP0T  &KG #FNQEWVKQ KUV FKG HGKGTNKEJG #PURTCEJG FGU +ORGTCVQTU CP FCU *GGT FCU \W FKGUGO <YGEM KP 2CTCFGCWHUVGNNWPI   CPIGVTGVGPKUVFKG5VCPFCTVGPVT·IGTKPFGTGTUVGP4GKJGUQCWEJCWHWPUGTGO5VÒEM

8581

1,5:1



1,5:1

“#U4QOI-QRHN8GUVCUKV\VNOKV2CVGTCWPF<GRVGT$/%%QJ4+%w 5GNVGPKPFKGUGT'TJCNVWPI&WPMGNDTCWPG2CVKPCJGTTNKEJGU2QTVT·VXQT\ÒINKEJGU'ZGORNCT



'ZGORNCTFGT5COONWPI'IQP$GEMGPDCWGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

8582

8583



“#U4QOI-QRHN8GUVCUKV\VNOKV2CVGTCWPF<GRVGT$/%%QJ4+%w $TCWPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





“#U4QOI-QRHN8GUVCUKV\VNOKV2CVGTCWPF<GRVGT$/%%QJ4+%w &WPMGNITÒPG2CVKPCUGJTUEJÌP



8584

ex 8585



“#U4QOI-QRHN8GUVCUKV\VNOKV2CVGTCWPF<GRVGT$/%%QJ4+%w &WPMGNITÒPG2CVKPCUGJTUEJÌP





“#U4QOI-QRHN8GUVCUKV\VNOKV2CVGTCWPF<GRVGT$/%%QJ4+%w &C\W)CKWU%CNKIWNCHÒT#ITKRRC“#U4QO$/% 6KDGTKWU %QJ #ITKRRC 4+%w  5VÒEM'KP5VÒEMNGKEJVMQTTQFKGTVUGJTUEJÌP



230


RÖMISCHE KAISERZEIT

8586



“5GUVGT\4QOI2KGVCUUKV\VNOKV2CVGTCFGPN'NNDQIGPCWH5VCVWGIGUVÒV\V5GEJU U·WNKIGT 6GORGN FGU &KXWU #WIWUVWU FCXQT QRHGTV FGT -CKUGT OKV \YGK )GJKNHGP $/% 5  #PO   %QJ4+%w 4&WPMNG2CVKPCGVYCUMQTTQFKGTVHCUVUGJTUEJÌPUGJTUEJÌP

8587



8588

1,5:1



“#U%CTVJCIQ0QXC *KURCPKC &WWOXKTK%P#VGN(NCEWPF%P2QO(NCEI-QRHT OKV.QTDGGTMTCP\5CNWUMQRHT42%  ªDGTFWTEJUEJPKVVNKEJGTJCNVGP&WPMNG2CVKPCIWVGUUGJTUEJÌP



 HÒT &KXWU #WIWUVWU“&WRQPFKWU4QOI-QRHNOKV5VTCJNGPDKPFG#WIWUVWUUKV\VNOKV <YGKI$/%%QJ4+%w )TÒPG2CVKPC(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌP



&GT (TCWGPMQRH CWH FGO 4GXGTU YWTFG XQP %QJGP CNU %CGUQPKC FKG XKGTVG WPF NGV\VG (TCW %CNKIWNCU KFGPVKHK\KGTV   &KGUG+FGPVKHK\KGTWPIKUVLGFQEJUGJT\YGKHGNJCHV<WT&KUMWUUKQPUKGJG42%5



&KG 4ÒEMUGKVG DG\KGJV UKEJ CWH FGP 4GIKGTWPIUCPVTKVV FGU %CNKIWNC KP 4QO CNU FGT -CKUGT XQT 5GPCV 4KVVGTP WPF   8GTVTGVGTPFGT2NGDUGKPG4GFGJKGNV %CUUKWU&KQ5WGVQP%CNKIWNC FKGFGPEQPUGPUWUWPKXGTUQTWODGUV· VKIGPUQNNVG5KGJGX-CGPGNKP5EJYGK\GT/ÒP\DN·VVGT5

8589

8590

8589 1,5:1



HÒT#ITKRRC“#U4QOI-QRHNOKV4QUVTCNMTQPG0GRVWPUVGJVNOKV&GNRJKPWPF&TGK \CEM$/% 6KDGTKWU %QJ #ITKRRC 4+%w 2T·EJVKIGU2QTVT·VXQT\ÒINKEJUGJTUEJÌP  'ZGORNCTFGT5COONWPI'IQP$GEMGPDCWGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T



“#U4QOI-QRHNOKV4QUVTCNMTQPG0GRVWPUVGJVNOKV&GNRJKPWPF&TGK\CEM$/%

6KDGTKWU %QJ #ITKRRC 4+%w $TCWPG2CVKPCUGJTUEJÌP

 231


RÖMISCHE KAISERZEIT

8591

8592



“#U4QOI-QRHNOKV4QUVTCNMTQPG0GRVWPUVGJVNOKV&GNRJKPWPF&TGK\CEM$/%

6KDGTKWU %QJ #ITKRRC 4+%w $TCWPG2CVKPCUGJTUEJÌP





“#U4QOI-QRHNOKV4QUVTCNMTQPG0GRVWPUVGJVNOKV&GNRJKPWPF&TGK\CEM$/%

6KDGTKWU %QJ #ITKRRC 4+%w )TÒPDTCWPG2CVKPCHCUVUGJTUEJÌP



8593



8594

HÒT#ITKRRKPCOCVGT“5GUVGT\4QOI&TCRKGTVG$ÒUVGT%CTRGPVWON$/% %QJ4+%w 4$TCWPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌPGU'ZGORNCTXQPHGKPGO5VKN  #ITKRRKPCFKG)GOCJNKPFGU)GTOCPKEWUYWTFGP%JTXGTDCPPVWPFOCEJVGKJTGO.GDGPP%JTKO#NVGT XQP  ,CJTGP GKP 'PFG 5KG JCVVG PGWP -KPFGT \WT 9GNV IGDTCEJV %CNKIWNC GKPGT KJTGT 5ÌJPG NKG­ FCU 5VÒEM \WT   'TKPPGTWPI CP UGKPG /WVVGT RT·IGP WPF XGTYGKUV OKV FGO 4GXGTU CWH FKG UGNVGPG XQO 5GPCV DGUEJNQUUGPG 'JTWPI   FC­UKGCNU(TCWRGT/CWNVKGTYCIGPKP4QOHCJTGPFWTHVG



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT%CTRGPVWON$/%%QJ4+%w  4$TCWPG2CVKPCUGJTUEJÌP

8595



8596



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT%CTRGPVWON$/%%QJ4+%w  4$TCWPG2CVKPC(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌP





“5GUVGT\4QOI&TCRKGTVG$ÒUVGT%CTRGPVWON$/%%QJ4+%w  4$TCWPG2CVKPCGVYCUMQTTQFKGTVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T

8597

8598



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT%CTRGPVWON$/%%QJ4+%w  4)TÒPDTCWPG2CVKPCUEJÌP





HÒT)GTOCPKEWU“#U4QOI-QRHN5%$/%%QJ )GTOCPKEWU 4+%w &WPMGNITÒPG2CVKPCUGJTUEJÌP



232


RÖMISCHE KAISERZEIT

8599

8600



“#U4QOI-QRHN5%$/%%QJ4+%w (GJNGTKPFGT.GIGPFGPDGUEJTGK DWPI  4&WPMNG2CVKPCUGJTUEJÌP





“&WRQPFKWU 4QO  I )GTOCPKEWU OKV #FNGT\GRVGT KP 3WCFTKIC T5+)0+54'%'26&'8+   %6+5)'4/)GTOCPKEWUUVGJVNOKV.GIKQPUCFNGT$/%%QJ )GTOCPKEWU 4+%w  )TÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



&CU5VÒEMGTKPPGTVCPFGP6TKWORJFGU)GTOCPKEWUCO/CKFGTKJOHÒTUGKPG5KGIGÒDGTFKG)GTOCPGPWPF DGUQPFGTUHÒTFKGVGKNYGKUG4ÒEMIGYKPPWPIFGTKPFGT8CTWUUEJNCEJVXGTNQTGPGP.GIKQPUCFNGT\WVGKNIGYQTFGPYCT

8602

8601 1,5:1



1,5:1

 HÒT 0GTQ WPF &TWUWU %CGUCTGU “&WRQPFKWU  4QO  I 0'41 '6 &48585   %#'5#4'5$GKFG2TKP\GPTGKVGPT%%#'5#4&+8+#8)2410#8)2/642++++22WO5% $/%%QJ4+%w 44&WPMGNITÒPG2CVKPCUGJTUEJÌP



'KPG(COKNKGPOÒP\GFGU%CNKIWNCFGTUKEJKPFGT6KVWNCVWTCNU7TGPMGNFGU#WIWUVWUDG\GKEJPGV&KGDGKFGP2TKP\GP YCTGP ·NVGTG $TÒFGT FGU %CNKIWNC 5KG YCTGP 6KDGTKWU WPF XQT CNNGO FGO 2T·VQTKCPGTRT·HGMVGP 5GKCPWU KO 9GIG   0GTQYWTFGCWHFKGRQPVKUEJGP+PUGNPXGTDCPPVYQGTQFGT5GNDUVOQTFDGIKPI5GKPLÒPIGTGT$TWFGT&TWUWU YWTFGHGUVIGPQOOGPWPFKORCNCVKPKUEJGP)GH·PIPKUGKPIGMGTMGTV&QTVUQNNGTXGTJWPIGTVUGKP



%NCWFKWU“3WCFTCPU4QOI9CCIGÒDGT2045%$/%%QJ4+%w $TCWPG2CVKPCHCUVUVGORGNHTKUEJXQT\ÒINKEJ



204UVGJVOÌINKEJGTYGKUGHÒT2 QPFWU 0 WOOK 4 GUVKVWVWO &KGUYÒTFGDGFGWVGPFC­%NCWFKWU\W$GIKPPUGKPGT 4GIKGTWPIFKG)GYKEJVGXQP&GPCTGPWPF#WTGKNGKEJVCPIGJQDGPJCV

1,5:1



8603

1,5:1

Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\+P'KEJGPMTCP\':5%1$%+8'55'48# 615$/%%QJ4+%w 44)WVGU2QTVT·VUGJTUEJÌP



'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T

8604

8605



“#U4QOI-QRHN%QPUVCPVKCUVGJVNOKVGTJQDGPGT4GEJVGPWPF5RGGT$/% %QJ4+%w &WPMGNITÒPG2CVKPCIWVGUUGJTUEJÌP





“#U4QOI-QRHN.KDGTVCUUVGJVTOKV2KNGWU$/%%QJ4+%w  )TÒPG2CVKPCHCUVXQT\ÒINKEJ

 233


RÖMISCHE KAISERZEIT

8607

8606

8606



“#U  4QO  I -QRH N/KPGTXC UVGJV T OKV 5RGGT WPF 5EJKNF $/%  %QJ    4+%w &WPMNG2CVKPCUGJTUEJÌP



“3WCFTCPU4QOI/QFKWU5%$/%%QJ4+%w  &WPMGNITÒPG2CVKPCIWVGUUGJTUEJÌP

 

8609

8608 8608 1,5:1



Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\%QPUVCPVKC UKV\V N CWH EWTWNKUEJGO 5VWJN   $/%%CNKEQ%QJ4+%w 5GJTUEJÌPHCUVUGJTUEJÌP  'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T



Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\6TKWORJDQIGPFCTCWH-CKUGT\W2HGTFGN \YKUEJGP\YGK6TQRJ·GPCWHFGO#TEJKVTCX&'$4+6#00$/%%CNKEQC%QJ4+%w (CUUWPIUURWTGPUEJÌPpUGJTUEJÌP  +O5QOOGTUVCTVGVG%NCWFKWUFKG+PXCUKQP$TKVCPPKGPUOKVXKGT.GIKQPGP+O,CJTMGJTVGFGT-CKUGTPCEJ4QO \WTÒEMWPFHGKGTVGFQTVUGKPGP6TKWORJ

8610

8611

8611 1,5:1



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\6TKWORJDQIGP FCTCWH 4GKVGTUVCVWG \YK   UEJGP\YGK6TQRJ·GP$/%%QJ4+%w $TCWPG2CVKPCUEJÌPpUGJTUEJÌPUGJTUEJÌP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\5RGUIGJVNOKV$NWOG$/%%QJ 4+%w $TCWPG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP



'ZGORNCTFGT#WMVKQP.GW<ÒTKEJ0T

234


RÖMISCHE KAISERZEIT

8613

8612

8612



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\5RGUIGJVNOKV$NWOG$/%%QJ 4+%w $TCWPG2CVKPCMQTTQFKGTVWPFIGIN·VVGVHCUVUGJTUEJÌP





“&WRQPFKWU4QOI-QRHN%GTGUUKV\VNOKVJTGPWPF(CEMGN$/%%QJ 4+%w )TÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



8614

8615 1,5:1



“#U4QOI-QRHN%QPUVCPVKCUVGJVNOKVGTJQDGPGT4GEJVGPWPF5RGGT$/% %QJ4+%w &WPMGNITÒPG2CVKPC4GXGTUGVYCU$GNCIWPFTCWJG1DGTHN·EJGHCUVXQT\ÒINKEJ





“#U4QOI-QRHN.KDGTVCUUVGJVTOKV2KNGWU$/%%QJ4+%w  $TCWPG2CVKPCIWVGUUGJTUEJÌP



8617

8616



“#U4QOI-QRHN.KDGTVCUUVGJVTOKV2KNGWU$/%%QJ4+%w  $TCWPG2CVKPC4GXGTUNGKEJVMQTTQFKGTVUGJTUEJÌP





Õ%KUVQRJQT ! 'RJGUWU +QPKC I-QRHN#WIWUVWUUVGJVXXKPGKPGO\YGKU·WNKIGP 6GORGNWPFYKTFXQPYGKDNKEJGT(KIWTDGMT·P\V42% 5GJTUEJÌP



&KG/ÒP\UV·VVGKUVPKEJVIGUKEJGTV

8619

8618





1,5:1

1,5:1

8618

 HÒT &KXWU #WIWUVWU “&WRQPFKWU  4QO  I -QRH N OKV 5VTCJNGPDKPFG.KXKC UKV\V N   OKV-QTP·JTGPWPFNCPIGT(CEMGN$/%%QJ #WIWUVWU 4+%w  )TÒPDTCWPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



 HÒT #PVQPKC Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV JTGPMTCP\#PVQPKC UVGJV CNU   %QPUVCPVKCXXOKV(CEMGNWPF(ÒNNJQTP$/%%QJ4+%w  4-TCV\GTCWHFGO#XGTUHCUVXQT\ÒINKEJ  #PVQPKC FKG ,ÒPIGTG GKPG 6QEJVGT FGU /CTEWU #PVQPKWU WPF FGT 1EVCXKC YCT FKG /WVVGT FGU %NCWFKWU %CNKIWNC   JCVVGUKGKO,CJT\WO5GNDUVOQTFIG\YWPIGP

235


RÖMISCHE KAISERZEIT

8620



8621

HÒT#ITKRRKPCOCVGT“5GUVGT\4QOI&TCRKGTVG$ÒUVGT5%$/%%QJ 4+%w  4&WPMNG2CVKPC2QTVT·VXQPHGKPGO5VKN(GNFGTNGKEJVIGIN·VVGVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  #ITKRRKPC OCVGT YCT FKG 6QEJVGT FGU #ITKRRC WPF FGT ,WNKC FGT 6QEJVGT FGU #WIWUVWU 5KG JGKTCVGVG )GTOCPKEWU   0CEJFGO6QFGKJTGU/CPPGUYWTFGUKGXQP6KDGTKWUPCEJ2CPFCVGTKCXGTDCPPVYQUKGCO1MVQDGTXGTJWP IGTVUGKPUQNN



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT5%$/%%QJ4+%w  4)TÒPG2CVKPC(GNFGTNGKEJVIGIN·VVGVXQT\ÒINKEJ



8623

8622

8622



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT5%$/%%QJ4+%w  4&WPMNG2CVKPCGVYCUMQTTQFKGTVUGJTUEJÌP



WPF#ITKRRKPCHKNKCÔ#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\&TCRKGTVG$ÒUVGT OKVJTGPMTCP\$/%%CNKEQ%QJ4+%w 4(CUVUGJTUEJÌP 



&KGLÒPIGTG#ITKRRKPC6QEJVGTFGU)GTOCPKEWUYWTFGKP1RRKFWO7DKQTWOIGDQTGP&CJGTNKG­UKGFKG5VCFVKO ,CJT\WT%QNQPKC%NCWFKC#TC#ITKRRKPGPUKWOFGOJGWVKIGP-ÌNPGTJGDGP

1,5:1



8624

1,5:1

Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\&TCRKGTVG$ÒUVGTOKVJTGPMTCP\$/% %QJ4+%w 44)WVGUUGJTUEJÌP



'ZGORNCTFGT#WMVKQP0#%<ÒTKEJ0T

8625 1,5:1



Õ%KUVQRJQT'RJGUQU +QPKC I-QRHTOKV.QTDGGTMTCP\&TCRKGTVG$ÒUVGT42% 42T·EJVKIG2QTVT·VUMN2T·IGUEJY·EJGXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI  'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

236

1,5:1


RÖMISCHE KAISERZEIT

8627

8626



 HÒT 0GTQ %NCWFKWU &TWUWU “5GUVGT\  4QO  I -QRH N%NCWFKWU UKV\V N OKV <YGKI   FCTWPVGT9CHHGP$/%%QJ4+%w 4)TÒPG2CVKPCUGJTUEJÌP





“5GUVGT\  4QO  I -QRH N KO (GNF T TGEJVGEMKIGT )GIGPUVGORGN 0%#24%NCWFKWU   UKV\VNOKV<YGKIFCTWPVGT9CHHGP$/%%QJ4+%w)GIGPUVGORGN5NI2CPIGTN$/% %QJ4+%w 4$TCWPG2CVKPCHCUVUGJTUEJÌP



&KG5EJTKHVFGU)GIGPUVGORGNUKUVYQJNHQNIGPFGTOC­GPCWH\WNÌUGP0 WOOWU % CGUCTG # WIWUVQ 24 QDCVWU &GT )GIGPUVGORGNYWTFGXGTOWVNKEJKPHNCXKUEJGT<GKVCPIGDTCEJV

8628

8628



1,5:1

“5GUVGT\  4QO  I -QRH N%NCWFKWU UKV\V N OKV <YGKI FCTWPVGT 9CHHGP $/%    %QJ4+%w 4&WPMNG2CVKPCUGJTUEJÌP

8629



8630 1,5:1



HÒT$TKVCPPKEWU“U5O[TPC5VGRJCPGRJQTQU2JKNKUVQUWPF5VTCVGIQU'KMCFKQUI&TC RKGTVG$ÒUVGT0KMGIGJVTOKV6TQRJ·G42% 44(CUVUGJTUEJÌPUEJÌP



$TKVCPPKEWUFGT5QJPFGU%NCWFKWUWPFFGT/GUUCNKPCYWTFGXQP0GTQGTOQTFGV



HÒT0GTQÔ#WTGWU4QOI&TCRKGTVG$ÒUVGN2TKGUVGTIGT·VG$/%%CNKEQ %QJ4+%w 4(CUVUGJTUEJÌP  &CU 5VÒEM HGKGTV FKG #WHPCJOG 0GTQU KP FKG XKGT ITQ­GP 2TKGUVGTMQNNGIKGP 2QPVKHKEGU #WIWTGP 3WKPFGEKOXKTK   UCETKUHCEKGPFKUWPF5GRVGOXKTKGRWNQPGU

8631

8632 1,5:1



0GTQ  Ô#WTGWU  4QO  I -QRH T%GTGU UVGJV N OKV JTGP /QJPMWIGN WPF   (CEMGN$/%%CNKEQ%QJ4+%w 45GJTUEJÌP 



Õ&GPCT4QOI-QRHT+P'KEJGPMTCP\':5%$/%%QJ4+%w  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 237


RÖMISCHE KAISERZEIT

8633



8634

8633

“&WRQPFKWUWO4QOI-QRHTOKV5VTCJNGPDKPFG/CEGNNWO/CIPWO$/%%QJ 4+%w (GNFGTIGIN·VVGV#XGTUNGKEJVÒDGTCTDGKVGVUGJTUEJÌP

&GTITQ­G4WPFDCWFGTFGP.GDGPUOKVVGNOCTMVDGJGTDGTIVGUVCPFCWHFGO%CGNKWUWPFYWTFGIGYGKJV





Ô#WTGWU  4QO  I -QRH T4QOC UVGJV TOKV5EJKNF$/%%CNKEQ%QJ 4+%w (CUVUGJTUEJÌPUGJTUEJÌP 

8635

8636



“5GUVGT\ WO  4QO  I -QRH T OKV .QTDGGTMTCP\ #GIKU N6TKWORJDQIGP $/%    %QJ4+%w &WPMGNITÒPG2CVKPCUGJTUEJÌP





“5GUVGT\ WO  4QO  I -QRH T OKV .QTDGGTMTCP\ #GIKU N6TKWORJDQIGP $/%    %QJ4+%w $TCWPG2CVKPCMQTTQFKGTVUGJTUEJÌPHCUVUGJTUEJÌP



8638

8637



“5GUVGT\ WO  4QO  I -QRH T OKV .QTDGGTMTCP\ #GIKU N0GTQ TGKVGV T DGINGKVGV XQP   GKPGO1HHK\KGTOKV8GZKNNWOKO#DUEJPKVV&'%845+1$/%%QJ4+%w 45GJTUEJÌP





“&WRQPFKWUWO4QOI-QRHTOKV5VTCJNGPDKPFG/CEGNNWO/CIPWO$/%%QJ 4+%w $TCWPG2CVKPC(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌP



&GTITQ­G4WPFDCWFGTFGP.GDGPUOKVVGNOCTMVDGJGTDGTIVGUVCPFCWHFGO%CGNKWUWPFYWTFGIGYGKJV

8639 1,5:1

 238

1,5:1

“&WRQPFKWUWO4QOI-QRHTOKV5VTCJNGPDKPFG8KEVQTKCIGJVNOKV-TCP\WPF2CNO \YGKI$/%%QJ4+%w )TÒPG2CVKPCXQT\ÒINKEJ




RÖMISCHE KAISERZEIT

8642 8641

8640



“&WRQPFKWUWO.WIFWPWOI-QRHTOKV5VTCJNGPDKPFG/CEGNNWO/CIPWO$/% %QJ4+%w &WPMNG2CVKPCUGJTUEJÌP



&GTITQ­G4WPFDCWFGTFGP.GDGPUOKVVGNOCTMVDGJGTDGTIVGUVCPFCWHFGO%CGNKWUWPFYWTFGIGYGKJV



“#UWO4QOI-QRHTOKV5VTCJNGPDKPFG0GTQCNU#RQNNQ%KVJCTQGFWUUVGJVTOKV.[TC $/%%QJ4+%w 44$TCWPG2CVKPCIWVGUUGJTUEJÌP



&GT /ÒP\V[R KUV CWEJ DGK 5WGVQP GTY·JPV 0GTQ       GDGPUQ NKG­ GT 5VCVWGP CWHUVGNNGP FKG KJP CNU GKPGP   5·PIGTFGT\WT-KVJCTCUKPIVFCTUVGNNVGP/KVFKGUGO$KNFNKG­GTCWEJ/ÒP\GPRT·IGP



Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\%QPEQTFKCUKV\VNOKV2CVGTCWPF(ÒNNJQTP $/%%CNKEQ%QJ4+%w (CUUWPIUURWTGPUEJÌPpUGJTUEJÌP



+O ,CJTG  YWTFG 4QO XQP FGO ITQ­GP $TCPF XGTYÒUVGV HÒT FGP 0GTQ UEJNKG­NKEJ FKG UVCFVTÌOKUEJGP %JTKUVGP   XGTCPVYQTVNKEJOCEJVGFQEJFKG)GTÒEJVGFC­0GTQUGNDUVFGP$TCPFNGIGPNKG­XGTUVWOOVGPPKG&KG%QPEQTFKC CNUQ'KPVTCEJVXQPFGTFKG4ÒEMUGKVGFGT/ÒP\GURTKEJVYCTKPFGT4GCNKV·VPKEJVIGIGDGP

8643

1,5:1

1,5:1



Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\)GUEJNQUUGPG 6ÒTGP FGU ,CPWUVGORGNU   $/%%CNKEQ%QJ4+%w  4-N2TÒHUVGNNGPCO4CPFCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  7PVGT0GTQMQPPVGPFKG6ÒTGPFGU,CPWUVGORGNUKP4QOIGUEJNQUUGPYGTFGPFJGUJGTTUEJVG(TKGFGP5EJYKGTKI KUVFKG&CVKGTWPIFKGUGU'TGKIPKUUGUPCEJFGO<GWIPKUFGT/ÒP\GPIGUEJCJGUKO,CJTGPCEJ5WGVQPKO,CJTG

1,5:1



8644

1,5:1

Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\,WRKVGTUKV\VNOKV$NKV\WPF<GRVGT$/% %CNKEQ%QJ4+%w 8QT\ÒINKEJ  &GO+WRRKVGT%WUVQUYCT0GTQPCEJFGT'PVFGEMWPIFGT8GTUEJYÌTWPIFGU2KUQKO#RTKN 6CEKVWU#PP:8 HH DGUQPFGTUXGTDWPFGP

8645

8646



Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\5GEJUU·WNKIGT 4WPFVGORGN FGT 8GUVC KO   +PPGTGP-WNVUVCVWGFGT)ÌVVKP$/%%CNKEQ%QJ4+%w 5EJÌPpUGJTUEJÌP 



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\-CKUGT WPF -CKUGTKP UVGJGP N $/%    %QJ4+%w 45GJTUEJÌP

&GT8GUVCVGORGNYCTKOITQ­GP$TCPF4QOU\GTUVÌTVYQTFGPYWTFGLGFQEJPQEJWPVGT0GTQPGWGTTKEJVGV



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

239


RÖMISCHE KAISERZEIT

8647

8648



“5GUVGT\4QOI-QRHNOKV.QTDGGTMTCP\,CPWUVGORGNOKVIGUEJNQUUGPGP6ÒTGP$/% %QJ4+%w $TCWPG2CVKPCUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\4QOC UKV\V N CWH 9CHHGP OKV 8KEVQTKC WPF   2CTC\QPKWO$/%%QJ4+%wXCT  $TCWPG2CVKPC-QTTQUKQPUUVGNNGPCWHFGO#XGTUUGJTUEJÌP



8649



8650

“5GUVGT\  .WIFWPWO  I -QRH N OKV .QTDGGTMTCP\ WPVGP )NQDWU#PPQPC UVGJV T OKV   (ÒNNJQTP FCXQT UKV\V %GTGU N OKV JTGP WPF (CEMGN FC\YKUEJGP #NVCT OKV /QFKWU KO *KPVGTITWPF   2TQTC$/%%QJ4+%w 4&WPMNG2CVKPCMQTTQFKGTVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T



“5GUVGT\.WIFWPWOI-QRHNOKV.QTDGGTMTCP\%GTGUUKV\VN#PPQPCUVGJVTFC\YK UEJGP(ÒNNJQTP/QFKWUWPF5EJKHHUDWI$/%%QJ4+%w  )TÒPG2CVKPCVGKNYGKUGMQTTQFKGTVUGJTUEJÌP



8651

1,5:1



1,5:1

“5GUVGT\WO.WIFWPWOI-QRHNOKV.QTDGGTMTCP\*CHGPXQP1UVKCQDGP2JCTQUOKV 0GRVWPUVCVWG KO *CHGPDGEMGP CEJV 5EJKHHG WPVGP NCIGTV 6KDGT N CWH &GNRJKP IGUVÒV\V $/%    %QJXGTIN4+%w 44&WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJGU'ZGORNCT 

8652

 240

“#U WO  4QO  I -QRH N OKV .QTDGGTMTCP\,CPWUVGORGN OKV IGUEJNQUUGPGP 6ÒTGP   $/%%QJ4+%w &WPMNG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT




RÖMISCHE KAISERZEIT

8653 1,5:1



1,5:1

“#U WO  4QO  I -QRH T OKV .QTDGGTMTCP\8KEVQTKC IGJV N WPF J·NV 5EJKNF OKV 5234   $/%%QJ4+%w &WPMNG2CVKPCHCUVXQT\ÒINKEJ

8654



8655

1,5:1

1,5:1



Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\-CKUGTOKV2CVGTCWPF<GRVGTWPF-CKUGTKP OKV2CVGTCWPF(ÒNNJQTPUVGJGPN$/%%CNKEQ%QJ4+%w 5GJTUEJÌP





Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\5CNWUUKV\VNOKV2CVGTC$/%%CNKEQ %QJ4+%w #W­GTIGYÌJPNKEJGU2QTVT·VUGJTUEJÌP



8656





8657

“5GUVGT\ WO  .WIFWPWO  I -QRH T OKV .QTDGGTMTCP\-CKUGT UVGJV N WPF DGITÒ­V FTGK   5QNFCVGPFCJKPVGT1HHK\KGTKO*KPVGTITWPF4WPFVGORGN$/%%QJ4+%w  4)TÒPG2CVKPCOKPMQTTQFKGTVHCUVUGJTUEJÌP



“5GUVGT\.WIFWPWOI-QRHNOKV.QTDGGTMTCP\4QOCUKV\VNOKV8KEVQTKCWPF2CTC\Q PKWO$/%%QJ4+%w &WPMGNITÒPG2CVKPCUGJTUEJÌP



8658

8659

8658 1,5:1



“#U4QOI-QRHTOKV.QTDGGTMTCP\,CPWUVGORGNOKVIGUEJNQUUGPGP6ÒTGP$/%XGTIN %QJ4+%wXGTIN 8QT\ÒINKEJGU'ZGORNCTOKVJGTXQTTCIGPFGO2QTVT·V



“#U.WIFWPWOI-QRHT8KEVQTKCIGJVNOKV5EJKNF$/%%QJ4+%w  5GJTUEJÌPUEJÌP

  241


RÖMISCHE KAISERZEIT

8660 1,5:1

1,5:1



“#UWO.WIFWPWOI-QRHN8KEVQTKCIGJVNOKV5EJKNF$/%%QJ4+%w W­GTUVUGNVGPKPFKGUGT'TJCNVWPI-CDKPGVVUVÒEM*GTXQTTCIGPFGU2QTVT·V5GJTCVVTCMVKXGU XQT\ÒINKEJGU'ZGORNCTOKVITÒPDTCWPGT2CVKPC



'ZGORNCT FGT 5COONWPI 'IQP $GEMGPDCWGT #WMVKQP $CPMJCWU #WHJ·WUGT  /ÒPEJGP  0T  FQTV 6KVGN   UVÒEMFGT#WMVKQP

8662

8661

8661

1,5:1

1,5:1



“#UWO.WIFWPWOI-QRHN8KEVQTKCIGJVNOKV5EJKNF$/%%QJ4+%w $TCWPG2CVKPCUGJTUEJÌP



Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\+822+6'4%85615 ,WRKVGT UKV\V N OKV   $NKV\WPF<GRVGT$/%%CNKEQ%QJ4+%w  (CUVXQT\ÒINKEJGU'ZGORNCTOKVCVVTCMVKXGO2QTVT·V 



&GO+WRRKVGT%WUVQUYCT0GTQPCEJFGT'PVFGEMWPIFGT8GTUEJYÌTWPIFGU2KUQKO#RTKN 6CEKVWU#PP:8HH  DGUQPFGTUXGTDWPFGP

8663

8664

1,5:1

1,5:1



Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\+822+6'4%85615 ,WRKVGT UKV\V N OKV   $NKV\WPF<GRVGT$/%%CNKEQ%QJ4+%w (CUVXQT\ÒINKEJ 



 HÒT &KXWU %NCWFKWU Ô#WTGWU  4QO  I -QRH NOKV.QTDGGTMTCP\6TKWORJCNSWCFTKICT $/%%CNKEQ%QJ4+%w 4*GPMGNURWT5EJÒTHURWTGPCWHFGO4GXGTUUGJTUEJÌP



&GT4GXGTUGTKPPGTVCPFGP6TKWORJFGP%NCWFKWUKO,CJTGCPN·­NKEJFGT'TQDGTWPI$TKVCPPKGPUIGHGKGTVJCVVG

1,5:1



8665

1,5:1

WPF#ITKRRKPCHKNKCÕ&GPCT4QOI$GKFGT$ÒUVGPT&KXWU%NCWFKWUWPF&KXWU#W IWUVWUKP'NGHCPVGPSWCFTKICN$/%%QJ4+%w 445GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC  &KG'NGHCPVGPSWCFTKICGTUEJGKPVCWHLWNKUEJENCWFKUEJGP2T·IWPIGPUVGVUPWTOKVCWUFTÒEMNKEJGO$G\WICWH#WIWUVWU

242


RÖMISCHE KAISERZEIT

8666 1,5:1



1,5:1

$6GVTCFTCEJOG ,CJT     #PVKQEJKC 5[TKC   I -QRH T OKV .QTDGGTMTCP\&TCRKGTVG   $ÒUVGT2TKGWT42% W­GTUVUGNVGPKPFKGUGT'TJCNVWPI 2T·EJVKIG2QTVT·VUXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC  'ZGORNCT FGT #WMVKQP 5VGTPDGTI  <ÒTKEJ  0T  WPF FGT #WMVKQP *GUU.GW  <ÒTKEJ  0T    #ITKRRKPC HKNKC YWTFG  P %JTKP-ÌNPIGDQTGP+JT\W'JTGPGTJKGNVFKG5VCFVFGP0COGP%QNQPKC%NCWFKC#TC #ITKRRKPGPUKWO

1,5:1



8667

1,5:1

 HÒT #ITKRRKPC HKNKC “U *[RCKRC .[FKC   I &TCRKGTVG $ÒUVG T-WNVUVCVWG FGT #TVGOKU XQP   *[RCKRCXX42% 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPC#XGTUNGKEJVFG\GPVTKGTVUGJTUEJÌP



&GT42%MGPPVPWT\YGK'ZGORNCTG

8669

8668

1,5:1

8670

1,5:1



8KPFGZÕ&GPCTICNNKUEJG/ÒP\UV·VVGI5#.85)'0'4+5*8/#0+8KEVQTKCUVGJVN CWH)NQDWUOKV-TCP\WPF2CNO\YGKI5234KP'KEJGPMTCP\$/%/CTVKP4+%w  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



Õ&GPCTICNNKUEJG/ÒP\UV·VVGI5#.85)'0'4+5*8/#0+8KEVQTKCUVGJVNCWH)NQDWU OKV-TCP\WPF2CNO\YGKI5234KP'KEJGPMTCP\$/%/CTVKP4+%w  4(GKPG6ÌPWPIUGJTUEJÌP



)CNDCÕ&GPCTURCPKUEJG/ÒP\UV·VVG 6CTTCEQ! I-QRHNOKV.QTDGGTMTCP\WPVGP )NQDWU.KDGTVCUUVGJVNOKV2KNGWUWPF<GRVGT$/%%QJXGTIN4+%w  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP





8671

8672



“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\8KEVQTKC IGJV T OKV -TCP\ WPF   2CNO\YGKI$/%%QJ4+%w 4$TCWPG2CVKPCHCUVUGJTUEJÌPIGTKPIGTJCNVGP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\%QPEQTFKCUKV\VNOKV1NKXGP\YGKIWPF<GR VGT$/%%QJ4+%w 5EJÌPpUGJTUEJÌP

 243


RÖMISCHE KAISERZEIT

8674

8673



“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\.KDGTVCU UVGJV N OKV 2KNGWU WPF   <GRVGT$/%%QJ4+%w  &WPMGNITÒPG2CVKPCHGKPGU2QTVT·VIWVGUUGJTUEJÌPUGJTUEJÌP 



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\52341$%+8 5'4 KP 'KEJGPMTCP\   $/%5#PO%QJ4+%w &WPMNG2CVKPCHCUVUGJTUEJÌP



8676

8675



“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\+P 'KEJGPMTCP\ 52341$%+8   5'4$/%5#PO%QJ4+%w &WPMGNITÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





“&WRQPFKWU  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\2CZ UVGJV N OKV <YGKI WPF   %CFWEGWU$/%%QJ4+%w $TCWPG2CVKPC4GXGTUNGKEJVMQTTQFKGTVUGJTUEJÌP



8678

8677 1,5:1

1,5:1



“&WRQPFKWU4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\+P'KEJGPMTCP\52341$%+8 5'4$/%%QJ4+%w $TCWPG2CVKPCOKPMQTTQFKGTVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Õ&GPCT4QOI-QRHT52341$%5KP-TCP\$/%%QJ4+%w  8QT\ÒINKEJGU2TCEJVGZGORNCT

8679

8680

8681

1,5:1



Õ&GPCT4QOI-QRHT52341$%5KP-TCP\$/%%QJ4+%w

5GJTUEJÌP



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\.KXKCUVGJVNOKV2CVGTCWPF<GRVGT$/%%QJ 4+%w 4(CUVUGJTUEJÌP

 

8681

 

.KXKCYCTGKPGGPVHGTPVG8GTYCPFVG)CNDCU5KGDGFCEJVGKJPKPKJTGO6GUVCOGPVOKV/KNNKQPGP5GUVGT\GP5KGJCVVG FKG 5WOOG CNNGTFKPIU PWT KP <CJNGP IGUEJTKGDGP UQ FC­ 6KDGTKWU FKG 5WOOG CWH  5GUVGT\GP JGTCDUGV\VG   YQTCWH)CNDCFKG'TDUEJCHVCWUUEJNWI

 244

Õ3WKPCT.WIFWPWOI-QRHTOKV.QTDGGTMTCP\8KEVQTKCUVGJVTCWH)NQDWUOKV-TCP\WPF 2CNO\YGKI$/%%QJ4+%w 45GJTUEJÌP




RÖMISCHE KAISERZEIT

8684

8683

8682

1,5:1

1,5:1



1VJQÕ&GPCT4QOI-QRHT5GEWTKVCUUVGJVNOKV<YGKIWPF<GRVGT$/%%QJ 4+%w 4)WVGUUGJTUEJÌP





Õ&GPCT4QOI-QRHT5GEWTKVCUUVGJVNOKV-TCP\WPF<GRVGT$/%%QJ4+%w 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ&GPCT4QOI-QRHT5GEWTKVCUUVGJVNOKV-TCP\WPF<GRVGT$/%%QJ4+%w )WVGU2QTVT·VHGKPG2CVKPCUGJTUEJÌPHCUVUGJTUEJÌP



8685

8687

1,5:1

8686

1,5:1



Õ&GPCT4QOI-QRHT5GEWTKVCUUVGJVNOKV-TCP\WPF<GRVGT$/%%QJ4+%w 5GJTUEJÌP





Õ&GPCT4QOI-QRHT%GTGUUVGJVNOKVJTGPWPF(ÒNNJQTP$/%%QJ4+%w#PO 4(CUVUGJTUEJÌP





Õ&GPCT 4QO  I -QRH T8KEVQTKC UVGJV N CWH )NQDWU OKV -TCP\ WPF 2CNO\YGKI $/%    %QJ4+%w 44)WVGUUGJTUEJÌP



1,5:1



8688

1,5:1

8KVGNNKWUÔ#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\$ÒUVGPFGU5QJPUWPFFGT6QEJVGT FGU8KVGNNKWUGKPCPFGTIGIGPÒDGT$/%%CNKEQ%QJ4+%w  442T·EJVKIGU2QTVT·VUGJTUEJÌPXQT\ÒINKEJ  &KG 4ÒEMUGKVG FKGUGU UGNVGPGP 5VÒEMGU \GKIV FKG DGKFGP -KPFGT CWU FGT \YGKVGP 'JG FGU 8KVGNNKWU 8KVGNNKWU )GTOC   PKEWU WPF 8KVGNNKC 8KVGNNKWU )GTOCPKEWU FGT XQP UGKPGO 8CVGT KO #NVGT XQP UKGDGP ,CJTGP KP FGP 4CPI GKPGUMCK UGTNKEJGP 2TKP\GP GTJQDGP YQTFGP YCT YWTFG KO ,CJTG  XQP /WEKCPWU GTOQTFGV 8KVGNNKC ÒDGTNGDVG FGP 5VWT\   KJTGU8CVGTUWPFYWTFGXQP8GURCUKCPWUOKVGKPGTTGKEJGP/KVIKHVXGTUGJGPKPFCU*CWUFGT#PVQPKKXGTJGKTCVGV

8689



Ô#WTGWU 4QO  I -QRH T OKV .QTDGGTMTCP\$ÒUVGP FGU 5QJPU WPF FGT 6QEJVGT FGU 8KVGNNKWU   GKPCPFGTIGIGPÒDGT$/%%CNKEQ%QJ4+%w 445GJTUEJÌP  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

245


RÖMISCHE KAISERZEIT

8690

1,5:1



1,5:1

Õ&GPCT4QOI-QRHT%QPEQTFKCUKV\VNOKV2CVGTCWPF(ÒNNJQTP$/%%QJ4+%w 2T·EJVKIGU2QTVT·VXQT\ÒINKEJ

8691

8692

8693



8694



Õ&GPCT 4QO  I -QRH T OKV .QTDGGTMTCP\8GUVC UKV\V T OKV 2CVGTC WPF <GRVGT $/%    %QJ4+%w 5GJTUEJÌP





Õ&GPCT 4QO  I -QRH T OKV .QTDGGTMTCP\8GUVC UKV\V T OKV 2CVGTC WPF <GRVGT $/%    %QJ4+%w (CUVUGJTUEJÌP





Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\&TGKHW­FCTCWH&GNRJKPFCTWPVGT4CDG$/% %QJ4+%w )WVGUUGJTUEJÌP





Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\&TGKHW­FCTCWH&GNRJKPFCTWPVGT4CDG$/% %QJ4+%w 7PTGIGNO·­KIGT5EJTÌVNKPIUGJTUEJÌP



'ZGORNCTFGT#WMVKQP0#%0<ÒTKEJ0T

8695

8695 1,5:1



“&WRQPFKWU 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\%QPEQTFKC UKV\V N OKV 2CVGTC WPF   (ÒNNJQTP$/%%QJ4+%w 4$TCWPG2CVKPCMN5EJTÌVNKPIUHGJNGTUGJTUEJÌPpXQT\ÒINKEJ  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

8696

 246

“#U URCPKUEJG /ÒP\UV·VVG 6CTTCEQ!   I -QRH N OKV .QTDGGTMTCP\*CPFUEJNCI $/%    %QJ4+%w &WPMGNITÒPG2CVKPCUGJTUEJÌP




RÖMISCHE KAISERZEIT

8697

8698

1,5:1

1,5:1



8GURCUKCPWUÔ#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\#GSWKVCUUVGJVNOKV 9CCIGWPF<GRVGT$/%%CNKEQ%QJ4+%  )WVGU2QTVT·VCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\2CZUKV\VNOKV<YGKIWPF<GRVGT$/% %CNKEQ%QJ4+% (CUUWPIUURWTGPHCUVUGJTUEJÌP



8700

8699

8701

8700 1,5:1

8699 1,5:1



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\2CZUKV\VNOKV<YGKIWPF%CFWEGWU$/% %QJ4+% (CUVXQT\ÒINKEJUGJTUEJÌP





Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\6TCWGTPFG ,WFCGC UKV\V T FCJKPVGT 6TQ   RJ·G$/%%QJ4+% (GKPG2CVKPC&TWEMUVGNNGUQPUVXQT\ÒINKEJ



8GURCUKCP DGHCPF UKEJ KP #NGZCPFTKC CNU GT \WO -CKUGT CWUIGTWHGP YWTFG 'T YCT 1DGTMQOOCPFKGTGPFGT KO LÒFK   UEJGP-TKGIFGPUGKP5QJP6KVWUUKGITGKEJ\W'PFGHÒJTVG



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\6TCWGTPFG ,WFCGC UKV\V T FCJKPVGT 6TQ   RJ·G$/%%QJ4+% /CTMCPVGU2QTVT·VUGJTUEJÌP

8702



8703

8704



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\6TCWGTPFG ,WFCGC UKV\V T FCJKPVGT 6TQ   RJ·G$/%%QJ4+% 5GJTUEJÌP





Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\6TCWGTPFG ,WFCGC UKV\V T FCJKPVGT 6TQ   RJ·G$/%%QJ4+% (CUVUGJTUEJÌP





Ô#WTGWU.WIFWPWOI-QRHTOKV.QTDGGTMTCP\#GSWKVCUUVGJVNOKV9CCIGWPF<GRVGT $/%%CNKEQ%QJXGTIN &GPCT 4+% 5EJÌPpUGJTUEJÌP 

8705

8706



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\,WF·CUKV\VNWPVGT2CNOGFCJKPVGTIGHGUUGN VGT,WFGNWPFT9CHHGP$/%%QJ4+% 4&WPMGNITÒPG2CVKPCUGJTUEJÌP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\4QOCUVGJVNOKV8KEVQTKCWPF5RGGT$/% %QJ4+% $TCWPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP

 247


RÖMISCHE KAISERZEIT

8707



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\/CTU IGJV T OKV 5RGGT WPF 6TQRJ·G   $/%XCT%QJ4+% $TCWPG2CVKPCIWVGUUGJTUEJÌPUEJÌP

8708





8709

1,5:1

Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\8GUVCVGORGN \YKUEJGP FGP 5VCVWGP \YGKGT   )ÌVVKPPGPKO+PPGTGP5VCVWGFGT8GUVC$/%%CNKEQ%QJ4+%  44+PVGTGUUCPVG#TEJKVGMVWTFCTUVGNNWPI 9KP\-TCV\GTCWHFGT8QTFGTUGKVGUEJÌPpUGJTUEJÌPUGJTUEJÌP  &CU5VÒEMFÒTHVGFGP9KGFGTCWHDCWFGU6GORGNUPCEJFGOPGTQPKUEJGP$TCPFHGKGTP



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\)GHNÒIGNVGT %CFWEGWU $/%  %QJ    4+% (CUVXQT\ÒINKEJ



8710 1,5:1



1,5:1

“&WRQPFKWU4QOI-QRHTOKV5VTCJNGPDKPFG(GNKEKVCUUVGJVNOKV%CFWEGWUWPF(ÒNN JQTP$/%%QJ4+% -CDKPGVVUVÒEM*GTXQTTCIGPFGU2QTVT·VKPJQJGO4GNKGH &WPMGNITÒPG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT  'ZGORNCTFGT5COONWPI'IQP$GEMGPDCWGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

8711

8712

8713

8712



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\#FNGTCWH#NVCT$/%%QJ4+%C (GKPG6ÌPWPIUGJTUEJÌP





“#U  4QO  I -QRH T OKV .QTDGGTMTCP\5RGU IGJV N OKV $NWOG $/%  %QJ    4+%C &WPMGNITÒPG2CVKPCOKPMQTTQFKGTVUGJTUEJÌPGU'ZGORNCTOKVHGKPGO2QTVT·V





 OKV 6KVWU WPF &QOKVKCPWU Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\6KVWU WPF   &QOKVKCPWUUKV\GPNOKV<YGKIGP$/%#PO%QJ4+% 45GJTUEJÌP



248


RÖMISCHE KAISERZEIT

8714

1,5:1

8715

1,5:1



Õ&GPCT  'RJGUWU  I -QRH T OKV .QTDGGTMTCP\6KVWU WPF &QOKVKCPWU UVGJGP X X OKV   2CVGTCG$/%%QJ4+% 4(CUVXQT\ÒINKEJ





WPF6KVWUÕ&KFTCEJOG4QOHÒT%CRRCFQEKCI$GKFGTUGKVU-QRHTOKV.QTDGGTMTCP\ 42%5[F #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



8716





 HÒT 6KVWU “5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\/CTU IGJV T OKV 5RGGT WPF   6TQRJ·G$/%%QJXGTIN4+%  4$TCWPG2CVKPC4GXGTUNGKEJVMQTTQFKGTVIWVGUUGJTUEJÌPUEJÌP



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\(QTVWPCUVGJVNOKV<YGKI5VGWGTTWFGTCWH )NQDWUWPF(ÒNNJQTP$/%%QJ4+% $TCWPG2CVKPCHCUVUGJTUEJÌP



1,5:1



8717

8718

1,5:1

Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\(QTVWPCUVGJVNOKV5VGWGTTWFGTWPF(ÒNNJQTP CWH$CUKU$/%%CNKEQ%QJXGTIN4+%C  5GNVGPKPFKGUGT'TJCNVWPI9KP\-TCV\GTXQT\ÒINKEJGU2TCEJVGZGORNCT 

8720

8719

8719 1,5:1



“&WRQPFKWU4QOI-QRHTOKV5VTCJNGPDKPFG(GNKEKVCUUVGJVNOKV%CFWEGWUWPF(ÒNN JQTP$/%%QJ4+%  /CTMCPVGU2QTVT·V)TÒPG2CVKPC4GXGTUNGKEJVMQTTQFKGTVXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“#U  4QO  I -QRH T OKV .QTDGGTMTCP\8+%614+# 0#8#.+5 8KEVQTKC UVGJV T CWH   2TQTCOKV-TCP\WPF2CNO\YGKI$/%%QJXGTIN4+%C )TÒPG2CVKPCUGJTUEJÌP



/ÌINKEJGTYGKUGYKTFJKGTFGT5GGUKGIIGHGKGTVFGP8GURCUKCPU6TWRRGPY·JTGPFFGULÒFKUEJGP-TKGIGUCWHFGO5GG )GPG\CTGVJGTTKPIGPMQPPVGP (NCXKWU,QUGRJWU,ÒFKUEJGT-TKGI+++: 

249


RÖMISCHE KAISERZEIT

1,5:1



8721 1,5:1

Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\#PPQPC UKV\V N OKV JTGP $/%    %CNKEQC%QJ4+% #VVTCMVKXGU'ZGORNCTUGJTUEJÌP 

8722 1,5:1

1,5:1



HÒT&QOKVKCPWUÔ#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\2TKP\TGKVGVNOKVGTJQDG PGT4GEJVGPWPF<GRVGT$/%%CNKEQ%QJ4+%  $GCTDGKVWPIUURWTGPCO4CPFIWVGUUGJTUEJÌP 

8723



“#U4QOI-QRHTOKV.QTDGGTMTCP\2CZUVGJVNOKV%CFWEGWUWPF<YGKICP%KRRWU IGNGJPV$/%#PO%QJ4+%C $TCWPG2CVKPCUGJTUEJÌP

1,5:1





8724 1,5:1

Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\2CTVJGT MPKGV T OKV TÌOKUEJGT 5VCPFCTVG   $/%%CNKEQ%QJ4+% 45EJÒTHURWTCWHFGO4GXGTUHCUVXQT\ÒINKEJ  &KG 4ÒEMUGKVGPFCTUVGNNWPI  GKP XQP #WIWUVWU ÒDGTPQOOGPGT 6[R   DG\KGJV UKEJ CWH GKP JÌEJUV DGOGTMGPUYGTVGU   'TGKIPKU GKPG )GUCPFVUEJCHV FGU 2CTVJGTMÌPKIU 8QNQICUGU DCV 8GURCUKCPWU CNUQ CWUIGTGEJPGV FGP TÌOKUEJGP   'TDHGKPFWOOKNKV·TKUEJG*KNHGIGIGPFKG#NCPGP&QOKVKCPWUDGOÒJVGUKEJWOFKGUGU-QOOCPFQ

8726

8725 8726



HÒT&QOKVKCPWUWPF#ITKRRC++“U,CJTFGU#ITKRRC++  %CGUCTGC2CPGCU +WFCGC  I-QRHFGU&QOKVKCPWUTOKV.QTDGGTMTCP\0KMGUVGJVNWPFUEJTGKDVCWHGKPGP5EJKNF42% )TÒPG2CVKPCHCUVXQT\ÒINKEJ 



HÒT#ITKRRC++“U,CJTFGU#ITKRRC++  %CGUCTGC2CPGCU +WFCGC I-QRHFGU 8GURCUKCPWUTOKV.QTDGGTMTCP\6[EJGUVGJVNOKVJTGPWPF(ÒNNJQTP42%  5GJTUGNVGPDGUQPFGTUKPFKGUGT'TJCNVWPI &WPMNG2CVKPCJGTXQTTCIGPFGU2QTVT·VUGJTUEJÌPpXQT\ÒINKEJ

250




RÖMISCHE KAISERZEIT

8727

8728

8728



6KVWU  Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\'NGHCPV N $/%  %QJ    4+%C (CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\8GURCUKCPWU WPF 6KVWU UVGJGP GKPCPFGT   IGIGPÒDGTWPFJCNVGP)NQDWUÒDGT5VGWGTTWFGT$/%%QJ4+%  -QTTQFKGTVHCUVXQT\ÒINKEJ



8730

8729

8729

1,5:1

1,5:1



“#U  4QO  I -QRH N OKV .QTDGGTMTCP\#GVGTPKVCU UVGJV T OKV <GRVGT WPF (ÒNNJQTP   $/%%QJ4+%D &WPMNG2CVKPCIWVGUUGJTUEJÌP





 HÒT &KXWU 8GURCUKCPWU Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\<YGK %CRTK   EQTPGFCTÒDGT5EJKNFOKVFGT#WHUEJTKHV5%FCTWPVGT)NQDWU$/%%QJ4+%  #VVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



&KG4GXGTUFCTUVGNNWPIKUVXQPGKPGO\W'JTGPFGU&KXWU#WIWUVWUWPVGT6KDGTKWUIGRT·IVGP5GUVGT\GPÒDGTPQOOGP /ÌINKEJGTYGKUGYCTFGT%CRTKEQTPCWEJFCU5VGTPDKNFFGU8GURCUKCPWU  &KG8QTUVGNNWPIUGKPGT-QPUGMTCVKQPFÒTHVG8GURCUKCPCOÒUCPVIGHWPFGPJCDGP5QUCIVFGT-CKUGTDGK5WGVQPCNUGT UVKTDV8CGRWVQFGWUHKQ 1YGJKEJINCWDGKEJYGTFGGKP)QVV 

8732



8731

8733

 HÒT &QOKVKCPWU Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\-QTKPVJKUEJGT *GNO CWH   6JTQP RWNXKPCTFGT/KPGTXC $/%%CNKEQ%QJ4+% 45EJÌPpUGJTUEJÌP  &KGUGU 5VÒEM KUV CPN·­NKEJ FGT UWRRNKECVKQPGU $KVVHGUVG  FGU ,CJTGU  IGRT·IV YQTFGP FKG PCEJ FGO #WUDTWEJ FGU   8GUWXU XQO 5GPCV CPIGQTFPGV YQTFGP YCTGP $GK FGP UWRRNKECVKQPGU D\Y NGEVKUVGTPKC UVGNNVG OCP RWNXKPCTKC  

)ÌVVGTVJTQPG HÒTFKG)ÌVVGTCWHFKGOCPOKV#VVTKDWVGPFGT)ÌVVGTXGTUCJ



HÒT,WNKC6KVK“&WRQPFKWU4QOI&TCRKGTVG$ÒUVGT%GTGUUVGJVNOKVJTGPWPF(CEMGN $/%%QJ4+% 4&WPMNG2CVKPCNGKEJVIGIN·VVGVHCUVUGJTUEJÌP





4GUVKVWVKQPHÒT&KXWU#WIWUVWU“#UVJTCMKUEJG/ÒP\UV·VVGI-QRHNOKV5VTCJNGP DKPFG#FNGTUVGJVNCWH)NQDWU-QRHT$/%%QJ4+%  44)TÒPG2CVKPCUGJTUEJÌPHCUVUGJTUEJÌP

 251


RÖMISCHE KAISERZEIT

8735

1,5:1

1,5:1



8736

8734

&QOKVKCPWU  Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\+822+6'4 %105'4   8#614#FNGTUVGJVTCWH$NKV\-QRHN$/%%QJ4+% 8QT\ÒINKEJ



'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T  &GO,WRKVGT%QPUGTXCVQTHÒJNVGUKEJ&QOKVKCPWUDGUQPFGTUXGTRHNKEJVGVGTYGKJVGKJOGKPGP6GORGNWPFGKPGP#NVCT

6CE * +++   *KGTOKV FCPMVG &QOKVKCP FGO )QVV HÒT UGKPG 4GVVWPI CWU FGO %CRKVQN KO ,CJTG  0CEJ FGT   #DFCPMWPI FGU 8KVGNNKWU YQNNVGP FGUUGP #PJ·PIGT FKG #DFCPMWPI TÒEMI·PIKI OCEJGP WPF ITKHHGP FKG #PJ·PIGT   8GURCUKCPU WPVGT FGPGP CWEJ &QOKVKCP YGKNVG CWH FGO %CRKVQN CP WPF DTCPPVGP GU PKGFGT &QOKVKCP JCVVG UKEJ   UEJQPDGKO$GIKPPFGU#PUVWTOUKO*CWUGGKPGU6GORGNJÒVGTUXGTDQTIGPWPFGPVMCOKO.GKPGPMNGKFGKPGU+UKURTKG UVGTU #P FGT 5VGNNG YQ FCU *CWU FGU 6GORGNJÒVGTU IGUVCPFGP JCVVG NKG­ &QOKVKCP PQEJ CNU %CGUCT GKP MNGKPGU   *GKNKIVWO\W'JTGPFGU,WRKVGT%QPUGTXCVQTGTTKEJVGP



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\5CNWU UKV\V N OKV JTGP WPF /QJPMWIGNP   $/%%QJ4+% (GKPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\&GNRJKPWO#PMGTIGYWPFGP$/%%QJ 4+% (GKPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



8738

8737



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\/KPGTXCIGJVTOKV5RGGTWPF5EJKNF$/% %QJ4+% )TÒPG2CVKPCOKPMQTTQFKGTVUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ #GIKU N-CKUGT UVGJV N OKV 5RGGT FCXQT   MPKGV)GHCPIGPGT)GTOCPGTOKV5EJKNF$/%%QJ4+%  &WPMGNITÒPG2CVKPCUGJTUEJÌP



&CU5VÒEMYWTFGPCEJFGOGTHQNITGKEJGP(GNF\WIFGU-CKUGTIGIGPFKG%JCVVGPIGRT·IV

8739 8740

8740



“#U4QOI-QRHTOKV.QTDGGTMTCP\#GIKUN/QPGVCUVGJVNOKV9CCIGWPF(ÒNNJQTP $/%%QJXGTIN4+% )TÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ #GIKU N)'4/#0+#%#26# )GHCPIGPG   )GTOCPKP UKV\V N IGHCPIGPGT )GTOCPG UVGJV T FC\YKUEJGP 6TQRJ·G $/% XGTIN  %QJ  4+%   XGTIN 4'VYCUÒDGTCTDGKVGVHCUVXQT\ÒINKEJ



&CU5VÒEMYWTFGPCEJFGOGTHQNITGKEJGP(GNF\WIFGU-CKUGTIGIGPFKG%JCVVGPIGRT·IV

252


RÖMISCHE KAISERZEIT

8741

8743

8742



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\/KPGTXCUVGJVNOKV5RGGT$/%%QJ 4+% 8QT\ÒINKEJ





“#U4QOI-QRHTOKV.QTDGGTMTCP\8KTVWUUVGJVTOKV5RGGTWPF2CTC\QPKWO$/% %QJ4+%D &WPMGNITÒPG2CVKPCXQT\ÒINKEJ





Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\%15:++++ 5·WNG FCTCWH .7&5#'%('%   $/%%QJ4+% 5GJTUEJÌP



&KGNWFKUCGEWNCTGUFGU&QOKVKCPWUKO,CJTYCTGP(GKGTPPCEJFGTCWIWUVGKUEJGP5·MWNCT·TCHCPFGPLGFQEJUGEJU ,CJTGXGTHTÒJVUVCVV

8744 8745





8744 1,5:1

8745

Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\*GTQNF IGJV N OKV 5VCD WPF 5EJKNF FCXQT   -CPFGNCDGT WPF 5·WNG OKV FGT #WHUEJTKHV %15:++++.8&5#'%('% $/%  %QJ  4+%    44(GKPG2CVKPCIWVGUUGJTUEJÌPUGJTUEJÌP



“&WRQPFKWU  4QO  I -QRH T OKV 5VTCJNGPDKPFG(QTVWPC UVGJV N OKV 5VGWGTTWFGT WPF   (ÒNNJQTP$/%%QJ4+%  &WPMGNITÒPG2CVKPCNGKEJVMQTTQFKGTV(GNFGTNGKEJVIGIN·VVGVIWVGUUGJTUEJÌP



8746

8747



“#U4QOI-QRHTOKV.QTDGGTMTCP\(QTVWPCUVGJVNOKV5VGWGTTWFGTWPF(ÒNNJQTP $/%%QJ4+% &WPMNG2CVKPCUGJTUEJÌP





“#U  4QO  I -QRH T OKV .QTDGGTMTCP\8KTVWU UVGJV T OKV 5RGGT WPF 2CTC\QPKWO   $/%%QJ4+% $TCWPG2CVKPCIWVGUUGJTUEJÌP



8749

8748

8749



Õ%KUVQRJQT  WPDGUVKOOVG MNGKPCUKCVKUEJG /ÒP\UV·VVG QFGT 4QO   I -QRH T OKV .QTDGGT   MTCP\.GIKQPUCFNGT\YKUEJGP\YGK5VCPFCTVGP42% .GKEJVMQTTQFKGTVUGJTUEJÌP





HÒT&KXWU6KVWU“5GUVGT\ ! 4QOI&KXWUUKV\VNOKV<YGKICWH9CHHGP%QNQUUGWO

#ORJKVGCVTWO(NCXKWO N$TWPPGP /GVC5WFCPU T)GD·WFG$/%5#PO%QJ4+%5 #PO 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCIGTKPIGTJCNVGPHCUVUEJÌP

 253


RÖMISCHE KAISERZEIT

8750



8751

HÒT&KXC,WNKC6KVK“5GUVGT\4QOI5%%CTRGPVWOTXQP\YGK/CWNVKGTGPIG\Q IGP$/%%QJ4+% 45GJTUEJÌP



&CU%CTRGPVWOGKP\YGKT·FGTKIGT9CIGPYCTUGKV%CGUCTU/WPKEKRCNIGUGV\PWTFGP(TCWGPFGTMCKUGTNKEJGP(COK NKGXQTDGJCNVGPFGPGPFGT5GPCVFKGUGU8QTTGEJVXGTNKGJ



“5GUVGT\4QOI5%%CTRGPVWOTXQP\YGK/CWNVKGTGPIG\QIGP$/%%QJ 4+% 44&WPMNG2CVKPCHCUVUGJTUEJÌP

8753

8754

8752





8752

0GTXC“#U4QOI-QRHTOKV.QTDGGTMTCP\*CPFUEJNCI$/%%QJ 4+% )TÒPG2CVKPC(GNFGTGVYCUIGIN·VVGVUGJTUEJÌP



&GTPGWG-CKUGTDGUEJYÌTVFKG'KPKIMGKVFGT.GIKQPGPHTGKNKEJXGTIGDNKEJFGPPKO$GUVTGDGPUKEJFKG0CEJHQNIG FGUITGKUGP-CKUGTU0GTXC\WUKEJGTPTCPIGP\YGK/·PPGTWOFKG)WPUVFGT.GIKQPGP/CTEWU7NRKWU6TCKCPWUFGT UR·VGTG-CKUGTWPF/%QTPGNKWU0KITKPWU%WTKCVKWU/CVGTPWUFGTJÌEJUVFGMQTKGTVG/KNKV·TUGKPGT<GKV \WOEWTUWU JQPQTWOFGU/CVGTPWUUKGJG#NHÌNF[*CNHOCPP%JKTQP5HH 



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\.KDGTVCUUVGJVNOKV2KNGWUWPF<GRVGT$/% %QJ4+% (GKPG2CVKPCUGJTUEJÌP





Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\2TKGUVGTIGT·VG$/%%QJ4+%  (GKPG2CVKPCIWVGUUGJTUEJÌP



8756

8755



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\.KDGTVCUUVGJVNOKV2KNGWUWPF<GRVGT$/% %QJ4+% 5EJYCT\G2CVKPCOKPMQTTQFKGTVUGJTUEJÌP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\.KDGTVCUUVGJVNOKV2KNGWUWPF<GRVGT$/% %QJ4+% $TCWPG2CVKPCHCUVUGJTUEJÌP



8757

 254

1,5:1

8757

“&WRQPFKWU4QOI-QRHTOKV5VTCJNGPDKPFG(QTVWPCUVGJVNOKV4WFGTWPF(ÒNNJQTP $/%%QJ4+% )TÒPG2CVKPCUGJTOCTMCPVGU2QTVT·VHCUVXQT\ÒINKEJIWVGUUGJTUEJÌP




RÖMISCHE KAISERZEIT

8759

8758

8758



“&WRQPFKWU4QOI-QRHTOKV5VTCJNGPDKPFG(QTVWPCUVGJVNOKV4WFGTWPF(ÒNNJQTP $/%%QJ4+% )TÒPDTCWPGGVYCUHNGEMKIG2CVKPCMPCRRGT5EJTÌVNKPIXQT\ÒINKEJ





Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\(QTVWPCUVGJVNOKV5VGWGTTWFGTWPF(ÒNNJQTP $/%%QJ4+% #VVTCMVKXGU'ZGORNCTIWVGUUGJTUEJÌP



8761

8760 1,5:1





Õ%KUVQRJQTWPDGUVKOOVGMNGKPCUKCVKUEJG/ÒP\UV·VVGQFGT4QOI-QRHTOKV.QTDGGTMTCP\ .GIKQPUCFNGT\YKUEJGP5VCPFCTVGWPF8GZKNNWO$/%%QJXGTIN4+%  4-N5EJTÌVNKPIUHGJNGTCWHFGO#XGTUUQPUVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



Õ%KUVQRJQTWPDGUVKOOVGMNGKPCUKCVKUEJG/ÒP\UV·VVGQFGT4QOI-QRHTOKV.QTDGGTMTCP\ $ÒPFGNXQPUGEJUJTGP$/%%QJ4+% 4-N-TCV\GTXQT\ÒINKEJ



8763

8764

8762



Õ%KUVQRJQTWPDGUVKOOVGMNGKPCUKCVKUEJG/ÒP\UV·VVGQFGT4QOI-QRHTOKV.QTDGGTMTCP\ $ÒPFGNXQPUGEJUJTGP$/%%QJ4+% 4.GKEJVMQTTQFKGTVUGJTUEJÌP





6TCKCPWUÕ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\)ÌVVKP #DWPFCPVKCQFGT +WUVKVKC UKV\VNOKV<GRVGT$/%%QJ4+%  44*GTTNKEJG2CVKPCYKP\-TCV\GTCWHFGO4GXGTUHCUVXQT\ÒINKEJXQT\ÒINKEJ



“#U4QOI-QRHTOKV.QTDGGTMTCP\8KEVQTKCIGJVNOKV5EJKNF$/%%QJ 4+% )TÒPG2CVKPC(GNFGTNGKEJVIGIN·VVGVHCUVXQT\ÒINKEJ





8765

8766

8767



Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\ #GIKU N-CKUGT KP 3WCFTKIC N OKV   <YGKIWPF<GRVGT$/%#PO%CNKEQ%QJ4+%  5VGORGNDTWEJCWHFGO#XGTUUGJTUEJÌP 



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV&CPWDKWUNCIGTVNOKV2TQTC $/%%QJ4+% #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV/CTUIGJVNOKV8KEVQTKCWPF 6TQRJ·G$/%%QJ4+% 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC

 255


RÖMISCHE KAISERZEIT

8768

8770

1,5:1

8769

1,5:1



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV#GSWKVCU UVGJVNOKV9CCIG WPF(ÒNNJQTP$/%%QJ4+% (CUVXQT\ÒINKEJXQT\ÒINKEJ





Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV-CKUGT KP 3WCFTKIC T OKV   #FNGT\GRVGTWPF.QTDGGT\YGKI$/%%QJXGTIN4+%XGTIN  4(GKPG2CVKPCUGJTUEJÌP



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV6TQRJ·G$/%%QJ 4+%D 8QT\ÒINKEJGU'ZGORNCTOKVUEJÌPGT6ÌPWPI





8771

8772



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV4QOCUVGJVNOKV8KEVQTKC WPF5RGGT$/%%QJ4+% &WPMNG2CVKPCOKPMQTTQFKGTVIWVGUUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV4QOC UKV\V N OKV 8KEVQTKC   WPF5RGGT$/%%QJ4+%  5GJTCVVTCMVKXGU'ZGORNCTOKVUEJÌPGTITÒPGT2CVKPCXQT\ÒINKEJHCUVXQT\ÒINKEJ



8773

8774



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV&CEKC UKV\V VTCWGTPF N CWH   5EJKNFFCXQT6TQRJ·G$/%HH%QJ4+% $TCWPG2CVKPCUGJTUEJÌP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV$TÒEMGFCTWPVGTCPMGTPFGU $QQV$/%%QJ4+% 4$TCWPG2CVKPCMN4CPFHGJNGTUGJTUEJÌP



'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

8775

8776



“&WRQPFKWU4QOI-QRHTOKV5VTCJNGPDKPFGNFTCRKGTV6TCWGTPFGT&CMGTUKV\VN CWH9CHHGPFCXQT6TQRJ·G$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





“#U4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV4QOCUVGJVNOKV8KEVQTKCWPF 5RGGT$/%%QJ4+% 8QT\ÒINKEJ



256


RÖMISCHE KAISERZEIT

8778

8779

8780

8777

8777



“#U  4QO  I -QRH T OKV .QTDGGTMTCP\5·WNG KP (QTO GKPGT -GWNG CWH .ÌYGPHGNN   CWH$CUKU$/%%QJ4+% 4)TÒPG2CVKPCRT·EJVKIGU2QTVT·VXQT\ÒINKEJ





Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\#4#$#&3KO#DUEJPKVV#TCDKCUVGJVN OKV<YGKIWPF-GWNGFCJKPVGT-COGNN$/%%QJXGTIN4+% (CUVXQT\ÒINKEJ



 YWTFG FCU 0CDCV·GTTGKEJ XQP 4QO CPPGMVKGTV 'U YKTF CWH FGT /ÒP\G CWUFTÒEMNKEJ FWTEJ #4#$ KC    #&3 WKUKVC FCTCWHJKPIGYKGUGPFC­#TCDKGPGTYQTDGPPKEJVCDGTGTQDGTVYWTFG



Õ&GPCT4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV8KC6TCKCPCNCIGTVNOKV4CF WPF<YGKI$/%%QJ4+% 5GJTUEJÌP 'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T &KG8KC6TCKCPCYCTGKPGXQP6TCKCPGTDCWVG5VTC­GXQP$GPGXGPVPCEJ$TWPFKUKWO



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV4GKVGTUVCVWG 6TCKCPU N OKV   5RGGTWPF5EJYGTV$/%%QJXCT4+%XCT 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





8782

8781







“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\4GKVGTUVCPFDKNFFGU-CKUGTUN OKV<GRVGTWPF8KEVQTKC$/%XGTIN%QJXGTIN4+%XGTIN  44$TCWPG2CVKPC4GXGTUMQTTQFKGTVIWVGUUGJTUEJÌPHCUVUGJTUEJÌP



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\#38# 64#+#0# 5234 126+/1   24+0%+2+5%(NW­IQVVNCIGTVNOKV5EJKNHWPVGT$QIGP$/%%QJXGTIN4+%  4)TÒPDTCWPG2CVKPCUGJTUEJÌP



&KG#SWC6TCKCPCYCTGKPXQP6TCKCPWUHÒT4QOPGWGTDCWVGU#SW·FWMV

1,5:1



1,5:1

Ô#WTGWU4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\(QTVWPCUKV\VNOKV5VGWGTTW FGTWPF(ÒNNJQTP$/%%CNKEQ%QJ4+% 5GJTUEJÌP 

1,5:1



8783

8784

1,5:1

Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\ #GIKU N(QTVWPC UKV\V N OKV 5VGWGTTW   FGTWPF(ÒNNJQTP$/%%CNKEQ%QJ4+% 45GJTUEJÌP  257


RÖMISCHE KAISERZEIT

1,5:1



8785

1,5:1

Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\#GIKUN6TQRJ·GFCTWPVGTUKV\GP\YGK )GHCPIGPG\WFGP5GKVGP$ÌIGPKP$QIGPVCUEJGPKO#DUEJPKVV2#46*+#%#26#$/%XGTIN %CNKEQ FKGU'ZGORNCTCDIGDKNFGV %QJXGTIN4+%XGTIN  44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

8786



8787



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\(QTVWPCUKV\VNOKV5VGWGTTW FGTWPF(ÒNNJQTP$/%%QJ4+% )TÒPDTCWPG2CVKPCUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV-CKUGT UKV\V CWH 2NCVVHQTO   TFCPGDGP\YGK1HHK\KGTGFCXQTHÒPH5QNFCVGP$/%%QJ4+%  4&WPMNG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP&GWVUEJNCPF)OD*5VWVVICTV0T #WHFGT4ÒEMUGKVGKUVGKPG#FNQEWVKQFCTIGUVGNNV

8788



8789



8790

“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\-CKUGTUVGJVTOKV5RGGTWPF 5EJYGTVNWPFTNCIGTP'WRJTCV6KITKUWPF#TOGPKC$/%%QJ4+%  4$TCWPG2CVKPC5EJTÌVNKPIUTK­MQTTQFKGTVUGJTUEJÌP



&KGUGU5VÒEMHGKGTVFKG'KPINKGFGTWPIFGTDGKFGPPGWGP2TQXKP\GP#TOGPKGPWPF/GUQRQVCOKGPKPFCU4GKEJ



“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\4')0# #&5+)0#6#   -CKUGTUKV\VNCWH2NCVVHQTOPGDGPKJO2T·HGMVWPF5QNFCVFCXQTFTGK-ÌPKIG$/%%QJ 4+% 4)TÒPG2CVKPC#XGTUMQTTQFKGTVUQPUVIWVGUUGJTUEJÌP



&KG FTGK -ÌPKIG FGPGP KJTG 4GKEJG \WIGVGKNV YWTFGP UKPF 2CTVJCOCUKTKU XQP #TOGPKGP #DICT XQP 1UTJQGPG WPF   2CTVJCOCURCVGUXQP2CTVJKGP



258

“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\4')0# #&5+)0#6#   -CKUGTUKV\VNCWH2NCVVHQTOPGDGPKJO2T·HGMVWPF5QNFCVFCXQTFTGK-ÌPKIG$/%%QJ 4+% 4)TÒPG2CVKPCMN5EJTÌVNKPIUTK­GVYCUMQTTQFKGTVUGJTUEJÌP




RÖMISCHE KAISERZEIT

8792

8791



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\6TCKCPUKV\VNCWH2NCVVHQTO WPFDGMT·P\V2CTVJCOCURCVGUFCXQTMPKGV2CTVJKCFCJKPVGTUVGJV5QNFCV$/%%QJ4+% 4$TCWPG2CVKPCUGJTUEJÌP



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\6TCKCPUKV\VNCWH2NCVVHQTO WPFDGMT·P\V2CTVJCOCURCVGUFCXQTMPKGV2CTVJKCFCJKPVGTUVGJV5QNFCV$/%%QJ4+% 4$TCWPG2CVKPCHCUVUGJTUEJÌP



+O,CJTGIKPIGPFKG2CTVJGTKPFKG1HHGPUKXGIGIGP6TCKCPFGTKP$CD[NQPOKV8GTYCNVWPIUCWHICDGPDGHC­VYCT 0CEJ CPH·PINKEJGP RCTVJKUEJGP 'THQNIGP  UKG XGTPKEJVGVGP FCU *GGT FGU #RRKWU /CZKOWU 5CPVTC UKGJG *CTV   OCPP)GTJCTFV #D #TUCEG ECGUWU GUV 'KP RCTVJKUEJGT (GNFJGTT CWU FGT <GKV 6TCKCPU WPF *CFTKCPU KP )ÌVVKPIGT   (QTWOHÒT#NVGTVWOUYKUUGPUEJCHV  5HH IGNCPIGU6TCKCP2CTVJCOCURCVGU\WO8GTTCVCPFGTRCTVJK UEJGP5CEJG\WDGYGIGPWPFGTOCEJVGKJP\WT$GNQJPWPIKP-VGUKRJQP\WO-ÌPKIFGT2CTVJGT



8793





8794

“&WRQPFKWU  4QO  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG2TQXKFGPVKC UVGJV N OKV   <GRVGTCP5·WNGIGNGJPVFCXQT)NQDWU$/%%QJ4+%  )TÒPG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



“&WRQPFKWU4QOI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG-CKUGTUVGJVT\YKUEJGP \YGK6TQRJ·GP$/%%QJ4+% $TCWPG2CVKPCUGJTUEJÌP



&KG 4GXGTUFCTUVGNNWPI XGTYGKUV CWH FGP UKGITGKEJGP (GNF\WI FGU 6TCKCPWU IGIGP FKG 2CTVJGT FGP 6TCKCPWU CD FGO   ,CJTGP%JTHÒJTVGWPFHÒTFGPKJOFGT$GKPCOG2CTVJKEWUXGTNKGJGPYWTFG&KGDGKFGP6TQRCGC GKPFCMKUEJGU WPF GKP RCTVKUEJGU  XGTYGKUGP CWH FKG OKNKV·TKUEJGP 'THQNIG FGU -CKUGTU FGT KP 7PKHQTO CNU UKGITGKEJGT (GNFJGTT   CDIGDKNFGV YKTF #NNGTFKPIU MQPPVGP FKG GTQDGTVGP )GDKGVG KO 1UVGP KO )GIGPUCV\ \W &CMKGP PKEJV NCPIG IGJCNVGP   YGTFGP

8795

1,5:1



8796

1,5:1

“3WCFTCPU4QOI&TCRKGTVG$ÒUVGFGU*GTEWNGUTOKV.QTDGGTMTCP\'DGTT$/%XCT %QJ4+% )TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



“3WCFTCPU4QOI&TCRKGTVG$ÒUVGFGU*GTEWNGUTOKV.QTDGGTMTCP\'DGTT$/%XCT %QJ4+% &WPMNG2CVKPCUGJTUEJÌP

8797



8798



Õ%KUVQRJQT  WPDGUVKOOVG MNGKPCUKCVKUEJG /ÒP\UV·VVG  I -QRH T OKV .QTDGGTMTCP\   .GIKQPUCFNGT\YKUEJGP\YGK5VCPFCTVGP$/%%QJ4+% 45GJTUEJÌP





Õ6GVTCFTCEJOG  6CTUQU %KNKEKC   I -QRH T OKV .QTDGGTMTCP\6[EJG UKV\V T OKV   2CNO\YGKIFCXQTUEJYKOOGPFGT(NW­IQVV-[FPQU2TKGWTXGTIN (CUVXQT\ÒINKEJ

 259


RÖMISCHE KAISERZEIT

1,5:1



8799 1,5:1

WPF&KXWU0GTXCÕ&KFTCEJOG%CGUCTGC %CRRCFQEKC I-QRH6TCKCPUTOKV.QTDGGT MTCP\-QRHFGU&KXWU0GTXCTOKV.QTDGGTMTCP\5[F FKGU'ZGORNCTGTY·JPV   44*GTTNKEJG2CVKPCXQT\ÒINKEJHCUVXQT\ÒINKEJ  'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0TFGT#WMVKQP*GUU.GW<ÒTKEJ0TWPFFGT 5COONWPI6JGQFQT2TQYG#WMVKQP$TÒFGT'IIGT9KGP0T

8801 8802

8800

8801 1,5:1



*CFTKCPWU  “5GUVGT\  4QO  I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\6TCKCP   UVGJVTWPFTGKEJV*CFTKCP)NQDWU$/%%QJ4+%C  &WPMGNITÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



&KG4ÒEMUGKVG\GKIVFKG*GTTUEJCHVUÒDGTICDGXQP6TCKCPCP*CFTKCPFGPGTCWHFGO6QVGPDGVVCFQRVKGTVJCDGPUQNN YCUCDGTYGKVGTJKPHTCINKEJKUV



“&WRQPFKWU4QOI-QRHTOKV5VTCJNGPDKPFGNFTCRKGTV4QOCUKV\VTCWH2CP\GTWPF GORH·PIV*CFTKCP$/%%QJ4+%  $TCWPG2CVKPCUGJTCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT



*CFTKCPJKGNVUGKPGPCFXGPVWUKP4QOCO,WNKXQO1UVGPMQOOGPFYQGTKP#PVKQEJKCCO#WIWUV \WO-CKUGTRTQMNCOKGTVYQTFGPYCT



“5GUVGT\4QOI$ÒUVGTOKV.QTDGGTMTCP\N5EJWNVGTFTCRKGTV4QOCUKV\VNCWH2CP \GTOKV8KEVQTKCWPF.CP\G$/%%QJ4+%D  &WPMGNITÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP

8803



8804



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV(GNKEKVCU UVGJV N OKV %CFWEGWU   WPF(ÒNNJQTP$/%%QJ4+%D &WPMGNITÒPG2CVKPCIWVGUUGJTUEJÌP





“5GUVGT\  4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV-CKUGTUVGJVNOKV5EJTKHV TQNNGWPFGTJGDVYGKDNKEJG)GUVCNVOKV/CWGTMTQPGWPF)NQDWU$/%%QJ4+%D  4&WPMNG2CVKPCUGJTUEJÌP



260


RÖMISCHE KAISERZEIT

8805

1,5:1



Ô#WTGWU  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\4QOC UKV\V N OKV 8KEVQTKC   WPF5RGGT$/%%CNKEQ%QJ4+% #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

8806



1,5:1

8806

1,5:1

Ô#WTGWU4QOI)GRCP\GTVG$ÒUVGTOKV.QTDGGTMTCP\4QOCUKV\VNOKV8KEVQTKC 5RGGTWPF5EJKNF$/%%CNKEQD%QJ4+% 45GJTUEJÌP 

8807

8808



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\4QOC UVGJV N OKV 8KEVQTKC WPF 5RGGT   $/%%QJ4+% 8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\-CKUGTUVGJVNOKV5VGWGTTWFGT CWH)NQDWUWPF5RGGT$/%%QJXGTIN4+%  8QT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI



8810

1,5:1

8809





8809

“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\4QOCUVGJVTOKV5RGGT\YKUEJGPFGO RGTUQPKHK\KGTVGP5GPCVWPFFGO-CKUGT$/%%QJXGTIN4+%  44)TÒPG2CVKPCUGJTUEJÌP



Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV9ÌNHKPNU·WIV4QOWNWUWPF 4GOWU$/%%CNKEQ%QJXGTIN4+% 5GJTUEJÌP



1,5:1



1,5:1

8811

1,5:1

Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV/KPGTXC UVGJV N OKV 5RGGT   WPF5EJKNF$/%#PO%QJ4+%  W­GTUVUGNVGPG8CTKCPVG-N5EJTÌVNKPIUHGJNGTCWHFGO#XGTUXQT\ÒINKEJ

 261


RÖMISCHE KAISERZEIT

8812

8813

8814



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV5KGDGP 5VGTPG ÒDGT /QPFUK   EJGN$/%%QJ4+% 5GJTUEJÌP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV&KCPCUVGJVTOKV2HGKNWPF $QIGP$/%%QJXCT4+%D )TÒPG2CVKPCUGJTUEJÌP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV0GRVWPUVGJVNOKV&GNRJKP WPF&TGK\CEM$/%%QJ4+% &WPMNG2CVKPCXQT\ÒINKEJ



8816

8815





8815

“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\NFTCRKGTV0GRVWPUVGJVNOKV#RJNC UVQPWPF&TGK\CEM$/%%QJ4+%  )TÒPDTCWPG2CVKPCYKP\5EJTÌVNKPIUTKUUGUGJTUEJÌP



“#U4QOI-QRHTOKV.QTDGGTMTCP\)CNGGTGT$/%%QJ4+% &WPMNG2CVKPCIWVGUUGJTUEJÌP



1,5:1



262

1,5:1

Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV5RGU IGJV N OKV $NWOG   $/%%CNKEQ%QJXGTIN4+% 5GJTUEJÌP 

1,5:1



8817

8818

1,5:1

Ô#WTGWU  4QO  I &TCRKGTVG $ÒUVG N0KN NCIGTV N OKV (ÒNNJQTP WPF 5EJKNHTQJT FGP   'NNDQIGPCWH5RJKPZIGUVÒV\VN(NW­RHGTFWPVGP-TQMQFKN$/%%CNKEQ%QJ4+%  4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 


RÖMISCHE KAISERZEIT

8820

8819 8820 1,5:1



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\#GI[RVQU NCIGTV N OKV 5KUVTWO FCXQT   +DKU$/%%QJ4+% (GKPG2CVKPCUGJTUEJÌP



Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T)'4/#0+# )GTOCPKC UVGJV N -QRH T OKV   5RGGTWPF5EJKNF$/%%QJ4+%XGTIN QJPGFKGUG$ÒUVGPXCTKCPVG   5GJTUGNVGPG$ÒUVGPXCTKCPVG5GJTUEJÌP



&KGUGU5VÒEMUVCOOVCWUFGT5GTKGFGT2T·IWPIGP\W*CFTKCPU\YGKVGTITQ­GT4GKUGFWTEJFKG2TQXKP\GP



8821





8822

“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\-CKUGT UVGJV T OKV 5EJTKH   VTQNNGFCXQTUVGJV+VCNKCNOKV(ÒNNJQTPWPF2CVGTCWPFQRHGTVÒDGT#NVCT$/%%QJ4+% )TÒPG2CVKPCHCUVUGJTUEJÌP



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\*CFTKCPUVGJVTFKG4GEJVG GTJQDGPFCXQTUVGJV/CWTGVCPKCNOKV2CVGTCWPF8GZKNNWO\YKUEJGPFGPDGKFGP(KIWTGP#NVCT$/% XGTIN%QJXGTIN4+%XGTIN  4$TCWPG2CVKPCIGIN·VVGVWPFGVYCUÒDGTCTDGKVGVUGJTUEJÌP



'ZGORNCTFGT5COONWPI.GQ$GP\#WMVKQP.CP\/ÒPEJGP0T

8823





8824

“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\-CKUGT WPF 2JT[IKC OKV   5KEJGN WPF 2CVGTC UVGJGP GKPCPFGT IGIGPÒDGT FC\YKUEJGP #NVCT WPF 1RHGTUVKGT $/% 5  #PO   %QJ4+% 44&WPMNG2CVKPCHCUVUGJTUEJÌP



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT-CKUGTUVGJVNWPFGTJGDV#EJCKCFC\YKUEJGP 8CUGOKV2CNO\YGKI$/%%QJ4+% $TCWPG2CVKPCUGJTUEJÌP



8825

8826



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT-CKUGTUVGJVTWPFGTJGDV$KVJ[PKC$/% %QJ4+%XGTIN 4)TÒPG2CVKPCHCUVUGJTUEJÌP





“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\-CKUGT UVGJV N WPF GTJGDV   MPKGPFG*KURCPKCOKV<YGKI$/%%QJ4+%  4$TCWPG2CVKPC(GNFGTIGIN·VVGVUGJTUEJÌP

 263


RÖMISCHE KAISERZEIT

8827

8828



“#U4QOI&TCRKGTVG$ÒUVGT-CKUGTGTJGDV)CNNKC$/%%QJ4+% 4&WPMGNITÒPG2CVKPCUGJTUEJÌP





Õ%KUVQRJQT PCEJ  /[NCUC %CTKC   I-QRHT-WNVUVCVWGFGU<GWU.CDTCWPFQUXXOKV &QRRGNCZVWPF5RGGT/GVECNH 4'VYCUMQTTQFKGTVUGJTUEJÌP



ex 8830 8829

8829



“U2GTIG 2CORJ[NKC I)GRCP\GTVG$ÒUVGTOKV.QTDGGTMTCP\-WNVDKNFFGT#TVGOKU2GTICKC \YKUEJGP\YGK5RJKPIGPCWH$CUGPKP\YGKU·WNKIGO6GORGN$/%  44$TCWPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



$6GVTCFTCEJOG,CJT  #NGZCPFTKC #GI[RVWU I-QRHNOKV.QTDGGTMTCP\0KN NCIGTVNOKV5EJKNHTQJTWPF(ÒNNJQTPWPVGP-TQMQFKNT&CVVCTK5CXKQ)GKUUGP&C\W'KPG YGKVGTG6GVTCFTCEJOGFGU*CFTKCPWU ,CJT4GXGTU-CPQRWU&CVVCTK)GKUUGP   5VÒEM5GJTUEJÌP

1,5:1



8831



1,5:1

HÒT&KXWU6TCKCPWUÔ#WTGWU4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\2JQG PKZUVGJVT$/%%CNKEQ4+%%QJ 45GJTUEJÌP



8832

8833

8834



 HÒT 5CDKPC Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO%QPEQTFKC UKV\V N OKV 2CVGTC   $/%%QJ4+% #VVTCMVKXG2CVKPCIWVGUUGJTUEJÌP





“5GUVGT\ 4QO  I &TCRKGTVG $ÒUVG T OKV JTGPMTCP\%QPEQTFKC UKV\V N OKV 2CVGTC FGP N   'NDQIGPCWHGKPG5VCVWGFGT5RGUIGUVÒV\V$/%#PO%QJ4+%E  4&WPMNG2CVKPCUGJTUEJÌP



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV&KCFGO2KGVCUUKV\VNOKV2CVGTCWPF<GRVGT$/% %QJ4+% KTTVÒONKEJG4GXGTUNGIGPFG  'VYCUMQTTQFKGTVIWVGUUGJTUEJÌP



 264


RÖMISCHE KAISERZEIT

8836

8835



“5GUVGT\4QOI&TCRKGTVG$ÒUVGNOKV&KCFGO2WFKEKVKCUKV\VN$/%#PO%QJ 4+% $TCWPG2CVKPCHCUVUGJTUEJÌP





“#U 4QO  I &TCRKGTVG $ÒUVG T%GTGU UKV\V N OKV JTGP WPF (CEMGN $/%  %QJ    4+% &WPMGNITÒPG2CVKPCNGKEJVMQTTQFKGTVUQPUVXQT\ÒINKEJ



8837





8838

1,5:1

$6GVTCFTCEJOG ,CJT     #NGZCPFTKC #GI[RVWU   I &TCRKGTVG $ÒUVG T-CKUGTKP   UVGJVNOKV<GRVGTWPFQRHGTVÒDGT#NVCT&CVVCTK FKGU'ZGORNCT )GKUUGP  44(GKPG6ÌPWPICVVTCMVKXGUHCUVXQT\ÒINKEJIWVGUUGJTUEJÌP



 HÒT #GNKWU Ô#WTGWU  4QO  I -QRH N%QPEQTFKC UKV\V N OKV 2CVGTC FGP N #TO CWH   (ÒNNJQTPIGUVÒV\V$/%%CNKEQ%QJ4+%E 45GJTUEJÌP  *CFTKCPMGJTVGCWUFGOLÒFKUEJGP-TKGI\WTÒEM5GKPG)GUWPFJGKVYCTCPIGITKHHGPUQFC­FGT-CKUGTKOOGT JKP,CJTGCNVGKPG0CEJHQNIGTGIGNWPIVTGHHGPOW­VG*CFTKCPU9CJNHKGNCWH.%GKQPKWU%QOOQFWUFGPGTCNU . #GNKWU 8GTWU \WO 0CEJHQNIGT DGUVKOOVG #GNKWU YCT \WO <GKVRWPMV UGKPGT 'TPGPPWPI %QPUWN QTFKPCTKWU JCVVG   CDGTMGKPGTNGKOKNKV·TKUEJG'THCJTWPI'TUVCTDCO0GWLCJTUVCI

8839

8840

8841

8841



Õ&GPCT4QOI-QRHT5RGUIGJVNOKV$NWOG$/%%QJ4+%  -N4CPFCWUDTWEJUGJTUEJÌP





Õ&GPCT4QOI-QRHT2KGVCUUVGJVTOKV9GKJTCWEJFQUGXQT#NVCT$/%%QJ 4+% 5GJTUEJÌP





“5GUVGT\4QOI-QRHT5RGUIGJVNOKV$NWOG$/%%QJ4+%  $TCWPG2CVKPCJGTTNKEJGU2QTVT·VIWVGUUGJTUEJÌP



8842

8843



“5GUVGT\4QOI-QRHT5RGUIGJVNOKV$NWOG$/%%QJ4+%  &WPMNG2CVKPC(GNFGTGVYCUIGIN·VVGVUGJTUEJÌP





“#U4QOI-QRHT2CPPQPKCUVGJVNOKV8GZKNNWO$/%%QJ4+%  &WPMGNITÒPG2CVKPCGVYCUMQTTQFKGTVUGJTUEJÌP



#GNKWUGTJKGNVFCUKORGTKWORTQEQPUWNCTGKP2CPPQPKC&CJGTGTUEJGKPV2CPPQPKCCWHFGO4GXGTUFGT/ÒP\G

265


RÖMISCHE KAISERZEIT

8845

8844





8844

“U /[VKNGPG .GUDQU   I -QRH T#UMNGRKQU UVGJV X X OKV 5EJNCPIGPUVCD -QRH N #WMVKQP   )KGUUGPGT/ÒP\JCPFNWPI/ÒPEJGP0T FKGU'ZGORNCT #WMVKQP6JG0GY;QTM5CNG 0GY;QTM0T FKGU'ZGORNCT UQPUVYQJNWPRWDNK\KGTV  8QPCNNGTITÌ­VGT5GNVGPJGKV$TCWPG2CVKPCUGJTUEJÌP



 HÒT #PVKPQWU “U 0KMQRQNKU 'RKTWU   I $TWUVDKNF HCUV X X -QRH T5VGTP ÒDGT *CNDOQPF   $NWO$/% 44)TÒPDTCWPG2CVKPCHCUVUGJTUEJÌP  'ZGORNCTFGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0TWPFFGT#WMVKQP0WOKUOC VKE(KPG#TVU:+0GY;QTM0T

8847

8846



“U/CPVKPGKC #TECFKC 8GVWTKWUI$TWUVDKNFHCUVXX-QRHT2HGTFUVGJVT$NWO$/%

#TECFKCPU  $TCWPG2CVKPC4GXGTUMQTTQFKGTVHCUVUGJTUEJÌP



'ZGORNCTFGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0T  /CPVKPGKC KP #TMCFKGP YCT FGT )GDWTVUQTV FGU #PVKPQQU &QTVFÒTHVGCNUQOKVJQJGT9CJTUEJGKPNKEJMGKVFKGUGFGP #TMCFKGTPIGYKFOGVG/ÒP\GGPVUVCPFGPUGKP



“U/CPVKPGKC #TECFKC 8GVWTKWUI$TWUVDKNFHCUVXX-QRHT2HGTFUVGJVT$NWO$/% )TÒPG2CVKPCNGKEJVMQTTQFKGTVUEJÌP



'ZGORNCTFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

8849

8850

8848



8848

“U-CNEJGFQP $KVJ[PKC I$TWUVDKNFHCUVXX-QRHN,ÒPINKPI #PVKPQQU! CWHTURTKPIGP FGO)TGKHGP$NWO9CFFKPIVQP4GEIGP 44&WPMNG2CVKPCMQTTQFKGTVUEJÌP



'ZGORNCTFGT5COONWPI,24JKIGVVK#WMVKQP/ÒP\GPWPF/GFCKNNGP&GWVUEJNCPF)OD*5VWVVICTV0T



“U 0KMQOGFKC $KVJ[PKC   I -QRH T#PVKPQQU UVGJV N OKV GTJQDGPGT 4GEJVGP $NWO  9CF   FKPIVQP4GEIGP $TCWPG2CVKPCUEJÌPpUGJTUEJÌP



'ZGORNCTFGT#WMVKQP)KGUUGPGT/ÒP\JCPFNWPI/ÒPEJGP0T



“U*CFTKCPQVJGTCK /[UKC I-QRHT#RKUUVKGTUVGJVT$NWO50)(TCPEG  44/KPMQTTQFKGTVUGJTUEJÌP 'ZGORNCTFGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0TWPFFGT#WMVKQP5VGTPDGTI <ÒTKEJ0T

266




RÖMISCHE KAISERZEIT

8851 8852



8852

“U -[\KMQU /[UKC  /CIKUVTCV 'WPGWU  I -QRH N,ÒPINKPI UVGJV T OKV 2HGTF $NWO    50)(TCPEGXCT 44&WPMGNITÒPG2CVKPCUEJÌP  'ZGORNCTFGT#WMVKQP6TKVQP8+++0GY;QTM0T



“U -[OG #KQNKU  /CIKUVTCV *KGTQP[OQU  I $TWUVDKNF HCUV X X -QRH T/·PPNKEJG )GUVCNV   UKV\VTOKVIGUEJWNVGTVGO<GRVGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0T

FKGU'ZGORNCT $NWO$/%/KQPPGV  8QPCNNGTITÌ­VGT5GNVGPJGKV9QJN7PKMWO&WPMGNITÒPG2CVKPCUEJÌP  'ZGORNCT FGT 5COONWPI &CXKF &QYF[ #WMVKQP 6TKVQP 8+++ 0GY ;QTM  0T  FGT #WMVKQP )KGUUGPGT   /ÒP\JCPFNWPI/ÒPEJGP0TFGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0TWPF FGT#WMVKQP/ÒP\GPWPF/GFCKNNGP#)$CUGN0T

8854

8853



8853

“U5O[TPC +QPKC I-QRHN9KFFGTT$NWOXGTINHH-NQUGXGTINHH  448QNNUV·PFKIÒDGTCTDGKVGVIWVGUUGJTUEJÌP

'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T 8GTOWVNKEJJCPFGNVGUUKEJWOFGP6[R-NQUGFGTXQNNUV·PFKIÒDGTCTDGKVGVYWTFG







“U 5CNC .[FKC  /CIKUVTCV 8CNGTKQU #PFTQU  I &TCRKGTVG $ÒUVG T&KQP[UQU UVGJV T OKV 6TCW   DGPWPFNGJPVCPGKPGT5·WNGCWHFGTGKP-CPVJCTQUUVGJV$NWO50)/ÒPEJGP  4)TÒPG2CVKPCMNGKPG#DURNKVVGTWPIGPCO4CPFUGJTUEJÌP  'ZGORNCTFGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0TWPFFGT#WMVKQP5VGTPDGTI <ÒTKEJ0T

8855



8856

“U5O[TPC +QPKC I-QRHN5VKGTUVGJVT$NWOXGTINHH-NQUG FKGU'ZGORNCT   44)TÒPG2CVKPCMQTTQFKGTVIGHÒNNVG-QTTQUKQPUUVGNNGPUEJÌP



'ZGORNCTFGT5COONWPI,24JKIGVVK#WMVKQP/ÒP\GPWPF/GFCKNNGP&GWVUEJNCPF)OD*5VWVVICTV0T



“U 6CTUQU %KNKEKC   I &TCRKGTVG $ÒUVG T OKV *GOJGO-TQPG2CPVGT UVGJV N 6CV\G CWH   -CPVJCTQUIGNGIVFCTÒDGT)TCHHKVQ%JK4JQ/QPQITCOO$NWO  44$TCWPG2CVKPC4CPFKO<KEM\CEMp/WUVGTIGMGTDV)TCHHKVQCWHFGO4GXGTUUEJÌP  'ZGORNCTFGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0TWPFFGT#WMVKQP5VGTPDGTI <ÒTKEJ0T

267


RÖMISCHE KAISERZEIT

8857



8858

“U #PM[TC )CNCVKC  /CIKUVTCV +WNKWU 5CVWTPKPWU  I -QRH T/GP UVGJV N OKV #PMGT WPF   <GRVGT$NWO50)%QR50)(TCPEGXCT FTCRKGTVGT-QRH   44&WPMNG2CVKPCHCUVUGJTUEJÌP  'ZGORNCTFGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0T



“&TCEJOG,CJT  #NGZCPFTKC #GI[RVWU I&TCRKGTVG$ÒUVGTOKV*GO*GO -TQPG#PVKPQQUTGKVGVTOKV-GT[MGKQP$NWO&CVVCTKXGTIN)GKUUGP  44$TCWPG2CVKPCHCUVUGJTUEJÌP



'ZGORNCTFGT5COONWPI&CXKF&QYF[#WMVKQP6TKVQP8+++0GY;QTM0T  #PVKPQQU GKP ,ÒPINKPI CWU $KVJ[PKWO KP $KVJ[PKGP YWTFG \WO )GNKGDVGP *CFTKCPU 'T UVCTD  KP I[RVGP YQ   *CFTKCPFCTCWHJKPFKG5VCFV#PVKPQWRQNKUITÒPFGVG

8859





8860

2D6GUUGTC#NGZCPFTKC #GI[RVWU I&TCRKGTVG$ÒUVGTFCXQT/QPFUKEJGN&TCRKGTVG$ÒUVGFGU 5CTCRKUTOKV-CNCVJQU$NWO&CVVCTKXGTIN #XGTU )GKUUGPXGTIN #XGTU   445EJÌP



 4GUVKVWVKQP HÒT#WIWUVWUÕ%KUVQRJQTPCEJWPDGUVKOOVGMNGKPCUKCVKUEJG/ÒP\UV·VVGI -QRHFGU#WIWUVWUT*CFTKCPUVGJVNOKVJTGP/GVECNH 445GJTUEJÌP



'KPGKPVGTGUUCPVG6JGQTKGXQP/CVVKPIN[WPF-KGPCUVUKGJVFKG'KPYGKJWPI*CFTKCPUKPFKG/[UVGTKGPXQP'NGWUKUKO ,CJT  CNU #PNC­ FGT 2T·IWPI +P FKGUGO (CNN Y·TG FCU 4'0 CWH FGO 4GXGTU CNU TGPCVWU \W XGTUVGJGP *C   FTKCP Y·TG UQOKV GKPG 9KGFGTIGDWTV FGU #WIWUVWU /GVECNH XGTYKTHV LGFQEJ FKGUG #WHHCUUWPI WPF HCUUV 4'0 CNU   TGPQXCXKVCWHFCUUKEJCWHGKPG'TPGWGTWPIFGT/ÒP\GUGNDUVFWTEJªDGTRT·IWPIDG\KGJV

8861



1,5:1

8861

#PVQPKPWU + 2KWU  Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\9ÌNHKP T   KP*ÌJNGOKV4QOWNWUWPF4GOWU$/%%QJ4+% 5GJTUEJÌP



'KPG&CTUVGNNWPIFGT)TÒPFWPIUUCIG4QOU

8862



 268

8863

“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\#PPQPC UVGJV T OKV JTGP WPF (ÒNN   JQTP\YKUEJGP/QFKWUWPF2TQTC$/%%QJ4+%  &WPMNG2CVKPC(GNFGTIGIN·VVGVUGJTUEJÌP



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\#RQNNQUVGJVXXOKV2CVGTCWPF.[TC $/%%QJ4+% $TCWPG2CVKPCUGJTUEJÌP




RÖMISCHE KAISERZEIT

8864

8865



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\)GHNÒIGNVGT$NKV\$/%%QJ 4+% $TCWPG2CVKPCUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\5CNWU UVGJV N OKV 2CVGTC WPF <GRVGT   FCXQT5EJNCPIGWO#NVCTIGYWPFGP$/%%QJ4+%  &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJIWVGUUGJTUEJÌP



8866





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\5CNWU UVGJV N OKV 2CVGTC WPF <GRVGT   FCXQT5EJNCPIGWO#NVCTIGYWPFGP$/%%QJ4+%  $TCWPG2CVKPCIWVGUUGJTUEJÌPHCUVXQT\ÒINKEJ



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\5CNWU UVGJV N OKV 2CVGTC WPF <GRVGT   FCXQT5EJNCPIGWO#NVCTIGYWPFGP$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌP



8868





8869

“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\5CNWUUKV\VNOKV2CVGTCWPFHÒVVGTVGKPG WOGKPGP#NVCTIGYWPFGPG5EJNCPIG$/%%QJ4+%  &WPMGNITÒPG2CVKPC-TCV\GTCWHFGO#XGTUHCUVXQT\ÒINKEJUGJTUEJÌP



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\6KDGTNCIGTVNOKV5EJKNHFKGT*CPF CWH5EJKHHIGUVÒV\V$/%%QJ4+%C 4$TCWPG2CVKPCUGJTUEJÌP



8870



8867

8871

“#U  4QO  I -QRH T OKV .QTDGGTMTCP\/CTU OKV 5RGGT WPF 5EJKNF UEJYGDV \W   UEJNCHGPFGT4JGC5KNXKCJGTCD$/%%QJ4+% 44&WPMNG2CVKPCUGJTUEJÌP



4JGC5KNXKCYCTFGT5CIGPCEJFKG6QEJVGTFGU-ÌPKIU0WOKVQT5KNXKWUXQP#NDC.QPIC&KGUGTYWTFGXQPUGKPGO $TWFGT CDIGUGV\V FGT UGKPG O·PPNKEJGP 0CEJMQOOGP VÌVGVG WPF 4JGC 5KNXKC \W GKPGT 8GUVCNKP OCEJVG &GT )QVV   /CTUXGTHÒJTVGLGFQEJ4JGC5KNXKCFKGFKG<YKNNKPIG4QOWNWUWPF4GOWUIGDCT



“#U  4QO  I -QRH T OKV .QTDGGTMTCP\6KDGT NCIGTV N OKV 5EJKNH FKG 4GEJVG CWH   5EJKHHIGNGIV$/%%QJ4+% 4&WPMNG2CVKPCUGJTUEJÌP

 269


RÖMISCHE KAISERZEIT

8873

8872



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\8KEVQTKC KP 3WCFTKIC T $/%    %QJ4+% &WPMGNITÒPG2CVKPCNGKEJVMQTTQFKGTVUGJTUEJÌP



&GT4GXGTUHGKGTVFGPKP$TKVCPPKGPFWTEJ3.QNNKWU7TDKEWUGTTWPIGPGP5KGIÒDGTFKG$TKICPVGP



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\+VCNKC UKV\V N CWH )NQDWU OKV (ÒNNJQTP   WPF<GRVGT$/%%QJ4+%C 4$TCWPG2CVKPCUGJTUEJÌP



8874

1,5:1



1,5:1

“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\-CKUGTUVGJVNOKV0KODWU<YGKIWPF 5RGGT$/%%QJ4+% -CDKPGVVUVÒEM+PFKGUGT'TJCNVWPIUGJTUGNVGP &WPMNG2CVKPCUEJCTHCWUIGRT·IVGUXQT\ÒINKEJGU2TCEJVGZGORNCT



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

8875



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\2CZ UVGJV N OKV (CEMGN WPF (ÒNNJQTP   WPFGPV\ÒPFGV9CHHGP$/%%QJXGTIN4+% &WPMNG2CVKPCXQT\ÒINKEJ



8876 1,5:1



1,5:1

“#U  4QO  I -QRH T OKV .QTDGGTMTCP\ NFTCRKGTV5234126+/124+0%+2+5% KP'KEJGPMTCP\$/%%QJ4+%CXCT  -CDKPGVVUVÒEM*GTTNKEJGU2QTVT·V&WPMNG2CVKPCHCUVUVGORGNHTKUEJXQT\ÒINKEJ  'ZGORNCTFGT5COONWPI'IQP$GEMGPDCWGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

270


RÖMISCHE KAISERZEIT

1,5:1



1,5:1

Ô#WTGWU4QOI-QRHT2CZUVGJVNOKV<YGKIWPF<GRVGT$/%%CNKEQ %QJ4+%C /CTMCPVGU2QTVT·VHCUVXQT\ÒINKEJ

1,5:1



8877

8878



1,5:1

Ô#WTGWU4QOI&TCRKGTVG$ÒUVGN-CKUGTUVGJVNOKV)NQDWU$/%%CNKEQ %QJ4+%G 8QT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGO2QTVT·V



8880

8879



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\4QOC UKV\V N CWH 2CP\GT OKV )NQDWU   WPF<GRVGT$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\#EJVU·WNKIGT 6GORGN FGU &KXWU #W   IWUVWU$/%%QJ4+%  )TÒPG2CVKPCMPCRRGT5EJTÌVNKPINGKEJVMQTTQFKGTVMN-TCV\GTUGJTUEJÌP



#PVQPKPWU2KWUNKG­FGP6GORGNFGU&KXWU#WIWUVWUTGUVCWTKGTGPFGTUKEJYKGCWUGKPGT0QVK\DGK5WGVQP %CNKIWNC  JGTXQTIGJV\YKUEJGP2CNCVKPWPF%CRKVQNDGHCPF

1,5:1



8881

1,5:1

Ô#WTGWU  4QO  I -QRH T OKV .QTDGGTMTCP\2KGVCU UVGJV N OKV )NQDWU WPF -KPF   \YKUEJGP\YGK-KPFGTP$/%%CNKEQ%QJ4+%  5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

8882



 HÒT (CWUVKPC OCVGT “5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T8GPWU UVGJV T OKV   #RHGN$/%%QJ4+% &WPMNG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 271


RÖMISCHE KAISERZEIT

8883 1,5:1



HÒT&KXC(CWUVKPCOCVGTÔ#WTGWUPCEJ4QOI&TCRKGTVG$ÒUVGT2HCWIGJVT-QRH \WTÒEMIGYCPFV$/%%CNKEQ%QJ4+%  9KP\&TWEMUVGNNGMN2TÒHUVGNNGPCO4CPFHCUVXQT\ÒINKEJ

8884

1,5:1



8885





1,5:1

Ô#WTGWUPCEJ4QOI&TCRKGTVG$ÒUVGT2KGVCUQRHGTVNÒDGT#NVCT$/%%CNKEQ %QJ4+%E )WVGUUGJTUEJÌP

8886



1,5:1

Ô#WTGWUPCEJ4QOI&TCRKGTVG$ÒUVGT2KGVCUQRHGTVNÒDGT#NVCT$/%%CNKEQ %QJ4+%C 5GJTUEJÌP

1,5:1



1,5:1



8887

1,5:1

Õ&GPCT PCEJ  4QO  I &TCRKGTVG $ÒUVG T&'&+%#6+1#'&+5 5GEJU·WNKIGT 6GORGN   $/%%QJ4+% 4(CUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



&GT4GXGTUUVGNNVFGPXQP#PVQPKPWU2KWUUGKPGTXGTUVQTDGPGP(TCW(CWUVKPCIGYGKJVGP6GORGNFCT0CEJFGO6QF FGU 2KWU YWTFGFCU*GKNKIVWOCWEJKJOIGYGKJV&GT6GORGNYWTFGUR·VGTKPFKG-KTEJG5CP.QTGP\QKP/KTCPFC WOIGYCPFGNVWPFOGJTHCEJWOIGDCWV&GT#TEJKVTCXOKVFGT+PUEJTKHV&+81#0610+01'6&+8#'(#856+0#' ':5%DNKGDGTUVCWPNKEJGTYGKUGGTJCNVGP#WUITCDWPIGPDGICPPGP



Õ&GPCTPCEJ4QOI&TCRKGTVG$ÒUVGT2KGVCUQRHGTVNÒDGT#NVCT$/%%QJ 4+%C (GKPG6ÌPWPIXQT\ÒINKEJ

8888



8889



“5GUVGT\ PCEJ  4QO  I &TCRKGTVG $ÒUVG T#GVGTPKVCU UVGJV N OKV 2JQGPKZ $/%    %QJ4+% $TCWPG2CVKPCMN5EJTÌVNKPIUTK­UGJTUEJÌP





“5GUVGT\PCEJ4QOI&TCRKGTVG$ÒUVGT%GTGUUVGJVNOKVJTGPWPF(CEMGN$/% %QJ4+% $TCWPG2CVKPCUGJTUEJÌP



272


RÖMISCHE KAISERZEIT

8891

8890



“5GUVGT\ PCEJ  4QO  I &TCRKGTVG $ÒUVG T8GUVC UVGJV N OKV 2CVGTC WPF (CEMGN FCXQT   #NVCT$/%%QJ4+% $TCWPG2CVKPC(GNFGTIGIN·VVGVUGJTUEJÌP





 HÒT (CWUVKPC HKNKC “#U 4QO  I &TCRKGTVG $ÒUVG T OKV 5VGRJCPG2WFKEKVC UKV\V N OKV   5EJNGKGT$/%#PO%QJ4+%E &WPMNG2CVKPCIWVGUUGJTUEJÌP



1,5:1



8892

1,5:1

 WPF /CTEWU #WTGNKWU Ô#WTGWU PCEJ  4QO  I -QRH T OKV .QTDGGTMTCP\&TCRKGTVG   $ÒUVGTOKV.QTDGGTMTCP\$/%%QJ4+%F 445GJTUEJÌP 

8893

8894

8895



Õ&GPCTPCEJ4QOI-QRHTOKV.QTDGGTMTCP\-QRHT$/%%QJ4+%C (GKPG6ÌPWPICVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





HÒT/CTEWU#WTGNKWU“5GUVGT\4QOI&TCRKGTVG$ÒUVGT2TKGUVGTIGT·VG$/% %QJ4+%D 4$TCWPG2CVKPCMN-TCV\GTCWHFGO#XGTUXQT\ÒINKEJ





“5GUVGT\  4QO  I -QRH N N FTCRKGTV2TKGUVGTIGT·VG $/%  #PO %QJ    4+%E 4)TÒPDTCWPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



1,5:1

8896

1,5:1



Ô#WTGWU  4QO  I -QRH T N FTCRKGTV*KNCTKVCU UVGJV N OKV 2CNO\YGKI WPF (ÒNNJQTP   $/%XGTIN5#PO%QJ4+%XGTIN 445GJTUEJÌP 



Ô#WTGWU4QOI-QRHN/KPGTXCUVGJVTOKV5RGGTWPF5EJKNF$/%%CNKEQ %QJ4+%D *GPMGNURWTNGKEJVIGYGNNVUEJÌPpUGJTUEJÌP





Õ&GPCT4QOI-QRHT(KFGUUVGJVTOKVJTGPWPF(TÒEJVGMQTD$/%%QJ 4+%C *GTTNKEJG2CVKPCIWVGUUGJTUEJÌP



8897

8898

273


RÖMISCHE KAISERZEIT

1,5:1



8899

1,5:1

Ô#WTGWU4QOI&TCRKGTVG$ÒUVGT/CTUIGJVTOKV5RGGTWPF6TQRJ·G$/% %CNKEQ%QJ4+% 5GJTUEJÌP



8900



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT/CTUIGJVTOKV5RGGTWPF6TQRJ·G$/% %QJ4+%#D $TCWPG2CVKPC(GNFGTNGKEJVIGIN·VVGVCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

1,5:1





8901 1,5:1

 WPF 'WRCVQT XQP $QURQTWU 'N5VCVGT ,CJT      I -QRH T OKV .QTDGGTMTCP\&TC   RKGTVG$ÒUVGTOKV&KCFGOFCXQT-GWNG(TQNQXC2N::8 FKGU'ZGORNCT   #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP#TU%NCUUKEC8)GPH0T

8902



8904

8903

#PVQPKPWU++/CTEWU#WTGNKWU“5GUVGT\4QOI)GRCP\GTVG$ÒUVGT/CTE #WTGNWPF.WEKWU8GTWUTGKEJGPUKEJFKG*CPF$/%#PO%QJ4+%  )WVGU2QTV·VFWPMGNDTCWPG2CVKPC(GNFGTNGKEJVIGIN·VVGVUGJTUEJÌPpXQT\ÒINKEJ





“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\2TQXKFGPVKC UVGJV N OKV )NQDWU   WPF(ÒNNJQTP$/%#PO%QJ4+% $TCWPG2CVKPCUGJTUEJÌP





“&WRQPFKWU  4QO  I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\/CTEWU #WTGNKWU WPF   .WEKWUUKV\GPNCWH2NCVVHQTOFCXQT.KDGTCNKVCUWPF6QICVWU$/%5#PO%QJ4+% 4&WPMGNITÒPG2CVKPCUGJTUEJÌP



274


RÖMISCHE KAISERZEIT

8905

1,5:1



1,5:1

“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\/KPGTXCUVGJVNOKV<YGKI5RGGTWPF 5EJKNF$/%%QJ4+% 8QT\ÒINKEJGU'ZGORNCTOKVITÒPGT2CVKPC



'ZGORNCTFGT#WMVKQP5VGTPDGTI::+<ÒTKEJ0T

1,5:1



8906

1,5:1

Ô#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\(GNKEKVCUUVGJVNOKV%CFWEGWUWPF(ÒNNJQTP $/%%CNKEQ%QJ4+% -N2TQDKGTURWTGPCO4CPFUGJTUEJÌP 

8907

8908



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\#GSWKVCU UKV\V N OKV 9CCIG WPF (ÒNN   JQTP$/%%QJ4+% )N·P\GPFGITÒPG2CVKPCUGJTUEJÌP





“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\%QPEQTFKCUVGJVNOKV\YGK5VCPFCTVGP $/%%QJ4+% )TÒPDTCWPG2CVKPCUGJTUEJÌP



8909

8910



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\6TQRJ·GNUKV\VVTCWGTPFG)GTOCPKPT UVGJVIGHGUUGNVGT)GTOCPG$/%%QJ4+% &WPMGNITÒPG2CVKPCIWVGUUGJTUEJÌP





“5GUVGT\  4QO  I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\8KGTU·WNKIGT 6GORGN FGU   /GTEWTKO+PPGTGP5VCVWGFGU)QVVGU$/%%QJ4+%  4$TCWPG2CVKPCUEJÌPpUGJTUEJÌP



&GT·I[RVKUEJG5VKNFGU6GORGNUNGIVGKPG8GTDKPFWPIOKVFGODGTÒJOVGP4GIGPYWPFGTFGT3WCFGPUEJNCEJVPCJG

275


RÖMISCHE KAISERZEIT

8912

8911



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\-CKUGTGTJGDV+VCNKC$/%%QJ 4+% $TCWPG2CVKPCUGJTUEJÌP





“#U  4QO  I -QRH T OKV .QTDGGTMTCP\6KDGT NCIGTV N OKV 5EJKNH FKG 4GEJVG TWJV   CWH$QQV$/%%QJ4+% $TCWPG2CVKPCUGJTUEJÌP



8914

8913



“&WRQPFKWU  4QO  I -QRH T OKV 5VTCJNGPDKPFG#GSWKVCU UVGJV N OKV 9CCIG WPF   (ÒNNJQTP$/%%QJ4+% $TCWPG2CVKPCMN5EJTÌVNKPIUTK­IWVGUUGJTUEJÌP





HÒT&KXWU#PVQPKPWUÕ&GPCT4QOI-QRHTNFTCRKGTV4QIWU$/%%QJ 4+% 5GJTUEJÌP



8916

8915 1,5:1



1,5:1

“5GUVGT\4QOI-QRHT5VCVWGFGU#PVQPKPWU2KWUCWHGKPGT5·WNG$/%%QJ 4+% )TÒPG2CVKPCUGJTUEJÌPUEJÌP



#WH FGO 4GXGTU FÒTHVG FKG 'JTGPU·WNG FGU -CKUGTU CWH FGO /CTUHGNF FCTIGUVGNNV UGKP XQP FGT UKEJ NGKFGT PWT FKG   $CUKUGTJCNVGPJCV



 HÒT (CWUVKPC HKNKC Ô#WTGWU  4QO  I &TCRKGTVG $ÒUVG T5CNWU UKV\V N WPF HÒVVGTV   5EJNCPIG$/%%CNKEQ%QJ4+% 9KP\*GPMGNURWTUGJTUEJÌP  'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T

8917

8918

8918 1,5:1



Õ&GPCT4QOI&TCRKGTVG$ÒUVGT*KNCTKVCUUVGJVNOKV2CNOGWPF(ÒNNJQTP$/% %QJ4+% 5GJTUEJÌP





“5GUVGT\4QOI&TCRKGTVG$ÒUVGT(GEWPFKVCUUVGJVTOKV<GRVGTWPF-KPF$/% %QJ4+% $TCWPG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT



276


RÖMISCHE KAISERZEIT

8919

8920

8921



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT(GEWPFKVCUUVGJVTOKV<GRVGTWPF-KPF$/% %QJ4+% $TCWPG2CVKPCUEJCTHCWUIGRT·IVGU'ZGORNCTIWVGUUGJTUEJÌP





“5GUVGT\4QOI&TCRKGTVG$ÒUVGT+WPQUVGJVNOKV2CVGTCWPF<GRVGTFCXQTUVGJV 2HCWN$/%%QJ4+% $TCWPG2CVKPCMN5VGORGNHGJNGTCWHFGO#XGTUXQT\ÒINKEJ





“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T-[DGNG UKV\V T OKV 6TQOOGN \YKUEJGP \YGK   .ÌYGP$/%%QJ4+% $TCWPG2CVKPCUGJTUEJÌP



8922

1,5:1



1,5:1

“#U4QOI&TCRKGTVG$ÒUVGT.CGVKVKCUVGJVNOKV-TCP\WPF<GRVGT$/% %QJ4+% &WPMGNITÒPG2CVKPCXQT\ÒINKEJGU2TCEJVGZGORNCT 

8925

8923

8924



HÒT&KXC(CWUVKPCHKNKC“5GUVGT\PCEJ4QOI&TCRKGTVG$ÒUVGT#NVCT$/% %QJ4+% )TÒPDTCWPG2CVKPCIWVGUUGJTUEJÌP





“5GUVGT\ PCEJ  4QO  I &TCRKGTVG $ÒUVGT&KCPCUVGJVTOKV(CEMGNCWHFGP5EJWNVGTP *CNDOQPF$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌP





OKV.WEKWU8GTWUWPF'WRCVQTXQP$QURQTWU'N5VCVGT,CJT  I$GKFGT$ÒUVGP GKPCPFGTIGIGPÒDGTFC\YKUEJGP5VGTP&TCRKGTVG$ÒUVGTOKV&KCFGO(TQNQXCXGTIN2N::8++ 45GJTUEJÌP

 277


RÖMISCHE KAISERZEIT

8926

8926 1,5:1



'N5VCVGT ,CJT      I $GKFGT $ÒUVGP GKPCPFGT IGIGPÒDGT FC\YKUEJGP 5VGTP&TCRKGTVG   $ÒUVGTOKV&KCFGO(TQNQXCXGTIN2N::8++ 45GJTUEJÌP

8927



8928

1,5:1



HÒT&KXWU.WEKWU8GTWU“5GUVGT\4QOI-QRHT&KXWUUKV\VTKP'NGHCPVGPSWCFTKIC OKVXKGT/CJQWVU$/%%QJ4+% 4)TÒPG2CVKPCUEJÌPpUGJTUEJÌP



.WEKWU 8GTWU  “5GUVGT\  4QO  I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\   /CTEWU#WTGNKWUWPF.WEKWU8GTWUTGKEJGPUKEJFKG*CPF$/%%QJXGTIN4+%XGTIN $TCWPG2CVKPCYKP\5EJTÌVNKPIUTK­XQT\ÒINKEJ 



'ZGORNCTFGT#WMVKQP)KGUUGPGT/ÒP\JCPFNWPI/ÒPEJGP0T

8930

8929

1,5:1



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\/CTEWU #WTGNKWU WPF .WEKWU 8GTWU   TGKEJGPUKEJFKG*CPF$/%#PO%QJ4+%  4$TCWPG2CVKPCIWVGU2QTVT·VCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\.WEKWU8GTWUUKV\VNWPFMTÌPV 5QJCGOWU FCJKPVGT \YGK 5QNFCVGP FCXQT GKP 5QNFCV $/%  XCT %QJ  XCT 4+%  XCT   44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVITÒPDTCWPGT2CVKPC &CU5VÒEMHGKGTVFKG'KPUGV\WPIFGU5QJCGOWUCNU-ÌPKIKP#TOGPKGP

278




RÖMISCHE KAISERZEIT

8931

8932

8932



Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\2CZ UVGJV N OKV <YGKI WPF (ÒNNJQTP   $/%%QJ4+% )WVGUUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\/CTU IGJV T OKV 5RGGT WPF 6TQRJ·G   $/%%QJ4+% )TÒPG2CVKPCGVYCUMQTTQFKGTVUGJTUEJÌPHCUVUGJTUEJÌP



8934

8933

8933



“5GUVGT\4QOI)GRCP\GTVG$ÒUVGTOKV.QTDGGTMTCP\4QOCUVGJVNOKV8KEVQTKC WPF6TQRJ·G$/%5#PO%QJ4+%  &WPMNG2CVKPC4GXGTUGVYCUMQTTQFKGTVHCUVXQT\ÒINKEJHCUVUGJTUEJÌP





HÒT.WEKNNCÕ&GPCT4QOI&TCRKGTVG$ÒUVGT8GUVCUVGJVNOKV5KORWNWOWPF 2CNNCFKWOFCXQT#NVCT$/%%QJ4+% 5GJTUEJÌP



8935

8936



“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T%QPEQTFKC UKV\V N OKV 2CVGTC WPF (ÒNNJQTP   $/%%QJ4+%XCT )N·P\GPFGFWPMGNITÒPG2CVKPC5EJTÌVNKPIUTK­UGJTUEJÌP





“#U  4QO  I &TCRKGTVG $ÒUVG T+WPQ UVGJV N OKV 2CVGTC WPF <GRVGT FCXQT UVGJV   2HCWN$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌP



8937

8938



“#U  4QO  I &TCRKGTVG $ÒUVG T8GPWU UVGJV T OKV #RHGN $/%  %QJ    4+% &WPMGNITÒPG2CVKPCIWVGUUGJTUEJÌP





%QOOQFWU  “5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\%QOOQFWU UKV\V N   CWH 2NCVVHQTO FCJKPVGT 1HHK\KGT FCXQT .KDGTCNKVCU OKV #DCEWU WPF (ÒNNJQTP WPF $ÒTIGT $/%    %QJ4+% 4&WPMGNITÒPG2CVKPCUGJTUEJÌP

 279


RÖMISCHE KAISERZEIT

8940

8939



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\#PPQPC UVGJV N OKV %QPEQTFKCUVCVWG WPF   (ÒNNJQTP\YKUEJGP/QFKWUWPF5EJKHH$/%#PO%QJ4+% $TCWPG2CVKPCUGJTUEJÌP





“&WRQPFKWU  4QO  I -QRH T OKV 5VTCJNGPDKPFG(QTVWPC UVGJV N OKV 5VGWGTTWFGT CWH   )NQDWUWPF(ÒNNJQTP$/%5#PO%QJ4+%  $TCWPG2CVKPCIWVGUUGJTUEJÌPHCUVXQT\ÒINKEJ



8942 8941



“5GUVGT\4QOI-QRHTOKV.QTDGGTMTCP\/KPGTXCUVGJVTOKV5RGGTWPF5EJKNF $/%%QJ4+% &WPMNG2CVKPCUGJTUEJÌP





Õ&GPCT  4QO  I -QRH T OKV .QTDGGTMTCP\,WRKVGT UVGJV N OKV $NKV\ WPF <GRVGT   $/%%QJ4+% -PCRRGT5EJTÌVNKPIXQT\ÒINKEJ



1,5:1



8943

1,5:1

Ô#WTGWU  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\%CFWEGWU \YKUEJGP \YGK IG   MTGW\VGP(ÒNNJÌTPGTP$/%%CNKEQ%QJ4+%  4#VVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT 

8944

8944 1,5:1



“U *KGTCRQNKU 2JT[IKC  KP *QOQPQKC OKV 5CTFGKU .[FKC   I &TCRKGTVG $ÒUVG T OKV .QTDGGT   MTCP\#RQNNQXQP*KGTCRQNKUUVGJVTOKV.[TCFCXQT5VCVWGFGT-QTGXQP5CTFGKUXX(TCPMG0QNN¾  FKGU'ZGORNCT  8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCMN-TCV\GTUGJTUEJÌP 'ZGORNCTFGT#WMVKQP)KGUUGPGT/ÒP\JCPFNWPI/ÒPEJGP0T

280




RÖMISCHE KAISERZEIT

8946 8945

8945



 HÒT &KXWU /CTEWU #WTGNKWU “5GUVGT\  4QO  I -QRH T&KXWU UKV\V T KP 'NGHCPVGP   SWCFTKICOKVXKGT/CJQWVU$/%%QJ4+% (CUVUGJTUEJÌP





HÒT%TKURKPCÕ&GPCT4QOI&TCRKGTVG$ÒUVGT*KNCTKVCUUVGJVNOKV2CNO\YGKI WPF(ÒNNJQTP$/%%QJ4+% (GKPG2CVKPCUGJTUEJÌP



8947

8948



“5GUVGT\4QOI&TCRKGTVG$ÒUVGT%QPEQTFKCUKV\VNOKV&QRRGNHÒNNJQTP$/%%QJ 4+% )TÒPG2CVKPCUGJTUEJÌP





“5GUVGT\4QOI&TCRKGTVG$ÒUVGT%QPEQTFKCUKV\VNOKV&QRRGNHÒNNJQTP$/%%QJ 4+% )TÒPG2CVKPC4GXGTUOKPMQTTQFKGTVUGJTUEJÌP



8949

2:1

2:1



2GTVKPCZÔ#WTGWU4QOI-QRHTOKV.QTDGGTMTCP\2TQXKFGPVKCUVGJVNFKG4GEJVG\W GKPGO5VGTPGTJQDGP$/%%CNKEQ%QJ4+%C  442TCEJVXQNNGU2QVTVT·VXQT\ÒINKEJGU2TCEJVGZGORNCT  2GTVKPCZIGDQTGPCO#WIWUVKP#NDC2QORGKCJCVVGGKPGIN·P\GPFG-CTTKGTGJKPVGTUKEJCNUGTKO,CJT PCEJFGT'TOQTFWPIFGU%QOOQFWU\WO-CKUGTRTQMNCOKGTVYWTFG'TYCTFGT5QJPGKPGU(TGKIGNCUUGPGPWPFYCT \WP·EJUV CNU .GJTGT V·VKI DGXQT GT GKPG OKNKV·TKUEJG -CTTKGTG DGICPP 5GPCVQT WPF UEJNKG­NKEJ EQPUWN UWHHGEVWU   YWTFG %QOOQFWU GTPCPPVG KJP \WO 2T·HGMVGP XQP 4QO 2GTVKPCZ MQPPVG PCEJ UGKPGT 'TPGPPWPI \WO -CKUGT FGP   5QNFCVGPCWHITWPFFGT\GTTÒVVGVGP5VCCVUHKPCP\GPMGKP&QPCVKXWOKPFGTGTYCTVGVGP*ÌJG\CJNGPUQMCOGUDCNF\WT 'TOQTFWPIFGU2GTVKPCZ

8950

8951

1,5:1

8951



Õ&GPCT 4QO  I -QRH T OKV .QTDGGTMTCP\1RU UKV\V N OKV \YGK JTGP $/%  %QJ    4+%C 45GJTUEJÌP





&KFKWU ,WNKCPWU  “5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\%QPEQTFKC UVGJV N   OKV\YGK(GNF\GKEJGP$/%%QJ4+% 4$TCWPG2CVKPCIWVGU2QTVT·VUGJTUEJÌP

 281


RÖMISCHE KAISERZEIT

8953

8952

8954

8952 1,5:1

8953 1,5:1



 HÒT &KFKC %NCTC Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T*KNCTKVCU UVGJV N OKV 2CNO\YGKI WPF   (ÒNNJQTP$/%%QJ4+% 44(GKPG2CVKPCIWVGU2QTVT·VMN5EJTÌVNKPIUTK­UGJTUEJÌP 



2GUEGPPKWU0KIGTÕ&GPCT#PVKQEJKCI-QRHTOKV.QTDGGTMTCP\2+'6#6'#8) $QPWU'XGPVWUUVGJVNOKV(TÒEJVGMQTDWPFJTGP$/%%QJ4+%  8QPCNNGTITÌ­VGT5GNVGPJGKV5GJTUEJÌP



%NQFKWU #NDKPWU  Õ&GPCT  4QO  I -QRH T4QOC UKV\V N CWH 5EJKNF OKV   2CNNCFKWOWPF<GRVGT$/%%QJ4+%C  2TCEJVXQNNGU2QTVT·VHCUVXQT\ÒINKEJGU'ZGORNCTOKVJGTTNKEJGT2CVKPC





8956

8955



“5GUVGT\  4QO  I -QRH T N FTCRKGTV(GNKEKVCU UVGJV N OKV %CFWEGWU WPF <GRVGT   $/%%QJXGTIN4+%E 4$TCWPG2CVKPCHCUVUGJTUEJÌP





5GRVKOKWU 5GXGTWU  “ #UUCTKC /CTEKCPQRQNKU /QGUKC KPHGTKQT  .GICV %QUEQPKWU )GPVKC   PWU  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\#RQNNQ UVGJV X X OKV $QIGP T 5EJNCPIG WO   $CWOUVWORHIGYWPFGP#/0)8CTDCPQX KTTVÒONKEJG$GUEJTGKDWPI   44.GKEJVMQTTQFKGTVUGJTUEJÌP



8957

8958







282

8959

8958

“#UUCTKC0KMQRQNKURTQU+UVTQP /QGUKCKPHGTKQT .GICV#WTGNKWU)CNNWUI-QRHTOKV.QT DGGTMTCP\(NW­IQVVNCIGTVNOKV<YGKIFKG.KPMGCWH3WGNNWTPGIGUVÒV\V#/0)8CTDCPQX )TÒPDTCWPG2CVKPCUGJTUEJÌP



“U)GTOG /[UKC I5VTCVGIQU0GKMKCUI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\-CKUGT UVGJV N OKV 5RGGT XQP 0KMG DGMT·P\V FCXQT UVGJV 6[EJG OKV 5VGWGTTWFGT WPF (ÒNNJQTP 5NI 4KIJGVVK   #WMVKQP/ÒP\GPWPF/GFCKNNGP&GWVUEJNCPF)OD*5VWVVICTV0T FQTVKTTVÒONKEJ0KMQ OCEJQU 50)(TCPEGXGTIN FQTVUVCTMÒDGTCTDGKVGV  44&WPMGNITÒPG2CVKPCUGJTUEJÌP



Õ6GVTCFTCEJOG.CQFKEGCCFOCTG 5[TKC I&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\ #FNGTUVGJVXX-QRHNOKV-TCP\KO5EJPCDGNWPVGP5VGTP2TKGWT  (GKPGU2QTVT·VIWVGUUGJTUEJÌP




RÖMISCHE KAISERZEIT

8960

8961



8961

WPF,WNKC&QOPC“U5VTCVQPKMGKC %CTKC I$GKFGT$ÒUVGPGKPCPFGTIGIGPÒDGTQDGPQXCNGT )GIGPUVGORGN #VJGPCMQRH T WPVGP TGEJVGEMKIGT )GIGPUVGORGN QEOU*GMCVG UVGJV N OKV 2CVGTC   WPF(CEMGNFCXQT*WPF50)-GEMOCP)GIGPUVGORGN*QYIGIQWPF  &WPMNG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP



 HÒT ,WNKC &QOPC “5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T,WPQ UKV\V N OKV $NWOG   WPF-KPF$/%%QJ4+% )TÒPG2CVKPCMN5EJTÌVNKPIUTK­UGJTUEJÌP



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



8962

8964

8963



 HÒT )GVC Õ&GPCT  4QO I&TCRKGTVG$ÒUVGT%CUVQTUVGJVNPGDGPUGKPGO2HGTF OKV<GRVGT$/%%QJ4+% 48QT\ÒINKEJ





#PVQPKPWU+++%CTCECNNCÕ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGT MTCP\-CKUGTCNU5QNUVGJVNOKV)NQDWUWPF5RGGT$/%%QJ4+% 5GJTUEJÌP





“#U4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\&GC%CGNGUVKUTGKVGVCWHGKPGO.ÌYGPT OKV6TQOOGNWPF<GRVGTFCTWPVGTUVTÌOV9CUUGTCWUGKPGO(GNUGP$/%%QJ4+%E  4#VVTCMVKXGU'ZGORNCTOKVITÒPGT2CVKPC#XGTUOKPIGIN·VVGVUGJTUEJÌP



8965

8967

8966



Õ#PVQPKPKCP4QOI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG8GPWUUVGJVNOKV8KEVQ TKC5RGGTWPF5EJKNF$/%%QJXGTIN4+%F 5GJTUEJÌP





Õ#PVQPKPKCP4QOI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG5QNUVGJVNOKV)NQDWU$/% %QJ4+%C )WVGUUGJTUEJÌP





“#UUCTKC#PEJKCNQU 6JTCEKC I&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\)CNGGTGN#/0) XGTIN8CTDCPQX FKGU'ZGORNCTGTY·JPV  &WPMGNITÒPG2CVKPCHCUVUGJTUEJÌP



'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T

1,5:1

8968

1,5:1

8969



“U *CFTKCPQRQNKU 6JTCEKC   I &TCRKGTVG $ÒUVG N OKV .QTDGGTMTCP\ 5RGGT WPF 5EJKNF#NVCT   8CTDCPQX 442T·EJVKIGITÒPG2CVKPCXQT\ÒINKEJ





Õ6GVTCFTCEJOG  6[TQU 2JQGPKEKC   I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\#FNGT   UVGJVXX-QRHNOKV-TCP\KO5EJPCDGNWPVGP2WTRWTUEJPGEMG2TKGWT 5GJTUEJÌP



6[TQU YCT FCU <GPVTWO FGT 2WTRWTIGYKPPWPI /CP DGPÌVKIVG GVYC  2WRWTUEJPGEMGP /WTGZ VTWPEWNWU  WO   GKP)TCOOFGUGZVTGOVGWTGP(CTDUVQHHGU\WJGT\WUVGNNGP*GWVGNKGIVFGT2TGKUHÒTGKP)TCOO2WTRWTWO'WTQ

283


RÖMISCHE KAISERZEIT

8970

8972

8971



HÒT,WNKC&QOPCÕ&GPCT4QOI&TCRKGTVG$ÒUVGT8GPWU)GPGVTKZUKV\VNOKV #RHGNWPF<GRVGTFCXQTUVGJV%WRKFQ$/%%QJ4+%D (CUVXQT\ÒINKEJ





“#U4QOI&TCRKGTVG$ÒUVGTOKV&KCFGO&KCPCKP$KICN$/%%QJ 4+% &WPMNG2CVKPCUGJTUEJÌP





“#U4QOI&TCRKGTVG$ÒUVGT-CKUGTKPUKV\VNOKV<YGKIWPF<GRVGT$/%5 #PO%QJ4+% $TCWPG2CVKPCYKP\5EJTÌVNKPIUTK­UGJTUEJÌP



8973

8974

8973 1,5:1



“#U  4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO8GPWU UKV\V N OKV <GRVGT $/%    %QJ4+% &WPMGNITÒPG2CVKPCOKPMQTTQFKGTVUGJTUEJÌPpXQT\ÒINKEJ





“#U4QOI&TCRKGTVG$ÒUVGTOKV&KCFGO8KGT8GUVCNKPPGPQRHGTPÒDGT#NVCTXQT 4WPFVGORGNFCDGK\YGK-KPFGT$/%%QJ4+%  44&WPMGNITÒPG2CVKPCWPDGFGWVGPFG)N·VVWPIUURWTGPUGJTUEJÌP



8975



8976

8977

HÒT2NCWVKNNCÕ&GPCT4QOI&TCRKGTVG$ÒUVGT-CKUGTWPF-CKUGTKPTGKEJGPUKEJ FKG*CPF$/%%QJ4+% #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



&CU 5VÒEM YWTFG CPN·­NKEJ FGT *QEJ\GKV FGU %CTCECNNC OKV 2NCWVKNNC IGRT·IV &KG CW­GTIGYÌJPNKEJG .GIGPFG   RTQRCIQKORGTK FKG0CEJMQOOGPFGT*GTTUEJCHV UVGJVICP\KO<GKEJGPFGT$GOÒJWPIGPFGU5GRVKOKWU5GXGTWU ÒDGTUGKPG5ÌJPG%CTCECNNCWPF)GVCGKPGPGWG&[PCUVKGCWH\WDCWGPFKGFGO4GKEJ5KEJGTJGKVWPF5VCDKNKV·VICTCP VKGTGP UQNN /KV FGT *GKTCV FGU 6JTQPHQNIGTU YKTF FKG *QHHPWPI CWH 0CEJMQOOGPUEJCHV WPF FCOKV FGP (QTVDGUVCPF   FGT*GTTUEJCHVFGT5GXGTGTXGTDWPFGP



Õ&GPCT4QOI&TCRKGTVG$ÒUVGT%QPEQTFKCUVGJVNOKV2CVGTCWPF<GRVGT$/% %QJ4+%C (CUVXQT\ÒINKEJUGJTUEJÌP





WPF4JGUMWRQTKU+++XQP$QURQTWU'N5VCVGT,CJT  I&TCRKGTVG$ÒUVGT OKV.QTDGGTMTCP\&TCRKGTVG$ÒUVGTOKV&KCFGOFCXQT-GWNG(TQNQXC2N:.8+  5GJTUEJÌPpXQT\ÒINKEJ



284


RÖMISCHE KAISERZEIT

8978 1,5:1

1,5:1



)GVC“#U4QOI-QRHTOKV.QTDGGTMTCP\(QTVWPCUKV\VNOKV5VGWGTTWFGT WPF(ÒNNJQTP$/%%QJ4+%C &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ

1,5:1



8979



1,5:1

/CETKPWU  Ô#WTGWU  4QO  I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\#PPQPC   UKV\VNOKVJTGPWPF(ÒNNJQTPFCXQT/QFKWU$/%%CNKEQ%QJXCT4+%XCT  445GJTUEJÌP 

8981

8982

8980



“#U4QOI)GRCP\GTVG$ÒUVGTOKV.QTDGGTMTCP\5CNWUUKV\VNOKV<GRVGTWPF2CVGTCFCXQT GKPGWOGKPGP#NVCTIGYWPFGPG5EJNCPIG$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌP





Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\#GSWKVCU UVGJV N OKV 9CCIG WPF (ÒNN   JQTP$/%%QJ4+% 8QT\ÒINKEJ





 HÒT &KCFWOGPKCPWU Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T2TKP\ UVGJV N OKV 5VCPFCTVG WPF   <GRVGTFCJKPVGT\YGK5VCPFCTVGP$/%XCT%QJXCT4+% (CUVXQT\ÒINKEJ



1,5:1



8983

Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T5RGU UVGJV T OKV $NWOG WPF TCHHV KJT -NGKF  $/%    %QJ4+% 48QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI 

8984



1,5:1

8985

“ #UUCTKC 0KMQRQNKU RTQU +UVTQP /QGUKC KPHGTKQT  .GICV #ITKRRC  I &TCRKGTVG $ÒUVG T   *[IKGKC UVGJV N WPF HÒVVGTV 5EJNCPIG #/0)  8CTDCPQX  WPIGPCWG $GUEJTGKDWPI FGT #XGTUNG   IGPFGUKGJG#DD  4)TÒPG2CVKPCXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T



#PVQPKPWU +8 'NCICDCN  “5GUVGT\ 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\   .+$46#5#8)856+ UKE .KDGTVCUUVGJVNOKV2KNGWUWPF<GRVGTT5VGTP$/%XCT%QJ XCT4+%XCT 44)TÒPG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP

 285


RÖMISCHE KAISERZEIT

1,5:1



8986

1,5:1

 HÒT &KXC ,WNKC &QOPC Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV 5EJNGKGT2HCW TCF   UEJNCIGPFT$/%%QJ4+% %CTCECNNC WPF 5GX#NGZCPFGT   8QPITQ­GT5GNVGPJGKV(GKPGU2QTVT·VUGJTUEJÌPpXQT\ÒINKEJ 

8987

8988

8989

1,5:1

1,5:1



HÒT,WNKC/CGUCÕ&GPCT4QOI&TCRKGTVG$ÒUVGT2WFKEKVKCUKV\VNOKV<GRVGTWPFNÒHVGV 5EJNGKGT$/%%QJ4+% 8QT\ÒINKEJGU2TCEJVGZGORNCTOKVHGKPGT6ÌPWPI





HÒT,WNKC2CWNCÕ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV&KCFGO-CKUGTWPF-CKUGTKPUVGJGP GKPCPFGTIGIGPÒDGTWPFTGKEJGPUKEJFKG*CPF$/%%QJ4+%  -N4CPFTKUUGWPFYKP\5EJTÌVNKPIUHGJNGTXQT\ÒINKEJ





 HÒT #SWKNKC 5GXGTC Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T%QPEQTFKC UVGJV N OKV   2CVGTCWPF&QRRGNHÒNNJQTPFCXQT5VGTP$/%%QJ4+%  5GJTUGNVGPKPFKGUGT'TJCNVWPI#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI 

8991

8991 1,5:1

8990





5GXGTWU #NGZCPFGT  “5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\   5GEWTKVCUUKV\VNOKV<GRVGTFCXQT#NVCT$/%%QJXCT4+%  )TÒPDTCWPG2CVKPCMN-TCV\GTCWHFGO4GXGTUIWVGUUGJTUEJÌPUGJTUEJÌP

Ô#WTGWU  4QO  I -QRH T OKV .QTDGTMTCP\ N FTCRKGTV.KDGTCNKVCU UVGJV N OKV   #DCEWUWPF(ÒNNJQTP$/%XCT%CNKEQ%QJXCT4+%XCT  9KP\-TCV\GTCWHFGO4GXGTUXQT\ÒINKEJ 

8992



 286



8993

“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\/CTUIGJVTOKV5RGGTWPF 5EJKNF$/%%QJ4+%  &WPMGNITÒPG2CVKPCJGTTNKEJGU2QTVT·VXQT\ÒINKEJIWVGUUGJTUEJÌP



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\/CTUIGJVTOKV5RGGTWPF 5EJKNF$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌP




RÖMISCHE KAISERZEIT

8994

8995



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV2TQXKFGPVKC UVGJV N OKV   JTGPWPF(ÒNNJQTPFCXQT/QFKWU$/%%QJ4+% &WPMGNITÒPG2CVKPCUGJTUEJÌP





“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV2TQXKFGPVKC UVGJV N OKV   JTGPWPF(ÒNNJQTPFCXQT/QFKWU$/%%QJ4+% $TCWPG2CVKPCUGJTUEJÌP



8997 8996



“5GUVGT\  4QO  I -QRH T OKV .QTDGGTMTCP\ N FTCRKGTV2TQXKFGPVKC UVGJV N OKV   JTGPWPF#PMGTFCXQT/QFKWU$/%%QJ4+%  )TÒPG2CVKPCOKPMQTTQFKGTVUGJTUEJÌP





Õ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\/CTUIGJVTOKV5RGGTWPF5EJKNF $/%%QJ4+% 2TCEJVGZGORNCTHCUV5VGORGNHTKUEJ



&KGMTKGIGTKUEJG&CTUVGNNWPIFGU/CTU7NVQTUVGJVKO<WUCOOGPJCPIOKVFGO2GTUGTMTKGIFGU-CKUGTU

8998





“U $[\CPVKQP 6JTCEKC   I )GRCP\GTVG $ÒUVG T OKV 5VTCJNGPDKPFG-CKUGT WPF 6[EJG XQP $[   \CPVKQP UVGJGP GKPCPFGT IGIGPÒDGT WPF JCNVGP 5EJCNGP ÒDGT GKPGP 6KUEJ CWH FGO GKPG 2TGKUMTQPG OKV   \YGK2CNO\YGKIGPUVGJV5EJÌPGTV)GKUU8CTDCPQX 44$TCWPG2CVKPCUGJTUEJÌP



“/GFCKNNQP,CJT  #OCUKC 2QPVWU I&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\ #FNGTOKVCWUIGDTGKVGVGP5EJYKPIGPCWH#NVCTN$CWOQDGP5QNKP3WCFTKIC9CFFKPIVQP4GEIGP #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



9000



8999

9001

“U 5GNIG 2KUKFKC   I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\#VJGPC UVGJV N OKV 5RGGT $/%    /KQPPGV50)(TCPEG50)X#WNQEM 44)TÒPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T



 HÒT ,WNKC /COCGC Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO(GNKEKVCU UVGJV N   OKV%CFWEGWUCP5·WNGIGNGJPV$/%%QJ4+% 8QT\ÒINKEJ

 287


RÖMISCHE KAISERZEIT

9002



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV&KCFGO(GNKEKVCUUVGJVNOKV%CFWEGWUCP5·WNG IGNGJPV$/%%QJ4+% )TÒPG2CVKPCUGJTUEJÌP

9003

1,5:1





9004



1,5:1

Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO%QPEQTFKC UKV\V N OKV 2CVGTC WPF &QR   RGNHÒNNJQTP$/%%QJ4+% (CUVXQT\ÒINKEJ

9005



1,5:1

 HÒT 1TDKCPC Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO%QPEQTFKC UKV\V N OKV   2CVGTCWPF&QRRGNHÒNNJQTP$/%%QJ4+% 8QT\ÒINKEJGU2TCEJVGZGORNCT

1,5:1





9006

9007

Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO%QPEQTFKC UKV\V N OKV 2CVGTC WPF &QR   RGNHÒNNJQTP$/%%QJ4+%  -N5EJTÌVNKPIUTK­UGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO%QPEQTFKC UKV\V N OKV 2CVGTC WPF &QR   RGNHÒNNJQTP$/%%QJ4+% 5GJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





“#U4QOI&TCRKGTVG$ÒUVGTOKV&KCFGO%QPEQTFKCUKV\VNOKV2CVGTCWPF&QRRGNHÒNNJQTP $/%%QJ4+% $TCWPG2CVKPC4GXGTUMQTTQFKGTVUGJTUEJÌP



9009

9008



 288

1,5:1

1,5:1

9008

/CZKOKPWU + 6JTCZ  “5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGT   MTCP\(KFGUUVGJVNOKV\YGK5VCPFCTVGP$/%%QJ4+%  )TÒPG2CVKPC-TCV\GTCWHFGO4GXGTUUGJTUEJÌP



Õ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\-CKUGTUVGJVNOKV5RGGT\YKUEJGP \YGK5VCPFCTVGP$/%%QJ4+% 8QT\ÒINKEJ




RÖMISCHE KAISERZEIT

9010



“U,CJT  #PGOWTKQP %KNKEKC I&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\2GTUGWU UVGJVNOKV*CTRCWPFFGOCDIGVTGPPVGP*CWRVFGT/GFWUC50).GXCPVG50)(TCPEGXCT  )N·P\GPFGFWPMGNITÒPG2CVKPCIWVGUUGJTUEJÌP

1,5:1



9011 1,5:1

HÒT&KXC2CWNKPCÕ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV5EJNGKGT2HCW$/%%QJ 4+% 4#VVTCMVKXGU'ZGORNCTOKVHGKPGT2CVKPCIWVGUUGJTUEJÌP

9013



9012



9013



Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T OKV 5EJNGKGT2HCW HNKGIV T OKV &KXC $/%  %QJ    4+% 45EJÌPpUGJTUEJÌP





HÒT/CZKOWU“#U4QOI&TCRKGTVG$ÒUVGT2TKGUVGTIGT·VG$/%%QJ 4+% $TCWPG2CVKPC(GNFGTGVYCUIGIN·VVGVUGJTUEJÌP



9014

9015

9014



“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T2TKP\ UVGJV N OKV 5VCD WPF <GRVGT FCJKPVGT   \YGK(GNF\GKEJGP$/%%QJ4+% $TCWPG2CVKPCUGJTUEJÌP





Õ&GPCT4QOI&TCRKGTVG$ÒUVGT2TKP\UVGJVNOKV5VCDWPF<GRVGTFCJKPVGT\YGK 5VCPFCTVGP$/%%QJ4+% -N-TCV\GTCWHFGO#XGTUXQT\ÒINKEJGU'ZGORNCT



1,5:1



9016

1,5:1

)QTFKCPWU + #HTKECPWU  Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\-CKUGT   UVGJVNOKV<YGKIWPF<GRVGT$/%%QJ4+% 44#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT  )QTFKCPWU+YWTFG\WUCOOGPOKVUGKPGOINGKEJPCOKIGP5QJPKP#HTKMC#PHCPI,CPWCT\WO#WIWUVWUCWUIGTW HGP WPF XQO 5GPCV CPGTMCPPV 0CEJFGO UGKP 5QJP 5EJNCEJV WPF .GDGP IGIGP FGP .GICVGP XQP 0WOKFKGP XGTNQTGP   JCVVGDGIKPIGTPCEJPQEJPKEJVGKPOCNGKPGO/QPCV4GIKGTWPI5GNDUVOQTF

289


RÖMISCHE KAISERZEIT

1,5:1



9017

1,5:1

)QTFKCPWU++#HTKECPWUÕ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\8KEVQTKC IGJVNOKV-TCP\WPF2CNO\YGKI$/%%QJ4+% 44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



)QTFKCPWU++#HTKECPWUYWTFGWOCNU5QJPFGU)QTFKCPWU+IGDQTGP&GT0COGUGKPGT/WVVGTKUVPKEJVDGMCPPV

FGTKPFGT*KUVQTKC#WIWUVCIGPCPPVG0COG(CDKC1TGUVKNNCKUVHKMVKX CDGTUKGYCTOÌINKEJGTYGKUGGKPG'PMGNKPFGU 5QRJKUVGP*GTQFGU#VVKEWUªDGT.GDGPWPF-CTTKGTGFGU)QTFKCPWUKUVYGPKIDGMCPPV\YCTHCDWNKGTVFGT#WVQTFGT *KUVQTKC#WIWUVCNWUVNQUGKPGPEWTUWUJQPQTWO\WUCOOGPKUVCDGTOGJTFCTCPKPVGTGUUKGTVFGO-CKUGTXGTUEJKGFGPG )GNÒUVG \W\WUEJTGKDGP UQ FKEJVGV GT FGO )QTFKCPWU  -QPMWDKPGP CP XQP FGPGP KJO LGFG  -KPFGT IGDQTGP   JCDGP UQNN UQYKG GKPG $KDNKQVJGM OKV    $·PFGP 5KEJGT KUV PWT FC­ )QTFKCPWU ++ EQPUWN UWHHGEVWU YCT   DGXQT GT UGKPGO 8CVGT CNU .GICV KP #HTKEC FKGPVG 'U KUV WPMNCT QD GT KP 6J[UFTWU IGOGKPUCO OKV UGKPGO 8CVGT   YGPKIG6CIGUR·VGTKP-CTVJCIQQFGTGTUVFWTEJFGP5GPCVKP4QO\WO-CKUGTGTJQDGPYQTFGPKUV#NU%CRGNKCPWU FGTFGO/CZKOKPWU6JTCZVTGWIGDNKGDGPG5VCVVJCNVGTXQP0WOKFKGPOKVUGKPGT#TOGGPCEJ-CTVJCIQOCTUEJKGTVG YWTFG )QTFKCPWU ++ \WO -QOOCPFGWT GKPGT VGKNU CWU (TGKYKNNKIGP DWPV \WUCOOGPIGYÒTHGNVGP #TOGG WPF UVGNNVG   UKEJ FGO (GKPF \WO -CORH 'T HKGN UGKP 8CVGT DGIKPI FCTCWHJKP 5GNDUVOQTF &KG /ÒP\GP FGT DGKFGP )QTFKCPK   #HTKECPK\·JNGP\WFGPUGNVGPGPWPFDGUQPFGTUDGIGJTVGP2T·IWPIGPFGTTÌOKUEJGP-CKUGT\GKV

1,5:1



9018

1,5:1

$CNDKPWU  Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\-CKUGT UVGJV N OKV   <YGKIWPF2CTC\QPKWO$/%%QJ4+%  )WVGU2QTVT·VCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI



9020

9020 1,5:1

9019



“5GUVGT\ 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\2TQXKFGPVKC UVGJV N OKV 5VCD WPF   (ÒNNJQTPFCXQT)NQDWU$/%%QJ4+% )TÒPDTCWPG2CVKPCUGJTUEJÌP





2WRKGPWU  Õ&GPCT 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\%QPEQTFKC UKV\V N OKV   2CVGTCWPF&QRRGNHÒNNJQTP$/%%QJ4+%  (GKPGU2QTVT·VJGTTNKEJG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



9022

9021

9022



Õ&GPCT4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\2CZUKV\VNOKV<YGKIWPF<GRVGT$/% %QJ4+% 5GJTUEJÌP





“5GUVGT\ 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\2CZ UKV\V N OKV <YGKI WPF <GRVGT   $/%%QJ4+%C (GNFGTFGT2QTVT·VUGKVGOKPIGIN·VVGVUGJTUEJÌP



290


RÖMISCHE KAISERZEIT

9023

9024



“5GUVGT\ 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\2CZ UKV\V N OKV <YGKI WPF <GRVGT   $/%%QJ4+%C $TCWPG2CVKPCHCUVUGJTUEJÌP





“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\8KEVQTKCUVGJVNOKV-TCP\WPF2CNO \YGKI$/%%QJ4+%C $TCWPG2CVKPC(GNFGTOKPDGTKGDGPUGJTUEJÌP



9026

9025



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\8KEVQTKCUVGJVNOKV-TCP\WPF2CNO \YGKI$/%%QJ4+%C $TCWPG2CVKPCHCUVUGJTUEJÌP





)QTFKCPWU +++  “5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\   (KFGUUVGJVNOKV5VCPFCTVGWPF<GRVGT%QJ4+%C &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ



9027

1,5:1



1,5:1

Ô#WTGWU  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\.KDGTCNKVCU UVGJV N OKV #DCEWU   WPF(ÒNNJQTP%CNKEQ%QJXGTIN4+% #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

9029

9028

9030

1,5:1



“#U4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\,WRKVGTUVGJVXXOKV<GRVGTWPF $NKV\%QJ4+%D &WPMGNITÒPG2CVKPCHCUVXQT\ÒINKEJ





Õ&GPCT  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\2KGVCU UVGJV X X -QRH N OKV   GTJQDGPGP*·PFGP%QJ4+% 7PIGYÌJPNKEJDTGKVGT5EJTÌVNKPIIWVGUUGJTUEJÌPUGJTUEJÌP





2JKNKRRWU+Õ#PVQPKPKCP#PVKQEJKCI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG 2#:(80&#6#%8/2'45+52CZUVGJVNOKV<YGKIWPF<GRVGT%QJ4+%  42T·IGUEJY·EJGCWHFGO4GXGTUUGJTUEJÌP



0CEJFGO6QFFGU)QTFKCPWU+++ CPFGO2JKNKRRWU+YCJTUEJGKPNKEJPKEJVWPUEJWNFKIYCT UEJNQ­2JKNKRRWU#TCDU OKV FGP 5CUCPKFGP GKPGP (TKGFGPUXGTVTCI FGT W C FKG <CJNWPI XQP  5GUVGT\GP CP5EJCRWTXQTUCJ&GT 4GXGTUWPUGTGU5VÒEMGUHGKGTVFKGUGP(TKGFGP

291


RÖMISCHE KAISERZEIT

9034

9031

9032

9033

9035



“#U4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\8KGT5VCPFCTVGP%QJ4+%D $TCWPG2CVKPCCVVTCMVKXGUHCUVXQT\ÒINKEJGU'ZGORNCT





Õ#PVQPKPKCP4QOI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG.ÌYGT%QJ4+%  8QT\ÒINKEJ



$GKFKGUGOWPFFGPHQNIGPFGP5VÒEMGPJCPFGNVGUUKEJWOGKPG2T·IWPICPN·­NKEJFGT6CWUGPFLCJTHGKGT4QOUCNUQ FGTNGV\VGPVCVU·EJNKEJIGHGKGTVGPTÌOKUEJGP5·MWNCTHGKGT&KGP·EJUVG5·MWNCTHGKGTJ·VVGPCEJGKPGTCPFGTGP<·JNWPI QFGTUVCVVHKPFGPOÒUUGPWPFY·TGFCPPKPFKG4GIKGTWPIU\GKV%QPUVCPVKPUFGU)TQ­GPIGHCNNGPHCPFLGFQEJ PKEJV UVCVV &KGU PCJO <QUKOQU \WO #PNC­ %QPUVCPVKP HÒT FGP 0KGFGTICPI FGU 4GKEJGU XGTCPVYQTVNKEJ\WOCEJGP FGPP PCEJ GKPGT CNVGP 2TQRJG\GKWPI YCT FKG 5KEJGTJGKV FGU 4GKEJGU OKV FGT QTFPWPIUIGO·­GP &WTEJHÒJTWPI FKGUGT   (GKGTPWPFFGO8QNN\WIFGTGPVURTGEJGPFGP-WNVGXGTMPÒRHV



Õ#PVQPKPKCP4QOI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG.ÌYGT%QJ4+%  5GJTUEJÌP



“5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV.QTDGGTMTCP\5#'%8.8/0188/-WNVUVC VWGFGT4QOCKPCEJVU·WNKIGO6GORGN%QJ4+% 45GJTUEJÌP





“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\5GEWTKVCUUKV\VNOKV<GRVGT%QJ 4+% (CUVXQT\ÒINKEJUGJTUEJÌP



9036



9037



HÒT1VCEKNKC5GXGTCÕ#PVQPKPKCP4QOI&TCRKGTVG$ÒUVGTOKV&KCFGOCWH/QPFUK EJGN5#'%8.#4'5#8))0KNRHGTFT%QJ4+%D 5GJTUEJÌPpXQT\ÒINKEJ





Õ#PVQPKPKCP  4QO  I &TCRKGTVG $ÒUVG T OKV &KCFGO CWH /QPFUKEJGN5#'%8.#4'5   #8))0KNRHGTFT%QJ4+%D 5GJTUEJÌP



9038

1,5:1

 292

1,5:1

 HÒT &KXWU 6TCKCPWU Õ#PVQPKPKCP  4QO  I -QRH T OKV 5VTCJNGPDKPFG#NVCT %QJ    4+%D 6TCKCPWU&GEKWU  48QT\ÒINKEJ




RÖMISCHE KAISERZEIT

9039

9040



9041

 HÒT &KXWU #PVQPKPWU + 2KWU Õ#PVQPKPKCP  4QO  I -QRH T OKV 5VTCJNGPDKPFG#NVCT   %QJ4+% 6TCKCPWU&GEKWU   -N5EJTÌVNKPIUTK­CVVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC





2JKNKRRWU ++  “5GUVGT\  4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\   5#'%8.#4'5#8))<KGIGUVGJVN%QJ4+%C $TCWPG2CVKPCUGJTUEJÌP





“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\2JKNKRRWU+WPF++UKV\GPN%QJ 4+%C 4$TCWPG2CVKPCCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



9042

9042 1,5:1



6TCKCPWU &GEKWU  “&QRRGNUGUVGT\ 4QO  I )GRCP\GTVG $ÒUVG T OKV 5VTCJNGPDKPFG   (GNKEKVCUUVGJVNOKV%CFWEGWUWPF(ÒNNJQTP%QJ4+%  4#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCTOKVFWPMGNDTCWPGT2CVKPC 

9044

9043

9043 9045



“&QRRGNUGUVGT\ 4QO  I )GRCP\GTVG $ÒUVG T OKV 5VTCJNGPDKPFG(GNKEKVCU UVGJV N OKV %CFW   EGWUWPF(ÒNNJQTP%QJ4+% 4&WPMGNITÒPG2CVKPCMQTTQFKGTVUGJTUEJÌPUEJÌP





“5GUVGT\4QOI)GRCP\GTVG$ÒUVGTOKV.QTDGGTMTCP\-CKUGTUKV\VNCWH2NCVVHQTOFCJKPVGT 6QICVWUFCXQT.KDGTCNKVCUOKV#DCEWUWPF(ÒNNJQTPWPFGKP$ÒTIGT%QJ4+%  44)TÒPG2CVKPCMPCRRGT5EJTÌVNKPIUGJTUEJÌP



“&WRQPFKWU4QOI)GRCP\GTVG$ÒUVGTOKV5VTCJNGPDKPFG.KDGTCNKVCUUVGJVNOKV#DCEWUWPF (ÒNNJQTP%QJ4+%E 4)TÒPG2CVKPCGVYCUTCWJG1DGTHN·EJGHCUVXQT\ÒINKEJ





293


RÖMISCHE KAISERZEIT

1,5:1



9046

1,5:1

“5GOKU4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\/CTUUVGJVNOKV5EJKNFWPF5RGGT %QJ4+% 44)TÒPG2CVKPCHCUVXQT\ÒINKEJUGJTUEJÌP

9047



9048



 HÒT *GTGPPKWU 'VTWUEWU “5GUVGT\ 4QO  I &TCRKGTVG $ÒUVG T2TKP\ UVGJV N OKV 5VCD WPF   5RGGT%QJ4+%C )TÒPDTCWPG2CVKPCUGJTUEJÌP





HÒT*GTGPPKC'VTWUEKNNC“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV&KCFGO(GEWPFKVCUUVGJVN OKV(ÒNNJQTPWPFJ·NVFKG*CPFÒDGTGKP-KPF%QJ4+%C )TÒPDTCWPG2CVKPCUGJTUEJÌP



9050

9049



6TGDQPKCPWU)CNNWU“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\<YGK U·WNKIGT6GORGNFCTKP5VCVWGFGT+WPQ/CTVKCNKU%QJXGTIN4+%C )TÒPG2CVKPCUGJTUEJÌP



&CU 'TUEJGKPGP XQP +WPQ /CTVKCNKU CWH FGO 4GXGTU UVGJV UKEJGT OKV GKPGO FGT *CWRVGTGKIPKUUG FGT <GKV KP 8GTDKP   FWPI2GUVWPF-TKGI1DFGT%JCTCMVGTFGT+WPQCNU.WHVTGKPKIGTKPFKGXQTFGT2GUVUEJÒV\VQFGTGJGTGKPOKNKV·TK UEJGT%JCTCMVGTKO8QTFGTITWPFUVGJVKUVWOUVTKVVGP



8QNWUKCPWU  “5GUVGT\ 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\<YGKU·WNKIGT   6GORGNFCTKP5VCVWGFGT+WPQ/CTVKCNKU%QJ4+%C 4&WPMNG2CVKPCUGJTUEJÌP

9051

9052



9051



“5GUVGT\4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\<YGKU·WNKIGT6GORGNFCTKP5VCVWGFGT +WPQ/CTVKCNKU%QJ4+%C 4$TCWPG2CVKPCMPCRRGT5EJTÌVNKPIHCUVUGJTUEJÌP





#GOKNKCPWUÕ#PVQPKPKCP4QOI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG/CTUUVGJVNOKV 5EJKNFWPF5RGGT%QJ4+% 4#VVTCMVKXG2CVKPCUGJTUEJÌPXQT\ÒINKEJ



1,5:1

 294

9053

1,5:1

Õ#PVQPKPKCP 4QO  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG-CKUGT UVGJV N OKV 2CVGTC WPF   <GRVGTFCXQT&TGKHW­WPF5VCPFCTVG%QJ4+% 445GJTUEJÌPXQT\ÒINKEJ 


RÖMISCHE KAISERZEIT

9055

9054 9055



Õ#PVQPKPKCP 4QO  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG8KTVWU UVGJV N OKV <YGKI WPF   5RGGT%QJ4+% 45GJTUEJÌP





“U 5KFG 2CORJ[NKC   I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\#VJGPC UVGJV T OKV $NKV\ WPF   #GIKU$/%+OJQQH$NWOGT-NGKPCUKCVKUEJG/ÒP\GP/KQPPGV50)(TCPEG50)X#WNQEM 8QPITQ­GT5GNVGPJGKV)TÒPG2CVKPCUGJTUEJÌP



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T

9057

9058

9056



8CNGTKCPWU  “5GUVGT\  4QO  I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\   8KEVQTKCUVGJVNOKV-TCP\WPF2CNO\YGKI/+44+%  )TÒPG2CVKPCIWVGUUGJTUEJÌPHCUVUGJTUEJÌP





HÒT&KXC/CTKPKCPCÕ#PVQPKPKCP8KOKPCEKWOI&TCRKGTVG$ÒUVGTOKV5EJNGKGTCWH/QPF UKEJGN2HCWHNKGIVTOKV&KXC/+4D4+% 5GJTUEJÌP





)CNNKGPWU“5GUVGT\4QO'OKUUKQPI)GRCP\GTVG$ÒUVGTOKV.QTDGGT MTCP\%QPEQTFKCUVGJVNOKV2CVGTCWPF&QRRGNHÒNNJQTP%QJ/+44+%  )TÒPG2CVKPCUGJTUEJÌP



9060 9059

9061



$#PVQPKPKCP/GFKQNCPWOI)GRCP\GTVG$ÒUVGTOKV5VTCJNGPDKPFG.')+/+08+2 8+(/KPGTXCUVGJVNOKV8KEVQTKC5RGGTWPF5EJKNF%QJ/+4P4+% 445GJTUEJÌP





$#PVQPKPKCP  /GFKQNCPWO  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG.') 8++=+ #8)   8+2?8+(5VKGTUVGJVT/+4T4+% 4(CUVUGJTUEJÌPUGJTUEJÌP



&KG .GIKQ ++ +VCNKEC YCTKP.CWTKCEWO .QTEJ UVCVKQPKGTV8GZKNNCVKQPGPFKGUGT.GIKQPIGJÌTVGP\WO%QOKVCVWUFGU )CNNKGPWUWPFJCDGPCPFGTITQ­GP#NGOCPPGPUEJNCEJVDGK/CKNCPFVGKNIGPQOOGPYQTCWHUKEJFKG6TGWGRTGKUWPIGP CWHFGO4GXGTUFGU5VÒEMGUDG\KGJGP



$#PVQPKPKCP/GFKQNCPWOI)GRCP\GTVG$ÒUVGTOKV5VTCJNGPDKPFG.'):::8.2 8+28+(0GRVWPUVGJVTOKV&TGK\CEMWPF&GNRJKP%QJ/+4T4+% 445GJTUEJÌP



&KG .GIKQ ::: 7NRKC 8KEVTKZ YWTFG  XQP 6TCKCP CWUIGJQDGP WPF M·ORHVG KP FGP &CMGTMTKGIGP &KG .GIKQP   WPVGTUVÒV\VGFKG4GDGNNKQPFGU2QUVWOWU

295


RÖMISCHE KAISERZEIT

9063

9062





9064

2QUVWOWU  “&QRRGNUGUVGT\  %QNQPKC  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG   -CKUGTUVGJVNOKV)NQDWUWPF<GRVGTXQP8KEVQTKCDGMT·P\V$CUVKGP%QJ'NOGT4+% 4)TÒPDTCWPG2CVKPCUGJTUEJÌPGU'ZGORNCT



“&QRRGNUGUVGT\%QNQPKCI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG)CNGGTG PCXKUNWUQTKC N $CUVKGP%QJ'NOGT4+% )TÒPG2CVKPCUGJTUEJÌP



&KG 0CXGU NWUQTKCG YWTFGP /KVVG FGU  ,CJTJWPFGTVU GKPIGHÒJTV &KG UGJT UEJNCPMGP WPF HNCEJIGJGPFGP 5EJKHHG   YWTFGP DKU KP FKG 5R·VCPVKMG KP TÌOKUEJGP (NW­HNQVVGP GKPIGUGV\V WPFURKGNVGPOKNKV·TKUEJGKPGDGFGWVGPFG4QNNG5Q IGNCPIVG,WNKCPWU++#RQUVCVCKO$ÒTIGTMTKGIIGIGP%QPUVCPVKWU++OKV/CPPKPPWTGNH6CIGPXQP7NOPCEJ 5KTOKWO  FKGU DGFGWVGV FC­ DGK  4WFGTGTP WPF  /CPP <WNCFWPI FGT -CKUGT FKG (CJTV OKV  0CXGU NWUQTKCG   WPVGTPCJO 'KPGT FGT ITÌ­VGP 8QTVGKNG FKGUGU 5EJKHHV[RU YCT LC FC­ GT PWT GKPG OKPKOCNG <GKV FGT 'KPYGKUWPI   DGPÌVKIVG WPF FCJGT OKV TGIWN·TGP .CPFVTWRRGP DGOCPPV YWTFG #PJCPF FGT KP /CKP\ IGHWPFGPGP 0CXGU NWUQTKCG   YWTFG  CP FGT 7PKXGTUKV·V 4GIGPUDWTI GKPG .WUQTKC PCEJIGDCWV UKGJG (GTMGN-QPGP5EJ·HGT 0CXKU .WUQTKC   'KP4ÌOGTUEJKHHKP4GIGPUDWTI5V-CVJCTKPGP2QUVWOWURTQRCIKGTVGFKGUGP5EJKHHUV[RCWHUGKPGP/ÒP\GPKP WPIGYÌJPNKEJGT9GKUG



“5GUVGT\  %QNQPKC  'OKUUKQP  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\8KEVQTKC IGJV N   OKV-TCP\WPF2CNO\YGKIFCXQT)GHCPIGPGT$CUVKGP'NOGT4+%  )TÒPG2CVKPCUGJTUEJÌP



9065

2:1



2:1

$#DUEJNCIXQPFGP5VGORGNPFGU#WTGWU%QNQPKCI)GRCP\GTVG$ÒUVGTOKV*GNO8KE VQTKCKP$KICT%CNKEQ\W%QJ'NOGT4+%\W5EJWNVGD FKGU'ZGORNCT   8QPCNNGTITÌ­VGT5GNVGPJGKV9QJN7PKMWO8QT\ÒINKEJ  'ZGORNCTFGT5COONWPI*QHHOCPP#WMVKQP4QNNKPGV(GWCTFGPV2CTKU/CK0T /ÌINKEJGTYGKUGHGKGTVFCU5VÒEMFKG+PDGUKV\PCJOG$TKVCPPKGPUFWTEJ2QUVWOWU



9066

 296

“&QRRGNUGUVGT\%QNQPKCI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG(KFGUUVGJVNOKV\YGK 5VCPFCTVGP$CUVKGP%QJ'NOGT4+% )TÒPG2CVKPCUGJTUEJÌP




RÖMISCHE KAISERZEIT

1,5:1



9067 1,5:1

$#PVQPKPKCP  %QNQPKC  I -QRH N OKV 5VTCJNGPDKPFG -GWNGWPF.ÌYGPHGNN,WRKVGTUVGJVN -QRHTOKV<GRVGTWPF$NKV\'NOGT4+%<UEJWEMG  44'VYCU5KNDGTUWFIWVGUUGJTUEJÌP 

9068





$#PVQPKPKCP  %QNQPKC  'OKUUKQP  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\5QN IGJV N   OKVGTJQDGPGT4GEJVGPWPF2GKVUEJG'NOGT 'OKUUKQP 4+%<UEJWEMG  8QT\ÒINKEJGU'ZGORNCT



“#PVQPKPKCP  %QNQPKC  'OKUUKQP  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG&TCRKGTVG   $ÒUVGFGU5QNT'NOGT4+%<UEJWEMG /KPMQTTQFKGTVHCUVXQT\ÒINKEJ



9071

9070





9069

9072

“&QRRGNUGUVGT\  #VGNKGT  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG6TKWORJDQIGP FCTCWH   6TQRJ·G\YKUEJGP\YGK)GHCPIGPGP$CUVKGP%QJ'NOGT4+%  44)TÒPG2CVKPCUGJTUEJÌP



“&WRQPFKWU  #VGNKGT  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG<YGKU·WNKIGT 6GORGN FCTKP   *GTEWNGUXQP-ÌNP&GWV\NOKV-GWNGWPF.ÌYGPHGNN$CUVKGP%QJ'NOGT4+%  $TCWPG2CVKPCUGJTUEJÌPGU'ZGORNCT



&CU5VÒEMKUVOKV&WRQPFKWU5VGORGNPCWHGKPGO·NVGTGP5GUVGT\IGRT·IVYQTFGP



“&WRQPFKWU  #VGNKGT  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG*GTEWNGU UVGJV N OKV <YGKI   -GWNGWPF.ÌYGPHGNN$CUVKGP%QJ4+% )TÒPG2CVKPCUGJTUEJÌP

9073



9074



“&WRQPFKWU#VGNKGTI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG-CKUGTUVGJVNOKV)NQDWUWPF 5RGGT$CUVKGP%QJ4+% )TÒPG2CVKPCUEJÌPpUGJTUEJÌP





“&WRQPFKWU  #VGNKGT  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG<YGK 8KEVQTKGP DGHGUVKIGP   GKPGP5EJKNFCPGKPGT2CNOGWPVGP\YGK)GHCPIGPG$CUVKGP%QJ4+%  $TCWPG2CVKPCHCUVUGJTUEJÌPUGJTUEJÌP

 297


RÖMISCHE KAISERZEIT

9075

9076

1,5:1

1,5:1



“&WRQPFKWU  #VGNKGT  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG-CKUGT UVGJV N OKV .CP\GWPF GTJGDV)CNNKC$CUVKGP%QJ4+% $TCWPITÒPG2CVKPCHCUVUGJTUEJÌP





.CGNKCPWU“#PVQPKPKCP/QIQPVKCEWOI)GRCP\GTVG$ÒUVGTOKV5VTCJNGPDKPFG8KEVQTKC IGJVTOKV-TCP\WPF2CNO\YGKI'NOGT4+% 4(NCWGT4GXGTUUVGORGNHCUVXQT\ÒINKEJ



)GQTI 'NOGT IGJV FCXQP CWU FC­ .CGNKCPWU FKG XQP 2QUVWOWU HTKUEJ GKPIGTKEJVGVG /ÒP\UV·VVG KP 6TKGT KP UGKPG   )GYCNV IGDTCEJV JCV WPF FQTV UGKPG /ÒP\GP RT·IGP NKG­ #WEJ %( <UEJWEMG PKOOV FKG /ÒP\UV·VVG KP 6TKGT CP  

&KGTÌOKUEJG/ÒP\UV·VVG-ÌNP6TKGT5 &KGUYWTFGWCXQP+-ÌPKICPIG\YGKHGNVFGTFKG/ÒP\UV·VVG KP /CKP\ XGTOWVGV &KG ICNNKUEJGP 7UWTRCVQTGP XQP 2QUVWOWU DKU 6GVTKEWU /ÒPEJGP  5  UQ CWEJ   )KNNLCO#PVQPKPKCPKWPF#WTGKFGU7NRKWU%QTPGNKWU.CGNKCPWU-ÌNP5 0CEJGKPGTCPFGTGP#WHHCUUWPI JCV .CGNKCPWU MWT\HTKUVKI -ÌNP GKPIGPQOOGP WPF FKG /ÒP\UV·VVG PCEJ /CKP\ XGTNCIGTV $GUN[$NCPF 6JG %WPGVKQ   6TGCUWTG4QOCP%QKPCIGQHVJG6JKTF%GPVWT[#&.QPFQP5WPF &GOYKFGTURTKEJV$5EJWNVG FGTCPPKOOVFC­.CGNKCPWUUKEJKPFGP$GUKV\GKPGT/ÒP\UV·VVGFGU2QUVWOWUUGV\VGWPFFQTVUGKPG/ÒP\GPRT·IGP NKG­ FQTV MQPPVG GT UKEJ CDGT PWT MWT\ JCNVGP YCU FKG 5GNVGPJGKV UGKPGT 2T·IWPIGP GTMN·TV 5EJWNVG &KG )QNFRT·   IWPIFGTICNNKUEJGP-CKUGTXQP2QUVWOWUDKU6GVTKEWU#CTCW5 9GKUGT/CKP\TÌOKUEJG/ÒP\UV·VVG! KP&KG/ÒP\UV·VVGP/CKP\WPF9KGUDCFGP5RG[GTNGIVUKEJCWH/CKP\HGUV

1,5:1



9077 1,5:1

2TQDWUÔ#WTGWU5KUEKCI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\5GEWTKVCUUKV\VN OKV<GRVGT%CNKEQ%QJ2KPM#WHDCW54+% 448QT\ÒINKEJGU2TCEJVGZGORNCT 

9080

9078

9079

9079 1,5:1 9078 1,5:1



$#PVQPKPKCP5KUEKCI&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG5+5%+#241$+#8)5KUEKCUKV\VN OKV&KCFGO\YKUEJGPFGP(NW­IÌVVGTP5CXWUWPF%QNCRKU%QJ4+%  44'VYCU5KNDGTUWFUGJTUEJÌPXQT\ÒINKEJ $GK5KUEKCXGTGKPKIVUKEJFGT%QNCRKUOKVFGT5CXG





%CTKPWUWPF0WOGTKCPWU“&GPCT.WIFWPWO ! I-QRHFGU%CTKPWUOKV.QTDGGT MTCP\ WPF FTCRKGTVG $ÒUVG FGU 0WOGTKCPWU OKV .QTDGGTMTCP\ PGDGPGKPCPFGT T8KEVQTKC IGJV N OKV   -TCP\WPF2CNO\YGKI2KPM#WHDCW4+% 8QPITQ­GT5GNVGPJGKV(CUVUGJTUEJÌP 



HÒT/CIPKC7TDKEC“#PVQPKPKCP6KEKPWOI&TCRKGTVG$ÒUVGTOKV&KCFGOCWH/QPFUKEJGN 8GPWUUVGJVNOKV*GNO<GRVGTWPF5EJKNF4+% 4)WVGUUGJTUEJÌP

298




RÖMISCHE KAISERZEIT

9082

9081



%CTCWUKWU“#PVQPKPKCP.QPFKPKWO ! I&TCRKGTVG$ÒUVGTOKV5VTCJNGPDKPFG2CZ UVGJVNOKV<YGKIWPF<GRVGT4+% &TWEMUVGNNGIWVGUUGJTUEJÌP





#NNGEVWU  “#PVQPKPKCP .QPFKPKWO  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG)CNGGTG  

0CXKUNWUQTKC N$WTPGVV4+% 5GJTUEJÌP



9GIGP FGU 3 KO 4U#DUEJPKVV YKTF KP FGT (QTUEJWPI IGNGIGPVNKEJ FKG #PUKEJV XGTVTGVGP FKGUG #PVQPKPKCPG TGFW   \KGTVGP(QTOCVGUUGKGP3WKPCTGIGYGUGP5GNDUVXGTUV·PFNKEJJCPFGNVGUUKEJPCEJYKGXQTWO&QRRGNFGPCTG&CU3 KUVCPFGTU\WFGWVGPXKGNNGKEJVCNU*KPYGKUCWHFKGHÒTIGRNCPVGP3WKPSWGPPCNKGP  #WHFGO4GXGTUFGU5VÒEMGUKUVGKPG0CXKUNWUQTKCFCTIGUVGNNVGKP/KVVGFGU,CJTJWPFGTVUGKPIGHÒJTVGT5EJKHHUV[R &KGUGJTUEJNCPMGPWPFHNCEJIGJGPFGP5EJKHHGYWTFGPDKUKPFKG5R·VCPVKMGKPTÌOKUEJGP(NW­HNQVVGPGKPIGUGV\VWPF URKGNVGP OKNKV·TKUEJ GKPG DGFGWVGPFG 4QNNG 5Q IGNCPIVG ,WNKCPWU ++ #RQUVCVC KO $ÒTIGTMTKGI IGIGP %QPUVCPVKWU ++   OKV/CPPKPPWTGNH6CIGPXQP7NOPCEJ5KTOKWOFKGUDGFGWVGVFC­DGK4WFGTGTPWPF/CPP<WNC FWPIFGT-CKUGTFKG(CJTVOKV0CXGUNWUQTKCGWPVGTPCJO'KPGTFGTITÌ­VGP8QTVGKNGFKGUGU5EJKHHV[RUYCTLCFC­ GTPWTGKPGOKPKOCNG<GKVFGT'KPYGKUWPIDGPÌVKIVGWPFFCJGTOKVTGIWN·TGP.CPFVTWRRGPDGOCPPVYWTFG#PJCPF FGTKP/CKP\IGHWPFGPGP0CXGUNWUQTKCGYWTFGCPFGT7PKXGTUKV·V4GIGPUDWTIGKPG.WUQTKCPCEJIGDCWVUKGJG (GTMGN-QPGP5EJ·HGT 0CXKU .WUQTKC 'KP 4ÌOGTUEJKHH KP 4GIGPUDWTI 5V -CVJCTKPGP  #NNGEVWU RTQRCIKGTVG   FKGUGP5EJKHHUV[RCWHUGKPGP/ÒP\GPWPIGYÌJPNKEJUVCTMYKGXQTKJOUEJQP2QUVWOWU

1,5:1



9084

1,5:1

Õ#TIGPVGWU4QOI-QRHTOKV.QTDGGTMTCP\8KGT-CKUGTQRHGTPXQT/CWGTTKPI4+%C (CUVXQT\ÒINKEJ

1,5:1



1,5:1

&KQENGVKCPWU“&GPCT ! 4QOI&TCRKGTVG$ÒUVGTOKV.QTDGGTMTCP\,WRKVGT UVGJVXX-QRHTOKV<GRVGTWPF$NKV\N#FNGTOKV-TCP\KO5EJPCDGN4+%XCT  44&WPMNG2CVKPCIWVGUUGJTUEJÌP 

1,5:1



9083

9085



1,5:1

Õ#TIGPVGWU4QOI-QRHTOKV.QTDGGTMTCP\8KGT-CKUGTQRHGTPXQT/CWGTTKPI4+%C *GTTNKEJG2CVKPCMN5EJTÌVNKPIUTK­XQT\ÒINKEJ



9086 1,5:1



1,5:1

Ô#WTGWU 4QO  I &TCRKGTVG $ÒUVG T OKV .QTDGGTMTCP\,WRKVGT UVGJV N OKV $NKV\ WPF <GRVGT   %CNKEQC4+% 448QT\ÒINKEJGU2TCEJVGZGORNCT  299


RÖMISCHE KAISERZEIT

9087

9088 9088 1,5:1



/CZKOKCPWU +  Õ#TIGPVGWU  5KUEKC  I -QRH T OKV .QTDGGTMTCP\8KGT -CKUGT   QRHGTPXQT/CWGTTKPI4+%D -N5EJTÌVNKPIUTK­XQT\ÒINKEJGU'ZGORNCTOKVHGKPGT6ÌPWPI





Õ#TIGPVGWU  6KEKPWO  I -QRH T OKV .QTDGGTMTCP\8KGT -CKUGT QRHGTP XQT /CWGTTKPI   4+%D *GTTNKEJG2CVKPCXQT\ÒINKEJ



9089

9089 1,5:1



“/GFCKNNQP  !  4QO  I )GRCP\GTVG $ÒUVG N OKV .QTDGGTMTCP\ WPF 5EJKNF J·NV OKV   FGT 4GEJVGP 2HGTF CO <ÒIGN&KG FTGK /QPGVCG UVGJGP X X OKV 9CCIGP WPF (ÒNNJÌTPGTP \W KJTGP   (Ò­GP*CWHGPOKV/ÒP\GP)PGEEJK  8QPITQ­GT5GNVGPJGKV-N-TCV\GTCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT 

9091

9090

1,5:1

1,5:1





“#PVQPKPKCP .WIFWPWO  I )GRCP\GTVG $ÒUVG T OKV *GNO WPF 5VTCJNGPDKPFG*GTEWNGU T   GTYÒTIVFGPPGOGKUEJGP.ÌYGPJKPVGTKJO-GWNGWPFGKPGKJPDGMT·P\GPFG8KEVQTKC4+%  45GJTUEJÌP



%QPUVCPVKWU +  Ô#WTGWU  5KUEKC -QRH T OKV .QTDGGTMTCP\2TKP\ UVGJV T OKV   5RGGTWPF)NQDWU%CNKEQ4+%C 44#VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

9093

9092

9093



Õ#TIGPVGWU  4QO  I -QRH T OKV .QTDGGTMTCP\8KGT -CKUGT QRHGTP XQT /CWGTTKPI   4+%C -N5EJTÌVNKPIUTK­IWVGUUGJTUEJÌPXQT\ÒINKEJ





“(QNNKU6TGXGTKI)GRCP\GTVG$ÒUVGNOKV.QTDGGTMTCP\<GRVGTWPF5EJKNF)GPKWU UVGJVNOKV2CVGTCWPF(ÒNNJQTP4+%XGTIN# 44&WPMNG2CVKPCUGJTUEJÌP



300


RÖMISCHE KAISERZEIT

9095

9094

9094 9096



5GXGTWU ++  “(QNNKU  6TGXGTK  I )GRCP\GTVG $ÒUVG T OKV .QTDGGTMTCP\   )GPKWUUVGJVNOKV2CVGTCWPF(ÒNNJQTP4+% 4&WPMNG2CVKPCUGJTUEJÌP





#NGZCPFGT XQP -CTVJCIQ “(QNNKU-CTVJCIQI-QRHTOKV.QTDGGTMTCP\-CTVJCIQ UVGJVXXOKV(TÒEJVGP4+% 44$TCWPG2CVKPCIGNQEJVIGTKPIGTJCNVGPUEJÌP



+O ,CJT  XGTNCPIVG /CZGPVKWU FGT UKEJ FGT .Q[CNKV·V FGT 6TWRRGP KP #HTKEC PKEJV UKEJGT YCT XQP . &QOKVKWU   #NGZCPFGT FGO XKECTKWU #HTKECG KJO UGKPGP 5QJP CNU )GKUGN \W UGPFGP #NGZCPFGT YGKIGTVG UKEJ WPF YWTFG XQP   UGKPGP6TWRRGP\WO#WIWUVWURTQMNCOKGTV



.KEKPKWU +  WPF .KEKPKWU ++ “(QNNKU  0KEQOGFKC  1HHK\KP  I $GKFGT $ÒUVGP   GKPCPFGT IGIGPÒDGT OKV 5VCVWGVVG FGT (QTVWPC(QTVWPC OKV 5VGWGTTWFGT WPF )NQDWU WPF ,WRKVGT OKV   8KEVQTKCWPF<GRVGTUVGJGPGKPCPFGTIGIGPÒDGT4+%  445EJTÌVNKPIUHGJNGTCWHFGO#XGTUUGJTUEJÌP

1,5:1



9097



1,5:1

/CTVKPKCPWU  “(QNNKU 0KEQOGFKC  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV 5VTCJNGPDKPFG   ,WRKVGTUVGJVNOKV8KEVQTKCCWH)NQDWUWPF<GRVGTFCXQT#FNGTFCJKPVGT)GHCPIGPGT4+%  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP  /CTVKPKCPWU YCT \WP·EJUV OCIKUVGT QHHKEKQTWO FGU .KEKPKWU FGT KJP PCEJ FGT 5EJNCEJV XQP #FTKCPQRGN KO ,WNK    \WO #WIWUVWU GTJQD 0CEJ FGT 0KGFGTNCIG FGU .KEKPKWU KP FGT 5EJNCEJV XQP %JT[UQRQNKU CO  5GRVGODGT    IGTKGVGP.KEKPKWUWPF/CTVKPKCPWUKPFKG)GHCPIGPUEJCHVFGU%QPUVCPVKPWU+FGTUKGYQJNJKPTKEJVGPNKG­

9098

9099

9099 1,5:1



%QPUVCPVKPWU+“(QNNKU6JGUUCNQPKEC1HHK\KPI-QRHTOKV.QTDGGTMTCP\ ,WRKVGTUVGJVNOKV$NKV\WPF<GRVGT4+%D 5KNDGTUWFXQT\ÒINKEJ



'ZGORNCTFGT#WMVKQP.CP\/ÒPEJGP0T



“(QNNKU6JGUUCNQPKEC1HHK\KPI)GRCP\GTVG$ÒUVGTOKV.QTDGGTMTCP\5QNUVGJVNOKV )NQDWUCWHFGO2NCPGKPGUTÌOKUEJGP.CIGTU ! 4+% 445GJTUEJÌP



9100



HÒT&KXWU%QPUVCPVKWU+“(QNNKU6TGXGTK'OKUUKQPI$ÒUVGTOKV5EJNGKGTWPF .QTDGGTMTCP\#NVCTHNCPMKGTVXQP\YGK#FNGTP4+%  $TCWPG2CVKPCYKP\5EJTÌVNKPIUTK­CVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 301


RÖMISCHE KAISERZEIT

1,5:1



9101

1,5:1

 HÒT %QPUVCPVKPWU ++ Ô5QNKFWU  0KEQOGFKC  I -QRH T OKV &KCFGO8KEVQTKC GKNV N   OKV-TCP\WPF2CNO\YGKI4+% 445GJTUEJÌPXQT\ÒINKEJ 

9102 2:1



2:1

HÒT%QPUVCPVKWU++Ô5ETKRWNC ! WPDGUVKOOVG/ÒP\UV·VVGI&TCRKGTVG$ÒUVGN OKV&KCFGO2TKP\UVGJVTOKV)NQDWUWPF5RGGT#WMVKQP6TKVQP+:0GY;QTM0T FKGU 'ZGORNCT 4+% 8QPITQ­GT5GNVGPJGKV8QT\ÒINKEJGU'ZGORNCT



9103



%QPUVCPVKPWU ++  “(QNNKU  #PVKQEJKC  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV   .QTDGGTMTCP\<YGK 5QNFCVGP UVGJGP GKPCPFGT IGIGPÒDGT OKV 5RGGTGP WPF 5EJKNFGP FC\YKUEJGP GKPG   5VCPFCTVG4+% 8QT\ÒINKEJ

1,5:1



1,5:1

%QPUVCPU  Ô5QNKFWU  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO<YGK   8KEVQTKGPJCNVGP5EJKNFOKVFGT#WHUEJTKHV816:/8.6::4+%  5GJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT 

1,5:1



9104



9105

1,5:1

%QPUVCPVKWU ++  Ô5QNKFWU  #PVKQEJKC  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV   2GTNFKCFGO8KEVQTKC UKV\V T WPF UEJTGKDV 816::: CWH GKPGP XQP GKPGO )GPKWU IGJCNVGPGP 5EJKNF   4+% 8QT\ÒINKEJGU'ZGORNCT 

9106

 302

Õ5KNKSWC  #PVKQEJKC  I -QRH T OKV 2GTNFKCFGO816+5::8/8.6+5::: KP   -TCP\4+% 5GJTUEJÌP




RÖMISCHE KAISERZEIT

9107



9108

9109

9111

9110

“/CKQTKPC5KUEKCI&TCRKGTVG$ÒUVGTOKV4QUGVVGPFKCFGO-CKUGTUVGJVKPGKPGTXQP 8KEVQTKCIGUVGWGTVGP)CNGGTGNOKV2JÌPKZWPF%JTKUVQITCOOUVCPFCTVG4+%  &WPMNG2CVKPCIWVGUUGJTUEJÌPXQT\ÒINKEJ





Õ5KNKSWC  5KUEKC  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO816+5:::/8.6+5   ::::KP-TCP\4+% 48QT\ÒINKEJ





Õ5KNKSWC  5KTOKWO  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO816+5:::/8.6+5   ::::KP-TCP\4+% 5GJTUEJÌP





Õ5KNKSWC  #TGNCVG  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO816+5:::   /8.6+5::::KP-TCP\4+% #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC





Õ5KNKSWC  5KTOKWO  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO816+5:::/8.6+5   ::::KP-TCP\4+% #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



9112

9113

9114



Õ5KNKSWC  0KEQOGFKC  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO816+5:::/8.6+5   ::::KP-TCP\4+% 8QT\ÒINKEJ





Õ5KNKSWC  #TGNCVG  1HHK\KP  I -QRH T OKV 2GTNFKCFGO816+5:::/8.6+5   ::::KP-TCP\4+% 5GJTUEJÌP





%QPUVCPVKWU ++  HÒT %QPUVCPVKWU )CNNWU “/CKQTKPC  5KUEKC  1HHK\KP  I   &TCRKGTVG$ÒUVGT-CKUGTUVGJVNOKV\YGK.CDCTC4+%  )TÒPG2CVKPCXQT\ÒINKEJIWVGUUGJTUEJÌP



9117 9115

9118

9116



8GVTCPKQ“/CKQTKPC6JGUUCNQPKEC1HHK\KPI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO -CKUGTUVGJVNOKV\YGK%JTKUVQITCOOUVCPFCTVGP4+% 4&WPMNG2CVKPCUGJTUEJÌPpXQT\ÒINKEJ





/CIPGPVKWU  “&QRRGNOCKQTKPC PCEJ  6TGXGTK  I &TCRKGTVG $ÒUVG T%JTKUVQ   ITCOO\YKUEJGP#NRJCWPF1OGIC4+% &WPMNG2CVKPCNGKEJVMQTTQFKGTVHCUVXQT\ÒINKEJ





,WNKCPWU++#RQUVCVCÕ5KNKSWC#TGNCVGI&TCRKGTVG$ÒUVGTOKV2GTNFKC FGO816:/8.6::KP-TCP\4+%  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPCUGJTUEJÌP



Õ5KNKSWC  #TGNCVG  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO816:/8.6:: KP   -TCP\4+% (CUVUGJTUEJÌP





303


RÖMISCHE KAISERZEIT

9119



9120

9119

“&QRRGNOCKQTKPC  .WIFWPWO  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO5VKGT   UVGJVT4+% $TCWPG2CVKPCUGJTUEJÌP



&CU /ÒP\DKNF TKGH WPVGT FGT EJTKUVNKEJGP $GXÌNMGTWPI XQP #PVKQEJKCITQ­GP#WHTWJTJGTXQT&KG#PVKQEJGPGTFGW VGVGPFGP5VKGTCNU1RHGTUVKGTUKGJG5\KFCV<WT9KTMWPIWPF#WHPCJOGFGT/ÒP\RTQRCICPFC +WN/KUQRF  KP/WUGWO*GNXGVKEWO  5&CKP#PVKQEJKCGKPG*WPIGTUPQVJGTTUEJVGWPFFGP%JTKUVGPFGT)GPW­ FGU1RHGTHNGKUEJGUFGTKPITQ­GT<CJNIGQRHGTVGP5VKGTGXGTDQVGPYCTKUVKJTGXQO-CKUGTKPUGKPGT5CVKTG/KUQRQ IQP $CTVJCUUGT IGUEJKNFGTVGURÌVVKUEJG4GCMVKQPCWHFKG/ÒP\GPKEJVXÌNNKIWPXGTUV·PFNKEJ&CFGT5VKGTCWEJXQP 5QETCVGU 5EJQNCUVKEWU CNU 1RHGTUVKGT DG\GKEJPGV YKTF JKUV GEEN    WPF FKG ÒDTKIGP &GWVWPIGP FGU 5VKGTGU  

#RKUUVKGT /KVJTCUUVKGT IQNFGPGU -CND RJKNQUQRJKUEJGU 5[ODQN HÒT GKPGP IWVGP -CKUGT WPF <QFKCMCNUVKGT  CWU   XKGNGTNGK)TÒPFGPCWUUEJGKFGPJCPFGNVGUUKEJDGKFGOCWHFGO4GXGTUCDIGDKNFGVGP5VKGTYCJTUEJGKPNKEJVCVU·EJNKEJ WO GKPGP 1RHGTUVKGT UKGJG 6JQTOCPP <WT &GWVWPI FGU 5VKGTGU CWH FGP (QNNGU -CKUGT ,WNKCPU KP$TGOGT$GKVT·IG \WT /ÒP\ WPF )GNFIGUEJKEJVG    &KG LÒPIUVG &GWVWPI FGU 5VKGTGU CNU -QP\GRVKQPU\GKEJGP -C[ 'JNKPI KP   ,0)5 UVGJVKO9KFGTURTWEJ\WTXQP,WNKCPXGTVTGVGPGP2JKNQUQRJKGFGU+CODNKEJQUWPFFGTEJCN F·KUEJGP1TCMGNUKGJG6JQTOCPP-QP\GRVKQPU\GKEJGPCWHCPVKMGP/ÒP\GP! KP8QTDGTGKVWPI 



Ô5QNKFWU  #PVKQEJKC  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO5QNFCV OKV   6TQRJ·GTNGIV*CPFCWH)GHCPIGPGP4+% 445GJTUEJÌP 



,QXKCPWU  Ô5QNKFWU #PVKQEJKC  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO   4QOCWPF%QPUVCPVKPQRQNKUUKV\GPHCUVXXWPFJCNVGP5EJKNFOKVFGT#WHUEJTKHV8168/8.:4+% 45GJTUEJÌP 



“%GPVGPKQPCNKU5KUEKCI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO8168/8.6:KP-TCP\4+% )TÒPG2CVKPCMN&TWEMUVGNNGCWHFGO#XGTUUQPUVXQT\ÒINKEJ

9122

9121

1,5:1



9123



1,5:1

8CNGPVKPKCPWU+Ô5QNKFWU#PVKQEJKC1HHK\KPI&TCRKGTVG$ÒUVGTOKV 4QUGVVGPFKCFGO-CKUGTUVGJVTOKV5VCPFCTVGWPF8KEVQTKCCWH)NQDWU4+%D (CUVXQT\ÒINKEJ



9124 9125

9126



Ô5QNKFWU  #PVKQEJKC  1HHK\KP  I &TCRKGTVG $ÒUVG T OKV 4QUGVVGPFKCFGO-CKUGT   UVGJVTOKV5VCPFCTVGWPF8KEVQTKCCWH)NQDWU4+%D 5GJTUEJÌP





Õ5KNKSWC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO4QOC UKV\V N OKV 8KEVQTKC   CWH)NQDWUWPF5RGGT4+%F 5GJTUEJÌP





Õ5KNKSWC  5KUEKC  I&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO816:/8.6::KP-TCP\ 4+%C 45GJTUEJÌP



304


RÖMISCHE KAISERZEIT

9127

1,5:1



1,5:1

8CNGPUÔ5QNKFWU0KEQOGFKC1HHK\KPI&TCRKGTVG$ÒUVGTOKV2GTNFKC FGO-CKUGTUVGJVTOKV.CDCTWOWPF8KEVQTKCCWH)NQDWU4+%F  9KP\5EJTÌVNKPIUTK­MN5VGORGNDTÒEJGCWHFGO4GXGTUFGPPQEJXQT\ÒINKEJGU2TCEJVGZGORNCT

9128

1,5:1





1,5:1

Ô  5ETKRWNC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 4QUGVVGPFKCFGO8KEVQTKC IGJV N   OKV-TCP\WPF2CNO\YGKI4+%E 445GJTUEJÌP 

9131

9130

9129

9132



Õ5KNKSWC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO4QOC UKV\V N OKV 8KEVQTKC   CWH)NQDWUWPF5RGGT4+%G (GKPG2CVKPCUGJTUEJÌP





Õ5KNKSWC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO4QOC UKV\V N OKV 8KEVQTKC   CWH)NQDWUWPF5RGGT4+%G 5EJTÌVNKPIUTK­HCUVXQT\ÒINKEJ





Õ5KNKSWC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO4QOC UKV\V N OKV 8KEVQTKC   CWH)NQDWUWPF5RGGT4+%G (GKPG2CVKPCUGJTUEJÌP





Õ5KNKSWC#PVKQEJKCI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO+P-TCP\816:/8.6 ::4+%D -N5EJTÌVNKPIUTK­UGJTUEJÌP



9133 1,5:1



1,5:1

Ô/GFCKNNQP\W5QNKFK (GUVCWTGWU #PVKQEJKC1HHK\KPI&08#.'052'4(#8) &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO8+%614+# 41/#0148/ 8KEVQTKC IGJV N OKV -TCP\ WPF   2CNO\YGKIKO#DUEJPKVV#01$#&GRG[TQV)PGEEJK4+%  8QPITQ­GT5GNVGPJGKV-NGKPG5EJÒTHURWTGPCWHFGO#XGTUIWVGUUGJTUEJÌP  &CU5VÒEMYKTFOKVGKPGO'EJVJGKVU\GTVKHKMCVXQP&CXKF5GCTIGNKGHGTV  &CU )GYKEJV FGU 5VÒEMGU GPVURTKEJV GVYC  FGU TÌOKUEJGP 2HWPFGU WPF UQOKV FGO TGHQTOKGTVGP #WTGWU FGU   &KQENGVKCPWU &CJGT YGTFGP FKGUG 5VÒEMG CWEJ CNU (GUVCWTGK DG\GKEJPGV 9CJTUEJGKPNKEJ YWTFGP FKGUG /ÒP\GP HÒT   &QPCVKXCXGTYGPFGV

305


RÖMISCHE KAISERZEIT

9134

9135



)TCVKCPWU  Õ5KNKSWC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO4QOC   UKV\VNCWH2CP\GTOKV8KEVQTKCCWH)NQDWUWPF5RGGT4+%D  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT6ÌPWPI





8CNGPVKPKCPWU++Õ5KNKSWC#SWKNGKCI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO 4QOCUKV\VNCWH2CP\GTOKV8KEVQTKCCWH)NQDWUWPF5RGGT4+%F  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCTOKVHGKPGT2CVKPC



9136

1,5:1



1,5:1

6JGQFQUKWU+HÒT#GNKC(NCEEKNNCÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI &TCRKGTVG $ÒUVG T8KEVQTKC UKV\V T WPF UEJTGKDV %JTKUVQITCOO CWH GKPGP CWH GKPGT 5·WNG UVGJGPFGP   5EJKNF4+% 44-TCV\GTCWHFGO4GXGTUOKPIGYGNNVHCUVXQT\ÒINKEJ  #GNKC(NCEEKNNCUVCOOVGCWU5RCPKGPWPFYCTFKGGTUVG'JGHTCWFGU6JGQFQUKWU+5KGIGDCTFGO-CKUGTWOFGP UR·VGTGP-CKUGT#TECFKWUCO5GRVGODGT*QPQTKWUWPFWO#GNKC2WNEJGTKCXGTUVCTDFKG-CKUGTKP

9137

9139

1,5:1

9138

1,5:1



/CIPWU/CZKOWUÕ5KNKSWC6TGXGTKI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO 4QOCUKV\VXXOKV)NQDWUWPF5RGGT4+%D 5GJTUEJÌPpXQT\ÒINKEJ





Õ5KNKSWC6TGXGTKI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO4QOCUKV\VXXOKV)NQDWU WPF5RGGT4+%D 5GJTUEJÌP





(NCXKWU 8KEVQT  Õ5KNKSWC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO   4QOCUKV\VXXOKV)NQDWUWPF5RGGT4+%F  45EJTÌVNKPIUTK­HCUVXQT\ÒINKEJGU'ZGORNCTOKVHGKPGT2CVKPC



9140



“0WOOWU #SWKNGKC  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO.CIGTVQT \YKUEJGP FGP 6ÒTOGP   5VGTP4+%D $TCWPG2CVKPCHCUVXQT\ÒINKEJ

1,5:1

 306

9141



1,5:1

'WIGPKWU  Ô5QNKFWU .WIFWPWO  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO<YGK -CKUGT   UKV\GPXXFCJKPVGT8KEVQTKC4+% 44.GKEJVIGYGNNVUGJTUEJÌP 


RÖMISCHE KAISERZEIT

1,5:1



9142

1,5:1

Õ5KNKSWC.WIFWPWOI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO4QOCUKV\VNCWH2CP\GTOKV8KEVQ TKCCWH)NQDWUWPF5RGGT4+% 4-N5EJTÌVNKPIUTK­UGJTUEJÌP



0CEJ FGO 6QF FGU 8CNGPVKPKCP ++ GTJQD FGT OCIKUVGT OKNKVWO #TDQICUV 'WIGPKWU \WO #WIWUVWU 'WIGPKWU FGT   GKIGPVNKEJ GKP %JTKUV YCT YCPFVG UKEJ DCNF GKPGT TÌOGTHTGWPFNKEJGP 4GNKIKQPURQNKVKM \W FGT #NVCT FGT 8KEVQTKC   YWTFGKPFKG%WTKC\WTÒEMIGDTCEJV6GORGNYWTFGPYKGFGTIGÌHHPGVTGNKIKÌUG(GUVGIGHGKGTVWPF1RHGTFCTIGDTCEJV OCTUEJKGTVG6JGQFQUKWU+IGIGP'WIGPKWUWPFCO5GRVGODGTVTCHGPUKEJFKG*GGTGCO(TKIKFWU 9KRRCEJ  #TDQICUV NKG­ ,WRKVGTUVCVWGP CWHUVGNNGP FGTGP $NKV\G PCEJ 1UVGP IGTKEJVGV YCTGP CWH FGP 5VCPFCTVGP FGT 6TWRRGP   YWTFGP$KNFGTFGU*GTEWNGUCPIGDTCEJV&GT5EJNCEJVXGTNCWHYCTCOGTUVGP6CIGIÒPUVKIFKG6TWRRGPFGU6JGQFQ UKWUYWTFGPUVCTMFG\KOKGTV0CEJGKPGOXQTCNNGT#WIGPXQNN\QIGPGP)GDGVFGU6JGQFQUKWUDTCEJVGGKP9GVVGTWO UEJYWPI CO  5GRVGODGT FKG 9GPFG FKG 6TWRRGP FGU 'WIGPKWU YWTFGP XGTPKEJVGV GT UGNDUV IGHCPIGPIGPQOOGP   WPF IGVÌVGV FGT RTQOKPGPVG5GPCVQTWPF2T·VQTKCPGTRT·HGMV8KTKWU0KEQOCEJWU(NCXKCPWUFGTNKGDGTUVGTDGPYQNNVG CNUUGKPG4QOCPKVCUCWH\WIGDGPY·JNVGFGP(TGKVQF/KVFGO4KPIGPCO(TKIKFWUFCUFGP%JCTCMVGTGKPGU4GNKIK QPUMTKGIGUJCVVGUGV\VGUKEJFCU%JTKUVGPVWOKOTÌOKUEJGP4GKEJRQNKVKUEJGPFIÒNVKIFWTEJ

9143



9145

9144

9146

9147

#TECFKWUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI&TCRKGTVG$ÒUVGTOKV 4QUGVVGPFKCFGO%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF5EJKNFOKV8168/8.6:4+%E  -TCV\GTCWH#XGTUWPF4GXGTUUGJTUEJÌP





Õ5KNKSWC  6TGXGTK  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO4QOC UKV\V N OKV 8KEVQTKC   CWH)NQDWUWPF.CP\G4+%D (NCWGT4GXGTUUVGORGNHCUVXQT\ÒINKEJ





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF 5EJKNF8KEVQTKCUKV\VTCWH2CP\GTWPFUEJTGKDV:::::CWH5EJKNFKO(GNFN5VGTP4+%  49KP\-TCV\GTUGJTUEJÌP



*QPQTKWU  Ô5QNKFWU  /GFKQNCPWO  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO   -CKUGTUVGJVTOKV5VCPFCTVGWPF8KEVQTKCCWH)NQDWU(W­CWH)GHCPIGPGO4+%  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Ô5QNKFWU6JGUUCNQPKECI)GRCP\GTVG$ÒUVGXXOKV*GNO5EJKNFWPF5RGGT%QP UVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF8KEVQTKCCWH)NQDWU(W­CWH2TQTC4+% 45GJTUEJÌP







1,5:1



9148

1,5:1

%QPUVCPVKPWU+++Õ5KNKSWC6TGXGTKI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO 4QOCUKV\VNOKV8KEVQTKCCWH)NQDWUWPF5RGGT4+% 4(GKPG6ÌPWPIUGJTUEJÌP



%QPUVCPVKPWU +++ YWTFG  KP $TKVCPPKGP \WO #WIWUVWU GTJQDGP 'T UGV\VG DCNF PCEJ )CNNKGP ÒDGT WPF FGJPVG   UGKPGP 'KPHNW­ CWEJ PCEJ 5RCPKGP CWU  GTNCPIVG %QPUVCPVKPWU +++ FKG #PGTMGPPWPI FGU *QPQTKWU XGTNQT CNNGT   FKPIU $TKVCPPKGP WPF 5RCPKGP  MCO GU \WT #WUGKPCPFGTUGV\WPI OKV *QPQTKWU  YWTFG %QPUVCPVKPWU +++ KP   UGKPGO*CWRVSWCTVKGTKP#TGNCVGDGNCIGTVWPFHNQJPCEJFGOGKP'PVUCV\JGGTIGUEJNCIGPYQTFGPYCTKPGKPG-KTEJG WPFNGIVGFGP2WTRWTCD&GT'ZMCKUGTYWTFGIGHCPIGPIGPQOOGPWPFPCEJ+VCNKGPIGUCPFVCDGTGTOQTFGVDGXQTGT *QPQTKWUGTTGKEJVG5GKP-QRHYWTFGCDFGO5GRVGODGTKP4CXGPPC\WT5EJCWIGUVGNNV

307


RÖMISCHE KAISERZEIT

9149

1,5:1

1,5:1



6JGQFQUKWU ++  Õ/KNKCTGPUG NGKEJV  %QPUVCPVKPQRQNKU  I &TCRKGTVG $ÒUVG N   OKV2GTNFKCFGO-CKUGTUVGJVXXOKVGTJQDGPGT4GEJVGPWPF)NQDWUN5VGTP4+%  4-N5VGORGNDTWEJCWHFGO#XGTUIWVGUUGJTUEJÌP

9151

9150



9153

9152



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF 5EJKNF8KEVQTKCUVGJVNOKV-TGW\KO(GNFQDGPN5VGTP4+% 5GJTUEJÌP





Ô5QNKFWU6JGUUCNQPKECI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF5EJKNF%QP UVCPVKPQRQNKUUKV\VNOKV-TGW\INQDWUWPF<GRVGTFCJKPVGT5EJKNFWPF5VGTP4+%  4&QRRGNUEJNCICWHFGO4GXGTUUGJTUEJÌP





Ô5QNKFWU  %QPUVCPVKPQRQNKU  I )GRCP\GTVG $ÒUVG X X OKV *GNO 5RGGT WPF 5EJKNF   %QPUVCPVKPQRQNKUUKV\VNOKV-TGW\INQDWUFCJKPVGT5EJKNFN5VGTP4+% 8QT\ÒINKEJ





Ô5GOKUUKU  %QPUVCPVKPQRQNKU  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO8KEVQTKC UKV\V T CWH   2CP\GTWPFUEJTGKDV :::8CWH5EJKNFN5VGTP4+%  4-N-TCV\GTCWHFGO#XGTUIWVGUUGJTUEJÌP



1,5:1



9154

1,5:1

HÒT#GNKC'WFQEKCÔ6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV&KCFGO -TGW\KP-TCP\4+% 4#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



'ZGORNCTFGT#WMVKQP5VGTPDGTI<ÒTKEJ0T  #GNKC 'WFQEKC 6QEJVGT GKPGU #VJGPGTU .GQPVKWU VTWI CNU #PJ·PIGTKP FGT CNVGP 4GNKIKQP FGP 0COGP #VJGPCKU GTUV    YWTFG UKG IGVCWHV #GNKC 2WNEJGTKC HÒJTVG UKG KJTGO $TWFGT \W 5KG JGKTCVGVG  6JGQFQUKWU ++ WPF HÒJTVG DKU    YGKVIGJGPF FKG 4GIKGTWPI &CPCEJ \QI UKG UKEJ PCEJ ,GTWUCNGO \WTÒEM WPF HÒJTVG GKP TGNKIKÌUGU .GDGP DKU \W   KJTGO6QF

1,5:1



9155

1,5:1

HÒT#GNKC2WNEJGTKCÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI&TCRKGTVG$ÒUVGTOKV &KCFGOIGMTÌPVXQPFGT*CPF)QVVGU0KMGUVGJVNOKV-TGW\4+% 44)WVGUUGJTUEJÌP #GNKC2WNEJGTKCYCTFKG·NVGUVG5EJYGUVGTFGU-CKUGTU5KGÒDGTPCJOOKV,CJTGPFKG4GIGPVUEJCHVKP1UVTQO PCEJFGOFGT2T·VQTKCPGTRT·HGMV#PVJGOKWUWPFFGT'WPWEJ#PVKQEJWUGPVOCEJVGVYQTFGPYCTGP

308




RÖMISCHE KAISERZEIT

9156



8CNGPVKPKCPWU+++“0WOOWU%[\KEWU1HHK\KPI&TCRKGTVG$ÒUVGTOKV 2GTNFKCFGO8KEVQTKCUVGJVHCUVXXOKV\YGK-T·P\GP4+% 445GJTUEJÌP

9157 1,5:1





1,5:1

#XKVWU  Ô5QNKFWU #TGNCVG  I &TCRKGTVG $ÒUVG T OKV 4QUGVVGPFKCFGO-CKUGT UVGJV T   OKV-TGW\WPF8KEVQTKCCWH)NQDWU(W­CWH)GHCPIGPGO4+%#PO  8QPITQ­GT5GNVGPJGKV5GJTUEJÌP 

8CTKCPVGOKV  242(  KPFGT#XGTUNGIGPFG  'RCTEJKWU#XKVWUUVCOOVGCWU)CNNKGPWPFJCVVGDGTGKVUXQTUGKPGT'TJGDWPI\WO#WIWUVWUJQJG\KXKNGWPFOKNKV·TK UEJGOVGTDGMNGKFGV'TJCVVGIWVG$G\KGJWPIGP\WFGP9GUVIQVGPWPFYCTOC­IGDNKEJFCTCPDGVGKNKIVKJTG7PVGT UVÒV\WPIKO-CORHIGIGP#VVKNCWPFFKG*WPPGP\WIGYKPPGP2GVTQPKWU/CZKOWUGTPCPPVG#XKVWU\WOOCIK UVGTOKNKVWORTCGUGPVCNKUWPFUCPFVGKJPCPFGP*QHFGU9GUVIQVGPMÌPKIU6JGQFGTKEJ0CEJFGO6QFFGU2GVTQPKWU /CZKOWUWPFFGT2NÒPFGTWPI4QOUFWTEJFKG8CPFCNGPNKG­#XKVWUUKEJKP)CNNKGPXQP6JGQFGTKEJFC\WCWHIGHQT FGTV\WO#WIWUVWUGTMN·TGP&GTTÌOKUEJG5GPCVGTMCPPVGKJPPQEJXQTUGKPGT#PMWPHVKP4QOCNU-CKUGTCP&CU 4GKEJ YWTFG CDGT DCNF XQP FGP 5WGDGP KP 5RCPKGP WPF XQP FGP 8CPFCNGP KP +VCNKGP DGFTQJV &GT 9GUVIQVGPMÌPKI   6JGQFGTKEJ YWTFG OKV FGT $GM·ORHWPI FGT 5WGDGP DGVTCWV FKG 8CPFCNGP YWTFGP XQO OCIKUVGT OKNKVWO 4KEKOGT   DGUKGIV0CEJUGKPGO5KGITGDGNNKGTVG4KEKOGTLGFQEJGTHQNITGKEJIGIGP#XKVWUWPFUGV\VG/CKQTKCPWUCNU-CKUGTGKP #XKVWUDNKGDPCEJUGKPGT'PVVJTQPWPI\WP·EJUVCO.GDGPWPFYWTFG\WO$KUEJQHXQP2KCEGP\CIGOCEJV'TYQNNVG PCEJ)CNNKGP\WTÒEMMGJTGPYWTFGLGFQEJCWHFGO9GIGTOQTFGVXGTOWVNKEJCWH8GTCPNCUUWPIFGU/CKQTKCPWUFGT JKGTOKV YCJTUEJGKPNKEJ CWH FKG 8GTUEJYÌTWPI GKPGU IGYKUUGP /CTEGNNWU TGCIKGTVG FGTGP <KGN XGTOWVNKEJ FCTKP   DGUVCPF#XKVWUYKGFGT\WT/CEJV\WXGTJGNHGP

9158

9159

9160

1,5:1

1,5:1



.GQ+Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV *GNO5RGGTWPF5EJKNF8KEVQTKCUVGJVNOKV.CPIMTGW\FCJKPVGT5VGTP4+%  .GKEJVDGUEJPKVVGPUGJTUEJÌP



“0WOOWUI&TCRKGTVG$ÒUVGTOKV&KCFGO/QPQITCOOKP-TCP\4+%HH



.GQ++WPF<GPQÔ5QNKFWU%QPUVCPVKPQRQNKUI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGT WPF5EJKNF<YGK-CKUGTVJTQPGPXXFCTÒDGT5VGTPÒDGT-TGW\4+%  44.GKEJVG(CUUWPIUURWTGPUGJTUEJÌP

5GJTUEJÌP

  

.GQ++YWTFGWOCNU5QJP<GPQUWPFFGT#TKCFPGIGDQTGP5GKP)TQ­XCVGT.GQ+GTJQDKJPCO1MVQDGT  \WO %CGUCT PCEJ .GQU 6QF YWTFG GT \WO #WIWUVWU GTJQDGP 0CEJ GKPGT #NNGKPTGIKGTWPI XQP FTGK 9QEJGP   UVKGI UGKP 8CVGT <GPQ CO  (GDTWCT  \WO /KVTGIGPVGP CWH .GQ ++ UVCTD CO  0QXGODGT  GKPGU YCJT   UEJGKPNKEJPCVÒTNKEJGP6QFGU

9161





9162

<GPQ  Ô5QNKFWU %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV *GNO   5RGGTWPF5EJKNF8KEVQTKCUVGJVNOKV-TGW\T5VGTP4+%  &QRRGNUEJNCICWHFGO4GXGTUUGJTUEJÌP



Ô5GOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO8KEVQTKCUKV\VTWPFUEJTGKDV 8::CWH5EJKNFKO(GNFN5VGTPKO(GNFT%JTKUVQITCOO4+% .GKEJVIGYGNNVUGJTUEJÌP

 309


LOTS RÖMISCHER MÜNZEN

9163



Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO8KEVQTKCIGJVTOKV-TCP\ WPF-TGW\INQDWUT5VGTP4+% 5GJTUEJÌP

1,5:1





9164 1,5:1

$CUKNKUEWUWPF/CTEWUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVG XXOKV*GNO5RGGTWPF5EJKNF8KEVQTKCUVGJVNOKV.CPIMTGW\FCJKPVGT5VGTP4+%  44-N4CPFHGJNGTMN-TCV\GTCWHFGO#XGTUHCUVXQT\ÒINKEJ  $CUKNKUEWUYCTFGT$TWFGTFGT#GNKC<GPQPKUFKGGTHQNITGKEJIGIGP<GPQKPVTKIKGTVGWPFKJTGO$TWFGTCWHFGP6JTQP XGTJCNH#DGTFKG-QUVGPFGU-TKGIGUIGIGPFGPIGHNQJGPGP<GPQWPRQRWN·TGTGNKIKÌUG/C­PCJOGPWPFUEJNKG­NKEJ GKP (GWGT KP FGT *CWRVUVCFV \YCPIGP KJP FKG /CEJV YKGFGT <GPQ \W ÒDGTNCUUGP &KGUGT JCVVG XGTURTQEJGP $CUK   NKUEWUWPFUGKPG(COKNKGPKEJV\WVÌVGPGTUEJKEMVGUKGFCJGTPCEJ.KOPCKP-CRRCFQMKGPKPU'ZKNWPFNKG­UKGFQTV XGTJWPIGTP

.1654¤/+5%*'4/ª0<'0 

5RG\KCNUCOONWPI XQP 4GRWDNKMFGPCTGP FGU .WEKWU 2CRKWU &KG 5COONWPI GPVJ·NV  &GPCTG FGU   .WEKWU 2CRKWU  X %JT -QRH FGT ,WPQ 5QURKVC T)TGKH URTKPIV T %TCYH    &GT 5COONGT   JCV GKPG DGCEJVNKEJG #P\CJN FKXGTUGT $GK\GKEJGP2CCTG FKGUGT KPVGTGUUCPVGP 5GTKG \WUCOOGPIGVTCIGP   XGTVTGVGPUKPFWCFKG2CCTG5EJ·NGKUGP*QDGN/QJPUVGPIGN-GTDOGUUGT5EJOGVVGTNKPI(NKGIG1DGT UVGORGN7PVGTUVGORGN #RNWUVTWO4QUVTWO 5EJKPMGP5EJYGKPUMQRH 5·IG5·IG -TGDU(KUEJ WPF XKGNG   CPFGTGOGJT*QEJKPVGTGUUCPVGU1DLGMVDKVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP  .WEKWU 2CRKWU /ÒP\OGKUVGT 4QOU  X %JT NKG­ GKPG DGOGTMGPUYGTVG 'OKUUKQP XQP &GPCTKK UGTTCVK CWURT·IGP  

%TCYH5[F &KG*CWRVDKNFGT ,WPQ5QURKVC)TGKH YGKUGPCWHFKGNCPWXKUEJG*GTMWPHVFGT(COKNKGFGT 2CRKGT CPUQPUVGP KUV ÒDGT FGP /ÒP\OGKUVGT PKEJVU DGMCPPV 9·JTGPF FKG *CWRVDKNFGT FWTEJI·PIKI DGKDGJCNVGP   YWTFGP FKGPVGP GKPG (ÒNNG XQP $GK\GKEJGP 2CCTGP \WT -GPP\GKEJPWPI FGT GKP\GNPGP 5VGORGN &KGUG $GK\GKEJGP   2CCTG IGJÌTGP NQIKUEJ \WUCOOGP OGKUV MQORNGOGPV·T QFGT \WOKPFGUV U\GPKUEJ UQ FC­ OCP FCU 2CCT HCUV KOOGT   OKVGKPGO6JGOCGTHCUUGPMCPP&KGUG$GK\GKEJGPDKGVGPGKPGPGKP\KICTVKIGP'KPDNKEMKPUTÌOKUEJG#NNVCIUNGDGP





-NGKPG 5COONWPI XQP 5KNDGTOÒP\GP FGT TÌOKUEJGP 4GRWDNKM FCDGK YGPKIG KORGTCVQTKUEJG 2T·   IWPIGP  &KG KPVGTGUUCPVG 5COONWPI GPVJ·NV  &GPCTG FCTWPVGT \ $ $TWVWU#JCNC ,WNKWU %CGUCT  

4GXGTU 'NGHCPV  5ETKDQPKWU .KDQ 4GXGTU 2WVGCN  %QPUKFKWU 0QPKCPWU 4GXGTU 6GORGN FGT 8GPWU   'T[EKPC#XGTUUVCTMMQTTQFKGTV (GTPGTUKPFFTGKMNGKPGTG0QOKPCNGGPVJCNVGP*QEJKPVGTGUUCPVGU1D LGMVOKV5GNVGPJGKVGPDKVVGDGUKEJVKIGP 5VÒEM<WO6GKNUGNVGP/GKUVUGJTUEJÌPYGPKIGUEJÌP



&GPCTG FGT TÌOKUEJGP 4GRWDNKM &CU .QV GPVJ·NV  &GPCTG FGT TÌOKUEJGP 4GRWDNKM W C %QTFKWU   4WHWU4GXGTU%WRKFQCWH&GNRJKP UQYKGGKPGP.GIKQPUFGPCTFGU/CTEWU#PVQPKWU .')8 &C\WGKP 3WKPCTFGU.2KUQ(TWIK+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP





5COONWPI TGKEJUTÌOKUEJGT $TQP\GOÒP\GP 'PVJCNVGP UKPF 5GUVGT\G &WRQPFKGP WPF #UUG HQNIGPFGT   4GIGPVGP #WIWUVWU WPF #ITKRRC 0GOCWUWU#U  #PVQPKC #U  %NCWFKWU Z  0GTQ  5GUVGT\G   &GEWTUKQWPF,CPWUVGORGN 8GURCUKCP ZWCGKP#UOKV+WFCGC%CRVC 6KVWU Z &QOKVKCP ZW CGKP5GUVGT\OKV)GTOCPKC%CRVCNGKEJVÒDGTCTDGKVGV 0GTXC Z 6TCKCP Z *CFTKCP ZFCDGK WC5GUVGT\&CEKC5GUVGT\#GI[VQU5GUVGT\*KURCPKC5GUVGT\4GUVKVWVQTK#HTKECG 5CDKPC#PVQPKPWU +2KWU Z (CWUVKPCOCVGT Z /CTEWU#WTGNKWU Z (CWUVKPCHKNKC Z WPF.WEKWU8GTWU  5VÒEM<WO6GKNUGNVGP9GPKIGNGKEJVÒDGTCTDGKVGVOGKUVUGJTUEJÌP 



5COONWPIOGKUVTÌOKUEJGT/ÒP\GP'PVJCNVGPUKPFÒDGTYKGIGPFTÌOKUEJG/ÒP\GPFGT-CKUGT\GKVXQP #WIWUVWUDKUKPFKG5R·VCPVKMGFCTWPVGTWC&GPCTG WCGKP4GRWDNKMFGPCTGKP&GPCT%CGUCTUOKV 'NGHCPVGKP)CKWU.WEKWU&GPCTFGU#WIWUVWUGVE GKP3WKPCTFGU*CFTKCPTGKEJUTÌOKUEJG$TQP \GOÒP\GP 5GUVGTVKK&WRQPFKK#UUGU FKXGTUG#PVQPKPKCPG WC&KXC/CTKPKCPC UR·VTÌOKUEJG$TQP \GOÒP\GP2TQXKP\KCNRT·IWPIGPYGPKIG-GNVGP&CU1DLGMVKUVFWTEJFKG\CJNTGKEJGPXGTVTGVGPGP-CKUGT WPF MCKUGTNKEJG &COGP UQYKG FKG VGKNU JÒDUEJGP 3WCNKV·VGP IWV CNU )TWPFUVQEM HÒT FGP #WHDCW GKPGT   4ÌOGTUCOONWPICDGTCWEJHÒTFGP#WUDCWGKPGTDGUVGJGPFGP5COONWPIIGGKIPGV+PVGTGUUCPVGU1DLGMV DKVVGWPDGFKPIVDGUKEJVKIGP EC5VÒEM$TWEJUVÒEMGOGKUVUGJTUEJÌPGKPKIGDGUUGT 



5COONWPI TÌOKUEJGT $TQP\GOÒP\GP XQP FGT 4GRWDNKM DKU KP FKG 5R·VCPVKMG &KG KPVGTGUUCPVG   5COONWPIGPVJ·NVÒDGTYKGIGPF5GUVGTVKK&WRQPFKKWPF#UUGUFGT-CKUGT\GKVCDGTCWEJMNGKPGTG0QOK PCNGGKP#UFGT4GRWDNKMYGPKIG(QNNGUWPF6GKNUVÒEMG&CXKGNG4GIGPVGPXGTVTGVGPUKPFGKIPGVUKEJ FCU1DLGMVJGTXQTTCIGPF\WO#WHQFGT#WUDCWGKPGT5COONWPI$KVVGWPDGFKPIVDGUKEJVKIGP  EC5VÒEM<WO6GKNUGNVGP5EJÌPpUGJTUEJÌP 

310


LOTS RÖMISCHER MÜNZEN 

5COONWPI TÌOKUEJGT &GPCTG FGT -CKUGT\GKV 8GTVTGVGP UKPF #WIWUVWU Z  4GXGTU %CRTKEQTP WPF   /ÒP\OGKUVGTRT·IWPI FGU 6WTRKNKCPWU 4GXGTU 6CTRGKC  6KDGTKWU 6TKDWVGRGPP[  )CNDC Z W C   5#.85 )'0 *7/#0+  8GURCUKCPWU Z  6KVWU 4GXGTU 'NGHCPV  &QOKVKCPWU 0GTXC 6TCKCP Z    *CFTKCP Z W C #GI[RVQU #HTKEC #NGZCPFTKC )GTOCPKC +VCNKC 0KNWU 4GUVKVWVQTK *KURCPKCG   4GUVKVWVQTK)CNNKCG 5CDKPC#PVQPKPWU2KWU&KXC(CWUVKPCOCVGT Z #PVQPKPWU++/CTEWU#WTGNKWU #PVQPKPWU ++ /CTEWU #WTGNKWU HÒT &KXWU #PVQPKPWU +2KWU Z (CWUVKPCHKNKC#PVQPKPWU++/CTEWU #WTGNKWU HÒT &KXC (CWUVKPC HKNKC .WEKWU 8GTWU HÒT .WEKNNC UQYKG #PVQPKPWU ++ /CTEWU #WTGNKWU HÒT   &KXWU.WEKWU8GTWU*QEJKPVGTGUUCPVGU1DLGMVFCUFWTEJFKG\CJNTGKEJGPXGTVTGVGPGP-CKUGTWPFMCKUGT NKEJG &COGP UQYKG UGNVGPG WPF IGUWEJVG 4GXGTUV[RGP UQYQJN CNU )TWPFUVQEM HÒT FGP #WHDCW GKPGT   5COONWPITÌOKUEJGT/ÒP\GPCNUCWEJ\WO#WUDCWGKPGTDGUVGJGPFGP5COONWPIJGTXQTTCIGPFIGGKIPGV KUV$KVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM<WO6GKNUGNVGP(CUVUGJTUEJÌPWPFUGJTUEJÌP 



.QV TÌOKUEJGT $TQP\GOÒP\GP 'PVJCNVGP UKPF CEJV 4GKEJURT·IWPIGP FCTWPVGT FTGK 5GUVGT\GP 0GTQ   (CWUVKPCOCVGT2JKNKRRWU#TCDU WPFHÒPHMNGKPGTG0QOKPCNG 0GTXC6TCKCPZ*CFTKCP%QOOQFWU  &C\WGKPGJÒDUEJGU[TKUEJG2T·IWPIFGU0GTQ+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM/GKUVUGJTUEJÌP



.QV OGKUV TÌOKUEJGT /ÒP\GP 'PVJCNVGP UKPF W C HÒPH CNGZCPFTKPKUEJG 6GVTCFTCEJOGP Z 0GTQ   *CFTKCPWU/CTEWU#WTGNKWU%NCWFKWU++ \YGKU[TKUEJG6GVTCFTCEJOGP #PVQPKPWU+++%CTCECNNCWPF 2JKNKRRWU+#TCDU UQYKGGKP&GPCTFGU)QTFKCPWU+++2KWU&C\WXKGTITKGEJKUEJG/ÒP\GP$[\CPVKQP Õ&TCEJOG 5[TKC 2JKNKRRQU + Õ6GVTCFTCEJOG 5GNIG Õ1DQN UQYKG GKPG MCRRCFQMKUEJG   &TCEJOG+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP



.QV TÌOKUEJGT 2TQXKP\KCNRT·IWPIGP &CU KPVGTGUUCPVG .QV GPVJ·NV \CJNTGKEJG 2T·IWPIGP CWU /QGUKGP   WPF 6JTCMKGP FCTWPVGT %CTCECNNC #/0)  4GXGTU (NW­IQVV  CDGT CWEJ MNGKPCUKCVKUEJG /ÒP\GP   UQYKGCNGZCPFTKPKUEJG6GVTCFTCEJOGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5EJÌPpUGJTUEJÌP



5COONWPITÌOKUEJGT/ÒP\GPXQPFGT4GRWDNKMDKU\WT5R·VCPVKMG'PVJCNVGPUKPFWC&GPCTG

Z4GRWDNKMZ-CKUGT\GKV #UUG 8GURCUKCPWUWPF0GTQ #PVQPKPKCPGXQP,WNKC&QOPCDKU\WT 6GVTCTEJKG FTGKDGUEJPKVVGPG5KNKSWGP WC/CIPWU/CZKOWUWPF8CNGPU/ÒP\UV·VVG6TGXGTK UQYKG FKXGTUG (QNNGU /CKQTKPCG  WPF 6GKNUVÒEMG W C /CIPGPVKWU )CNGTKC 8CNGTKC &QRRGNOCKQTKPC XQP   ,WNKCPWU ++ GVE  *QEJKPVGTGUUCPVGU 1DLGMV FCU JGTXQTTCIGPF CNU )TWPFUVQEM HÒT FGP #WHDCW GKPGT   4ÌOGTUCOONWPI CDGT CWEJ \WO #WUDCW GKPGT DGUVGJGPFGP 5COONWPI IGGKIPGV KUV WPF WPDGFKPIV DG   UKEJVKIVYGTFGPUQNNVG EC5VÒEM<WO6GKNUGNVGP5EJÌPpXQT\ÒINKEJ



.QVTÌOKUEJGT/ÒP\GP&CUKPVGTGUUCPVG.QVGPVJ·NVWCGKPGP&GPCTFGTTÌOKUEJGP4GRWDNKM %TCYH  HÒPH&GPCTGFGT-CKUGT\GKVGKPGP5GUVGT\FGU5GXGTWU#NGZCPFGTGKPGP%GPVGPKQPCNKUFGU,WNKC PWU++UQYKG\YGK2TQXKP\KCNRT·IWPIGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPWPFDGUUGT



.QVOGKUVTÌOKUEJGT/ÒP\GP&CUKPVGTGUUCPVG.QVGPVJ·NVWC&GPCTG Z4GRWDNKMZ-CKUGT \GKVFCXQPGKP5VÒEM\GTDTQEJGPFGT)GUCOVGKPFTWEMFGT&GPCTGKUVUGJTUEJÌP GKPKIG#PVQPKPKCPG XQP)QTFKCPWU+++DKU\WT6GVTCTEJKG5GUVGT\GP WC8GURCUKCP4GXGTU+WFCGC%CRVC2JKNKRRWU++ 4GXGTU 2TKPEKRK +WXGPVWVKU 6TCKCPWU &GEKWU 4GXGTU .KDGTCNKVCU  -CKUGT UKV\V N CWH 2NCVVHQTO  HGTPGT   GKPKIG &WRQPFKGP WPF #UUG W C 0GTQ  UQYKG UR·VCPVKMG $TQP\GOÒP\GP XKGNG O·­KI GTJCNVGP CDGT   CWEJGKPKIGXQT\ÒINKEJ D[\CPVKPKUEJG2T·IWPIGPUQYKGGKPKIG2TQXKP\KCNRT·IWPIGP+PVGTGUUCPVGU.QV OKV5GNVGPJGKVGPDKVVGDGUKEJVKIGP EC5VÒEM<WO6GKNUGNVGP)GTKPIGTJCNVGPpXQT\ÒINKEJ



.QVOGKUVTÌOKUEJGT/ÒP\GP&CU.QVGPVJ·NVÒDGTYKGIGPF/ÒP\GPFGTTÌOKUEJGP-CKUGT\GKVFCTWPVGT &GPCTG WC0GTQ&QOKVKCP6TCKCP*CFTKCP(CWUVKPCHKNKC.WEKWU8GTWU.WEKNNC FKXGTUG OGKUV UR·VTÌOKUEJG $TQP\GOÒP\GP2TQXKP\KCNRT·IWPIGP WC6TCKCP“&TCEJOG#NGZCPFTKC UQYKGGKPKIG ITKGEJKUEJG2T·IWPIGP WC-QTKPVJ5VCVGT.CTKUUC&TCEJOG6JGUUCNKUEJG.KIC&TCEJOG WPFGKP D[\CPVKPKUEJGUÔ*[RGTRGTQP*QEJKPVGTGUUCPVGU.QVDKVVGWPDGFKPIVDGUKEJVKIGP  5VÒEM<WO6GKNUGNVGP/GKUVUGJTUEJÌP



)GOKUEJVGU .QV OGKUV TÌOKUEJGT /ÒP\GP 'PVJCNVGP UKPF W C \YGK &GPCTG 6TCKCP WPF 5GRVKOKWU   5GXGTWU  GKP #PVQPKPKCP FGU )QTFKCPWU +++ \YGK 2TQXKP\KCNRT·IWPIGP W C GKPG CNGZCPFTKPKUEJG   &TCEJOG UR·VTÌOKUEJG$TQP\GOÒP\GP\YGKITKGEJKUEJG2T·IWPIGPWPFGKPGTWUUKUEJG/ÒP\G  5VÒEM/GKUVUGJTUEJÌP





4ÌOKUEJG$TQP\GOÒP\GP'PVJCNVGPUKPF5GUVGT\GFGUWPF,CJTJWPFGTVUP%JTUQYKGFKXGTUG MNGKPGTG0QOKPCNGWPFXKGT#PVQPKPKCPG$KVVGDGUKEJVKIGP 5VÒEM5EJÌPpUGJTUEJÌP





.QV TÌOKUEJGT &GPCTG WPF#PVQPKPKCPGFGT-CKUGT\GKV&CUKPVGTGUUCPVG.QVGPVJ·NV&GPCTGXQP #WIWUVWU DKU 5GXGTKPC FCTWPVGT \ $ 1VJQ UEJÌP  8KVGNNKWU 8GURCUKCP 4GXGTU +WFCGC  5GRVKOKWU   5GXGTWU 4GXGTU 'NGHCPV  (GTPGT UKPF  #PVQPKPKCPG W C 2JKNKRRWU #TCDU 4GXGTU 'NGHCPV OKV   /CJQWV UQYKGGKPG&TCEJOG 6KDGTKWU WPFGKPG*GOKFTCEJOG 0GTQ CWU%CGUCTGC%CRRCFQEKCGGPV JCNVGP+PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP  5VÒEM<WO6GKNUGNVGP/GKUVUGJTUEJÌPGKPKIGUEJY·EJGT

















311


VÖLKERWANDERUNG 

5COONWPITÌOKUEJGT/ÒP\GPFGT-CKUGT\GKV&CU.QVGPVJ·NV2T·IWPIGPCWUFGT<GKVXQP#WIWUVWU DKU#WTGNKCPWUFCTWPVGT&GPCTG WC#WIWUVWU*CFTKCP#PVQPKPWU2KWU%NQFKWU#NDKPWU5GRVK OKWU 5GXGTWU #PVQPKPWU +++ %CTCECNNC ,WNKC /CGUC ,WNKC /COCGC GVE   #PVQPKPKCPG FCTWPVGT   *QUVKNKCPWU#GOKNKCPWU3WKPVKNNWU GKPGP3WCFTCPUFGU0GTXCUQYKGGKPG2TKXKP\KCNRT·IWPICWU#RQN NQPKU .[FKCG <GKV FGU &QOKVKCPWU  *QEJKPVGTGUUCPVGU 1DLGMV FCU FWTEJ FKG \CJNTGKEJGP XGTVTGVGPGP   4GIGPVGPWPFGKPKIGUGJTJÒDUEJG3WCNKV·VGPJGTXQTTCIGPFCNU)TWPFNCIGHÒTFGP#WHDCWGKPGT4ÌOGT UCOONWPI CDGT CWEJ \WO #WUDCW GKPGT DGUVGJGPFGP 5COONWPI IGGKIPGV KUV $KVVG WPDGFKPIV DGUKEJVK   IGP 5VÒEM/GKUVUGJTUEJÌPGKPKIGDGUUGT





5[TKUEJG6GVTCFTCEJOGP2JKNKRRWU+#TCDU ZFCXQPZ.KPMUDÒUVG 2JKNKRRWU++ Z &C\W'KPG $TQP\GFGU2JKNKRRWU#TCDUCWU#PVKQEJKC 5VÒEM/GKUVUGJTUEJÌP





.QVTÌOKUEJGT/ÒP\GP&CUKPVGTGUUCPVG1DLGMVGPVJ·NVÒDGTYKGIGPF$TQP\GOÒP\GPCDFGT6GVTCTEJKG

(QNNGUWPF6GKNUVÒEMG/CKQTKPCG WC/CIPGPVKWU %GPVGPKQPCNGUGVE CDGTCWEJFTGK#PVQPKPKCPG

WC%CTKPWU UQYKGGKPGTGRWDNKMCPKUEJG$TQP\G+PVGTGUUCPVGU1DLGMVDKVVGDGUKEJVKIGP  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





5COONWPIXQP6GUUGTGP/GUUKPI#RRNKMGPGVE&KGKPVGTGUUCPVG5COONWPIGPVJ·NVFTGK2D6GUUGTGP

9GKDNKEJGT -QRH8KEVQTKC UKV\V N 51&#.'5   -QRH N#FNGT -QRH FGU %QOOQFWU!  N   &TCRKGTVG$ÒUVGT \YGK/GUUKPI#RRNKMGP $·TVKIGT-QRHTÒDGTFGT5EJWNVGT<GRVGT/·PPNKEJGTWPF YGKDNKEJGT -QRH GKPCPFGT IGIGPÒDGT  \YGK #DFTÒEMG XQP )GOOGP KP $TQP\G #HTKMCMQRH *GTEWNG   UMQRH KO .ÌYGPHGNN  UQYKG GKPG GKPUGKVKIG TGEJVGEMKIG “6GUUGTC 2WDGU  *QEJKPVGTGUUCPVGU 1DLGMV   DKVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM<WO6GKNXQPITQ­GT5GNVGPJGKV5GJTUEJÌP 

8¤.-'49#0&'470)

9186

9187

1,5:1

1,5:1

1,5:1

1,5:1

+6#.+# 

1FQCMGTÔ6TGOKUUKUKO0COGPFGU<GPQPCEJ4QOI&TCRKGTVG$ÒUVGTOKV &KCFGO-TGW\KP-TCP\4+%XCT 4)WVGUUGJTUEJÌPHCUVXQT\ÒINKEJ



9'56)16'0 

#PQP[OÔ6TGOKUUKUKO0COGPFGU8CNGPVKPKCPWU+++I&02.#8#.'06+#0852(#8)

UKE &TCRKGTVG$ÒUVGTOKV2GTNFKCFGO+P.QTDGGTMTCP\-TGW\4GKPJCTVXGTINHH4+%  5GJTUEJÌP

1,5:1



312

1,5:1

4GEECTGF+Ô6TGOKUUKU6QNGVQI$GKFGTUGKVU$ÒUVGXX%08/KNGUE  45GJTUEJÌPpXQT\ÒINKEJ

1,5:1



9188





9189 1,5:1

5WKPVJKNCÔ6TGOKUUKU%QTFQDC $CGVKEC I$GKFGTUGKVU$ÒUVGXX%08/KNGUC 8QT\ÒINKEJ




BYZANZ

9190

1,5:1

1,5:1

9191

1,5:1

1,5:1

156)16'0 

6JGQFGTKEJÕ5KNKSWCOKV0COGP#PCUVCUKWU+4CXGPPCI)GRCP\GTVG $ÒUVGTOKV2GTNFKCFGO/QPQITCOO*CJP/+$-TCWUXGTINHH/GVNKEJ 45GJTUEJÌP





Õ5KNKSWCOKV0COGP+WUVKPWU+4CXGPPCI)GRCP\GTVG$ÒUVGTOKV2GTNFKCFGO /QPQITCOO*CJP/+$-TCWU/GVNKEJXCT 5GJTUEJÌP



1,5:1

9192





9193

1,5:1

#VJCNCTKEJ  “ 0WOOK 4QO  I &TCRKGTVG $ÒUVG T OKV *GNO9ÌNHKP N U·WIV   4QOWNWUWPF4GOWU-TCWUXGTIN*CJP/+$XGTIN 6JGQFGTKEJ /GVNKEJXGTINC  5GJTUEJÌP



9KVKIKU  Õ 5KNKSWC 4CXGPPC  I &TCRKGTVG $ÒUVG T OKV &KCFGO+P -TCP\ &0    88+6+%'54':*CJP/+$/GVVNKEJ-TCWU 5GJTUEJÌPXQT\ÒINKEJ



$;<#06+0+5%*'/ª0<'0

9194

$;<#0< 



9195

#PCUVCUKWUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGX XOKV*GNO5RGGTWPF5EJKNF8KEVQTKCUVGJVNOKV.CPIMTGW\FCJKPVGT5VGTP&1%K5GCT  9KP\5EJTÌVNKPIUHGJNGTCWHFGO#XGTUMN)TCHHKVKXQT\ÒINKEJ



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF 5EJKNF8KEVQTKCUVGJVNOKV%JTKUVQITCOOUVCDFCXQT5VGTP&1%E5GCT 5GJTUEJÌP



9196 1,5:1



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF 5EJKNF8KEVQTKCUVGJVNOKV%JTKUVQITCOOUVCDFCXQT5VGTP&1%G5GCT  8QT\ÒINKEJGU2TCEJVGZGORNCT

1,5:1



1,5:1

9197



1,5:1

Ô5QNKFWU6JGUUCNQPKECI)GRCP\GTVG$ÒUVGXXOKV*GNO5EJKNFWPF5RGGT8KEVQTKCUVGJVN OKV.CPIMTGW\KO(GNFNWPFTLGGKP5VGTP&1%XCT*CJP5GCT  8QPITQ­GT5GNVGPJGKV#VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

 313


BYZANZ

9198

9199

9200



Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO8KEVQTKCIGJVTOKV-TCP\ WPF-TGW\INQDWUKO(GNFT5VGTP&1%5GCT 5GJTUEJÌP





+WUVKPWU+Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXX OKV *GNO 5RGGT WPF 5EJKNF'PIGN UVGJV X X OKV -TGW\UVCD WPF -TGW\INQDWU T 5VGTP &1%  F   5GCT -N2T·IGUEJY·EJGCO4CPFXQT\ÒINKEJGU'ZGORNCT



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF 5EJKNF'PIGNUVGJVXXOKV-TGW\UVCDWPF-TGW\INQDWUT5VGTP&1% QJPGFKGUG1HHK\KP 5GCT 8QT\ÒINKEJGU2TCEJVGZGORNCT





9203

9201







9202

+WUVKPKCPWU +  Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG   HCUV X X OKV *GNO 5RGGT WPF 5EJKNF'PIGN UVGJV X X OKV -TGW\UVCD WPF -TGW\INQDWU &1%  J   5GCT 5GJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGHCUVXXOKV*GNO5RGGT WPF5EJKNF'PIGNUVGJVXXOKV-TGW\UVCDWPF-TGW\INQDWU&1%K5GCT  -N2T·IGUEJY·EJGUGJTUEJÌP



Õ5KNKSWC  %CTVJCIQ  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO816/8.6*6+ KP   -TCP\&1%5GCT 5GJTUEJÌP



9205

9204

9204



“(QNNKU,CJT  %QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO -TGW\INQDWUWPF5EJKNFT-TGW\9GTV&1%C5GCT  &WPMNG2CVKPCDTGKVGUUGJTUEJÌPGU'ZGORNCT





“(QNNKU4QO&TCRKGTVG$ÒUVGTOKV&KCFGO9GTV&1%5GCT  4)TÒPG2CVKPCUGJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO-TGW\INQ DWUWPF5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%E5GCT )TCHHKVQCWHFGO#XGTUUGJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO-TGW\INQ DWUWPF5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%F5GCT 2T·IGUEJY·EJGCO4CPF&QRRGNUEJNCIIWVGUUGJTUEJÌP



9206



314



9207


BYZANZ

9208









9211

Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO-TGW\INQ DWUWPF5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%G5GCT (CUVXQT\ÒINKEJ



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO-TGW\INQ DWUWPF5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%H5GCT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO-TGW\INQ DWUWPF5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%I5GCT 5GJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO-TGW\INQ DWUWPF5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%K5GCT )WVGUUGJTUEJÌPHCUVXQT\ÒINKEJ



9215

9213

9212



9210

9209

9214

Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV *GNO   -TGW\INQDWUWPF5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%L 5GCT 5GJTUEJÌP



Ô5QNKFWU  %QPUVCPVKPQRQNKU  I )GRCP\GTVG $ÒUVG X X OKV *GNO -TGW\INQDWU WPF   5EJKNF'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWUT5VGTP&1%5GCT  &TWEMUVGNNGCO4CPFMN-TCV\GTCWHFGO#XGTUCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Ô5GOKUUKU %QPUVCPVKPQRQNKU  I &TCRKGTVG $ÒUVG T OKV &KCFGO8KEVQTKC UKV\V T OKV 5EJKNF   FCXQT%JTKUVQITCOO&1%5GCT 5GJTUEJÌP





Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV&KCFGO8KEVQTKCIGJVTOKV-TCP\WPF -TGW\INQDWUT5VGTP&1%5GCT /KPIGYGNNVMN-TCV\GTCWHFGO4GXGTUUGJTUEJÌP





9216 1,5:1



1,5:1

Õ/KNKCTGPUG NGKEJV  6JGUUCNQPKEC  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO-CKUGT UVGJV N OKV   5RGGTWPF5EJKNFT5VGTP&1%*CJP/+$'C5GCT 8QPITÌ­VGT5GNVGPJGKV5GJTUEJÌP  315


BYZANZ

9217

















 316

9219

9220

9221

+WUVKPWU++Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV *GNO8KEVQTKCCWH)NQDWUWPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1% XGTIN QJPGFKGUG1HHK\KP 5GCT  4-N-TCV\GTCWHFGO#XGTUCVVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%C5GCT  8QT\ÒINKEJHCUVXQT\ÒINKEJ



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%D5GCT  &TWEMUVGNNGCO4CPFXQT\ÒINKEJ



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%D5GCT  8QT\ÒINKEJUGJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1% QJPGFKGUG1HHK\KP 5GCT 9KP\-TCV\GTXQT\ÒINKEJ



9222



9218

9223

9224

9225

9226

Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%E5GCT  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%F5GCT  2T·IGUEJY·EJGCO4CPFIWVGUUGJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%F5GCT  )TCHHKVQCWHFGO4GXGTUIWVGUUGJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%H5GCT  )TCHHKVQCWHFGO#XGTUUGJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%I5GCT 8QT\ÒINKEJ




BYZANZ

9227



9228

9229

9230

9231

Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%J5GCT  2T·IGUEJY·EJGCO4CPFXQT\ÒINKEJ





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%J5GCT 5GJTUEJÌP





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWUN5VGTP&1%E5GCT  2T·IGUEJY·EJGCO4CPFXQT\ÒINKEJ



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF 5EJKNF%QPUVCPVKPQRQNKU UKV\V X X OKV <GRVGT WPF -TGW\INQDWU N 5VGTP &1%  QJPG FKGUG   1HHK\KP 5GCT +PVGTGUUCPVG(GJNRT·IWPIIWVGUUGJTUEJÌP





&CU 5VÒEM KUV \YGKOCN IGRT·IV YQTFGP CNNGTFKPIU JCPFGNV GU UKEJ PKEJV WO GKPGP PQTOCNGP &QRRGNUEJNCI FGT   5EJTÌVNKPI YWTFG Y·JTGPF FGU 2T·IGXQTICPIU IGYGPFGV FCJGT YWTFG DGKO \YGKVGP 5EJNCI 4GXGTU CWH #XGTU WPF   #XGTUCWH4GXGTUIGRT·IV



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQ DWUWPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWUN5VGTP&1%G5GCT 2T·IGUEJY·EJGCO4CPF-TCV\GTCWH#XGTUWPF4GXGTUIWVGUUGJTUEJÌP

1,5:1







1,5:1

Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQ DWU WPF 5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWUN-TGW\&1%5GCT 44)WVGUUGJTUEJÌP

9233



9232

9235





9234

Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1% QJPGFKGUG1HHK\KP 5GCT -N&TWEMUVGNNGWPF5EJÒTHURWTCO4CPFXQT\ÒINKEJ



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO8KEVQTKCCWH)NQDWU WPF5EJKNF%QPUVCPVKPQRQNKUUKV\VXXOKV<GRVGTWPF-TGW\INQDWU&1%C5GCT  )TCHHKVKCWHFGO#XGTUIWVGUUGJTUEJÌP



Ô5GOKUUKU %QPUVCPVKPQRQNKU  I &TCRKGTVG $ÒUVG T OKV &KCFGO'PIGN UKV\V T WPF UEJTGKDV CWH   5EJKNFFCXQT%JTKUVQITCOON5VGTP&1%5GCT /KPIGYGNNVUGJTUEJÌP

 317


BYZANZ

9236

ex 9238

ex 9238



Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV&KCFGO8KEVQTKCUVGJVXXOKV-TCP\ WPF-TGW\INQDWUT5VGTP&1%5GCT /KPIGYGNNVUGJTUEJÌP





Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV&KCFGO8KEVQTKCUVGJVXXOKV-TCP\ WPF-TGW\INQDWUT5VGTP&1%5GCT&C\WGKP\YGKVGU'ZGORNCT  5VÒEM/KPIGYGNNVZ)TCHHKVQHCUVUGJTUEJÌP



WPF5QRJKC“(QNNKU,CJT  0KMQOGFKC1HHK\KPI*GTTUEJGTRCCTVJTQPVXX 9GTV&1%F5GCT&C\WGKPCPQP[OGT(QNNKU XQT\ÒINKEJ &1%F5GCT  5VÒEM&WPMNG2CVKPCIWVGUUGJTUEJÌPWPFXQT\ÒINKEJ





9239



9240

9241

9242

6KDGTKWU++%QPUVCPVKPWUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP \GTVG $ÒUVG X X OKV -TQPG -TGW\INQDWU WPF 5EJKNF-TGW\ CWH XKGT 5VWHGP &1%  D 5GCT    2T·IGUEJY·EJGCO4CPFHCUVXQT\ÒINKEJ





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%D5GCT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%E5GCT (CUVXQT\ÒINKEJ





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%G5GCT (CUVXQT\ÒINKEJ



9243

9244

9245

9246



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%I5GCT 8QT\ÒINKEJ





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%I5GCT 8QT\ÒINKEJ





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%J5GCT 2T·IGUEJY·EJGCO4CPFHCUVXQT\ÒINKEJ





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%K5GCT  2T·IGUEJY·EJGCO4CPFHCUVXQT\ÒINKEJXQT\ÒINKEJ



318


BYZANZ

9247



9248

9249

9250

Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV-TQPG-TGW\INQ DWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%K5GCT  2T·IGUEJY·EJGCO4CPFHCUVXQT\ÒINKEJ





Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV -TQPG   -TGW\INQDWUWPF5EJKNF-TGW\CWHXKGT5VWHGP&1%L5GCT 5GJTUEJÌP





/CWTKEKWU 6KDGTKWU  Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG   $ÒUVG X X OKV *GNO WPF -TGW\INQDWU'PIGN UVGJV X X OKV %JTKUVQITCOOUVCD WPF -TGW\INQDWU   &1%D5GCT 45GJTUEJÌP



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNOWPF-TGW\ INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%D5GCT  4&TWEMUVGNNGCO4CPFUQPUVHCUVXQT\ÒINKEJ





9251



9252

9253

Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV *GNO WPF   -TGW\INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%H5GCT  'VYCUXGTRT·IVUQPUVXQT\ÒINKEJ





Ô5GOKUUKU  %QPUVCPVKPQRQNKU  I &TCRKGTVG $ÒUVG T OKV 2GTNFKCFGO8KEVQTKC IGJV T   OKV-TGW\INQDWUWPF-TCP\&1%C5GCT 4.GKEJVIGYGNNVUGJTUEJÌP





Ô5QNKFWU6JGQWRQNKU #PVKQEJKC 1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNOWPF-TGW\INQ DWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1% QJPGFKGUG1HHK\KP 5GCT 5GJTUEJÌP



9254





9255

Ô5QNKFWU6JGQWRQNKU #PVKQEJKC 1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNOWPF-TGW\INQ DWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%G5GCT  2T·IGUEJY·EJGCO4CPFMN-TCV\GTHCUVXQT\ÒINKEJ



Ô5QNKFWU \W  5KNKSWCG 6JGQWRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV *GNO WPF   -TGW\INQDWU T 5VGTP'PIGN UVGJV X X OKV %JTKUVQITCOOUVCD WPF -TGW\INQDWU T 5VGTP &1%   

QJPGFKGUG1HHK\KP 5GCT )WVGUUGJTUEJÌP

 319


BYZANZ

9256

9257 9256 1,5:1





2JQECUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI-QPUWNCTDÒUVGXXOKV/CRRC WPF -TGW\ CWH )NQDWU'PIGN UVGJV X X OKV %JTKUVQITCOOUVCD WPF -TGW\INQDWU &1%  QJPGFKGUG 1HHK\KP 5GCT 445GJTUEJÌP



Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV -TQPG WPF   -TGW\INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%,5GCT  -N2T·IGUEJY·EJGP)TCHHKVQCWHFGO#XGTUHCUVXQT\ÒINKEJ



9258

1,5:1



1,5:1

Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO-TGW\&1% 5GCT &TWEMUVGNNGCO4CPFUQPUVHCUVXQT\ÒINKEJ

9259

9260

9261



9262



Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV2GTNFKCFGO-TGW\&1% 5GCT .GKEJVIGYGNNVUGJTUEJÌP





Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV -TQPG WPF   -TGW\INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%G5GCT  8QT\ÒINKEJ



Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV -TQPG WPF   -TGW\INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%G5GCT  -N-TCV\GTUGJTUEJÌP



Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV -TQPG WPF   -TGW\INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%K5GCT  8QT\ÒINKEJ







9263





320

9264

Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV -TQPG WPF   -TGW\INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%K5GCT  5GJTUEJÌP



Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV -TQPG WPF   -TGW\INQDWU'PIGNUVGJVXXOKV%JTKUVQITCOOUVCDWPF-TGW\INQDWU&1%L5GCT  (CUVXQT\ÒINKEJ




BYZANZ

9265

9266

9267



*GTCENKWU  Ô6TGOKUUKU  %QPUVCPVKPQRQNKU  1HHK\KP  I &TCRKGTVG $ÒUVG T   OKV&KCFGO-TGW\&1%E5GCT )GYGNNVHCUVUGJTUEJÌP





WPF*GTCENKWU%QPUVCPVKPWUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$Ò UVGPXX-TGW\CWHFTGK5VWHGPKO(GNF0&1%C5GCT 2T·IGUEJY·EJGPUGJTUEJÌP





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$ÒUVGPXX-TGW\CWHFTGK5VWHGP &1%F5GCT 5GJTUEJÌP



9269

9268

ex 9271

9270



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$ÒUVGPXX-TGW\CWHFTGK5VWHGP &1%F5GCT -TCV\GTUGJTUEJÌP





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$ÒUVGPXX-TGW\CWHFTGK5VWHGPT +&1%F5GCT 5GJTUEJÌP





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$ÒUVGPXX-TGW\CWHFTGK5VWHGPT +&1%F5GCT -N-TCV\GT2T·IGUEJY·EJGCO4CPFUGJTUEJÌP





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$ÒUVGPXX-TGW\CWHFTGK5VWHGP &1%C5GCT&C\W4QOCPWU+8*KUVCOGPQP UVCTMDGUEJPKVVGPWPFCDIGHNCEJV&1%5GCT  5VÒEM(CUVUGJTUEJÌP



1,5:1



9272

1,5:1

 OKV *GTCENKWU %QPUVCPVKPWU WPF /CTVKPC Õ 5KNKSWC  -CTVJCIQ  I &TCRKGTVG   $ÒUVGOKV-TQPGXX$GKFGT$ÒUVGPOKV-TQPGXXFC\YKUEJGP-TGW\&1%5GCT  (CUVUGJTUEJÌP

9273

9274



9275



*GTCENKWU%QPUVCPVKPWUWPF*GTCENQPCUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI &TGK-CKUGTXQPXQTP-TGW\CWHFTGK5VWHGP&1%I5GCT )WVGUUGJTUEJÌP





%QPUVCPU++Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI&TCRKGTVG$ÒUVGXX OKV-TQPGWPF-TGW\INQDWU-TGW\CWHFTGK5VWHGP&1% *GTCENQPCUQJPGFKGUG1HHK\KP 5GCT 2T·IGUEJY·EJGPUQPUVIWVGUUGJTUEJÌP



Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I &TCRKGTVG $ÒUVG X X OKV -TQPG WPF   -TGW\INQDWU-TGW\CWHFTGK5VWHGP&1%K5GCT 2T·IGUEJY·EJGPXQT\ÒINKEJ





'ZGORNCTFGT5COONWPI9KNNKCO*GTDGTV*WPV#WMVKQP5QVJGD[ U0GY;QTMXQO0T

321


BYZANZ

9277

9276



Õ*GZCITCOO%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGXXOKV-TQPGWPF-TGW\INQDWU -TGW\CWH)NQDWUÒDGTFTGK5VWHGP&1%5GCT 5VCTMG2T·IGUEJY·EJGPCO4CPFUGJTUEJÌP





WPF%QPUVCPVKPWU+8Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$ÒUVGPXX FCTÒDGT-TGW\-TGW\CWHFTGK5VWHGP&1%G5GCT 2T·IGUEJY·EJGCO4CPFXQT\ÒINKEJ



1,5:1



1,5:1

9278

OKV%QPUVCPVKPWU+8*GTCENKWUWPF6KDGTKWUÔ5QNKFWU%CTVJCIQI$GKFGT$Ò UVGPXX-TGW\CWH\YGK5VWHGP\YKUEJGP\YGK2TKP\GP&1%5GCT 45GJTUEJÌP

9279

9280

9281



9282



Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI$GKFGT$ÒUVGPXX-TGW\CWHFTGK5VWHGP \YKUEJGP\YGK2TKP\GP&1%G5GCT -N-TCV\GTUGJTUEJÌP





%QPUVCPVKPWU +8  Ô5GOKUUKU %QPUVCPVKPQRQNKU  I &TCRKGTVG $ÒUVG T OKV &KCFGO   -TGW\CWH)NQDWU&1%5GCT -NGKPG(NGEMGPUGJTUEJÌP





Ô6TGOKUUKU%QPUVCPVKPQRQNKUI&TCRKGTVG$ÒUVGTOKV&KCFGO-TGW\&1%5GCT  &TWEMUVGNNGUGJTUEJÌP





OKV*GTCENKWUWPF6KDGTKWUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG $ÒUVGXXOKV*GNO5RGGTWPF5EJKNF-TGW\CWHFTGK5VWHGP\YKUEJGP\YGK2TKP\GP&1% 1HHK\KP HGJNV 5GCT 5GJTUEJÌP

ex 9283



9284

9285

1,5:1



1,5:1

Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF 5EJKNF-TGW\CWHFTGK5VWHGP\YKUEJGP\YGK2TKP\GP&1%E5GCT&C\W*GTCENKWUWPF*GT CENKWU%QPUVCPVKPWUÔ5QNKFWU 5GCT WPF%QPUVCPVKPWU+8Ô5GOKUUKU 5GCT   5VÒEM5GJTUEJÌP





Ô5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GRCP\GTVG$ÒUVGXXOKV*GNO5RGGTWPF 5EJKNF-TGW\CWHFTGK5VWHGP\YKUEJGP\YGK2TKP\GP&1%F5GCT )WVGUUGJTUEJÌP





+WUVKPKCPWU ++  4GIKGTWPI  Ô5QNKFWU  %QPUVCPVKPQRQNKU  1HHK\KP  I   $ÒUVG%JTKUVKXX-CKUGTUVGJVXXOKV-TGW\CWH\YGK5VWHGPWPF#MCMKC&1%I5GCT  442T·IGUEJY·EJGCO4CPFFGPPQEJUGJTCVVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT  &KGGTUVG%JTKUVWUFCTUVGNNWPICWHGKPGT/ÒP\G

322


BYZANZ

1,5:1



9286

1,5:1

6KDGTKWU +++  Ô5QNKFWU %QPUVCPVKPQRQNKU  1HHK\KP  I )GRCP\GTVG $ÒUVG X X OKV   -TQPG5RGGTWPF5EJKNF-TGW\CWHFTGK5VWHGP&1%G5GCT  42T·IGUEJY·EJGCO4CPFXQT\ÒINKEJ



 DGINGKVGVG #RUKOCTQU FGP 2CVTKMKQU,QJCPPGUFGTFCUXQO-CNKRJGP#DFCN/CNKMGTQDGTVG0QTFCHTKMC\WTÒEM IGYKPPGP UQNNVG 0CEJ FGT 'TOQTFWPI FGU ,QJCPPGU YWTFG #RUKOCTQU CNU 6KDGTKWU +++ \WO -CKUGT CWUIGTWHGP 'T   DTCEJFGP(GNF\WICDMGJTVGPCEJ%QPUVCPVKPQRQNKU\WTÒEMDGNCIGTVGFKG*CWRUVCFVWPFMQPPVG.GQPVKWUCDUGV \GPMGJTVG+WUVKPKCPWU++CPFKG/CEJV\WTÒEMWPFNKG­.GQPVKWUWPF6KDGTKWU+++JKPTKEJVGP

1,5:1



9287

1,5:1

+WUVKPKCPWU ++  WPF 6KDGTKWU Ô5QNKFWU %QPUVCPVKPQRQNKU  I $ÒUVG %JTKUVK X X   $GKFGT$ÒUVGPXXOKV-TGW\CWH\YGK5VWHGP&1%D5GCT  2T·IGUEJY·EJGCO4CPFXQT\ÒINKEJ  'ZGORNCTFGT#WMVKQP$CPMJCWU#WHJ·WUGT/ÒPEJGP0T

1,5:1



9288

1,5:1

2JKNKRRKEWUÔ5QNKFWU%QPUVCPVKPQRQNKU1HHK\KPI)GMTÌPVG$ÒUVGXXKO.QTQU OKV-TGW\INQDWUWPF#FNGT\GRVGT-TGW\CWHFTGK5VWHGP&1%G5GCT  42T·IGUEJY·EJGIWVGUUGJTUEJÌPHCUVXQT\ÒINKEJ



2JKNKRRKEWUYWTFGGKPKIG/QPCVGXQTFGT'TOQTFWPIFGU+WUVKPKCPWU++KP%JGTUQPGUUQU\WO-CKUGTCWUIGTWHGP'T YCT GKP #PJ·PIGT FGU /QPQVGNGVKUOWU GKPGT EJTKUVQNQIKUEJGP .GJTG PCEJ FGT %JTKUVWU \YGK 0CVWTGP CDGT PWT   GKPGP9KNNGPJCV&KG2TQRCIKGTWPIFKGUGT.GJTGFKGCWHFGO-QP\KNXQP%QPUVCPVKPQRQNKUCNU*·TGUKGXGT WTVGKNV YQTFGP YCT DGUEJYQT PGWGP TGNKIKÌUGP 7PHTKGFGP JGTCWH 2CRUV %QPUVCPVKP   YGKIGTVG UKEJ FGP   PGWGP-CKUGTCP\WGTMGPPGP#O,WPKYWTFG2JKNKRRKEWUCDIGUGV\VIGDNGPFGVWPFKPU'ZKNIGUEJKEMV#O ,CPWCTUVCTDFGT'ZMCKUGTUGKP)TCDHKPFGVUKEJKO-NQUVGT&CNOCVQK

1,5:1



9289

1,5:1

#PCUVCUKWU ++ #TVGOKWU  Ô5QNKFWU %QPUVCPVKPQRQNKU  1HHK\KP  I $ÒUVG X X OKV   -TGW\INQDWUWPF#MCMKC-TGW\CWHFTGK5VWHGP&1%E5GCT  442T·IGUEJY·EJGCO4CPFYKP\-TCV\GTHCUVXQT\ÒINKEJ  #O,WPKYWTFG2JKNKRRKEWUXQP#PJ·PIGTPFGU#PCUVCUKWU++IGDNGPFGVWPFKPU'ZKNIGUEJKEMV#OHQNIGPFGP 6CIDGUVKGI#PCUVCUKWU++FGP6JTQP<YGKCPFGT#DUGV\WPIFGU2JKNKRRKEWUOC­IGDNKEJDGVGKNKIVG/·PPGT6JGQ FQTQU /[CEGU WPF )GQTIKQU $QWTCRJWU NKG­ FGT PGWG -CKUGT MWT\ FCTCWH GDGPHCNNU DNGPFGP WPF KPU 'ZKN UEJKEMGP   #PCUVCUKWU++XGTUV·TMVGFKG$GHGUVKIWPIGPFGT*CWRVUVCFVWPFIKPIIGIGPFKG$GFTQJWPIFWTEJFKG#TCDGTXQT&KG 5QNFCVGPGKPGTXQPKJOKP4JQFQUUVCVKQPKGTVGP(NQVVGTGDGNNKGTVGPUEJNKG­NKEJWPF\YCPIGPKJP\WT#DFCPMWPI XGTUWEJVGGTOKVDWNICTKUEJGT7PVGTUVÒV\WPIXGTIGDNKEJFKG/CEJV\WTÒEM\WIGYKPPGPWPFYWTFGGPVJCWRVGV

323


BYZANZ

1,5:1



9290

1,5:1

.GQ +++  WPF %QPUVCPVKPWU 8 Ô5GOKUUKU  %QPUVCPVKPQRQNKU  I &TCRKGTVG   $ÒUVGXXOKV-TQPG-TGW\INQDWUWPF#MCMKC&TCRKGTVG$ÒUVGXXOKV-TQPG-TGW\WPF#MCMKC &1%5GCT 44/KPIGYGNNVUGJTUEJÌP

9292

9291



9293

9294

9294



%QPUVCPVKPWU8WPF.GQ+8Ô5QNKFWU%QPUVCPVKPQRQNKUI$GKFGT$ÒUVGP XX$ÒUVG.GQU+++XXOKV-TGW\&1%F5GCT 5GJTUEJÌP





/KEJCGN +  WPF 6JGQRJ[NCEVWU Õ/KNKCTGUKQP %QPUVCPVKPQRQNKU  I -TGW\ CWH FTGK   5VWHGP(ÒPH<GKNGP5EJTKHV&1%5GCT 4CPFHGJNGTIWVGUUGJTUEJÌP





.GQ 8  Õ/KNKCTGUKQP %QPUVCPVKPQRQNKU  I -TGW\ CWH FTGK 5VWHGP(ÒPH <GKNGP   5EJTKHV&1%5GCT 5GJTUEJÌP





/KEJCGN++WPF6JGQRJKNWU“(QNNKU%QPUVCPVKPQRQNKUI$GKFGT$ÒUVGPX X9GTV&1%5GCT )TÒPG2CVKPCUGJTUEJÌP



1,5:1



1,5:1

6JGQRJKNWU  Ô5QNKFWU  5[TCMWU  I &TCRKGTVG $ÒUVG X X OKV -TGW\ WPF   -TQPG&TCRKGTVG$ÒUVGXXOKV-TGW\INQDWUWPF-TQPG&1%5GCT 8QT\ÒINKEJ

9296



9295

9298



9297

OKV%QPUVCPVKPWUWPF/KEJCGN+++Ô5QNKFWU%QPUVCPVKPQRQNKUI$ÒUVGXXOKV 2CVTKCTEJGPMTGW\WPF#MCMKCN5VGTP<YGK$ÒUVGPXXQDGP-TGW\&1%F5GCT  5GJTUEJÌP





Ô5QNKFWU%QPUVCPVKPQRQNKUI$ÒUVGXXOKV2CVTKCTEJGPMTGW\WPF#MCMKCN5VGTP <YGK$ÒUVGPXXQDGP-TGW\&1%F5GCT 5GJTUEJÌP





/KEJCGN +++  Õ/KNKCTGUKQP  %QPUVCPVKPQRQNKU  I -TGW\ CWH FTGK 5VWHGP   (ÒPH<GKNGP5EJTKHV&1%5GCT )WVGUUGJTUEJÌP



324


BYZANZ

9299

1,5:1



1,5:1

$CUKNKWU+WPF%QPUVCPVKPWUÔ5QNKFWU%QPUVCPVKPQRQNKUI%JTKUVWUVJTQPV XX$GKFGT$ÒUVGPXXOKV2CVTKCTEJGPMTGW\&1%5GCT  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT

9300



9301



.GQ 8+  “(QNNKU %QPUVCPVKPQRQNKU  I &TCRKGTVG $ÒUVG X X OKV -TQPG WPF #MCMKC   8KGT<GKNGP5EJTKHV&1%5GCT 5GJTUEJÌP





%QPUVCPVKPWU8++WPF<QG“(QNNKU%QPUVCPVKPQRQNKUI$GKFGT$ÒUVGPX XOKV2CVTKCTEJGPMTGW\(ÒPH<GKNGP5EJTKHV&1%5GCT 5GJTUEJÌP



9302

9303 9303 1,5:1



WPF4QOCPWU++Ô5QNKFWU%QPUVCPVKPQRQNKUI$ÒUVG%JTKUVKXX$GKFGT$ÒUVGP XXOKV2CVTKCTEJGPMTGW\&1%5GCT 5GJTUEJÌPpXQT\ÒINKEJ





0KEGRJQTWU ++  Ô6GVCTVGTQP %QPUVCPVKPQRQNKU  I $ÒUVG %JTKUVK X X$ÒUVGP FGT   /WVVGTIQVVGUWPFFGU-CKUGTUXXOKV2CVTKCTEJGPMTGW\&1%5GCT 45GJTUEJÌP



9304

9305

9306

9307



Õ/KNKCTGUKQP%QPUVCPVKPQRQNKUI/GFCKNNQPDÒUVGCWH-TGW\5EJTKHV&1%5GCT  4CPFCWUDTWEJUGJTUEJÌP



$CUKNKWU ++  WPF %QPUVCPVKPWU 8+++ Ô*KUVCOGPQP  %QPUVCPVKPQRQNKU  I   $ÒUVG%JTKUVKXX$GKFGT$ÒUVGPXXOKV2CVTKCTEJGPMTGW\&1%L5GCT  -N4CPFHGJNGTMN-TCV\GTIWVGUUGJTUEJÌP





Õ/KNKCTGUKQP  %QPUVCPVKPQRQNKU  I $GKFGT $ÒUVGP X X FC\YKUEJGP -TGW\(ÒPH   <GKNGP5EJTKHV&1%5GCT (CUVUGJTUEJÌP





Ô*KUVCOGPQP  %QPUVCPVKPQRQNKU  I $ÒUVG %JTKUVK X X$GKFGT $ÒUVGP X X OKV   -TGW\&1%5GCT -TCV\GTCWHFGO4GXGTUUGJTUEJÌP





325


BYZANZ

9308

9310

9310

9309



Ô6GVCTVGTQP%QPUVCPVKPQRQNKUI$ÒUVG%JTKUVKXX$GKFGT$ÒUVGPXXOKV2CVTK CTEJGPMTGW\&1%D5GCT 5GJTUEJÌP





4QOCPWU +++  Ô*KUVCOGPQP %QPUVCPVKPQRQNKU  I %JTKUVWU VJTQPV X X/CTKC   MTÌPV-CKUGT&1%F5GCT 5GJTUEJÌP





%QPUVCPVKPWU+:Ô*KUVCOGPQP 5E[RJCV %QPUVCPVKPQRQNKUI%JTKUVWUVJTQPVXX $ÒUVGXXOKV-TGW\\GRVGTWPF)NQDWUOKV2CVTKCTEJGPMTGW\&1%C5GCT (CUVXQT\ÒINKEJ



9311 1,5:1



1,5:1

6JGQFQTC  Ô*KUVCOGPQP %QPUVCPVKPQRQNKU  I %JTKUVWU UVGJV X X-CKUGTKP WPF   /CTKCJCNVGP.CDCTWO&1%C5GCT -N5EJTÌVNKPIUTK­HCUVXQT\ÒINKEJ  <W $GIKPP FGT 4GIKGTWPI FGU 4QOCPWU +++ YWTFG 6JGQFQTC GKPG 6QEJVGT FGU %QPUVCPVKPWU 8+++ OKV GKPGT 8GT   UEJYÌTWPI KP 8GTDKPFWPI IGDTCEJV WPF IG\YWPIGP KP FCU 2GVTKQP-NQUVGT KP %QPUVCPVKPQRQNKU GKP\WVTGVGP +O   4CJOGP GKPGU #WHUVCPFGU IGIGP /KEJCGN 8 YWTFG UKG CO  #RTKN  \WT -CKUGTKP IGMTÌPV WPF TGIKGTVG OKV   KJTGT5EJYGUVGT<QGDKUFKGUG%QPUVCPVKPWU+:JGKTCVGVG0CEJFGO6QFFGU%QPUVCPVKPWU+:ICDGU\WP·EJUV $GUVTGDWPIGPFGTGPIUVGP/KVCTDGKVGTFGU-CKUGTUFGP/KNKV·TIQWXGTPGWTXQP$WNICTKGP0KMGRJQTQU2TQVGWQP\WO -CKUGT \W RTQMNCOKGTGP GU IGNCPI GPIGP 8GTVTCWVGP 6JGQFQTCU LGFQEJ UKG \WXQT \WO 2CNCUV \W DTKPIGP YQ UKG    DGTGKVUÒDGT,CJTGCNVXQPFGT.GKDICTFGWPFFGP5GPCVQTGPGTPGWV\WT-CKUGTKPCWUIGTWHGPYWTFGUVCTD 6JGQFQTCFGTGP4GIKGTWPIXQPFGPD[\CPVKPKUEJGP*KUVQTKMGTP2UGNNQUWPF<QPCTCUCWUFTÒEMNKEJIGNQDVYWTFGCP GKPGT&CTOMTCPMJGKVPCEJFGOUKGCWHFGO6QVGPDGVVPQEJFGPITGKUGP/KEJCGN5VTCVKQVKMQU\WO0CEJHQNIGTGTPCPPV JCVVG

9312



%QPUVCPVKPWU:Ô*KUVCOGPQP 5E[RJCV %QPUVCPVKPQRQNKUI%JTKUVWUVJTQPVXX -CKUGTUVGJVXXOKV.CDCTWOWPF-TGW\INQDWU&1%5GCT )WVGUUGJTUEJÌP

1,5:1

 326

9313



1,5:1

Ô6GVCTVGTQP%QPUVCPVKPQRQNKUI$ÒUVGFGT/WVVGTIQVVGUQTCPUXX&TCRKGTVG$ÒUVGXXOKV -TQPG-TGW\INQDWUWPF#MCMKC&1%5GCT 45GJTUEJÌPHCUVXQT\ÒINKEJ




BYZANZ

9314

9316

9315



Ô6GVCTVGTQP%QPUVCPVKPQRQNKUI$ÒUVGFGT/WVVGTIQVVGUQTCPUXX&TCRKGTVG$ÒUVGXXOKV -TQPG-TGW\INQDWUWPF#MCMKC&1%5GCT 4)GUVQRHVGU.QEJHCUVUGJTUEJÌP





4QOCPWU+8OKV/KEJCGN8++%QPUVCPVKWUWPF#PFTQPKEWUÔ*KUVCOGPQP 5E[RJCV  %QPUVCPVKPQRQNKUI%JTKUVWUMTÌPV-CKUGTRCCT2TKP\GPUVGJGPXX&1%5GCT  #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



WPF'WFQEKCÔ6GVCTVGTQP%QPUVCPVKPQRQNKUI$TWUVDKNFFGT/WVVGTIQVVGUXXXQTFGT$TWUV PKODKGTVGT%JTKUVWUMQRH*ÒHVDKNFGTFGU-CKUGTUWPFFGT-CKUGTKPXXOKV-TGW\CWH)NQDWU&1% 5GCT 445GJTUEJÌP





9319

9318

9317

ex 9320



/KEJCGN 8++  Ô*KUVCOGPQP 5E[RJCV  %QPUVCPVKPQRQNKU  I $ÒUVG %JTKUVK X X   $ÒUVGXXOKV.CDCTWOWPF-TGW\INQDWU&1%5GCT 5GJTUEJÌP





Ô*KUVCOGPQP 5E[RJCV %QPUVCPVKPQRQNKUI$ÒUVG%JTKUVKXX$ÒUVGXXOKV.CDCTWOWPF -TGW\INQDWU&1%5GCT 5GJTUEJÌP





Ô*KUVCOGPQP 5E[RJCV %QPUVCPVKPQRQNKUI$ÒUVG%JTKUVKXX$ÒUVGXXOKV.CDCTWOWPF -TGW\INQDWU&1%5GCT 5GJTUEJÌP





Ô*KUVCOGPQP 5E[RJCV %QPUVCPVKPQRQNKUI$ÒUVG%JTKUVKXX$ÒUVGXXOKV.CDCTWOWPF -TGW\INQDWU&1%5GCT&C\W+WUVKPWU++5QNKFWU 5GCT *GTCENKWUWPF*GTCENKWU%QP UVCPVKPWU5QNKFWU 5GCT  5VÒEM5GJTUEJÌPGKP5VÒEMOKV&QRRGNUEJNCIWPF*GPMGNURWT



9321

9322

9323



Õ/KNKCTGUKQP %QPUVCPVKPQRQNKU  I /WVVGTIQVVGU UVGJV QTCPU X X-CKUGT UVGJV X X OKV -TGW\   WPF5EJYGTVKP5EJGKFG&1%C5GCT 445GJTUEJÌP





0KEGRJQTWU +++  'N*KUVCOGPQP %QPUVCPVKPQRQNKU  I $ÒUVG %JTKUVK X X$TWUVDKNF   XXOKV-TGW\WPF-TGW\INQDWU&1%5GCT 5GJTUEJÌPpXQT\ÒINKEJ





'N*KUVCOGPQP 5E[RJCV  %QPUVCPVKPQRQNKU  I %JTKUVWU VJTQPV X X-CKUGT UVGJV X X OKV .C   DCTWOWPF-TGW\INQDWU&1%5GCT $GUEJPKVVGPHCUVUGJTUEJÌP

 327


BYZANZ

9324

9325



#NGZKWU+Ô*[RGTR[TQP 5E[RJCV 6JGUUCNQPKECI%JTKUVWUVJTQPVXX -CKUGTUVGJVXXOKV.CDCTWOWPF-TGW\INQDWU&1%J5GCT (CUVXQT\ÒINKEJ





/CPWGN +  'N#URTQP 6TCEJ[ 5E[RJCV   %QPUVCPVKPQRQNKU  I %JTKUVWU   VJTQPVXX-CKUGTWPF/CTKCUVGJGPXXOKV2CVTKCTEJGPMTGW\&1%C5GCT  #VVTCMVKXGU'ZGORNCTUGJTUEJÌP



9326

9327



'N#URTQP6TCEJ[ 5E[RJCV %QPUVCPVKPQRQNKUI$ÒUVG%JTKUVKXX-CKUGTUVGJVXX OKV.CDCTWOWPF#MCMKC&1%D5GCT .GKEJVIGYGNNVUGJTUEJÌP





Ô*[RGTR[TQP 5E[RJCV  6JGUUCNQPKEC  I $ÒUVG %JTKUVK X X-CKUGT UVGJV X X OKV .CDCTWO   WPF-TGW\INQDWU&1%H5GCT 8QPITQ­GT5GNVGPJGKV)GYGNNVUGJTUEJÌP



9328





+UCCMKQU-QOPGPQU7UWTRCVQTKP<[RGTP$6TCEJ[ ! 0KEQUKC ! I /WVVGTIQVVGUUKV\VXXCWHFGT$TWUV-QRH%JTKUVKOKV0KODWU-CKUGTOKV/CRRCWPF5V)GQTIOKV 5EJYGTVUVGJGPXXOKV2CVTKCTEJGPMTGW\&1%5GCT 442T·IGUEJY·EJGPHCUVUGJTUEJÌP



+UCCMKQU++#PIGNQUÔ*[RGTR[TQP 5E[RJCV %QPUVCPVKPQRQNKUI/CTKCVJTQPVXX -CKUGT OKV -TGW\\GRVGT WPF 'T\GPIGN /KEJCGN UVGJGP X X WPF JCNVGP 5EJYGTV &1%  F 5GCT    45GJTUEJÌPHCUVXQT\ÒINKEJ



9330





9329

9331

'N6TCEJ[ 5E[RJCV  %QPUVCPVKPQRQNKU  I /CTKC VJTQPV X X-CKUGT UVGJV X X OKV -TGW\\GRVGT   WPF#MCMKCWPFYKTFXQO'T\GPIGN/KEJCGNIGMTÌPV&1%C5GCT  -N2T·IGUEJY·EJGPHCUVXQT\ÒINKEJ



#NGZKQU+++Ô*[RGTR[TQP 5E[RJCV %QPUVCPVKPQRQNKUI%JTKUVWUUVGJV X X-CKUGT WPF 5V %QPUVCPVKPWU UVGJGP X X WPF JCNVGP 2CVTKCTEJGPMTGW\ &1%  D 5GCT    5GJTUEJÌPpXQT\ÒINKEJ



#NGZKQU+++OW­VGPCEJGKPGTYQEJGPNCPIGP$GNCIGTWPIFWTEJFCU*GGTFGU-TGW\\WIGUWPVGT(ÒJTWPIFGT 8GPG\KCPGT%QPUVCPVKPQRGNXGTNCUUGP'UMCO\WO+PVGTOG\\QFGU.CVGKPKUEJGP-CKUGTTGKEJGU

328


BYZANZ

9332





/KEJCGN 8+++  Ô*[RGTR[TQP %QPUVCPVKPQRQNKU  I /CTKC KP /CWGTTKPI-CKUGT   MPKGVXQT%JTKUVWUFCJKPVGT5V/KEJCGN$GPFCNN2TKXCVG%QNNGEVKQP 5KINQP &1%5GCT  7PIGYÌJPNKEJIWVCWUIGRT·IVGU'ZGORNCTUGJTUEJÌPXQT\ÒINKEJ



Ô*[RGTR[TQP%QPUVCPVKPQRQNKUI/CTKCKP/CWGTTKPI-CKUGTMPKGVXQT%JTKUVWUFCJKPVGT5V /KEJCGN$GPFCNN2TKXCVG%QNNGEVKQP 5KINCWPMGPPVNKEJ &1%HH5GCT  4GXGTUUVCTMÒDGTCTDGKVGVUGJTUEJÌP



9335

9334



9333

9336

9337

#PFTQPKEWU++WPF/KEJCGN+:Ô*[RGTR[TQP 5E[RJCV %QPUVCPVKPQRQNKU I/CTKCKP/CWGTTKPI5KINC2WPMVÒDGTG2WPMVÒDGT/ $GPFCNN2TKXCVG%QNNGEVKQP5KINC  %JTKUVWUMTÌPVDGKFG-CKUGT&1%.2%5GCT 5GJTUEJÌP





Õ$CUKNKMQP%QPUVCPVKPQRQNKUI%JTKUVWUVJTQPVXX<YGK-CKUGTUVGJGPXXOKV .CDCTWO&1%HH.2%5GCT 5GJTUEJÌP





/CPWGN++Õ5VCXTCVQP NGKEJVGT5VCPFCTF2KUVQU5GTKG %QPUVCPVKPQRQNKU /ÒP\UV·VVG QFGT6JGUUCNQPKEC I$ÒUVG%JTKUVKXX$ÒUVGXX$GPFCNN2TKXCVG%QNNGEVKQP

5KINC &1%HH.2%5GCT 5GJTUEJÌP



&KG 2KUVQU5GTKG KUV PKEJV KP FGT TGIWN·TGP MCKUGTNKEJGP /ÒP\UV·VVG KP %QPUVCPVKPQRQNKU IGRT·IV YQTFGP UQPFGTP   GPVYGFGT KP GKPGT \YGKVGP /ÒP\UV·VVG KP %QPUVCPVKPQRQNKU YQ OÌINKEJGTYGKUG -CWHNGWVG /ÒP\GP RT·IGP NCUUGP   MQPPVGP QFGTKP6JGUUCNQPKEC



,QJCPPGU 8+++  Õ5VCXTCVQP %QPUVCPVKPQRQNKU  I $ÒUVG %JTKUVK X X$ÒUVG X X   $GPFCNN2TKXCVG%QNNGEVKQP 5KINC &1%H.2%5GCT 5GJTUEJÌP

9338

1,5:1



9338

&#5.#6'+0+5%*'-#+5'44'+%*810%1056#06+012'. 

$CNFWKP++XQP%QWTVGPC[Ô*[RGTRGTQP 5E[RJCV PCEJ6[RFGT*[RGTRGTCFGU,QJCP PGU+++&WMCU8CVCV\GUX%QPUVCPVKPQRQNKUI%JTKUVWUVJTQPVXXTÒDGTFGO6JTQPXKGT2WPMVG /CTKCMTÌPV-CKUGT&1%H/GVECNHwXGTIN5H5GCT  442T·IGUEJY·EJGPMN-TCV\GTCWHFGO4GXGTUUGJTUEJÌP



'ZGORNCTFGT#WMVKQP(TKV\4WFQNH-ÒPMGT1UPCDTÒEM0T  #WHITWPFFGTXGTVTCINKEJGP8GTGKPDCTWPIGP\YKUEJGPFGO-CKUGTTGKEJ0KMCKCWPFFGO.CVGKPKUEJGP-CKUGTTGKEJXQP %QPUVCPVKPQRGN YCT GU DGKFGP 5GKVGP WPVGTUCIV /ÒP\GP FGU LGYGKNU CPFGTGP 5VCCVGU PCEJ\WRT·IGP $CNFWKP ++ XQP   %QWTVGPC[ DTCEJ FKGUGP 8GTVTCI WPF NKG­ *[RGTRGTC OKV 0COGP WPF 6[R FGU ,QJCPPGU +++ &WMCU8CVCV\GU XQP   0KMCKCRT·IGP9KTMÌPPGPFCPMFGT24#6+%#&'..#/'4%#674+# GPVUVCPFGPWO FGU(NQTGPVKPKUEJGP -CWHOCPPU(TCPEGUEQ$CNFWEEK2GIQNQVVKFKG2T·IWPIGPFGT.CVGKPGTKFGPVKHK\KGTGPFC2GIQNQVVKKPUGKPGO*CPFDWEJ HÒT -CWHNGWVG FKG XQP FGP .CVGKPGTP XGTYGPFGVGP 5KINC CPHÒJTV YKG KO XQTNKGIGPFGP (CNN FKG )TWRRG XQP XKGT   2WPMVGP JGTCNFKUEJ NKPMUCNUQXQO$GVTCEJVGTIGUGJGPTGEJVUÒDGTFGO6JTQP

329


TRAPEZUNT

9339

9339 1,5:1

0+%#'# 

6JGQFQTQU + -QOPGPQU .CUMCTKU  Õ6TCEJ[  /CIPGUKC  I %JTKUVWU   VJTQPVXX-CKUGTOKV5EJYGTVWPF5V6JGQFQTUVGJGPXXWPFJCNVGP5VGTP\GRVGT&1%5GCT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



9340



,QJCPPGU+++Ô*[RGTRGTQP 5E[RJCV /CIPGUKCI%JTKUVWUVJTQPVX X/CTKCMTÌPV-CKUGT&1%5GCT -N-TCV\GTCO4CPFOKPIGYGNNVHCUVXQT\ÒINKEJ



9341

64#2'<706 

/CPWGN +  Õ#URGT  I 5V 'WIGPKWU UVGJV X X OKV -TGW\-CKUGT UVGJV X X OKV   .CDCTWOWPF#MCMKC4GVQYUMK5GCT 5GJTUEJÌP

1,5:1



9342



1,5:1

/CPWGN +++Õ#URGTI5V'WIGPKWU\W2HGTFGNOKV-TGW\-CKUGT\W2HGTFGT OKV<GRVGT4GVQYUMK5GCT 5GJTUEJÌP



.165 

$[\CPVKPKUEJGÔ5QNKFK+WUVKPKCPWU+5GCT Z +WUVKPWU++5GCT Z 6KDGTKWU++%QP UVCPVKPWU5GCT Z +PVGTGUUCPVGU.QVDKVVGWPDGFKPIVDGUKEJVKIGP 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





$[\CPVKPKUEJGÔ5QNKFK+WUVKPKCPWU+5GCT Z +WUVKPWU++ Z 6KDGTKWU++%QPUVCPVKPWU Z  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ





5COONWPIOGKUVD[\CPVKPKUEJGT/ÒP\GP ÒDGTYKGIGPF(QNNGUWPF6GKNUVÒEMG XQO,CJTJWP FGTV&KGKPVGTGUUCPVG5COONWPIGPVJ·NVOGKUV$TQP\GPCDGTCWEJGKP*GZCITCOO&C\WGKPKIG5R· VTÌOGT WC'WFQZKC WPFGKPDWNICTKUEJGU)GRT·IG&CXKGNG4GIGPVGPWPF0QOKPCNGCWUGKPGONCPIGP <GKVTCWOGPVJCNVGPUKPFKUVFCU1DLGMVJGTXQTTCIGPFCNU)TWPFUVQEMHÒTGKPG5COONWPID[\CPVKPKUEJGT /ÒP\GPCDGTCWEJ\WO#WUDCWGKPGTDGUVGJGPFGP5COONWPIIGGKIPGV$KVVGWPDGFKPIVDGUKEJVKIGP  EC5VÒEM<WO6GKNUGNVGP/GKUVUGJTUEJÌP 

330


ORIENTALEN

-4'7<(#*4'4

9346

,1*#00+6'4#7(4*1&15 

4C[OQPF $¾TGPICT  Õ)KINKCVQ  I )TQ­OGKUVGT MPKGV N XQT 2CVTKCTEJGPMTGW\   -TGW\$GEMGPDCWGTXGTINHH/GVECNHwHH 5GJTUEJÌP

9347



9348

.'8#06+0+5%*'$'+5%*.)' 

Ô<GEEJKPG PCEJ XGPG\KCPKUEJGO 6[R KO 0COGP FGU #PVQPKQ 8GPGTKQ  I (D  XGTIN  E  

%JKQU )CODGTKPKXGTIN %JKQU  5GJTUEJÌP



JPNKEJG 5VÒEMG IKDV GU KP %JKQU &KGUGO YKG CWEJ FGO HQNIGPFGP  5VÒEM HGJNGP LGFQEJ FKG FTGK 2WPMVG FKG FCU   <GKEJGPFGT/ÒP\UV·VVG%JKQUUKPF



Ô<GEEJKPGPCEJXGPG\KCPKUEJGO6[RKO0COGPFGU/KEJGNG5VGPQI(DXGTINF %JKQU  )CODGTKPKXGTIN %JKQU  5GJTUEJÌP





.QVWPDGUVKOOVG$GKUEJN·IG\WXGPG\KCPKUEJGP<GEEJKPGPFGU,CJTJWPFGTVU  5VÒEM(CUVUGJTUEJÌPWPFUGJTUEJÌP



14+'06#.+5%*'/ª0<'0

9351

9350

-75*#0 

/CKQTGU&QOWU'N5VCVGTPCEJI-ÌPKIUVGJVXX)ÌVVKP#TFQMUJQOKV(ÒNNJQTPVJTQPV XX)ÌDN 5GJTUEJÌP





'N5VCVGTPCEJI-ÌPKIUVGJVXX)ÌVVKP#TFQMUJQOKV(ÒNNJQTPVJTQPVXX)ÌDN  5GJTUEJÌP



9352

9353 9353 1,5:1

)726#+0+0&+'0 

5COWFTCIWRVC  Ô5VCVGT  I -ÌPKI UVGJV X X)ÌVVKP #TFQMUJQ VJTQPV X X #NVGMCT   XGTIN2N++/KVEJKPGT 5GJTUEJÌP



&KG<WUEJTGKDWPIKUVPKEJVIGUKEJGTV



Ô5VCVGTI-WOCTCFGXKWPF%JCPFTCIWRVC+UVGJGPGKPCPFGTIGIGPÒDGT.CMUJOKUKV\VXXCWH .ÌYGP#NVGMCT2N+HH/KVEJKPGT #VVTCMVKXGUUGJTUEJÌPGU'ZGORNCT



#NVGMCTYGKUVFKG/ÒP\G%JCPFTCIWRVC+\W

331


GROSSMOGULE IN INDIEN

9355

9354



%JCPFTCIWRVC++Ô5VCVGTI-ÌPKIUVGJVNOKV2HGKNWPF$QIGPN)CTWFC5VCPFCTVG .CMUJOKVJTQPVXX#NVGMCTXGTIN2N+8HH/KVEJKPGTHH 5GJTUEJÌP





Ô5VCVGTI-ÌPKIUVGJVNOKV2HGKNWPF$QIGPN)CTWFC5VCPFCTVG.CMUJOKVJTQPVXX#NVG MCTXGTIN2N+8HH/KVEJKPGTHH (CUVUGJTUEJÌP



-+&#4+6'0+0+0&+'0 

-KFCTC PCEJ  Ô5VCVGT 6CZKNC  I -ÌPKI UVGJV X X)ÌVVKP #TFQMUJQ VJTQPV X X )ÌDN   &C\W\YGKYGKVGTMKFCTKVKUEJGÔ5VCVGTG 5VÒEM5GJTUEJÌP



9357



8KPC[CFKV[CUR·VGU,CJTJWPFGTVÔ5VCVGTI-ÌPKIT#TFQMUJQUKV\VXX 5EJYGTVITKHH  /KVEJKPGTHH 5GJTUEJÌP



-¤0+)'8108+,#;#0#)#4 

&GXCTC[C +  Ô2CIQFG 5JKXC WPF 2CTXCVK VJTQPGP X X5EJTKHV /KVEJKPGT  &C\W   6TCXCPEQTG/QJWTUQYKGGKPGYGKVGTGKPFKUEJG)QNFOÒP\G+PUIGUCOVI  5VÒEM5GJTUEJÌP Z WPFXQT\ÒINKEJ Z



9360

9359

/#/.7-'0 

#N<CJKT4WMPCNFKP$C[DCTU+Ô&KPCTI-C\CP%QNNXGTINHH 5GJTUEJÌP



57.6#0#6)7,#4#6 

/CJOWF5JCJ+++Ô6CPMC,CJTGU\CJNPKEJVNGUDCTI(D4CLIQT  5GJTUEJÌP



9362

9361

57.6#0#6,#70274 

*WUGKP5JCJÔ6CPMCI(D4CLIQT

5GJTUEJÌP



)4155/1)7.'+0+0&+'0  332

/WJCOOCF #MDCT  Ô/QJWT  #*    7TFW <CHCT 3CTKP  I -/   XGTIN 5GJTUEJÌP




MUWAHHIDEN

9363

1,5:1



1,5:1

#WTCPI\GD #NCOIKT  Ô/QJWT  #*,CJT     $KLCRWT  I   -/ 5GJTUEJÌP



9364

#55#/ 

.CMUJOK5KOJCÔ/QJWT 5' I-/

5GJTUEJÌP



9365

1,5:1

1,5:1

/;514' 

6QNCQ,I-COCN-WOCT9GTV.ÌYGUVGJVNXQT.CPFUEJCHVOKVCWHIGJGPFGT5QPPG(D -/ 5GJTUEJÌP



9366

/79#**+&'0 

#DW*CHU7OCTDKP+UJCSÔ&KPCTQ,I-C\CP%QNNXGTINHH

5GJTUEJÌP





#DDCFKFKUEJG&KPCTG8KGT&KPCTGWC#DW,CHCT#DFCNNCJCN/CPUWTWPF#DW#DFCNNCJCN/CJFK  5VÒEM-N)TCHHKVK Z UGJTUEJÌP





.QV QTKGPVCNKUEJGT )QNFOÒP\GP #VLGJU XQP 5WOCVTC Z  %G[NQP Z  1UOCPGP Z 5ÒNG[OCP +   /WTCF+++/GJOGV+8 5WOCVTC5WNC[JKFGP)JCJCFCXCNCUXQP-CPC[K5JC[DCPKFGP$WTLK/COG NWMGP*QEJKPVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM/GKUVUGJTUEJÌP



.165

333


LITERATURVERZEICHNIS Alexandropoulos Alföldi Alföldi Alram Altekar Alvarez-Burgos Amandry AMNG Arnold-Biucchi

van Arsdell Ashton

= = = = = = = = = = = = = = =

Ashton/Weiss

=

Ashton et al.

= = = = = = = = = = = = = =

Atlan v. Aulock

Bab. Bbelon, Perses Babelon, Traité Bahrf. Balcer Baldus Baldwin

Balog Banti Banti/Simonetti Barron Bastien

Bendall Bérend

= = = = = = = = = = = = =

Betlyon

=

Bickford-Smith

=

Bloesch

=

Bauslaugh Bedoukian Bellinger

Bopearachchi Burgos Burnett

= = = = = = = = = = = = = =

Butcher

= =

Blum BN Bact. BMC

Bodenstedt Boehringer

334

Alexandropoulos, J.: Les monnaies de l’Afrique Antique. Toulouse 2000. Alföldi, A.: Studien zur Geschichte der Weltkrise des 3. Jahrhunderts nach Christus. Darmstadt 1967. Alföldi, A. und Alföldi, E.: Die Kontorniat-Medaillons. Berlin 1976-1990. Alföldi, Maria R.: Bild und Bildersprache der römischen Kaiser. Mainz 1999. Alram, M.: Iranisches Personennamenbuch Band IV. Nomina propria iranica in nummis. Wien 1986. Altekar, A. S.: The Coinage of the Gupta Empire. Varanasi 1957. Alvarez-Burgos, F.: La Moneda Hispanica desde sus origines hasta el Siglo V. Madrid 1987. Amandry, M.: Notes de numismatique africane. V, in: RN XXXII (1990), S. 56-84. Imhoof-Blumer (Herausgeber): Die antiken Münzen Nordgriechenlands. 4 Bände, Berlin 1898-1935. Arnold-Biucchi, C.: The Randazzo Hoard 1980 and Sicilian Chronology in the early fifth Century B.C. ANS NS 18, New York 1990. -: La monetazione d’argento di Himera classica, in: Quaderni Ticinesi XVII (1988), S. 85-100. van Arsdell, R. D.: Celtic coinage of Britain. London 1989. Ashton, R. H. J.: A series of pseudo-Rhodian drachms from Mainland Greece, in: NC 1988, S. 21-32. -: The pseudo-Rhodian drachms of Mylasa, in: NC 1992, S. 1-39. -: The Coinage of Rhodes 408-c. 190 BC, in: Meadows/Shipton (Hrsg.), Money and its uses in the ancient greek world, Oxford 2001, S. 79-115. Ashton, R. H. J. und Weiss, A.-P. C.: The Post-Plinthophoric Silver Drachms of Rhodes, in: NC 1997, S. 1-40. Ashton et al.: The Hecatomnus Hoard (CH 5.17, 8.96, 9.387), in: Coin Hoards IX (2002), S. 95-158. -: The Pixodarus Hoard (CH 9.421), in: Coin Hoards IX (2002), S. 159-243. Atlan, S.: Untersuchungen über die sidetischen Münzen des V. und IV. Jahrhunderts v. Chr. Ankara 1967. v. Aulock, H.: Münzen und Städte Lykaoniens. Tübingen 1976. -: Münzen und Städte Pisidiens. 2 Bände. Tübingen 1977. -: Kleinasiatische Münzstätten VI-VII, in: JbNum 20 (1970), S. 151-159. Babelon, E.: Monnaies Consulaires. Paris 1885 f. Babelon, E. : Les Perses Achéménides. Paris 1893. -: Traité des monnaies grecques et romaines. Paris 1901 ff. Bahrfeldt, M. von: Die römische Goldmünzenprägung. Halle 1923. Balcer, J. M.: The early silver coinage of Teos, in: SNR 42 (1968), S. 5-50. Baldus, H. R.: MON(eta) URB(is) - ANTIOXIA. Frankfurt/Main 1969. Baldwin, Agnes, The Electrum Coinage of Lampsakos. New York 1914. -: The Electrum and Silver Coins of Chios, issued during the sixth, fifth and fourth Centuries, B.C., in: American Journal of Numismatics, 48 (1914), S. 1-60. Balog, P.: The Coinage of the Mamluk Sultans of Egypt and Syria. New York 1964. Banti, A.: Corpus Nummorum Romanorum. Monetazione Republicana. Firenze 1980 ff. Banti, A. und Simonetti, L.: Corpus Nummorum Romanorum. Firenze 1972 ff. Barron, J. P.: The Silver Coins of Samos. London 1966. Bastien, P.: Le Monnayage de Bronze de Postume. Wetteren 1967. -: Imitations of Roman Bronze Coins, A.D. 318-363, in: ANSMN 30 (1985), S. 143-177. Bauslaugh, R. A.: Silver Coinage with the Types of Aesillas the Quaestor. New York 2000. Bedoukian, P. D.: Coinage of Cilician Armenia. Danbury 1979. Bellinger, A. R.: The Syrian tetradrachms of Caracalla and Macrinus. New York 1940. -: The first Civic Tetradrachms of Ilium, in: ANSMN VIII (1958), S. 11-24. -: Troy, The Coins. Princeton 1961. Bendall, S. : A private collection of Palaeologan coins. Wolverhampton 1988. Bérend, D.: Les tétradrachmes de Rhodes de la première période, 1re partie, in: Schweizerische Numismatische Rundschau 51 (1972), S. 5-39. Betlyon, J. W.: A New Chronology for the Pre-Alexandrine Coinage of Sidon, in: ANSMN 21 (1976), S. 11-35. Bickford-Smith, R. A.: The imperial mints in the east for Septimius Severus: it is time to begin a thorough reconsideration, in: RIN XCVI (1994/1995), S. 53-71. Bloesch, H., Tetradrachms of Aegae, in: Mørkholm/Waggoner (Hrsg.), Greek Numismatics and Archaeology: Essays in Honor of Margaret Thompson, Wetteren 1979, S. 1-7. -: Hellenistic Coins of Aegae (Cilicia), in: ANSMN 27 (1982), S. 53-96. Blum, G.: Numismatique d’Antinoos, in: JIAN XVI (1914), S. 33-70. Bopearachchi, O.: Monnaies Gréco-Bactriennes et Indo-Greeks. Paris 1991. Catalogue of Greek Coins in the British Museum. London 1873-1927. Coins of the Roman Republic in the British Museum. London 1910. Coins of the Roman Empire in the British Museum. London 1923 ff. (soweit erschienen 2. Auflage). Catalogue of the Imperial Byzantine Coins in the British Museum. London 1908. Catalogue of Oriental Coins in the British Museum. London 1875 ff. Bodenstedt, Fr.: Die Elektronmünzen von Phokaia und Mytilene. Tübingen 1981. Boehringer, Chr.: Zur Chronologie mittelhellenistischer Münzserien 220-160 v. Chr. Berlin 1972. Boehringer, E.: Die Münzen von Syrakus. Berlin 1929. Bopearachchi, O./Pieper, W.: Ancient Indian Coins. Turnhout 1998. Burgos, F. A.: La moneda Hispanica desde sus orígenes hasta el siglo V. Madrid 1987. Burnett, A.: The Enna Hoard and the Silver Coinage of the Syracusan Democracy, in: Schweizerische Numismatische Rundschau 62 (1983), S. 5-46. -: The Coinage of Allectus, in: BJN 54 (1984), S. 21-40. Butcher, K.: Coinage in Roman Syria. London 2004.


Buttrey = Buttrey u. a. , Morgantina Studies = Cahn

= = =

Cahn/Gerin Calciati Calico Caltabiano Castelin

= = = = = =

CBN CNV Coh. Coins from Karanis

= = = = =

Coleiro Crawf. Crawford

= = =

Curtis Dattari Dattari/Savio De Callataÿ

= = = =

Delestrée

=

Delestrée/Tache

=

Delrieux

=

Dembski Dengate Depeyrot

= = =

Deppert-Lippitz Desneux Dittrich DOC

= = = =

Draganov Edhem Elmer

= = =

Emmet Fb. Fischer-Bossert

= = =

Forrer Franke Franke/Hirmer Franke/Nollé v. Fritze

= = = = =

Frolova Frolova/Ireland Furtwängler

= = = =

Gaebler Gallatin Gamberini Geissen

= = = =

Gielow Gilljam Gnecchi

= = =

Buttrey, T. V.: The Spintriae as Historical Sources, in: NC 1973, S. 52-63. Buttrey, T. V./Erim, K. T./Groves, T. D./Holloway, R. R.: Morgantina Studies. Vol. II. The Coins. Princeton 1989. Cahn, H. A.: Die Münzen der sizilischen Stadt Naxos. Basel 1944. -: Knidos. Die Münzen des sechsten und fünften Jahrhunderts v. Chr. Berlin 1970. -: Zwei griechische Miszellen, in: Margolis/Voegtli (Hrsg.), Numismatics-Witness to History, Wetteren 1986, S. 11-14. Cahn, H. A. und Gerin, D.: Themistokles at Magnesia, in NC 1988, S. 13-20. Calciati, R.: Corpus Nummorum Siculorum. La Monetazione di Bronzo, 1983 ff. -: Pegasi. Mortara 1990. Calico, X.: The Roman Aurei. 2 Bände. Barcelona 2003. Caltabiano, M. C.: La Monetazione di Messana. Berlin 1993. Castelin, K.: Keltische Münzen. Katalog der Sammlung des Schweizerischen Landesmuseums Zürich. Bern 1985. -: Die Goldprägung der Kelten in den böhmischen Ländern. Graz 1965. Estiot, S. : Monnaies de l’Empire romain. XII.1 D’Aurélien à Florien (270-276 après J.-C.). Paris 2004. Vico Monteoliva, J./Cores Gomendio, M. C./Cores Uria, G.: Corpus Nummorum Visigothorum. Madrid 2006. Cohen, H.: Medailles imperiales, 2. Auflage. Paris/London 1880 ff. Haatvedt, R. A. und Peterson, E. E.: Coins from Karanis. The University of Michigan Excavations 1924-1935. Ann Arbor 1964. Coleiro, E.: Maltese Coins of the Roman Period, in: NC 1971, S. 67-91. Crawford, M. H.: Roman Republican Coinage. Cambridge 1974. Crawford, M. H.: Provenances, Attributions and Chronology of some Early Italian Coinages, in: Coin Hoards IX (2002), S. 269-273. Curtis, J. W.: The Tetradrachms of Roman Egypt. Chicago 1969. Dattari, G.: Monete imperiali greche. Kairo 1901. Savio, A.: Catalogo completo della collezione Dattari. Triest 1999. de Callataÿ, F.: Les monnaies hellénistiques en argent de Ténédos, in: Ashton/Hurter (Hrsg.), Studies in Greek Numismatics in Memory of Martin Jessop Price, London 1998. -: L’Histoire des Guerres Mithridatiques vue par les Monnaies. Louvain-la-Neuve 1997. Delestrée, L.-P. : Le Correcte de la Légende du Bronze Gaulois aux «Tria nomina», in : Cahiers Numismatique. Bull. de la S.E.N.A. 105, September 2005. Delestrée, L.-P./Tache, M.: Nouvel Atlas de Monnaies Gauloises. Vol. I - III. Saint-Germain-en-Laye 2002-2007. Delrieux, F. : Les Monnaies de Mylasa aux Types de Zeus Osogoa et Zeus Labraundos, in : NC 1999, S. 3345. Dembski, G.: Münzen der Kelten. Wien 1998. Dengate, J. A.: The Triobols of Megalopolis, in: ANSMN 13 (1967), S. 57-110. Depeyrot, G.: Le monnaies d´or de Dioclétien à Constantin I (284-337). Wetteren 1995. -: Le monnaies d´or de Constantin II a Zenon (337-491). Wetteren 1996. -: Les monnaies hellènistique de Marseille, Wetteren 1999. Deppert-Lippitz, B.: Die Münzprägung Milets vom vierten bis ersten Jahrhundert v. Chr. Aarau 1984. Desneux, J.: Le tetradrachmes d`Akanthos, in: Revue belge de numismatique 95 (1949), S. 5-122. Dittrich, K.: Antike Münzen aus Olbia und Pantikapäum. Prag 1959. Bellinger, A. R., Grierson, Ph. und Hendy, M. F.: Catalogue of the Byzantine Coins in the Dumbarton Oaks Collection. Washington 1966 ff. Draganov, D.: The Bronze Coinage of Dionysopolis, in: Numismatic Circular 105 (1997), S. 371-377. Edhem, Ghalib I.: Cataloque des Monnaies Turcomanes. Istanbul 1894. Elmer, G.: Die Münzprägung der gallischen Kaiser in Köln, Trier und Mailand. Sonderdruck aus Bonner Jahrbücher 146, 1941. Emmet, K.: Alexandrian Coins. Lodi 2001. Friedberg, R.: Gold Coins of the World. 6. Auflage. New York 1991. Fischer-Bossert, W.: Chronologie der Didrachmenprägung von Tarent. Berlin 1999. -: Die Lysimacheier des Skostokos, in: RBN CLI (2005), S. 49-74, Pl. III-VIII. Forrer, R.: Keltische Numismatik der Rhein- und Donaulande. Straßburg 1908. Franke, P. R.: Die antiken Münzen von Epirus. Wiesbaden 1961. Franke, P. R. und Hirmer, M.: Die Griechische Münze. München 1964. Franke, P. R. und Nollé, M. K.: Die Homonoia-Münzen Kleinasiens. Saarbrücken 1997. Fritze, H. von: Die vorkaiserlichen Münzen von Adramytion, in: Nomisma V (1910), S. 10-24. -: Die Elektronprägung von Kyzikos, in: Nomisma VII (1912). -: Die Silberprägung von Kyzikos, in: Nomisma IX (1914). Frolova, N. A.: The Coinage of the Kingdom of Bosporus. Oxford 1979. Frolova, N. A. und Ireland, S.: The Coinage of the Bosporan Kingdom. Oxford 2002. Furtwängler, A. E., Monnaies grecques en Gaule. Le trésor d’Auriol et le monnayage de Massalia 525/520-460 av. J.-C. Fribourg 1978. Gaebler, H.: Die Silberprägung von Lampsakos, in: Nomisma XII (1923), S. 1-33. Gallatin, A.: Syracusan dekadrachms of the Euainetos type. Cambridge 1930. Gamberini, C.: Le Imitazioni e la Contraffazioni Monetarie nel Mondo. Bologna 1971. Geissen, A.: Katalog Alexandrinischer Kaisermünzen der Sammlung des Instituts für Altertumskunde der Universität Köln. Opladen 1974 ff. Gielow, H. E.: Die Silberprägung von Dankle-Messana (Ca. 515-396 v. Chr.), in: MBNG 48 (1930), S. 1-54. Gilljam, H. H.: Antoniniani und Aurei des Ulpius Cornelius Laelianus. Köln 1982. Gnecchi, F.: I Medaglioni Romani. Milano 1912.

335


Göbl

Grierson/Blackburn Grose/McClean Grunauervon Hoerschelmann Gutmann/Schwabacher Hahn

= = = = = =

Göbl, R.: Ostkeltischer Typenatlas. Braunschweig 1968. -: Typologie und Chronologie der keltischen Münzprägung in Noricum. Wien 1973. -: Münzprägung des Kusanreiches. Wien 1984. -: Sasanidische Numismatik. Braunschweig 1968. Grierson, P. und Blackburn, M.: Medieval European Coinage. Cambridge 1986. Grose, S. W.: Catalogue of the McClean Collection of Greek Coins. Cambridge 1923 ff.

= =

Grunauer-von Hoerschelmann, S.: Die Münzprägung der Lakedaimonier. Berlin 1978. Gutmann, F. und Schwabacher, W.: Die Tetradrachmen- und Didrachmenprägung von Himera (472-409 v. Chr.), in: MBNG 47 (1929), S. 101-144. -: Die Ostprägung des römischen Reiches im 5. Jahrhundert. Wien 1989. -: Moneta imperii byzantini. Wien 1973 ff. -: Money of the incipient Byzantine Empire. Wien 2000. Hahn, W. und Luegmeyer, A.: Der langobardenzeitliche Münzschatzfund von Aldrans in Tirol, Wien 1992. Hardwick, N.: The Coinage of Chios from the VIth to the IVth Century B.C., in: Hackens (Hrsg.), Proceedings of the 11th international Numismatic Congress, September 8-13, 1991, Volume I, Louvain-LaNeuve 1993, S. 211-222. Hazard, H. W.: The Numismatic History of late medieval north Africa. New York 1952. Head, B. V.: On the Chronological Sequence of the Coins of Ephesus, in: NC 1880, S. 85-173. Heesch, J. van: Une représentation remarquable des quatre saisons sur semisses de l’epoque antoninienne, in: Scheers, S. (Hrsg.), Studio Paulo Naster Oblata I. Numismatica Antiqua, Leuven 1982, S. 193-196. -: The Last Civic Coinages and the religious Policy of Maximinus Daza (AD 312), in: NC 1993, S. 65-75. Heipp-Tamer, C.: Die Münzprägung der lykischen Stadt Phaselis in griechischer Zeit. Saarbrücken 1993. Hendy, M. F.: Coinage and money in the Byzantine Empire 1081-1261. Washington 1969. Hepworth, R. G.: Epaminondas’ Coinage, in: Carradice et al. (Hrsg.), Proceedings of the 10th international congress of numismatics, London 1986, S. 35-40. Herrmann, F.: Die Silbermünzen von Larissa in Thessalien, in: ZfN 35 (1924). Hersh, C. A.: Additions and Corrections to Martin J. Price`s “The Coinage in the name of Alexander the Great and Philip Arrhidaeus”, in: Ashton/Hurter (Hrsg.): Studies in Greek Numismatics in memory of Martin Jessop Price. London 1998, S. 135-144. Herzfelder, H.: Les monnaies d' argent de Rhegion. Paris 1957. Holloway, R. R. und Jenkins, G. K.: Terina. Bellinzona 1983. Hopper, R. J.: Observations on the Wappenmünzen, in: Kraay/Jenkins (Hrsg.), Essays in Greek Coinage Presented to Stanley Robinson. Oxford 1968, S. 16-39. Houghton, A.: Coins of the Seleucid Empire from the collection of Arthur Houghton. New York 1983. -: The Royal Seleucid Mint of Seleucia on the Calycadnus, in: Le Rider/Jenkins/Waggoner/Westermark (Hrsg.), Kraay-Mørkholm Essays, Louvain-la-Neuve 1989, S. 77-98. Houghton, A./Lorber, C.: Seleucid Coins. Lancaster 2002. Howgego, C. J.: Greek Imperial countermarks. London 1985. Hurter, S.: 42 Tetradrachmen von Klazomenai. Ein Fundbericht, in: Schweizerische Numismatische Rundschau XLV (1966), S. 26-50. -: Der Tissaphernes-Fund, in: Mørkholm/Waggoner (Hrsg.), Greek Numismatics and Archaeology: Essays in Honor of Margaret Thompson, Wetteren 1979, S. 97-108. -: Lions and lionesses, eagles and a few heads: a new uncertain mint in Caria, in: Burnett/Wartenberg/Witschonke (Hrsg.), Coins of Macedonia and Rome: Essays in Honour of Charles Hersh, London 1998, S. 109-117. -: A New Lycian Coin Type: Kherei, Not Kuperlis, in: Israel Numismatic Journal 14 (2000-2002), S. 15-18. Ierardi, M.: Tetradrachms of Agathokles of Syracuse, in: AJN 7-8 (1995-1996), S. 1-73. Imhoof-Blumer, F.:Die Münzen Akarnaniens, in: NZ 1878, S. 1-180. -: Griechische Münzen. München 1890. -: Lydische Stadtmünzen. Genf 1897. -: Kleinasiatische Münzen. 2 Bände. Wien 1901-1902. Jenkins, G. K.: Electrum Coinage at Syracuse, in: Kraay/Jenkins (Hrsg.), Essays in Greek Coinage presented to Stanley Robinson, Oxford 1968, S. 145-162. -: The Coinage of Gela. Berlin 1969. -: Himera: The Coins of Akragantine Type, in: La Monetazione Arcaica di Himera Fino al 472 A.C. Atti del II Convegno del Centro Internazionale di Studi Numismatici – Napoli 15-19 Aprile 1969. Rom 1971, S. 21-36. -: Rhodian Plintophoroi. A Sketch, in: Le Rider/Jenkins/Waggoner/Westermark (Hrsg.), Kraay-Mørkholm Essays, Louvain-la-Neuve 1989, S. 101-136. -: The Coins of Punic Sicily. Zürich 1997. Jenkins, G. K./Lewis, R. B.: Carthaginian Gold and Electrum Coins. London 1963. Johnston, A.: The Coinage of Metapontum. Part 3. New York 1990. -: The bronze coinage of Metapontum, in: Kraay-Mørkholm Essays, Louvain-la-Neuve 1989, S. 121-136. Jones, N. F.: The Autonomous Wreathed Tetradrachms of Magnesia On-Maeander, in: ANSMN 24 (1979), S. 63-109. Jongkees, J. H.: The Kimonian Dekadrachms. Utrecht 1941. Jurukova, J.: Die Münzprägung von Bizye. Berlin 1981. -: Die Münzprägung von Deultum. Berlin 1973. Corpus Nummorum Palaestinensium. 4 Bände. Jerusalem 1956-1961. Kaenel, H.-M. von: Münzprägung und Münzbildnis des Claudius, Berlin 1986. -: Britannicus, Agrippina Minor und Nero in Thrakien, in: SNR 63 (1984), S. 127-166. Kampmann, U.: Die Homonoia-Verbindungen der Stadt Pergamon. Saarbrücken 1996. Karbach, F.-B.: Die Münzprägung von Eirenopolis in Ostkilikien, in: JbNum 42/43 (1992/93), S. 83-145. Karwiese, S.: Die Münzprägung von Ephesos. Wien 1995.

Hahn/Luegmeyer Hardwick

= = = = =

Hazard Head van Heesch

= = =

Heipp-Tamer Hendy Hepworth

= = = =

Herrmann Hersh

= =

Herzfelder Holloway-Jenkins Hopper

= = =

Houghton Houghton

= =

Houghton/Lorber Howgego Hurter

= = = = =

Ierardi Imhoof-Blumer

Jenkins

= = = = = = = = =

=

Jenkins/Lewis Johnston

= = = =

Jones

=

Jongkees Jurukova

= =

Kadman von Kaenel

= = = = = =

Kampmann Karbach Karwiese

336


Kazan Coll. Kellner Kindler

= = =

Kinns

= = = =

Klein Kleiner Kleiner/Noë Klose K./M. Konuk

= = = = = =

Kostial Kraay

= = = = = = = = = = = = = = = =

Kraay/King Kraus Kritt Kroll/Walker Krzyzanowska Kubitschek La Tour Lacam Lambros Lavva Lederer

Le Rider Lindgren Coll.

Lorber LPC Lukanc MacDonald Maier Malloy Mamroth Martin Mavrogordato May

Mazard Merker Meshorer Meshorer

Meshorer/Qedar Metcalf Metcalf² Metlich Milbank Mildenberg

Mildenberg/Hurter Miles Milne

= = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = = =

Kazan, W. The Coinage of Islam. Collection of William Kazan. Beirut 1983. Kellner, H. J.: Die Münzfunde von Manching und die keltischen Fundmünzen aus Südbayern. Stuttgart 1990. Kindler, A.: The Coins of the Ituraeans, in: Hackens (Hrsg.), Proceedings of the 11th international Numismatic Congress, September 8-13, 1991, Volume I, Louvain-La-Neuve 1993, S. 283-288. Kinns, P.: CH 8, 474: Milesian Silver Coinage in the second century BC, in: Ashton/Hurter (Hrsg.), Studies in Greek Numismatics in memory of Martin Jessop Price, London 1998, S. 175-195. -: The Coinage of Miletus, in: NC 1986, S. 233-260. -: Two Studies in the Silver Coinage of Magnesia on the Maeander, in: Le Rider/Jenkins/Waggoner/Westermark (Hrsg.), Kraay-Mørkholm Essays, Louvain-la-Neuve 1989, S. 137-148. -: The Attic Weight Drachms of Ephesus: A Preliminary Study in the Light of Recent Hoards, in: NC 1999, S. 47-97. Klein, D.: Sammlung von griechischen Kleinsilbermünzen und Bronzen. Milano 1999. Kleiner, F. S.: The Dated Cistophori of Ephesus, in: ANSMN 18 (1972), S. 17-32. Kleiner, F. S. und Noë, S. P.: The early Cistophoric Coinage. New York 1977. Klose, D. O. A.: Die Münzprägung von Smyrna in der römischen Kaiserzeit. Berlin 1987. Krause, C. L./Mishler, C.: Standard Catalogue of World Coins. Aktuelle Auflage. Konuk, K.: The Early Coinage of Kaunos, in: Ashton/Hurter (Hrsg.), Studies in Greek Numismatics in Memory of Martin Jessop Price, London 1998, S. 197-223. Kostial, M.: Kelten im Osten. München 1997. Kraay, C. M.: The Coinage of Sybaris after 510 B. C., in: NC 1958, S. 13-37. -: The Melos Hoard of 1907 Re-examined, in: NC 1964, S. 1-20. -: The archaic Coinage of Himera. Napoli 1984. Kraay, C. M. und King, C. E.: A mid-fifth century hoard from South Italy, in: SNR 66 (1987), S. 7-33. Kraus, F. F.: Die Münzen Odovacars und des Ostgotenreiches in Italien. Halle (Saale) 1928. Kritt, B.: Dynastic Transitions in the Coinage of Bactria. Lancaster 2001. Kroll, J. H. und Walker, A. S.: The Athenian Agora. Vol. XXVI: Thje Greek Coins. Princeton 1993. Krzyzanowska, A.: Monnaies coloniales d´Antioche de Pisidie. Varsovie 1970. Kubitschek. W. : Ninica-Claudiopolis, in : NZ 34 (1902), S. 1-27. La Tour, H. de.: Atlas de Monnaies Gauloises. Paris 1892. Lacam, G.: La fin de l’Empire Romain et le monnayage or en Italie. Luzern 1983. Lambros, I. P.: Anagrafh twn nomismatwn thj kurioij Elladoj. Peloponnhsoj. Athen 1891. Lavva, S.: Die Münzprägung von Pharsalos. Saarbrücken 2001. Lederer, P.: Die Staterprägung der Stadt Nagidos. Berlin 1932. -: Neue Beiträge zur antiken Münzkunde aus schweizerischen öffentlichen und privaten Sammlungen, in: SNR 30 (1943), S. 1-103. Le Rider, G.: Le monnayage d' argent et d' or de Philipp II. frappé en Macedonie de 359 à 294. Paris 1978. -: Monnaies Crétoises. Paris 1966. Lindgren, H. C.: Lindgren III. Ancient Greek bronze coins from the Lindgren Collection. Quarryville 1993. -, und Kovacs, F. L.: Ancient bronze coins of Asia Minor and the Levant from the Lindgren collection. San Mateo 1985. Lorber, C. C.: Amphipolis. The Civic Coinage in Silver and Gold. Los Angeles 1990. Bendall, S. und Donald, P. J.: The later Palaeologan coinage 1282-1453. Bristol 1979. Lukanc, I.: Les Imitations des Monnaies d`Alexandre le Grand et de Thasos. Wetteren 1996. MacDonald, G.: Catalogue of the Greek Coins in the Hunterian Collection. Band 1-3, Glasgow 1899-1905. Maier, A.: Die Silberprägung von Apollonia und Dyrrhachion, in: NZ 1908, S. 1-33. Malloy, A. G./Preston, F./Seltman, A. J.: Coins of the Crusader States. New York 1994. Mamroth, A.: Silbermünzen des Königs Perseus, in: ZfN 38 (1928), S. 1-28. Martin, P.-H.: Die anonymen Münzen des Jahres 68 nach Christus. Mainz 1974. Mavrogordato, J. A.: A Chronological Arrangement of the Coins of Chios, Parts 1-4, in: NC 1915-1918. May, J. M. F.: The coinage of Abdera (540-345 B.C.). London 1966. -: Ainos. Its history and coinage. London 1950. -: The Coinage of Dikaia-by-Abdera, c 540/35-476/5 B.C., in: NC 1965, S. 1-25. -: The coinage of Damastion. Oxford 1939. Mazard, J.: Corpus nummorum Numidiae Mauretanique. Paris 1955. Merker, I. L.: The Silver Coinage of Antigonos Gonatas and Antigonos Doson, in ANSMN IX (1960), S. 39-52. Meshorer, Y.: Nabataean Coins. Jerusalem 1975. -: Ancient Jewish Coinage. Vol. I und II. New York 1982. -: The Coinage of Aelia Capitolina. Jerusalem 1989. -: A Treasury of Jewish Coins. Jerusalem 2001. Meshorer, Y. und Qedar, S.: Samarian Coinage. Jerusalem 1999. Metcalf, W. E.: The Cistophori of Hadrian. New York 1980. Metcalf, D. M.: Coinage of the Crusades and the Latin East. 2. Auflage. London 1995. Metlich, M. A.: The Coinage of Ostrogothic Italy. London 2004. Milbank, S. R.: The Coinage of Aegina. New York 1925. Mildenberg, L.: The Coinage of the Bar Kokhba War. Aarau 1984. -: Money Supply under Artaxerxes III Ochus, in: Ashton/Hurter (Hrsg.), Studies in Greek Numismatics in Memory of Martin Jessop Price, London 1998, S. 277-286. -: Vestigia Leonis, Göttingen 1998. Mildenberg, L. und Hurter, S.: The Arthur S. Dewing Collection of Greek Coins. New York 1985. Miles, G. C.: The Coinage of the Visigoths of Spain. New York 1952. -: The Coinage of the Umayyads of Spain. 2 Bände. New York 1950. Milne, J. G.: The autonomous Coinage of Smyrna, in: NC 1923, S. 1-30. -: Catalogue of Alexandrian Coins. Oxford 1971. -: Kolophon and its Coinage. New York 1941.

337


Mionnet

=

MIR

=

Mørkholm/Kromann

= = = = = = = = = = =

Morrisson/Schwartz

=

Mostecky Moushmov Moustaka Müller Münsterberg Müseler

= = = = = = = = = = = = = = = = =

Mitchiner Mittag Mlasowsky de Morgan Mørkholm

Munro-Hay/Juel-Jensen Naville Newell

Nicolet-Pierre

= Nicolet-Pierre/Amandry = Noë Noë/Johnston Noeske Oakley Paeonian Hoard Papageorgiadou-Banis Paruck Paschalis Pfeiler

= = = = = = = = = =

Paulsen Picard

= =

Pink Price

= =

Price/Trell Price/Waggoner Prieur

= = = =

Ravel

338

Rajgor Raymond Retowski RIC Rizzo Robertson

= = = = = = = =

Robinson

=

Rogers Rostovtsew/Prou

= =

Mionnet, Th.-E.: Déscription des médailles antiques, grecques et romaines. 7 Bände. Paris 1806-1808. Supplement: 9 Bände, Paris 1819-1837. Göbl, R.: Moneta Imperii Romani. Die Münzprägung der Kaiser Valerianus I./Gallienus/Saloninus (253-268), Regalianus (260) und Macrianus/Quietus (260/262). Wien 2000. -: Die Münzprägung des Kaisers Aurelianus (270/275). Wien 1983. Mitchiner, M.: Indo- Greek and Indo- Scythian Coinage. London 1975 ff. -: Oriental Coins and their Values. London 1977 ff. Mittag, P. F.: Alte Köpfe in neuen Händen – Urheber und Funktion der Kontorniaten. Bonn 1999. Mlasowsky, A.: Die antiken Tesseren im Kestner-Museum Hannover. Hannover 1991. de Morgan, J.: Numismatique Orientale. Paris 1936. Mørkholm, O.: Studies in the Coinage of Antiochus IV of Syria. Copenhagen 1963. -: The Accession of Antiochus IV of Syria, in: ANSMN 11 (1964), S. 63-76. -: The Autonomous Tetradrachms of Laodicea ad Mare, in: ANSMN 28 (1983), S. 89-107. -: The Coinages of Ariarathes VI and Ariarathes VII of Cappadocia, in: SNR 57 (1978), S. 144-163. Mørkholm, O. und Kromann, A: The Ptolemaic Silver Coinage on Cyprus 192/1-164/3 B.C., in: Chiron 14 (1984), S. 149-173. Morrisson, C. und Schwartz, J. H.: Vandal Silver Coinage in the Name of Honorius, in: ANSMN 27 (1982), S. 149-179. Mostecky, H.: Münzen zwischen Rom und Byzanz. Louvain-la-Neuve 1997. Moushmov, N. A.: Antichnitie moneti na Balkanskita poluostrov i monetitie tsare. Sofia 1912. Moustaka, A.: Kulte und Mythen auf thessalischen Münzen. Würzburg 1983. Müller, L.: Den thraciske Konge Lysimachus's Mynter. Kopenhagen 1857. Münsterberg, R.: Die Beamtennamen auf griechischen Münzen. Hildesheim 1973. Müseler, K.: Bergbaugepräge. 2 Bände, Hannover 1983. -: Nachtrag zu den Bänden I und II. Hannover 1998. Munro-Hay, S. C./Juel-Jensen, B.: Aksumite Coinage. London 1995. Naville, L.: Les Monnaies d’or de la Cyrénaique. Genf 1951. Newell, E. T.: Late Seleucid Mints in Ake-Ptolemais and Damaskus. ANS NNM 84. New York 1939. -: The Coinage of the Eastern Seleucid Mints. New York 1938. -: The Coinage of the Western Seleucid Mints. New York 1941. -: The Seleucid Mint of Antioch. Am. Journal of Num. New York 1917. -: The Coinage of Demetrius Poliorcetes. Chicago 1978. -: The Seleucid Coinage of Tyre. ANS NNM 73. New York 1936. -: The Pergamene mint under Philetaerus. ANS NNM 76. New York 1936. Nicolet-Pierre, H.: Monnaies archaïques d’Athènes sous Pisistrate et les Pisistratides (c. 545-c. 510), in : RN 1983. - : Argent et or frappés en Babylonie entre 331 et 311 ou de Mazdai à Seleucos, in: Amandry/Hurter/Bérend (Hrsg.), Travaux de Numismatique grecque offerts a Georges Le Rider, London 1999, S. 285-305. Nicolet-Pierre, H./Amandry, M.: Un nouveau trésor de monnaies d’argent pseudo-athéniennes venu d’Afghanistan, in: RN 1994, S. 34-54. Noë, S. P.: The Coinage of Caulonia. New York 1958. -: The Coinage of Metapont. New York 1927. Noë, S. P. und Johnston, A.: The Coinage of Metapontum Parts 1 and 2. New York 1984. Noeske, H.-Chr.: Die Münzen der Ptolemäer. Frankfurt 2000. Oakley, J. H.: The autonomous wreathed tetradrachms of Kyme, Aeolis, in: ANSMN 27 (1982). Catalogue of the extremely important Paeonian hoard, Sotheby & Co., London, Auktion vom 16. April 1969. Papageorgiadou-Banis, Ch.: The Coinage of Kea. Athen 1997. Paruck, F. D. J.: Sasanian Coins. Nachdruck New Delhi 1976. Paschalis, D. P.: NOMISMATIKH THS ARXAIAS ANDROU, in: JIAN I (1898), S. 299-366. Pfeiler, H.: Die Münzprägung der Brettier, in. Jahrbuch für Numismatik und Geldgeschichte 14 (1964), S.7-50. Paulsen, R.: Die Münzprägungen der Boier. Wien/Leipzig 1933. Picard, O.: Chalcis et la Confédération Eubéenne. Étude de Numismatique et d´Histoire (Ive-Ier siècle). Paris 1979. Pink, K.: Der Aufbau der römischen Münzprägung in der Kaiserzeit: VI/1 Probus, in: NZ 73 (1949), S. 13-74. Price, M. J.: The Larissa, 1968 Hoard (IGHC 37), in: Le Rider/Jenkins/Waggoner/Westermark (Hrsg.), Kraay-Mørkholm Essays, Louvain-la-Neuve 1989, S. 233-243. -: The Coinage in the name of Alexander the Great and Philipp Arrhidaeus. London 1991. Price, M. J. und Trell, B. L.: Coins and their Cities. London 1977. Price, M. J. und Waggoner, N.: Archaic Greek Coins in the Asyut Hoard. London 1975. Prieur, M. und K.: A type corpus of the syro-phoenician tetradrachms and their fractions from 57 BC to AD 253. London 2000. Ravel, O. E.: Les »Poulains« de Corinthe. Basel 1936 ff. -: The Collection of Tarentine Coins formed by M. P. Vlasto. London 1947. Rajgor, D.: Standard Catalogue of Sultanate Coins of India. Bombay 1991. Raymond, D.: Macedonian Regal Coinage to 413 B. C. New York 1953. Retowski, O.: Die Münzen der Komnenen von Trapezunt. Braunschweig 1974². Mattingly, H. and Sydenham, E. A.: The Roman Imperial Coinage Vol. I-X. London 1923 ff. Rizzo, G. M.: Monete Grecche della Sicilia. Rom 1946. Robertson, A. S.: Roman imperial coins in the Hunterian Coin Cabinet, University of Glasgow. Vol. I-V. London 1962 ff. Robinson, E. S. G.: Carthaginian and other South Italian Coinages of the Second Punic War, in: NC 1964, S. 37-64. Rogers, E.: The Copper Coinage of Thessaly. London 1932. Rostovtsew, M. und Prou, M.: Catalogue des plombes de l’antiquité du moyen age et des temps modernes. Paris 1900.


Rouvier RPC Russo

= = =

Rutter

= = = = = = = = = = = = = = = = = = =

Ruzicka Sacks Sambon Scheers Scheu

Schlumb. Schönert Schönert-Geiss Schulte Schulten Schwabacher

Sear

Senior/MacDonald

= = = = = = = = = =

Seyrig

=

Shore Simonetta Sjöqvist

= = = =

Sellwood Seltman

Senior

Slg. Bally-Herzog Slg. BCD

Slg. Gutknecht Slg. Jameson Slg. Pangerl Slg. Mazzini Slg. Pozzi Slg. Schledehaus

= = = = = = = = = = =

Slg. Slocum Slg. Trau

= =

SNA Tübingen SNG ANS

= =

SNG Ashmolean SNG v. Aulock SNG Berry SNG BM SNG Cop. SNG Delepierre SNG Evelpidis SNG Fitzwilliam SNG France SNG Kayhan SNG Keckman SNG Levante SNG Lloyd SNG Lockett SNG Milano SNG Morcom

= = = = = = = = = = = = = = = =

Rouvier, J.: Numismatique des Villes de la Phenicie, in : JIAN 3-7 (1900-1904). Burnett, A./Amandry, M./Ripolles, P. P.: Roman Provincial Coinage Vol. I-II. London/Paris 1992-1999. Russo, R.: Unpublished Roman Republican bronze coins, in: Burnett/Wartenberg/Witschonke (Hrsg.), Coins of Macedonia and Rome: Essays in honour of Charles Hersh. London 1998. Rutter, N. K.: Campanian Coinages 475-380 B. C. Edinburgh 1979. -: Historia Numorum. Italy. London 2001. Ruzicka, L.: Die Münzen von Serdica, in: NZ XLVIII (1915), S. 1-82. Sacks, K. S.: The wreathed Coins of Aeolian Myrina, in: ANSMN 30 (1985), S. 1-43. Sambon, A.: Les Monnaies Antiques de l' Italie. Paris 1903. Scheers, S.: La Gaule Belgique, Numismatique Celtique. Louvain 1983. Scheu, F.: The earliest coins of the Bruttians. Numismatic Chronicle 1955, S. 101 ff. -: Bronze coins of the Bruttians, in: NC 1961, S. 51-66. -: Coinage Systems of Aetolia, in: NC 1960, S. 37-52. -. Silver and gold coins of the Bruttians, in: NC 1962, S. 43-63. Schlumberger, G.: Numismatique de l' Orient latin. Paris 1878. Schönert, E.: Die Münzprägung von Perinthos. Berlin 1965. Schönert-Geiss, E.: Die Münzprägung von Byzantion. 2 Bände, Berlin und Amsterdam 1970 und 1972. -: Die Münzprägungen von Maroneia. Berlin 1987. Schulte, B.: Die Goldprägung der gallischen Kaiser von Postumus bis Tetricus. Aarau 1983. Schulten, P. N.: Die römische Münzstätte Trier. Frankfurt 1974. -: Die Typologie der römischen Konsekrationsprägungen. Frankfurt 1979. Schwabacher, W.: Die Tetradrachmenprägung von Selinunt, in: MBNG XLIII (1925), S. 1-89. -: Lycian Coin Portraits, in: Kraay/Jenkins (Hrsg.), Essays in Greek Coinage presented to Stanley Robinson, Oxford 1968, S. 111-124. Sear, D. R.: Byzantine Coins and their Values. London 1974. -: Greek Imperial Coins. London 1972. -: The History and Coinage of the Roman Imperators. London 1998. Sellwood, D.: An Introduction to the Coinage of Parthia. London 1971. Seltman, C. T.: Athens. Its History and Coinage before the Persian Invasion. Cambridge 1924. -: The Temple Coins of Olympia. Cambridge 1921. -: The Engravers of the Akragantine Decadrachms, in: NC 1948, S. 1-10. Senior, R.: From Gondophares to Kanishka. Glastonbury 1997. -: Indo-Scythian Coins and History. 3 Bände. London 2001. Senior, R. C./MacDonald, D.: The decline of the Indo-Greeks. A re-appraisal of the chronology from the time of Menander to that of Azes. Athen 1998. Seyrig, H.: Monnaies Hellénistiques, in: RN 1963, S. 1-64. -: Monnaies hellénistiques de Byzance et de Chalcédoine, in: Kraay/Jenkins (Hrsg.), Essays in Greek Numismatics presented to Stanley Robinson, Oxford 1968, S. 183-200. Shore, F. B.: Parthian Coins & History. Quarryville 1993. Simonetta, B.: The Coins of the Cappadocian Kings. Fribourg 1977. Sjöqvist, E.: Numismatic Notes from Morgantina I. The SIKELIWTAN Coinage, in: ANSMN IX (1960), S. 53-63. Sammlung Arthur Bally-Herzog. Auktion Münzen und Medaillen AG 93, Basel 2003. Münzen von Korinth. Sammlung BCD. Auktion Lanz 105, München 2001. Münzen von Euboia. Sammlung BCD. Auktion Lanz 111, München 2002. Sammlung BCD. Auktion Leu 90, Zürich 2004. The BCD Collection of the Coinage of Boiotia. Auktion Triton IX, New York 2006. Sammlung Hans Hermann Gutknecht, Auktion Münzen und Medaillen GmbH 17, Stuttgart 2005. Collection R. Jameson. Tome I-III. Paris 1913-1924. Martini, R.: Collezione Pangerl. Contromarche Imperiali Romane (Augustus-Vespasianus). Milano 2003. Mazzini, G.: Monete imperiali romane. Milano 1957-1958. Catalogue des Monnaies Greques antiques, Auktion Kat. Naville + Cie. I, Genf 1920. Savio, A.: Katalog der alexandrinischen Münzen der Sammlung Dr. Christian Friedrich August Schledehaus im Kulturgeschichtlichen Museum Osnabrück. Bramsche 1997. The John J. Slocum Collection of Coins of the Crusades, Auktion Sotheby’s LN 7145, London 1997. Sammlung Franz Trau. Münzen der römischen Kaiser. Auktion Gilhofer & Ranschburg/Adolph Hess A. G. vom 22. Mai 1935. Ilisch, L.: Sylloge Nummorum Arabicorum. Palestina IV. Tübingen 1993. Sylloge Nummorum Graecorum. The Collection of the American Numismatic Society. New York 1961 ff. -: Ashmolean Museum, Oxford. London 1976 ff. -: Sammlung v. Aulock, Deutschland. Berlin 1957-1968. -: The Burton Y. Berry Collection. New York 1961 ff. -: The British Museum. London 1993. -: The Royal Collection of Coins and Medals, Danish National Museum. Copenhagen 1942-1979. -: Bibliothèque Nationale, Collection Jean et Marie Delepierre. Paris 1983. -: Collection Rena H. Evelpidis, Athenes. Louvain 1970 ff. -: Fitzwilliam Museum, Leake and General Collection. London 1940 ff. -: Bibliothèque Nationale, Cabinet des Medailles. Paris 1993 ff. -: The Muharrem Kayhan Collection. Istanbul 2002. -: The Erkki Keckman Collection in the Skopbank, Helsinki. Helsinki 1994. -: Switzerland I, Levante-Cilicia. Bern 1986 ff. -: The Lloyd Collection. London 1933. -: The Lockett Collection. London 1938 ff. -: Civiche Raccolte Numismatiche. Milano 1988 ff. -: The John Morcom Collection of Western Greek bronze Coins. Oxford 1995.

339


SNG München SNG Pfalz SNG Righetti SNG Spaer SNG Tübingen Spaer

= = = = = =

Spijkerman S./S. Starr Stumpf

= = = =

Sutherland Svoronos

= = = = = = = = =

Syd. Taylor Thompson

= =

Touratsoglou Traeger Troxell

Tudeer Tziambazis Varbanov Vecchi

= = = = = = = = =

Vismara Vogt

= = = = = =

Waddington

=

Waggoner

= = =

Wallace Weber Coll. Weidauer Weiser

= = = = =

Wenninger Westermark

= = =

Westermark/Jenkins Williams

= = = = = = = = = = = = = =

Work Wruck Yarkin Youroukova Ziegaus Ziegler Zoega Zschucke

340

-: Staatliche Münzsammlung München. Berlin 1968 ff. -: Pfälzer Privatsammlungen. München 1993 ff. -: Katalog der Sammlung Jean-Pierre Righetti im Bernischen Historischen Museum. Bern 1993. -: The Arnold Spaer collection of Seleucid coins. Jerusalem 1998. -: Münzsammlung der Universität Tübingen. Berlin 1981 ff. -: Spaer, A.: More on the ‘Ptolemaic’ Coins of Aradus, in: Le Rider/Jenkins/Waggoner/Westermark (Hrsg.), Kraay-Mørkholm Essays, Louvain-la-Neuve 1989, S. 267-273. Spijkerman, A.: The Coins of the Decapolis and Provincia Arabia. Jerusalem 1978. Spengler, W. F./Sayles, W. G.: Turkoman Figural Bronze Coins and their Iconography. Lodi 1992. Starr, Ch. G.: Athenian Coinage. Oxford 1970. Stumpf, G. R.: Numismatische Studien zur Chronologie der römischen Statthalter in Kleinasien (122 v.-163 n. Chr.). Saarbrücken 1991. Sutherland, C. H. V.: The Cistophori of Augustus. London 1970. Svoronos, J. N.: ΤΑ ΝΟΜΙΣΜΑΤΑ ΤOΥ ΚΡΑΤΟΥΣ ΤΟΝ ΠΤΟΛΕΜΑΙΩΝ. Athen 1904. -: L’Hellénisme primitif de la Macédoine, Paris 1919. -: Les monnaies d' Athènes. München 1923 ff. -: Numismatique de la Crète ancienne. Nachdruck Bonn 1972. Sydenham, E. A.: The Coinage of the Roman Republic. London 1952. -: The Coinage of Caesarea in Cappadocia. London 1933. Taylor, J. J.: Bronze Age Goldwork of the British Isles, Cambridge 1980. Thompson, M.: The New-Style Silver Coinage of Athens. 2 Bände. ANS, Numismatic Studies 10. New York 1961. -: The mints of Lysimachos, in: Kraay/Jenkins (Hrsg.), Essays in Greek coinage presented to Stanley Robinson. Oxford 1968. -: Posthumous Philipp II Staters of Asia Minor, in: Scheers, S. (Hrsg.), Studio Paulo Naster Oblata. Leuven 1982, S. 57-65. -: Alexander’s Drachm Mints II: Lampsacus and Abydus. New York 1991. Touratsoglou, I.: Die Münzstätte von Thessaloniki in der römischen Kaiserzeit. Berlin 1988. Traeger, B.: Itanos. Europas maritimes Sprungbrett der Antike nach Afrika, in: NNB 2/1999, S. 55-63. Troxell, H. A.: Arsinoe’s Non-Era, in: ANSMN 28, (1983), S. 35-70. -: The Coinage of the Lycian League. New York 1992. -: Carians in Miniature, in: Houghton, A. u. a. (Hrsg.), Festschrift für Leo Mildenberg. Wetteren 1984, S. 249-257. -: Orontes, Satrap of Mysia, in: SNR 60 (1981), S. 27-37. Studies in the Macedonian Coinage of Alexander the Great. New York 1997. Tudeer, L. O. Th.: Die Tetradrachmenprägung von Syrakus in der Periode der signierenden Künstler. Berlin 1913. Tziambazis, E.: A Catalogue of the Coins of Cyprus (from 560 B.C. to 1571 A.D.). Larnaca 2001-2002. Varbanov, I.: Greek Imperial Coins. Bourgas 2005. Vecchi, I. G.: Italian cast Coinage. London 1979. -: The coinage of the Rasna: a study in Etruscan numismatics, in: SNR 67-78 (1988-1999). Vismara, I. G.: Monetazione arcaica della Lycia. Vol. I-III. Milano 1989-1996. Vogt, J.: Die alexandrinischen Münzen. Grundlegung einer alexandrinischen Kaisergeschichte. Band I+II. Stuttgart 1924. Waddington, W.; Babelon, E. und Reinach, Th.: Recueil général des monnaies grecques d´Asie Mineure. Band I-4, Paris 1904-1912. Waggoner, N. M.: Early Greek Coins from the Collection of Jonathan P. Rosen. New York 1983. -: Further reflections on Audoleon and his Alexander mint, in: RBN 129 (1983), S. 5-21. -: A new Wrinkle in the Hellenistic Coinage of Antioch/Alabanda, in: Le Rider/Jenkins/Waggoner/Westermark (Hrsg.), Kraay-Mørkholm Essays, Louvain-la-Neuve 1989, S. 283-290. Wallace, W. P.: The Euboian League and its Coinage. New York 1956. Forrer, L.: The Weber Collection. London 1922 ff. Weidauer, L.: Probleme der frühen Elektronprägung. Fribourg 1975. Weiser, W.: Katalog der ptolemäischen Bronzemünzen der Sammlung des Instituts der Altertumskunde der Universität Köln. Opladen 1995. -: Katalog der bithynischen Münzen der Sammlung des Instituts für Altertumskunde der Universität zu Köln. Band 1. Nikaia. Opladen 1983. Wenninger, A.: Zur Münzprägung der Stadt Syangela in Karien, in: NNB 11/1980, S. 388. Westermark, U.: Das Bildnis des Philetairos von Pergamon. Stockholm 1960. -: Himera: The Coins of Akragantine Type, in: Amandry/Hurter/Bérend (Hrsg.), Travaux de Numismatique grecque offerts a Georges Le Rider, London 1999, S. 409-434. Westermark, U. und Jenkins, K.: The Coinage of Kamarina. London 1980. Williams, R. T.: The silver Coinage of the Phokians. London 1972. -: The silver Coinage of Velia. London 1992. -: The Confederate Coinage of the Arcadians in the Fifth Century B.C. New York 1965. Work, E: The earlier staters of Heraclea Lucaniae, New York 1940. Wruck, W.: Die syrische Provinzialprägung von Augustus bis Traian. Stuttgart 1931. Yarkin, U.: The Coinage of Syangela in Caria, in: NC 1975, S. 12-18. Youroukova, Y.: Coins of the Ancient Thracians. Sofia 1976. Ziegaus, B.: Das Geld der Kelten und ihrer Nachbarn. München 1994. Ziegler, R.: Münzen Kilikiens aus kleineren deutschen Sammlungen. München 1989. Zoega, G.: Numi Aegyptii imperatorii. Rom 1787. Zschucke, C.-F.: Die römische Münzstätte Trier. Trier 1988². -: Die Bronze-Teilstück-Prägungen der römischen Münzstätte Trier. Trier 1989. -: Die römische Münzstätte Köln. Trier 1993.


STICHWORTVERZEICHNIS A

#DDCKVKU #DFGTC #D[FQU #ECTPCPKC #FTCO[VVGKQP #GFWK #GIKPC #GI[RVWU  #GQNKU #GUGTPKC #I[TKQP #KICK #KIGCK #KIQURQVCOQK #KPQU #KVPCK #KVQNKC #K\CPKU #MCPVJQU #MG2VQNGOCKU #MTCICU #NCDCPFC #NCKUC #NGZCPFTKC #GI[RVWU  #NGZCPFTKC6TQCU #NGZCPFTKPGT #OCUKC #OCVJQU #ODKCPK #OKUWU #ORJKRQNKU #PCMVQTKQP #PC\CTDQU #PEJKCNQU #PGOWTKQP #PM[TC #PVCPFTQU #PVKQEJKC #PVKQEJKC2KUKFKCG #RCOGKCCO1TQPVGU #RCOGKC-KDQVQU #RJTQFKUKCU2NCTCUC #RJ[VKU #RVGTC #RWNKC #TCDKC(GNKZ #TCFQU #TECFKC #TIQNKU #TIQU#ORJKNQEJKMQP #TUG5CIWPVWO #URGPFQU #UUCO #UUQU #UV[TC #VCTPGWU #VJGP #VTGDCVGU

#VVKEC #WNGTEK&KCDNKPVGU #ZWO

B

$CD[NQP $CD[NQPKC $CEVTKC $CTI[NKC $CTUEWPGU $GNIKEC $GT[VQU $KNDKNKU $KT[VKU $KVJ[PKC $QGQVKC $QJGOKC $QKGT $QURQTWU  $QVVKMG $TGVVKK $TKVCPPKC $TWPFKUKWO $TWVVKWO $WDQP $[DNQU $[\CPVKPKUEJG/Ã&#x2019;P\GP $[\CPVKQP $[\CP\

C

%CGUCTGC%CRRCFQEKCG %CGUCTGC2CPGCU %CNCDTKC %CNGU %CORCPKC %CRRCFQEKC %CTKC %CTPWVGU %CTVJCIQ0QXC %CUVWNQ %JCDCMVC %JCNMKU'WDQGCG %JCNMKU %QGNGU[TKC  %JKQU %KNKEKC  %QNQPKC%CGUCTCWIWUVC %QOOCIGPG %QTE[TC %QTKPVJKC %TGVC %[RTWU %[TGPCKEC

D

&CTFCPQU &GTTQPGU &KMCKC &KQP[UQRQNKU

341


&WTQVTKIGU &[TTJCEJKWO

E

'DWUWU 'MWCNCMQU 'NCKC 'NCKWUUC5GDCUVG 'NGWUKU 'NKU 'NWUCVGU 'PVGNNC 'RJGUQU  'RKFCWTQU 'RKTWU 'TGVTKC 'T[VJTCK 'T[Z 'VGPPC 'VTWTKC 'WDQGC 'WOGPGKC

G

)CFGU )CNCVKC )CNNKC )CODTGKQP )CTICTC )GIGPUVGORGN  )GNC )GTIKU )GTOCPKC )QTV[PC )TKGEJKUEJG/ÒP\GP )TQUUOQIWNGKP+PFKGP )WRVCKP+PFKGP )[TVQP

H

*CFTKCPQRQNKU *CFTKCPQVJGTCK *CNKMCTPCUUQU *CTRCIKQP *GMCVQPPGUQK *GNKQRQNKU *GTCMNGKC +QPKC  *GTCMNGKC .WECPKC  *KGTCRQNKU-CUVCDCNC *KGTCRQNKU2JT[IKCG *KGTQMCKUCTGKC *KOGTC *KURCPKC  *[DNC/GICNG *[GNGUKGJG8GNKC *[RCKRC

I

+CUQU +NKQP 342

+NKRGPUG +NN[TKEWO +ORGTCVQTKUEJG2T·IWPIGP +PFKC +QNNC +QPKC   +UVTQU +VCNKC +WFCGC

J

,QJCPPKVGTCWH4JQFQU

K

-CKPQP -CNEJGFQP -CNNCVKU -COCTKPC -COKTQU -CORCPQK -CTVJCIQ -CVCPG -CWPQU -GDTGP -GNGPFGTKU -GNVKUEJG/ÒP\GP -GPVQTKRCK -GRJCNNGPKC -GRJCNQKFKQP -KFCTKVGPKP+PFKGP -KGTKQP -KQU -KUVJGPG -NC\QOGPCK -PKFQU -PQUUQU -ÌPKIGXQP8KLC[CPCICT -QNQRJQP -QOCOC -QPVGTDKC-CTDKMC -QTKPVJ -QTQRKUUQU -QT[MQU -QU -TCIQU -TCPPQP -TGW\HCJTGT -TQVQP -UJCJCTCVCU -WUJCP -[FQPKC -[OG -[\KMQU

L

.COKC .CORUCMQU .CQFKMGKC 2JT[IKC  .CQFKMGKC 5[TKC  .CTKUUC2JTKMQPKU .CTKUUC6JGUUCNKCG


.CTKUUC6TQCFKU .CVGKPKUEJGU-CKUGTTGKEJXQP%QPUVCPVKPQRGN .GIKQPURT·IWPIGP .GQPVKPQK .GUDQU .GVG .GWMCK .GWMCU .GXCPVKPKUEJG$GKUEJN·IG .KN[DCKQP .QETKU .QMTKU1RWPVKC .QMTQK'RK\GRJ[TKQK .QRCFWUC .QVU .WECPKC .[EKC .[FKC 

M

/CEGFQPKC /CIPGUKC /CIPGVGU /CKQPKC /COGTVKPQK /CONWMGP /CPVKPGKC /CTMKCPQRQNKU /CTQPGKC /CUKM[VGU /CUUCNKC /GFOC /GICNQRQNKU /GICTC /GICTKU /GNFK /GPCKPQP /GUGODTKC /GUUCPC /GUUGPG /GUUGPKC /GVCRQPV /KNGV /KNGVQRQNKU /QGUKC /QNQUUQK /QTICPVKPC /QV[C /WYCJJKFGP /[NCUC /[PFQU /[QWU /[TKPC /[UKC  /[UQTG /[VKNGPG

N

0CIKFQU 0GCPFTGKC 0GCRQNKU%CORCPKCG 0GCRQNKU %CTKC 

0GOCWUWU 0GQPVGKEJQU 0GUQU 0KECGC 0KMQOGFKC 0KMQRQNKU 'RKTWU  0KMQRQNKURTQU+UVTQP 0KU[TQU 0WEGTKC 0WOKFKC 0[UC

O

1DWNEQ 1FGUUQU 1KPKCFCK 1NDC 1NDKC 1N[ORKC 1N[PVJQU 1RJT[PKQP 1TKGPVCNKUEJG/Ã&#x2019;P\GP 1UVIQVGP

P

2CGQPKC 2CGUVWO 2CNG 2CORJ[NKC 2CPPQPKC 2CPQTOQU 2CPVKMCRCKQP 2CRJNCIQPKC 2CTKQP 2CTQTGKC 2CTVJKC 2GNQRQPPGUWU 2GNVCK 2GTICOQP 2GTIG 2GTTJCKDQK 2GTUKC 2GTUKU 2GVGNKC 2JCKUVQU 2JCNCPPC 2JCTPCMGKC 2JCTUCNQU 2JCUGNKU 2JKNCFGNRJKC 2JKNKRRK 2JKNKRRQRQNKU 2JKUVGNKC 2JNKCUKC 2JNKWU 2JQGPKEKC  2JQMCKC 2JT[IKC 2KCMQU 2KPCTC 2KUKFKC 2NCMKC 2QPVWU 343


2QRWNQPKC 2QUGKFQPKC 2TCKUQU 2TKCRQU 2TQMQPPGUQU 2WPKGT

R

4JCWMQU 4JGIKQP 4JQFQU 4GVJ[OPQP 4ÌOKUEJG/ÒP\GP

S

5CD·GT 5CKVK5CGVCKDK 5CKVVC 5CNC 5CNCOKU 5COPKWO 5COQU 5COQVJTCMG 5CTFGKU 5CTFKPKC 5CUCPKFGP 5E[VJKC 5GDCUVG 5GEQDKTKEGU 5GIGUVC 5GIQDTKIC 5GMCKUC 5GNGWMGKC 5GNGWMGKC2KGTKC 5GNIG 5GNKPWU 5GPQPGU 5GUVQU 5KEKNKC 5KE[QPKC 5KFG 5KFQP 5KM[QP 5KNN[QP 5KPQRG 5MGRUKU 5O[TPC 5QNQK 5QNQWU 5VGORGNUEJPGKFGT 'WCKPGVQU 'WMNGKFCU -KOQP /CGUVTQFGNNC(QINKC 2JT[IKNNQU 5QUKQP 5VTCVQPKMGKC 5WGUUC#WTWPEC

344

5WNVCPCV)WLCTCV 5WNVCPCV,CWPRWT 5[CPIGNC 5[DCTKU 5[TCMWU 5[TKC 

T

6CTGPV 6CTTCEQ 6CTUQU  6CWTQOGPKWO 6CXKQP 6GCVG 6GNOGUUQU 6GOPQU 6GQU 6GTOGUUQU 6JCUQU 6JGDG 6JGDGP 6JGTOCK*KOGTCKCK 6JGUUCNKC 6JGUUCNQPKEC 6JTCEKC  6JWTKQK 6J[CVGKTC 6J[TTJGKQP 6NQU 6QOKU 6TCIKNQU 6TCNNGU 6TCRG\WPV 6TKPQXCPVGU 6TKRQNKU 6TQCU 6TQLCUKGJG+NKQP 6WFGT 6[TQU

U

7ODTKC 7TCPQRQNKU

V

8GNKC 8GVWNQPKC 8KDQ8CNGPVKC 8KPFGNKMGT 8ÌNMGTYCPFGTWPI

W

9GUVIQVGP

Z

<GWIKVCPKC


Künker in Berlin

Künker‘s Berlin branch

Termine telefonisch unter +49 (0)541 96 20 20

For appointments call +49 (0)541 96 20 20

Seit dem 24. Juli ist unser Berliner Büro jeden Dienstag zwischen 10 und 17 Uhr für Sie geöffnet. An diesen Tagen beraten unsere Experten Sie gerne. Selbstverständlich nehmen wir auch Ihre Einlieferungen zu unseren nächsten Auktionen entgegen oder kaufen Ihre Münzen oder Medaillen an.

We will be happy to welcome you in our new office in Berlin, open since Juli 24, 2007. Our numismatic experts will assist you every Tuesday from 10 am - 5 pm.

Sollten Sie einen anderen Termin oder einen Besuch bei Ihnen zu Hause wünschen, bitten wir um einen Anruf unter der oben stehenden Telefonnummer.

Should you need an appointment on another day or wish us to visit you at home, please call us at the abovementioned telephone number.

At the new branch we will accept your consignment for our upcoming auctions or purchase your coins and medals.

Poststraße 22 · 10178 Berlin · Germany Öffnungszeiten: Jeweils Dienstag 10-17 Uhr Opening hours: eyery Tuesday 10 am - 5 pm www.kuenker.de · service@kuenker.de

345


346


Medici-Vase. Berlin, KPM, um 1823. H 71,6 cm. Verkauft für e 128.000,-

Herbstauktionen 2007 16. Nov. 17. Nov. 28. Nov. 29. Nov. 1. Dez. 7./8. Dez.

Kunstgewerbe Alte Kunst Moderne Kunst Zeitgenössische Kunst Photographie Asiatische Kunst

Einlieferungen sind jetzt willkommen. Unsere Experten beraten Sie gerne.

Berlin-Auktion Frühjahr 2008 Hochbedeutende Berliner Porzellane sowie Gemälde und Zeichnungen

Neumarkt 3 50667 Köln Tel. 02 21 ⁄ 92 57 29 - 0 Fax - 6 Poststraße 22 10178 Berlin Tel. 030 ⁄ 27 87 60 8 -0 Fax - 6 www.Lempertz.com info@Lempertz.com 347


348


NUMISMATISCHE AUSDRÜCKE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von aller größter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn Ziseliert

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse traces of inscription flan flan defect weakly struck rare in this condition rare year die(s) mistake in the die extraordinary condition overstruck unpublished unique specimen gilt extremely rare head tiny flan ornamental border tin chased

frappe en tranche frotté plomb decentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe champ de trésor monnaie commemorative lissé troué frappé ondulé patine dorée joli siécle petit traces de corrosion rayure cuivre alliace légère gauche minimal imitation pièce magnifique de frappe molle défaut sur la tranche erreur sur la tranche inscription sur la tranche droite revers traces de légende flan Flan défectueux de frappe molle conservation rare année rare coin erreur de frappe conservation extraordinaire surfrappé inédit pièce unique doré très rare en face petit flan tranche ornée étain ciselé

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda tondello errore di tondello conio stanco conservazione rara annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Mehrwertsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die zur Zeit gültige, ermäßigte Mehrwertsteuer von 7 % erhoben. Papiergeld unterliegt ebenfalls dem ermäßigten Steuersatz. Goldmünzen, bei denen Zuschlagpreis und Aufgeld geringer ist als das zweieinhalbfache des Metallpreises, unterliegen dem normalen Mehrwertsteuersatz von zur Zeit 19 %, ebenso historische Wertpapiere. Goldmünzen, die als Anlagegold gelten, sind mehrwertsteuerfrei. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in € - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf dem Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Mindestangebote

werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Tag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Mindeststeigerungsstufe Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 100,--

€ 5,--

bis zu

€ 300,--

€ 10,--

bis zu

€ 1.000,--

€ 20,--

Für Büchersendungen und Sendungen ins Ausland werden Versandkosten nach Aufwand in Rechnung gestellt.

bis zu

€ 1.500,--

€ 50,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 3.000,--

€ 100,--

bis zu

€ 10.000,--

€ 200,--

bis zu

€ 20.000,--

€ 500,--

ab

€ 20.000,--

€ 1.000,--

DIE VERSTEIGERER:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the reduced VAT (value added tax=Mehrwertsteuer) of 7 per cent as presently applicable, which is payabel additionally. The reduced VAT applies also to paper-money. Gold coins for which the hammer-price plus surcharge is less than two and ohne half times the intrinsic gold price, are subject to the normal VAT rate of presently 19 per cent. The same applies to historical bonds. Gold coins which are considered as a gold investment are free of VAT. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law. Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awardet item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sende of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted.

The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only dischare such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s).

up to

€ 100,--

€ 5,--

up to

€ 300,--

€ 10,--

up to

€ 1.000,--

€ 20,--

up to

€ 1.500,--

€ 50,--

Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde.

up to

€ 3.000,--

€ 100,--

Shipment to foreign countries and shipment of books we charge upon expenses.

up to

€ 10.000,--

€ 200,--

The prices realized will be published in the form of a list immediately after the auction.

up to

€ 20.000,--

€ 500,--

above

€ 20.000,--

€ 1.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours befor auction. If necessary, the auctioneer is alloweed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the same

THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP


NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Spreu, Dr. Sebastian Steinbach, Jens Ulrich Thormann M. A., Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuerte systeme waiblingen media-print, Paderborn Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

BANKVERBINDUNGEN DEUTSCHE BANK OSNABRÜCK DRESDNER BANK OSNABRÜCK SPARKASSE OSNABRÜCK VOLKSBANK BORGLOH-HILTER E. G. BANKHAUS LAMPE KG BIELEFELD POSTBANK HANNOVER CREDIT SUISSE

BLZ 265 700 90, Konto 0 177 006 BLZ 265 800 70, Konto 780 520 200 BLZ 265 501 05, Konto 247 320 BLZ 265 624 90, Konto 1 200 222 400 BLZ 480 201 51, Konto 174 076 BLZ 250 100 30, Konto 2900 60 - 308 Konto 135 494 - 42 - 1

Zahlungen aus dem Ausland - Foreign payments SPARKASSE OSNABRÜCK DEUTSCHE BANK OSNABRÜCK POSTBANK HANNOVER CREDIT CARDS

IBAN: DE50 2655 0105 0000 2473 20 SWIFT-CODE: NOLADE22XXX IBAN: DE11 2657 0090 0017 7006 00 SWIFT-CODE: DEUTDE3B265 IBAN: DE73 2501 0030 0290 0603 08 SWIFT-CODE: PBNKDEFF We do accept VISA and MASTERCARD Service charge: 4,5 %

ERHALTUNGS- UND SELTENHEITSGRADE ERHALTUNGSGRADE/ GRADING TERMS DEGRÉS DE CONSERVATION GRADI DI CONSERVAZIONE

SELTENHEITSGRADE

Polierte Platte Proof

Flan bruni Fondo specchio

Stempelglanz Uncirculated

Fleur de coin Fior di conio

Vorzüglich Extremely fine

Superbe Splendido

Sehr schön Very fine

Très beau Bellissimo

Schön Fine

Beau Molto Bello

Gering erhalten Very good

Très bien conservé Bello

R = Selten Von großer Seltenheit

RR = Sehr selten Von größter Seltenheit

Profile for Fritz Rudolf Kuenker GmbH & Co. KG

Auktion 133 Künker  

Griechische Bronzemünzen - Die Sammlung Friedrich Popken, Münzen der Antiken Welt mit Spitzenstücken aus prominenten Sammlungen

Auktion 133 Künker  

Griechische Bronzemünzen - Die Sammlung Friedrich Popken, Münzen der Antiken Welt mit Spitzenstücken aus prominenten Sammlungen