Page 1


114. AUKTION DEUTSCHE MÜNZEN AB 1871 IN GOLD UND SILBER ORDEN UND EHRENZEICHEN 22. Juni 2006 Steigenberger Hotel Remarque Osnabrück Natruper-Tor-Wall 1 Hotel-Telefon (05 41) 60 96 633 Hotel-Fax (05 41) 60 96 634 (nur während der Auktion/only during the auction/ uniquement pendant la vente/solamente durante l'asta)

ZEITPLAN AUKTIONEN 112 - 114 AUKTION 112 DIE BIBLIOTHEK DES NUMISMATIKERS PROF. DR. PETER BERGHAUS U. A.

Dienstag, den 20. Juni 2006 10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 620 14.00 Uhr - 15.00 Uhr Nr. 621 bis Nr. 847

GOLDMÜNZEN AUS DREI JAHRTAUSENDEN

AUKTION 113 MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT DIE SAMMLUNG DR. MARTIN SELLMANN U. A.

AUKTION 113

15.00 Uhr - 18.30 Uhr Nr. 1001 bis Nr. 1753 Mittwoch, den 21. Juni 2006 10.00 Uhr - 13.00 Uhr Nr. 2001 bis Nr. 2659 14.00 Uhr - 18.30 Uhr Nr. 2660 bis Nr. 3587 Donnerstag, den 22. Juni 2006 10.00 Uhr - 13.00 Uhr Nr. 3588 bis Nr. 4236 14.00 Uhr - 15.00 Uhr Nr. 4237 bis Nr. 4383

AUKTION 114 DEUTSCHE MÜNZEN AB 1871 IN GOLD UND SILBER

15.00 Uhr - 17.00 Uhr Nr. 6001 bis Nr. 6547

ORDEN UND EHRENZEICHEN

17.00 Uhr - 18.30 Uhr Nr. 7001 bis Nr. 7310

Detaillierter Zeitplan siehe Seite 5 Besichtigungen siehe Seite 8 Horaire détaillé voir page 5 Exposition des monnaies voir page 8

Detailed timetable view page 5 Viewing of auction good view page 8 Calendario dettagliato veda pagina 5 Esposizione veda pagina 8


UNSERE ADRESSE OUR ADDRESS

Fritz Rudolf Künker e. K. Münzenhandlung Gutenbergstr. 23 · 49076 Osnabrück Telefon: 05 41-96 20 20 Telefax: 05 41-96 20 222 Gebührenfreie Rufnummer: 08 00-58 36 537 International calls: International fax:

+49 (0)5 41-96 20 20 +49 (0)5 41-96 20 222

Während der Auktion/During the auction Steigenberger Hotel Remarque: Telefon: Fax:

+49 (0)5 41-60 96 633 +49 (0)5 41-60 96 634

Ust.-Id.-Nr.: DE 117 620 142 UNSERE GESCHÄFTSZEITEN OPENING HOURS

Montag-Donnerstag Freitag Sonnabend Saturday

9.00 - 17.00 Uhr 9.00 - 15.30 Uhr nach Vereinbarung by prior appointment

Außerhalb unserer Geschäftszeit steht unseren Kunden ein automatischer Anrufbeantworter zur Verfügung. Answering machine available after opening hours.

WWW.KUENKER.DE E-MAIL: INFO@KUENKER.DE

Auf unserer Internetseite haben Sie die Möglichkeit: • die Abbildungen zu vergrößern • Ihre Gebote direkt per Email abzugeben • die Ergebnisse der Auktionen abzurufen On our website you have the possibility: • to zoom all images • to place your bids • to view all auction results

IHRE ANSPRECHPARTNER CONTACT

Abwicklung der Aufträge und Einlieferungen

Gisela Thomas, Prokuristin Telefon: (05 41) 96 20 221 Annahme von Einlieferungen Staff members accepting consignments

Dr. Andreas Kaiser Telefon: (05 41) 96 20 254 Arne Kirsch, Prokurist Telefon: (05 41) 96 20 234 Oliver Köpp, Prokurist Telefon: (05 41) 96 20 229 Jens-Ulrich Thormann MA (Antike Münzen) Telefon: (05 41) 96 20 242 Mitglied Verband der Deutschen Münzenhändler e. V. Associaton Internationale des Numismates Professionnels (AINP) 2


HINWEISE FÜR UNSERE BIETENDEN AUKTIONSKUNDEN 1. 2.

Die Auktionsbedingungen finden Sie am Ende dieses Katalogs. Bitte senden Sie uns Ihre Aufträge möglichst frühzeitig zu. Wenn uns Ihr Auftrag erst kurz vor der Auktion erreicht, können sich bei der Bearbeitung Fehler einschleichen. 3. Das beiliegende Formular macht es Ihnen leicht, ein schriftliches Gebot abzugeben. Falls Sie Ihre Gebote faxen möchten: unser Telefax 0541 96 20 222 steht Ihnen Tag und Nacht zur Verfügung. 4. Die von Ihnen ersteigerten Objekte werden Ihnen innerhalb von acht Tagen nach Beendigung der Auktion zugeschickt. Die Aufträge werden in der Reihenfolge des Eingangs bearbeitet, d. h. die zuerst eingegangenen Aufträge werden auch zuerst bearbeitet. Auch alle Bieter, die keinen Zuschlag erhalten haben, werden von uns nach der Auktion benachrichtigt. 5. Wenn Sie telefonisch bieten möchten, rufen Sie bitte vor der Auktion unseren Kundenservice an. Frau Thomas freut sich auf Ihren Anruf entweder direkt unter 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37. 6. Wenn Sie als neuer Kunde noch nicht bei uns gekauft haben, ist es empfehlenswert, wenn Sie uns Referenzen angeben. Nennen Sie uns eine Münzhandlung, mit der Sie bereits in Geschäftsverbindung stehen. Oder rufen Sie unseren Kundenservice an. Telefon 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37. 7. Unsere Broschüre “DIE KÜNKER-AUKTIONEN: WIE BIETE ICH ERFOLGREICH?“ liegt in jedem Katalog und ist für Sie eine nützliche Hilfe. 8. Die Echtheit aller verkauften Objekte wird auch über die gesetzliche Frist hinaus gewährleistet. 9. Alle Kunden, die als Bieter an einer unserer Auktionen teilnehmen, erhalten innerhalb von zwei Wochen nach der Auktion unsere Ergebnisliste gratis. 10. Sie haben Fragen zu einer bestimmten Münze? Sie möchten persönlich an unserer Auktion teilnehmen? Sie haben andere Fragen? Unser Kundenservice freut sich auf Ihren Anruf, entweder direkt unter 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37.

RENSEIGNEMENTS A L'ATTENTION DE NOS CLIENTS DES VENTES AUX ENCHERES 1.

Vous trouverez les conditions générales de vente aux enchères à la fin de ce catalogue. 2. Veuillez-nous faire parvenir vos ordres le plus tôt possible. Si vos ordres nous parviennent juste avant la vente aux enchères, des erreurs risquent d’être commises lors de leur traitement. 3. Le formulaire ci-joint vous aidera à rédiger facilement votre offre. Si vous souhaitez faxer votre offre, vous pourrez-le faire 24 heures sur 24 au +49 (0)541 – 96 20 222. 4. Les objets dont vous serez adjudicataire vous seront envoyés dans les huit jours suivant la fin de la vente aux enchères. Les commandes seront prises en compte dans l’ordre de leur arrivée, c’est-à-dire que les commandes nous parvenant les premières seront d’abord traitées. Après la vente aux enchères, nous préviendrons tous les enchérisseurs n’ayant pas obtenu l’adjudication. 5. Si vous souhaitez faire des enchères par téléphone, veuillez appeler aupravant notre service clientèle. Madame Thomas sera heureuse de vous répondre directement au +49 (0)541 – 96 20 221. 6. Si vous êtes un nouveau client et n’avez encore fait aucune acquisition chez nous, il serait conseillé de nous fournir quelques références. Indiquez-nous si vous traitez déjà avec un professionnel du commerce des monnaies. Ou contactez notre service clientèle au +49 (0)541 – 96 20 221. 7. Notre brochure intitulée : »DIE KÜNKER-AUKTIONEN : WIE BIETE ICH ERFOLGREICH?“ (»Les ventes aux enchères de Künker : comment faire une enchère réussie ? « ) jointe dans chaque catalogue vous sera très utile. 8. L’authenticité des pièces vendues sera garantie même au-delà des délais légaux. 9. Tous les clients participant à l’une de nos ventes aux enchères en tant qu’enchérisseurs recevront gratuitement une liste de résultats dans les deux semaines suivant la vente aux enchères. 10. Vous avez des questions concernant une pièce particulière ? Vous désirez prendre part personnellement à notre vente aux enchères ? Vous avez d’autres questions ? Notre service clientèle se fera un plaisir de vous répondre au +49 (0)541 – 96 20 221.

IMPORTANT INFORMATION FOR PLACING BIDS 1.

The terms and conditions of the auction can be found at the end of this catalogue. 2. Please send us your instructions as early as possible. The likelihood of errors occurring increases if we do not receive your instructions until shortly before the auction. 3. The enclosed form makes it simple for you to submit a written bid. Our fax machine +49 (0)541 – 96 20 222 is on standby day and night in case you wish to fax your bids. 4. The objects which you purchase will be delivered to you within eight days of the close of auction. Instructions are processed in the same order as they were received – in other words, the first instructions to be received are the first to be processed. All unsuccessful bidders will be also informed after the auction. 5. If you would like to bid by telephone, please ring our customer service beforehand. Mrs. Thomas will be pleased to speak to you on +49 (0)541 96 20 221. 6. If you are a new customer who has not yet bought anything through us, we recommend that you give us references. Name a coin dealer with whom you have already done business. Or call our customer service on +49 (0)541 – 96 20 221. 7. Our brochure „DIE KÜNKER-AUKTIONEN: WIE BIETE ICH ERFOLGREICH?“ ("The Künker auctions: How to bid successfully?“) is enclosed in every catalogue and will prove useful to you. 8. The genuineness of all sold objects is also warranted beyond the statutory length of time. 9. All customers who participate as bidders in our auction receive our list of results free of charge within two weeks of the close of auction. 10. Do you have questions about a particular coin? Would you like to participate personally in our auction? Do you have any other questions? Our customer service team will be pleased to help you – call on +49 (0)541 96 20 221.

INFORMAZIONI PER GLI OFFERENTI DELLE NOSTRE ASTE 1. 2.

Le condizioni d’asta si trovano alla fine di questo catalogo. Siete pregati di inviarci i vostri ordini il più presto possibile. Se il vostro ordine ci perviene poco tempo prima dell’apertura dell’asta, si possono verificare errori nell’elaborazione dello stesso. 3. Per le vostre offerte scritte potete utilizzare il modulo allegato al catalogo. Nel caso voleste trasmettere le vostre offerte per fax, siete pregati di inviarle al seguente numero: +49 (0)541-96 20 222. 4. Gli oggetti che avete acquistato all’asta vi saranno spediti entro otto giorni dal termine della stessa. Gli ordini vengono evasi in base alla data di ricevimento, quindi hanno precedenza quelli pervenuti prima. Anche gli offerenti che non hanno avuta alcuna aggiudicazione riceveranno una nostra comunicazione al termine dell’asta. 5. Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare prima la consulenza ai clienti. La sig.ra Thomas, raggiungibile al numero diretto +49 (0)541- 96 20 221, sará a vostra disposizione. 6. Se siete clienti nuovi e non avete mai acquistato da noi, vi proponiamo di inviarci delle referenze. Dateci il nome di un negozio di monete presso il quale avete già fatto degli acquisti, oppure chiamate la nostra consulenza ai clienti al numero +49 (0)541 96 20 221. 7. Nel nostro opuscolo « DIE KÜNKER-AUKTIONEN : WIE BIETE ICH ERFOLGREICH?“ („Aste Künker: come avere successo nelle offerte?“), allegato ad ogni catalogo, troverete consigli utili. 8. Il certificato d’autenticità di tutti gli oggetti venduti viene rilasciato anche oltre i termini privisti per legge. 9. Tutti i clienti che hanno partecipato ad una nostra asta riceveranno gratuitamente l´elenco delle aggiudicazioni entro quindici giorni dal termine della stessa. 10. Avete delle domande su una moneta in particolare ? Desiderate partecipare personalmente ad una nostra asta? Avete altre domande? Rivolgetevi al nostro Servizio Clienti al numero +49 (0)541 – 96 20 221.

3


WICHTIGE HINWEISE FÜR UNSERE EINLIEFERER 1.

Unser Expertenteam garantiert Ihnen eine fachgerechte Bearbeitung der von Ihnen eingelieferten Stücke. 2. Die Schätzpreise werden von uns aufgrund unserer hervorragenden Marktkenntnisse sorgfältig festgelegt. Die Stücke werden zu 80% der im Katalog angegebenen Schätzpreise ausgerufen. Durch diese Regelung werden Sie als Einlieferer geschützt. Für nicht verkaufte Objekte werden keine Gebühren erhoben. 3. Der Standard unserer Kataloge ist von hoher Qualität und findet internationale Anerkennung. Wir haben eine der besten Kundendateien, die es weltweit gibt. 4, Von der individuellen Betreuung unserer Kunden profitieren auch Sie als Einlieferer. 5. Als Einlieferer erhalten Sie Ihren Auktionserlös innerhalb von 45 Tagen nach der Auktion. Sonderregelungen sind nach Absprache möglich. 6. Auf Wunsch kann Ihre Einlieferung bei Ihnen zuhause abgeholt werden. Ab € 2.500,-- Einlieferungssumme übernehmen wir die Kosten, ab € 25.000,-können wir unter Umständen an einem vereinbarten Ort Ihre Einlieferung nach Absprache gerne auch persönlich entgegennehmen. Selbstverständlich ist Ihr Versteigerungsgut durch uns versichert. 7. Nicht alle Münzen eignen sich, als Einzelstücke aufgenommen zu werden. Vertrauen Sie auf die Erfahrung unserer Experten, die niedrigpreisige Münzen liebevoll zu interessanten Lots zusammenstellen. 8. Der Schätzwert Ihrer Einlieferung sollte mindestens € 1.000,-- betragen. 9. Ihre Einlieferung wird Ihnen sofort bei Übernahme durch ein Protokoll quittiert. Spätestens fünf Wochen vor der Auktion erhalten Sie eine genaue Auflistung Ihrer Objekte mit den dazugehörenden Katalognummern. 10. Innerhalb einer Woche nach der Auktion erhalten Sie bereits die Ergebnisliste und können alle erzielten Preise feststellen. 11. Profitieren Sie von der Anziehungskraft eines führenden Unternehmens. Bitte wenden Sie sich bei Fragen an unseren Kundenservice unter Leitung von Frau Gisela Thomas direkt unter 0541 – 96 20 221 oder gebührenfrei unter 0800 – 5 83 65 37. 12. Unsere Verträge für Einlieferungen können Sie unverbindlich anfordern. Haben Sie noch Fragen? Frau Thomas freut sich auf Ihren Anruf. Telefon: 0541 – 96 20 221 oder gebührenfrei unter 0800 5 83 65 37.

RENSEIGNEMENTS IMPORTANTS A L'ATTENTION DES VENDEURS 1.

Notre équipe d’experts garantit une prise en charge compétente des pièces que vous nous confiez. 2. Notre excellente connaissance du marché nous permet de fixer soigneusement les prix estimés. Les pièces seront mises aux enchères à un prix représentant 80% du prix estimé indiqué dans le catalogue. Cette réglementation vous protège en tant que vendeur. Aucuns frais ne seront prélevés sur les pièces invendues. 3. Nos catalogues ont un niveau qualitatif élevé, reconnu au plan international. Nous disposons d’un des meilleurs fichiers clients du monde. 4. En tant que vendeur, vous profiterez vous aussi du suivi personnalisé que nous offrons à nos clients. 5. Le vendeur recevra le produit de la vente dans les 45 jours qui suivront les enchères. Des dispositions spéciales pourront être prises sur accord préalable. 6. Nous prendrons en charge les frais d´expédition des pièces dont le montant sera supérieur à € 2.500,--: Si leur montant est supérieur à € 25.000,--, l´un de nos employés se poudra charger de prendre la livraison à un lieu concordée. En concertation, notre assurance couvrira tous les risques. 7. Les pièces de monnaie ne se prêtent pas toutes à une vente individuelle. Faites confiance à l’expérience de nos spécialistes qui se chargeront avec plaisir de rassembler les pièces bon marché de manière à constituer des lots intéressants. 8. La valeur estimée des pièces fournies devrait s’élever à un minimum de € 1.000,--. 9. Au moment de la prise en charge, vous recevrez un détail des pièces fournies. Au plus tard cinq semaines avant la vente aux enchères, vous recevrez une liste exacte de vos pièces avec les numéros de catalogue correspondants. 10. Dans la semaine qui suivra la vente aux enchères, vous recevrez déjà la liste de ses résultats et pourrez prendre connaissance des prix obtenus. 11. Profitez de l’attrait du leader du marché. Pour tout renseignement, veuillez-vous adresser à notre service clientèle sous la direction de madame Gisela Thomas : +49 (0)541 – 96 20 221. 12. Vous pouvez demander sans engagement de votre part nos contrats de dépôt de pièces? Vous avez d’autres questions? Madame Thomas sera heureuse de vous répondre au +49 (0)541 – 96 20 221.

4

IMPORTANT INFORMATION FOR OUR CONSIGNERS 1.

Our team of specialists guarantees an expert treatment of the consigned items. 2. The estimates are carefully established by us due to our excellent knowledge of the market. Bidding for the items is then started at 80 % of the estimate price stated in the catalogue. This arrangement protects you as a consigner. Unsold items incur no fees. 3. The standard offered in our catalogue is of the highest quality, and is recognised internationally. We have one of the best clientele lists worldwide. 4. You as a consigner also profit from the individual consultation offered to our customers. 5. As a consigner, you receive the auction proceeds within 45 days of the close of auction. Special arrangements can be made following discussion. 6. For consignments with a value over € 2.500,-- we may bear the transportation costs. For deliveries over € 25.000,-- we may personally collect the items at an arranged place after prior consultation. Upon consultation, the shipping of your goods could be covered by our insurance. 7. Not all coins are suited to be registered as individual items. Trust in our expert´s experience as they carefully combine less-valuable coins into interesting lots. 8. The valuation price of your delivery should be at least € 1.000,--. 9. Your delivery is confirmed in writing immediately on receipt. At least five weeks before the auction, you receive an exact list of your objects with the relevant catalogue numbers. 10. Within a week of the close of auction, you receive a list with the results in order to see what prices were reached for each individual lot. 11. Profit from our position as a leading coin dealer. If you have any questions, please contact our customer service team which is headed by Mrs. Gisela Thomas – directly on +49 (0)541 – 96 20 221. 12. Would you like to receive copies of our contracts for consigner, without making any commitment? Do you have any other questions? Mrs. Thomas will be pleased to help you – please call on +49 (0)541 – 96 20 221.

INFORMAZIONI PER I NOSTRI DEPOSITANTI 1.

Il nostro team di esperti assicura un trattamento accurato dei pezzi che ci avete inviato. 2. Eseguiamo valutazioni finalizzate alla vendita. I prezzi di stima sono frutto della nostra eccezionale conoscenza del mercato e della nostra attenta valutazione. La base d´asta ammonta all´80% del prezzo di stima indicato sul catalogo. Non si addebitano spese per gli oggetti invenduti. 3. I nostri cataloghi sono di alta qualità e sono riconosciuti a livello internazionale. I nostri clienti sono fra i migliori al mondo. 4. Come depositanti potete beneficiare dell’assistenza riservata a ciascuno dei nostri clienti. 5. Come depositanti riceverete gli importi realizzati all’asta entro 45 giorni dal termine della stessa. Si possono concordare condizioni particolari. 6. A partire da un controvalore degli oggetti di € 2.500,--i costi del trasporto sono a nostro carico, mentre a partire da un controvalore di € 25.000 gli oggetti possono essere ritirati personalmente da un nostro incaricato ad un posto concordato. Naturalmente il trasporto dei vostri oggetti puó essere assicurato tramite la nostra assicurazione. 7. Non tutte le monete possono essere negoziate singolarmente. Fidatevi dell´esperienza dei nostri esperti, che raggruppano le monete non molto preziose in lotti di sicuro interesse. 8. Il valore stimato degli oggetti depositati deve ammontare ad almeno € 1.000,--. 9. Nel momento in cui gli oggetti sono presi in consegna, viene rilasciata una ricevuta numerata. Riceverete un elenco preciso degli oggetti che avete depositato con i relativi numeri di catalogo al massimo cinque settimane prima dell’asta. 10. Riceverete l’elenco degli oggetti aggiudicati entro una settimana dalla chiusura dell’asta. Potrete cosi verificare i prezzi realizzati. 11. Approfittate della capacità di un leader di mercato per aumentare il valore dei vostri oggetti. Se avete delle domande, rimaniamo a vostra disposizione per qualsiasi necessità. Rivolgetevi alla nostra consulenza ai clienti diretta dalla sig.ra Gisela Thomas al numero +49 (0)541-91 20 221. 12. Volete ricevere i nostri contratti senza impegno? Avete altre domande? Potete contattare la sig.ra Gisela Thomas al numero +49 (0)541-96 20 221.


DETAILLIERTER ZEITPLAN AUKTIONEN 112-114 AUKTION 112 DIE BIBLIOTHEK DES NUMISMATIKERS PROF. DR. PETER BERGHAUS U. A.

Dienstag, den 20. Juni 2006 10.00 Uhr - 13.00 Uhr Nr. 1 bis Nr. 620 14.00 Uhr - 15.00 Uhr Nr. 621 bis Nr. 847

GOLDMÜNZEN AUS DREI JAHRTAUSENDEN

AUKTION 113 MÜNZEN UND MEDAILLEN AUS MITTELALTER UND NEUZEIT DIE SAMMLUNG DR. MARTIN SELLMANN U. A.

15.00 Uhr - 18.30 Uhr Nr. 1001 bis Nr. 1753

Mittwoch, den 21. Juni 2006 10.00 Uhr - 13.00 Uhr Nr. 2001 bis Nr. 2659 Europäische Münzen und Medaillen: Belgien - Rußland 14.00 Uhr - 18.30 Uhr Nr. 2660 bis Nr. 3587 Europäische Münzen und Medaillen: San Marino - Ungarn, Münzen und Medaillen aus Übersee, Habsburgische Erblande-Österreich, Deutsche Münzen und Medaillen: Aachen - Lübeck

AUKTION 113

Donnerstag, den 22. Juni 2006 10.00 Uhr - 13.00 Uhr Nr. 3588 bis Nr. 4236 Deutsche Münzen und Medaillen: Lüneburg - Würzburg 14.00 Uhr - 15.00 Uhr Nr. 4237 bis Nr. 4383 Sammlung Brettsteine, Medaillen, Notmünzen, Papiergeld, Münzwaage, Münzgefäße, Münzteller, Lots

AUKTION 114 DEUTSCHE MÜNZEN AB 1871 IN GOLD UND SILBER

15.00 Uhr - 17.00 Uhr Nr. 6001 bis Nr. 6547

ORDEN UND EHRENZEICHEN

17.00 Uhr - 18.30 Uhr Nr. 7001 bis Nr. 7310

BESICHTIGUNGEN

Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 22.05.2006, nach vorheriger telefonischer Vereinbarung unter Nr. 05 41 - 96 20 221.

5


INHALT AUKTION 114 Nr. DEUTSCHE MÜNZEN AB 1871 IN GOLD UND SILBER Reichskleinmünzen Reichssilbermünzen Reichsgoldmünzen Weltkrieg und Inflation Weimarer Republik Drittes Reich BRD DDR Geplantes Königreich Polen Zweiter Weltkrieg Deutsche Kolonien Staatliche Notmünzen Danzig

6001 6001 6035 6197 6379 6385 6439 6449 6470

-

6487

-

6501

-

6547 6034 6196 6378 6384 6438 6448 6469 6484 6485 6486 6499 6500 6517

Proben Lots

6518 6526

-

ORDEN UND EHRENZEICHEN Deutsche Staaten bis 1918 Bayern, Königreich Hamburg, Freie Hansestadt Hohenzollern, Fürstentümer Mecklenburg-Schwerin, Großherzogtum Preußen, Königreich Sachsen, Königreich Sachsen, Weimar, Großherzogtum Sachsen-Altenburg, Herzogtum Württemberg, Königreich Deutsches Reich, 1871-1918 Weimarer Republik, 1919-1933 Freikorps Schaumburg-Lippe, Freistaat Deutsches Reich 1933-1945 Bundesrepublik Deutschland

7001 7001 7001

-

7004

-

7007

-

7016 7018 7021 7025 7025

-

7028

-

7031 7045 7047 7047 7050 7078 7080

-

7084

-

7091

-

Deutsche Gruppen, Spangen, Miniaturkettchen und -spangen Deutsche Konvolute Ausländische Orden und Ehrenzeichen Ägypten Äthiopien Afghanistan Algerien Argentinien Bangladesch Burma (Myanmar) Brasilien Bulgarien Burundi China 6

Seite 9 9 12 26

-

40 44 45

-

48

-

49

-

54 11 26 39 39 44 45 47 47 48 48 49 49 51

6525 6547

51 52

-

52 54

7310 7024 7002 7003 7005 7006 7013 7014 7015 7017 7020 7024 7027 7026 7027 7029 7030

55 55

-

57

-

98 58 55 55 55 56 56 57 57 57 57 58 58 58 58 58 59

7044 7046 7308 7049 7077 7079 7082 7083 7086 7087 7088 7089 7090 7096

59

-

62

-

62

-

61 61 98 62 65 65 66 66 67 67 67 68 68 68


Nr. Dänemark Dominikanische Republik El Salvador Finnland Frankreich Gabun Großbritannien Haiti Honduras Indien Indonesien Internationale Gesellschafts-Orden Italien Kambodscha Kolumbien Kongo Korea Kuba Laos Lettland Luxemburg Souveräner Malteser Ritterorden Marokko Mexiko Mongolei Nepal Nigeria Österreich Pakistan Paraguay Peru Philippinen Portugal Ruanda Rumänien Rußland Spanien Sri Lanka Syrien Thailand Tunesien Uruguay Ungarn Vatikan und Kirchenstaat Venezuela Vereinte Nationen Vietnam Ausländische Gruppen, Spangen, Miniaturkettchen und -spangen Literaturverzeichnis

Seite

7098

-

7105 7107 7112 7120

-

7125 7131

-

7141 7145 7156 7158

-

7173

-

7176 7187 7193

-

7201 7209

-

7212 7216 7225 7230 7233 7236 7249

-

7254 7257

-

7281 7292 7295 7300 7302

-

7097 7099 7100 7101 7102 7103 7104 7106 7111 7119 7123 7124 7130 7139 7140 7144 7155 7157 7170 7171 7172 7174 7175 7186 7192 7199 7200 7208 7210 7211 7215 7224 7229 7232 7235 7248 7252 7253 7256 7278 7279 7280 7291 7294 7299 7301 7308

7309

-

7310

71

-

72 73

-

74 75

-

77

-

80

-

82

-

84

-

86 87 88

-

89 90

-

92 93

-

96

-

69 69 69 69 69 70 70 70 70 72 72 72 73 74 74 75 76 77 78 78 79 80 80 81 82 83 83 85 85 86 87 88 89 89 90 92 92 92 93 95 95 95 97 97 97 98 98 98 99

Ein Stichwortverzeichnis finden Sie am Ende des Auktionskataloges 113.

7


WICHTIGE HINWEISE FÜR UNSERE TELEFONBIETER Wenn Sie telefonisch bieten möchten, muß das vor der Auktion durch uns genehmigt werden. Voraussetzung für ein telefonisches Mitbieten ist, daß Sie mindestens den Schätzpreis schriftlich bieten. Telefonisches Bieten ist erst ab einem Schätzpreis von ca. 500 Euro pro Los möglich. Bitte rufen Sie Frau Thomas vor der Auktion an unter +49 (0)541 96 20 221 oder gebührenfrei unter 0800 58 36 537. Wir übernehmen keinerlei Haftung, falls die telefonische Verbindung während der Auktion nicht zustande kommt.

INFORMATIONS POUR NOS CLIENTS PARTICIPANT A NOS VENTES AUX ENCHERES PAR TELEPHONE Si vous désirez participer par téléphone à nos ventes aux enchères, veuillez vous mettre en relation avec notre service clientèle quelques jours avant la vente en appelant le numéro +49 (0)541 96 20 233. Une participation téléphonique à la vente sera possible à la condition que vous nous fassiez parvenir aussi votre ordre par écrit. Cet ordre devra être au moins égal au minimum au prix d’estimation et concerner un lot estimé au moins 500 Euros. Nous déclinons toute responsabilité dans le cas où la communication téléphonique serait interrompue, ou bien ne pourrait être établie.

IMPORTANT INFORMATION ON TELEPHONE BIDDING If you wish to participate in the auction as a telephone bidder, please let us know several days in advance as we have to approve and schedule all calls. To register for telephone bidding, we require that you submit at least the estimate as a written bid in addition to being called. Telephone bidding is accepted on lot numbers with estimates above 500 Euro. Please call us at +49 (0)541 96 20 233 for more information or to register for telephone bidding. We do not assume liability for telephone bids, should the telephone line be interrupted.

INFORMAZIONI PER LA PARTECIPAZIONE TELEFONICA Se desiderate la partecipazione telefonica in diretta durante l´asta, siete pregati di chiamare la Signorina Sonia Russo al numero diretto +49 (0)541 96 20 245 qualche giorno prima dell´asta e di inviarci la vostra offerta, la quale deve ammontare come minimo al prezzo di stima anche per iscritto. Accettiamo una partecipazione telefonica in diretta durante l´asta per oggetti il cui prezzo di stima ammonta come minimo ai 500 Euro. Non assumeremo nessuna responsabilità se la linea telefonica è occupata o se non siete raggiungibili.

__________________________________________

BESICHTIGUNG Besichtigung des Auktionsgutes in unseren Geschäftsräumen, Gutenbergstr. 23, 49076 Osnabrück, ab dem 22.05.2006, nach vorheriger telefonischer Vereinbarung unter +49 (0) 5 41 96 20 221.

EXPOSITION Les monnaies seront visibles à partir du 22 mai 2006, Gutenbergstr. 23, 49076 Osnabrück, sur rendez-vous téléphonique +49 (0)541 96 20 221.

8

ON VIEW The auction good can be viewed at our office from May 22nd, Gutenbergstr. 23, 49076 Osnabrück, by prior appointment. Please call +49 (0)541 96 20 221.

ESPOSIZIONE Tutti i lotti sono visionabili a partire dal 22 Maggio 2006 presso la nostra sede, Gutenbergstr. 23, 49076 Osnabrück previo appuntamento telefonico +49 (0)541 96 20 221.


&'765%*'/ª0<'0#$ &KG0WOOGTPKPFGT\YGKVGP5RCNVGDG\KGJGPUKEJCWHFGP,CGIGT-CVCNQI &KG&GWVUEJGP/Ã&#x2019;P\GPUGKV #WHNCIG $GKWPUGTJ·NVNKEJHÃ&#x2019;Tb 



4'+%*5-.'+0/ª0<'0

,CGIGT

,CGIGT  

2HGPPKI( +PFKGUGT'TJCNVWPI·W­GTUV UGNVGP2TCEJVGZGORNCT 'TUVCDUEJNCI5VGORGNINCP\

 

2HGPPKI% -N-TCV\GTHCUV5VGORGNINCP\



 

/CTM& 8QT\Ã&#x2019;INKEJp5VGORGNINCP\





,CGIGT  

 

 

 

2HGPPKI* 5GNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI(GKPG2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\

/CTM) -CDKPGVVUVÃ&#x2019;EM (GKPGT5VGORGNINCP\



 

/CTM* *GTTNKEJG2CVKPCHCUV5VGORGNINCP\



 

/CTM& 2TCEJVGZGORNCT5VGORGNINCP\



 

/CTM, 2TCEJVGZGORNCT5VGORGNINCP\





2HGPPKI) 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



2HGPPKI# (CUV5VGORGNINCP\



9


,CGIGT

,CGIGT  

 

 

/CTM( 8QT\ÒINKEJp5VGORGNINCP\

  

/CTM# 5GNVGPKPFKGUGT'TJCNVWPI 8QT\ÒINKEJ



/CTM) 5GJTUGNVGPKPFKGUGT'TJCNVWPI 8QT\ÒINKEJp5VGORGNINCP\



/CTM' (CUV5VGORGNINCP\

 

/CTM#)* '5VÒEM6GKNYGKUGUGNVGP 5EJÌPpUGJTUEJÌP 

 

2HGPPKI, 5GNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG



2HGPPKI' 5GNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG



 

10

/CTM& 5GJTUGNVGPKPFKGUGT'TJCNVWPI 5VGORGNINCP\

  



 

 

 

/CTM' 5GNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI8QT\ÒINKEJ



2HGPPKI' 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG



2HGPPKI' 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG




,CGIGT   2HGPPKI#2QNKGTVG2NCVVG

 

 

 

 

2HGPPKI# 2QNKGTVG2NCVVGOKPDGTÒJTV

2HGPPKI)2QNKGTVG2NCVVG

2HGPPKI# (CUV5VGORGNINCP\

2HGPPKI( 5GJTUGNVGPKPFKGUGT'TJCNVWPI 5VGORGNINCP\



,CGIGT  

/CTM# 2TCEJVGZGORNCT5VGORGNINCP\

 

/CTM) 45GJTUEJÌP



 

/CTM) (CUV5VGORGNINCP\



 

/CTM' (CUV5VGORGNINCP\



 

/CTM, 5GNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT2QNKGTVG2NCVVG



2HGPPKI, 2TCEJVGZGORNCT2QNKGTVG2NCVVG













 

2HGPPKI# 5GJTUEJÌPpXQT\ÒINKEJ



 

2HGPPKI#5GJTUEJÌP



 

11


4'+%*55+.$'4/ª0<'0 #0*#.6

,CGIGT

,CGIGT  

(TKGFTKEJ+ /CTM5EJÌP

  

/CTM5KNDGTJQEJ\GKV 8QT\ÒINKEJp5VGORGNINCP\



$#&'0

   

 

/CTM 2TCEJVGZGORNCT (CUV5VGORGNINCP\

(TKGFTKEJ++ /CTM2TCEJVGZGORNCT /KP4CPFHGJNGTHCUV5VGORGNINCP\



  

 

/CTM8QT\ÒINKEJ



 

/CTM 8QT\ÒINKEJGU'ZGORNCT XQPRQNKGTVGP5VGORGNP



 

12

/CTM5KNDGTJQEJ\GKV 9KP\4CPFHGJNGT HCUV5VGORGNINCP\



(TKGFTKEJ+ /CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT /KP4CPFHGJNGT5VGORGNINCP\



/CTM 2TCEJVGZGORNCT (CUV5VGORGNINCP\



 ( /CTMQJPG3WGTUVTKEJKO# ªDGTFWTEJUEJPKVVNKEJGTJCNVGP 5GJTUEJÌP 

 

/CTM8QT\ÒINKEJ




,CGIGT  

/CTM 5GNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT (GKPG2CVKPCOKP 5EJTÌVNKPIUHGJNGTHCUV5VGORGNINCP\

 

/CTM 2TCEJVGZGORNCT5VGORGNINCP\

 

/CTM 2TCEJVGZGORNCT(CUV 5VGORGNINCP\

 

 

/CTM 2TCEJVGZGORNCT5VGORGNINCP\

/CTM 2TCEJVGZGORNCT(CUV 5VGORGNINCP\

,CGIGT  

/CTM )QNFGPG*QEJ\GKV 8QT\ÒINKEJp5VGORGNINCP\





 

/CTM OKV.GDGPUFCVGP5VGORGNINCP\



 

/CTM OKV.GDGPUFCVGP 2TCEJVGZGORNCT'TUVCDUEJNCI HCUV5VGORGNINCP\5VGORGNINCP\



(TKGFTKEJ++ /CTM2TCEJVGZGORNCT (CUV5VGORGNINCP\5VGORGNINCP\



 

/CTM)GRWV\VUGJTUEJÌP



 

/CTM 2TCEJVGZGORNCT5VGORGNINCP\









 

 13


,CGIGT  

/CTM 2TCEJVGZGORNCT5VGORGNINCP\



,CGIGT   /CTM8QT\ÒINKEJ



$#;'40

 

 

 

  14

.WFYKI++ /CTM2TCEJVGZGORNCT (CUV5VGORGNINCP\

/CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI (CUV5VGORGNINCP\

/CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI 'TUVCDUEJNCIHCUV5VGORGNINCP\

/CTM8QT\ÒINKEJ

 

1VVQ++ /CTM5EJÌPpUGJTUEJÌP



 

/CTM(CUV5VGORGNINCP\



 

/CTM5GJTUEJÌP



 

/CTM 5GNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCTOKVHGKPGT 6ÌPWPI(CUV5VGORGNINCP\











 

/CTM 8QT\ÒINKEJp5VGORGNINCP\




,CGIGT

,CGIGT  

 

 

/CTM (CUV5VGORGNINCP\ CWURQNKGTVGT2NCVVG /CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

.WFYKI+++ /CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\

 

/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 49KP\4CPFHGJNGTXQT\Ã&#x2019;INKEJGU 'ZGORNCTXQPRQNKGTVGP5VGORGNP 

 

/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 2TCEJVGZGORNCT5VGORGNINCP\



/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV (GKPG2CVKPCHCUV5VGORGNINCP\



/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV (CUV5VGORGNINCP\



 

/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV8QT\Ã&#x2019;INKEJ



 

/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 8QT\Ã&#x2019;INKEJGU'ZGORNCTXQP RQNKGTVGP5VGORGNP



 



$4#705%*9'+)

 

   

 

'TPUV#WIWUV /CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 8QT\Ã&#x2019;INKEJGU'ZGORNCTXQP RQNKGTVGP5VGORGNP

/CTM1JPG.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 8QT\Ã&#x2019;INKEJGU'ZGORNCT XQPRQNKGTVGP5VGORGNP





15


*#/$74)

,CGIGT

,CGIGT  

/CTM/KV.Ã&#x2019;PGDWTI 4GIKGTWPIUCPVTKVV 8QT\Ã&#x2019;INKEJGU'ZGORNCTXQP RQNKGTVGP5VGORGNP

 

(TGKGWPF*CPUGUVCFV /CTM(CUV5VGORGNINCP\

 

/CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI (GKPG2CVKPCHCUV5VGORGNINCP\





$4'/'0  

(TGKGWPF*CPUGUVCFV /CTM(CUV5VGORGNINCP\



 

/CTM(CUV5VGORGNINCP\



 

 

  16

/CTM(CUV5VGORGNINCP\

/CTM8QT\Ã&#x2019;INKEJ

/CTM8QT\Ã&#x2019;INKEJ









 

/CTM 2TCEJVGZGORNCT5VGORGNINCP\



 

/CTM 5GNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



/CTM2QNKGTVG2NCVVG



 


*'55'0

,CGIGT  

,CGIGT  

.WFYKI+++ /CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI /KP4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\

 

 

 

.WFYKI+8 /CTM(GKPG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



/CTM8QT\ÒINKEJ





/CTM 2TCEJVGZGORNCT (CUV5VGORGNINCP\



.+22'



/CTM 4#VVTCMVKXGU UGJTUEJÌPGU'ZGORNCT

/CTM8QT\ÒINKEJ





   

'TPUV.WFYKI /CTM 8QT\ÒINKEJp5VGORGNINCP\ 5VGORGNINCP\

 

.GQRQNF+8 /CTM8QT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM(CUV5VGORGNINCP\



 

/CTM(CUV5VGORGNINCP\



 

/CTM 9KP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\

 17


.ª$'%-

/'%-.'0$74)5%*9'4+0

,CGIGT  

,CGIGT

(TGKGWPF*CPUGUVCFV /CTM 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM(CUV5VGORGNINCP\



 

/CTM(CUV5VGORGNINCP\



 

/CTM2QNKGTVG2NCVVG

 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ

 

  18

/CTM 8QT\ÒINKEJp5VGORGNINCP\

/CTM(CUV5VGORGNINCP\

 

(TKGFTKEJ(TCP\++ /CTM*ÒDUEJG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



 

(TKGFTKEJ(TCP\+8 /CTM 5EJÌPG2CVKPCRQNKGTVG2NCVVG 

 

/CTM,CJTJWPFGTVHGKGT +P752NCUVKMJQNFGTFGT0)%OKV FGT$GYGTVWPI2( 2QNKGTVG2NCVVG



 

/CTM,CJTJWPFGTVHGKGT 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM,CJTJWPFGTVHGKGT +P752NCUVKMJQNFGTFGT0)% OKVFGT$GYGTVWPI2(%COGQ 5GNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG 

 






,CGIGT ,CGIGT  

/CTM,CJTJWPFGTVHGKGT 8QT\ÒINKEJ



 

/CTM 4CPFUVCDOKPIGIN·VVGVXQT\ÒINKEJ



 

/CTM(CUVUGJTUEJÌP



 

(TKGFTKEJ#WIWUV /CTM(CUV5VGORGNINCP\



   

/CTM8QT\ÒINKEJ /CTM2CVKPCXQT\ÒINKEJ

 

 

/CTM8QT\ÒINKEJ



 

/CTM -N4CPFHGJNGTUGJTUEJÌP



 

/CTM .GKEJVDGCTDGKVGVUEJÌPpUGJTUEJÌP



/'%-.'0$74)564'.+6<

 

 

 

(TKGFTKEJ9KNJGNO /CTM ªDGTFWTEJUEJPKVVNKEJGTJCNVGP 5GJTUEJÌP

#FQNH(TKGFTKEJ8 /CTM 2QNKGTVG2NCVVGOKPDGTÒJTV





/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI/5 2TCEJVGZGORNCT 5VGORGNINCP\ 

1.&'0$74)

 

0KEQNCWU(TKGFTKEJ2GVGT /CTM(CUVXQT\ÒINKEJ 

19


,CGIGT  $ /CTM$8QT\ÒINKEJ

,CGIGT  

/CTM W­GTUVUGNVGPKPFKGUGT 'TJCNVWPI2TCEJVGZGORNCTXQP UEJÌPUVGT'TJCNVWPI (CUV5VGORGNINCP\





 

 

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI2( 2QNKGTVG2NCVVGOKPDGTKGDGP 

 

/CTM(CUVUGJTUEJÌP

(TKGFTKEJ+++ /CTM# (CUV5VGORGNINCP\



9KNJGNO++ /CTM# 8QT\ÒINKEJp5VGORGNINCP\ CWURQNKGTVGT2NCVVG



 

/CTM#(CUVUGJTUEJÌP



 

/CTM# 7PKXGTUKV·V$GTNKP 2TCEJVGZGORNCT2QNKGTVG2NCVVG





24'755'0

 

 # 9KNJGNO+ /CTM#/KV)WVCEJVGPXQP 4ÒFKIGT-CKUGT 5GNVGPKPFKGUGT'TJCNVWPI 8QT\ÒINKEJ 

 # /CTM# *ÒDUEJG2CVKPCHCUVXQT\ÒINKEJ 20




,CGIGT

,CGIGT  

/CTM# -CKUGTKP7PKHQTO 2QNKGTVG2NCVVGOKPDGTÒJTV

  

*GKPTKEJ::+8 /CTM 8QT\ÒINKEJp5VGORGNINCP\



4'755,ª0)'4'4.+0+'

 

/CTM# 5GIGPFGU/CPUHGNFGT$GTIDCWU 8QT\ÒINKEJ



 

*GKPTKEJ:+8 /CTM(CUVUGJTUEJÌP



 

/CTM5EJÌPpUGJTUEJÌP



5#%*5'0

 

/CTM# 5GIGPFGU/CPUHGNFGT$GTIDCWU -N4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



 

#NDGTV /CTM (CUVXQT\ÒINKEJXQT\ÒINKEJ



 

/CTM2TCEJVGZGORNCT *GTTNKEJG2CVKPCHCUV5VGORGNINCP\



 

/CTM8QT\ÒINKEJ



4'755.6'4'4.+0+'

 

 

*GKPTKEJ::++ /CTM 8QT\ÒINKEJp5VGORGNINCP\



/CTM 8QT\ÒINKEJp5VGORGNINCP\



21


,CGIGT  

(TKGFTKEJ#WIWUV+++ 5KNDGTPG)GFGPMOÒP\GKP/CTM )TÌ­G /ÒP\DGUWEJFGU-ÌPKIU 8QT\ÒINKEJ 

 

/CTM7PKXGTUKV·V.GKR\KI 2QNKGTVG2NCVVG



 

/CTM7PKXGTUKV·V.GKR\KI 8QT\ÒINKEJp5VGORGNINCP\



 



,CGIGT  

 

/CTM /KP5EJTÌVNKPIUHGJNGT HCUV5VGORGNINCP\



5KNDGTPG)GFGPMOÒP\GKP/CTM )TÌ­G /ÒP\DGUWEJFGU-ÌPKIU 2TCEJVGZGORNCTXQPRQNKGTVGP 5VGORGNPHCUV5VGORGNINCP\ 

 

/CTMOKV.GDGPUFCVGP 8QT\ÒINKEJ



 

/CTMOKV.GDGPUFCVGP 8QT\ÒINKEJ

/CTM7PKXGTUKV·V.GKR\KI /KP4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\



5#%*5'0#.6'0$74)

 

)GQTI/CTM 8QT\ÒINKEJp5VGORGNINCP\



 

/CTMOKV.GDGPUFCVGP 8QT\ÒINKEJp5VGORGNINCP\



22

 

'TPUV/CTM 8QT\ÒINKEJ



 

/CTM 2CVKPCHCUVUGJTUEJÌP




,CGIGT   ,CGIGT  

 

/CTM 4GIKGTWPIULWDKN·WO (CUVXQT\ÒINKEJ



/CTM 4GIKGTWPIULWDKN·WO 5GJTUEJÌPpXQT\ÒINKEJ



/CTM )GDWTVUVCI 9KP\4CPFHGJNGTUGJTUEJÌP



/CTM )GDWTVUVCI2TCEJVGZGORNCT (CUV5VGORGNINCP\



5#%*5'0%1$74))16*#

 

 

 

%CTN'FWCTF /CTM 8QT\ÒINKEJp5VGORGNINCP\

/CTM -N4CPFHGJNGTDGTKGDGP UGJTUEJÌP



 D /CTM-WT\GT$CTV 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ





5#%*5'0/'+0+0)'0

 

)GQTI++ /CTM)GDWTVUVCI 9KP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\



23


,CGIGT  

/CTM 2TCEJVGZGORNCT (CUV5VGORGNINCP\



 

/CTM(CUVXQT\ÒINKEJ



 

/CTM -N4CPFHGJNGTUGJTUEJÌP



 

9KNJGNO'TPUV /CTM 8QT\ÒINKEJp5VGORGNINCP\



,CGIGT  C /CTM.CPIGT$CTV 8QT\ÒINKEJ

 D /CTM-WT\GT$CTV 5GJTUEJÌPpXQT\ÒINKEJ

 

/CTM OKV.GDGPUFCVGP (CUV5VGORGNINCP\







 

 

/CTM OKV.GDGPUFCVGP (CUV5VGORGNINCP\

/CTM*QEJ\GKV 8QT\ÒINKEJp5VGORGNINCP\





5#%*5'09'+/#4'+5'0#%*

ex 6180

 

 

24

%CTN#NGZCPFGT /CTM 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM*QEJ\GKV &C\W,/CTM *QEJ\GKV 8QT\ÒINKEJp5VGORGNINCP\



/CTM*QEJ\GKV $GTKGDGPHCUVXQT\ÒINKEJ




,CGIGT  

/CTM (GKPG2CVKPCHCUV5VGORGNINCP\

 

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI/5 8QT\ÒINKEJp5VGORGNINCP\ 

,CGIGT  

/CTM7PKXGTUKV·V,GPC (CUV5VGORGNINCP\



 

/CTM7PKXGTUKV·V,GPC (CUV5VGORGNINCP\



 

/CTM7PKXGTUKV·V,GPC 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM7PKXGTUKV·V,GPC &C\W,/CTM7PK XGTUKV·V,GPC5VÒEM 8QT\ÒINKEJp5VGORGNINCP\



 

 

/CTM,CJTJWPFGTVHGKGT 8QT\ÒINKEJGU'ZGORNCT XQPRQNKGTVGP5VGORGNP /CTM,CJTJWPFGTVHGKGT 9KP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\

5%*9#4<$74)47&1.56#&6

 

)ÒPVJGT /CTM8QT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ







5%*9#4<$74)510&'45*#75'0

5%*#7/$74).+22'

 

)GQTI /CTM8QT\ÒINKEJ



  

-CTN)ÒPVJGT /CTM /KP4CPFHGJNGTHCUV5VGORGNINCP\

 25


4'+%*5)1.&/ª0<'0 

*KPYGKUHÃ&#x2019;TWPUGTG-WPFGP



)GO·­'7.KUVGHÃ&#x2019;T#PNCIGIQNFHÃ&#x2019;TFCU,CJT IKNVHÃ&#x2019;T4GKEJUIQNFOÃ&#x2019;P\GPHQNIGPFG4GIGNWPI





,CGIGT  

/CTMOKV.GDGPUFCVGP 8QT\Ã&#x2019;INKEJp5VGORGNINCP\





9#.&'%-2;4/106



)QNFOCTMUKPF/Y5VRHNKEJVKI   )QNFOCTMUKPF/Y5VHTGKDKUb )QNFOCTMUKPF/Y5VRHNKEJVKI C XQPbDKUb D CDb )QNFOCTMUKPF/Y5VHTGKDKUb )QNFOCTMUKPF/Y5VRHNKEJVKI C XQPbDKUb D CDb &KGQDGPIGPCPPVGP$GVT·IGXGTUVGJGPUKEJ KPMNWUKXG#WHIGNF &KGCPHCNNGPFG/Y5VYKTFCWHWPUGTGP4GEJ PWPIGPUGRCTCVCWUIGYKGUGP

#0*#.6

,CGIGT

 

(TKGFTKEJ /CTM 48QT\Ã&#x2019;INKEJp5VGORGNINCP\

26

9KNJGNO++ /CTM 2QNKGTVG2NCVVGOKPDGTÃ&#x2019;JTV

(TKGFTKEJ+ /CTM8QT\Ã&#x2019;INKEJ



 

/CTM8QT\Ã&#x2019;INKEJ



 

/CTM+P752NCUVKMJQNFGT FGT2%)5OKVFGT$GYGTVWPI /52TCEJVGZGORNCT (CUV5VGORGNINCP\ 

 

(TKGFTKEJ++ /CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



9ª466'/$'4)

 

 






$#&'0

,CGIGT   /CTM5GJTUEJÌP

ex 6201

,CGIGT  

(TKGFTKEJ+ /CTM5VÒEM 5GJTUEJÌP



 

 

 

/CTM2TCEJVGZGORNCT (CUV5VGORGNINCP\

/CTM8QT\ÒINKEJ

 

/CTM 8QT\ÒINKEJp5VGORGNINCP\

 

/CTM 5GNVGPGT,CJTICPI 9KP\-TCV\GTUGJTUEJÌP

 

 

/CTM8QT\ÒINKEJ

/CTM -N4CPFHGJNGTUGJTUEJÌP



/CTM 2TCEJVGZGORNCT (CUV5VGORGNINCP\



 

/CTM 9KP\4CPFHGJNGTXQT\ÒINKEJ



 

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI/5 (CUV5VGORGNINCP\



 

(TKGFTKEJ++ /CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ



 

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI 2(7NVTC%COGQ 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT2QNKGTVG2NCVVG 













27


$#;'40

,CGIGT  

/CTM 5GNVGPGT,CJTICPI -TCV\GTUGJTUEJÌP



 

/CTM(CUVXQT\ÒINKEJ



 

/CTM5GJTUEJÌP



 

/CTM 5GNVGPGT,CJTICPI 5GJTUEJÌPpXQT\ÒINKEJ



1VVQ++ /CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM5GJTUEJÌP



 

/CTM5GJTUEJÌP



 

/CTM 5VÒEM/KPIGYGNNVUGJTUEJÌP



,CGIGT  

 

     

 

.WFYKI++ /CTM ,WUVKGTVUGJTUEJÌPpXQT\ÒINKEJ

/CTM 8QT\ÒINKEJp5VGORGNINCP\ CWURQNKGTVGT2NCVVG

/CTM8QT\ÒINKEJ /CTM5GJTUEJÌP /CTM5GJTUEJÌP

/CTM 8QT\ÒINKEJp5VGORGNINCP\





  

  

 

/CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



28


,CGIGT ,CGIGT   /CTM(CUVXQT\ÒINKEJ  

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 



/CTM+P752NCUVKMJQNFGT FGT2%)5OKVFGT$GYGTVWPI /52TCEJVGZGORNCT (CUV5VGORGNINCP\



$4#705%*9'+)

 

/CTM 8QT\ÒINKEJp5VGORGNINCP\



 

9KNJGNO /CTM5GJTUEJÌP



$4'/'0

 

/CTM8QT\ÒINKEJ

 

/CTM 5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ WPFXQT\ÒINKEJ



/CTM(CUV5VGORGNINCP\

 

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI 2(%COGQ 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT2QNKGTVG2NCVVG 

/CTM8QT\ÒINKEJ

(TGKGWPF*CPUGUVCFV /CTM9KP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\





 

 

 

 

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI /5(CUV5VGORGNINCP\ 

 

/CTM 9KP\4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\







*#/$74)

 

(TGKGWPF*CPUGUVCFV /CTM45GJTUEJÌP

 29


,CGIGT  

,CGIGT   /CTM(CUV5VGORGNINCP\

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI /52TCEJVGZGORNCT 5VGORGNINCP\



/CTM(CUV5VGORGNINCP\



   

 

/CTM5GJTUEJÌP



 

/CTM *GPMGNURWTUGJTUEJÌP



/CTM5GJTUEJÌP /CTM5GJTUEJÌP

 

   



/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI /52TCEJVGZGORNCT (CUV5VGORGNINCP\



   

/CTM5GJTUEJÌP /CTM5GJTUEJÌP

 

 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI /59KP\-TCV\GT XQT\ÒINKEJp5VGORGNINCP\



*'55'0

 

/CTM 8QPITQ­GT5GNVGPJGKV 0WT'ZGORNCTGIGRT·IV -N4CPFHGJNGTUGJTUEJÌP

 

/CTM5GJTUEJÌP

30

 

.WFYKI+++ /CTM 2TCEJVGZGORNCTW­GTUVUGNVGPKP FKGUGT'TJCNVWPI2QNKGTVG2NCVVG 

 

/CTM5GJTUEJÌP

 




,CGIGT  

/CTM 5GJTUEJÌPpXQT\ÒINKEJ

 

/CTM8QT\ÒINKEJ

 

/CTM -N4CPFHGJNGTUGJTUEJÌP

 

.WFYKI+8 /CTM 5GJTUGNVGPKPFKGUGT'TJCNVWPI 8QT\ÒINKEJp5VGORGNINCP\

 # /CTM# 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2TCEJVGZGORNCT (CUV5VGORGNINCP\

 # /CTM# 9KP\4CPFHGJNGTUGJTUEJÌP

 

/CTM -N4CPFHGJNGTUGJTUEJÌP

,CGIGT 

 

/CTM #VVTCMVKXGUXQT\ÒINKEJGU'ZGORNCT



 

'TPUV.WFYKI /CTM 2TCEJVGZGORNCT5GJTUGNVGPKP FKGUGT'TJCNVWPI2QNKGTVG2NCVVG









 

/CTM8QT\ÒINKEJ



 

/CTM8QT\ÒINKEJ



 

/CTM 5GJTUEJÌPpXQT\ÒINKEJ









31


.ª$'%-

/'%-.'0$74)5%*9'4+0

,CGIGT  

 

(TGKGWPF*CPUGUVCFV /CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI /52TCEJVGZGORNCT (CUV5VGORGNINCP\ 

/CTM 2TCEJVGZGORNCT (CUV5VGORGNINCP\



,CGIGT  

(TKGFTKEJ(TCP\+++ /CTM 9KP\4CPFHGJNGTUGJTUEJÌP



/'%-.'0$74)564'.+6<

 

#FQNH(TKGFTKEJ8 /CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI /54 8QT\ÒINKEJ5VGORGNINCP\ 

24'755'0  

 

 

  32

/CTM (CUUWPIUURWTGPUQPUVXQT\ÒINKEJ

/CTM -N4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



 # 9KNJGNO+ /CTM# (CUV5VGORGNINCP\



 # /CTM## 5VÒEM(CUV5VGORGNINCP\



 # /CTM# (CUV5VGORGNINCP\



 $ /CTM$ Z  &C\W,#/CTM# 5VÒEM'VYCUIGYGNNVUGJTUEJÌP



 # /CTM#5GJTUEJÌP





/CTM 2TCEJVGZGORNCT (CUV5VGORGNINCP\



/CTM8QT\ÒINKEJ



&KGGTUVG4GKEJUIQNFOÒP\G


,CGIGT  # /CTM#5GJTUEJÌP

,CGIGT 

&KGGTUVG4GKEJUIQNFOÒP\G

 # /CTM## 5VÒEM5GJTUEJÌP WPFUGJTUEJÌPpXQT\ÒINKEJ

 # /CTM# 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG





 % /CTM%5GJTUEJÌP



 # /CTM# /KP4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



 $ /CTM$ 5GNVGPGT,CJTICPI 9KP\4CPFHGJNGTYKP\-TCV\GT UGJTUEJÌP 

 # /CTM# 8QT\ÒINKEJ XQT\ÒINKEJp5VGORGNINCP\



 # /CTM#5GJTUEJÌP



 # /CTM# &C\W,$/CTM$ 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



 # /CTM#5GJTUEJÌP



 # /CTM# -NGKPG-TCV\GTUGJTUEJÌP



 # /CTM# 5VÒEM-N4CPFHGJNGT UGJTUEJÌP



 # /CTM# Z ,% /CTM%5VÒEM #NNGOKV(GJNGTPUEJÌPpUGJTUEJÌP



 # /CTM# 8QT\ÒINKEJp5VGORGNINCP\



 # /CTM# (CUV5VGORGNINCP\



 # /CTM#8QT\ÒINKEJ





 # /CTM#8QT\ÒINKEJ



 # /CTM# 5GNVGPGT,CJTICPI5GJTUEJÌP

33


,CGIGT

,CGIGT  # /CTM#8QT\ÒINKEJ

 $ /CTM$ $GUUGTGT,CJTICPI5GJTUEJÌP

 % /CTM% $GUUGTGT,CJTICPI5GJTUEJÌP

 % /CTM% $GUUGTGT,CJTICPI5GJTUEJÌP

   

 

 

34



 

/CTM#+P752NCUVKMJQN FGTFGT0)%OKVFGT$GYGTVWPI /58QT\ÒINKEJp5VGORGNINCP\



 

/CTM### 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



 

/CTM#8QT\ÒINKEJ











/CTM#8QT\ÒINKEJ



9KNJGNO++ /CTM# 8QT\ÒINKEJCWURQNKGTVGT2NCVVG

/CTM## 5VÒEM5GJTUEJÌPpXQT\ÒINKEJ



(TKGFTKEJ+++ /CTM# (CUV5VGORGNINCP\

/CTM# -N-TCV\GTRQNKGTVG2NCVVG

 

 # /CTM# 8QT\ÒINKEJp5VGORGNINCP\



 # /CTM## Z  #5VÒEM5GJTUEJÌP



 # /CTM## 5VÒEM8QT\ÒINKEJ



 # /CTM# (CUV5VGORGNINCP\ CWURQNKGTVGT2NCVVG



 # /CTM# 8QT\ÒINKEJp5VGORGNINCP\







 # /CTM### #### #### ##5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ 


5#%*5'0

,CGIGT  

ex 6328

/CTM# -CKUGTKP7PKHQTO8QT\ÒINKEJ



,CGIGT  

4'755.6'4'4.+0+'

,QJCPP /CTM&C\W, /CTM5VÒEM 'VYCUIGDQIGP Z 4CPFUVCD NGKEJVIGIN·VVGV Z UGJTUEJÌP



/CTM&C\W, /CTM5VÒEM 5GJTUEJÌPWPF UGJTUEJÌPpXQT\ÒINKEJ



 

#NDGTV /CTM5GJTUEJÌP



 

/CTM -N4CPFHGJNGTUGJTUEJÌP



 

 

*GKPTKEJ::++ /CTM44 9KP\4CPFHGJNGT UGJTUEJÌPpXQT\ÒINKEJ



4'755,ª0)'4'4.+0+'

ex 6332

 

 

*GKPTKEJ:+8 /CTM 2TCEJVGZGORNCTW­GTUVUGNVGPKP FKGUGT'TJCNVWPI (CUV5VGORGNINCP\ 

/CTM&C\W, /CTM5VÒEM 5GJTUEJÌP



 

/CTM5GJTUEJÌP



 

/CTM 5GNVGPGT,CJTICPI 5GJTUEJÌPpXQT\ÒINKEJ

 35


,CGIGT   /CTM8QT\Ã&#x2019;INKEJ



 

)GQTI /CTM8QT\Ã&#x2019;INKEJ



 

/CTM(CUVXQT\Ã&#x2019;INKEJ



 

 

 

 

36

/CTM8QT\Ã&#x2019;INKEJ

/CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

/CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

/CTM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

/CTM8QT\Ã&#x2019;INKEJ



 

/CTM8QT\Ã&#x2019;INKEJ



 

/CTM8QT\Ã&#x2019;INKEJ



 

/CTM+P752NCUVKMJQNFGT FGT2%)5OKVFGT$GYGTVWPI /52TCEJVGZGORNCT (CUV5VGORGNINCP\





(TKGFTKEJ#WIWUV+++ /CTM+P752NCUVKMJQNFGT FGT0)%OKVFGT$GYGTVWPI2( %COGQ 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG 

/CTM8QT\Ã&#x2019;INKEJ

,CGIGT   /CTM8QT\Ã&#x2019;INKEJ






5%*9#4<$74)510&'45*#75'0

,CGIGT   /CTM8QT\ÒINKEJ



5#%*5'0%1$74))16*#

,CGIGT  

-CTN)ÒPVJGT /CTM 4(CUVUGJTUEJÌPUGJTUEJÌP



9#.&'%-2;4/106

 

%CTN'FWCTF/CTM +P752NCUVKMJQNFGTFGT 2%)5OKVFGT$GYGTVWPI/5 2TCEJVGZGORNCT (CUV5VGORGNINCP\   

(TKGFTKEJ /CTM $GTKGDGPUGJTUEJÌP



9ª466'/$'4)

5#%*5'0/'+0+0)'0  

 

)GQTI++ /CTM4 8QT\ÒINKEJp5VGORGNINCP\

/CTM 448QT\ÒINKEJp5VGORGNINCP\





 

-CTN /CTM5GJTUEJÌP



 

/CTM 5VÒEM(CUVXQT\ÒINKEJ WPFXQT\ÒINKEJ



 

/CTM 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM 8QT\ÒINKEJp5VGORGNINCP\



 

/CTM5VÒEM.GKEJVG $GCTDGKVWPIUURWTGPCO4CPF Z  UGJTUEJÌPpXQT\ÒINKEJ

 37


,CGIGT   /CTM8QT\ÒINKEJ



 

/CTM 5GNVGPGT,CJTICPI8QT\ÒINKEJ



 

/CTM5GJTUEJÌP



 

/CTM -N4CPFHGJNGTUGJTUEJÌP



,CGIGT   /CTM8QT\ÒINKEJ



 

/CTM(CUV5VGORGNINCP\



 

/CTM 2TCEJVGZGORNCTW­GTUVUGNVGP DGUQPFGTUKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG 

&'765%*156#(4+-#  

 

/CTM 5GNVGPGT,CJTICPI5GJTUEJÌP

9KNJGNO++ /CTM8QT\ÒINKEJ



 C 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNF OKPGKP1UVCHTKMC (CUUWPIUURWTGPUGJTUEJÌP  

ex 6366

 

38

/CTM 5VÒEM8QT\ÒINKEJ



 C 4WRKGP66CDQTC)GRT·IV OKV)QNFCWUFGT5GMGPMG)QNF OKPGKP1UVCHTKMC (CUUWPIUURWTGPIGRWV\VUGJT UEJÌP 


9'.6-4+')70&+0(.#6+10

&#0<+)

,CGIGT  & )WNFGP 8QT\ÒINKEJp5VGORGNINCP\

 & )WNFGP 8QT\ÒINKEJp5VGORGNINCP\

,CGIGT 

 

2HGPPKI& 445GJTUEJÌP

 

2HGPPKI& 5GNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG



2HGPPKI' 5GNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG







.165810 4'+%*5)1.&/ª0<'0  

 

 

 

 

2TGW­GP9KNJGNO+ ,#/CTM# ,%/CTM%&C\W ,/CTM#5VÒEM 5GJTUEJÌP Z WPFXQT\ÒINKEJ 9KNJGNO+,#/CTM #9KNJGNO++,#/CTM #&C\W5ÒFCHTKMC)GQTIG 82QWPF5#2TGVQTKC I(GKPIQNF(D5VÒEM 5GJTUEJÌPWPFDGUUGT 9ÒTVVGODGTI-CTN ,/CTM&C\W ,/CTM, /CTM5VÒEM 5GJTUEJÌP Z WPFXQT\ÒINKEJ



 



 

2HGPPKI#2QNKGTVG2NCVVG



 

/CTM'2QNKGTVG2NCVVG



 

/CTM'2QNKGTVG2NCVVG





#NNIGOGKP&KXGTUGWPF /CTM5VÒEMGFGU-CKUGTTGKEJU ,  Z  #%% Z   Z 5VÒEM #NNGOKV(GJNGTPOGKUVUGJTUEJÌP  &KXGTUGWPF/CTM 5VÒEMGFGU-CKUGTTGKEJU,  Z  Z 

Z  Z  Z  %#$ %# Z # Z   Z  Z  # Z  Z   Z 5VÒEM 6GKNYGKUGDGTKGDGP OGKUVUGJTUEJÌP 

39


9'+/#4'44'27$.+-

,CGIGT  

4GKEJUOCTM() 5VÒEM8QT\ÒINKEJp5VGORGNINCP\



 

4GKEJUOCTM#& Z ' (),5VÒEM 8QT\ÒINKEJp5VGORGNINCP\



,CGIGT  

 

 

4GPVGPRHGPPKI( 5GNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI5VGORGNINCP\

4GPVGPRHGPPKI' 2QNKGTVG2NCVVG

4GKEJURHGPPKI# 8QT\ÒINKEJ

 

4GKEJURHGPPKI# 5GJTUEJÌP

 

4GKEJUOCTM' 5GNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG



4GKEJUOCTM# (CUV5VGORGNINCP\



 

4GKEJUOCTM) 8QT\ÒINKEJp5VGORGNINCP\



 

4GKEJUOCTM, 4(GKPG2CVKPCHCUV5VGORGNINCP\



 

4GKEJUOCTM'4JGKPNCPFG 9KP\4CPFHGJNGTWPF-TCV\GT RQNKGTVG2NCVVG









 \W 4GKEJUOCTM#8CTKCPVGOKV HNCEJIGRT·IVGT,CJTGU\CJN2TQDG! I7PGFKGTV (CUV5VGORGNINCP\  40

 

 

4GKEJUOCTM#.ÒDGEM 2QNKGTVG2NCVVGOKPDGTÒJTV






,CGIGT  

,CGIGT

4GKEJUOCTM# $TGOGTJCXGP(CUV5VGORGNINCP\



 

4GKEJUOCTM# $TGOGTJCXGP(CUV5VGORGNINCP\



 

4GKEJUOCTM# $TGOGTJCXGP8QT\ÒINKEJ

 

4GKEJUOCTM# $TGOGTJCXGP2TCEJVGZGORNCT XQPRQNKGTVGP5VGORGNP (CUV5VGORGNINCP\

 

4GKEJUOCTM# $TGOGTJCXGP8QT\ÒINKEJ

 

4GKEJUOCTM# $TGOGTJCXGP 5GJTUEJÌPpXQT\ÒINKEJ

 

4GKEJUOCTM# $TGOGTJCXGP 5GJTUEJÌPpXQT\ÒINKEJ





 

4GKEJUOCTM# 0QTFJCWUGP(CUV5VGORGNINCP\



 

4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 8QT\ÒINKEJ



4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 2CVKPCUGJTUEJÌPpXQT\ÒINKEJ



4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 8QT\ÒINKEJ



4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP -N4CPFHGJNGTXQT\ÒINKEJ



4GKEJUOCTM( 7PKXGTUKV·V6ÒDKPIGP 9KP\4CPFHGJNGTUGJTUEJÌP



 

 

      

41


,CGIGT  

 

 

 

 

42

4GKEJUOCTM# 7PKXGTUKV·V/CTDWTI 2QNKGTVG2NCVVG



4GKEJUOCTM# 7PKXGTUKV·V/CTDWTI (CUV5VGORGNINCP\



4GKEJUOCTM# 'KEJDCWO8QT\Ã&#x2019;INKEJ

4GKEJUOCTM# 'KEJDCWO8QT\Ã&#x2019;INKEJ

4GKEJUOCTM# 'KEJDCWO2TCEJVGZGORNCT 2QNKGTVG2NCVVG

,CGIGT  

4GKEJUOCTM) 'KEJDCWO8QT\Ã&#x2019;INKEJ



 

4GKEJUOCTM( 'KEJDCWO8QT\Ã&#x2019;INKEJ



 

4GKEJUOCTM( 'KEJDCWO-N4CPFHGJNGT XQT\Ã&#x2019;INKEJp5VGORGNINCP\



 

4GKEJUOCTM&&Ã&#x2019;TGT 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



 

4GKEJUOCTM&&Ã&#x2019;TGT 8QT\Ã&#x2019;INKEJ










,CGIGT  

 

 

 

 

,CGIGT

4GKEJUOCTM# 0CWODWTI5CCNG8QT\ÒINKEJ



4GKEJUOCTM& &KPMGNUDÒJN 9KP\-TCV\GTXQT\ÒINKEJ



4GKEJUOCTM#.GUUKPI 8QT\ÒINKEJp5VGORGNINCP\

4GKEJUOCTM#9CNFGEM 8QT\ÒINKEJ

4GKEJUOCTM'/GKUUGP 8QT\ÒINKEJ

 

4GKEJUOCTM'/GKUUGP /KP4CPFHGJNGTUGJTUEJÌP



 

4GKEJUOCTM# 8GTHCUUWPIUVTGWG2QNKGTVG2NCVVG



 

4GKEJUOCTM#<GRRGNKP 8QT\ÒINKEJCWURQNKGTVGT2NCVVG



 

4GKEJUOCTM&<GRRGNKP 8QT\ÒINKEJ



 

4GKEJUOCTM&<GRRGNKP 5GJTUEJÌPpXQT\ÒINKEJ



 

4GKEJUOCTM# 4JGKPNCPFT·WOWPI (CUV5VGORGNINCP\ CWURQNKGTVGT2NCVVG









43


,CGIGT  

 

4GKEJUOCTM# /CIFGDWTI (CUV5VGORGNINCP\ CWURQNKGTVGT2NCVVG 4GKEJUOCTM# /CIFGDWTI 5GJTUEJÌPpXQT\ÒINKEJ

,CGIGT 

 

 

 

 

44

4GKEJUOCTM# (TGKJGTTXQO5VGKP (CUV5VGORGNINCP\



4GKEJUOCTM#.WVJGT+P 752NCUVKMJQNFGTFGT#0#OKVFGT $GYGTVWPI2(%COGQ 2TCEJVGZGORNCT2QNKGTVG2NCVVG



4GKEJUOCTM#.WVJGT 2TCEJVGZGORNCT (CUV5VGORGNINCP\



 

4GKEJUOCTM).WVJGT 8QT\ÒINKEJ



 

4GKEJUOCTM# 2TCEJVGZGORNCT5GJTUGNVGPKP FKGUGT'TJCNVWPI2QNKGTVG2NCVVG





 

4GKEJUOCTM& -WTUOÒP\G2TCEJVGZGORNCT (CUV5VGORGNINCP\



4GKEJUOCTM& -WTUOÒP\G5GJTUEJÌP



4GKEJUOCTM' -WTUOÒP\G5GJTUEJÌP



&4+66'54'+%*

   

4GKEJUOCTM))QGVJG 445GJTUEJÌP




$70&'54'27$.+- &'765%*.#0&

,CGIGT  

4GKEJUOCTM) 48QT\ÒINKEJ



,CGIGT  

 

4GKEJUOCTM( 5EJKNNGT2TCEJVGZGORNCT 2QNKGTVG2NCVVGOKPDGTÒJTV

  

   

 

4GKEJUOCTM( 5EJKNNGT8QT\ÒINKEJ

4GKEJUOCTM( 5EJKNNGT8QT\ÒINKEJ





 

 

4GKEJURHGPPKI# (CUV5VGORGNINCP\

 

4GKEJURHGPPKI& 8QT\ÒINKEJ



2HGPPKI) $CPM&GWVUEJGT.·PFGT5GNVGP DGUQPFGTUKPFKGUGT'TJCNVWPI 5VGORGNINCP\



2HGPPKI) $CPM&GWVUEJGT.·PFGT 45GJTUEJÌP



2HGPPKI) $CPM&GWVUEJGT.·PFGT 4-QTTQFKGTV(WPFGZGORNCT UGJTUEJÌP



2HGPPKI,448QT\ÒINKEJ

 C 2HGPPKI) 'KPG1TKIKPCNTQNNGOKV5VÒEM 5VGORGNINCP\  

 

2HGPPKI, 5GJTUGNVGPKPFKGUGT'TJCNVWPI 'TUVCDUEJNCIHGKPUVGT5VGORGNINCP\

&/(),) ) Z 5VÒEM 8QT\ÒINKEJpRQNKGTVG2NCVVG

 





  

&/, 5GNVGPKPFKGUGT'TJCNVWPI 8QT\ÒINKEJ

 45


,CGIGT  

&/& )GTOCPKUEJGU/WUGWO +P752NCUVKMJQNFGTFGT#0#OKV FGT$GYGTVWPI/5 8QT\ÒINKEJp5VGORGNINCP\



 D( &/,1N[ORKUEJG 5QOOGTURKGNGKP/ÒPEJGP 5RKTCNG8CTKCPVGOKV#TCDGUMGPKP FGT4CPFUEJTKHV 442QNKGTVG2NCVVG



-745/ª0<'05#6<&'4 $70&'54'27$.+- &'765%*.#0&  

 

&/) /CTMITCHXQP$CFGP+P75 2NCUVKMJQNFGTFGT#0#OKVFGT $GYGTVWPI/58QT\ÒINKEJ

 

&/,'KEJGPFQTHH 2QNKGTVG2NCVVGGVYCUCPIGNCWHGP

 

&/,'KEJGPFQTHH -N)TÒPURCPHNGEM XQT\ÒINKEJp5VGORGNINCP\

 

 

46

&/,/CZ2NCPEM 2QNKGTVG2NCVVG

&/(/CZ2NCPEM 2QNKGTVG2NCVVG

-WTUOÒP\GPUCV\#&(), 2QNKGTVG2NCVVG 

.165$70&'54'27$.+- &'765%*.#0& 

 

&KXGTUG-WTUWPF)GFGPMOÒP\GP FGT$4&WC&/ (KEJVG Z &/() Z GVE &C\WGKPKIG)GFGPMOÒP\GPFGT &&4WC/CTM $CEJ  /CTM 9CIPGT GVE+PVGT GUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM 5GJTUEJÌPpRQNKGTVG2NCVVG 

 

&KXGTUG/ÒP\GPFGT$4&XQO 2HGPPKIDKU\WO/CTMUVÒEM WC&/(KEJVG.GKDPK\ 22  *WODQNFV 22 GVE+PVGTGUUCPVGU .QVOKVFWTEJYGIIWVGP'TJCNVWP IGPDKVVGDGUKEJVKIGP5VÒEM (CUV5VGORGNINCP\D\Y RQNKGTVG2NCVVG



  

7OHCPITGKEJG5COONWPIXQP-WTU WPF)GFGPMOÒP\GPFGT$4&XQO 2HGPPKIDKU\WO/CTM5VÒEMW CFKGGTUVGP(ÒPH )GTOCPKUEJGU /WUGWO5EJKNNGT/CTMITCHXQP $CFGP'KEJGPFQTHH(KEJVG +PUIG UCOVUKPFGPVJCNVGPZ&/ )GFGPMOÒP\GPZ&/-WTU WPF)GFGPMOÒP\GPZ&/ -WTUOÒP\GP KPMNZ6TCWDGP WPFJTGP UQYKGYGKVGTG -NGKPOÒP\GP+PVGTGUUCPVGU.QV DKVVGDGUKEJVKIGP5VÒEM 5GJTUEJÌPpRQNKGTVG2NCVVG 

 

-QORNGVVG5GTKGFGT&/-WTU OÒP\GP , &KG 5COONWPIDGKPJCNVGVCWEJFCU UGNVGPG5VÒEM,+PVGTGUUCPVGU .QVDKVVGDGUKEJVKIGP/GKUVUGJT UEJÌP










,CGIGT  

,2HGPPKI,, 2HGPPKI()& ,&/&,( ,,,, (,(,& ,,&/, )(),&& ,&,&), (),&C\WGKP 2HGPPKI5VÃ&#x2019;EMFGU&TKVVGP4GKEJU UQYKG-CPCFC5KNXGT/CRNG.GCH *QNQITCO5GVKP 1TKIKPCN'VWK5VÃ&#x2019;EM 8QT\Ã&#x2019;INKEJp5VGORGNINCP\ 

,CGIGT   /CTMFGT&GWVUEJGP0QVGPDCPM *WODQNFV5VGORGNINCP\



  /CTMFGT&GWVUEJGP0QVGPDCPM *WODQNFV5VGORGNINCP\



&'765%*'&'/1-4#6+5%*' 4'27$.+-



  /CTMFGT&GWVUEJGP0QVGPDCPM 5EJKPMGN 8QT\Ã&#x2019;INKEJp5VGORGNINCP\



  /CTMFGT&GWVUEJGP0QVGPDCPM 5EJKPMGN2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\



  /CTMFGT&GWVUEJGP0QVGPDCPM 5EJKPMGN2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\



  /CTMFGT&GWVUEJGP0QVGPDCPM 5EJKPMGN2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\



  /CTMFGT&GWVUEJGP0QVGPDCPM .GKDPK\2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\

2

/CTMQ, )GDWTVUVCIXQP1VVQXQP )WGTKEMG /QVKXRTQDG45VGORGNINCP\







2

/CTMQ,,CJTG&&4 2TQDG(CUV5VGORGNINCP\



2

/CTM ,CJTG/Ã&#x2019;P\RT·IWPIKP $GTNKP2TQDG 42QNKGTVG2NCVVGQTKIKPCNXGTRCEMV



)'&'0-/ª0<'05#//.70)'0 &'4&&4 

  /CTMFGT&GWVUEJGP0QVGPDCPM .GKDPK\2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\



  /CTMFGT&GWVUEJGP0QVGPDCPM .GKDPK\2CVKPC XQT\Ã&#x2019;INKEJp5VGORGNINCP\



  /CTMFGT&GWVUEJGP0QVGPDCPM .GKDPK\-N4CPFHGJNGT XQT\Ã&#x2019;INKEJp5VGORGNINCP\



 

 

-QORNGVVG5GTKGFGT&&4)GFGPM OÃ&#x2019;P\GPFGU<GKVTCWOGU

, 5VÃ&#x2019;EM



-QORNGVVG5COONWPIFGT&&4 )GFGPMOÃ&#x2019;P\GP\WWPF /CTM&C\W'KPKIG &WDNGVVGPUQYKGFKXGTUG-WTUOÃ&#x2019;P \GPXQO2HGPPKIDKU\WO/CTM 5VÃ&#x2019;EM5GJTKPVGTGUUCPVGU1DLGMV DKVVGDGUKEJVKIGP5VÃ&#x2019;EM /GKUVXQT\Ã&#x2019;INKEJp5VGORGNINCP\  47


)'2.#06'5 -¤0+)4'+%*21.'0

,CGIGT

,CGIGT  C (GPKIQY( 5GNVGPKPFKGUGT'TJCNVWPI /KP-QTTQUKQPUHNGEMGP RQNKGTVG2NCVVG

 

0GW)WKPGC2HGPPKI# 8QT\ÒINKEJ



 

0GW)WKPGC/CTM# 8QT\ÒINKEJp5VGORGNINCP\



 

0GW)WKPGC/CTM# 8QT\ÒINKEJ



 

0GW)WKPGC/CTM# 8QT\ÒINKEJ



 

0GW)WKPGC/CTM# 5GJTUEJÌPpXQT\ÒINKEJ





<9'+6'49'.6-4+')

 

2T·IWPIGPFGT4GKEJUMTGFKVMCU UGP4GKEJURHGPPKI, 448QT\ÒINKEJ



&'765%*'-1.10+'0

&'765%*0'7)7+0'#  

 

0GW)WKPGC2HGPPKI# 8QT\ÒINKEJ

0GW)WKPGC2HGPPKI# -N(NGEMXQT\ÒINKEJ





&'765%*156#(4+-#  

0GW)WKPGC2HGPPKI# 8QT\ÒINKEJ



 

0GW)WKPGC2HGPPKI# 8QT\ÒINKEJ



48

 

*GNNGT, 8QT\ÒINKEJp5VGORGNINCP\




&#0<+)

,CGIGT  

4WRKG, 5GJTUGNVGPKPFKGUGT'TJCNVWPI 2QNKGTVG2NCVVG

,CGIGT 

 &D 2HGPPKI 45GJTUEJÌPpXQT\ÒINKEJ



-+#765%*17  

%GPV&C\W,%GPV 5VÒEM5GJTUEJÌP 

 

%GPV&C\W,%GPV 5VÒEM5GJTUEJÌP 

ex 6502

 &

 &

)WNFGP&C\W ,&)WNFGP 5VÒEM8QT\ÒINKEJ



)WNFGP (GKPG2CVKPC XQT\ÒINKEJp5VGORGNINCP\



 &

)WNFGP 8QT\ÒINKEJp5VGORGNINCP\



 &

)WNFGP8QT\ÒINKEJ

 &

)WNFGP /KP4CPFHGJNGT XQT\ÒINKEJp5VGORGNINCP\



56##6.+%*'016/ª0<'0 9'56(#.'0  0 $KNNKQP/CTM (TGKJGTTXQO5VGKP8QT\ÒINKEJ



 49


,CGIGT ,CGIGT  &

 &

)WNFGP 5GNVGPDGUQPFGTUKPFKGUGT 'TJCNVWPI2QNKGTVG2NCVVG

)WNFGP 45GJTUEJÌPpXQT\ÒINKEJ

 & )WNFGP-QIIG 5GJTUEJÌPpXQT\ÒINKEJ

 & )WNFGP /CTKGPMKTEJG5GJTUEJÌP

 & )WNFGP /CTKGPMKTEJG 9KP\4CPFHGJNGTUGJTUEJÌP 50

 & )WNFGP-TCPVQT 8QT\ÒINKEJ



 & )WNFGP-TCPVQT -N4CPFHGJNGTUGJTUEJÌP



 & )WNFGP-QIIG 8QT\ÒINKEJ



 & )WNFGP-QIIG 5GJTUEJÌP













 & )WNFGP4CVJCWU /KP4CPFHGJNGTYKP\-TCV\GT XQT\ÒINKEJ




241$'0810 4'+%*5)1.&/ª0<'0 $#;'40

,CGIGT  & )WNFGP4CVJCWU 9KP\4CPFHGJNGTUGJTUEJÌP



241$'0810 4'+%*5-.'+0/ª0<'0

 

2HGPPKIQ,QJPG/ÒP\\GKEJGP INCVVGT4CPF-WRHGTOO I5EJCCH)5NI$GE MGPDCWGT48QT\ÒINKEJ

,CGIGT  

.WFYKI+++/CTM QJPG/ÒP\\GKEJGPINCVVGT 4CPF5KNDGTXGTIQNFGV OOI5EJCCHCF C)5NI$GEMGPDCWGT 8QT\ÒINKEJ



241$'0&'4 9'+/#4'44'27$.+- 

241$'0810 4'+%*55+.$'4/ª0<'0 $4'/'0

 

 

/CTM#4CPFUEJTKHV =&'765%*'54'+%*?(ª0( /#4-5KNDGTOOI 5NI$GEMGPDCWGTXCT

#NWOKPKWOOKV-WRHGTMGTP  5EJCCHCFC) #NWOKPKWO OKV-WRHGTMGTP 4CPFWPF(GNFGT DGCTDGKVGVUGJTUEJÌP 

 

/CTM#4CPFUEJTKHV &'765%*'54'+%*(ª0( /#4-#NWOKPKWOOKV-WRHGT MGTPOOI 5NI$GEMGPDCWGT FKGU 'ZGORNCT 5EJCCHCFC) -N-TCV\GTXQT\ÒINKEJ

(TGKGWPF*CPUGUVCFV/CTM Q,OKVXGTVKGHVGT4CPFUEJTKHV %21'..#6*-WRHGTXGTUKN DGTVOOI5EJCCHCF C)5NI$GEMGPDCWGT 8QT\ÒINKEJ 

9ª466'/$'4)

 

9KNJGNO++/CTM (\WOL·JTKIGP4GIKG TWPIULWDKN·WO4CPFUEJTKHV)166 /+6705#NWOKPKWOOKV-WR HGTMGTPOOI 5NI$GEMGPDCWGT5EJCCH /442T·IGDGFKPIVGYKP\ 4CPFHGJNGTOCVVKGTV5VGORGNINCP\ 



'ZGORNCTFGT5COONWPI$GEMGPDCWGT #WMVKQP(TKV\4WFQNH-ÒPMGT 1UPCDTÒEM0T

51


 

,/CTM,/CTM , /CTM,/CTM ,/CTM,/CTM # ,CJTG-ÌPKITGKEJ  ,/CTM# 7PKXGTUKV·V $GTNKP ,/CTM'

8ÌNMGTUEJNCEJVFGPMOCN , /CTM,C/CTM &C\W9GKOCTGT4GRWDNKM ,4GKEJUOCTM(

.GUUKPI ,4GKEJUOCTM # 8GTHCUUWPI &C\WGKPKIG -NGKPOÒP\GPFGU-CKUGTTGKEJUWPF FGT9GKOCTGT4GRWDNKM5VÒEM 5GJTUEJÌPpHCUV5VGORGNINCP\ 

 

*CODWTI,/CTM ,/CTM/GEM NGPDWTI5EJYGTKP(TKGFTKEJ(TCP\ +8,/CTM *QEJ\GKV  ,/CTM *QEJ\GKV  5CEJUGP9GKOCT'KUGPCEJ9KN JGNO'TPUV,/CTM

7PKXGTUKV·V,GPC ,/CTM 5EJCWODWTI.KRRG)GQTI ,/CTM OKV.GDGPU FCVGP 5EJYCT\DWTI5QPFGTUJCW UGP-CTN)ÒPVJGT,C /CTM 4GIKGTWPIULWDKN·WO  ,D/CTM

4GIKGTWPIULWDKN·WO 9ÒTVVGO DGTI9KNJGNO++,/CTM ,/CTM ,C/CTM

5KNDGTJQEJ\GKV &C\WFKXGTUG -NGKPOÒP\GPFGU-CKUGTTGKEJU 5VÒEM/GKUVXQT\ÒINKEJ 

 

&KXGTUGWPF/CTM5VÒEMG FGU-CKUGTTGKEJU,    ##  Z 

Z    C +PVGTGUUCPVGU.QVOKVDGUUGTGP 6[RGPDKVVGDGUKEJVKIGP 5VÒEM6GKNYGKUGOKV(GJNGTP UEJÌPpUGJTUEJÌP 

 

$CFGP(TKGFTKEJ+ ,/CTM 4GIKG TWPIULWDKN·WO ,/CTM

4GIKGTWPIULWDKN·WO , /CTM )QNFGPG*QEJ\GKV  ,/CTM )QNFGPG *QEJ\GKV ,/CTM OKV .GDGPUFCVGP ,/CTM

OKV.GDGPUFCVGP (TKGFTKEJ++ ,/CTM ,/CTM5VÒEM 4CPFHGJNGT Z  UGJTUEJÌPpHCUV5VGORGNINCP\ 

,CGIGT  

 

/CTM((TKGFTKEJXQP 5EJKNNGTINCVVGT4CPF#NWOKPKWO OOI5NI$GEMGP DCWGT5EJCCHCF) 2TCEJVGZGORNCTXQPRQNKGTVGP 5VGORGNP5VGORGNINCP\



4GKEJUOCTM(OKV4CPF UEJTKHV'+0+)-'+670&4'%*6 70&(4'+*'+6,X.KGDKI 5KNDGT1JPG2WP\KGTWPIOO I5EJCCHCFC) 5NI$GEMGPDCWGT 448QT\ÒINKEJp5VGORGNINCP\ 

.165 4'+%*5-.'+0/ª0<'0  

-QPXQNWVXQP-NGKPOÒP\GPFGU -CKUGTTGKEJUFGT9GKOCTGT4GRW DNKMWPFFGU&TKVVGP4GKEJUXQO 2HGPPKIDKU\WO/CTM5VÒEM &C\W'KPKIG/ÒP\GPFGT0GDGP IGDKGVG )GPV5CCTNCPF1DGTDG HGJNUJCDGT1UVGVE +PVGTGUUCPVGU .QVOKVDGUUGTGP6[RGPDKVVGDG UKEJVKIGP5VÒEM 5EJÌPpXQT\ÒINKEJ



4'+%*55+.$'4/ª0<'0  

 

52

#NNIGOGKP,/CTM ,/CTM,/CTM ,/CTM ,/CTM,/CTM ,/CTM

*QEJ\GKV ,/CTM# ,/CTM# ,CJTG -ÌPKITGKEJ ,/CTM # 7PKXGTUKV·V$GTNKP , /CTM,/CTM 5VÒEM5GJTUEJÌPWPFDGUUGT  $C[GTP.WKVRQNF,/CTM OKV.GDGPUFCVGP*GUUGP .WFYKI+++,/CTM &C\W,2HGPPKI# ,2HGPPKI'

8GTRT·IWPI 5VÒEM (GNFGTIGIN·VVGV Z UGJT UEJÌPpXQT\ÒINKEJ




 

 

 

 

$C[GTP.WFYKI++ ,/CTM1VVQ++ ,/CTM, /CTM,/CTM

Z .WKVRQNF2TKP\TGIGPV ,/CTM )G DWTVUVCI ,/CTM

)GDWTVUVCI ,/CTM  )GDWTVUVCI .WFYKI+++ ,/CTM ,/CTM5VÒEM 5GJTUEJÌPpXQT\ÒINKEJ 

*GUUGP'TPUV.WFYKI ,/CTM 2JKNKRRFGT )TQ­OÒVKIG ,/CTM

2JKNKRRFGT)TQ­OÒVKIG , /CTM5VÒEM8QT\ÒINKEJ



2TGW­GP9KNJGNO+ ,#/CTM#,# /CTM#(TKGFTKEJ+++ ,/CTM#, /CTM#9KNJGNO++ ,/CTM# #,/CTM## ,/CTM#, /CTM# ,CJTG-ÌPKI TGKEJ ,/CTM#  ,CJTG-ÌPKITGKEJ ,/CTM  7PKXGTUKV·V$GTNKP , /CTM# 7PKXGTUKV·V$TGU NCWZ ,/CTM &GT -ÌPKITKGH ,/CTM

&GT-ÌPKITKGHZ , /CTM# 4GIKGTWPIULWDK N·WO ,/CTM#

4GIKGTWPILWDKN·WO , /CTM# -CKUGTKP 7PKHQTO ,/CTM#

-CKUGTKP7PKHQTO 5VÒEM (GNFGTIGIN·VVGV Z  UGJTUEJÌPpHCUV5VGORGNINCP\ 

5CEJUGP#NDGTV,/CTM ,/CTMOKV .GDGPUFCVGP)GQTI, /CTM,/CTM (TKGFTKEJ#WIWUV+++, /CTM,/CTM ,/CTM ,/CTM

7PKXGTUKV·V.GKR\KI , /CTM

8ÌNMGTUEJNCEJVFGPMOCN  5VÒEM5GJTUEJÌPpXQT\ÒINKEJ 

9'+/#4'44'27$.+-  

,4GKEJUOCTM#

4JGKPNCPFG ,4GKEJUOCTM # 4JGKPNCPFG , 4GKEJUOCTM# .ÒDGEM  ,4GKEJUOCTM#

.GUUKPI ,4GKEJUOCTM ' /GKUUGP , 4GKEJUOCTM# 8GT HCUUWPIUVTGWG ,4GKEJU OCTM# <GRRGNKP , 4GKEJUOCTM#& 4JGKP NCPFT·WOWPI ,4GKEJU OCTM& 8QIGNYGKFG , 4GKEJUOCTM) )QGVJG  ,4GKEJUOCTM#

.WVJGT ,4GKEJUOCTM ( 5EJKNNGT &C\WYGKVGTG /ÒP\GPFGT9GKOCTGT4GRWDNKM WPFFGU4GKEJU5VÒEM /GKUVXQT\ÒINKEJ 

 

&KXGTUGWPF4GKEJUOCTM 5VÒEMGFGT9GKOCTGT4GRWDNKM ,   5VÒEM /GKUVUGJTUEJÌP 

&4+66'54'+%*  

,4GKEJUOCTM)

.WVJGT ,4GKEJUOCTM # .WVJGT ,4GKEJU OCTM##, 4GKEJUOCTM' )CTPK UQPMKTEJG2QVUFCOOKV&CVWO  ,4GKEJUOCTM& )CT PKUQPMKTEJG2QVUFCOOKV&CVWO  ,4GKEJUOCTM(

5EJKNNGT ,4GKEJUOCTM ( 5EJKNNGT , 4GKEJURHGPPKI# 5VÒEM5GJTUEJÌPWPFDGUUGT



&'765%*'-1.10+'0  

 

&GWVUEJ1UVCHTKMC4WRKG ,,,4WRKG #4WRKG #*GNNGT,*GNNGT #,-W*GNNGT# Z -W *GNNGT,UQYKG6CDQTC *GNNGT Z *GNNGT

Z 5VÒEM5GJTUEJÌPWPF DGUUGT



&GWVUEJ0GW)WKPGC/M 2HGPPKI, &GWVUEJ1UVCHTKMCFKXGTUG/ÒP\GP FGU<GKVTCWOGUXQO *GNNGTDKU\WT4WRKGWC *GNNGTOKVXQNNUV·PFKIGO ..&C\WFKXGTUG'WTQ /ÒP\GPFGT$4& 5VÒEM  +PVGTGUUCPVGU.QVDKVVGDGUKEJVKIGP 5VÒEM'KPKIGOKVMN(GJNGTP HCUVUGJTUEJÌPpRQNKGTVG2NCVVG

 53


 

 

&GWVUEJ1UVCHTKMC, 4WRKG,4WRKG ,4WRKGP ,4WRKG,, 4WRKG,4WRKG #&C\W&KXGTUG WPF*GNNGT5VÒEMGUQYKG 2GUC Z  Z  5VÒEM6GKNYGKUGOKV(GJNGTP UEJÌPpXQT\ÒINKEJ 

&GWVUEJ0GW)WKPGC, 0GW)WKPGC2HGPPKI# ,0GW)WKPGC2HGPPKI #,0GW)WKPGC2HGPPKI #,0GW)WKPGC /CTM#5VÒEM$TQUEJKGT URWTGP Z UGJTUEJÌP

54

#NNIGOGKP-QPXQNWVUVCCVNKEJGT 0QVOÒP\GPXQP$TCWPUEJYGKI $TGOGP*CODWTI5EJNGUYKI *QNUVGKP5EJYCT\DWTIWPFFGT 2TQXKP\9GUVHCNGP&C\WFKXGTUG /ÒP\GPFGU5CCTNCPFGU/ÒP\GP CWU2QT\GNNCPWPF5VGKP\GWIUQYKG (CJTOCTMGPFGT5VTC­GPDCJP0ÒTP DGTI(ÒTVJ5VÒEM 5GJTUEJÌPpHCUV5VGORGNINCP\



9GUVHCNGP&KXGTUG0QVOÒP\GPFGT 2TQXKP\9GUVHCNGPFGU<GKVTCWOGU WC$KNNKQP/CTM  4 ,0000 00000 00C0D00 5VÒEM/GKUVXQT\ÒINKEJ 

&#0<+)  

,&C2HGPPKI,& -W2HGPPKI,&-W 2HGPPKI,&2HGPPKI ,&2HGPPKI ,&)WNFGP,& )WNFGP,&)WNFGP ,&)WNFGP ,&2HGPPKI,& 2HGPPKI Z ,& )WNFGP,&)WNFGP 5VÒEM/GKUVUGJTUEJÌP 

 

&CP\KIGT/ÒP\UGTKG,&C 2HGPPKI,&2HGPPKI  Z ,&2HGPPKI ,&2HGPPKI,& 2HGPPKI,&)WN FGP,&)WNFGP ,&)WNFGP,& )WNFGP&CP\KIGT/ÒP\ UGTKG,&2HGPPKI ,&2HGPPKI,& )WNFGP,&)WN FGP5VÒEM4CPFHGJNGT

Z UGJTUEJÌPpXQT\ÒINKEJ



56##6.+%*'016/ª0<'0  

 




14&'070&'*4'0<'+%*'0 

#DDKNFWPIGPUKPFUQHGTPPKEJVCPFGTUCPIGIGDGPCWH)TÌ­GXGTMNGKPGTV 'TJCNVWPIUCPICDGPWPF.KVGTCVWTXGT\GKEJPKUCO'PFGFGU-CVCNQIGU

7001 (1:1)

&'765%*'56##6'0$+5 $#;'40-¤0+)4'+%* 

6JGTGUKGPQTFGP 1TFGPUMTGW\ OKV FGT %JKHHTG KP $TKNNCPVGP )QNF GOCKNNKGTV &KCOCPVTQUGP IGRTÒHV    MCWO UKEJVDCTG 'OCKNNGCDURNKVVGTWPIGP KP FGT YGK­GP 'OCKNNG FGT 8QTFGTUGKVG FGU QDGTGP -TGW\CTOGU   UQYKGKO4CPFFGU4ÒEMUGKVGPOGFCKNNQPUCPCNVGTIGP·JVGT1TKIKPCNPCFGN1'- ++  &KG%JKHHTGKP$TKNNCPVGPYCTUVCVWVGPO·­KIPKEJVXQTIGUGJGP



/KNKV·T&KGPUVCWU\GKEJPWPIUMTGW\ HÒT ::+8 ,CJTG $TQP\G CO $CPF &C\W 1XCNG 4GIKOGPVU,WDKN·   WOUOGFCKNNG \WO L·JTKIGP $GUVGJGP FGU  DC[GTKUEJGP +PHCPVGTKGTGIKOGPVU *CTVOCPP KO ,CJTG   XGTUKNDGTVCP\GTUEJNKUUGPGT5EJNGKHG 5VÒEM++



7003 7004 (1:1)

7004 (1:1)

*#/$74)(4'+'*#05'56#&6 

)GFGPMOGFCKNNG\WTL·JTKIGP)GFGPMHGKGTFGT2QNK\GKDGJÌTFG0KEJVVTCIDCT$TQP\G&WTEJ OGUUGTOOKOPKEJVRCUUGPFGP'VWKHÒTGKPGJCODWTIKUEJG2QNK\GK&KGPUVLWDKN·WOUOGFCKNNGFCVKGTV  ++



*1*'0<1..'40(ª456'06ª/'4 

(ÒTUVNKEJ *QJGP\QNNGTPUEJGT *CWUQTFGP  /QFGNN CD   5KNDGTPGU 8GTFKGPUVMTGW\ WPVGT (ÒTUV   (TKGFTKEJ5KNDGTPGU'JTGPMTGW\IGPCPPV 5KNDGTCO$CPF1'- ++





(ÒTUVNKEJ *QJGP\QNNGTPUEJGT *CWUQTFGP  /QFGNN CD   5KNDGTPG 8GTFKGPUVOGFCKNNG OKV5EJYGT VGTP#WUICDG5KNDGT5EJYGTVGT5KNDGTXGTIQNFGVCO$CPF1'- ++

 55


7006

ex 7007

7008

/'%-.'0$74)5%*9'4+0)4155*'4<1)67/ 

/KNKV·TXGTFKGPUVMTGW\-NCUUG.GKEJVIGYÌNDVG(QTOOKVCWUIGRT·IVGT4ÒEMUGKVG-TKGIUOGVCNN 8GTIQNFWPIPKEJVOGJTXQTJCPFGPCP0CFGN&C\W.CPFYGJT&KGPUVCWU\GKEJPWPIUUEJPCNNG1'- XCT 5VÒEM+++++



0KOOGTIWVHÒJTVFKGUGGKPFGWVKI\GKVIGPÌUUKUEJG*GTUVGNNWPIUXCTKCPVGKO1'-PKEJVCWH

24'755'0-¤0+)4'+%* 

,QJCPPKVGTQTFGP $TWUVUVGEMMTGW\ FGT 1TFGPUTKVVGT 5KNDGT GOCKNNKGTV KO <GPVTWO OGJTGTG MNGKPG   'OCKNNGEJKRRU CWH FGT 4ÒEMUGKVG RWP\KGTV  WPF )* )GDTÒFGT *GOOGTNG !  CP 0CFGN &C\W   $TWUVMTGW\CWU.GKPGP 5VÒEM++p





*QJGP\QNNGTUEJG&GPMOÒP\GHÒT0KEJVM·ORHGT$TQP\GCO$CPF1'-





-QPXQNWVXQPXKGT-TKGIUGTKPPGTWPIU#WU\GKEJPWPIGP -TKGIUFGPMOÒP\G#WUHÒJTWPIOKV IGTCFNKPKIGP -TGW\CTOGPFGP QJPG $CPF   &ÒRRGNMTGW\  XGTNKGJGPGU 'ZGORNCT QJPG $CPF     #NUGPMTGW\  5RCPIGPRT·IWPI CO $CPF HÒT 4GUGTXGVTWRRGP   -TKGIUFGPMOÒP\G  HÒT   -·ORHGTCO$CPF1'-   5VÒEM++p+++

++

7010

7011

7012





7013

8GTFKGPUVMTGW\HÒT-TKGIUJKNHG#WUHÒJTWPIKPFWPMNGT$TQP\G  CO$CPF1'-XCT

'KPG$TQP\G#WUHÒJTWPIKUVKPFGT(CEJNKVGTCVWTDKUJGTPKEJVPCEJIGYKGUGP

++





9CVGTNQQ)GFGPMOGFCKNNG  FGU .ÒPGDWTIGT,·IGT$CVCKNNQPU   *CPPQXGTUEJGU +PHCPVGTKG   4GIKOGPVU0T $NCPMGPDWTI)QUNCT3WGFNKPDWTI.ÒPGDWTI5VCFG $TQP\GXGTUKNDGTVQJPG$CPF ++





#D\GKEJGPHÒT)TGP\CWHUGJGT#WUHÒJTWPIYQJNWPVGT-ÌPKI(TKGFTKEJ9KNJGNO+++QFGT+8PWOOG TKGTVZOOOKVCEJVMNGKPGP.ÌEJGTP\WO#PP·JGP +++





#D\GKEJGP HÒT #OVUFKGPGTFGT#OVUDG\KTMG<GEJNKP(QTOCVZOOITCXKGTV#OVUFKGPGTFGT #OVUDG\KTMG<GEJNKPFKG#FNGTMNCWGOKVFGO4GKEJUCRHGNCDIGDTQEJGPCP0CFGN ++



56


7017 ex 7014

7018

7016

5#%*5'0-¤0+)4'+%* 

'JTGPMTGW\ HÒT HTGKYKNNKIG 9QJNHCJTVURHNGIG KO -TKGIG #WUHÒJTWPI OKV  CWH FGT 4ÒEMUGKVG   'KEJGPNCWDNKPMUKO-TCP\CPUGJTUEJÌPGTCNVGT&COGPUEJNGKHG&C\W'JTGP\GKEJGPHÒT8GTFKGPUVKO -TKGIG/GFCKNNG$TQP\G  CP'KPGT$CPFURCPIG1'- 5VÒEM++



5#%*5'09'+/#4)4155*'4<1)67/ 

/KNKV·T &KGPUVCWU\GKEJPWPI  /QFGNN   /GFCKNNG  -NCUUG HÒT +: &KGPUVLCJTG #TIGPVCP   CO$CPF1'-



5#%*5'0#.6'0$74)*'4<1)67/ 

*GT\QI'TPUV/GFCKNNG#WUHÒJTWPIWPVGT*GT\QI'TPUV++5KNDGTCPCNVGTGVYCUCWUIGDNGKEJVGT&COGP UEJNGKHG1'- ++





6CRHGTMGKVUOGFCKNNG#WUHÒJTWPIKP$TQP\G  QJPG$CPF1'-





)QNFGPG 'TKPPGTWPIUOGFCKNNG \WO L·JTKIGP 4GIKGTWPIULWDKN·WO -ÌPKI -CTNU  #WUHÒJTWPI KP   $TQP\GXGTIQNFGVUVCTMGT4CPFUEJCFGPWPFOGJTGTG4CPFFGNNGP¤UGGPVHGTPV1'- +8

(TÒJGWPFUGNVGPG#WUICDGKP$TQP\G

4++

9ª466'/$'4)-¤0+)4'+%*

7019 (1:1)





ex 7020



7021 7022

-TKGIUFGPMÒP\G HÒT FGP (GNF\WI  (ÒT VTGWGP &KGPUV KP GKPGO (GNF\WIG XCTKCPVG 2T·IWPI OKV   ITÌ­GTGO IGUEJYWPIGPGP 5EJKNF )GUEJÒV\DTQP\G OKV 5VGORGNUEJPGKFGT\GKEJGP & OKV 1TKIKPCN   DCPFTKPIQJPG$CPF1'- ++



/KNKV·T&KGPUVCWU\GKEJPWPI  /QFGNN OKV /QPQITCOO -ÌPKI -CTNU    -NCUUG HÒT    &KGPUVLCJTG 'KUGP IGUEJY·T\V $TQP\G XGTIQNFGV CWH $CPFURCPIG CWHIGNGIV FCU $CPF CO QDGTGP   WPF WPVGTGP 4CPF GVYCU \GTUEJNKUUGP &C\W /KNKV·T&KGPUVCWU\GKEJPWPIUMTGW\ PCEJ :8 &KGPUVLCJTG   1'- 5VÒEM++p+++WPF++



&'765%*'54'+%* 

#D\GKEJGPFGT#TOGGCDVGKNWPI9Q[TUEJ#P0CFGN

++p



'KPIGDQTGPGP2C­OCTMGHÒT&GWVUEJ5ÒFYGUVCHTKMC#WUHÒJTWPIHÒTFGP)KDGQP2CUUXGTIQNFGVQJPG ,CJTWPFQJPGGKPIGUEJNCIGPG-QPVTQNNPWOOGT ++

  57


7023

7024



'KPIGDQTGPGP2C­OCTMG HÃ&#x2019;T &GWVUEJ5Ã&#x2019;FYGUVCHTKMC #WUHÃ&#x2019;JTWPI HÃ&#x2019;T FGP )TQQVHQPVGKP 2CUU XGTIQNFGV   QJPG,CJTWPFQJPGGKPIGUEJNCIGPG-QPVTQNNPWOOGT ++





'KPIGDQTGPGP2C­OCTMGHÃ&#x2019;T&GWVUEJ5Ã&#x2019;FYGUVCHTKMC#WUHÃ&#x2019;JTWPIHÃ&#x2019;TFGP5YCMQROWPF2CUUXGTIQNFGV QJPG,CJTWPFQJPGGKPIGUEJNCIGPG-QPVTQNNPWOOGT ++



7025

7026

7027

9'+/#4'44'27$.+- (4'+-1425 

&GVCEJGOGPVXQP4CPFQY&GWVUEJTKVVGTMTGW\-NCUUGXGTUKNDGTVWPFGOCKNNKGTVOGJTGTGCNVG'OCKNNG UEJ·FGPCWHFTGK-TGW\CTOGPCP0CFGNKORCUUGPFGPLGFQEJDGUEJ·FKIVGP'VWK &GEMGNNQUG  +++





&GWVUEJ4WUUKUEJG9GUVCTOGG#YCNQHH-TGW\-NCUUGXGTUKNDGTVWPFGOCKNNKGTVOKV5EJTCWDUEJGKDG ++ +PVGTGUUCPVG8CTKCPVGFKGUGU'JTGP\GKEJGPU



5%*#7/$74).+22'(4'+56##6 

'JTGPICDGFGU(TGKUVCCVGU5EJCWODWTI.KRRGKP5KNDGT0KEJVVTCIDCT5KNDGTOOIKO4CPF RWP\KGTVKO1TKIKPCNXGTNGKJWPIUGVWK*ª5- 44+p++



7029 7028

&'765%*'54'+%* 

&GWVUEJGU4GKVGTCD\GKEJGP#D\GKEJGP-NCUUGKP$TQP\GTÃ&#x2019;EMUGKVKIG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC .CWGTKP0Ã&#x2019;TPDGTIWPF$GTNKPCP0CFGN1'- ++





#WUYGKUOCTMG FGT 5VCCVNKEJGP -TKOKPCNRQNK\GK $TQP\G UGJT UVCTM IGVTCIGP OKV XKGNGP 5EJTCOOGP   PWOOGTKGTV +8



58


7030 (1:1)

$70&'54'27$.+-&'765%*.#0& 

$WPFGUXGTFKGPUVQTFGP)TQ­MTGW\UGVDGUVGJGPFCWU)TQ­MTGW\XGTIQNFGVWPFGOCKNNKGTVCO5EJWNVGT DCPF OKVGKPIGYGDVGPN·PINKEJGP$WPFGUCFNGTP WPF$TWUVUVGTP5KNDGTXGTIQNFGVVGKNYGKUGGOCKNNKGTV FCU1TFGPUMTGW\OKV\YGK0KGVGPDGHGUVKIVCP0CFGNFKGUGRWP\KGTV5V.WPFKO1TKIKPCN XGTNGKJWPIUGVWKFGT(KTOC5VGKPJCWGT.Ã&#x2019;EMKP.Ã&#x2019;FGPUEJGKF5#.. 5VÃ&#x2019;EM+



3WCNKV·VUXQNNG#PHGTVKIWPIYQJNCWUFGP5GEJ\KIGT,CJTGP

7031

&'765%*')4722'052#0)'0 /+0+#674'0-'66%*'070&52#0)'0 

)TQ­G 1TFGPUURCPIG OKV UGEJU #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\  -NCUUG     5CEJUGP(TKGFTKEJ#WIWUV/GFCKNNGKP$TQP\GCO$CPFHÃ&#x2019;T-QODCVVCPVGP 'JTGPMTGW\FGU9GNV MTKGIGU HÃ&#x2019;T (TQPVM·ORHGT 6TGWFKGPUVMTGW\HÃ&#x2019;T,CJTG 5CEJUGP#NVGPDWTI6CRHGTMGKVUOGFCKNNG -TKGIUOGVCNN 5CEJUGP.CPFYGJT&KGPUVCWU\GKEJPWPI-NCUUG/GFCKNNG  5VÃ&#x2019;EM++p+++



7032



)TQ­G1TFGPUURCPIGOKVXKGT#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\-NCUUG .Ã&#x2019;DGEM *CPUGCVGPMTGW\ /GEMNGPDWTI5EJYGTKP/KNKV·TXGTFKGPUVMTGW\-NCUUG 'JTGP MTGW\FGU9GNVMTKGIGUHÃ&#x2019;T(TQPVM·ORHGT1'- 5VÃ&#x2019;EM++

 59




)TQ­G 1TFGPUURCPIG OKV XKGT #WU\GKEJPWPIGP   $C[GTP /KNKV·T8GTFKGPUVMTGW\  /QFGNN -TGW\   -NCUUGOKV5EJYGTVGTP 2TGW­GP'KUGTPGU-TGW\-NCUUG 'JTGPMTGW\FGU9GNVMTKGIGU HÃ&#x2019;T (TQPVM·ORHGT   $C[GTP #TOGGFGPM\GKEJGP  CO WPTKEJVKIGP $CPF  1'-      5VÃ&#x2019;EM++



&CUWPTKEJVKIRNC\KGTVG#TOGGFGPM\GKEJGPJ·PIVCO$CPFFGT&KGPUVCWU\GKEJPWPI

ex 7037

7034





)TQ­G 1TFGPUURCPIG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\  -NCUUG     1NFGPDWTI(TKGFTKEJ#WIWUV-TGW\-NCUUGOKV$CPFURCPIG814&'/('+0&' 'JTGPMTGW\ FGU9GNVMTKGIGUHÃ&#x2019;T(TQPVM·ORHGT1'- 5VÃ&#x2019;EM+p++



)TQ­G 1TFGPUURCPIG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\  -NCUUG    *CO   DWTI*CPUGCVGPMTGW\ 'JTGPMTGW\FGU9GNVMTKGIGUHÃ&#x2019;T(TQPVM·ORHGT<WUCOOGPOKVGPVURTGEJGP FGT+PVGTKOURCPIG1'- 5VÃ&#x2019;EM++



&KGUG 5RCPIG DGUVCPF WTURTÃ&#x2019;PINKEJ CWU GKPGT <YGKGTURCPIG WPFYWTFGCWU#PNC­FGT8GTNGKJWPIFGU'JTGPMTGW\GU FGU9GNVMTKGIGUHÃ&#x2019;T(TQPVM·ORHGTGTYGKVGTV





)TQ­G 1TFGPUURCPIG OKV FTGK #WU\GKEJPWPIGP   2TGW­GP 'KUGTPGU -TGW\  -NCUUG      1NFGPDWTI (TKGFTKEJ #WIWUV-TGW\  -NCUUG   2TGW­GP /KNKV·T&KGPUVCWU\GKEJPWPI  /QFGNN   -TGW\+-NCUUGHÃ&#x2019;T:8&KGPUVLCJTG1'- 5VÃ&#x2019;EM++



)TQ­G1TFGPUURCPIGPOKV\YGKXQPFTGK#WU\GKEJPWPIGP 2TGW­GP'KUGTPGU-TGW\-NCUUG  $CFGP5KNDGTPG8GTFKGPUVOGFCKNNG-TKGIUOGVCNNXGTUKNDGTVCO$CPFFGT/KNKV·TKUEJGP-CTN(TKGFTKEJ /GFCKNNG   $CPF HÃ&#x2019;T FGP 'KUGPGTP *CNDOQPF FCTCWH UKNDGTPG $CPFURCPIG OKV CTCDKUEJGP 5EJTKHV   \GKEJGPWPFCWHIGUVGMVGT/KPKCVWTFGU'KUGTPGP*CNDOQPFGU&C\W/KPKCVWTFGT5KNDGTPGP8GTFKGPUV OGFCKNNGXQO4QVGP*CNDOQPF1'- 5VÃ&#x2019;EM++



ex 7038



7040

)TQ­G 1TFGPUURCPIG OKV \YGK #WU\GKEJPWPIGP   -QNQPKCN&GPMOÃ&#x2019;P\G HÃ&#x2019;T 9GK­G $TQP\G XGTIQNFGV   CWH FGO $CPF PCEJVT·INKEJ DGHGUVKIV 5RCPIG *'4'41.#0&   'JTGPMTGW\ FGU 9GNVMTKGIGU HÃ&#x2019;T   (TQPVM·ORHGT &C\W 'KP YGKVGTGU UGRCTCVGU 'JTGPMTGW\ FGU 9GNVMTKGIGU HÃ&#x2019;T (TQPVM·ORHGT CO $CPF   1'- 5VÃ&#x2019;EM+





)TQ­G 1TFGPUURCPIG OKV \YGK #WU\GKEJPWPIGP   9Ã&#x2019;TVVGODGTI 9KNJGNOUMTGW\ OKV 5EJYGTVGTP    'JTGPMTGW\FGU9GNVMTKGIGUHÃ&#x2019;T(TQPVM·ORHGT1'- 5VÃ&#x2019;EM++





)TQ­G 1TFGPUURCPIG OKV \YGK #WU\GKEJPWPIGP   $CFGP )GF·EJVPKUOGFCKNNG HÃ&#x2019;T  UQIGPCPPVG   $TWFGTOQTFOGFCKNNG -CTNUTWJGT 2T·IWPI   2TGW­GP *QJGP\QNNGTP&GPMOÃ&#x2019;P\G  HÃ&#x2019;T   -·ORHGTCPCNVIGP·JVGT$CPFURCPIG1'- 5VÃ&#x2019;EM++



(TÃ&#x2019;JG5RCPIGGKPGU8GVGTCPGPFGT(GNF\Ã&#x2019;IGY·JTGPFWPFKP(QNIGFGTFGWVUEJGP4GXQNWVKQPXQPCWUFGT /KVVGFGU,CJJWPFGTVUOKVNGKEJVCPIGUEJOWV\GP$·PFGTPFKG/GFCKNNGPLGFQEJKPJGTXQTTCIGPFGT'TJCNVWPI



60

-QPXQNWV XQP \YGK &TGKGT WPF FTGK <YGKGTURCPIGP &CTWPVGT XKGT OKV 'KUGTPGP -TGW\GP ++ -NCUUG    5VÃ&#x2019;EM++




7042

ex 7043



/KPKCVWTGPMGVVEJGPOKV\YÌNH#WU\GKEJPWPIUOKPKCVWTGPFGUFGWVUEJGP4GKEJGUKPFGTJGWVK IGP 6TCIGYGKUG QJPG *CMGPMTGW\   &GWVUEJGU -TGW\ KP )QNF   'JTGPDNCVVURCPIG FGU *GGTGU     '- +    '- ++  OKV 9KGFGTJQNWPIUURCPIG    5KNDGTPGU 8GTYWPFGVGPCD\GKEJGP    5KNDGTPGU+PHCPVGTKGUVWTOCD\GKEJGP /GFCKNNG9KPVGTUEJNCEJVKO1UVGP 'JTGPMTGW\FGU9GNV MTKGIGUHÒT(TQPVM·ORHGT $CNVGPMTGW\ 4KVVGTMTGW\FGU8GTFKGPUVQTFGPUFGU5QWXGT· PGP /CNVGUGT4KVVGTQTFGPU   9GJTOCEJVU&KGPUVCWU\GKEJPWPI HÒT  ,CJTG   9GJTOCEJVU&KGPUV   CWU\GKEJPWPIHÒT,CJTG 5VÒEM++



5EJÌPGU#WU\GKEJPWPIUMGVVEJGPGKPGUJQEJFGMQTKGTVGP8GVGTCPGPDGKFGT9GNVMTKGIG



2TGW­KUEJG /KPKCVWTQTFGPUURCPIG OKV UGEJU #WU\GKEJPWPIUOKPKCVWTGP   /GFCKNNG XQO 4QVGP -TGW\    -NCUUG   #NNIGOGKPGU 'JTGP\GKEJGP  -NCUUG   .CPFYGJT&KGPUVCWU\GKEJPWPI ++ -NCUUG  

/GFCKNNG  -TKGIUFGPMOÒP\GHÒT-QODCVVCPVGP 'TKPPGTWPIUGKEJGPPCEJ&KGPUVLCJ TGPDGKFGT5VCCVU'KUGPDCJP %GPVGPCTOGFCKNNG8KGNIGVTCIGPG5RCPIGOKVVGKNYGKUGGVYCU\GTUEJNKU UGPGP$·PFGTP&C\WGT/KPKCVWTMGVVEJGPQJPG0CFGNP 'KUGTPGU-TGW\++ (TQPVM·ORHGT MTGW\ /KNKV·T&KGPUVCD\GKEJGPHÒT:++,CJTG/GFCKNNG $CNVGPMTGW\ 5VÒEM++WPF+++



7044



-QPXQNWVXQP\YGK/KPKCVWTGPMGVVEJGP C '-++D (TQPVM·ORHGTMTGW\E 5EJCWODWTI.KRRG -TGW\ HÒT VTGWG &KGPUVG  F  )GQTIKGP 1TFGP FGT -ÌPKIKP 6COCTC 5VGTP FGT  -NCUUG    C '-++D 1NFGPDWTI(TKGFTKEJ#WIWUV-TGW\-NCUUGE (TQPVM·ORHGTMTGW\F 2TGW­GP /KNKV·TFKGPUVCWU\GKEJPWPIUMTGW\HÒT:8,CJTGG /GFCKNNGFGU5QNFCVGP5KGFNWPIU8GTDCPFGU-WTNCPF H 5EJYCT\GU8GTYWPFGVGP#D\GKEJGP 5VÒEM++



+PVGTGUUCPVG-GVVEJGPXQP(TGKMQTRU#PIGJÌTKIGP

ex 7045

&'765%*'-1081.76' 



-QPXQNWVXQP#WU\GKEJPWPIGP/GFCKNNGPWPF#D\GKEJGPFCXQPFGWVUEJGFCTWPVGTPKEJVVTCIDCT $TQP\GOGFCKNNG FGT  &GWVUEJGP #TOGGYGVVM·ORHG $GTNKP   OO 4CPFUEJ·FGP  WPF  CWU   N·PFKUEJG W C CWU $WNICTKGP 4W­NCPF ,CRCP (TCPMTGKEJ WPF /CTQMMQ WPVGTUEJKGFNKEJG /GVCNNG    VGKNYGKUGCP$·PFGTP 5VÒEM++p+++



-QPXQNWVXQPXKGT(KPIGTTKPIGPOKV6QVGPMQRHWPFOKV'-WPFQFGT4GKEJUHCTDGP Z WPVGTUEJKGFNK EJG/GVCNNGWPF)TÌ­GP 5VÒEM++WPF+++

 61


#75.0&+5%*'14&'070&'*4'0<'+%*'0 );26'0 -¤0+)4'+%*   

/GFCKNNG HÒT FGP GTUVGP 2CN·UVKPCMTKGI <YGK 'ZGORNCTG   MÌPKINKEJG #WUICDG   TGRWDNKMCPKUEJG   #WUICDGLGYGKNUCO$CPF 5VÒEM++



7048 7049

7050



/GFCKNNGCWU#PNC­FGT6JTQPDGUVGKIWPI-ÌPKI(CTWMU8GTUKNDGTVCO$CPF



/GFCKNNGHÒTOKNKV·TKUEJG2HNKEJVGTHÒNNWPI/GFCKNNG\YGKVG-NCUUG5KNDGTRWP\KGTVCO$CPF

++



++



++



4'27$.+- 5'+6 

6*+12+'0 -#+5'444'+%* $+5  

/GFCKNNGHÒTFKG4ÒEMIGYKPPWPIXQP'TKVTGCKP$TQP\G$TQP\GCO$CPF

7051







62

7053

1TFGPXQO5KGIGN-ÌPKI5CNQOQPU/QFGNN#WUHÒJTWPI QJPG'OCKNNG )TQ­MTGW\UGVDGUVGJGPF CWU)TQ­MTGW\FGMQTCVKQPXGTIQNFGVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5GXCFLKCPKP #FFKU#DGDCCO5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTXGTIQNFGVCP0CFGN1#0XCTXCT 5VÒEM++



1TFGPXQO5KGIGN-ÌPKI5CNQOQPU/QFGNN#WUHÒJTWPI QJPG'OCKNNG -QOOCPFGWTFGMQTCVKQP XGTIQNFGVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5GXCFLKCPKP#FFKU#DGDCCO5EJWNVGT DCPF1#0XCT ++



1TFGP XQO 5KGIGN -ÌPKI 5CNQOQPU -QPXQNWV XQP  4KVVGTFGMQTCVKQPGP    /QFGNN    /QFGNN   #WUHÒJTWPIDGKFGXGTIQNFGVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5GXCFLKCPKP#FFKU #DGDCLGYGKNUCO$CPF1#0XCT 5VÒEM++




7054 (1:1)





&TGKHCNVKIMGKVU1TFGP)TQ­MTGW\UGVDGUVGJGPFCWU)TQ­MTGW\FGMQTCVKQPVNYXGTIQNFGVWPFGOCKNNKGTV 'OCKNNGOCNGTGK CO 5EJWNVGTDCPF WPF $TWUVUVGTP VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN FKGUG   RWP\KGTV1#0 5VÒEM++



&TGKHCNVKIMGKVU1TFGP -QOOCPFGWTFGMQTCVKQP XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK CO   NCPIGPCWHYGPFKIMQPHGMVKQPKGTVGO*CNUDCPFOKV/GVCNNUEJNKG­GP1#0 ++



7056



ex 7057

&TGKHCNVKIMGKVU1TFGP 4KVVGTFGMQTCVKQP XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV 'OCKNNGOCNGTGK CO $CPF   1#0 ++



5GNVGPFCFKGPKGFTKIGTGP5VWHGPYGKN\WOGKUVPWTCP+PN·PFGTXGTNKGJGPKOGWTQR·KUEJGP*CPFGNPKEJVJ·WHKI\W HKPFGPUKPFCNUFKGJÌJGTGP5VWHGP



1TFGP FGT -ÌPKIKP XQP 5CDC  #WUHÒJTWPI QJPG 'OCKNNG  )TQ­MTGW\UGV DGUVGJGPF CWU )TQ­   MTGW\FGMQTCVKQP  XGTIQNFGV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI FGT (KTOC 5GXCFLKCP KP #FFKU   #DGDC CO 5EJWNVGTDCPF WPF $TWUVUVGTP 5KNDGT XGTIQNFGV CP 0CFGN FCTCWH GDGPHCNNU *GTUVGNNGTDG   \GKEJPWPIFGT(KTOC5GXCFKLCPKP#FFKU#DGDC81.2'5 5VÒEM++

 63


7058 (1:1)



/GPGNKM1TFGP )TQ­MTGW\UGV DGUVGJGPF CWU )TQ­MTGW\FGMQTCVKQP XGTIQNFGV WPF GOCKNNKGTV CO   5EJWNVGTDCPFWPF$TWUVUVGTPXGTIQNFGVWPFGOCKNNKGTVCP0CFGN1#0 5VÒEM++

7059



7061



/GPGNKM1TFGP-QOOCPFGWTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFKO1TKIKPCNGVWKFGT(KTOC #TVJWU$GTVTCPF2CTKU1#0 ++



/GPGNKM1TFGP-QOOCPFGWTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF1#0



1TFGP FGU 5VGTPU XQP VJKQRKGP  /QFGNN $TWUVUVGTP \WO )TQ­MTGW\ XGTIQNFGV WPF FWTEJDTQEJGP   IGCTDGKVGVCP0CFGNFCTCWH*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5GXCFLKCPKP#FFKU#DGDC1#0 ++





1TFGP FGU 5VGTPU XQP VJKQRKGP  /QFGNN )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUFGMQTCVKQP   XGTIQNFGVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC5GXCFLKCPKP#FFKU#DGDCCO*CNUDCPF WPF $TWUVUVGTP XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN CWH FKGUGT *GTUVGNNGTDG\GKEJPWPI FGT (KTOC   5GXCFLKCP 5VÒEM++





1TFGP FGU 5VGTPU XQP VJKQRKGP  /QFGNN -QOOCPFGWTFGMQTCVKQP XGTIQNFGV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC5GXCFLKCPKP#FFKU#DGDCCO*CNUDCPF ++





1TFGPFGU5VGTPUXQPVJKQRKGP-QPXQNWVXQPFTGKXGTUEJKGFGPGP'ZGORNCTGP1HHK\KGTUFGMQTCVKQP4KVVGT FGMQTCVKQPWPF/GFCKNNGXGTIQNFGVLGYGKNUCP$·PFGTPFCXQPGKPGUOKVMNGKPGT4QUGVVG 5VÒEM++





)TQ­G)QNFGPGWPF)TQ­G5KNDGTPG8GTFKGPUVOGFCKNNG





/KNKV·TKUEJG #WU\GKEJPWPIUOGFCKNNG *CKNG 5GNCUUKG + $TQP\G CO $CPF FCTCWH 2CNOGPCWHNCIG HÒT FKG   \YGKVG8GTNGKJWPICP6TCIGURCPIGFGT(KTOC/CRRKP9GDD.VF ++





-TÌPWPIUOGFCKNNG*CKNG5GNCUUKG+8GTIQNFGVCO$CPF



64

++

5VÒEM++

++

 


7068

7070

7069

7072

  

-TGW\HÒTFGP5KGIÒDGT+VCNKGP#WUICDGHÒT+PN·PFGT$TQP\GXGTUKNDGTVCO$CPF -TGW\HÒTFGP5KGIÒDGT+VCNKGP#WUICDGHÒT#WUN·PFGT$TQP\GXGTUKNDGTVCO$CPF )GFGPMOGFCKNNG\WO,CJTGUVCIFGU5KGIGUÒDGT+VCNKGP8GTUKNDGTVCO$CPF



/GFCKNNG HÒT FGP 'KPUCV\ KO -QTGCMTKGI $TQP\G XGTUKNDGTV (GKNURWT KO 4CPF CWH FGT 7PVGTUGKVG   *GTUVGNNGTDG\GKEJPWPI FGT (KTOC % % 5RQTTQPI  %Q KP 5EJYGFGP CO $CPF KO GVYCU DGUEJ·FKI   VGP1TKIKPCNXGTNGKJWPIUGVWKFGT(KTOC#TVJWU$GTVCPFKP2CTKU ++p



/GFCKNNG HÒT FGP 'KPUCV\ KO -QTGCMTKGI $TQP\G XGTUKNDGTV (GKNURWT KO 4CPF CWH FGT 7PVGTUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC%%5RQTTQPI%QKP5EJYGFGPCO$CPF ++





7075

ex 7076

7073

 

++ ++ ++

  

ex 7079 ex 7078

/GFCKNNGHÒTFGP-QPIQ'KPUCV\8GTIQNFGVCO$CPF /GFCKNNGHÒT2CVTKQVGPKP$TQP\G#O$CPFFCTCWH9KGFGTJQNWPIUURCPIGP

++p+++ ++

 

81.-54'27$.+-   

'JTGP\GKEJGPHÒTFKG*GNHGTFGT8GTGKPVGP0CVKQPGPDGKFGT*WPIGTMCVCUVTQRJGKPVJKQRKGP6GKNYGKUG NCEMKGTVCO$CPF 4++





-QPXQNWV XQP HÒPH XGTUEJKGFGPGP #WU\GKEJPWPIGP &CTWPVGT FKG 8GTYWPFGVGPOGFCKNNG WPF FCU 'JTGP   \GKEJGPHÒT8GTFKGPUVGWOFGP9KGFGTCWHDCWPCEJFGO$ÒTIGTMTKGILGYGKNUCP$·PFGTP 5VÒEM++



<9'+6'4'27$.+- 5'+6  

$TQP\GOGFCKNNGFGU)TQ­GP616#.VJKQRKGPNCWHUKO,CJTG$TQP\GCO*CNUDCPF

-¤0+)4'+%* $+5  

++



#()*#0+56#0

-QPXQNWVXQPXKGTXGTUEJKGFGPGP#WU\GKEJPWPIGP /GFCKNNGHÒTFGP(GNF\WIIGIGPFKGPQTFCHIJCPK UEJGP4GDGNNGP5KNDGT /GFCKNNGHÒT6TGWG&KGPUVGKP5KNDGT /GFCKNNGHÒT6TGWG&KGPUVGKP $TQP\G 8GTFKGPUVOGFCKNNGFGU5QPPGPQTFGPU5KNDGT 5VÒEM++



&'/1-4#6+5%*'4'27$.+-   

-QPXQNWV XQP FTGK #WU\GKEJPWPIGP   /GFCKNNG HÒT  &KGPUVLCJTG KP FGT #TOGG   /GFCKNNG HÒT    &KGPUVLCJTGKPFGT#TOGG /GFCKNNG\WO,CJTGUVCIFGT4GXQNWVKQP 5VÒEM++

 65


ex 7080

ex 7082 7081

#.)'4+'0 

#NNIGOGKPG /KNKV·T8GTFKGPUVOGFCKNNG -QPXQNWV FGT )QNFGPGP XGTIQNFGV  5KNDGTPGP XGTUKNDGTV  WPF   $TQP\GPGP/GFCKNNGCP$·PFGTP 5VÃ&#x2019;EM++





0CVKQPCNGT8GTFKGPUVQTFGP-NCUUGCO$CPF81.2'5





-QPXQNWVXQPFTGK#WU\GKEJPWPIGP #WU\GKEJPWPIHÃ&#x2019;TFKG8GTVGKFKIWPIFGU8CVGTNCPFGU /GFCKNNG HÃ&#x2019;T 9KGFGTUVCPFUM·ORHGT IGIGP (TCPMTGKEJ   /GFCKNNG HÃ&#x2019;T FKG 0CVKQPCNG $GHTGKWPI XQP (TCPMTGKEJ   LGYGKNUCP$·PFGTP 5VÃ&#x2019;EM++

++



7083 (1:1)

#4)'06+0+'0 

66

/CK8GTFKGPUVQTFGP/QFGNN#DVGKNWPIHÃ&#x2019;TCNNIGOGKPG8GTFKGPUVG)TQ­MTGW\UGVDGUVGJGPFCWU)TQ­ MTGW\FGMQTCVKQP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTVGKYGKUGXGT IQNFGVWPFGOCKNNKGTVCP0CFGN1#0 5VÃ&#x2019;EM++




7084

$#0).#&'5%* 

)TQ­G 1TFGPUURCPIG OKV HÃ&#x2019;PH #WU\GKEJPWPIGP  /GFCKNNGHÃ&#x2019;T-CORHGKPUCV\KO)GDKTIG #TOGG -CORHUVGTP    /GFCKNNG HÃ&#x2019;T 9CJNJGNHGT     /GFCKNNG \WO  ,CJTGUVCI FGT 7PCDJ·PIKIMGKV    /GFCKNNG\WOL·JTKIGP$GUVGJGPFGU$GPICNKUEJGP4KHNG4GIKOGPVUCP0CFGNP  5VÃ&#x2019;EM++

7086

7085







)TQ­G 1TFGPUURCPIG OKV XKGT #WU\GKEJPWPIGP   #TOGG-CORHUVGTP    *WTTKECP'KPUCV\OGFCKNNG    *QEJYCUUGT'KPUCV\OGFCKNNG #TOGG&KGPUVCWU\GKEJPWPIHÃ&#x2019;T,CJTGCP0CFGNP  5VÃ&#x2019;EM++



)TQ­G1TFGPUURCPIGOKVXKGT#WU\GKEJPWPIGP /GFCKNNGHÃ&#x2019;T-CORHGKPUCV\KO)GDKTIG /GFCKNNG \WO,CJTGUVCIFGT7PCDJ·PIKIMGKV /GFCKNNG\WOL·JTKIGP$GUVGJGPFGU$GPICNKUEJGP 4KHNG4GIKOGPVU #TOGG&KGPUVCWU\GKEJPWPIHÃ&#x2019;T,CJTGCP0CFGNP 5VÃ&#x2019;EM++



ex 7087

ex 7088

$74/# /;#0/#4  

-QPXQNWVXQP\YGK#WU\GKEJPWPIGP 'JTGP\GKEJGP6JKJC6CNC<CT\GKVHÃ&#x2019;T6CRHGTMGKV /GFCKNNGHÃ&#x2019;T DGUQPFGTG8GTFKGPUVG-NCUUGLGYGKNUCO$CPF 5VÃ&#x2019;EM++

4'27$.+-   



$4#5+.+'0

-QPXQNWV XQP HÃ&#x2019;PH #WU\GKEJPWPIGP   5KNDGTPGU 8GTFKGPUVMTGW\ FGT /CTKPG HÃ&#x2019;T VTGWG &KGPUVG XGTUKN   DGTV 'JTGP\GKEJGPHÃ&#x2019;TVTGWG&KGPUVGKPFGT#TOGG-NCUUG 'JTGP\GKEJGPHÃ&#x2019;TVTGWG&KGPUVGKP FGT #TOGG  -NCUUG   'JTGP\GKEJGP HÃ&#x2019;T VTGWG &KGPUVG KP FGT #TOGG  -NCUUG   5KNDGTPG   8GTFKGPUVOGFCKNNG5CPVQU&WOQPVFGT.WHVYCHHGXGTUKNDGTVLGYGKNUCP$·PFGTP 5VÃ&#x2019;EM++

 67


ex 7090 7089 (1:1)

81.-54'27$.+-   

)GQTIK&KOKVTQHH1TFGP*QJNIGHGTVKIVGLGFQEJUEJYGTG#WUHÒJTWPI)QNFGOCKNNKGTVCP2GPVCIQPCN DCPFURCPIG1#0 ++

-¤0+)4'+%*   

6#+9#0



$7470&+

-QPXQNWVXQP\YGK#WU\GKEJPWPIGP -ÌPKINKEJG/KNKV·T8GTFKGPUVOGFCKNNG -ÌPKINKEJG<KXKN8GT FKGPUVOGFCKNNGLGYGKNUCP$·PFGTP 5VÒEM++

ex 7091



$7.)#4+'0

7092



ex 7096

%*+0#

-QPXQNWVXQPUKGDGPXGTUEJKGFGPGP#WU\GKEJPWPIGP 4WJOGU/GFCKNNGFGT/CTKPGCWHFGT4ÒEMUGKVG PWOOGTKGTV %KPI(GPI8GTFKGPUVQTFGPFGT#TOGG-NCUUG 8GTFKGPUVOGFCKNNGFGU/CTK PGMQTRU   /GFCKNNG HÒT VTGWG &KGPUVG KP FGT #TOGG   *CK -WPI/GFCKNNG FGT /CTKPG     /GFCKNNG HÒT  5VWPFGP -CORHGKPUCV\ FGT .WHVYCHHG   'TKPPGTWPIUOGFCKNNG CP FCU 'PFG FGU   <YGKVGP9GNVMTKGIULGYGKNUCP$·PFGTPFTGKOKV+PVGTKOUURCPIG 5VÒEM++



81.-54'27$.+- 5'+6  

/KNKV·T8GTFKGPUVQTFGP 8GTUKNDGTV VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG GKPITCXKGTVGU   8GTNGKJWPIUFCVWOCP$CPF6TCIGURCPIG ++





1TFGP HÒT 8GTFKGPUVG WO FKG 4CWOHCJTV  -NCUUG XGTIQNFGV CP 0CFGN KO UGKFGPGP 1TKIKPCNXGTNGK   JWPIUGVWK ++





)GFGPMOGFCKNNGFGT8QNMUDGHTGKWPIUCTOGG\WO6CIFGT#TOGG #WIWUV 8GTIQNFGVCP2GPVCIQPCN DCPFURCPIGKO1TKIKPCNUGKFGPGVWK ++





/GFCKNNG HÒT )TQ­G .GKUVWPI KP FGT 8QNMUDGHTGKWPIUCTOGG  LGV\KIGU  /QFGNN  -NCUUG XGTIQNFGV   WPFVGKNYGKUGNCEMKGTVCP2GPVCIQPCNDCPFURCPIG\WUCOOGPOKV+PVGTKOUURCPIGKO1TKIKPCNGVWK ++





-QPXQNWVXQPUKGDGPXGTUEJKGFGPGP#WU\GKEJPWPIGP /GFCKNNGHÒTFKG$GHTGKWPIXQP0QTEJKPC  'JTGP\GKEJGPFGT&GOQMTCVKUEJGP2CTVGKHÒT8GTFKGPUVG 'JTGP\GKEJGPHÒTXGTFKGPUVG'KUGPDCJPGT   'JTGP\GKEJGP #WUIG\GKEJPGVGT 5QNFCV   'JTGP\GKEJGP HÒT JGNFGPJCHVG WPF XQTDKNFNKEJG 5QNFCVGP    -NCUUG KO 'VWK   'TKPPGTWPIUOGFCKNNG CP FKG &WTEJUEJYKOOWPI FGU ;CPIVUG FWTEJ /CQ    1TFGPHÒT8GTFKGPUVGWOFKG9KUUGPUEJCHV-NCUUGLGYGKNUCP2GPVCIQPCN$·PFGTPQFGT$CPFVTCIG URCPIGP 5VÒEM++



68


7097



ex 7098

&0'/#4-

ex 7098

'TKPPGTWPIUOGFCKNNG CP FKG (GNF\ÒIG XQP  $TQP\G CO DGUEJ·FKIVGP 1TKIKPCNDCPF 8'40    ++



8GTFKGPUVQTFGPXQP&WCTVG5CPEJG\WPF/GNNC)TQ­MTGW\UGVDGUVGJGPFCWU)TQ­MTGW\5KNDGTXGTIQN FGVWPFGOCKNNKGTVCO5EJWNVGTDCPFWPF$TWUVUVGTP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPIFGT(KTOC#PVKIWC8KNCTFGDQ[4KGTCKP*CXCPPCCP0CFGN1#0  5VÒEM++



&1/+0+-#0+5%*'4'27$.+-



7100

ex 7099



1TFGPHÒT*GNFGPJCHVKIMGKVWPF6TGWG'ZGORNCTG &GMQTCVKQP-NCUUG &GMQTCVKQP-NCUUG LGYGKNUXGTIQNFGVWPFGOCKNNKGTVCO$CPF 5VÒEM++



'.5#.8#&14 

0CVKQPCN1TFGP ,QU¾ /CVKCU &GNICFQ -QOOCPFGWTMTGW\ XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF   81.2'5 ++



(+00.#0& 

-QPXQNWVXQPHÒPH'JTGP\GKEJGP&CTWPVGT/GFCKNNGPXQO4QVGP-TGW\KP5KNDGTWPF$TQP\GLGYGKNUCP $·PFGTP 5VÒEM++



(4#0-4'+%* &4+66'$+5(ª0(6'4'27$.+- 5'+6  

-QPXQNWVXQPFTGK#WU\GKEJPWPIGP 1TFGPFGT'JTGPNGIKQP/QFGNNUGKV4KVVGTFGMQTCVKQP 5KNDGTVNY8GTIQNFGVWPFGOCKNNKGTVQJPG$CPF /CTQMMQ/GFCKNNG5KNDGTCO$CPFOKV$CPURCPIG /#41%   2TKXCVGT 8GTFKGPUVQTFGP .G /¾TKVG *CNUFGMQTCVKQP XGTIQNFGV WPF GOCKNNKGTV CO *CNU   DCPF 5VÒEM++

 69


)#$70 

1TFGPHÒT8GTFKGPUVGWOFKG0CVKQPCN'T\KGJWPI1HHK\KGTUFGMQTCVKQPXGTIQNFGVCO$CPFOKV4QUGVVG FC\W#TDGKVU8GTFKGPUVOGFCKNNGCO$CPF81.2'5 5VÒEM++



ex 7106 7104 7107

)4155$4+6#00+'0 

1TFGP FGU $TKVKUEJGP 'ORKTG  /QFGNN UGKV   1HHK\KGTUMTGW\ XGTIQNFGV   CO OKNKV·TKUEJGP   $CPF<'+ +p++

*#+6+

4'27$.+- 



/KNKV·TXGTFKGPUVQTFGP ,GCP ,CESWGU &GUUCNKPGU .G )TCPF 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV   CO$CPFOKV6TCIGURCPIGKO1TKIKPCNGVWKFGT(KTOC8KNCTFGDQ[4KGTCKP*CXCPPC81.2'5  4++





-QPXQNWVXQPFTGK#WU\GKEJPWPIGP /KNKV·T'JTGP\GKEJGPFGT)CTFGXQP*CKVK #TOGG&KGPUVCWU \GKEJPWPIHÒT,CJTG 0CVKQPCNGT1TFGPHÒT#TDGKVUXGTFKGPUVLGYGKNUCP$·PFGTP 5VÒEM++





(TCPEKUEQ/QTC\CP1TFGP-QOOCPFGWTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF1#0

*10&74#5

7108



7109

++



7111

7110

/KNKV·T8GTFKGPUVQTFGP 4KVVGTMTGW\ XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG *GTUVGNNGTDG\GKEJPWPI   FGT(KTOC05/G[GTKP0GY;QTMCO$CPF81.2'5 ++





/GFCKNNGFGT5VTGKVMT·HVGHÒTJGTXQTTCIGPFG8GTFKGPUVG8GTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPF





)QNFGPGU 8GTFKGPUVMTGW\ FGT .WHVYCHHG XQP *QPFWTCU 8GTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG   *GTUVGNNGTDG\GKEJPWPIFGT(KTOC05/G[GTKP0GY;QTMCO$CPF ++





4QVGU *GT\ HÒT XGTYWPFGVG #PIGJÌTKIG FGT 5VTGKVMT·HVG 8GTIQNFGVVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEM UGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC05/G[GTKP0GY;QTMCO$CPF ++



70

++


ex 7112

(ª456'06ª/'4

7113

ex 7114

ex 7115

+0&+'0



$CJCYCNRWT#NNIGOGKPGOKNKV·TKUEJG&KGPUVOGFCKNNG5KNDGTCO$CPFCP6TCIGURCPIG\WUCOOGPOKV FGT/KPKCVWTOGFCKNNG5KNDGTCO$·PFEJGP%.'0# 5VÒEM++





$CJCYCNRWT  /KNKV·T&KGPUVCWU\GKEJPWPIUOGFCKNNG 5KNDGT CO $CPF KP 1TKIKPCNUEJCEJVGN %.'0#    ++



4'27$.+- 5'+6  



-QPXQNWVXQPUGEJU#WU\GKEJPWPIGP 2CUEJKOK-TKGIUUVGTP 2QTXK-TKGIUUVGTP /KNK V·T&KGPUVCWU\GKEJPWPIUOGFCKNNG HÒT  ,CJTG   /KNKV·T&KGPUVCWU\GKEJPWPIUOGFCKNNG HÒT  ,CJTG    )GFGPMOGFCKNNG\WO7PCDJ·PIKIMGKVUVCI )GFGPMOGFCKNNG\WO7PCDJ·PIKIMGKVUVCI  5VÒEM++



-QPXQNWVXQPUGEJU#WU\GKEJPWPIGP 8GTYWPFGVGPOGFCKNNG /GFCKNNGHÒT&KGPUVKO*QEJIGDKTIG  /K\QTCP-TKGIUOGFCKNNG /GFCKNNGHÒTDGUQPFGTG'KPU·V\G /GFCKNNGHÒT-CORHGKPUCV\KO*QEJ IGDKTIG 2QNK\GK8GTFKGPUVOGFCKNNGOKV5RCPIG0CICNCPFLGYGKNUCP$·PFGTP 5VÒEM++



7116



)TQ­G1TFGPUURCPIGOKVCEJV#WU\GKEJPWPIGP /GFCKNNGHÒTDGUQPFGTGP'KPUCV\ 1RGTCVKQP8KLC[ /GFCKNNG 5CKP[C5JGXC/GFCKNNG /GFCKNNGHÒT'KPUCV\KPITQ­GT*ÌJG 8KFGUJ5JGXC/GFCKNNG   /GFCKNNG \WO  ,CJTGUVCI FGT 7PCDJ·PIKIMGKV    /KNKV·T&KGPUVCWU\GKEJPWPIOGFCKNNG HÒT    ,CJTG   8GTGKPVG 0CVKQPGP 70/16/GFCKNNG HÒT HTKGFGPUUVKHVGPGP 'KPUCV\ KP 6CFUEJKMKUVCP CP   0CFGNPOKVFC\WIGJÌTKIGT+PVGTKOURCPIG 5VÒEM++

7117







7118

)TQ­G 1TFGPUURCPIG OKV UGEJU #WU\GKEJPWPIGP   /GFCKNNG HÒT DGUQPFGTG 'KPU·V\G   5CKP[C 5GXC   /GFCKNNG 8KFGUJ5GXC/GFCKNNG /GFCKNNG\WO,CJTGUVCIFGT7PCDJ·PIKIMGKV /GFCKNNGHÒT  ,CJTG &KGPUV KP FGP 5VTGKVMT·HVGP   8GTGKPVG 0CVKQPGP 70+(+./GFCKNNG HÒT FGP 'KPUCV\ KO .KDC   PQPCP0CFGNP 5VÒEM++



)TQ­G 1TFGPUURCPIG OKV XKGT #WU\GKEJPWPIGP   8KLC[ 1RGTCVKQPU5VGTP   8KLC[ 1RGTCVKQPU   /GFCKNNG 5CP[C5GXC/GFCKNNG /GFCKNNG\WO,CJTGUVCIFGT7PCDJ·PIKIMGKV /GFCKNNGHÒT ,CJTG&KGPUVKPFGP5VTGKVMT·HVGPCP0CFGNP 5VÒEM++

 71


7121



7122

7119

)TQ­G1TFGPUURCPIGOKVHÒPH#WU\GKEJPWPIGP /GFCKNNGHÒTDGUQPFGTG'KPU·V\G 8KLC[1RGTCVKQPU /GFCKNNG 5CP[C5GXC/GFCKNNG /GFCKNNG\WO,CJTGUVCIFGT7PCDJ·PIKIMGKV /GFCKNNGHÒT ,CJTG&KGPUVKPFGP5VTGKVMT·HVGPCP0CFGNP 5VÒEM++



+0&10'5+'0 

1TFGP HÒT 8GTFKGPUVG WO FGP #WHDCW FGT 5VTGKVMT·HVG &GMQTCVKQP  -NCUUG XGTUKNDGTV VGKNYGKUG XGT   IQNFGVWPFGOCKNNKGTVCO$CPF ++



 

2QNK\GK8GTFKGPUV5VGTP&GMQTCVKQP-NCUUGXGTUKNDGTVCO$CPF )WGTKNNC5VGTPHÒTFGPDGYCHHPGVGP-CORHIGIGPFKG0KGFGTN·PFGTCO$CPF

 

++ 4++

ex 7123 7125 ex 7124



-QPXQNWVXQPUKGDGPXGTUEJKGFGPGP#WU\GKEJPWPIGP /GFCKNNGHÒTFKG6GKNPCJOGCPFGP-·ORHGPKP <GPVTCNLCXC /GFCKNNGHÒTFKG6GKNPCJOGCPFGP-·ORHGPKP,CMCTVC /GFCKNNGHÒTFKG 6GKNPCJOG CP FGP -·ORHGP CWH $QTPGQ   /GFCKNNG HÒT FKG 6GKNPCJOG CP FGP CPVKMQOOWPKUVKUEJGP   -·ORHGP    /GFCKNNG HÒT  ,CJTG VTGWG &KGPUVG KP FGT #TOGG   'JTGPOGFCKNNG HÒT IGNGKUVGVGP   /KNKV·TFKGPUV      'JTGP\GKEJGP )WVGT 2CVTKQV FGT 8GTGKPKIVGP 5VTGKVMT·HVG LGYGKNU CP   $·PFGTP 5VÒEM++



+06'40#6+10#.')'5'..5%*#(6514&'0 

1TFGP7PUGTGT.KGDGP(TCWXQP/GTEGFGU-QOOCPFGWTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPF \WUCOOGPOKV/KPKCVWTXGTIQNFGVWPFGOCKNNKGTVCO$·PFEJGPWPF-PQRHNQEJTQUGVVGOKV#WHNCIGKO 1TKIKPCNGVWKFGT(KTOC#NDGTVKKP/CKNCPF 5VÒEM++



3WCNKV·VUXQNNG#PHGTVKIWPICWUFGPGT,CJTGPOKVTQVGOCKNNKGTVGT-TQPGPJCWDGWPFUGRCTCVCWHFGP9CRRGPCWHIG NGIVGP-TGW\GP

-¤0+)4'+%*   

+6#.+'0

1TFGP FGT -TQPG XQP +VCNKGP -QOOCPFGWTMTGW\ )QNF GOCKNNKGTV CO *CNUDCPF KO OKP TGRCTKGTVGO   1TKIKPCNGVWKFGU*QHLWYGNKGTU%TCXCP\QNCKP4QO<'+ +p++ #PHGTVKIWPI CWU FGT <GKV FGU <YGKVGP 9GNVMTKGIU &KGUGT 1TFGP YWTFG KP FKGUGT 5VWHG CWEJ CP GKPG 4GKJG JÌJGTGT   1HHK\KGTGFGTFGWVUEJGP9GJTOCEJVXGTNKGJGP

72




7129

7127 ex 7131

7126

ex 7133



ex 7132

1TFGP FGT -TQPG XQP +VCNKGP 4KVVGTMTGW\ )QNF GOCKNNKGTV CO $CPF KO NWZWTKÌUGP 1TKIKPCNXGTNGK   JWPIUGVWK OKV &GFKMCVKQPUUEJKNFEJGP + %#2+6#0+ &'. u (#06'4+# #..  #/+%1 5#48'..+  

&KG*CWRVNGWVGFGU+PHCPVGTKGFGO(TGWPF5CTXGNNK  ++



4'27$.+- 5'+6  

8GTFKGPUVQTFGP FGT KVCNKGPKUEJGP 4GRWDNKM  /QFGNN   1HHK\KGTUMTGW\ 5KNDGT XGTIQNFGV   WPF GOCKNNKGTV CO $CPF OKV 4QUGVVG \WUCOOGP OKV /KPKCVWT 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO   $·PFEJGP OKV 4QUGVVG WPF -PQRHNQEJTQUGVVG FGT KO 1TKIKPCNXGTNGKJWPIUGVWK FGT (KTOC %TCXCP\QNC KP   4QO<'+ 5VÒEM++



8GTFKGPUVQTFGP FGT KVCNKGPKUEJGP 4GRWDNKM  /QFGNN   4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV CO $CPF \WUCOOGP  -PQRHNQEJTQUGVVG FGT KO 1TKIKPCNXGTNGKJWPIUGVWK FGT (KTOC 5GHCPQ   ,QJPUQPKP4QO<'+ ++





8GTFKGPUVOGFCKNNG HÒT FCU 0CVKQPCNG (GWGTYGJT-QTRU 8GTUKNDGTV CO $CPF KP 1TKIKPCNVÒVG FGU   *GTUVGNNGTU.QTKQNK(TCVGNNKKP/CKNCPF$4#5 +p+





-QPXQNWV XQP UGEJU XGTUEJKGFGPGP #WU\GKEJPWPIGP   -TGW\ HÒT FGP 70+(+.(TKGFGPUGKPUCV\    -TGW\HÒTFGP(TKGFGPGKPUCV\KO5KPCK -TGW\HÒTFGP(TKGFGPGKPUCV\KO.KDCPQP /GFCKNNGHÒT FGP'KPUCV\PCEJFGO'TFDGDGPKP(TKCWN /GFCKNNGHÒTFGP'KPUCV\PCEJFGO'TFDGDGPKPFGT $CUKNKMCVC /GFCKNNGHÒTFGP'KPUCV\PCEJFGO'TFDGDGPKP7ODTKGP 5VÒEM++





-#/$1&5%*# '456'5-¤0+)4'+%* $+5  

1TFGP HÒT #TDGKVUXGTFKGPUVG  'ZGORNCTG   1HHK\KGTUFGMQTCVKQP XGTIQNFGV WPF GOCKNNKGTV CO $CPF   OKV4QUGVVG 4KVVGTFGMQTCVKQPXGTIQNFGVWPFGOCKNNKGTVCO$CPF81.2'5 5VÒEM++





-QPXQNWVXQPCEJVXGTUEJKGFGPGP#WU\GKEJPWPIGP )QNFGPG8GTFKGPUVOGFCKNNGFGU-ÌPKIU0QTQFQO XGTIQNFGV   )QNFGPG 8GTFKGPUVOGFCKNNG FGU -ÌPKIU 0QTQFQO KP $TQP\G   /WPKUGTCRJQP1TFGP   4KVGTFGMQTCVKQP   #TDGKVU8GTFKGPUVOGFCKNNG XGTUKNDGTV   #TDGKVU8GTFKGPUVOGFCKNNG KP $TQP\G    #PWUUCTC/GFCKNNGHÒTMÌPKINKEJG<WHTKGFGPJGKV /GFCKNNGHÒTFGP9KGFGTCWHDCW /GFCKNNGHÒT 6TGWG&KGPUVGLGYGKNUCP$·PFGTP 5VÒEM++



81.54'27$.+-   

5KGIGUQTFGP'ZGORNCTGWPF-NCUUGXGTIQNFGVWPFNCEMKGTVLGYGKNUCP2GPVCIQPCND·PFGTP OKV#WHNCIGPLGYGKNUOKV+PVGTKOURCPIG 5VÒEM++

 73


ex 7135 ex 7134

ex 7136



0CVKQPCN8GTVGKFKIWPIUQTFGP  'ZGORNCTG   WPF  -NCUUG XGTIQNFGV WPF NCEMKGTV LGYGKNU CP   2GPVCIQPCND·PFGTPOKV#WHNCIGPFCDGKGKPG+PVGTKOURCPIG 5VÒEM++





1TFGP HÒT 8GTFKGPUVG WO FGP 0CVKQPCNGP #WHDCW  'ZGORNCTG   WPF  -NCUUG XGTIQNFGV WPF   NCEMKGTVLGYGKNUCP$CPFVTCIGURCPIGP 5VÒEM++





#TDGKVU8GTFKGPUVQTFGP'ZGORNCTGWPF-NCUUGXGTIQNFGVWPFGOCKNNKGTVLGYGKNUCP2GPVC IQPCND·PFGTPOKV#WHNCIGPLGYGKNUOKV+PVGTKOURCPIG 5VÒEM++



ex 7137

7138

7140 7141



1TFGPHÒT8GTFKGPUVGWOFKG(TGWPFUEJCHVFGT8ÌNMGT8GTIQNFGVWPFNCEMKGTVCP2GPVCIQPCNDCPFOKV +PVGTKOURCPIGFC\W#TDGKVU8GTFKGPUVOGFCKNNGXGTIQNFGVWPFNCEMKGTVCP$CPFVTCIGURCPIGWPF1TFGP FGTUQ\KCNKUVKUEJGP8QNMUIGOGKPUEJCHVXGTIQNFGVWPFGOCKNNKGTVCO$CPF 5VÒEM++



 

1TFGP*GNFFGT#TDGKV/QFGNNXGTIQNFGVWPFNCEMKGTVCP$CPFVTCIGURCPIG 1TFGP*GNFFGT#TDGKV/QFGNNXGTIQNFGVWPFNCEMKGTVCP$CPFVTCIGURCPIG

 



/KNKV·T8GTFKGPUVQTFGP)GPGTCN,QUG/CTKC%QTFQDC&GMQTCVKQP-NCUUG$TQP\GVGKNYGKUGGOCKNNKGTV CO$CPFOKV6TCIGURCPIG81.2'5 ++

++ ++

-1.7/$+'0 

-10)1 &'/1-4#6+5%*'4'27$.+- 5'+6  

74

8GTFKGPUVQTFGP4KVVGTFGMQTCVKQPOKV5EJYGTVGTPXGTUKNDGTVVGKNYGKUGGOCKNNKGTVOKP'OCKNNG#WUDTWEJ CO$CPF81.2'5 ++




ex 7144

ex 7142 ex 7143



-QPXQNWV XQP CEJV XGTUEJKGFGPGP 1TFGP WPF 'JTGP\GKEJGP   /KNKV·T8GTFKGPUVMTGW\  -NCUUG    /KNKV·T8GTFKGPUVMTGW\-NCUUG <KXKN8GTFKGPUVMTGW\-NCUUGXGTIQNFGV <KXKN8GTFKGPUV MTGW\-NCUUGXGTUKNDGTV <KXKN8GTFKGPUVMTGW\-NCUUG$TQP\G /GFCKNNGHÃ&#x2019;T8GTFKGPUVGWO FKG9KUUGPUEJCHVWPF-WPUV-NCUUGXGTUKNDGTV /GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG9KUUGPUEJCHVWPF -WPUV  -NCUUG $TQP\G   /GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FGP 5RQTV  -NCUUG XGTUKNDGTV LGYGKNU CP   $·PFGTPGKPGUFCXQPOKV#WHNCIG 5VÃ&#x2019;EM++



<#+4'   

8GTFKGPUVQTFGPXQP<CKTG4KVVGTFGMQTCVKQPXGTUKNDGTVWPFGOCKNNKGTV\WUCOOGPOKV/KPKCVWTXGTUKNDGTV WPFGOCKNNKGTVCO$·PFEJGPWPF4GXGTUCD\GKEJGPKP1TKIKPCNXGTNGKJWPIUUEJCEJVGNXQP#TVJWU$GTVTCPF 81.2'5 5VÃ&#x2019;EM+p++





-QPXQNWVXQPXGTUEJKGFGPGP1TFGPWPF'JTGP\GKEJGP 6CRHGTMGKVUMTGW\ 6CRHGTMGKVUMTGW\OKV 2CNOGP WPF $CPFURCPIG 4'27$.+37' &7 <#+4'  1255*#$#   5Ã&#x2019;F5JCDC'KPUCV\OGFCKNNG     5Ã&#x2019;F5JCDC'KPUCV\OGFCKNNG OKV .QTDGGTURCPIG   /GFCKNNG \WO  ,CJTGUVCI FGT 4GXQNWVKQP OKV   +PVGTKOURCPIGKO5EJ·EJVGNEJGP /GFCKNNGHÃ&#x2019;TGKPNCPIGU'JGNGDGP#WUHÃ&#x2019;JTWPIHÃ&#x2019;T*GTTGP/GFCKNNG  -NCUUG XGTUKNDGTV KO 5EJ·EJVGNEJGP   /GFCKNNG HÃ&#x2019;T GKP NCPIGU 'JGNGDGP #WUHÃ&#x2019;JTWPI HÃ&#x2019;T &COGP   /GFCKNNG-NCUUGXGTUKNDGTVKO5EJ·EJVGNEJGP /GFCKNNGHÃ&#x2019;TGKPNCPIGU'JGNGDGP#WUHÃ&#x2019;JTWPIHÃ&#x2019;T &COGP/GFCKNNG-NCUUG$TQP\G /GFCKNNGHÃ&#x2019;T8GTFKGPUVGWOFKG/WVVGTUEJCHV-NCUUGXGTIQNFGV   /GFCKNNG HÃ&#x2019;T 8GTFKGPUVG WO FKG /WVVGTUEJCHV  -NCUUG XGTUKNDGTV   /GFCKNNG HÃ&#x2019;T 8GTFKGPUVG   WO FKG /WVVGTUEJCHV  -NCUUG $TQP\G   .CPFYKTVUEJCHVU8GTFKGPUVOGFCKNNG  -NCUUG XGTIQNFGV     .CPFYKTVUEJCHVU8GTFKGPUVOGFCKNNG  -NCUUG XGTUKNDGTV   .CPFYKTVUEJCHVU8GTFKGPUVOGFCKNNG    -NCUUG $TQP\G   5RQTV8GTFKGPUVOGFCKNNG  -NCUUG $TQP\G LGYGKNU CP $·PFGTP  5VÃ&#x2019;EM CP   &COGPUEJNGKHGP 5VÃ&#x2019;EM++



7145

7147

7146

-14'# 5ª&-14'#4'27$.+- 5'+6  

1TFGP HÃ&#x2019;T 8GTFKGPUVG WO FCU 8CVGTNCPF 8GTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CP 0CFGN \WUCOOGP OKV   4GXGTUOKPKCVWTKO1TKIKPCNXGTNGKJWPIUGVWK ++





1TFGP HÃ&#x2019;T 8GTFKGPUVG WO FKG OKNKV·TKUEJG 5KEJGTJGKV 8GTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CP 0CFGN   \WUCOOGPOKV4GXGTUOKPKCVWTKO1TKIKPCNXGTNGKJWPIUGVWK ++





8GTFKGPUVQTFGP XQO 4QVGP -TGW\ 8GTUKNDGTV VGKNYGKUG GOCKNNKGTV CO $CPF \WUCOOGP OKV +PVGTKO   URCPIGKO1TKIKPCNGVWK +p++

 75


7149

ex 7148





-QPXQNWVXQPUGEJUXGTUEJKGFGPGPOKNKV·TKUEJGP#WU\GKEJPWPIGP /GFCKNNGHÃ&#x2019;TFKG8GTPKEJVWPIPQTF MQTGCPKUEJGT 5RKQPG   /GFCKNNG HÃ&#x2019;T  &KGPUVLCJTG KP FGP UÃ&#x2019;FMQTGCPKUEJGP 5VTGKVMT·HVGP /GFCKNNG HÃ&#x2019;T&KGPUVLCJTGKPFGPUÃ&#x2019;FMQTGCPKUEJGP5VTGKVMT·HVGP /GFCKNNGHÃ&#x2019;T&KGPUVLCJTGKPFGPUÃ&#x2019;FMQTGC PKUEJGP5VTGKVMT·HVGP /GFCKNNGHÃ&#x2019;T&KGPUVLCJTGKPFGPUÃ&#x2019;FMQTGCPKUEJGP5VTGKVMT·HVGP 'JTGP\GK EJGPHÃ&#x2019;T8GTFKGPUVGWOFKG5KEJGTJGKVFGU.CPFGULGYGKNUCO$CPFWPF\WUCOOGPOKV+PVGTKOURCPIG KO8GTNGKJWPIUGVWK 5VÃ&#x2019;EM++ 5RCPIGOKVHÃ&#x2019;PH/KPKCVWTCWU\GKEJPWPIGPGKPGU8GVGTCPGPFGU-QTGC-TKGIGUCP0CFGN

7151

7150

5VÃ&#x2019;EM++

 

7152

014&-14'#81.-54'27$.+- 5'+6  

1TFGPFGT0CVKQPCNHNCIIG&GMQTCVKQPFGT-NCUUG#WUHÃ&#x2019;JTWPIXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTVCP0CFGN%#$ ++





1TFGPFGU4QVGP$CPPGTUFGTFTGKITQ­GP4GXQNWVKQPGP8GTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CP0CFGN%#$ ++





1TFGP,CJTG8QNMUTGRWDNKM-QTGC8GTIQNFGVVGKNYGKUGGOCKNNKGTVCP0CFGN%#$



7153

ex 7154

4++

ex 7155



1TFGP $GHTGKWPI FGU 8CVGTNCPFGU WPF  ,CJTG 5KGI XQP  8GTUKNDGTV VGKNYGKUG XGTIQNFGV WPF   GOCKNNKGTVCP0CFGN ++





1TFGPHÃ&#x2019;T8GTFKGPUVGWOFGP$GTIDCWWPF-NCUUGXGTIQNFGVQFGTXGTUKNDGTVVGKNYGKUGGOCKNNKGTV CP$CPFURCPIGP%#$5 5VÃ&#x2019;EM++





-QPXQNWV XQP HÃ&#x2019;PH XGTUEJKGFGPGP /GFCKNNGP   /GFCKNNG HÃ&#x2019;T XGTFKGPUVXQNNGP &KGPUV   $GHTGKWPIU   OGFCKNNG    /KNKV·T8GTFKGPUVOGFCKNNG   /GFCKNNG \WO )GFGPMGP CP FKG $GHTGKWPI FGU 8CVGT   NCPFGU   /GFCKNNG \WO  ,CJTGUVCI FGT )TÃ&#x2019;PFWPI FGT 8QNMUTGRWDNKM LGYGKNU CP $·PFGTP QFGT CP    $CPF6TCIGURCPIGP 5VÃ&#x2019;EM++

76




ex 7157 ex 7158

7156

-7$# $ª4)'4.+%*'4'27$.+- $+5  

/KNKV·T8GTFKGPUVQTFGP -TGW\  -NCUUG $TQP\G XGTIQNFGV VGKNYGKUG GOCKNNKGTV CO ITÃ&#x2019;PGP $CPF HÃ&#x2019;T   DGUQPFGTG&KGPUVG1#05 ++



81.-54'27$.+- 5'+6  

-QPXQNWVXQPUGEJUXGTUEJKGFGPGP#WU\GKEJPWPIGP /GFCKNNGHÃ&#x2019;TFGP5KGIKO$Ã&#x2019;TIGTMTKGI /GFCKNNG HÃ&#x2019;TKPVGTPCVKQPCNG-·ORHGT #NNIGOGKPG&KGPUVOGFCKNNGFGT5VTGKVMT·HVG /GFCKNNGHÃ&#x2019;TFKG8GTVGKFK IWPI FGU 8CVGTNCPFGU   /GFCKNNG \WO L·JTKIGP $GUVGJGP FGT 8QNMUTGRWDNKM -WDC   /GFCKNNG HÃ&#x2019;T   8GTFKGPUVG KO -CORH WO FKG #NRJCDGVKUKGTWPI FGU8QNMGUFCXQPGKPGCP2GPVCIQPCN$CPFURCPIGWPF GKPGCP6TCIGURCPIG 5VÃ&#x2019;EM++

-¤0+)4'+%*   

.#15

-QPXQNWVXQPFTGK#WU\GKEJPWPIGP &WEQODCTVCP/GFCKNNG <KXKNGU-TKGIU'JTGP\GKEJGP /KNK V·TKUEJGU-TKGIU'JTGP\GKEJGPLGYGKNUCO$CPF 5VÃ&#x2019;EM++

ex 7159

7160



ex 7162



7163



<KXKNXGTFKGPUVQTFGP'ZGORNCTG 1HHK\KGTUFGMQTCVKQPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO$CPFOKV 4QUGVVG 4KVVGTFGMQTCVKQPXGTUKNDGTVWPFVGKNYGKUGGOCKNNKGTVCO$CPF81.2'5 5VÃ&#x2019;EM++





1TFGP HÃ&#x2019;T 8GTFKGPUVG WO FKG 8QNMUGT\KGJWPI -QOOCPFGWTFGMQTCVKQP XGTIQNFGV WPF VGKNYGKUG GOCKN   NKGTVCO*CNUDCPF ++





1TFGPHÃ&#x2019;T8GTFKGPUVGWOFKG8QNMUGT\KGJWPI 1HHK\KGTUFGMQTCVKQPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO $CPFOKV4QUGVVG 4KVVGTFGMQTCVKQPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO$CPF 5VÃ&#x2019;EM++





.CPFYKTVUEJCHVU8GTFKGPUVQTFGP   1HHK\KGTUFGMQTCVKQP XGTIQNFGV VGKNYGKUG XGTUKNDGTV WPF GOCKNNKGTV   CO $CPF OKV 4QUGVVG   4KVVGTFGMQTCVKQP XGTIQNFGV VGKNYGKUG XGTUKNDGTV WPF GOCKNNKGTV CO $CPF   81.2'5 5VÃ&#x2019;EM++



(TCWGP8GTFKGPUVQTFGP 4KVVGTFGMQTCVKQP XGTIQNFGV VGKNYGKUG XGTUKNDGTV CP &COGPUEJNGKHG 81.2'   5 ++





77


ex 7164

ex 7166 ex 7167

ex 7165



-ÌPKINKEJG8GTFKGPUVOGFCKNNG8KGTXGTUEJKGFGPG'ZGORNCTG 8GTFKGPUVOGFCKNNGFGU-ÌPKIU5KUCXCPI 8QPIKP5KNDGTXGTUKNDGTV 8GTFKGPUVOGFCKNNGFGU-ÌPKIU5KUCXCPI8QPIKP$TQP\G 8GTFKGPUVOG FCKNNG FGU -ÌPKIU $QTQOC 5VJC -CV[C KP 5KNDGT XGTUKNDGTV   8GTFKGPUVOGFCKNNG FGU -ÌPKIU $QTQOC   5VJC-CV[CKP$TQP\GLGYGKNUCO$CPF 5VÒEM++



81.-54'27$.+- 5'+6  

6CRHGTMGKVU1TFGP   &GMQTCVKQP  -NCUUG   &GMQTCVKQP  -NCUUG LGYGKNU XGTIQNFGV WPF VGKNYGKUG   NCEMKGTVCO2GPVCIQPCNDCPFOKV#WHNCIGP81.2'5 5VÒEM++





(TGKJGKVU1TFGP   &GMQTCVKQP  -NCUUG XGTIQNFGV WPF VGKNYGKUG NCEMKGTV   &GMQTCVKQP  -NCUUG   XGTUKNDGTVWPFVGKNYGKUGNCEMKGTVLGYGKNUCO2GPVCIQPCNDCPF81.2'5 5VÒEM++





-·ORHGT1TFGP   &GMQTCVKQP  -NCUUG   &GMQTCVKQP  -NCUUG LGYGKNU XGTIQNFGV WPF VGKNYGKUG   NCEMKGTVCO2GPVCIQPCNDCPFOKV#WHNCIGP 5VÒEM++



ex 7170

ex 7168

7171

ex 7169



#TDGKVU8GTFKGPUVQTFGP -NCUUGXGTIQNFGV -NCUUGTÌVNKEJUKNDGTHCTDGP -NCUUGTÌVNKEJ HCTDGPLGYGKNUVGKNYGKUGNCEMKGTVCP$CPFURCPIGP 5VÒEM++





-QPXQNWV XQP FTGK XGTUEJKGFGPGP 1TFGP   5KGIGU1TFGP   1TFGP FGU 9KGFGTUVCPFU IGIGP (TCPM   TGKEJ 1TFGPFGU9KGFGTUVCPFUIGIGPFKG8GTGKPKIVGP5VCCVGPLGYGKNUXGTIQNFGVWPFVGKNYGKUGNCEMKGTV CO2GPVCIQPCNDCPFQFGTCPNCEMKGTVGT6TCIGURCPIG 5VÒEM++





-QPXQNWV XQP FTGK XGTUEJKGFGPGP #WU\GKEJPWPIGP   1TFGP \WO L·JTKIGP $GUVGJGP FGT 8QNMUTGRW   DNKM 1TFGPHÒT8GTFKGPUVGWOFGP#WHDCW 'JTGP\GKEJGP\WOL·JTKIGP$GUVGJGPFGTNCQVKUEJGP -QOOWPKUVKUEJGP 2CTVGK LGYGKNU XGTIQNFGV WPF VGKNYGKUG NCEMKGTV QFGT GOCKNNKGTV CP 6TCIGURCPIGP   81.2'5 5VÒEM++



'456'4'27$.+-   

78

.'66.#0&

8GTFKGPUVQTFGP XQO 4QVGP -TGW\ -TGW\  -NCUUG 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPF   <'+ ++




7172 (1:1)

.7:'/$74) 

<KXKNWPF/KNKV·T8GTFKGPUVQTFGP#FQNRJUXQP0CUUCW/QFGNN UGKV )TQ­MTGW\UGVDGUVGJGPF CWU )TQ­MTGW\ #WUHÃ&#x2019;JTWPI OKV GKPVGKNKIGO 8QTFGTUGKVGPOGFCKNNQP 5KNDGT XGTIQNFGV WPF GOCKNNKGTV   OKP 'OCKNNGCDRNCV\WPI KO 8QTFGTUGKVGPOGFCKNNQP CO 1TKIKPCNUEJWNVGTDCPF WPF $TWUVUVGTP #WUHÃ&#x2019;J   TWPIOKVOGJTVGKNKIGO/GFCKNNQP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGNKO1TKIKPCNXGT NGKJWPIUGVWK<'+ 5VÃ&#x2019;EM44++



#PHGTVKIWPIPCEJFGT$TWUVUVGTPUVCOOVCWHITWPFFGT#PHGTVKIWPIUCTVCWUFGO*CWUG#TVJWU$GTVTCPFKP2CTKU

79


7173

ex 7174

5178'40'4/#.6'5'44+66'414&'0 

$TWUVMTGW\FGT,WUVK\&QPCVGP5KNDGTXGTIQNFGVWPFGOCKNNKGTVCP0CFGN

++



-QPXQNWV XQP \YGK 'KPUCV\OGFCKNNGP   /GFCKNNG HÒT FGP 'KPUCV\ Y·JTGPF FGU *GKNKIGP ,CJTGU     /GFCKNNGHÒTFGP'KPUCV\PCEJFGO'TFDGDGPKP5ÒFKVCNKGPLGYGKNUCO$CPF 5VÒEM++

NVGTG#PHGTVKIWPIOKVUGRCTCVCPIGHGTVKIVGPWPFGOCKNNKGTVGP-TGW\CTO#WHNCIGP

 

/#41--1 

1TFGPFGU6JTQPU4KVVGTFGMQTCVKQPXGTUKNDGTVWPFVGKNYGKUGGOCKNNKGTVCO$CPF81.2'5

++



7176

4'27$.+- 5'+6  



7177

/':+-1

/KNKV·TXGTFKGPUVQTFGP&KXKUKQPU)GPGTCN+IPCEKQ%QOQPHQTV1TFGPUUGVDGUVGJGPFCWU*CNUFGMQTCVKQP XGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCP6TCIGMQTFGN  WPF$TWUVUVGTPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTV CP0CFGN 5VÒEM++



1TFGPFGT0CVKQPCNGP'JTGPNGIKQPFGT/GZKMCPKUEJGP#MCFGOKGFGT5EJÌPGP-ÒPUVG8GTIQNFGVVGKNYGKUG GOCKNNKGTVCP6TCIGMQTFGN ++



7178

7179



4GXQNWVKQPU8GTFKGPUVMTGW\ #WUICDG HÒT FKG GTUVG 2GTKQFG  VGKNYGKUG GOCKNNKGTV CP 6TCIG   URCPIG)418& ++





4GXQNWVKQPU8GTFKGPUVMTGW\#WUICDGHÒTFKG\YGKVG2GTKQFGVGKNYGKUGGOCKNNKGTVCP6TCIG URCPIG)418& ++



80


ex 7182

7181

7180

7183



6TGWGMTGW\XQO/CK8GTIQNFGVGOCKNNKGTVCO$CPFOKV6TCIGURCPIG)418&



)QNFGPG'JTGPOGFCKNNGFGT8GTGKPKIVGP(TQPVFGT8GVGTCPGPFGT4GXQNWVKQPXQP8GTIQNFGV VGKNYGKUGGOCKNNKGTVCO$CPFOKV6TCIGURCPIG 4++





#TOGG&KGPUVCWU\GKEJPWPI -QPXQNWV XQP  XGTUEJKGFGPGP -TGW\GP    -NCUUG HÃ&#x2019;T  ,CJTG    -NCUUGHÃ&#x2019;T,CJTG -NCUUGHÃ&#x2019;T,CJTG -NCUUGHÃ&#x2019;T,CJTG -NCUUGHÃ&#x2019;T,CJTG  -NCUUGHÃ&#x2019;T,CJTGLGYGKNUCP$·PFGTPOKV6TCIGURCPIGP)418&&&& && 5VÃ&#x2019;EM++



/CTKPG8GTFKGPUV'JTGP\GKEJGP &GMQTCVKQP FGT  -NCUUG  6[R XGTIQNFGV VGKNYGKUG XGTUKNDGTV WPF   GOCKNNKGTVCO$CPFOKV6TCIGURCPIG)418& ++





++



ex 7185

7184 ex 7186



/CTKPG8GTFKGPUVMTGW\HÃ&#x2019;T$GJCTTNKEJMGKV8GTIQNFGVVGKNYGKUGGOCKNNKGTVCO$CPFOKV6TCIGURCPIG  ++





-QPXQNWV XQP XKGT XGTUEJKGFGPGP 'JTGP\GKEJGP FGT /CTKPG   /GFCKNNG HÃ&#x2019;T /CTKPG.GJTV·VKIMGKV     'JTGP\GKEJGP HÃ&#x2019;T -TKGIUGKPU·V\G KP FGT /CTKPG &GMQTCVKQP  -NCUUG   5RQTVCWU\GKEJPWPI FGT   /CTKPG  -NCUUG   5RQTVCWU\GKEJPWPI FGT /CTKPG  -NCUUG LGYGKNU CP $·PFGTP )418 &   &&& 5VÃ&#x2019;EM++



-QPXQNWVXQPUGEJUXGTUEJKGFGPGP#WU\GKEJPWPIGPFGU/GZKMCPKUEJGP4QVGP-TGW\GU 8GTFKGPUVQT FGP XQO 4QVGP -TGW\  -NCUUG CP 6TCIGMQTFGN     8GTFKGPUVMTGW\ XQO 4QVGP -TGW\ KP )QNF   XGTIQNFGV 8GTFKGPUVQTFGPXQO4QVGP-TGW\KP5KNDGTXGTUKNDGTV -TGW\HÃ&#x2019;TVTGWG&KGPUVGHÃ&#x2019;T4QV -TGW\*GNHGT 'JTGPMTGW\FGU4QVGP-TGW\GUHÃ&#x2019;T6·VKIG0·EJUVGPNKGDG )TQ­GT5VGTPHÃ&#x2019;T,CJTG &KGPUVKO/GZKMCPKUEJGP4QVGP-TGW\ 5VÃ&#x2019;EM++





81


7187

7188

7189

ex 7190

/10)1.'+ /10)1.+5%*'81.-54'27$.+- 

1TFGP HÒT 8GTFKGPUVG KO -CORH  /QFGNN   5KNDGT GOCKNNKGTV CWH FGT 4ÒEMUGKVG 6T·IGT   PWOOGTCP5EJTCWDUEJGKDG*'4(/ ++





1TFGP FGU 2QNCTUVGTPU  /QFGNN   5KNDGT GOCKNNKGTV CWH FGT 4ÒEMUGKVG 6T·IGTPWOOGT   CP5EJTCWDUEJGKDG*'4(/ ++





1TFGPFGU2QNCTUVGTPU/QFGNN UGKV 5KNDGTGOCKNNKGTVCWHFGT4ÒEMUGKVG6T·IGTPWOOGT CP0CFGN*'4(/ ++





1TFGP FGU /WVVGTTWJOU &GMQTCVKQPGP FGT  WPF  -NCUUG LGYGKNU XGTIQNFGV WPF GOCKNNKGTV CWH FGT   4ÒEMUGKVGPWOOGTKGTVWPFCP5EJTCWDUEJGKDGP*'4(/W 5VÒEM++



7191

7194

ex 7192

ex 7195



/GFCKNNG FGT (TGWPFUEJCHV 5KNDGT VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG 6T·IGTPWOOGT  CP   GOCKNNKGTVGT6TCIGURCPIGCWU5KNDGT*'4(/ ++





-QPXQNWVXQP#WU\GKEJPWPIGP /GFCKNNGHÒTFGP5KGIÒDGT,CRCP /GFCKNNGHÒTFGP ,CJTGUVCIFGU5KGIGUXQP%JCNEJKP)QN /GFCKNNG\WO,CJTGUVCIFGUUGNDGP#PNCUUGU 'KPYGKVGTGU 'ZGORNCT OKV $NCPEQ8GTNGKJWPIUFQMWOGPV   /GFCKNNG \WO  ,CJTGUVCI FGT OQPIQNKUEJGP 8QNMU   TGXQNWVKQP /GFCKNNG\WO,CJTGUVCIFGUUGNDGP#PNCUUGU /GFCKNNG\WO,CJTGUVCIFGU5KGIGU ÒDGT ,CRCP   /GFCKNNG \WO  ,CJTGUVCI FGT )TÒPFWPI FGT 5VTGKVMT·HVG FGT /QPIQNGK   'JTGP   OGFCKNNGFGU5VCCVGU /GFCKNNG\WO,CJTGUVCIFGT)TÒPFWPIFGU/QPIQNKUEJGP4QVGP-TGW\GU LGYGKNU XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV QFGT NCEMKGTV CP GOCKNNKGTVGP QFGT NCEMKGTVGP 6TCIGURCPIGP    5VÒEM++



0'2#.  

0GRCN6CTC1TFGP&GMQTCVKQPFGT-NCUUGVGKNYGKUGXGTUKNDGTVWPFGOCKNNKGTVCP0CFGN /GFCKNNG\WO5KNDGTPGP6JTQPLWDKN·WO-ÌPKI6TKDJWDCPUKO,CJTG5KNDGTCO$CPF



-QPXQNWVXQPUKGDGPXGTUEJKGFGPGP#WU\GKEJPWPIGP 'TFDGDGPOGFCKNNG /KNKV·T&KGPUVUVGTP HÒT  ,CJTG   /KNKV·T&KGPUVCWU\GKEJPWPIUOGFCKNNG HÒT  ,CJTG   <KXKN&KGPUVUVGTP HÒT  ,CJTG    <KXKN&KGPUVCWU\GKEJPWPIUOGFCKNNGHÒT,CJTG 2QNK\GK&KGPUVUVGTPHÒT,CJTG /GFCKNNGHÒT 6TGWG&KGPUVGHÒT-ÌPKI$KTGPFCLGYGKNUCP$·PFGTP 5VÒEM++

82

++ ++

 




7196





7197

)TQ­G1TFGPUURCPIGOKV#WU\GKEJPWPIGP -TÌPWPIUOGFCKNNG-ÌPKI/CJGPFTCU ,WDKN·WOUOG FCKNNG -ÌPKI $KTGPFTCU    WPDGMCPPVG /GFCKNNG   &KGPUVCWU\GKEJPWPI HÒT JÌJGTG $GCOVG HÒT   &KGPUVLCJTG &KTIJC5GXC2CVVC5CKPKM#WU\GKEJPWPI &KTIJC5GXC2CFFCM2TCJCTK#WU\GKEJPWPI   #TOGG&KGPUVCWU\GKEJPWPI HÒT  ,CJTG   2QNK\GK&KGPUVCWU\GKEJPWPI HÒT  &KGPUVLCJTG   /G   FCKNNGHÒT'KPU·V\GKPFGT.WHV /GFCKNNGHÒTUQ\KCNG8GTFKGPUVGCP0CFGN 5VÒEM++



)TQ­G1TFGPUURCPIGOKVHÒPH#WU\GKEJPWPIGP -TÌPWPIUOGFCKNNG-ÌPKI$KTGPFTC /GFCKNNG HÒT6GKNPCJOGCP(TKGFGPUGKPU·V\GPFGT8GTGKPVGP0CVKQPGP #TOGG&KGPUVCWU\GKEJPWPIHÒT,CJTG  /GFCKNNGHÒTVTGWG&KGPUVGKPFGP)CTFGPWPF5KEJGTJGKVUICTFGP 70+(+./GFCKNNGFGT8GTGKPVGP 0CVKQPGPHÒT(TKGFGPUGKPUCV\KO.KDCPQPCP0CFGN 5VÒEM++



7199 7198





)TQ­G1TFGPUURCPIGOKVHÒPH#WU\GKEJPWPIGP /GFCKNNGHÒT'KPUCV\KPITQ­GT*ÌJG /GFCKNNGHÒT 6GKNPCJOG CP (TKGFGPUGKPU·V\GP FGT 8GTGKPVGP 0CVKQPGP   #TOGG&KGPUVCWU\GKEJPWPI HÒT  ,CJTG    /GFCKNNGHÒTUQ\KCNG8GTFKGPUVG 70+(+./GFCKNNGFGT8GTGKPVGP0CVKQPGPHÒT(TKGFGPUGKPUCV\KO .KDCPQPCP0CFGN 5VÒEM++



)TQ­G/KPKCVWTQTFGPUURCPIGOKV#WU\GKEJPWPIUOKPKCVWTGP )QTMJC&CMUJKP$CJW1TFGP-NCUUG  6TKUJCMVK2CVVC1TFGP/KPKCVWTFGU$TWUVUVGTPU\WT-NCUUG -TÌPWPIUOGFCKNNG-ÌPKI$KTGPFTCU    ,WDKN·WOUOGFCKNNG -ÌPKI $KTGPFTCU    -TÌPWPIUOGFCKNNG -ÌPKI )[CPGPFTCU      5WRTCUJCOUCPK[C 2CVVC/GFCKNNG   /GFCKNNG HÒT 'KPUCV\ KP ITQ­GT *ÌJG   /GFCKNNG HÒT FKG   6GKNPCJOG CP (TKGFGPUGKPU·V\GP FGT 8GTGKPVGP 0CVKQPGP   #TOGG&KGPUVCWU\GKEJPWPI HÒT  ,CJTG    2QNK\GK&KGPUVCWU\GKEJPWPIHÒT,CJTG 5#4%8GTFKGPUVOGFCKNNG /GFCKNNGHÒTFGP'TFDG DGP'KPUCV\ 70241(14/GFCKNNGFGT8GTGKPVGP0CVKQPGPHÒT(TKGFGPUGKPUCV\KOGJGOCNKIGP ,WIQUNCYKGPCP0CFGN 5VÒEM++



+ORQUCPVG5RCPIG

ex 7200

0+)'4+# 

-QPXQNWV XQP UKGDGP XGTUEJKGFGPGP #WU\GKEJPWPIGP   1TFGP FGT $WPFGUTGRWDNKM 0KIGTKC 5KNDGTPG   /GFCKNNG XGTUKNDGTV   1TFGP FGT $WPFGUTGRWDNKM 0KIGTKC /GFCKNNG KP $TQP\G   1TFGP FGU 0KIGT   $TQP\GPG8GTFKGPUVOGFCKNNG 0KIGTKC-TKUGPOGFCKNNG 0CVKQPGP&KGPUV/GFCKNNG  8GTVGKFKIWPIUOGFCKNNG /KNKV·T&KGPUVOGFCKNNG 5VÒEM++

 83


7202 7201

-#+5'44'+%*   



¤UVGTTGKEJKUEJ-CKUGTNKEJGT1TFGPFGT'KUGTPGP-TQPG&GMQTCVKQPFGT+++-NCUUGOKV5EJYGTVGTPWPF -TKGIUFGMQTCVKQP $TQP\G XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CWH FGT 4ÒEMUGKVG GKPGU -TQPGPDCPFGU   5VGTPEJGPRWP\G CO 1TKIKPCNFTGKGEMUDCPF OKV CWHIGNGIVGP 5EJYGTVGTP KO 1TKIKPCNXGTNGKJWPIUGVWK   <'+) +p++



(TCP\ ,QUGRJ1TFGP 4KVVGTMTGW\ )QNF GOCKNNKGTV 4ÒEMUGKVGPOGFCKNNQP MCPP IGÌHHPGV YGTFGP MNGKPGT   'OCKNNGEJKRR CWH FGO XQTFGTGP QDGTGP -TGW\CTO KO $CPFTKPI )QNFRWP\G WPF *GTUVGNNGTDG\GKEJPWPI   FGT(KTOC8KPE/C[GT U5ÌJPGKP9KGPCO1TKIKPCNFTGKGEMUDCPFFCTCWHOKVHGKPGO&TCJVDGHGUVKIVG /KPKCVWTFGU1TFGPUMTGW\GU)QNFQJPG'OCKNNGWPF<GPVTGPKO1TKIKPCNGVWK<'+) ++p



7203



¤56'44'+%*

7206

)QNFGPGU8GTFKGPUVMTGW\OKVFGT-TQPGWPFOKV-TKGIUFGMQTCVKQP#WUHÒJTWPIOKVJQJNGT-TQPG)QNF GOCKNNKGTVKO$CPFTKPI)QNFRWP\GWPF*GTUVGNNGTDG\GKEJPWPIFGT(KTOC8KPE/C[GT U5ÌJPGKP9KGP CO1TKIKPCNMTKGIUFGMQTCVKQPU&TGKGEMUDCPFKO1TKIKPCNGVWK/#4-E +p



-QPXQNWV XQP FTGK XGTUEJKGFGPGP 8GTFKGPUVMTGW\GP   )QNFGPGU 8GTFKGPUVMTGW\ $TQP\G XGTIQNFGV   *GTUVGNNGT 9KNJ -WP\ KP 9KGP 5KNDGTPGU8GTFKGPUVMTGW\OKVFGT-TQPG5KNDGTWPNGUGTNKEJGT*GT UVGNNGT CWU $WFCRGUV   'KUGTPGU 8GTFKGPUVMTGW\ OKV FGT -TQPG 'KUGP ,GYGKNU CO &TGKGEMUDCPF   /#4- 5VÒEM++



-QPXQNWVXQPFTGKWPVGTUEJKGFNKEJGP1HHK\KGTU&KGPUVCWU\GKEJPWPIGPHÒT,CJTG 'TUVG#WUICDGOKV HTÒJGT&TGKGEMUDCPFOQPVWT 'TUVG#WUICDG4GXGTU2GTNOWVV <YGKVG#WUICDG4GXGTU2GTNOWVV ,GYGKNUCP&TGKGEMUD·PFGTP/#4-CDD 5VÒEM++





6KTQNGT,WDKN·WOUOGFCKNNG6TCIDCT5KNDGTQJPG$CPF/#4-





-NGKPG 5COONWPI RCVTKQVKUEJGT #D\GKEJGP XQTYKGIGPF FGU 'TUVGP 9GNVMTKGIU %C  5VÒEM GKPKIG   FQRRGNV ITÌ­VGPVGKNU UGJT UEJÌP GOCKNNKGTV OCPEJG CP $·PFEJGP FKG OGKUVGP CP 0CFGNP CWH 5COVWP   VGTNCIGCWHIGUVGEMVWPFXQPGKPGO)QNFTCJOGPWOIGDGP %C5VÒEM++





84

++




ex 7208 (1:1)

ex 7208 (1:1)

7209

ex 7210

'456'4'27$.+-   

'JTGP\GKEJGPHÃ&#x2019;T8GTFKGPUVGWOFKG4GRWDNKM¤UVGTTGKEJQFGT¤UVGTTGKEJKUEJGT8GTFKGPUVQTFGP5GV\WO )TQ­GP 'JTGP\GKEJGP CO $CPFG QFGT \WO )TQ­MTGW\ FGU 8GTFKGPUVQTFGPU DGUVGJGPF CWU -NGKPQF   XGTIQNFGVWPFGOCKNNKGTVCO1TKIKPCNUEJWNVGTDCPFWPF$TWUVUVGTP5KNDGTTGRGTEKGTVVGKNYGKUGXGTIQNFGV GOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT(KTOC%(4QVJGWPF0GHHGKP9KGPCP0CFGN <'+ 5VÃ&#x2019;EM+p++  &KG#PHGTVKIWPIGPFGT(KTOC4QVJGUKPFUGNVGPGTCNUFKG#PHGTVKIWPIGPFGT(KTOC4GKVVGTGT

2#-+56#0 

6CPIJK-KFOCV1TFGP&GMQTCVKQP-NCUUGXGTUKNDGTVWPFVGKNYGKUGGOCKNNKGTVCO*CNUDCPF



-QPXQNWV XQP FTGK #WU\GKEJPWPIGP   *KIKTK/GFCKNNG HÃ&#x2019;T 8GTFKGPUVG   -TKGIUUVGTP HÃ&#x2019;T FGP GTUVGP   -TKGIIGIGP+PFKGP -TKGIUUVGTPHÃ&#x2019;TFGP\YGKVGP-TKGIIGIGP+PFKGPFKGDGKFGPNGV\VGPOKV6T·IGT PCOGPLGYGKNUCP$·PFGTP 5VÃ&#x2019;EM++

++

  85


7211 (1:1)

2#4#)7#; 

0CVKQPCNGT 8GTFKGPUVQTFGP )TQ­MTGW\UGV DGUVGJGPF CWU )TQ­MTGW\FGMQTCVKQP 5KNDGT XGTIQNFGV WPF   GOCKNNKGTV CWH FGT 4Ã&#x2019;EMUGKVG OGJTGTG MNGKPG 'OCKNNGTGRCTCVWTGP KO /GFCKNNQPTKPI CO 5EJWNVGTDCPF   WPF$TWUVUVGTP5KNDGTCP0CFGNKO8GTNGKJWPIUGVWKFGT(KTOC-TGVN[KP2CTKU1#0  5VÃ&#x2019;EM4++



#NUMQORNGVVGT5GVUGNVGPCPIGDQVGP

7213 7212

2'47 



86

1TFGP FGT 5QPPG XQP 2GTW -QOOCPFGWTFGMQTCVKQP 5KNDGT XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTVCWHFGT 4Ã&#x2019;EMUGKVG *GTUVGNNGTDG\GKEJPWPI FGU /Ã&#x2019;P\JCWUGU 2CTKLC KP .KOC CO *CNUDCPF KO 1TKIKPCNXGTNGK   JWPIUGVWK1#0 ++



1TFGPHÃ&#x2019;TJGTXQTTCIGPFG8GTFKGPUVG)TQ­MTGW\UGVDGUVGJGPFCWU)TQ­MTGW\FGMQTCVKQPXGTIQNFGVWPF VGKNYGKUGGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPIFGT%*/QPGFCKP.KOCCO5EJWNVGT DCPFWPF$TWUVUVGTP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWHFGT4Ã&#x2019;EMUGKVG*GTUVGNNGTDG\GKEJPWPI FGT%CUC0CEKQPCNFG/QPGFCKP.KOCCP0CFGN1#0 5VÃ&#x2019;EM++




ex 7216 7214





7215

1TFGPHÒTJGTXQTTCIGPFG8GTFKGPUVG-QOOCPFGWTFGMQTCVKQP5KNDGTXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTV CWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGU0CVKQPCNGP/ÒP\JCWUGUKP.KOCCO*CNUDCPFKO1TKIK PCNGVWK1#0 +p++



1TFGP HÒT JGTXQTTCIGPFG 8GTFKGPUVG 1HHK\KGTU&GMQTCVKQP XGTIQNFGV WPF VGKNYGKUG GOCKNNKGTV CWH FGT   4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPIFGU0CVKQPCNGP/ÒP\JCWUGUKP.KOCCO$CPF1#0 ++



&KG WPVGTGP -NCUUGP FGT NCVGKPCOGTKMCPKUEJGP UKPF YGKVCWU UGNVGPGT CWH FGO GWTQR·KUEJGP /CTMV \W HKPFGP CNU FKG   JÌJGTGP-NCUUGP

2*+.+22+0'0 

4K\CN1TFGP )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUFGMQTCVKQP XGTIQNFGV WPF VGKNYGKUG NCEMKGTV   CO *CNUDCPF WPF $TWUVUVGTP XGTIQNFGV WPF VGKNYGKUG NCEMKGTV CP 0CFGNP FC\W 4GXGTUCD\GKEJGP CWH   *CNUFGMQTCVKQPWPF$TWUVUVGTP*GTUVGNNGTDG\GKEJPWPIFGT(KTOC#<COQTC5QPU 5VÒEM++

7217



7220 7218 7219



4K\CN1TFGP 4KVVGTFGMQTCVKQP XGTIQNFGV WPF NCEMKGTV CO $CPF \WUCOOGP OKV +PVGTKOURCPIG KP 8GT   NGKJWPIUUEJCEJVGN ++





4K\CN1TFGP8GTFKGPUVMTGW\-NCUUGXGTIQNFGVWPFVGKNYGKUGNCEMKGTVCO*CNUDCPF





1TFGPXQO)QNFGPGP2HNWI8GTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCWHFGT4ÒEMUGKVG*GTUVGNNGTDG\GKEJPWPI FGT(KTOC'N1TQCO*CNUDCPFCDUEJPKVV81.2'5 ++





$TQP\G-TGW\HÒT6CRHGTMGKV$TQP\GVGKNYGKUGNCEMKGTVCO$CPFOKV+PVGTKOURCPIGWPF4GXGTUCD\GK EJGPKPGVYCU\GTFTÒEMVGT8GTNGKJWPIUUEJCEJVGN QJPG&GEMGN 4'; ++



++

87


7222

7223

7221

ex 7224



/KNKV·T8GTFKGPUVOGFCKNNG 8GTIQNFGV VGKNYGKUG XGTUKNDGTV WPF GOCKNNKGTV CO $CPF OKV +PVGTKOURCPIG   WPF4GXGTUCD\GKEJGPKPGVYCU\GTFTÃ&#x2019;EMVGT8GTNGKJWPIUUEJCEJVGN4'; ++



-TGW\HÃ&#x2019;TNCPIGPWPFVTGWGP&KGPUV8GTIQNFGVWPFGOCKNNKGTVCO$CPF\WUCOOGPOKV+PVGTKOURCPIG 4'; ++





/GFCKNNGHÃ&#x2019;TJGTQKUEJG6CRHGTMGKVDGK0CVWTMCVCUVTQRJGP8GTIQNFGVCO$CPFOKV6TCIGURCPIG





-QPXQNWVXQPHÃ&#x2019;PHXGTUEJKGFGPGP#WU\GKEJPWPIGP /KNKV·TKUEJG.QDGU/GFCKNNG .W\QP(GNF\WIU OGFCKNNG/QFGNN /KPFCPCQ,WNQ(GNF\WIUOGFCKNNG/QFGNN $GHTGKWPIU/GFCKNNG COGTKMC PKUEJG*GTUVGNNWPI  7PCDJ·PIKIMGKVUOGFCKNNG COGTKMCPKUEJG*GTUVGNNWPI LGYGKNUCP$·PFGTPFTGK FCXQPOKV+PVGTKOURCPIGP4';XCT 5VÃ&#x2019;EM++

++





7225

7226 (1:1) 7226 (1:1) 7227

4'27$.+- 5'+6 

21467)#.



/KNKV·TKUEJGT 1TFGP XQP #XK\  /QFGNN UGKV  4KVVGTMTGW\ 5KNDGT XGTIQNFGV WPF GOCKNNKGTV CO   $CPF<'+ ++





1TFGPHÃ&#x2019;T8GTFKGPUVGWOFKG8QNMUCWHMN·TWPI-QOOCPFGWTUGVDGUVGJGPFCWU-QOOCPFGWTFGMQTCVKQP 5KNDGTXGTIQNFGVCO*CNUDCPFCDUEJPKVVWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVOKP #WUDTWEJUQYKG*CCTTK­KPFGTDNCWGP'OCKNNGCP0CFGNFKGUGRWP\KGTV<'+ 5VÃ&#x2019;EM++



1TFGPHÃ&#x2019;T8GTFKGPUVGWOFKG8QNMUCWHMN·TWPI1HHK\KGTUFGMQTCVKQP5KNDGTXGTIQNFGVCO$CPF<'+ ++





88


7228 ex 7229



8GTFKGPUVQTFGP $TWUVUVGTP \WO -QOOCPFGWT 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CP 0CFGN   FKGUGRWP\KGTV<'+ ++





-QPXQNWV XQP CEJV XGTUEJKGFGPGP #WU\GKEJPWPIGP   /KNKV·TXGTFKGPUVMTGW\  -NCUUG   /KNKV·TXGT   FKGPUVUVGTP   /KNKV·T6TGWGFKGPUVUVGTP   /KNKV·T/GFCKNNG HÒT DGKURKGNJCHVGU 8GTJCNVGP  -NCUUG    /KNKV·T/GFCKNNGHÒTDGKURKGNJCHVGU8GTJCNVGP-NCUUG /KNKV·T/GFCKNNGHÒTDGKURKGNJCHVGU8GTJCN VGP  -NCUUG   8GTFKGPUVMTGW\ XQO 4QVGP -TGW\   5KNDGTPG /GFCKNNG FGU 4QVGP -TGW\GU HÒT IWVG   <WUCOOGPCTDGKV LGYGKNU CP $·PFGTP &C\W GKP .GKUVWPICD\GKEJGP FGU /CTPKPGMQTRU WPF GKP 5VQHH   CD\GKEJGPFGU4QVGP-TGW\GU 5VÒEM++



47#0&# 

0CVKQPCNQTFGP FGT 4GXQNWVKQP $TWUVUVGTP \WO )TQ­MTGW\ XGTIQNFGV VGKNYGKUG GOCKNNKGTV CP 0CFGN   FKGUGRWP\KGTV81.2'5 ++



5GJTITQ­GTWPFUEJYGTGT$TWUVUVGTP

7232 7231



0CVKQPCNQTFGPFGU(TKGFGPU$TWUVUVGTP\WO)TQ­QHHK\KGTXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTV CP0CFGNFKGUGRWP\KGTV ++



5GJTITQ­GTWPFUEJYGTGT$TWUVUVGTP



0CVKQPCNQTFGP FGT 'KPVCWUGPF *ÒIGN-QOOCPFGWTFGMQTCVKQPXGTIQNFGVWPFGOCKNNKGTVCOPKEJVICP\ UVKOOKIGP*CNUDCPF81.2'5 ++

-¤0+)4'+%*   



47/0+'0

-QPXQNWV XQP FTGK 1TFGP   1TFGP FGU 5VGTPU XQP 4WO·PKGP  /QFGNN 1HHK\KGTUMTGW\ 5KNDGT   GOCKNNKGTV GKP 'OCKNNGEJKR KO 8QTFGTUGKVGPOGFCKNNQP CO $CPF OKV 4QUGVVG CWH WPVGTGO -TGW\CTO   *GTUVGNNGTUEJKNF4'5%*CWHIGNÌVGV 1TFGPFGT-TQPGXQP4WO·PKGP/QFGNN4KVVGTMTGW\5KNDGT GOCKNNKGTV QJPG $CPF   1TFGP FGT -TQPG XQP 4WO·PKGP  /QFGNN 4KVVGTMTGW\ OKV -TQPG WPF   5EJYGTVGTP CO NCPIGP 6CRHGTMGKVUDCPF KO 'VWK GKPGU 4KVVGTMTGW\GU FGU 5VGTPQTFGPU <'+     5VÒEM++

 89


ex 7234





ex 7235

-QPXQNWV XQP UGEJU #WU\GKEJPWPIGP   $TQP\GPG 8GTFKGPUVOGFCKNNG FGT .CPFGUYCEJV GTUVGU /QFGNN  

OKV $WEJUVCDGP    5KNDGTPG /GFCKNNG HÒT /CPPJCHVKIMGKV WPF 6TGWG   -ÌPKI %CTQN /GFCKNNG     7PCDJ·PIKMGKVUOGFCKNNG /GFCKNNG#WHUEJYWPIFGU.CPFGU -ÌPKI%CTQN,WDKN·WOU OGFCKNNGHÒT<KXKN OKV9CRRGP  5VÒEM++



-QPXQNWVXQPXKGTXGTUEJKGFGPGP#WU\GKEJPWPIGP $TQP\GOGFCKNNGHÒTVTGWG&KGPUVGGTUVGU/QFGNN  $TQP\GOGFCKNNGHÒTVTGWG&KGPUVGGTUVGU/QFGNNOKV5EJYGTVGTP/QFGNN $TQP\GPG8GTFKGPUV OGFCKNNG FGT .CPFGUYCEJV GTUVGU /QFGNN OKV $WEJUVCDGP   /GFCKNNG-TGW\\WIIGIGPFGP-QOOW PKUOWULGYGKNUCP$·PFGTP 5VÒEM++p+++



7236 (1:1)

7237 (1:1)

7238 (1:1)

4755.#0& <#4'067/ $+5  

5V 9NCFKOKT1TFGP -TGW\  -NCUUG )QNF GOCKNNKGTV 'OCKNNGOCNGTGK FKGUG CWH 8QTFGT WPF 4ÒEM   UGKVGDGTKGDGPMGKPG2WP\KGTWPIQJPG$CPFKOPKEJVRCUUGPFGP'VWK<'+ ++



(TÒJGU 'ZGORNCT OKV DTGKVGTGP -TGW\CTOCPU·V\GP FCU OÌINKEJGTYGKUG XQT 'KPHÒJTWPI FGT 2WP\KGTWPI JGTIGUVGNNV   YWTFG



5V 9NCFKOKT1TFGP -TGW\  -NCUUG )QNF GOCKNNKGTV KO 4KPI WPNGUGTNKEJ RWP\KGTV QJPG $CPF KO   PKEJVRCUUGPFGP'VWK<'+ +p++



'ZGORNCTWOOKVUEJO·NGTGP-TGW\CTOCPU·V\GP



90

5V #PPGP1TFGP  /QFGNN -TGW\  -NCUUG )QNFGOCKNNKGTV'OCKNNGOCNGTGKCWHFGT4ÒEMUGKVGWP VGT FGO 'OCKNNG WPNGUGTNKEJ RWP\KGTV GDGPHCNNU CWH FGO $CPFTKPI RWP\KGTV CO IGP·JVGP $QIGPDCPF   <'+ +p++




7239 (1:1)

7241 (1:1)

7240 (1:1)



5V #PPGP1TFGP  /QFGNN /KPKCVWT FGU -TGW\GU  -NCUUG )QNF GOCKNNKGTV 'OCKNNGOCNGTGK CO   $·PFEJGP +p++





5V5VCPKUNCWU1TFGP-TGW\-NCUUG)QNFGOCKNNKGTV'OCKNNGOCNGTGKKO6TCIGTKPIWPNGUGTNKEJRWP\KGTV COCNVGP*CNUDCPF<'+ +p++





5V 5VCPKUNCWU1TFGP /KPKCVWT FGU -TGW\GU  -NCUUG )QNF GOCKNNKGTV 'OCKNNGOCNGTGK OKP 'OCKN   NGEJKRRKO8QTFGTUGKVGP\GPVTWOWPFCWHFGT4ÒEMUGKVGFGUQDGTGP#TOUCO$·PFEJGP ++p+++



7245

7242

7244



5V )GQTIU5QNFCVGPMTGW\ -TGW\  5VWHG #WUHÒJTWPI KP WPGFNGO /GVCNN TÒEMUGKVKI PWOOGTKGTV /   OKVFGP<GKEJGPHÒTWPGFNGU/GVCNNCWHFGP-TGW\CTOGPCPUR·VGTGTUQYLGVKUEJGT2GPVCIQPCN DCPFURCPIG4147# ++



6CRHGTMGKVUOGFCKNNGQ,-NCUUG5KNDGT)TCXWT0QOOI5OKTPQXF +++



)GFGPMMTGW\HÒT(GNFIGKUVNKEJGCPFGP-TKOMTKGI-WRHGTQJPG$CPF4147#

++

  

)'14)+5%*'.')+10 

1TFGPFGT-ÌPKIKP6COCTC5VGTPFGT-NCUUG5KNDGTTGRGTEKGTV<GPVTWOXGTIQNFGVWPFGOCKNNKGTVCP 0CFGNFKGUGRWP\KGTV5+.$'41#0 4+p++



W­GTUVSWCNKV·VUXQNNG#PHGTVKIWPIOKVOGJTVGKNKIGO/KVVGNOGFCKNNQP



':+.

1TFGPFGUOKVNGKFXQNNGP*GT\GPU8GTIQNFGVGOCKNNKGTVCO2GPVCIQPCNDCPF

++

 91


7247

7251

7249

7248

519,'670+10 



.GPKPQTFGP  /QFGNN CD   )QNF VGKNYGKUG GOCKNNKGTV OKV 2NCVKPCWHNCIG CWH FGT 4Ã&#x2019;EMUGKVG   *GTUVGNNGTDG\GKEJPWPI FGU .GPKPITCFGT /Ã&#x2019;P\JQHU OKV 6T·IGTPWOOGT  CP UQYLGVKUEJGT   2GPCVQIQPCNDCPFURCPIG*'4( +p++



.GPKPQTFGP  /QFGNN CD   )QNF VGKNYGKUG GOCKNNKGTV 'OCKNNGEJKRR KP FGT TQVGP (CJPG OKV   2NCVKPCWHNCIG CWH FGT 4Ã&#x2019;EMUGKVG *GTUVGNNGTDG\GKEJPWPI FGU .GPKPITCFGT /Ã&#x2019;P\JQHU OKV 6T·IGTPWOOGT   CP\GTUEJNKUUGPGTUQYLGVKUEJGT2GPCVQIQPCNDCPFURCPIGOKV.GIKVKOCVKQPUDÃ&#x2019;EJNGKPFCVKGTV *'4( +p++



52#0+'0 (ª0(6'5-¤0+)4'+%*   

/KNKV·TKUEJGT 1TFGP 7PUGTGT .KGDGP (TCW XQP /QPVGUC &GMQTCVKQP FGT 4KVVGT ·NVGTG #WUHÃ&#x2019;JTWPI   5KNDGTVGKNYGKUGGOCKNNKGTVOKP*CCTTK­KPFGT'OCKNNGCO$CPF<'+XCT ++



52#0+5%*'456##6(4#0%14')+'470)   

/KNKV·TKUEJGT 1TFGP XQP %CNCVTCXC &GMQTCVKQP FGT 4KVVGT PGWGTG #WUHÃ&#x2019;JTWPI 5KNDGT XGTIQNFGV WPF   VGKNYGKUGGOCKNNKGTVCO&TGKGEMUDCPF<'+ ++





/KNKV·TKUEJGT 1TFGP 7PUGTGT .KGDGP (TCW XQP /QPVGUC &GMQTCVKQP FGT 4KVVGT PGWGTG #WUHÃ&#x2019;JTWPI   5KNDGTXGTIQNFGVWPFGOCKNNKGTVCO$CPF<'+ ++



7252 ex 7253 ex 7254



/KNKV·TKUEJGT 1TFGP XQP #NE±PVCTC &GMQTCVKQP FGT 4KVVGT PGWGTG #WUHÃ&#x2019;JTWPI 5KNDGT XGTIQNFGV WPF   VGKNYGKUGGOCKNNKGTVCO$CPF<'+ ++



-QPXQNWVXQPPGWPXGTUEJKGFGPGP#WU\GKEJPWPIGP 8GTYWPFGVGPOGFCKNNG-NCUUG /GFCKNNG HÃ&#x2019;TFGPDGYCHHPGVGP&KGPUV /GFCKNNGHÃ&#x2019;T'KPUCV\KO0QTFGPWPF1UVGP /GFCKNNGFGT/CTKPG \WO,CJTGUVCIFGT7PCDJ·PIKIMGKV /GFCKNNGFGT.WHVYCHHG\WO,CJTGUVCIFGT7PCDJ·PIKI MGKV /GFCKNNGHÃ&#x2019;TFKG6GKNPCJOGCO4KXGTGUUC(GNF\WI /GFCKNNGHÃ&#x2019;TFKG6GKNPCJOGCPFGT#OVU GKPHÃ&#x2019;JTWPI FGU 2T·UKFGPVGP   2JWTPC $JWOK-TKGIUOGFCKNNG   /GFCKNNG HÃ&#x2019;T  ,CJTG DGUQPFGTGP   &KGPUVGKPG/GFCKNNGDGUEJ·FKIVLGYGKNUCP$·PFGTP 5VÃ&#x2019;EM++



54+.#0-#



5;4+'0 

92

1TFGPHÃ&#x2019;T6CRHGTMGKV-QPXQNWVFGT&GMQTCVKQPGPFGTWPF-NCUUGLGYGKNUVGKNYGKUGXGTIQNFGV WPFGOCKNNKGTVCP$·PFGTPGKPGUFCXQPOKV5VGTPEJGPCWHNCIG81.2'5 5VÃ&#x2019;EM+p++




ex 7255





7257

ex 7256

7258

-QPXQNWVXQPFTGK1TFGP 1TFGPFGT2HGKNG/QFGNN OKV2HGKNGP 4KVVGTFGMQTCVKQPXGTUKNDGTV VGKNYGKUG GOCKNNKGTV   1TFGP HÃ&#x2019;T 'TIGDGPJGKV &GMQTCVKQP  -NCUUG XGTUKNDGTV VGKNYGKUG GOCKNNKGTV     1TFGP HÃ&#x2019;T 'TIGDGPJGKV &GMQTCVKQP  -NCUUG VGKNYGKUG XGTUKNDGTV LGYGKNU CP $·PFGTP FCXQPGKPGU OKV.QTDGGT#WHNCIG81.2'55 5VÃ&#x2019;EM++



-QPXQNWVXQPHÃ&#x2019;PHXGTUEJKGFGPGP#WU\GKEJPWPIGP 'JTGP\GKEJGPHÃ&#x2019;T8GTYWPFGVG 'TKPPGTWPIUOG FCKNNG CP FGP 5VCCVUUVTGKEJ XQO  /·T\    /GFCKNNG \WO L·JTKIGP ,WDKN·WO FGT U[TKUEJGP   #TOGG /GFCKNNGHÃ&#x2019;TNCPIGPWPFDGKURKGNJCHVGP/KNKV·TFKGPUV 2CNGUVKPC(GNF\WIUOGFCKNNGXQP 81.2'5 5VÃ&#x2019;EM++



6*#+.#0& 

%JWNC%JQO-NCQ1TFGP&GMQTCVKQPFGT/KVINKGFGT5KNDGTVGKNYGKUGGOCKNNKGTVCO$CPF$.#6* ++



4COC/KNKV·TXGTFKGPUVQTFGP&GMQTCVKQP-NCUUG5KNDGTCO$CPFOKV$CPFURCPIG$.#6*



'NGRJCPVGPQTFGP/QFGNN$TWUVUVGTP\WO)TQ­MTGW\QFGT)TQ­QHHK\KGTXGTUKNDGTVVGKNYGKUGXGTIQNFGV WPFGOCKNNKGTVCP0CFGN$.#6*0 +p++





'NGRJCPVGPQTFGP/QFGNN)TQ­QHHK\KGTUUGVDGUVGJGPFCWU)TQ­QHHK\KGTUFGMQTCVKQPXGTUKNDGTVVGKNYGKUG XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFWPF$TWUVUVGTPXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP 0CFGNKO1TKIKPCNXGTNGKJWPIUGVWK$.#6*0 5VÃ&#x2019;EM+p++



++

 

7261





'NGRJCPVGPQTFGP  /QFGNN )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUFGMQTCVKQP XGTUKNDGTV VGKN   YGKUG XGTIQNFGV WPF GOCKNNKGTV CO *CNUDCPFCDUEJPKVV WPF $TWUVUVGTP XGTUKNDGTV VGKNYGKUG XGTIQNFGV   WPFGOCKNNKGTVCP0CFGN$.#6*0 5VÃ&#x2019;EM+p++



'NGRJCPVGPQTFGP/QFGNN-QOOCPFGWTFGMQTCVKQPXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO *CNUDCPFCDUEJPKVV$.#6*0 +p++

 93


7268

ex 7263



7265

'NGRJCPVGPQTFGP/QFGNN-QPXQNWVXQP'ZGORNCTGP 1HHK\KGTUFGMQTCVKQPHÒT&COGPXGTUKNDGTV VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP&COGPUEJNGKHGOKV4QUGVVG 4KVVGTFGMQTCVKQPHÒT&COGP·NVGTGU 'ZGORNCT5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP&COGPUEJNGKHG$.#6*00 5VÒEM+





1TFGP FGT -TQPG XQP 6JCKNCPF  /QFGNN $TWUVUVGTP \WO )TQ­MTGW\ QFGT )TQ­QHHK\KGT XGTUKNDGTV   VGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN$.#6*0 +p++





1TFGP FGT -TQPG XQP 6JCKNCPF  /QFGNN )TQ­QHHK\KGTUUGV DGUVGJGPF CWU )TQ­QHHK\KGTUFGMQTCVKQP   XGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFCDUEJPKVVWPF$TWUVUVGTPXGTUKNDGTVVGKNYGKUG XGTIQNFGVWPFGOCKNNKGTVCP0CFGN$.#6*0 5VÒEM+p++





1TFGPFGT-TQPGXQP6JCKNCPF/QFGNN-QOOCPFGWTFGMQTCVKQPXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPF GOCKNNKGTVCO*CNUDCPFCDUEJPKVV$.#6*0 +p++





1TFGPFGT-TQPGXQP6JCKNCPF/QFGNN-QPXQNWVXQPXGTUEJKGFGPGP#WU\GKEJPWPIGP 4KVVGTFG MQTCVKQP 5KNDGT VGKNYGKUG XGTIQNFGV WPF GOCKNNKGTV CWH FGT 4ÒEMUGKVG FGT -TQPG RWP\KGTV   )QNFGPG   8GTFKGPUVOGFCKNNGFGU1TFGPUXGTIQNFGV 5KNDGTPG8GTFKGPUVOGFCKNNGFGU1TFGPUXGTUKNDGTVLGYGKNU CP$·PFGTP$.#6*000 5VÒEM++





8CNNCDJCDJQTP1TFGP5KNDGTCO$CPF$.#6*



7269

++

7272

7270

7273

7271



-ÌPKINKEJG/QPQITCOO&GMQTCVKQP#WUICDGHÒT-ÌPKI4COC8 %JWNCNQPIMQTP &GMQTCVKQP-NCUUG 5KNDGTVGKNYGKUGXGTIQNFGVCO$CPF$.#6*& ++





-ÌPKINKEJG /QPQITCOO&GMQTCVKQP #WUICDG HÒT -ÌPKI 4COC 8+++ &GMQTCVKQP  -NCUUG 5KNDGT   VGKNYGKUGXGTIQNFGVCO$CPF$.#6*& ++





&WUJFK/CNC/GFCKNNG5KNDGTCP6TCIGURCPIGQJPG$CPF$.#6*





-ÌPKINKEJG 4CLCTWEJK *QH8GTFKGPUVOGFCKNNG  #WUICDG -ÌPKI 4COC 8 %JWNCNQPIMQTP  /GFCKNNG   -NCUUG5KNDGTCO$CPF$.#6*$ ++





-ÌPKINKEJG 4CLCTWEJK *QH8GTFKGPUVOGFCKNNG  #WUICDG -ÌPKI 4COC +: $JWOKRQN  /GFCKNNG   -NCUUG5KNDGTCO$CPF$.#6*$ ++



94

++


7275

7274 ex 7277

ex 7278 ex 7276



2TCDCU/CNC/GFCKNNG5KNDGTCO$CPF$.#6*$

++



++



&KG/GFCKNNGYWTFGHÒT8GTFKGPUVGWOFKG'WTQRC4GKUG-ÌPKI%JWNCNQPIMQTPUKO,CJTGXGTNKGJGP



/GFCKNNG\WO5KNDGTPGP6JTQPLWDKN·WO-ÌPKI%JWNCNQPIMQTPU5KNDGTCO$CPF$.#6*



(TGKJGKVUOGFCKNNG   /GFCKNNG  -NCUUG   /GFCKNNG  -NCUUG LGYGKNU CO $CPF OKV 6TCIGURCPIG   $.#6*#$ 5VÒEM++





-QPXQNWV XQP HÒPH XGTUEJKGFGPGP OKNKV·TKUEJGP 'JTGP\GKEJGP   /GFCKNNG HÒT JGTXQTTCIGPFGP )TGP\   FKGPUV 5KGIGUOGFCKNNGHÒT6GKNPGJOGTCO<YGKVGP9GNVMTKGI (GNF\WIUOGFCKNNGHÒT6GKNPGJOGTCO -QTGCMTKGI /GFCKNNGHÒT8GTFKGPUVGWOFKG*GKOCVHTQPV-NCUUG /GFCKNNGHÒTFGP'KPUCV\HÒT FKG(TGKJGKVFGU8QNMGUWPFIGIGPFGP6GTTQTLGYGKNUCP$·PFGTP$.#6*#%$  5VÒEM++



-QPXQNWVXQP\GJPXGTUEJKGFGPGP#WU\GKEJPWPIGP -TÌPWPIUOGFCKNNG-ÌPKI4COCU+: $JWOKRQN   -NCUUG   4GIKGTWPIU,WDKN·WOUOGFCKNNG    4GIKGTWPIU,WDKN·WOUOGFCKNNG    /GFCKNNG   \WT+PXGUVKVWTFGU6JTQPHQNIGTU#WUHÒJTWPIHÒT&COGP /GFCKNNG\WT+PXGUVKVWTFGT-TQPRTKP\GUUKP #WUHÒJTWPI HÒT *GTTGP   /GFCKNNG \WT +PXGUVKVWT FGT -TQPRTKP\GUUKP #WUHÒJTWPI HÒT &COGP    /GFCKNNG\WT(GKGTFGU)GDWTVUVCIGUFGT-ÌPKIKP5KTKMKV#WUHÒJTWPIHÒT&COGP /GFCKNNG\WT ,CJTHGKGT FGT 5VCFV $CPIMQM   /GFCKNNG HÒT  ,CJTG VTGWG &KGPUVG   8GTFKGPUVOGFCKNNG XQO   4QVGP-TGW\-NCUUGLGYGKNUCO$CPFFTGKCP&COGPUEJNGKHGP$.#6*$#  5VÒEM++





ex 7279 7280

670'5+'0 

-QPXQNWV XQP \YGK #WU\GKEJPWPIGP   /KNKV·TXGTFKGPUV'JTGP\GKEJGP  -NCUUG XGTUKNDGTV    )QNFGPG/GFCKNNGHÒTVTGWG&KGPUVGDGKFGT2QNK\GKXGTIQNFGVVGKNYGKUGGOCKNNKGTVLGYGKNUCO$CPF 5VÒEM++



747)7#; 

1TFGP HÒT 8GTFKGPUVG WO FKG .WHVHCJTV /KNKV·TKUEJG #DVGKNWPI OKV 5EJYGTVGTP  -QOOCPFGWTMTGW\   XGTIQNFGVWPFGOCKNNKGTVCO*CNUDCPFKO1TKIKPCNGVWKFGT(KTOC05/G[GTKP0GY;QTM81.2' 5 +p++

 95


7281 (1:1)

70)#40 6+67.#4-¤0+)4'+%*   

7PICTKUEJGT8GTFKGPUVQTFGP5GV\WO/KVVGNMTGW\OKV5VGTPDGUVGJGPFCWU*CNUMTGW\5KNDGTXGTIQNFGV WPFGOCKNNKGTVQJPG*CNUDCPFWPF$TWUVUVGTP5KNDGTVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCP0CFGN<'+  5VÃ&#x2019;EM+p++

7283

7282



7PICTKUEJGT8GTFKGPUVQTFGP1HHK\KGTUMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHGKPGO-TGW\CTOOGJ TGTGMNGKPG*CCTTKUUG<'+ ++p



7PICTKUEJGT8GTFKGPUVQTFGP4KVVGTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO&TGKGEMUDCPF<'+



7PICTKUEJGT8GTFKGPUVQTFGP4KVVGTMTGW\XGTIQNFGVWPFGOCKNNKGTVCO-TKGIU&TGKGEMUDCPF<'+ ++

7285

7286

++

  

7287

 

7PICTKUEJGT8GTFKGPUVQTFGP5KNDGTPGU8GTFKGPUVMTGW\5KNDGTCO-TKGIU&TGKGEMUDCPF<'+ 7PICTKUEJGT8GTFKGPUVQTFGP$TQP\GPGU8GTFKGPUVMTGW\$TQP\GCO&TGKGEMUDCPF<'+



'JTGP\GKEJGPFGU7PICTKUEJGP4QVGP-TGW\GU8GTFKGPUVMTGW\5KNDGTXGTIQNFGVWPFGOCKNNKGTVCWHFGT 4Ã&#x2019;EMUGKVG\YGK6TCIGJCMGP<'+ ++

96



++ ++

  


ex 7288



7290

7PICTKUEJG XGTIQNFGVG $TQP\GOGFCKNNG 5+)07/ .#7&+5  OKV FGT -TQPG $TQP\G XGTIQNFGV   OOCOUR·VGTGP&TGKGEMUDCPF\WUCOOGPOKV/KPKCVWTKOPKEJVRCUUGPFGP'VWK8'40  5VÒEM++



7PICTKUEJG5KNDGTPG8GTFKGPUVOGFCKNNG5KNDGTCOUR·VGTGP&TGKGEMUDCPF



7PICTKUEJG$TQP\GPG8GTFKGPUVOGFCKNNG$TQP\GOKV4GUVXGTIQNFWPICO&TGKGEMUDCPF



+p++



+++



7291 7296



)TQ­G 1TFGPUURCPIG OKV UGEJU #WU\GKEJPWPIGP   )TQ­G 5KNDGTPG 6CRHGTMGKVUOGFCKNNG XGTUKNDGTV      -NGKPG5KNDGTPG6CRHGTMGKVUOGFCKNNGXGTUKNDGTV   (GWGTMTGW\OKV-TKGIUFGMQTCVKQPWPF5EJYGT VGTP /GFCKNNGHÒTFKG$GHTGKWPIXQP1DGTWPICTP 5KGDGPDÒTIKUEJG'TKPPGTWPIUOGFCKNNG 9GNV MTKGIU'TKPPGTWPIUOGFCKNNGOKV5EJYGTVGTPCP0CFGN 5VÒEM++



8#6+-#070&-+4%*'056##6 

'JTGPMTGW\2TQ'EENGUKCGV2QPVGHKEG/QFGNN-QPXQNWVXQPFTGK'ZGORNCTGPKPXGTUEJKGFGP)TÌ ­GP &WTEJOGUUGTOO OO OO5KNDGTLGYGKNUCO$CPF 5VÒEM++





#D\GKEJGP FGT 8GTGKPKIWPI HTCP\ÌUKUEJGT 4KVVGT FGT 1TFGP FGU *GKNKIGP 5VWJNU 8GTIQNFGV CO $CPF   &C\W$TQP\G$GPGOGTGPVKOGFCKNNGHÒT8GTFKGPUVGWOFCU*GKNKIG,CJTCO$CPF 5VÒEM++





'TKPPGTWPIUOGFCKNNG FGU 9GNV(COKNKGP6TGHHGP KP $TCUKNKGP  8GTIQNFGV VGKNYGKUG GOCKNNKGTV CO   *CNUDCPF ++



&CU9GNV(COKNKGP6TGHHGPHCPFCOWPF#WIWUVKP$TCUKNKGPWPVGTFGO2CVTQPCV2CRUV,QJCPPGU2CWNU++ WPFFGT70'(UVCVV

8'0'<7'.# 

1TFGPFGT$ÒUVG$QNKXCTU)TQ­MTGW\UGVDGUVGJGPFCWU)TQ­MTGW\FGMQTCVKQPXGTIQNFGVWPFGOCKNNKGTV CO5EJWNVGTDCPFWPF$TWUVUVGTPXGTUKNDGTVVGKNYGKUGXGTIQNFGVWPFGOCKNNKGTVCWHFGT4ÒEMUGKVG*GT UVGNNGTDG\GKEJPWPIFGT(KTOC05/G[GTKP0GY;QTMCP0CFGN 5VÒEM++



#PHGTVKIWPICWUFGPGT,CJTGP



1TFGPFGT$ÒUVG$QNKXCTU4KVVGTFGMQTCVKQPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVKO1TKIKPCNGVWKFGTFGT (KTOC05/G[GTKP0GY;QTM +p++





(TCPEKUEQFG/KTCPFC1TFGP-QOOCPFGWTFGMQTCVKQPXGTIQNFGVWPFVGKNYGKUGGOCKNNKGTVCO*CNUDCPF 81.2'5 ++





/KNKV·T8GTFKGPUVMTGW\ )GPGTCN 4CHCGN 7TFCPGVC -TGW\  -NCUUG XGTIQNFGV CO $CPF \WUCOOGP   OKV/KPKCVWTXGTIQNFGVCO$·PFEJGPDGKFGCWHFGT4ÒEMUGKVGRWP\KGTV-)(KO1TKIKPCNXGT NGKJWPIUGVWKFGT(KTOC05/G[GTKP0GY;QTM 5VÒEM++



/KNKV·T8GTFKGPUVMTGW\ )GPGTCN 4CHCGN 7TFCPGVC -TGW\  -NCUUG $TQP\G CO $CPF KO 1TKIKPCN   XGTNGKJWPIUGVWKFGT(KTOC05/G[GTKP0GY;QTM ++





97


7305

ex 7302

7300

ex 7303

8'4'+06'0#6+10'0 

-QTGCMTKGIU'KPUCV\OGFCKNNG#WUHÒJTWPIHÒTFCU·VJKQRKUEJG-QPVKPIGPV



-QPXQNWVXQPUGEJU'KPUCV\OGFCKNNGPCPXGTUEJKGFGPGP$·PFGTP 70+/1< /QUCODKM  706#%

-CODQFUEJC    70'( +UTCGNKUEJI[RVKUEJG )TGP\G    70151/ 5QOCNKC    701/5+.  

5KGTTC.GQPG  /107% -QPIQ /;$ 5VÒEM++

4++

 

 FCXQPPWTGKPG 

81.-54'27$.+- 014& 

8+'60#/



-·ORHGT1TFGP &GMQTCVKQP FGT  WPF FGT  -NCUUG XGTUKNDGTV VGKNYGKUG XGTIQNFV WPF NCEMKGTV CP   2GPVCIQPCND·PFGTPOKV5VGTPEJGPCWHNCIGP'/'45 5VÒEM++





1TFGPFGU5QNFCVGPFGU4WJOU&GMQTCVKQPGPFGTWPF-NCUUGLGYGKNUVGKNYGKUGXGTIQNFGVWPF NCEMKGTV DGKGKPGT#DRNCV\WPIGP CP2GPVCIQPCND·PFGTP'/'45 5VÒEM++





1TFGPXQO)QNFGPGP5VGTP&GMQTCVKQPGPFGTWPF-NCUUGLGYGKNUXGTUKNDGTVVGKNYGKUGXGTIQN FGVWPFNCEMKGTV DGK\YGK#DRNCV\WPIGP CP2GPVCIQPCND·PFGTP'/'45 5VÒEM++





/GFCKNNG FGU $CPPGTU FGT 'PVUEJNQUUGPJGKV \WO 5KGI 8GTIQNFGV VGKNYGKUG GOCKNNKGTV CO 2GPVCIQPCN   DCPF'/'45 ++



7306

ex 7307

7309



'JTGP\GKEJGP /GUUKPI (GUVWPI FGU 8CVGTNCPFGU 8GTIQNFGV WPF GOCKNNKGTV CP $CPFVTCIGURCPIG   '/'45 ++





-QPXQNWV XQP FTGK #WU\GKEJPWPIGP   'JTGP\GKEJGP HÒT FKG 'PVUEJNQUUGPJGKV \WO 5KGI  -NCUUG     'JTGP\GKEJGPHÒTFKG'PVUEJNQUUGPJGKV\WO5KGI-NCUUG $GHTGKWPIU'JTGP\GKEJGPFGT0CVKQPCNGP $GHTGKWPIU(TQPVLGYGKNUCP$CPFVTCIGURCPIGPOKV5VGTPEJGPCWHNCIGP'/'455  5VÒEM++



-QPXQNWV XQP \YGK #WU\GKEJPWPIGP   9KFGTUVCPFU'JTGP\GKEJGP XGTIQNFGV   5KGIGU'JTGP\GKEJGP   XGTUKNDGTVVGKNYGKUGXGTIQNFGVLGYGKNUCP$CPFVTCIGURCPIGP'/'455D 5VÒEM++





#75.0&+5%*')4722'052#0)'0 /+0+#674'0-'66%*'070&52#0)'0 

/KPKCVWT1TFGPUURCPIG GKPGU JQJGP &KRNQOCVGP OKV CEJV /KPKCVWTGP   -QNWODKGP $Q[CEC1TFGP   )TQ­MTGW\ %JKPCD\Y6CKYCP1TFGPFGU5VTCJNGPFGP5VGTPU)TQ­MTGW\ $TCUKNKGP1TFGPXQO -TGW\FGU5ÒFGPU)TQ­MTGW\ /CNVGUGTQTFGP8GTFKGPUVMTGW\ /QFGNN )TQ­MTGW\ 5RCPKGP (TCPEQ4GIKGTWPI 1TFGP +UCDGNNC NC %CVVQNKEC )TQ­MTGW\   'EWCFQT 0CVKQPCNGT 8GTFKGPUVQTFGP   )TQ­MTGW\ 2GTW1TFGPFGT5QPPGXQP2GTW)TQ­MTGW\ $QNKXKGP1TFGPFGU%QPFQTUFGT#P FGP)TQ­MTGW\&TGK/KPKCVWTGPYGKUGPOKP'OCKNNGEJKRRUCWH 5VÒEM++p



#75.0&+5%*'-1081.76' 

98

-QXQNWV XQP XKGT #WU\GKEJPWPIGP &CDGK  $TQP\G5KIPWO .CWFKU -CKUGT -CTNU OKV 4CPFUVGORGN   $410<'WPF&·PKUEJG-TKGIUOGFCKNNGHÒTFTGKCP$·PFGTP 5VÒEM++






LITERATURVERZEICHNIS

BRA2 CAB CLENA EMER GROV HERF4 HÜSK MARK MYB OAN OEK REY RORU SALL2 VERN VOLPE2 ZEI

Brambilla, Alessandro: Le Medaglie Italiane 1901 - 1996. Mailand 1997. Cabral, David: Orders and Decorations of the Democratic Peoples Republic of Korea. San Ramon 2000. McClenaghan, Tony: Indian Princely Medals - A Record of the Orders, Decorations and Medals of the Indian Princely States. Neu Dehli, London und Hartford 1996. Emering, Edward J.: Orders, Decorations and Badges of the Socialist Republic of Vietnam and the National Front for the Liberation of South Vietnam - A Photographic Reference. Atglen 1997. Grove, Frank G.: Orders, Awards and Military Decorations. Nachdruck der Ausgabe Guadalajara 1974. Herfurth, Dietrich: Sowjetische Auszeichnungen 1918-1991 - Auszeichnungen der Mongolischen Volksrepublik 1924-1992. Ein Katalog - Vierte Ausgabe. Berlin 4. Auflage 2004. Hüsken, André: Katalog der Orden und Ehrenzeichen des Deutschen Reiches 1871-1945. Hamburg 1999. Marko, Alexander A.: Auszeichnungen der Österreichisch-Ungarischen Monarchie und der Zwischenkriegszeit - Preiskatalog 1997. Linz 1996. Mackay, James, und Mussell, John W.: The Medal Yearbook 2004. Honiton 2003. Werlich, Robert: Orders and Decorations of all Nations – Ancient and Modern – Civil and Military. Washington 2. Auflage 1990. Nimmergut, Jörg: Deutschland-Katalog 2005/2006 Orden & Ehrenzeichen 1800-1945. München 15. Auflage 2005. Reynolds, Robert H.: Philippine Medals. Glasboro 1998. Romanoff, Prince Dimitri: The Orders, Medals and History of Imperial Russia. Rungsted Kyst 2000. Sallach, Alexander von: Die Orden und Ehrenzeichen unserer Republik - Zweite Auflage. Konstanz zweite wesentlich erweiterte Auflage 2004. Vernon, Sydney B.: Vernon's Collectors Guide to Orders, Medals & Decorations (With Valuations). Temecula, 4. überarbeitete Ausflage 2000. Volpe, Mario: Segni d'Onore - Compendio degli Ordini Cavallereschi e delle Onorificenze d'Italia, d'Europa e del Resto del Mondo. Band 2. Rom 2004. Zeige, Carsten: Europa Preiskatalog 2005. Hamburg 2005.

ERHALTUNGSANGABEN I II III IV

hervorragende Erhaltung gute bis sehr gute Erhaltung gute Erhaltung mäßige Erhaltung

99


Numismatik trifft Philatelie – Eine starke Allianz für den Sammler Sehr geehrte Kundin, sehr geehrter Kunde und Münzfreund, ich möchte mich auf diesem Wege herzlich für Ihr Interesse an unseren Auktionen bedanken. Ich wünsche Ihnen viel Erfolg beim Bieten und viel Freude an den neuen Erweiterungen Ihrer Sammlung. An dieser Stelle möchte ich Sie auf eine interessante Kooperation unseres Hauses hinweisen. In der Vergangenheit haben uns viele Kunden immer wieder auf das Thema Briefmarken angesprochen und nach einem geeigneten Partner im Bereich der Philatelie gefragt. Um diesem Anliegen unserer Kunden nachzukommen, haben wir lange nach einem Experten gesucht, der unsere hohen Ansprüche an Fachkompetenz, Seriosität und Kundenorientierung teilt. Ich freue mich, Ihnen heute mit dem renommierten Briefmarkenauktionshaus Dr. Derichs aus Köln diesen Partner vorstellen zu können. Es ist bemerkenswert, dass das erste Treffen zwischen Herrn Roland Meiners, Inhaber der Dr. Derichs GmbH und mir, auf die Initiative eines gemeinsamen Kunden hin stattgefunden hat. Der gutgemeinte Rat dieses in Philatelie und Numismatik gleichermaßen erfahrenen Kunden und die intensiven Gespräche mit Herrn Meiners überzeugten mich sehr bald, in Dr. Derichs ein kompetentes Auktionshaus gefunden zu haben, das wir Ihnen in allen Belangen der Philatelie weiterempfehlen können. Ich wünsche Ihnen auch auf dem interessanten Sammelgebiet der Philatelie viel Vergnügen und würde mich persönlich sehr freuen, wenn Sie unserer Empfehlung folgen würden.

Ihr Fritz Rudolf Künker

Osnabrück, im Mai 2006

100


101


102


103


104


VERSTEIGERUNGSBEDINGUNGEN Die Versteigerung erfolgt im Auftrag und für Rechnung der Eigentümer unter Einhaltung der sich aus der Versteigerungsordnung (BGB1 I 1976, 1346) ergebenden und für Kommissionäre geltenden gesetzlichen Bestimmungen des BGB und HGB gegen Barzahlung des Kaufpreises in €-Währung. Durch Abgabe eines Gebotes werden die Versteigerungsbedingungen anerkannt, dies gilt auch für die schriftlichen Gebote. Der Zuschlagpreis ist Nettopreis im Sinne des Mehrwertsteuergesetzes und bildet die Berechnungsgrundlage für das vom Käufer zu zahlende Aufgeld in Höhe von 15 %. Auf den daraus entstehenden Gesamtpreis (Zuschlag + Aufgeld) wird die zur Zeit gültige, ermäßigte Mehrwertsteuer von 7 % erhoben. Papiergeld unterliegt ebenfalls dem ermäßigten Steuersatz. Goldmünzen, bei denen Zuschlagpreis und Aufgeld geringer ist als das zweieinhalbfache des Metallpreises, unterliegen dem normalen Mehrwertsteuersatz von zur Zeit 16%, ebenso historische Wertpapiere. Goldmünzen, die als Anlagegold gelten, sind mehrwertsteuerfrei. Ausländischen Käufern aus Ländern der europäischen Gemeinschaft wird die in Deutschlang gültige Umsatzsteuer berechnet. Anderen ausländischen Käufern (aus Drittländern) wird, sofern die Münzen durch uns exportiert werden, ein Aufgeld von 15 % netto auf den Zuschlagpreis berechnet; sie erhalten die Lieferung nur gegen Zahlung des Kaufpreises in € - Währung, bankspesenfrei. Ausländischen Münzhändlern aus Ländern der europäischen Gemeinschaft wird bei Nachweis der Umsatzsteuer-Identifikationsnummer (§ 27 a USTG) und der sonstigen Voraussetzungen gemäß § 4 Nr. 1 b USTG in Verbindung mit § 6 a USTG die Lieferung ohne Umsatzsteuer berechnet. Sofern nichts anderes vereinbart wird, ist die Zahlung der Auktionsrechnung bei anwesenden Käufern sofort, bei schriftlichen Bietern spätestens 20 Tage nach Erhalt fällig. Bei Zahlungsverzug werden Zinsen von 1 % pro Monat berechnet. Wird die Zahlung nicht sofort an den Versteigerer geleistet oder die Abnahme der zugeschlagenen Sache verweigert, so findet die Übergabe der Sache an den Ersteigerer nicht statt. Der Ersteigerer verliert vielmehr seine Rechte aus dem Zuschlag, und die Sache kann auf seine Kosten erneut versteigert werden. In diesem Fall haftet der Ersteigerer für den Ausfall, dagegen hat er auf dem Mehrerlös keinen Anspruch. Der Zuschlag erfolgt nach dreimaligem Ausruf des höchsten Gebotes und verpflichtet zur Abnahme und Zahlung. Bei Meinungsverschiedenheiten über den Zuschlag wird die Nummer noch einmal ausgerufen. Der Versteigerer ist berechtigt, Nummern zu vereinigen oder zu trennen. Eine Vorausnahme von Nummern erfolgt nicht. Der Zutritt zur Versteigerung ist nur Interessenten gestattet, die einen Katalog besitzen. Die Mindeststeigerungsstufen für das Bietungsverfahren betragen: Mindestangebote

werden. Schriftliche Gebote können nur bis 24 Stunden vor Auktionsbeginn verbindlich berücksichtigt werden. Im Bedarfsfall ist der Auktionator berechtigt, die Limits um 3 – 5 % zu überschreiten. Bei mehreren gleichhohen Geboten erhält das zuerst eingegangene den Zuschlag. Unlimitierte Aufträge haben keinen Anspruch auf unbedingte Ausführung. Telefonisches Bieten ist nur in Ausnahmefällen möglich. Telefonische Bieter müssen sich mindestens einen Tag vor der Auktion voranmelden. Der Versand geht zu Lasten und auf Risiko des Ersteigerers bzw. Empfängers. Das Auktionsgut bleibt bis zur vollständigen Bezahlung aller Forderungen aus Anlaß der Versteigerung Eigentum des Verkäufers. Ist der Käufer Vollkaufmann, so ist Osnabrück als Gerichtsstand vereinbart. Für das Mahnverfahren gilt die Zuständigkeit des Amtsgerichts Osnabrück auch in allen anderen Fällen als vereinbart. Ansonsten ist es Osnabrück nur, wenn nur die Firma Fritz Rudolf Künker ihren allgemeinen Gerichtsstand in der BRD hat, oder wenn alle Ansprüche im Wege des Mahnverfahrens geltend gemacht werden, oder wenn die im Klageweg in Anspruch zu nehmende Vertragspartei nach Vertragsabschluß ihren gewöhnlichen Aufenthaltsort aus dem Geltungsbereich der BRD verlegt hat, oder ihr Wohnsitz oder gewöhnlicher Aufenthaltsort zum Zeitpunkt der Klage nicht bekannt ist. Die Beschreibung im Katalog ist gewissenhaft durchgeführt. Sie begründet jedoch keine Rechts- oder Sachmängelhaftung gemäß §§ 434, 459 ff BGB. Die Angabe der Erhaltung ist streng nach den im deutschen Münzhandel üblichen Erhaltungseinstufungen vorgenommen und gilt als persönliche Beurteilung. Bei der Auktion anwesende Käufer kaufen grundsätzlich „wie besehen“. Da durch Vorbesichtigung Gelegenheit gegeben ist, sich vom Erhaltungszustand des Versteigerungsgutes zu überzeugen, können nach erfolgtem Zuschlag Reklamationen nur bei irrtümlich übersehener Henkel- oder Fassungsspur oder gestopftem Loch berücksichtigt werden. Bei Losen mit mehreren Stücken sind die Stückzahlen nur Circa-Angaben, irrtümliche Zuschreibungen sind im Einzelfall nicht ausgeschlossen. Diese Lose sind nach erfolgtem Zuschlag von jeder Reklamation ausgeschlossen. Der Versteigerer kann bei eventuellen Meinungsverschiedenheiten bzw. Beanstandungen einen vereidigten Sachverständiger seiner Wahl (die Kosten trägt der unterliegende Teil) beauftragen. Eventuelle Beanstandungen können nur innerhalb von 8 Tagen nach der Auktion bzw. nach Erhalt der ersteigerten Stücke berücksichtigt werden. Die Echtheit der Stücke wird bis zur Höhe des Kaufpreises garantiert. Die beigedruckten Preise sind Schätzpreise, die unter- oder überschritten werden können. Aufträge, die unter 80 % des Schätzpreises liegen, können nicht bearbeitet werden.

Ausländische Kunden kaufen nach den Devisen-, Zoll- und Steuerbestimmungen ihres Landes. Versandformalitäten werden vom Versteigerer erledigt.

Mindeststeigerungsstufe Soweit nicht anders vermerkt, gelten im übrigen die allgemeinen Versteigerungsbestimmungen und – auch im Verhältnis zu ausländischen Kunden – gilt Deutsches Recht.

bis zu

€ 100,--

€ 5,--

bis zu

€ 300,--

€ 10,--

bis zu

€ 1.000,--

€ 20,--

Für Büchersendungen und Sendungen ins Ausland werden Versandkosten nach Aufwand in Rechnung gestellt.

bis zu

€ 2.000,--

€ 50,--

Die Ergebnisliste erscheint sofort nach der Auktion.

bis zu

€ 5.000,--

€ 100,--

bis zu

€ 10.000,--

€ 200,--

bis zu

€ 20.000,--

€ 500,--

ab

€ 20.000,--

€ 1.000,--

DIE VERSTEIGERER:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP

Schriftliche Aufträge werden von uns ohne Auftragsprovision gewissenhaft ausgeführt. Aufträge von uns unbekannten Sammlern können nur ausgeführt werden, wenn ein Depot hinterlegt wird oder Referenzen benannt

106


TERMS AND CONDITIONS OF AUCTION The auction is conducted on behalf and for the account of the appropiate proprietors of the goods and is subject to the federal Auction Regulation (Versteigerungsordnung, BGB1 I 1976, 1346) published in the Federal Law GazetteVol. I, 1976, 1346 and the relevant provisions for factors in accordance with the German Cicil Code (BGB) and Commercial Code (HGB). Payment of the hammer-price has to be made in cash and in Euro. The submission of an offer implies the express acknowledgement of these Terms and Conditions of Auction; the same applies to the submission of an offer in writing. The hammer-price is exclusive of applicable German VAT according to the prevailing VAT – legislation and represents the basis for calculating the surcharge of 15 percent payable by the puchaser. The total price so calculated (hammerprice plus surcharge) is subject to the reduced VAT (value added tax=Mehrwertsteuer) of 7 per cent as presently applicable, which is payabel additionally. The reduced VAT applies also to paper-money. Gold coins for which the hammer-price plus surcharge is less than two and ohne half times the intrinsic gold price, are subject to the normal VAT rate of presently 16 per cent. The same applies to historical bonds. Gold coins which are considered as a gold investment are free of VAT. Purchasers from abroad will be charged a surcharge of 15 per cent net on the hammer-price, provided the export of the coins is undertaken by the auctioneer. Buyers in European Community (EEC) countries (other than Germany) will be charged Value Added Tax at the rates prevailing in Germany. Dealers from EEC countries (other than Germany) will receive goods free of tax upon presentation of their VAT I.D. number, and upon fulfillment of the other conditions set forth in Paragraph 4, Nr. 1 b, and Paragraph 6 a of the GermanTurnover Tax Law. Buyers from other countries are not charged Value Added Tax. Delivery will be made against payment in Euro with no bank charges to the auctioneer. Unless mutually agreed otherwise, payment of the auction bill from purchasers present at the auction is due immediately. From purchaser who have submitted a bid in writing, payment is due within 20 days after receipt of the goods. Defaulted payments shall bear an interest charge of 1 % per month in the amount in default. Should payment to the auctioneer not be made immediately or should the acceptance of the awardet item be refused, such item shall not be handed overt to the purchaser. Instead the purchaser shall forfeit all right and title in and to such item from the award and the item may again be put to auction at this buyer’s cost. In this event the buyer shall be liable for any shortfall, while he shall have no right or claim towards any excess proceeds. An item will be knocked down after the highest bid has been called three times. The award shall be a binding commitment and liability on the part of the bidder to take acceptance and delivery of the item or items so awarded. In the event of any dispute with regard to the award the lot will be put up again for bidding. The auctioneer reserves the right to combine or to seperate lots. Lots will not be called out of sequence. Access to the auction will only be permitted to interested persons who are in possession of the catalogue.

price or prices for a given lot, the bid first received by the auctioneer shall be given the award. Unlimited bids shall not oblige the auctioneer to consider, accept or carry out such order. Telephone bidding is generally an option for lots of substantial value only. The registration is required at the latest a day before auction. Shipment (by mail or otherwise) of the goods shall be for the sole cost and risk of the purchaser or receipient, resp. The auctioned goods remain the sole and exclusiv property of the vendor until full payment and settlement of any and all dues and claims in connection with the auction. In the event the purchaser is a merchant (in the sende of the German commercial laws) Osnabrück shall be the agreed and exclusive place of jurisdiction. The competence of the District Court (Amtsgericht) of Osnabrück is agreed in respect of summary proceedings for the collection of defaulted payments (Mahnverfahren) as well as in any and all other cases. Should the purchaser not be a merchant Osnabrück shall be the place of jurisdiction with the District Court of Osnabrück’s competence, if only the auctioneer has his ordinary legal domicil in the Federal Republic of Germany or if claims are made by way of summary proceedings of collection (Mahnverfahren) or if the defendant has moved his ordinary legal domicil outside the jurisdiction of the Federal Republik of Germany or if the legal domicil of the defendant is unknown to the auctioneer at the time of filing a suit. To the exclusion of any other legislation German law, as in force at the time, shall be applied for the settlement of any and all legal or judicial matters. The specifications and descriptions in the catalogue have been prepared diligently and in good faith do, however, not constitute the acceptance by the auctioneer of any warranty or liability in respect of defect in material or title. The state of preservation of items is strictly assessed in accordance with the grades accepted by the German coin trade and only represents an individual and personal assessment. Purchasers present at the auction acquire items strictly on the basis of “as is where is” and “as inspected”. In view of the opportunity of prior inspection to ascertain the state and condition of the auction lots, complaints and objections made after the sale will only be considered, if by obvious error or mistake loop or traces or moutings, traces of trimmings or settings, or the plugging of a hole (eyelet) have remained unnoticed. If and when auctioned in lots, the quantities of individual pieces given, only represent an approximate figure. An error in the allocation of indivdual pieces to a certain lot cannot be excluded. Such lots are, therefore, excluded from any complaintes or objections after the lot is knocked down. In the event of disputes or complaints as to the quality of an item the auctioneer may call upon a gernerally sworn expert of the trade, which the auctioneer may choose at his sole discretin, for assessment an the rendering of a decision as to the justification of such dispute or complaint. The costs of such expert shall be borne by the party loosing the dispute according to the expert’s decision. Complaints or objections, if justified, will only be considered if made and received by the auctioneer within 8 days after the auction or after receipt the lots, respectively. The authenticity of the coins is warranted. Warranted up to the total purchase price. The prices set out in the catalogue are estimates only, which may bei exceeded or undercut. Orders for less than 80 per cent of the estimated price cannot accepted.

The minimum rates of increase for the bidding procedure are: for minimum offers

minimum increase rate

Purchasers from abroad will have to observe all applicable laws and regulations in respect of foreign exchange, customs duties and taxation of their country. The auctioneer will only dischare such formalities, which have to be observed, in the Federal Republic of Germany in connection with the export of the purchased item(s).

up to

€ 100,--

€ 5,--

up to

€ 300,--

€ 10,--

up to

€ 1.000,--

€ 20,--

up to

€ 2.000,--

€ 50,--

Unless stipulated otherwise herein, the general rules regulations for auctions applicable in Germany shall govern any transaction in respect of the auction; German Law shall also be applicable in relation to purchasers form abroad. Only the German text has legal forde.

up to

€ 5.000,--

€ 100,--

Shipment to foreign countries and shipment of books we charge upon expenses.

up to

€ 10.000,--

€ 200,--

The prices realized will be published in the form of a list immediately after the auction.

up to

€ 20.000,--

€ 500,--

above

€ 20.000,--

€ 1.000,--

Orders submitted in writing will be carried out diligently and without charge of an extra commission. Orders from collectors unknown to the auctioneer can only be accepted and carried out if a deposit or references to the satisfaction on the auctioneer are given. To be bindingly accepted, written bids need to be received at least 24 hours befor auction. If necessary, the auctioneer is alloweed to increase the bids by 3-5%. Should several bids be obtained in writing bidding the same

THE AUCTIONEERS:

FRITZ RUDOLF KÜNKER DR. ANDREAS KAISER ARNE KIRSCH OLIVER KÖPP

105


NUMISMATISCHE BEGRIFFE EXPRESSIONS NUMISMATIQUES NUMISMATIC TERMS TERMINI DI NUMISMATICA DEUTSCH

ENGLISCH

FRANÇAIS

ITALIANO

Abschlag Am Rand Berieben Blei Dezentriert Doppelschlag Einfassung Einseitig Emailliert Erhaltung Etwas Exemplar Fassungsspuren Fehlprägung Feld(er) Fundexemplar Gedenkmünze Geglättet Gelocht Geprägt Gewellt Goldpatina Hübsch Jahrh. = Jahrhundert. Kl. = klein Korrosionsspuren Kratzer Kupfer Legierung Leicht(e) l. = links Min. = minimal Nachahmung Prachtexemplar Prägeschwäche Randdelle Randfehler Randschrift r. = rechts Rückseite Schriftspuren Schrötling Schrötlingsfehler Schwach ausgeprägt Selten in dieser Erhaltung Seltener Jahrgang Stempel Stempelfehler Überdurchschnittlich erhalten Überprägt Unediert Unikum Vergoldet Von aller größter Seltenheit Vorderseite Winz.= winzig Zain Zierrand Zinn Ziseliert

struck at the rim/border slightly polished lead uncentered double struck frame uniface enamelled condition/preservation slightly specimen, copy trace of mounting mis-strike field(s) specimen from a hoard commemorative coin tooled holed minted bent golden patina attractive century small traces of corrosion scratch(es) copper alloy slightly left minimal imitation attractive, perfect piece weakly struck edge nick edge faults lettered edge to right reverse traces of inscription flan flan defect weakly struck rare in this condition rare year die(s) mistake in the die extraordinary condition overstruck unpublished unique specimen gilt extremely rare head tiny flan ornamental border tin chased

frappe au tranche frotté plomb decentré double frappe encadrement uniface émaillé conservation un peu exemplaire traces de monture défaut de frappe champ de trésor monnaie commemorative lissé troué frappé ondulé patina doré jolie siécle petit traces de corrosion rayure cuivre alliace légère gauche minimal imitation pièce magnifique de frappe molle défaut sur la tranche erreur a la tranche inscription sur la tranche droite revers traces de légende flan erreur de flan de frappe molle conservation rare année rare estampe erreur de frappe Conservation extraordinaire surfrappé inédit pièce unique dorée très rare en face petit flan tranche ornée étain ciselé

coniazione al bordo trattato piombo non centrato ribattitura cornice uniface smaltato conservazione un poco esemplare tracce di montatura difetto di coniazione campo da tesoretto moneta commemorativa liscio bucato coniato ondolato patina d´oro carino secolo piccolo segni di corrosione graffio(i) rame lega leggero sinistra minimamente contraffazzione esemplare magnifico conio stanco ammaccatura al bordo errore nel bordo inscrizione sul bordo destra rovescio tracce di leggenda tondello errore di tondello conio stanco conservazione rara annata rara conio errore di conio conservazione estraordinaria ribattuto inedito pezzo unico dorato di estrema raritá diritto veramente piccolo tondello taglio ornato stagno cesellato

107


NUMISMATISCHE BEARBEITUNG FOTOS LAYOUT DRUCK

Alexandra Putz, Jens Ulrich Thormann MA, Petra Wedekämper, Manuela Weiß Lübke & Wiedemann, Stuttgart danner pc - gesteuterte systeme waiblingen media-print, Paderborn Jeglicher Nachdruck, auch auszugsweise, bedarf der Genehmigung des Auktionshauses

BANKVERBINDUNGEN DEUTSCHE BANK OSNABRÜCK DRESDNER BANK OSNABRÜCK SPARKASSE OSNABRÜCK VOLKSBANK BORGLOH-HILTER E. G. BANKHAUS LAMPE KG BIELEFELD POSTBANK HANNOVER CREDIT SUISSE

BLZ 265 700 90, Konto 0 177 006 BLZ 265 800 70, Konto 780 520 200 BLZ 265 501 05, Konto 247 320 BLZ 265 624 90, Konto 1 200 222 400 BLZ 480 201 51, Konto 174 076 BLZ 250 100 30, Konto 2900 60 - 308 Konto 135 494 - 42 - 1

Zahlungen aus dem Ausland - Foreign payments SPARKASSE OSNABRÜCK DEUTSCHE BANK OSNABRÜCK POSTBANK HANNOVER CREDIT CARDS

IBAN: DE50 2655 0105 0000 2473 20 SWIFT-CODE: NOLADE22XXX IBAN: DE11 2657 0090 0017 7006 00 SWIFT-CODE: DEUTDE3B265 IBAN: DE73 2501 0030 0290 0603 08 SWIFT-CODE: PBNKDEFF We do accept VISA and MASTERCARD Service charge: 4,5 %

ERHALTUNGS- UND SELTENHEITSGRADE ERHALTUNGSGRADE/ GRADING TERMS DEGRÉS DE CONSERVATION GRADI DI CONSERVAZIONE

SELTENHEITSGRADE

108

Polierte Platte Proof

Flan bruni Fondo specchio

Stempelglanz Uncirculated

Fleur de coin Fior di conio

Vorzüglich Extremely fine

Superbe Splendido

Sehr schön Very fine

Très beau Bellissimo

Schön Fine

Beau Molto Bello

Gering erhalten Very good

Très bien conservé Bello

R = Selten Von großer Seltenheit

RR = Sehr selten Von größter Seltenheit

Auktion 114 Künker  

Deutsche Münzen ab 1871 in Gold und Silber, Orden und Ehrenzeichen

Read more
Read more
Similar to
Popular now
Just for you