Mobile Bay Parents September 2015

N I U C re n unio

SUNDAY 1-3

October 18, 2015

PM

Legendary Gulf Coast Eats with a Laid Back Vibe [View’s not bad either]

Mobile Causeway 251.626.2188

MobileParentsSept.indd 1

Gulf Shores 251.948.2445

1

OriginalOysterHouse.com

www.facebook.com/mobilebayparentsmagazine

8/11/15 3:12 PM

S

A S

H m

2 R

Lo as

Mobile Bay Parents I September 2015

2

www.mobilebayparents.com

om

September2015 34

Volume 5 Number 4

Columns

38

4

Mom of the Month 6

Living With Children John Rosemond

Advocating for Your Special Needs Child

Promoting Good Social Skills

14

Kids Health Watch

Help them get the support, treat- Helping your special needs ment & education they deserve. child interact better with others.

sponsored by Children’s Medical Group

32

Dave Says Dave Ramsey

40 48

36

Get This!

Gerry Paige Smith

37

Growing Up Online Carolyn Jabs

2015 Special Needs Resource Guide

You’ve Got It, Mom!

Discover 10 ways to boost your self-confidence as a mother, Local and national resources assist you in caring for your child. and as a woman.

50

A Page in a Book Gerry Paige Smith

51

Centsibly Southern Chic Laura Handey

On The Cover Andrew (age 6) lives at home with his parents, Amy and Richard Carpenter, and his older brother, Reed (10). He attends Mary B. Austin Elementary School and St. Ignatius Catholic Church.

Andrew’s grandparents all live in the Mobile area. The Carpenters feel very fortunate that they all help them so much every week. Maternal grandparents are Martha and Bo Palmer. Paternal grandparents are Ingrid and Larry Carpenter.

3

Departments 8

Bits and Pieces 15

School Bits 52

Family Calendar 56

Movie Reviews www.facebook.com/mobilebayparentsmagazine

MomOfTheMonth Welcome to the Special Needs Issue of Mobile Bay Parents magazine. I am honored to have my son, Andrew, featured on the cover this month, and humbled to be writing to you in this letter.

How did I join this special needs community? Andrew was born in 2009 via a scheduled C-section. I went to the hospital that day expecting to bring home my healthy baby boy three days later. God had other plans for my family. When Andrew was born, he was diagnosed with congenital cytomegleovirus (CMV). He spent eight weeks in the NICU at Children’s and Women’s Hospital. During those eight weeks, we learned our son has cerebral palsy and may never walk, talk or live a typical life. I was thrust into the special needs community kicking and screaming.

On day three, I called the most amazing special needs mom I know, Kathy McMaken. I knew Kathy could guide me as I began this journey, and she did. She led me to Goodwill Easter Seals Early Intervention Program where Andrew’s new adventure in special needs programming began.

I am just like every other mom. I want my children to enjoy their childhood, get an education, make friends, participate in activities they love and make friends along the way. I wanted Andrew to go to preschool and graduate, so we found the Goodwill Easter Seals Child Development Center that could and would take him. He learned with his typical and non-typical peers for two and half years and graduated with his cap and gown.

Last year, he transitioned to Kindergarten. He participated in the regular classroom and even had lines in the school program (spoken by his talker) despite being non-verbal.

This year he begins first grade at Mary B. Austin Elementary. He’s come a long way from those days in the NICU. I have learned a lot over the last six years and it all started by reaching out to another mom in this special needs community.

Andrew has and still participates in so many special needs programs that I learned about from others. He goes to elementary school, attends multiple therapy sessions weekly, plays spring baseball, rides horses once a week and even participated in Dance without Limits this past spring. He has attended United Cerebral Palsy (UCP) Camp Smile and other respite programs offered by Goodwill Easter Seals. In fact, Andrew is so busy, along with the rest of my family, that people often ask me, “How do you do it all?”

We do it because it is worth all of the extra effort when we see Andrew shine. Every little boy wants to play baseball and Andrew is no exception. He loves to play at Westside Park in their Challenger League. Nothing makes him happier then wearing his baseball uniform and getting to hit the ball and run to first base (with assistance in his walker or wheelchair). Andrew shines brightly at the Buckaroo Barn when he rides his favorite horse, Red, who happens to be 15 hands tall. Imagine seeing your child stand on the back of a 15-hand horse grinning from ear to ear. Speaking of shining, he was a shining star during his dance recital when it was his turn to take center stage. Andrew can join all of these extracurricular activities because of the time and effort he puts in at Pediatric Physical Therapy. He works hard so he can play hard. Andrew has worked hard at physical therapy since he was seven months old. Cheryl Thames and her team have taught Andrew to roll over, sit independently, crawl, walk in a walker, stand up from a chair and so many other skills we thought he might never have been able to do on his own.

Having a special needs child is difficult. Andrew requires a lot of extra effort every day just to get through the daily routine. At six years old, he still needs help eating, drinking, toileting, dressing, moving around and getting in and out of the car. He cannot do it by himself and neither can I. All of you are part of my special needs community.

Amy Carpenter Mobile Bay Parents I September 2015

4

Mobile Bay Mobile Bay’s Foremost Parenting Source

Mobile Bay Parents Magazine is founded on the principle that parenting is an exciting, diverse, challenging, and significant role in our community.

Mobile Bay Parents Magazine is a community advocate for families and the parenting process.

Publisher Lynn Knighton lynn@mobilebayparents.com Editor DeAnne Watson deanne@mobilebayparents.com Associate Editor Kelly Watson Research Editor Lucy Green Contributing Writers Jennifer Adair, M.D. Amy Carpenter Laura Handey Carolyn Jabs Heidi Smith Luedtke, Ph.D. Judy M. Miller Varina Mead Dave Ramsey John Rosemond Gerry Paige Smith Cover Photography Hannah Stinson www.hannahstinsonphotography.com

President Jason Watson Advertising Sales Lynn Knighton Leslie Hall Danielle Nicholas ads@mobilebayparents.com (251) 304-1200 Ad Design Tim Welch

Visit us at www.mobilebayparents.com Mobile Bay Parents magazine is published monthly by KeepSharing, LLC. Mailing address: P.O. Box 81105, Mobile, Alabama, 36689. The phone number for voice and fax is (251) 304-1200.

Mobile Bay Parents is copyrighted 2013 by KeepSharing LLC. All rights reserved. Reproduction in whole or part without written permission is prohibited. Opinions expressed in Mobile Bay Parents magazine are those of the authors and do not necessarily reflect the view of the owners, nor do they constitute an endorsement of products and services herein.

www.mobilebayparents.com

ce

he e, nity. y ss.

m

com

y by 05, oice

hare or ons ose w of t of

om

5

www.facebook.com/mobilebayparentsmagazine

LivingWithChildren

by John Rosemond

Making Consequences Work Q: Why is it that no consequence seems to work for long, if at all, with my very strongwilled 7-year-old daughter? I have tried everything I’ve ever heard or read about to deal with her constant disobedience and disrespect. Some things, like taking away her computer privileges for a day or so, have worked for maybe a week at most, then stop working. It’s like she doesn’t really care if I punish her.

Nothing fazes her. Help!

A: Consequences only work when the child in question regards the parent as an authority figure. Your daughter’s disrespect is clear indication that she does not see you in that light. You are obviously frustrated with her, which undermines her respect for you.

Obedience and respect are not obtained by using proper consequences. They are obtained by projecting a proper attitude.

The attitude in question is calm, self-possessed, straightforward, and matter-of-fact.

The parent is cool, calm, and collected— unflappable. A child’s natural response to an adult who projects those qualities—which I call Plan A—is obedience. That adult will only need to fall back on consequences— Plan B—occasionally, as a reminder.

Without the proper parental attitude, no consequence will work for more than a few hours to a few days. With the proper attitude, consequences are rarely needed. As living proof, parents who have wellbehaved, well-mannered children are models of the attitude in question.

Other parents sometimes make the mistake of thinking these parents are “lucky.” Not so. They are not relaxed because they were blessed with “easy” children. Their kids are easy because they are relaxed.

Their kids also know they mean business. When it comes to consequences, these parents don’t fool around. They use huge consequences in response to small misbehaviors. Taking away computer privileges for a day or two when a child disobeys

is an example of fooling around. Taking away every single privilege the child enjoys for two or three weeks during which time the child goes to bed at least one hour early every night is not fooling around.

“For one misbehavior?” someone asks incredulously.

Yes, for one misbehavior. The purpose of a consequence is to significantly reduce, even eliminate, the likelihood that the misbehavior will recur. To accomplish that, the consequence has to instill a permanent memory, one that lights up like the Fourth of July if the child is ever again so inclined.

That approach to the use of consequences, coupled with the attitude described above, minimizes their need and leads eventually to a very relaxed, easy-going parent-child relationship. Face it, the need to discipline constantly as you describe yourself doing, creates tension in the parent-child relationship. That tension interferes with the free flow of affection.

In short, the key to having a wonderful relationship with your kids is to embrace your natural authority and stop worrying about whether punishments “fit” crimes.

Family psychologist John Rosemond answers parents’ questions at www.johnrosemond.com and parentguru.com.

HOME SCHOOL ART SCHOOL ART ALL YEAR LONG After-School Art Classes

T

i

t

a

A

p

THE MUSEUM SCHOOL Mobile Bay Parents I September 2015

6

www.mobilebayparents.com

s

rly

s

e

e

nt of

APPLY ONLINE

NOW

n

e

-

om

ASMS

The Alabama School of Mathematics and Science To succeed in this highly technological and

ASMS is our state’s only fully public, residential high

their capabilities in math, science, and the humanities to

seniors. TUITION, ROOM, BOARD, AND BOOKS ARE

information-based society, students need to develop a level higher than what was acceptable in the past.

An education from ASMS will lead students into

promising careers. Let us prepare you for the future.

school for highly motivated sophomores, juniors, and FREE. All current 9th- and 10th-grade Alabama residents can apply. Learn more and register for Preview Day, the school’s annual open house, at www.asms.net.

Alabama School of Mathematics and Science 1255 Dauphin St., Mobile, AL 36604 251.441.2100 - www.asms.net admissions@asms.net 7 www.facebook.com/mobilebayparentsmagazine

Girls Just Wanna Have Fun

The 9th annual ‘Girls Just Wanna Have Fun’ fundraiser for Ronald McDonald House Charities of Mobile is a “must do” event for ladies 21 years of age and older featuring heavy hors d’oeuvres from local area chefs and restaurants, McTini’s and an unforgettable evening of manicures, make-overs, shopping, entertainment and more. Thursday, September 10, 2015 from 5:30 p.m. to 9:00 p.m. at the Alabama Cruise Terminal, 201 South Water Street, Mobile. Event tickets are available for $50 in advance or $60 at the door. Attendees may also purchase $25 or $50 ‘Purse-Onality’ tickets which include a stylish purse – and a surprise gift inside valued at that (or more!) Visit www.rmhcmobile.org or call Ronald McDonald House Charities of Mobile at 251-694-6873 to purchase tickets.

t Ot o C

BayFest 5K & Fun Run

BayFest will host its 9th Annual 5K Run/Walk on Saturday, September 26th to kick off the beginning of the 2015 BayFest Music Festival. The 5K race will start at 8:00a.m. and Fun Run will start at 9:00a.m. in Bienville Square in downtown Mobile. Pre-register by mail (entries should be postmarked by September 19), in person at McCoy Outdoor or Run-N-Tri in Mobile or Running Wild in Fairhope until noon on September 24, or online (www.bayfest5k2015.eventbrite.com) until 4a.m. September 26. Food, beverages, and music will be provided after the race. All registered participants will be eligible for door prize drawings - you must be present to win. For more information, please visit www.bayfest.com/5k.php.

Vintage Affair Gala Wine Tasting and Auction

The 21st Annual Vintage Affair Gala, sponsored by Lexus of Mobile, is an upscale wine tasting and auction benefiting the American Cancer Society. The night will feature live and silent auctions offering original local art, fabulous trips, estate jewelry and other exclusive items. Where: The Alabama Cruise Terminal, Mobile, Thursday, October 1, 6:00 p.m. to 9:00 p.m. Join over 400 attendees including local and regional executives, physicians, business professionals and other influential members of the community. For tickets and sponsorship opportunities visit www.vintageaffairmobile.org email blair.bullen@cancer.org or call 344.9858

Take Strides Towards Down Syndrome Awareness at Mobile's Buddy Walk®

On Saturday, October 17 at 10 a.m., participants from Mobile and surrounding communities will walk together for Down syndrome awareness as part of the 8th Annual Buddy Walk. More than 750 people are expected to attend the event, which is one of over 250 Buddy Walks across the U.S. this fall to raise awareness and funds for programs that benefit people with Down syndrome and their families. This year’s Buddy Walk will be held in Bienville Square, located in the heart of downtown Mobile, and is a one-mile walk in which anyone can participate without special training. Along with the walk through the historic area, there will also be live music, food, special guests, games for all ages, vendors and exhibitors and much more. The Buddy Walk was developed by the National Down Syndrome Society (NDSS) in 1995 to celebrate Down Syndrome Awareness Month in October and to promote acceptance and inclusion of people with Down syndrome. For more information on the Mobile Buddy Walk, visit http://bit.ly/buddywalkmobile, and, for more information about the Down Syndrome Society of Mobile, visit www.dssmobile.org.

“Lions, Tigers, THE FAIR, Oh My!”

The Grounds will host the 61st annual Greater Gulf State Fair from Oct. 30 – Nov. 8. This year’s Fair will feature a new theme “Lions, Tigers, THE FAIR, Oh My” with a full schedule of Wizard of Oz themed entertainment and design. “The 2015 Fair is focused on creating the cleanest, most family-friendly event in America,” said Scott Tindle, executive director of The Grounds. Tickets are on sale now! To purchase your tickets or for more information about the 2015 Fair, please visit thegroundsmobile.com.

Mobile Bay Parents I September 2015

8

www.mobilebayparents.com

H

es

,

es

e

Mobile Fashion Week Celebrates 5th Anniversary!

Mobile Fashion Week (MFW) celebrates its 5th anniversary with shows being held on location at the Warehouse District at Mobile Aeroplex, Mobile Fashion Week’s opening night is Thursday, September 24th to include local salons during the famed Hair Show. Friday, September 25th presents the popular Fashion’s Night Out and Saturday, September 26th will conclude Mobile Fashion Week with The Finale. Doors will open each night at 6 p.m. Showtime is set for 7 p.m. and events will conclude each night at 10 p.m.

For the first time, Mobile Fashion Week will present junior designers from around the Gulf Coast to showcase their collections. Arianna Swan of Spanish Fort High School will present her designs at Fashion’s Night Out. The Mobile Fashion Council winner, Helen Legg of Fairhope High School, will display her collection during The Finale. Finally, the Thursday night Hair Show will feature designs from Santajia Lindsey of Vigor High School.

Other designers include Tieler James, winner of Project Runway Threads, Katharine Faust, House of Faust, Lauren Dufilho and Native Royalty. Proceeds are distributed to the following charities: Camp Rap-A-Hope, Eye Heart World, and Children with Hair Loss. For more information visit us at: http://www.mobfashionweek.com/

Art Works: The Throwdown 4

This one-of-a-kind silent auction/ loud party features a competition like none other seen in Mobile. Five artists will compete in a battle of creativity. Returning to defend his belt is last year's Throwdown Champion Rando Dixon, pitted against artists Chris Cumbie, Mateo, Amanda Solley, and Bronwyn Coffeen.

Master of Ceremonies will be Local 15's Darwin Singleton and each masterpiece will be sold in a live auction at the end of the evening. While watching the competition and bidding, party goers can enjoy dancing to the spins of local D.J. Hunter Clark, food provided by Heroes and The Royal Scam, plenty of beer, wine and, of course, MAC's signature cocktail: "The Red Rooster".

ART Works is the Mobile Arts Council's largest annual fundraiser. All proceeds go to support our mission of bringing people and art together.

Please visit artworksthrowdown4.brownpapertickets.com for more information.

n ive g

HE t r

om

9

www.facebook.com/mobilebayparentsmagazine

Original Oyster House Hosts Free Never Forget Lunch for First Responders

The Original Oyster House restaurants will honor Mobile and Baldwin County law enforcement, firefighters, paramedics and sheriff officers by offering a free “Never Forget” Lunch at either the Gulf Shores or Mobile Causeway location on Friday, September 11, from 11 a.m. to 4 p.m. The 8th Annual Never Forget Lunch was established by the Original Oyster House restaurants in honor of the 911 First Responders who risked their lives to save, protect and serve and also to recognize all first responders for their service. The Mobile Causeway restaurant will also host a blood drive in memory of 9/11. “We promised we would not forget and we have not forgotten the brave men and women that not only went above and beyond that tragic day in history, but today continue to serve and protect. Please join us on Friday, September 11 anytime between 11 am to 4 p.m. Just show your ID or better yet wear your uniform so we may recognize you with a handshake or pat on the back,” stated Joe Roszkowski, CEO and president of Superb Foods/ Original Oyster House restaurants. In memory of 9/11, LifeSouth Community Blood Centers, a 501(c) 3 non-profit community blood supplier, will also be on hand at the Causeway restaurant for blood donations. All blood donations collected will be distributed to hospitals in Mobile, Baldwin, and Escambia Counties.

8th Annual GO RUN for Gynecologic Cancer Research

Second Annual Boots & BBQ Barn Bash Kicks off at Camp Grace

The second annual Boots & BBQ Barn Bash kicks off on Thursday, Oct. 8, , to benefit pediatric rheumatology patients. Guests are invited to enjoy an evening of live music and barbecue at Camp Grace, located at 11081 Wanda Drive. Festivities start at 6:30 p.m., with live music from Ashton Shepherd. Guests are encouraged to wear their best pair of cowboy boots and enjoy s’mores, hayrides and a bonfire. Moe’s Original Bar B Que will provide its award-winning barbecue and sides for dinner. The Boots & BBQ Barn Bash is presented by Children’s of Alabama and Rheum4yAL, an advocacy group that works with children across Alabama suffering from juvenile arthritis. This year’s event honors Mitchell Hughey of Mobile. Proceeds from the Boots & BBQ Barn Bash will provide funding for a pediatric rheumatologist from Children’s of Alabama to hold clinics in Mobile to treat the many children along the Gulf Coast suffering from autoimmune disorders. Pediatric rheumatologist Melissa Mannion, M.D., M.S.P.H., began seeing patients in June in the USA Pediatric Specialty Clinic, located at 1504 Springhill Avenue. The clinic is held every other month on the third or fourth Friday of the month. For more information or to register online, visit http://give.childrensal.org/barnbash or “Boots & BBQ Barn Bash” on Facebook. Admission is $60 per person and $500 per table. For sponsorship information, contact Kerrie Benson, the Gulf Coast coordinator for Children’s of Alabama, at Kerrie.Benson@childrensal.org.

Camp I Believe Supports Children Through Grief Process

When a child is grieving the loss of a loved one or friend, it is important for them to know that they are not alone with their grief. Gentiva Hospice has developed Camp I Believe, an overnight camp to help children ages 6 – 15 years old deal with their feelings and become empowered to cope with the loss of their loved one. The camp will be held September 12-13, at Camp Baldwin in Elberta, AL. The campers are able to attend camp free of charge through funding provide by the Gentiva Hospice Foundation.

Camp I Believe is a two day camp where children can learn to express grief in a healthy, safe environment. Our professional staff and trained volunteers include social workers, spiritual care coordinators, nurses, recreational therapists and bereavement specialists. Campers will be encouraged to not only reflect, but to laugh and play again. The beautiful grounds of Camp Baldwin allow children to heal through nature and a variety of fun activities which include fishing, swimming, kayaking, canoeing, arts and crafts, field games and much more. Camp I Believe is currently seeking campers to participate in the camp. We are also seeking supply donations and volunteers. If you or a friend would like more information, please visit www.gentiva.com, or call or email Kim Smith at Gentiva Hospice, at 251-621-2500, or Kimberly.Smith1@gentiva.com.

10

O

S t fro J T

The eight-annual “GO” for Gynecologic Oncology, a 5K and one mile Fun Run/Walk presented by Catranis Family Charitable Foundation, will be held September 19, at 8 a.m. at the University of South Alabama Moulton Tower & Alumni Plaza to benefit gynecologic cancer research at the University of South Alabama Mitchell Cancer Institute (MCI). The GO Run includes prizes, music, vendor booths, food, and children’s activities.

Register online at www.usamci.com/gorun or in person at McCoy Outdoor, Run-N-Tri in Mobile or at Running Wild in Fairhope. For info regarding the GO Run contact the USA Office of MCI Development at 251-460-6209 or visit www.usamci.com/gorun.

Mobile Bay Parents I September 2015

sh LL jo th

www.mobilebayparents.com

s

f al st s We

n r

will n,

2015 Leukemia Cup Regatta

The Leukemia & Lymphoma Society’s (LLS) Alabama/Gulf Coast chapter is proud to announce its 2015 Leukemia Cup Regatta, setting sail to raise funds to support blood cancer research and patient services. Local sailors and friends will raise funds in honor of local leukemia survivor, Shephard Hall, of Daphne. This year’s race will be held on September 19th at the Buccaneer Yacht Club. The race will begin at 11:00 a.m. on Saturday. All are also invited to the race pre-event at the Buccaneer Yacht Club on Friday, September 18. This event will include a silent auction, live auction, Calcutta auction and a brief presentation by Shephard Hall and family. Tickets to this event can be bought at the door for $25. Doors open at 6:00 p.m. In addition to raising funds for the mission of LLS, participants will enjoy the time spent with their honored skipper, Shephard Hall. Shephard’s mom, Brady Hall, states their involvement with LLS perfectly when she said, “When Shep was diagnosed, we knew we would have opportunities to share our faith and how the Lord has been with us every step of the way. The Regatta is just another opportunity for us to share our story while at the same time allowing LLS to move one step closer to finding a cure. We are impressed with how much effort LLS is putting forth in finding a cure for blood cancers. No parent should have to watch a child suffer with cancer. It’s been a difficult journey we wouldn’t wish on anybody. Though we wouldn’t trade our journey for anything, our prayer is that a cure will be found so that others will not have to suffer.” Visit www.leukemiacup.org/al to learn more about the Regatta series or to register for the event.

Laissez Les Bons Temps Rouler Pour UCP

On Thursday, September 17, United Cerebral Palsy (UCP) of Mobile will host its 6th annual Food and Folly event. The doors open at 6:30 p.m. at the Fort Whiting Armory (1620 South Broad Street, Mobile). Our FOOD will be provided by some of the best local restaurants and chefs as they will present their favorite dishes for guests to sample. The FOLLY will consist of live music from the Excelsior Band, a unique Mardi Gras procession featuring Chief Slacabamorinico and the Joe Cain Footmarchers. In addition, there will be a wine grab, silent auction, and wine tasting.

Tickets are on sale now for $35 per person or $60 per couple. Don't miss out on the opportunity to have a great night out while supporting the many important programs of UCP! For more information, please contact Kenneth Sheets at 251.479.4900 or via e-mail atksheets@ucpmobile.org.

m

d

a d sh n,

om

BECAUSE YOUNG BONES ARE DIFFERENT THAN OLD BONES. We have a Doc for that.

DR. HANDWERGER For a 1st or 2nd Opinion.

410-3600 • alortho.com

11

www.facebook.com/mobilebayparentsmagazine

T

F

T

Children’s Cup Regatta Benefits Children’s of Alabama Patients

GulfQuest Grand Opening

On September 26, the world’s only maritime museum dedicated to the historical, cultural and economic significance of the Gulf of Mexico will open to the public.

Located on the Mobile River, this handson museum will become only the second interactive maritime museum in the United States. With 90 exhibits, a museum store, a museum café and event space, GulfQuest is a 120,000 square foot museum designed to look as if it were a ship headed into Mobile Bay and the Gulf of Mexico. Six years after the building’s groundbreaking in April 2009, GulfQuest will become a major educational and tourist attraction for Mobile, the Gulf Coast and Alabama. Early projections indicate GulfQuest will draw more than 300,000 visitors per year.

“Beyond its focus on the Gulf of Mexico, GulfQuest will be unique among maritime museums in that it features interactive exhibits, simulators and theaters, complemented by artifacts and memorabilia,” Tony Zodrow, GulfQuest executive director said. Within the building, GulfQuest’s exhibits are housed inside the stern of a full-sized container ship, displayed as if dockside.

Hours of operation are Tuesday – Friday, 9 a.m. to 5 p.m.; Saturday, 9 a.m. to 6 p.m.; Sunday, 11 a.m. to 6 p.m. GulfQuest will be closed on Mondays. Admission prices are; Adults (18-64) $18, Youth (13-17) $16, Child (5-12) $14, Seniors (65+) $16. Groups of 15 or more are eligible for discount rates. Children under 5 will be admitted free of charge. An adult must accompany all children/youth. Admission prices do not include sales tax. www.gulfquest.org.

Mobile Rotary and Goodwill Easter Seals Send Children and Adults to Camp ASCCA

The sixth annual Children’s Cup Regatta sets sail on October 10, to benefit patients from the Alabama Gulf Coast treated at Children’s of Alabama. Sailing enthusiasts and friends in Mobile and Baldwin counties are invited to enjoy a day of sailboat racing at the Fairhope Yacht Club, located at 101 Volanta Ave. A family-friendly event, guests are invited to watch the races free-of-charge beginning at 12:30 p.m.

The kids activity area opens at 4 p.m. and features a waterslide, arts and crafts, games, and a chance to paint with Fairhope artist Ricky Trione. Throughout the afternoon, guests can bid on silent auction items and enjoy barbecue plates, a cash bar, and live music from Doc Rogers and the Rock Dodgers. The awards ceremony begins at 7 p.m.

The entry fee for Performance Handicap Racing Fleet, Portsmouth, Rhodes 19 and Catalina 22 is $50 per boat. Youth Class entry fee is $25 per boat. Children’s of Alabama patients and their families in the area are invited to attend the Regatta. A few boats will be available to take former patients out to watch the sailing action close-up. The youth portion of the Children’s Cup Regatta is known as “Katie’s Cup Youth Regatta” in honor of Katie Hamlin of Fairhope. As a 16 year-old Bayside Academy honor student and soccer player, Katie was diagnosed with a possible staph infection in May 2009. After falling sick a few weeks later, she was induced into a coma and put on a ventilator. She was diagnosed with acute respiratory distress syndrome and transferred to Children’s of Alabama. After seven months of treatment, Katie was able to return home and is now a walking, talking miracle. Katie will be in attendance at this year’s Regatta. For more information or to register online, visit http://childrensal.kintera.org/childrenscup, or call Kerrie Benson at (251) 610-4969. Event updates will be posted regularly to facebook.com/ChildrensCupRegatta. Day-of registration is available from 9-10:30 a.m. on Oct. 10 at the Fairhope Yacht Club.

Auditions for “Secret Garden” and “Elf, Jr.”!

For the 31st year, 100 local children and adults with disabilities departed from Goodwill Easter Seals’ Gordon Smith Campus in July for a week-long camping adventure sponsored through a generous donation from the Mobile Rotary Club. Campers attended Easter Seals’ Camp ASCCA (Alabama Special Camp for Children and Adults), the largest barrier-free camp facility in the nation. Located in Jackson’s Gap, Alabama, on Lake Martin, Camp ASCCA offers campers a wide variety of recreational and educational activities.

Camper activities include horseback riding, fishing, tubing, swimming, environmental education, arts and crafts, canoeing, a "splash pad," outdoor adventure elements such as a zip-line, and much more.

Campers of all abilities can participate in everything from water skiing to horseback riding. The Mobile Rotary Club has been a long-time financial sponsor of the event. Goodwill Easter Seals coordinates the trip each year and sends support staff to assist the campers and staff of Easter Seals’ Camp ASCCA. For more information on Goodwill Easter Seals of the Gulf Coast, please visit www.gesgc.org.

Mobile Bay Parents I September 2015

Sunny Side Theater will hold auditions for its annual Fall Production “Secret Garden” August 31 and September 2 at 7p.m. Join us for this classic retelling of a lonely orphan, her new friend and the magic of their imaginations giving life back to an old garden. Based on the book by Frances Hodgson Burnett, this is a great chance for novices and more advanced actors to have their time to shine on the stage. Sunny Side Theater will also be holding auditions for “Elf, Jr.” October 5, 6 and 7 at p.m. Based on the beloved holiday film, this hilarious fish-out-of-water comedy follows Buddy the Elf in his quest to find his true identity. Anyone interested in auditioning should come on one of the audition nights to at the Azalea City Center for the Arts, 63 Midtown Park East prepared to read from the script. For information, call Owner/Director Chris Paragone at 251-510-1808.

12

www.mobilebayparents.com

u

se

c in in

e sts m. s

oc m.

25 a ke h h de h s s to ble n er e o e

Local Events Raise Funds for Mobile’s Ronald McDonald House

Through a labor of love Mobile’s Ronald McDonald House opened its doors in 2000. Built on the simple idea that nothing else should matter when a family is focused on the health of their hospitalized child – Mobile’s Ronald McDonald House and Ronald McDonald Family Rooms allow families around the Gulf Coast and even across the United States to focus on what matters most and stay at our ‘home away from home’.

The person instrumental in bringing a Ronald McDonald House to Mobile was Gray Zimlich. At 10 years old, Gray and David Zimlich’s son, Day, had a brain tumor and they stayed in the Ronald McDonald House in Boston while receiving treatment. After a two-month stay, on the flight home to Mobile, Day asked his mother if they could build a Ronald McDonald House in Mobile— and she promised him she would make it happen— and did. Fifteen years later, Mobile’s Ronald McDonald House has been a “homeaway-from-home” to more than 6,000 families.

It is because of the generous support of the community that we can provide a supportive home environment to these families. From businesses and organizations volunteering to prepare a home-cooked meal, schools collecting “wish list” items, to friendly volunteers offering a smile to our families as they enter the door, it is truly “The House That Love Built.” You can learn more about how to lend a hand to families of Ronald McDonald House Charities of Mobile by attending the upcoming Volunteer Open House on Thursday, October 1, 5:30 p.m. at Ronald McDonald House located at 1626 Springhill Avenue, Mobile.

Gather your friends and family to support our fundraisers – including the upcoming ‘Girls Just Wanna Have Fun’ benefit set for Thursday, September 10 from 5:30 –9:00 p.m. at the Alabama Cruise Terminal.

High school students also donate their time through the Red Shoe Krewe (RSK). Local student Julie Rensink commented, “Being selected for the Red Shoe Krewe (RSK) my sophomore year has given me an experience that I will never forget.” The Red Shoe Krewe is a group of Mobile County’s juniors and seniors who dedicate their time to help around the Ronald McDonald House making each families' stay more comfortable. “All of the members meet once each month and during a meeting we put our heads together to come up with fun, stress-free activities that we can do for the parents and children staying at the House. We put on many programs including our biggest event the Bunny Hop held each spring. We all work together striving to achieve the same goal: helping a family in need of comfort” says Rensink For more information on Ronald Mobile House Charities of Mobile, including wish list, other volunteer opportunities and fundraisers please visit www.rmhcmobile.org or call 251-694-6873.

ld ll n” r s ic on or

s

dy n e to s

om

13

www.facebook.com/mobilebayparentsmagazine

KidsHealthWatch

Sponsored by Children’s Medical Group

Hearing Loss Out of the myriad of disabilities that people live with every day, hearing loss may be seen as a less significant problem. However, it can be detrimental to a child’s development if it is not recognized early on. Recognizing hearing loss in a child may seem an easy enough task, but hearing loss is often misdiagnosed, no matter the age of the child.

The first years of life – especially the first two years – are crucial developmental and formative years for children. This is when the brain develops and neurons make new connections at a faster rate than any other time, and it is during this time their personality begins to develop.

The ability to recognize voices and process words and sounds is so important in the beginning. Imagine how much a baby would miss if he or she did not have one of these senses – particularly hearing – during this time. This is why every newborn in Alabama and at least 38 other states require newborns to be screened for hearing before being discharged from the hospital.

There are several types of hearing loss: some are genetic, some are caused by infections during pregnancy or early in the life of the child, and some can occur from something as simple as repetitive ear infections.

Because hearing is so important to the development, it is important to request a hearing screen at any age if you have any reason to think there might be a problem.

Some signs of hearing loss (even mild) vary depending on the age. If your baby doesn’t startle or turn to sounds by three or four months of age, that could be a red flag. If your infant is not babbling (saying “mama” or “dada”) by twelve or fifteen months, you should let your pediatrician know. As your child gets older, if he or she seems to be inattentive, distracted, seems to ignore you at times (sometimes you can have hearing loss only in one ear) or needs music, etc. to be louder than you would expect, these could be subtle signs of a hearing problem as well.

There are many options for treatment, depending on the cause of hearing loss.

Problems caused by ear infections typically call for treatment with tympanostomy tubes.

Hearing aids or cochlear implants may be required if the hearing loss is severe, progressive, or genetic. If the problems occur during the time where they are learning to commu-

nicate, extensive speech therapy could be required to catch them up developmentally, so again, identifying the problem as early in life as possible is crucial.

Often times, a hearing problem can be difficult to identify since it relies heavily on the child’s development and symptoms observed outside of a clinician’s office. Sometimes it can be mistaken for just an irritable or quiet infant, a tantrum-throwing toddler, or an inattentive adolescent that just has “selective hearing.” However, if there is any speech delay identified or any parental concern, a hearing screen is easy to perform and should be done to see if further investigation is needed.

As parents, you are the first line of defense.

You will likely be the first one to notice any problems, so if you start to notice problems that could be related to hearing, be careful, be attentive, and, above all else, be patient.

Jennifer Adair, M.D., was born and raised in Mobile. She graduated from Davidson High School in 2002 and received her Bachelor of Science in Chemistry at The University of Alabama in 2006. She completed her medical training at the University of South Alabama College of Medicine, and pediatric residency at the University of Nevada College of Medicine – Las Vegas and the University of South Alabama. She joined Children’s Medical Group in July 2013 and currently practices at their Airport office.

Jennifer and her husband, Cory, reside in Mobile with their dogs, Fitz and Barkley.

s

d

M

st c da fil w

p

Mobile Bay Parents I September 2015

14

www.mobilebayparents.com

Autauga County Schools

Corpus Christi Catholic School Teachers Host Summer Drama Camp

Junior high teachers, Miss Toni Counts and Mrs. Laura Lynn Lambert hosted a week-long drama camp during the summer.

The students learned stage direction, vocal techniques, and memorization skills, plus they played improvisation games.

In addition, as part of the camp, the students put on a miniversion of “The Wizard of Oz” for family and friends.

, n

e he

or an ve eare d.

.

u-

ma of at d cal fice.

om

Cottage Hill Celebrates New Year

Cottage Hill Christian Academy high school students started the new year with praise and celebration. Students were welcomed, new faculty introduced and expectations established. It was a positive beginning of prayer and dedication that will be part of the beginning of each week.

First Day at E.R. Dickson

E.R. Dickson Elementary students’ summer ended Monday, August 10, as Mobile County Schools began their first day of the school year. Students and parents were greeted by Principal Katryna Kinn, who welcomed students to a new school year. Over 100 teachers and staff were smiling, helping students off each bus as it arrived and assisting students in finding their new classes. The cafeteria was full as students receive free breakfast and lunch daily. Kindergarten parents were walking backwards in the halls as they were filming each minute of that milestone first day of school. Fifth grade students were excited as it was their last first day of elementary school. It was a busy and productive first day at ERD.

St. Mary Catholic Welcomes Newest Faculty Members St. Mary Catholic School welcomes new faculty

members to our school family! Left to right: Katelynn Hanna, middle school math teacher and parish director of youth ministry; Nicki Dean, fourth grade teacher; Mary Keese Finnorn, teacher assistant; and Kortnee Acton, middle school resource teacher.

RCS Eagles Soaring to Higher Heights!

Monday, August 11, was the start of a new year with new beginnings at Revelation Christian School. The students begin each day by giving God praise during their Morning Assembly. What an awesome way to jump start our 10th year of existence!

15

www.facebook.com/mobilebayparentsmagazine

S

C

Autauga County Schools St. Paul’s

Receives 2015 Nappie Awards

St. Pius X Takes it Out to the Ballgame

Despite the grueling heat over 300 St. Pius X parish and school supporters enjoyed a night at the ballgame at Bay Bears Stadium, Monday, August 3. Everyone had a great time supporting their team and school!

Cr

Le

Nearly one million votes were cast in the 2015 Nappie Awards, revealing Mobilians’ favorites in local area businesses, services, arts, cuisine, and more! St. Paul’s Episcopal School was honored to receive the “Best Private School” award and we are very proud of our Kindergarten teacher, Sarah Gross, who received the “Coolest Elementary Teacher” award.

Go Saints!

Please send your school news and photos to: lynn@mobilebayparents.com.

Corpus Christi Catholic School Building the Body of Christ, One Student at a Time .

n g e A wo th Ale for

U

The mission of Corpus Christi Catholic School is to nurture every child by providing opportunities to grow in faith, achieve academic success, and serve others as disciples of Jesus. Established in 1958 by Corpus Christi Parish, Corpus Christi Catholic School provides students in K3 through eighth grade an outstanding education. In addition, the school provides a warm, nurturing environment with developmentally appropriate programs for children aged 6 weeks to 2-years old. For additional information or to schedule a tour, please contact Corpus Christi Catholic School at 251.342.5474.

Corpus Christi Catholic School 6300 McKenna Drive, Mobile, AL 36608 www.corpuschristiparish.com/school Mobile Bay Parents I September 2015

16

www.mobilebayparents.com

C F o

Ea

s d in t K4 sp a o n a W we n a

e h, of us h e h d o c

om

Saraland High School FBLA Members Compete at National Conference

Saraland High School Future Business Leaders of America members Alexis Crane (senior) and Landon McNellage (junior) attended the FBLA National Leadership Conference in Chicago, Illinois this summer.

They won first place at the Alabama FBLA Leadership Conference with the chapter’s Community Service Project for the 20142015 school year, earning the right to compete at the national event.

They attended workshops, networked with students from across the globe, and competed in their competitive event. Alexis Crane led the state as the Alabama State President. Alabama FBLA won first place as the largest contributor to the March of Dimes, raising over $65,000.

Alexis is now presiding as the vice-president for the National Southern Region as well as the Alabama State President.

UMS-Wright Surprises K4 Students with Crayons to Celebrate First Day of School

Each school year, UMS-Wright spends one day delivering large inflatable crayons to our incoming K4 students. This special surprise is a fun way to kick off the start of a new school year at UMS-Wright.

We would like to welcome all of our new K4 families and wish them a wonderful school year at UMS-Wright!

17

www.facebook.com/mobilebayparentsmagazine

Autauga County Schools

St. Paul’s Cheerleaders Win Multiple Awards

St. Paul’s Episcopal School’s Varsity Cheerleaders attended the Universal Cheerleaders Association Camp at the University of Alabama July 21-24.

They were awarded the Overall Trophy for Game Day, 1st Place in Cheer, 2nd Place in Sideline, and 4th in Extreme Routine.

4 Cheerleaders were named All American at the UCA camp and invited to London to perform in the New Year’s Day Parade: Madison Mace, Madelyn Claire Lott, Caroline Dickerson, and Kate Nichols. Go Saints!

d kn en p

t

Summer Camp at St. Mary Catholic School

som a c pa

Under the direction of St. Mary Catholic School's Carmen Tuite, the summer of 2015 brought another fun camp for over 50 students in Pre K3 through grade 6. Activities included swimming, bowling, skating, trips, movies, trips to the Environmental Studies Center, the library, The Visitation Monastery, The Institute for Marine Mammal Studies Center in Gulfport, Bay Bears Games, a Dolphin Cruise in Orange Beach, a boat trip on The Duke in Dauphin Island, and a visit to Five Rivers. Daily activities included crafts, educational activities, cupcake decorating and a pajama party! Pictured, Campers visit The Visitation Monastery in Mobile.

Mobile Bay Parents I September 2015

18

Mi

www.mobilebayparents.com

al 4. er,

d

om

Little Flower School Installs New Fence

Through the continuing generosity of friends and parishioners of Little Flower Catholic Parish, new fencing was installed on the west side of the campus this summer. The attractive black wrought iron fence adds security as well as beauty to the mid-town campus. A portion of the funds for this phase of the fence project came about through money raised at the annual Leprechauns at the Loop. Principal, Alesa Weiskopf said, "We are so pleased to have this new addition to beautify our campus. What a nice way to welcome our students back to school."

Lott Middle School Camp Wildcat

Lott Middle School held its academic bridging program Camp Wildcat on July 2123. Incoming sixth grade students new to the middle school environment spent three days getting detailed instruction on what they would need to know to prepare them for success in the middle school learning environment. Each student was provided with a binder, dividers, paper, and pencil pouches with supplies in it. Teachers worked with students to help them with organizational skills, study tactics, and activities to prepare them for the upcoming year.

Students that participated spent three days getting to know some of their teachers, learning the school rules and procedures, and participating in hands-on activities. Students were able to conduct science experiments in group settings. Students took part in current event assignments where they were encouraged to share their opinions and ideas during the activities.

Much like a college orientation for incoming freshman, students that attended Camp Wildcat will start the year off knowing what is expected of them and be well prepared for Middle School. The students and teachers left Camp Wildcat with excitement for the upcoming year.

19

www.facebook.com/mobilebayparentsmagazine

P

E. Au P

Autauga County Schools

Swim Team Raises Money for Mobile BayKeeper Organization

w

The Oakwood Swim and Racquet Club Stingrays Swim Team raised $800 for the Mobile BayKeeper Organization in their summer Swim A Thon. The Swim Team collectively swam 1732 feet (equal to 8.2 miles) and collected pledges to raise the money for the nonprofit organization responsible for the Oil Spill Clean Up and ongoing health and preservation of the Mobile Bay Watershed.

McGill-Toolen Cheerleaders Host Cheer Clinic

McT Catholic Cheerleaders hosted a clinic for elementary and middle school girls to get ready for the upcoming CYO football season.

Dir of M

Please email School News and Photos to Lynn@mobilebayparents.com by the 7th of the month.

0000067769-01

New friends are now best friends. New experiences are now the best times ever. No wonder it’s so easy to tell others about it and include them in the fun.

Welcome to Riverview Camp for Girls!

We’ve do put Itogether everything you’re looking for in a perfect“I saw camp onemy of Why choose Riverview each summer? mysetting! first river Recognized on a mountain,as I rode Golf,times Dance, Dance, Outdoor Sports, Soccer,use Beach Volleyball, Basketball, “As go,Stomp it was one of the BEST.”Skills AndClass, what child couldn’t some of that these days?

Riverview Refinement, Program, Campfires night,Recognized optional trips and more!

We’ve put together everythingCIT you’re looking for in a perfect every camp setting! as one of the Southeast’s best all-around summer camps for girls, Riverview is an oasis of fun, friends and happiness. Spring and Fall &available 2 week Sessions ages to 16...

Mother-Daughter Weekends1are also!

Registeredfor Nurses and6 Physician on Staff. Entire full-summer staff is First Aid andand CPRFall Certified.

Camper/Counselor Ratio 5:1 Spring Mother-Daughter Weekends...

waiting lists start early...sign up soon!...

Waitingwww.riverviewcamp.com! lists start early...sign up soon!...

Only 1 /Mountain 2 hours from Huntsville Located on top of Lookout in Mentone, AL. Only a 5 hr drive.

1

Call for FREE DVD and catalog 1-800-882-0722 Accredited by American Camping Association • Members of Christian Camping International

K

T co

are de

T ce

c g gi

• R OPES C OURSE • C LIMBING T OWER • O UTDOOR L IVING S KILLS • C AMPFIRE F UN • C OUNSELOR -I N -T RAINING • 20

J “C Hi G

D RAMA

www.riverviewcamp.com

“S

AND

Dr. Larry & Susan Hooks, Owners/Directors • Donna Bares,Asst. Director

1 & 2Week Sessions for Ages 6-16

C RAFTS • C HORUS

first I had campfires every night. Icamps felt close to God. giggled a lot is with friends and counselors. time flew by! thehorse.

Southeast’s best all-around for girls,IRiverview annew oasis of fun, friends andThe happiness...

I Exciting felt safe and secure. Iinclude: gained confidence in myselfPool,Tennis, through the world around me.” activities Riding, Heated Canoeing, Ropes Course, Climbing Tower,

s

AND

FLAG TWIRLING • CHEERLEADING • RIFLERY • ARCHERY • TRIP DAY • GOLF

We don’t wonder anymore how it happened, that one summer could bring such happy memories.

B ASKETBALL • S OCCER • A RTS

• H ORSEBACK R IDING • S WIMMING • T ENNIS • C ANOEING • D ANCE • A EROBICS • G YMNASTICS • B EACH V OLLEYBALL •

Mobile Bay Parents I September 2015

E be p pro is th th t fr pe a ye y PT

www.mobilebayparents.com

ed im .2 fit g

B ASKETBALL • S OCCER • A RTS

•

AND

C RAFTS • C HORUS

AND

D RAMA

•

om

Health and Fitness a Priority at E. R. Dickson

E. R. Dickson Elementary students returned in August and found a number of improvements.

Principal, Mrs. Katryna L. Kinn and Assistant Principal, Dr. Wendy M. Clanton started working together two years ago after being named administrators of E. R. Dickson Elementary School in 2013. In addition to being focused on providing a quality academic program, both administrators believe that providing a quality health and fitness program is equally important. E.R. Dickson received the USDA Fresh Fruit & Vegetable Grant for the first time in 2014-15 and recently applied to continue with the program that provides fresh fruits and vegetables to students twice per week. Discussion between administrators and PTA board members began nearly two years ago about putting in a track around the youth size soccer field. Administrators and PTA board members worked with Mr. Tommy Sheffield, MCPSS Executive Operations Director, Mr. Kenney Holder, MCPSS Supervisor of New Construction, and Mr. Russell Hudson, MCPSS Purchasing Manager to finalize plans.

MAWSS Watercolor Contest Winners

Winners of the 2015 MAWSS “Fun with Water” Watercolor Contest have been selected from more than 525 entries submitted by area students in grades K-12.

This year’s winners are: Overall winner— Noelle Sherer, “Swimming Over the Jellyfish,” Dunbar Magnet School.

9th-12th Grade— Jordyn McLaney, “Curiosity,” Theodore High School. 6th-8th Grade—Alli Leslie, “Upside Down Summer,” Dunbar Magnet School.

3rd-5th Grade— Benjamin Cumpton, “The Water Slide,” Knollwood Christian School. K-2nd Grade— Daltrey LeGros, “Pirate Ship,” Council Traditional School. The annual watercolor contest sponsored by the Mobile Area Water and Sewer System (MAWSS) encourages area students to tap into their artistic side and depict the role that clean water plays in their daily lives.

The winners were recognized at an awards ceremony on August 7 at Bel Air Mall. MAWSS officials presented all winners with gift certificates to mall retailers. In addition, the grand prize winner's school also received a gift certificate. Pictured here Noelle Sherer's artwork, “Swimming Over the Jellyfish”.

Preschool Services Child & Adolescent Services (Education - Residential) Consultation & Training •

• 21

•

•

www.facebook.com/mobilebayparentsmagazine

Autauga County Schools

“Alive in You� at Little Flower School

Little Flower Catholic School welcomed twelve hard-working volunteers from St. Mary Magdalen Catholic Parish in Altamonte Springs, Florida, during one of the hottest weeks of July. The volunteers, participants in "Alive in You", seemed unfazed by the heat as they painted, pulled weeds, set out new plants, and polished areas all across the campus. Alive in You is a Catholic service experience that offers youth an opportunity to grow in their faith, hear motivational speakers, perform service, and take part in praise and worship. There were 200 Alive In You participants in Mobile for the week, coming from areas across the United States. Participants were responsible for the cost of their travel. They were housed at Spring Hill College for the week, and spread out throughout Mobile for their work assignments. "What a joy it was to have Alive in You on our campus this week. Their youthful energy and willingness to help was such a gift to us," said Alesa Weiskopf, Little Flower principal.

K4 Students Make Elephant Toothpaste

Mrs. Williams and her K4 students at Cottage Hill Christian Academy started the year learning that school is fun.

The students discovered that they would be learning many new and exciting things this year like making Elephant Toothpaste with ingredients we have in our

A

Th in w a se fel

kitchens at home.

pre w ti

M W Mobile Bay Parents I September 2015

22

www.mobilebayparents.com

om

St. Pius X Holds Annual Reading Camp

St. Pius X School hosted its annual Summer Reading Camp the week of July 17, for students entering 1st-8th grade. The camp concentrated on reading and math skills and enabled students to complete their summer reading requirement. Pictured are most students who attended the camp along with the camp faculty.

Please email School News and Photos to Lynn@mobilebayparents.com by the 7th of the month.

St. Luke’s Ambassadors Attend Planning Retreat

The St. Luke's Student Ambassadors participated in their second full day retreat at Camp Baldwin working hard to ensure that the Wildcat Spirit is alive and strong this school year. They planned several "surprise" events and challenges for their fellow students to enjoy throughout the upcoming year, filmed a Wildcat Welcome video and prepared great orientation day for the 6th graders who are on the University Campus for the first time this year and participated in team building exercise on the ropes course. No doubt this group is Wildcat Strong!

1st Place - “Best Doc in the Box Clinic” MORE HOURS GREAT DOCTORS BETTER CARE As a "Thank You" for voting us "Best Doc in the Box" stop by our West Mobile clinic on Wednesdays or our Semmes location on Thursdays to receive a FREE B12 shot!

NO APPOINTMENT NECESSARY | WE’RE WAITING FOR YOU.

WEST MOBILE SEMMES SPRINGHILL Mon-Fri 8am-10:30pm Mon-Fri 8am-7:30pm Mon-Fri 8am-7:30pm Weekends 8am-3:30pm Weekends 8am-3:30pm Weekends 8am-3:30pm 23

CITRONELLE SARALAND Mon-Fri 8am-6pm Mon-Fri 8am-7:30pm Weekends 8am-3:30pm Weekends 8am-3:30pm www.facebook.com/mobilebayparentsmagazine

Autauga County Schools Drug Education Vehicle Visits E.R. Dickson

D E an G

T

This week the Infirmary Drug Education Vehicle visited fifth graders at E.R. Dickson Elementary. The Drug Education Vehicle travels to almost 200 sites in Mobile and surrounding counties each year visiting public, private and parochial schools as well as attending community events and special programs educating on the dangers of drugs and alcohol.

St. Pius X Pool Party

McGill-Toolen Students Receive iPads

St. Pius X Strong Parent Group hosted a pool party on Tuesday evening August 11 at Woodland Swim Club to celebrate the start of the new school. Over 100 people attended the event.

McGill-Toolen Catholic Student Government Officers Mark Prendergast, Sean Griffin, Hallett DeMouy and Philip Picard help prepare iPads for students.

All 1200 students at McGill-Toolen Catholic will receive iPads at orientation as part of the school’s new on-toone initiative.

PA Pet ad.qxp_Layout 1 7/20/15 6:05 PM Page 1

Mobile Bay Parents I September 2015

24

www.mobilebayparents.com

co if a v

. s

p y d rt

om

Sea Cadet News

Dunlap Division of the U.S. Naval Sea Cadet Corps received hands-on training during their recent camp out in Bay Minette, AL on July 31, 2015.

Each year the unit holds an end of the year summer pool party/BBQ. This year, the unit’s Executive Officer, ENS Tony Graham, offered his land and time to teach the 43 cadets some outdoor skills. After the cadets, set up camp by installing tents it was time for the training to begin. ENS Graham instructed the cadets in the various methods of fire starting (a much needed skill for chow time) and water purification was taught by taking water from the cattle trough, cleaning it and making the water safe for drinking.

Then it was time for chow, so the cadets learned how to clean and cook wild animals (in this case it was chickens). Later, while sitting around the camp fire the cadets shared their summer trainings experiences. This summer cadets traveled to numerous states for trainings. Those trainings included Navy League Orientation, Recruit Training, Petty Officer Leadership Academy, Marksmanship, Wilderness, Field Ops and Medical Field Ops (medical support in combat scenarios). The trainings listed are just a few that were offered all across the USA by the NSCC this summer.

The following morning, the cadets completed Physical Training better known as “PT”. Nothing like a few pushups to get the heart pumping in the morning!

Then the cadets broke down camp and prepared for the party to begin. As you can imagine, there was food, food, and more food, swimming, volleyball, soccer, and even a large scale “Jenga”. Fun for the whole family! The party ended with an Awards Ceremony to show off the cadets’ accomplishments.

Cadets learn seagoing skills aboard Navy and U.S. Coast Guard ships and shore activities that emphasize patriotism, courage, self-reliance, team work, leadership skills, accountability, military training that builds character, and for some, helping those transiting into a military career. They are even authorized by the Secretary of the Navy to wear Navy uniforms marked with the Sea Cadet Corps insignia. The program is open to the community for young men and women ages 10 to high school graduation with open enrollment year round.

The Sea and League Cadets drill together one weekend a month at the United States Coast Guard Aviation Training Center in Mobile.. Upon completion of training as a Sea Cadet, the young men and women cadets are under no obligation to enlist in any of the armed forces. However, if they decide to enlist, they are usually eligible to enlist at an advanced pay grade. Participation in the Sea Cadets is also a positive factor in the awarding of ROTC scholarships. If you or someone you know is interested in the Sea or League Cadet program and how they may join or by volunteering as an adult leader, visit our Division website www.drdunlap.org or our national website www.seacadets.org. You may also follow our local unit page on Facebook at www.facebook.com/DunlapDivison.

25

www.facebook.com/mobilebayparentsmagazine

Autauga County Schools Three UMS-Wright Students

Named National Merit Finalist

Richard Chapman, Riley Nolan, and Brown Sisson are the three UMS-Wright students who earned National Merit Finalist recognition for the 2014-15 school year. Selection for this prestigious honor is very rigorous and requires outstanding performance on the PSAT, completion of a very detailed application process, and an outstanding SAT score which is consistent with the PSAT score. We congratulate Richard, Riley, and Brown and wish them well at the colleges they have chosen to attend. - Richard Chapman: University of Alabama Honors College; - Riley Nolan: United States Military Academy; - Brown Sisson: Duke University.

sch Ca S o

St. Paul’s Football Player Commits to Air Force Academy

Senior football player, Miller Mosley recently committed to play quarterback and further his career at the Air Force Academy. St. Paul’s Episcopal School is very proud of his accomplishments and looks forward to watching Miller play during the 2015 football season as a Saint!

(m

Inspiring CURIOSITY Nuturing PEACE Fostering GROWTH

Enroll Today!

Our classrooms are structured to enhance personal and academic growth of children.

Call TODAY to register for "A Day in the Life" Experience what the Montessori Method has to offer your child.

University - 513 Georgian Drive • 251-342-5399 Hillcrest - 227 Hillcrest Road • 251-344-8755

Mobile Bay Parents I September 2015

26

www.mobilebayparents.com

e t n

om

St. Mary Catholic School Enrichment Program Focuses on STREAM

St. Mary Catholic School held its annual Enrichment Series the last week of July. The program focused on STREAM: science, technology, reading, engineering, and math for the middle school portion of the program. With Fairy Tales as the theme for the engineering section, St. Mary Catholic School students Ryan O'Donnell, Ashlynn Smith, Kayleigh Johnson, and Thomas Wood proudly display their engineering project, a tower made of toothpicks and marshmallows!

Little Flower School Hosts New Faculty Orientation

The start of the 2015-2016 school year brought many new faces to the faculties at Catholic schools in Mobile and Baldwin Counties. Before the first day of school, Little Flower Catholic School hosted all the new teachers in area Catholic schools for a system-wide orientation session. Gwen Byrd, Superintendent of Catholic Schools; Ginger Koppersmith, Associate Superintendent for Student Services; Pat Arensberg, director of the Office of Religious Education; and others gave presentations to those in attendance. Shown (left to right) are new teachers Joanna Gomes (Spanish at Little Flower School), Rebecca Kudija (language arts at Little Flower School), Ellen Murphy (math at McGill-Toolen High School), Kevin Fitzsimmons (math and science at Most Pure Heart of Mary School), Justin Trawick (P.E. at Little Flower School), and RenĂŠe Cherry (fifth grade at Little Flower School).

27

www.facebook.com/mobilebayparentsmagazine

Autauga County Schools St. Luke’s Students Affect Community in Positive Way

Several years ago Jordan Odom and her family made a trip to Boston where Jordan noticed several interesting signs in the parks where the big dig occurred.

They stood out to her because they did not carry a negative message…Don’t Park Here….No Dogs Allowed…etc. Two months later they visited grandparents in Beloit, Wisconsin. There, Jordan noticed that the parks as well as small areas in the community had actual doors mounted in frames standing alone. Each door was brightly painted and written with positive messages. It was there that Jordan asked her parents, “why are there no Positive Signs at home?”….it was at that moment the idea was born. Sixteen year old Jordan Odom joined forces with two friends from school, Caroline Chestang and Elizabeth Thompson to work on developing the positive signs idea. They determined a positive “ + “ shape expressed their idea the best. Over the course of a year, they developed the content of the signs. They wanted the background to be photos of the area the signs would be posted. Elizabeth Thompson set to work on this. They wanted the message to be positive and include something about nature. Jordan and Caroline set to work on this. They interviewed several sign companies to determine costs, and worked through the mounting material, height, etc.

Eventually, they reached out to Connie Hudson, who forwarded their project to Bess Rich, who then forwarded to the Mayor. Soon the girls were meeting with Parks and Recreation’s, Dan Otto and Matthew Capes. They were approved to put five signs in Medal of Honor Park! Make sure you check this out this month!

The girls are also developing a website in which other communities can purchase their signs, along with a line of t-shirts. "It is amazing to watch how their dreams are becoming a reality, and how with some effort the can make a “positive” impact on our community!" responded Jordan's mother, Angela Odom. Pictured here are the girls after their meeting with Parks & Recreation!

Mobile Bay Parents I September 2015

28

www.mobilebayparents.com

o gr

w Co u C

A

v sc be

e ed. t nts as h hat as es on +“ ed

Cottage Hill Christian Family Orientation

It is GREAT to be a Warrior! Cottage Hill Christian Academy celebrated the start of this school year with a school wide gathering. It was amazing to see the entire Warrior Nation meeting together to dedicate our school year to the Lord and to receive important information. This was a very exciting night as our preschool and elementary students had the opportunity to meet their teachers and drop off school supplies. The middle school and high school students received their schedules and had a wonderful time reconnecting with friends.

This school year will be very exciting as our Middle school students have some amazing electives to choose from including Wacky Science-Science Olympiad, Drum Line, Band, and Robotics. The Elementary students are looking forward to some new sports opportunities such as soccer, Pee-wee football and cheerleading. A growing high school population brings new opportunities to the West Campus and the newly redesigned Charles Lang Football stadium which now offers fans the opportunity to be closer to all the action.

Come join us for a Friday Night game and check us out online to keep up with the Warrior Nation at www.chcacademy.org. Cottage Hill Christian Academy is truly a family and it is great to be a WARRIOR!

ey an

ch s

om

EVERY TIME YOU SEE THIS TAG, REMEMBER THAT AN ALABAMA CHILD IS BATTLING CANCER ... AND RECEIVING WORLD-CLASS CARE WITHOUT EVER LEAVING OUR STATE. Over the past decade, Alabama’s Curing Childhood Cancer tag has raised more than $2.5 million for childhood cancer research and treatment programs at Children’s of Alabama.

If you already have our tag, be sure to renew it at your local Department of Motor Vehicles.

If not, please purchase one when it’s time for a new tag.

Buy a tag. Alabama children are counting on you! curingchildhoodcancer.org

P

t ey

St. Pius X Student Garden

Approximately 100 St. Pius X Parents, parishioners, faculty and alumni gathered together on Saturday, August 8 for a campus clean-up day prior to the start of the 2015-16 school year. Pictured here are volunteers preparing the soil for students to plant upon their return to school August 10. The garden is a sustainable garden with all produce being consumed by students either in the cafeteria or with their classes.

29

www.facebook.com/mobilebayparentsmagazine

U

Autauga County Schools McGill-Toolen Football Players Visit Brother Paul at Hospital

McT Catholic football players and friends visited Brother Paul at Sacred Heart, where he was recovering from a slight stroke. It was good to see Br. Paul and spend some time together! Front row: Student Amelia Wilson, Br. Paul, student Lauren Prescott and alumni Amanda Wilson. Back: Vinny Vialpando, student Wes Megginson, Philip Rehm, Scotty Megginson, John-Henry Caponis and Jack Rooney.

E

a w i

Co

S H a

o c th

St. Paul’s Faculty and Staff Participate in Professional Development Experiences

te s r

St. Paul’s Episcopal School faculty participated in numerous professional development opportunities this summer. Teachers were offered a variety of sessions, including 21st Century Learning Design, OneNote, OfficeMix, Sway, and Skype in the Classroom. All of the sessions focused on how the specific technologies can enhance the learning environment. Teachers created plans for implementing these tools in order to better engage, assess, and collaborate with their students as well as extend their students’ learning beyond the four walls of their classroom.

see 100s of alligators in their natural habitat

m fo br (ri

19500 HIGHWAY 71 SUMMERDALE, AL

Awesome time! Our 5 year old and 1 year old both loved getting to feed the animals.

Amazing experience for our entire family!

Great place! Kids loved it! Especially getting to hold the baby alligator!

visit gatoralleyfarm.com or call 251.946.2486 for fall hours

Co

me

Mobile Bay Parents I September 2015

30

C at S t sc a a

S

Pl

ay

(251.946.2483)

C

!

www.mobilebayparents.com

Sta l o pa Un

d ee a a p y.

g nts

UMS-Wright Student Earns Distinguished Eagle Scout Ranking

Matthew Kiszla, a rising senior at UMS-Wright was honored in July at his Eagle Scout Court of Honor.

The Eagle Scout Court of Honor is held after an Eagle Scout board of review has certified that a Scout has completed all the requirements for the Eagle Scout rank which are: 1) Be active in your troop, team, crew, or ship for a period of at least six months after you have achieved the rank of Life Scout. 2) demonstrate that you live by the principles of the Scout Oath and Scout Law in your daily life.

3) earn a total of 21 merit badges (10 more than you already have). Matthew is following in the footsteps of his two older brothers, Luke '11 (left) and Cameron '09 (right). We are so proud of you, Matthew!

L

m 6 s

om

Cottage Hill Teachers Attend AP Training

Cottage Hill Christin Academy teachers attended the Walton Advanced Placement Summer Institute in Marietta, GA in June to prepare for teaching AP courses this school year. In addition to AP English 12 and AP Calculus, several new AP courses are being offered. The new courses are AP English 11, AP US History, and AP Studio Art. Fran Greenough and Patrick Morris (pictured left) along with Kathy Stabler and Lynn LeFan attended the week long training. In addition to AP course offerings, Cottage Hill Christian Academy partners with the University of Mobile, the University of Alabama, and Troy University to offer dual enrollment courses to students in grades 10 – 12.

31

www.facebook.com/mobilebayparentsmagazine

S

“

Q. I have a question about budgeting. I

give myself and my husband $150 a month each for blow money to be used on whatever we want. I’m upset because he spends all his eating out, then he buys other things he wants that he has no money for. Am I being too stingy?

A. I think you guys are handling your money poorly.

You’re acting like his mother instead of his wife, and he’s acting like a little boy instead of a man. You don’t want to give your husband an allowance and then not be happy when he spends money “he didn’t have” because he went over what you dictated to him. That’s a bad budget process.

The budget process, if you’re the nerd in the family, should start with you writing it all out. Then he sits down with you, has an equal say in the decisions and you two okay it together. He needs to understand that this is you asking him to man-up and be part of the decision-making process, so that

Mobile Bay Parents I September 2015

you can both be in agreement as to what’s best for the family. In one sense, you may not like it at first, because right now you’ve got control of things. But in another sense, I’ll bet you’re pretty tired of carrying the weight of all the financial decision making and being the only adult in the household.

He doesn’t even have to work on all that much. I want you to lay it out, but I expect him to sit down and go over it all with you. You’re not asking him to be an accountant with a pocket protector, but you have every right to expect him to be in on the decisions that are made about your family and your finances!

Q. My husband and I have been following your plan. We just paid cash for our new home after selling the old one, so we’re out of the Baby Steps. But we’ve still got about $50,000 in student loan debt hanging over our heads. We make over $100,000 a year combined, so how would you suggest handling this?

32

A. Whoa, hang on a minute! I think you’re a little confused about the steps in my plan.

You’re not out of the Baby Steps quite yet.

You just got Baby Step 6, which is pay off your mortgage, done ahead of time.

Go back to Baby Step 2, which involves paying off all your debt except for your house, and take care of the student loans. You guys make good money, so it shouldn’t take long at all. After that, if you haven’t already, move to Baby Step 3 and set aside a fully loaded emergency fund of three to six months of expenses. Baby Step 4 is investing 15 percent of your income for retirement, and Baby Step 5 means putting aside money for the kids’ college education — if you have kids. The seventh Baby Step is building wealth and giving.

I hope that helps straighten things out. The good news is you won’t have to fight through a house payment while you’re paying off the student loan debt.

So for now, just get into attack mode and make it disappear. Then, move on to the other steps. Other than getting the sequence a little mixed up, you guys are doing great!

www.mobilebayparents.com

1

F & • • • •

e n. .

or

SEWARD FARMS MAZE “ THE GULF COAST ’S ORIGINAL CORNFIELD MAZE” OVER

10 YEFARS O FAMILY FUN!

SEPTEMBER 26 - OCTOBER 31

MONDAY - THURSDAY: SCHOOL FIELD TRIPS (BY RESERVATION ONLY) SATURDAYS: OPEN FROM 10AM - 9PM FOR THE GENERAL PUBLIC FRIDAYS AND SUNDAYS: CLOSED

AN A-MAZING PLACE TO GET LOST AND HAVE FUN ON A FARM!!

u d

e d

om

FAMILY FUN & ACTIVITIES ze hallenging Corn Ma C • • Pig Races ins Hayride and Cow Tra • Giant Jumping Pillow • Cannons Tube Slide and Corn • Farm Animals & Goat walk • • Field of Fright Pony Rides • Wagon Wheel Café • • Live Music Cuisine in the Coernr : •Candle Light Dinn re… o Souvenir Shop & M •

Fire Pits Area & Birthday Huts (by reservation only) For more information & pricing: www.facebook.com/mobilebayparentsmagazine www.SewardFarms.com or 228-641-3936 33

to sc

ha

Be

Th the

tes firm be

Ta

ing we

Ha “m ish

Jud ma Wr ado

During each visit I asked my child’s therapists about treatment and outcomes, recommendations of what to read, what I might expect, and clarification of my questions. I did the same with my daughter’s teachers and therapists when she attended developmental preschool. I took notes, notebooks full of notes. I was driven by my love for her as well as trying to assure she was physically, emotionally, and psychologically safe.

Parents are natural advocates for their children. We love our children, and we want the best for them.

As a mother of four children, three with special needs, I know how important it is to advocate for my children. There is no one who will be more committed to making sure my children have access to the support, treatment, and education they are guaranteed more than me.

My youngest daughter was my second child to be diagnosed with special needs (each of my kids have different special needs). I was at first overwhelmed by my lack of knowledge and intimidated by how to best advocate for what she would require in school, when I did not yet know myself. I chose to dive in. Great hope impelled me.

First steps: accept your child’s diagnosis and become the expert about it. Gather information about your child’s special needs diagnosis, recommended remedial techniques, and treatment. Learn all you can about your child’s special needs. Break the information into terms that you can understand. This will help others appreciate your child’s special needs when you share the information with them.

I needed to fully comprehend my daughter’s diagnosis and the recommended care and treatments (therapies). I felt I would be a far more effective advocate for my child if my knowledge about my child’s special need bordered on encyclopedic. I fast-tracked my education. I purchased books, highlighted passages, and wrote in the margins where I required further clarification, discovered something I desired to learn more about, or wanted to share with others. I went online to reputable websites and printed out articles.

And similar to my expanding collection of books about my daughter’s special needs, I highlighted passages and made notes in the margins. I created an impressive section of resources in my personal library about each of my kids’ special needs.

Mobile Bay Parents I September 2015

Become über-organized.

I purchased two 3-inch, 3-ring binders and index pages with pockets. One binder contained written records-sections for my child’s initial diagnosis and follow-up reports; therapy goals and therapy progress reports; copies of bills; medical paperwork; IEPs (Individualized Education Plans)--the original and future updates; and teacher emails, notes, and cards, etc. The other binder was my personal “education primer.” It held 3-holed college lined paper full of my journal entries; questions and the answers to them; definitions of terms--technical and layman; and highlighted recommended resources; and the printed articles about the diagnosis my child had been given. I dated every paper that went into both binders.

Learn about your child’s rights.

Legally, children with special needs are entitled to an “appropriate” education. Your child should have access to “specially designed instruction” (20 U.S.C. §1401) to meet their unique needs. Learn what this means for your child.

Become competent about the “rules of the game.” Research and understand your state’s and the federal education laws and regulations. These federal laws apply to children with special needs: 34

www.mobilebayparents.com

* The Individuals with Disabilities Education Act (IDEA) http://idea.ed.gov * The Americans with Disabilities Act (ADA) http://www.dol.gov/dol/topic/disability/ada.htm * Section 504 of the Rehabilitation Act of 1973 http://www.hhs.gov/ocr/civilrights/resources/ factsheets/504.pdf

Do a search in your library or online to learn about cases similar to your child’s to answer your questions. Be informed about the procedures you must follow in your school to protect your child’s rights and yours.

Print the legal rights, regulations and procedures out. Add these to the binder that has your child’s diagnosis information.

Be prepared.

Build healthy relationships with your child’s team--therapists, doctors, and school.

This encompasses preparation and planning for meetings with your child’s doctors, therapist, and teachers and aides. Be polite, firm, and persistent.

Create a meeting agenda with your objectives: items such as addressing issues or test scores, clarifying treatment or goals, identifying problems, proposing solutions, or to firm up agreements. Focus on solutions. Share this ahead of time with the team members you are meeting with. This allows them to be prepared as well.

Take care of yourself.

Parenting a child with special needs is challenging, sometimes downright exhausting. We moms typically give and give, until there is little to nothing left to give. And then we find we cannot be the parents we wish to be for our kids.

Give yourself permission to put yourself first for a minimum of an hour each day.

Have someone you trust watch your child if she or he is at home while you embrace “me” time. Take a walk; sit in silence, garden, or do yoga. Do something that will replenish your mama stores and bring you back to balance. MBP Judy M. Miller is a freelance writer living in the Midwest with her husband and four children. She is a Gottman Educator and the author of What To Expect From Your Adopted Tween, a guide for adoptive parents, and Writing to Heal Adoption Grief: Making Connections & Moving Forward, a workbook for older adopted teens and adopted adults.

nmy

y

s

d

ried

h

om

35

www.facebook.com/mobilebayparentsmagazine

Calling Kids to the Kitchen

Recommending the Best Toys and Products for Kids

When a child begins to show the markings of a young chef, it’s important to foster that interest early! Before the ease of prepackaged treats and the accessibility of convenience food sings its siren song, introduce kids first to the pleasures and rewards of real cooking. From prepping the mix and crafting the plate to consuming something delicious that they made by themselves – engaging a child’s interest in the kitchen is a great recipe for cultivating their nutritional education and expanding tastes. The following items are recommended early introductions to cooking for the kids with culinary interests!

by Gerry Paige Smith

Curious Chef 16-Piece Cupcake Set

Moose Toys Chocolate Bar Maker

There are no half measures when it comes to cooking with Curious Chef. This 16-piece Cupcake Set includes a 6-cup muffin tin, frosting decorator, 6 frosting tip designs, 6 silicone cup liners, frosting spreader, stickers and more that quickly move a little chef straight to the business of cooking.

With a shopping list included, young foodies can tailor their recipe choices to their own taste as they plan their cupcake menu. This set features real dishwasher-safe cooking implements that are made with kids’ size and safety in mind. If your kid’s mind is on food preparation, foster their culinary interest by giving them the tools to have a hand in the cooking as well!

Young confectioners get an easy introduction to candymaking with this Chocolate Bar Maker set that lets them remake favorite chocolate flavors into their own signature taste combinations and styles. Using a microwave to melt their favorite chocolate, little hands can then squeeze the soft medium into the shapes of their choice.

They also have the option of adding their own toppings, wrappings, stickers and more to give their own creative touches to the sweets they craft. Ideal for the budding chef with a sweet tooth, the Moose Toys Chocolate Bar Maker is a sweet start for little chocolate lovers with big ideas!

(Easy Chef)

(Curious Chef)

YayLabs Play and Freeze Ice Cream Ball

Easy-Bake Ultimate Oven

There’s nothing that tastes quite as authentic as homemade ice cream.

For the younger set, waiting for the traditional ice cream churn is the real challenge. Enter YayLabs’ Play and Freeze Ice Cream Ball that keeps kids engaged in the process from start to delicious finish. Just add the ice cream mix in one side, ice and salt in the other, lock it down and get the ball rolling. Kids passing, flipping, spinning and shaking the ball generates the movement needed to activate the icing process which takes about 15 – 20 minutes. Time flies (and ice cream freezes) while you’re having fun! It needs no electricity so it’s perfect for young chefs to take along to the beach, on camping trips, picnics and more! The best homemade ice cream is on a roll with the Play and Freeze Ice Cream Ball.

The new Easy-Bake oven gets a big makeover with a sleek new design, more safety features and a cosmetic overhaul that makes it appealing to chefs of all ages.

Simply whip of a batch of cookies with the included mix, then shape and set them on the small baking pan. Once the oven is preheated, just slide the pan into the slot on one side using the pan tool. When the cook time is complete and the cool down period finished, your pan of delicious cookies can be removed from the slot on the other side. Refill mixes and additional tools are available from Easy-Bake as well. Nostalgia for the heat lamp ancestor of this popular kids appliance is quickly replaced with fresh appreciation for this all new cooking tool that makes kids’ baking easier than ever.

(YayLabs)

(Hasbro)

Paige Smith is a freelance writer and syndicated columnist living in Alabama. More on GET THIS! at www.PageBookMedia.com.

Mobile Bay Parents I September 2015

36

www.mobilebayparents.com

fen sw sur tha en info Tw

wh sta of mis for Ba you ch po ba on

the mo the esp bre pa tha cre som

wh me ch the pre wh inti

ou cu Jus are

e. po t for

mp h

om

Becoming Mindful About Photos Social media has become the new back fence, a place where parents can tell stories, swap tips and even brag a bit. A recent survey from the Pew Research Center found that moms, in particular, give and get lots of encouragement as well as useful parenting information from networks like Facebook, Twitter, Pinterest and Instagram.

Almost all of these efforts involve photos which would be great if those photos would stay put. Unfortunately, they don’t. Photos of cute kids—especially babies—have been misappropriated by people who use them for their own, sometimes dubious, purposes.

Baby role playing, for example, involves young women who use random photos of children to fantasize about motherhood. By posting pics and inventing details about babies they don’t now, they attract attention on social media.

In these so-called digital kidnappings, the child may not be in physical danger. Still, most parents find it disconcerting to see their child’s face in someone else’s fantasy, especially if there’s a preoccupation with breastfeeding or bathtime. In other cases, parents have stumbled across familiar photos that have been used in advertising or to create memes, those Internet placards that sometimes take on a life of their own.

Obviously, people vary a great deal in what they feel comfortable saying on social media, and parenthood doesn’t necessarily change that. Some new parents find that they are very protective about a baby’s online presence; others become Mommy bloggers who build a loyal following by chronicling intimate details about domestic life.

All parents should, however, think seriously about what impact a post that seems cute today may have on a child in the future.

Just as couples need to negotiate what they are willing to share on social media, parents

must also try to imagine how a child will feel when he or she is an eye-rolling eight year old, an easily embarrassed teen or a young adult looking for a job. How can parents balance the benefits of social networking with its risks? Here are a few tips.

Use privacy settings. The report from Pew found that parents typically had 150 friends on Facebook, and of those, one third were “actual” friends. Consider sharing photos of kids only with those friends. Most social media sites make it easy to establish different groups within your FB community.

(Details about setting privacy settings for the main social media venues are available at socialmediaexaminer.com/social-media-privacy-settings/.) Go through your network and think about whether your relationship is close enough to share details about your child.

Grandparents, other family members, close friends? Absolutely! Colleagues, associates and friends of friends. Probably not.

Share your reshare policy. Even if you are careful about privacy, photos can escape your network if they are reshared. To discourage resharing, remind friends and family that photos are “for your eyes only.” Talk to other parents, too. Explain your concerns about over-sharing and ask that they not post photos of playdates and other outings without your permission. Extend the same courtesy to them.

Use a nickname. Instead of using your child’s real name, use a pseudonym. This makes it harder to connect an escaped photo with your family. It will also spare your child the embarrassment of having baby pics show up when someone Googles them in the future.

Make copying difficult. A few techniques will make it harder for people to use your photos for other purposes. Try saving photos with the lowest possible resolution.

Not only will the file transmit more quickly, but it will also be blurry if someone tries to enlarge it. Parents can also borrow a trick from professional photographers by putting a signature or watermark on photos. Visualwatermark.com is one of several free services that make it easy to brand digital pics.

37

No naked pictures. Ever. No matter how cute or innocent they may seem, naked pictures should not be posted online. Even if you don’t attract the attention of a predator or run afoul of the obscenity standards on your social network, you run the risk of distributing a picture that will be used to harass your child in the future.

Use an alternative album. Some parents use social media as a kind of baby album, keeping track of firsts as they happen. Really important photos deserve better protection. Try making albums on password protected sites like Flickr or Photobucket.

Share passwords only with family members and other trusted friends who really want to see all your great photos. Back up photo files in the cloud and on a separate hard or flash drive. For photos that really matter, consider making prints or photo books which are likely to last longer than any digital format.

Be selective. Taking digital pictures is sooooo easy. Be ruthless about culling your photos. Review and delete at least once a week. And only share photos that are special in some way. Close-ups with only a few props tend to be more interesting, and they also make it harder for strangers to identify your child or locate your home.

Post vacation pictures after you return home so people won’t know when your house is unoccupied. **Now that every cell phone includes a camera, parents also need to think about when photos are an intrusion. Yes, childhood is fleeting and a photo can help you remember. But photos can also turn you into an observer instead of a participant, especially if you are thinking ahead to the number of “likes” a photo will get on social media. Instead of reflexively reaching for the camera, get in the habit of asking whether a photo will deepen—or interrupt— a special moment with your child.

Carolyn Jabs, M.A., raised three computer savvy kids including one with special needs. She has been writing Growing Up Online for ten years and is working on a book about constructive responses to conflict. Visit www.growing-up-online.com to read other columns. @ Copyright, 2015, Carolyn Jabs. All rights reserved.

www.facebook.com/mobilebayparentsmagazine

Ta is a pra ide thi

Ta tive pe ho rem

Tim ca un vis mu tim on mu yo wh ite the

Gr ing off ten ne the inv

by Varina Mead

Understanding social cues and forging new friendships can be challenging and scary for special needs children. It is the very personal interaction between two people that has the potential to cause anxiety. Helping your child build social skills will help with family relationships, peer/classroom interaction, and their future jobs. Social skills help us positively bond and interact with those around us and is a “language” that children learn differently.

Here, we will go over some of “the rules” associated with social skills, as it relates to special needs children, and how to encourage these interactions. Patience, persistence and encouragement is key!

The Do’s

Eye Contact: Eye contact is used to convey listening and value. Everybody likes to be heard, and eye contact helps Mobile Bay Parents I September 2015

reassure the speaker that he or she is being listened to! Below are some methods used by families and professionals to help encourage eye contact when working with children: The sticker method: Place a sticker on your forehead. Sit down at eye level with the child and engage them in eye contact, even if only building up to 60 seconds.

Encourage them to continue to look at the sticker as long as they can. Once you feel your child has become more comfortable looking at the target, you can begin to involve conversation.

Puppets: Puppets are a fun and nonthreatening tool that can be used to help develop eye contact when held near your face. This encourages the child to interact with an object with the goal to lead up to making eye contact with you while you 38

talk. Having your child talk to a picture of a person may be helpful as well, possibly making it less intimidating.

Another tool can be to use social outings to “people watch” and/or watch television with your child while pointing out the social skills you are working on. Drawing attention to two individuals, who are looking at each other’s faces while talking, can help reinforce the lessons you are trying to teach.

Make a big deal out of it. When your child is able to maintain eye contact for the desired amount of time, rewards work best!

You can verbally reward the child such as “Way to look my way!”, a high five, or a treat such as a sticker, M&M or whatever currency your child will respond to. Just make sure that you convey how proud you are of them (all while making eye contact, of course)! www.mobilebayparents.com

Taking turns: Taking turns when talking is a skill learned in real life that needs real practice. Below, you will find some helpful ideas for helping your child understand this process.

Talking Stick: A talking stick is an old Native American tool used for speaking. One person has the opportunity to talk while holding the stick, while the others must remain silent.

Timers: An hourglass or other visual timer can be a useful tool when helping children understand the dance of language. The visual cue allows the child to see how much time they have to talk, or how much time the other person has to talk. While one person is talking, the other person must practice their listening skills. Should you feel your child may become anxious while waiting, consider use of a soothing item or “stimming” item to help alleviate the anxiety until it is their turn.

Group stories: This can be a fun, entertaining and very easy tool. One person starts off a story (keeping it limited to a few sentences); then “passes the story off” to the next person, who adds more to the story; then on to the next person! Everybody involved would have to have a clear un-

derstanding that it is a fun “game” and that nobody can get mad if the story doesn’t go the way they want it to. Keep it silly and fun. This can be a wonderful game to play while in the car or waiting at the doctor’s office or at your favorite restaurant.

Board games: This is a fun activity for everybody that encourages taking turns.

Certain toys such as building blocks can encourage teamwork as you work on building something together!

The use of a social story: “Using social stories at home and in therapy are a perfect way to address possible social situations, which may arise in a child’s day-to-day life. By role playing or reading a social story, the child can work through these situations and learn how to react or handle possible social problems, such as bullying, understanding body language, or classroom etiquette. The use of social stories is not limited to the Autism Spectrum population. These social stories are beneficial for any child with difficulty in social relationships, attention, or classroom participation,” states Caroline Stough, Speech Pathologist with Easter Seals Central Alabama.

There are a wide variety of social stories available through many books

and websites. You can also learn how to create your own unique social story for your unique situation. At the bottom of this article, you will find some helpful websites and books to help you identify the social story that may fit your child’s need.

The Don’ts:

Don’t criticize. Your child is learning a new skill. Although it can require a great deal of patience, understanding, and perseverance on your part, make sure to keep any frustrations you have “in check”. Criticizing your child can lead to self-consciousness, inappropriate behavior, and resentment. Try to find ways to encourage yourself as well as your child!

Don’t look away. For busy parents who are cooking dinner, going through mail, on the computer or involved in other numerous tasks, be mindful of making eye contact every time you interact with your child.

Try not to yell down the hall or speak to them while loading clothes into the dryer.

Be sure to look at your child when they are talking to you, and have them look at you (as much as possible). MBP Varina Mead is the Director of Marketing at Easter Seals Central Alabama.

of y

out w-

g, y-

ld e! s

r

ou t,

om

39

www.facebook.com/mobilebayparentsmagazine

GENERAL RESOURCES James D. Sears, EdD, JD

(ad on page 5) Special Education Attorney Law Offices of Sears & Sears, PC 7096-B Stone Drive, Daphne (251) 621-3485; searsandsearslaw.com James D. Sears has over 45 years’ experience in the field of special education. The Law Offices of Sears & Sears, PC assists families in navigating the educational system to ensure the best education for the child who has special needs. No representation is made that the legal services to be performed are greater than the quality of legal services performed by other lawyers.

Access To Recreation 8 Sandra Court, Newbury Park, CA. (800) 634-4351; www.accesstr.com Provides exercise and recreational equipment for people with disabilities.

with special health care needs to participate fully in school.

3. Vocational Rehabilitation Service (VRS) 2419 Gordon Smith Drive, Mobile (251) 479-8611, Toll-free number: (800) 671-6842, TTY: (800) 499-1816. Vocational Rehabilitation Service (VRS), the largest division within the Alabama Department of Rehabilitation Services, helps Alabamians with disabilities achieve independence through employment. VRS provides specialized employment- and education-related services and training to assist teens and adults with disabilities in becoming employed. In addition, VRS works with middle schools, high schools, junior colleges and universities statewide to assist students with disabilities in receiving appropriate educational opportunities.

4. State of Alabama Independent Living / Homebound Service (SAIL) 2419 Gordon Smith Drive, Mobile (251) 479-8611, Toll-free number: (800) 671-6842, TTY: (800) 499-1816 The State of Alabama Independent Living / Homebound Service (SAIL) provides specialized in-home education and

Mobile Bay Parents I September 2015

American Speech-Language-Hearing Association (256) 325-8885 (Alabama contact); www.asha.org, www.alabamashaa.org ASHA is committed to ensuring that all people with speech, language, and hearing disorders receive services to help them communicate effectively.

Bay Area Clinical Associates, LLC Catalina M. Arata, Ph.D., M. Hope Jackson, Ph.D., Ellen L. Odom, M.S., L.P.C 2864 Dauphin Street, Suite A, Mobile, (251) 470-7607 www.bayareaclinical. com, bayareaclinical@bellsouth.net At Bay Area Clinical Associates, LLC, we specialize in a variety of areas and services for Mobile and the greater region of southwest Alabama and southeastern Mississippi. We provide psychological assessment and treatment to families, adults, adolescents and children with a variety of problems. Children ages 5+, Adolescents, Adults, Couples and Families. We specialize in issues of anxiety, depression, adjustment issues, grief, school-related difficulties, eating disorders and Post-divorce issues. Psycho-educational testing for ADHD, LD, and Gifted.

Alabama Council for Developmental Disabilities RSA Union Building, 100 North Union Street, Montgomery (334) 242-3973, (800) 232-2158; www.acdd.org Our Mission is to promote and support independence, advocacy, productivity and inclusion for Alabamians with developmental disabilities. ACDD is dedicated to the vision that all Alabamians, regardless of disability, will live, learn, work, and play in inclusive communities.

Alabama Department of Rehabilitation Services 602 South Lawrence Street, Montgomery, 36104 (334) 293-7500, (800) 441-7607; www.rehab.alabama.gov Unique in the nation, the Alabama Department of Rehabilitation Services is comprised of state and federal programs that provide a continuum of services from birth through life for Alabamians with disabilities. ADRS has four major programs: 1. Alabama’s Early Intervention System (AEIS) 1610 Center Street, Suite A, and Mobile (251) 439-7890, Toll-free number: (800) 543-3098 or TTY (800) 499-1816. A division of the Alabama Department of Rehabilitation Services, Early Intervention provides supports and services for infants and toddlers birth though age 2 (0 to 36 months of age) who have a medical diagnosis that can delay normal development or who have a developmental delay causing the child to not meet developmental milestones. Early intervention supports and services focus on teaching the parents and other caregiver’s ways to help the child learn and participate in everyday activities.

2. Children’s Rehabilitation Service (CRS) CRS District Office 1610 Center Street Suite A, Mobile.

(251) 432-4560, Toll-free number: (800) 879-8163, (800) 499-1816 Children’s Rehabilitation Service (CRS) is a statewide organization of skilled professionals providing quality medical, rehabilitative, coordination and support services for children with special health care needs and their families.

Every county in Alabama is served through a network of 14 community-based offices. This network provides specialty clinic and other services by physicians, nurses, social workers, physical therapists, speech-language pathologists, audiologists, occupational therapists, registered dietitians, secretaries, and administrators. CRS staff members also work closely with local school systems to enable children

Alabama Scottish Rite Learning Center (205) 365-1640; www.alsrlcenter.org We are happy to serve as consultants to teachers of students whom we have evaluated and who have been determined to be experiencing dyslexia, language-learning disabilities, or severe speech or language disabilities. We will work collaboratively with teachers and other members of the IEP team to develop goals and benchmarks necessary to assist students in reaching their academic potential.

We will also provide teachers with in-service training in the areas of identification and remediation of dyslexia, inservice training in the areas of language-learning disabilities and severe speech or language disabilities. Free Testing of speech and language disorders such as dyslexia.

counseling, attendant care, training and medical services to Alabamians with severe disabilities. The SAIL program has seven community-based offices located throughout the state to serve residents in all 67 counties. SAIL ensures the consumer can live as independently as possible at home and in the community through specialized programs.

Alabama Disabilities Advocacy Program 205 North Conception Street, Mobile (251) 338-0950 (Office), (205) 534-9373 (Cell); www.adap.net; e-mail: dslawkowski@adap.ua.edu The Alabama Disabilities Advocacy Program (ADAP) is part of the nationwide federally mandated protection and advocacy (P&A) system. ADAP’s mission is to provide quality, legally based advocacy services to Alabamians with disabilities in order to protect, promote and expand their rights.

ADAP’s vision is one of a society where persons with disabilities are valued and exercise self-determination through meaningful choices, and have equality of opportunity.

Alabama Institute for Deaf and Blind Mobile Regional Center-1050 Government Street (251) 432-7777; www.aidb.org Alabama Institute for Deaf and Blind is a comprehensive education, rehabilitation and employment system serving children and adults who are deaf, blind and multidisabled.

AIDB has five campuses and eight statewide regional centers.

40

Center for Attention & Learning 829 University Blvd S., Mobile (251) 342-6443; www.centerforattentionmobile.com John I. Bailey, Jr., MD Medical Evaluation & Treatment for School Learning & Behavioral Problems, Classroom & Homework Difficulties, ADHD-ADD, LD, Autistic Spectrum Disorders, Tourette, & Depression & other Mood Problems. Over thirty years’ experience. Member, Professional Advisory Board of the National Attention Deficit Disorder Association.

The Centre 1507 Dauphin Street, Mobile, (251) 471-5844 1290 Main Street, Suite B, Daphne, (251) 625-0118 www.thecounselingcentre.com The areas of specialization include: Treatment of Depression and Anxiety, Grief, Abuse/Trauma Issues, Life Adjustments, Spiritual Issues, Career Planning, Divorce Recovery, Attention-Deficit Disorders, Learning Disabilities, Behavioral Problems, Parenting Skills, Peer Conflicts, Family Counseling, Pre-Marital Counseling, Relationship/Marital Therapy, Medical and Health Concerns, Psychological Testing, Psycho-Educational Evaluations. The Centre’s CrossRhodes Art Therapy Program provides counseling for children who are facing life-threatening illnesses. The nurturing therapeutic environment allows them to ask questions and express feelings in a healthy, healing way. Art becomes an added voice for telling their story. It gives them a selfsoothing avenue to practice coping strategies they can use in their daily lives.

Community Serv. for Vision Rehabilitation 600 BelAir Boulevard, Suite 110, Mobile (251) 476-4744; www.csvrlowvision.org 29653 Anchor Cross Boulevard, Daphne (251) 928-2888; visionrehab@bellsouth.net

www.mobilebayparents.com

Com org and by e oph wor nat

De 55 (25 The age The and req you you

Dia (30 Wo es f righ and Dia pro

Eas Mob 244 (25 Eas Dev Rec 12) of c gym &m from atio 596 (33 Our tion recr serv tion Hea &C with

Ha (25 Imp Lice enla ma acc acc

Int The (33 Mob The ship dev inte The who pro

Lea (33 alab Inc me fam striv chil

ng

rs ial.

nties of

ch,

-

ion rn

-

ers .

, & ver

on.

try, oral ly,

es

nd

se

om

Community Services for Vision Rehabilitation is a non-profit organization, dedicated to helping those with low vision and blindness. The clinic provides professional evaluation by eye doctors (ODs and MDs), occupational therapists, ophthalmic technicians, computer specialists and others. It works in collaboration with state agencies and regional and national resources.

Delicious Dietician 55 Midtown Park East, Mobile (251) 478-2233; www.4tdd.com The Delicious Dietician offers “One- on- One” Disease Management services specific to the client’s individual needs.

The Delicious Dietician understands the need for education and practical advice when dealing with health problems requiring restricted diets. Let The Delicious Dietician teach you how to live deliciously, despite having limitations with your meals. For questions email info@4tdd.com.

Dianne Craft – Child Diagnostics (303) 694-0532; www.diannecraft.org Wonderful website filled with information, articles, resources for learning disabilities, dyslexia, auditory processing, right/left brain learning. We provide nutritional therapy and supplement recommendations. You can purchase Dianne’s DVDs, CDs, Books, vitamins, and other various products through her online store.

Easter Seals of Alabama Mobile Location: Goodwill Easter Seals of the Gulf Coast, 2440 Gordon Smith Drive (251) 471-1581, (800) 411-0068; www.gesgc.org Easter Seals offers Parent Education and Support, Child Development Centers, Early Intervention and a Wonderful Recreation Program that provides school-age children (6 12) of all abilities the opportunity to participate in a variety of community recreational activities. Sessions include gymnastics, rock wall climbing, bowling, skating, music & movement, and tee ball. Staff is assisted by volunteers from the University of South Alabama Therapeutic Recreation and Occupational Therapy Programs.

5960 East Shirley Lane, Montgomery, AL (334) 395-4489; www.alabama.easterseals.com Our organization consists of eight community rehabilitation program sites and the world’s largest barrier free recreational camp, Camp ASCCA. Easter Seals Alabama services include: Medical Rehabilitation, Early Intervention, Physical Therapy, Occupational Therapy, Speech and Hearing Therapy, Job Training and Employment, Child Care & Camping and Recreation. We provide services for people with disabilities and their families.

Handi Home and Bath, LLC (251) 610-3277; info@handihomeandbath.com Improving Access and Safety Throughout Your Home!

Licensed and Insured, we install grab bars, access ramps, enlarge doorways, remodel baths, upgrade lighting and make other changes to make your home/business more accessible. Call for a FREE Consultation. Visa and MC accepted.

Intellectual & Developmental Disabilities The Arc of Alabama, Inc., Montgomery, AL (334) 262-7688, (866) 243-9557; www.thearcofal.org; Mobile Arc - mobilearc.org; info@thearcofalabama.com The Arc of Alabama, Inc. is a volunteer-based membership organization made up of individuals with intellectual, developmental and other disabilities, their families, friends, interested citizens, and professionals in the disability field.

The Arc also advocates for people with other disabilities who need similar supports and services in order to be as productive and independent as possible.

Learning Disabilities Association of Alabama (334) 277-9151; www.ldaamerica.org/lda-chapters/ alabama/. The Learning Disabilities Association of Alabama, Inc. (LDAA) is a non-profit grassroots organization whose members are individuals with learning disabilities, their families, and the professionals who work with them. LDAA strives to advance the education and general welfare of children and adults with learning disabilities.

The Listening Program (888) 228-1798; www.advancedbrain.com The Listening Program (TLP) is a music listening therapy that provides engaging brain stimulation to improve performance in school, work and life. It gently trains the auditory system to accurately process sound. Auditory processing problems can lead to academic, emotional, cognitive and social challenges, including problems with ADD, Listening, Speech & language, memory, communication, Social skills, reading, Sensory Integration, Balance and coordination and self-regulation. Auditory processing problems are often found in children and adults with Autism Spectrum Disorder, ADD, dyslexia and learning disabilities.

March of Dimes Mobile Alabama Chapter 205 Lambert Street, Suite A, Mobile (251) 438-1360; www.marchofdimes.com/alabama The March of Dimes Alabama Chapter has one goal: to help babies in our community start life in the healthiest way possible. Through education and intervention, we help moms-to-be learn how to take care of themselves before, during and after their pregnancy. We are also there when things don’t go as planned, providing comfort and information to families when a baby is born too soon. The Alabama Chapter also partners with local medical groups and organizations to establish guidelines for how to care for pregnant women and premature babies. And we provide grants to researchers working to understand birth defects and premature birth and to find treatments and solutions.

Mental Health – National Alliance on Mental Illness (251) 461-3450, (334) 396-4797; www.namialabama; www.namimobile.org NAMI Alabama is an organization comprised of local support and advocacy groups throughout the state dedicated to improving the quality of life for persons with a mental illness in Alabama. The number of such groups is growing rapidly as families become more determined to improve treatment and care for Alabamians diagnosed with a mental illness. The mission statement/purpose of NAMI Alabama is to provide support, education, and advocacy for persons with mental illnesses, their families, and others whose lives are affected by these brain disorders. Numerous local meetings. Meetings listed under the calendar tab on our website.

Mercy Medical–Pediatric Home Health Care 3280 Dauphin Street, Suite B122 B, Mobile (251) 304-3158; www.mercymedical.com/homecare_ pediatric.php. Mercy Pediatric Home Care allows children to recover in the comfort of their own home with family members, rather than in a hospital. It provides cost-effective, compassionate medical care to homebound children under 18-years old who are recovering from injuries or surgeries, dealing with chronic or complicated diagnoses or other serious health problems. In addition to the psychological and emotional advantages of recovering at home, Mercy Pediatric Home Care saves healthcare dollars, reduces the likelihood of complications such as infection and provides high-tech medical care by a skilled, specially-trained team of healthcare professionals. Mercy Pediatric Home Care also supports the family by offering educational, nutritional, and spiritual counseling and assistance in securing resources.

Mobile Association for the Blind 2440 Gordon Smith Drive, Mobile (251) 473-3585, (877) 292-5463, (800) 232-5463; The Mobile Association for the Blind is now a 45,000 square foot manufacturing facility where many visually impaired individuals who are not able to join the public workforce are employed in our Sheltered Workshop. Our organization also provides assistance to other citizens with disabilities. Counseling and evaluation, skills training, and job placement are just some of the services we provide to help create the self-esteem needed to become productive members of society.

Mulherin Custodial Home 2496 Halls Mill Road, Mobile (251) 471-1998; www.mulherinhome.com Mulherin Home provides a home for individuals, children

41

www.facebook.com/mobilebayparentsmagazine

and adults with developmental disabilities. Our foremost concern is the happiness, comfort, and welfare of the residents at Mulherin Home. The Mulherin Custodial Home is a 501(c) (3) organization, and a United Way agency.

Santa America 308 Belrose Avenue, Daphne (251) 626-6609; www.santa-america.org Santa America is a national volunteer service organization with a very special mission. Over one-hundred Santa’s across America visit children and families in crisis. Santa Claus visits when a child or family needs him—twelve months a year—bringing love, hope and joy to special needs children in a loving visit of about an hour at home, hospital, or hospice. Santa’s visits are free. There is no charge for a visit from Santa Claus—ever.

Sight Savers America 337 Business Circle, Pelham, AL (877) 942-2627; www.sightsaversamerica.org Sight Savers America is a nonprofit 501(c)(3) that assists children with obtaining eye exams, glasses, and other needed eye care from local eye care providers and clinics. Children are referred to Sight Savers via failed vision screenings at school, referrals from teachers, school administrators, school nurses, eye-care professionals and parents. Children of families who qualify for our program receive the eye care they need at no cost to the family.

PHYSICAL AND SPEECH THERAPY BlueBird Pediatric Therapy, Inc.

(ad on page 9) 6312 Piccadilly Square Drive, Suite 3, Mobile, (251) 287-0378; www.bluebirdtherapy.com We provide occupational therapy and speech therapy services. Some of the special techniques that we use during treatment include, Integrative Listening Systems, Sensory Integration Techniques, Handwriting Without Tears, DIR/ Floor time Concepts, Neurodevelopmental Treatment Techniques, and more. Our hope is to address the ongoing needs of children with diagnosed disabilities, as well as, address the ongoing needs of children who may simply just need a little extra help staying afloat when they are having trouble meeting the demands of their school systems or daily activities in society.

Pediatric Physical Therapy of Mobile

(ad on page 18) 3202 Old Shell Road, Mobile (251) 450-0070; www.pptmobile.com It is the mission of Pediatric Physical Therapy to provide Mobile and Baldwin County pediatric patients with options for out-patient physical therapy services. Treatment will be individualized, assertive, and aggressive to maximize functional outcomes. We strive to have child-friendly, play-based treatment programs which are family centered.

We believe in empowering the patient and the family to heal themselves through patient education. We believe in physical fitness for all ages and abilities thus will promote pediatric fitness and sports. Pediatric Physical Therapy strives to utilize state of the art technology and evidence based practice during treatment. Families will be guided toward area community resources. Services will be coordinated with other community agencies and other health professionals working with the child. We will provide students of physical therapy a problem based clinical with emphasis on adult learning. The clinic will practice according to the guidelines and ethics of the American Physical Therapy Association.

Therapy Services at USA Children’s & Women’s Hospital

(ad on Inside Front Cover) 1610 Center Street, Mobile (251) 415-1670; www.usahealthsystem.com Therapy Services at USA Children’s & Women’s Hospital offers a team-oriented program of pediatric physical,

Mobile Bay Parents I September 2015

occupational and speech-language therapies. Services are provided on both an inpatient and outpatient basis.

We offer pediatric-specific care for infants and children with varied diagnoses. Services include assessment and treatment of: Developmental Delays, Orthopedic Injuries, Neuromuscular Problems—Cerebral Palsy, Spina Bifida, Traumatic Brain Injury, Spinal Cord Injury, etc., Burns and Wounds, Speech and Language Deficits, Feeding Problems, Sensory Problems, Attention Problems & Loss of Function Due to Chronic Illness.

Buckaroo Barn, L.L.C 39821 Duffee Lane, Bay Minette (251) 604-3904; www.buckaroobarnllc.com Physical Therapy specializing in Hippotherapy for Special Little Buckaroos. Specially trained physical and occupational therapists use this treatment for patients with movement dysfunction. A specially trained therapist directs the movement of the horse analyzes the patient’s responses and adjusts the treatment accordingly. Hippotherapy is a medical treatment which uses the movement of the horse to influence the rider’s posture, balance, function, and sensory processing.

accept some insurance. Services offered include Individual Therapy (Adult and Child), Family Therapy, Group Therapy, The JAGSS Group (Junior Autism Group for Social Skills), Parent Child Interaction Therapy (PCIT), Evaluations and Assessments.

USA Speech and Hearing Clinic 1119 HAHN, 5721 USA Drive North, Mobile (251) 445-9378; www.southalabama.edu/alliedhealth/ speechandhearing/clinic.html The clinic serves two primary purposes: to provide services in speech, language and hearing to citizens of Mobile and surrounding areas and to provide the supervised clinical experiences needed by the students for graduation and to obtain professional licensure/certification. Because the USA Speech and Hearing Clinic functions as a service facility and teaching facility, activities and procedures address both purposes. Diagnostic and treatment services in speech, language and hearing are provided to persons of all ages and with all types of speech-language and hearing disorders.

FINANCIAL

Gulf Coast Therapy (251) 928-7312; www.gulfcoasttherapy.com Gulf Coast Therapy is a state-of-the-art outpatient therapy center serving Mobile and Baldwin County. We are committed to offering our patients a center of excellence for the treatment of pain and/or disability. The mission of Gulf Coast Therapy is to provide our patients with the skills they need in order to function at their highest level of independence and increase their quality of life. Services include: early intervention, outpatient pediatrics and school-based therapy.

Disabled Children Relief Fund (516) 377-1605; Disabled Children’s Relief Fund (DCRF), a non-profit 501(c) (3) organization, provides disabled children with assistance to obtain wheelchairs, orthopedic braces, walkers, lifts, hearing aids, eyeglasses, medical equipment, physical therapy, and surgery. Blind, Deaf, Amputees, and children with Cerebral Palsy, Muscular Dystrophy, Spastic Quadriplegia, Encephalitis, Rheumatoid Arthritis, Spina Bifida, Down’s syndrome, and other disabilities receive assistance. DCRF focuses special attention on helping children throughout the U.S. that do not have adequate health insurance, especially the physically challenged.

Kids Kount- Therapy Services, LLC 2504 Dauphin Street, Suite A, Mobile, (251) 517-0355 26420 Kensington Place, Suite C, Daphne, (251) 517-0355 Our therapy techniques skillfully weave sensory experiences and practical application into activities of daily living.

Children learn to work through challenges in a caring, supportive environment; and we all celebrate their accomplishments. We strive to instill compassion and confidence in each child, and we give each child encouragement to become their own unique self. We provide speech, occupational, and physical therapy for children from birth to 21 years.

Family Support 1050 Government Street, Mobile (251) 438-1609; www.famsupport.com Family Support is a 501(c) (3) nonprofit that brings together Alabamians with disabilities, their families, and supporters to provide assistance to their neighbors with disabilities. Assistance is “whatever is necessary” within available funds, and may include information and referrals, home modifications, food, clothing, therapy, prescription drugs, utilities assistance, childcare, special holiday help, etc.

Springhill Medical Center- Outpatient Pediatric Rehabilitation Springhill Medical Center’s Gerald Wallace Annex; 100 Memorial Drive Suite 1-C (at Dauphin and I-65).

(251) 340-0688; www.Springhillmedicalcenter.com Rehabilitation Center offers Physical, Occupational and Speech therapy services to children ages 0-18. Our therapists will screen, analyze and evaluate children who may be experiencing limitations or difficulties in daily life environments or developmental performance areas. Together with parents or caregivers a treatment plan will be developed to maximize the child’s independence, behavior and self-esteem. Upon referral by the child’s physician, an appointment should be scheduled by calling (251) 340-0688.

Hours of Operation: Monday through Friday; 8am- 5pm.

Facebook: Springhill Medical Center Rehabilitation University of South Alabama Psychology Clinic 307 University Blvd North, UCOM 2000, Mobile (251) 460-7149; www.southalabama.edu/colleges/artsandsci/psychology Email: PsychologyClinic@Southalabama.edu As a training clinic for the USA Clinical and Counseling Psychology doctoral training program, USA Psychological Clinic also offers low-cost services for children, adults, and families, including psychological testing and counseling, martial counseling, and stress management. Under the supervision of Licensed Psychologists, graduate students provide a variety of clinical services, offering reduced fees (therapy $5-$25/session, evaluations $250-$500).

Psychology faculty members also see clients for a fee and

42

Medicaid Waiver Program www.medicaid.alabama.gov Visit our website for more information about intellectual disabilities waiver and living at home waiver.

State of Alabama Independent Living Waiver (800) 441-7607; www.medicaid.alabama.gov/CONTENT/4.0_Programs/4.3.0_LTC/4.3.1.5_State_Ala_Ind_ Liv_Waiver.aspx. This waiver program provides services to disabled adults age 18 years or older who have specific medical diagnoses and who would otherwise qualify for care in a nursing care facility. Diagnoses may include but not limited to; Quadriplegia, Traumatic Brain Injury, Amyotrophic lateral sclerosis, Multiple Sclerosis, Muscular dystrophy, Spinal muscular atrophy, severe cerebral palsy, Stroke, and other substantial neurological impairments, severely debilitating disease or rare genetic diseases (such as Lesch-Nyhan disease).

The Rileigh and Raylee Angel Ride Foundation (251) 243-0365; www.angel-ride.org The Rileigh and Raylee Angel Ride Foundation is a foundation started by the inspiration of two children -Rileigh Glass and Raylee Odom. Rileigh was born with Down syndrome and Raylee with Muscular Dystrophy. The mission of the foundation is to provide financial assistance to families of children with unforeseen health problems. Upon careful review of an applicant’s files, awards are distributed on a needs basis. All files are documented with medical diagnosis, physician recommendations, family income, expense records; and an estimated cost of transportation, food and

www.mobilebayparents.com

lodg face not

SC ED

Re

(ad 15 104 ww At R ing lang also

Th

(ad 497 (25 The pro and abil and Pro ville

Th Th

(ad 117 (25 The edu rati are indi sch with disa ing pre The to e sett the

Th

(ad 545 (25 Wo aut bas chil lang beh

Th

(ad (25 The tuto bou stud gies Tan the Edu follo Thin tion 12 ADD imp

ual py, , d

ces d

to SA

oth annd .

ic

id

on e -

ls,

fic

r y,

ch

daass me e f

a oe nd

om

lodging. The Foundation genuinely seeks to assist families faced with financial burdens when health complications are not covered by health plans.

SCHOOLS AND EDUCATIONAL RESOURCES Read-Write

(ad on page 18) 15 Midtown Park West, Mobile; (251) 287-1822 1048 Stanton Road, Suite G, Daphne (251) 625-4020 www.dyslexiaspecialist.net At Read-Write, we offer educational consulting, screening and one-on-one therapy for students and adults with language based learning disabilities such as dyslexia. We also offer reading readiness for 4and 5 year olds.

The Learning Tree, Inc.

(ad on page 21) 4979 Lott Rd., Eight Mile (251) 649-4420; www.learning-tree.org The Learning Tree, Inc. is a non-profit organization that provides educational and residential services for children and adolescents, ages 2 ½ -21, with developmental disabilities, including autism. The organization also provides and Individual and professional consultation and training.

Programs are located in Mobile, Anniston, Auburn Jacksonville, and Tallassee.

The Learning Tree – The Little Tree Preschool

(ad on page 21) 1176 Azalea Road, Mobile (251) 649-4220 ext. 1225 or 1226; www.learning-tree.org The Little Tree Preschool offers high quality preschool education for children ages 2 ½ - 5. Low student-teacher ratios are maintained and teachers are certified. Children are encouraged to grow as learners by building on individual strengths to establish a strong foundation for school success. The preschool includes services for children with autism spectrum disorders and other developmental disabilities. The Little Tree Preschool is an inclusive learning environment that focuses on teaching readiness and prerequisite skills to prepare children for primary school.

The curriculum is comprehensive and encourages children to explore and discover answers, and we provide a social setting to promote healthy self-esteem and sensitivity to the needs of others.

The Learning Tree - Woody’s Song School

(ad on page 21) 5459 Able Ct., Mobile (251) 331-8021; www.learning-tree.org Woody’s Song School serves children ages 5-18 on the autism spectrum. The private, nonprofit school is a tuitionbased, twelve month, day program. The school helps children with autism increase their skills in the areas of language, socialization and cognitive skills while decreasing behaviors that interfere with their learning.

The Think Tank

(ad on page 35) (251) 414-4494; www.thinktankminds.com The Think Tank Tutoring provides one-on-one in-home tutoring to general education, learning disabled and home bound students. In addition to working one-on-one with students, The Think Tank tutors provide educational strategies to parents during each tutoring session. The Think Tank Tutoring and Educational Services works directly with the student’s teachers ensuring we follow the Individual Education Plan for special needs students. In addition, we follow the student’s current classroom curriculum. The Think Tank Tutoring provides homework help, test preparation, and study skills to students in grades Pre-K through 12 in all subjects. We have qualified educators to work with ADD, ADHD, hearing impaired, MR, Dyslexic, and speech impaired students.

USA Children’s & Women’s Hospital

(ad on Inside Front Cover) 320 Alumni Circle, Educational Services Building, Suite 19 (251) 460-7212 The University provides services to students who are physically, emotionally or learning disabled. Students in need of accommodations in or out of the classroom due to a disability should make contact with the Office of Student Disability Services.

Augusta Evans School 6301 Biloxi Avenue, Mobile (251) 221-5400; evans.mce.schoolinsites.com Augusta Evans School was organized to provide a quality education, appropriate for mentally handicapped students of Mobile County and individualized to meet each of these student’s needs. As Special Education practices in the United State, Alabama, and Mobile County move into a new century, it has become imperative that changes in philosophies and methods are forthcoming. To this end, the faculty, staff and parents of Evans School are dedicated to insuring that every special needs individual receives an education of the highest quality, an education appropriately designed for each individual, an education which provides each individual with the skills necessary to become a productive citizen, and an education delivered in a setting designed to allow each student to develop to his maximum potential. The faculty and staff of Augusta Evans School take pride in its leadership role in Special Education in Mobile County.

Bright Beginnings School 1901 Schillinger Road, Mobile (251) 689-8253; www.brightdyslexics.com Bright Beginnings School was developed to give parents an alternative for their children’s education. Each child is unique and should be taught in unique ways. At Bright Beginnings each child is individually challenged and taught to meet his/her specific needs. An individual educational plan is developed for each child and is taught in small group settings. Full day academic program specializing in dyslexia. All subjects. Serving grades 1-5.

Continuous Learning Center 1870 Pleasant Avenue, Mobile (251) 221-2122; continuous.mcc.schoolinsites.com Our mission is to provide quality instruction in a structured and supportive learning environment. As a learning community, we value relationships, exhibit mutual respect, and maintain high expectations for all students. The Continuous Learning Center (CLC) is an alternative school created by the Mobile County Public School System to serve students who have been suspended for short or long terms from regular school. The students are served by an experienced, highly trained, professional staff to be productive and successful in the education setting. Our focus is on improving the social and academic abilities of our students by using behavior modification systems and teaching basic academic skills. New additions to our Career/Technology program include horticulture and cosmetology. We are still teaching students hands on, “real world” skills in the fields of carpentry, cabinetry and millwork as well. Please feel free to come and visit our facility!

Gordon Smith Child Development Center 2448 Gordon Smith Drive, Mobile (251) 471-1581; gesgc.org Children of all abilities receive high quality instruction with small child-staff ratios. Programming includes Special Education Preschool (Part B) services through the local school system, Early Headstart classrooms and an Alabama “First Class” Voluntary PreK classroom. With high quality instruction, small child-staff ratios, and increased opportunities for inclusion, this program addresses all aspects of learning: social/emotional, physical, cognitive and language.

Summer camp and afterschool programs are available for elementary school children.

Green House at ACCA, The 63 Midtown Park East, Mobile (251) 209-1102; www.azaleacityarts.com

43

Tea & Spa Parties Frozen • American Girl • Spa • Fashion Show • Princess • Mermaid • PYO Pottery • Pinkalicious Cupcake and more! Packages range from affordable to Seriously Spoiled! and our celebrations are always completely private in our VIP suite. We attend to all of the details, so you can relax and enjoy!

SPA

(SPECIAL PAMPERING ACTIVITIES)

packages and ear piercing available by appointment in our girls spa.

4180 Oak Ridge Ave Mobile 36619 251-447-4846 www. s pa-tea-da. c om Join our birthday club Text spateada to 31996

www.facebook.com/mobilebayparentsmagazine

Bo Dooley; bodooley.thegreenhouse@gmail.com Helping individuals with academic and social learning challenges: Social learning, ADHD live coach, Cogmed Coach, Fastforword provider, academic tutoring/math.

Kumon Learning Center 3152 Old Shell Rd Suite # 1, Mobile (251) 447-2264; www.kumon.com For more than 50 years, Kumon’s after-school academic enrichment program has helped children achieve success worldwide. We strive to instill in children the desire to achieve and the motivation to learn on their own. Whether your child is seeking enrichment, needs help catching up or is just beginning his or her academic career, Kumon is designed to help him or her develop a love of learning. Students advance through the program at their own pace. Our emphasis on individualized learning helps your child become focused, motivated and self-reliant. We monitor each child’s progress to ensure comprehension before moving on to a new concept. With a strong academic foundation, critical thinking and problem solving abilities, your child has the potential to achieve whatever he or she desires.

Lindamood-Bell Learning 2864 Dauphin Street, Suite D, Mobile, (251) 473-6808 Toll Free: (800) 300-1818; www.lindamoodbell.com mobile.center@lindamoodbell.com “We create the magic of learning!” Founded in 1986 by Patricia Lindamood and Nanci Bell, Lindamood-Bell is dedicated to enhancing human learning. Our founders are the authors of critically acclaimed instructional programs that teach children and adults to read, spell, comprehend, think critically, and express language. The Lindamood-Bell programs have proven successful for individuals with a wide range of learning challenges, including previous, thirdparty diagnoses of learning disabilities such as dyslexia, hyperlexia, ADHD, CAPD, and autism spectrum disorders.

Schoolworks 2534 Old Shell Road, Mobile (256) 252-8374; www.schoolworksedu.com Michael Ann Kelley; michaelann@schoolworksedu.com Provide Tutoring SAT, GRE, ACT I and II Test Prep, ADHD Coaching for Children and Adults, All Subject Areas for Elementary and High School Students, Organizational, Study, Note Taking and Test Taking Skills classes, Homework Assistance, Writing Skills. We offer on-site tutoring during your child’s study hall. We monitor your child’s grades, along with their classroom teacher’s assignments to ensure we are all on the same path to success for your student S. W. Regional School for the Deaf and Blind 3980 Burma Road, Mobile (251) 221-5454; www.afb.org Local website; http://regional.mcs.schoolinsites.com (please note, using www with this address does not work, you must type in http://) The mission of the Southwest Alabama Regional School for the Deaf and Blind is to create a positive, supportive educational environment that provides opportunities for sensory impaired students to reach individual potential in the areas of academics, independence, responsibility and social competence. This will be accomplished through the implementation of appropriate curricula, utilizing specialized communication and equipment, directed by a cooperative, dedicated, specially trained faculty and staff supported by parents and the community.

Springhill Child Development Center 10 Westminster Way, Mobile (251) 342-3122; www.gesgc.org At the Goodwill Easter Seals Spring Hill Child Development Center, we base our programs on the philosophy that all children can learn and here we provide the tools and support necessary to foster that learning. Children with and without disabilities receive comprehensive child-care services. Our center is licensed by the Department of Human Resources and provides a rich learning environment suitable for the developmental needs of each child.

With high-quality instruction, small staff-child ratios, and increased opportunities for inclusion, this program provides

Mobile Bay Parents I September 2015

an optimal setting for young learner’s ages 2 1/2 - 5 years old. Areas of learning addressed on a consistent basis are social/emotional, physical, cognitive and language. Children with special educational needs receive programming in an inclusive preschool setting. Support services, including speech, occupational therapy, physical therapy, and music therapy, are provided by the Mobile County Public School System.

Sylvan 8020 Moffett Rd, Suite A, Semmes (251) 649-8522; www.sylvanlearning.com A Better School Year Starts with Sylvan .Don’t worry about falling behind later–start now, don’t hope for the best, get your child the help he or she needs today. Partner with Sylvan to give your child a leg up on schoolwork and a boost in confidence. Let our proven tutoring approach help your child start the school year off right. Our Tutoring Services include math, reading, writing, study skills, homework help, summer camps, state test prep, SAT/ACT prep, College Prep, SylvanSync, and many other services.

RECREATION BlueBird Pediatric Therapy, Inc. – Kids Yoga

(ad on page 9) 6312 Piccadilly Square Drive, Suite 3, Mobile (251) 287-0378; www.bluebirdtherapy.com We are excited to present as a new program, since March 2015, to the Mobile area and surrounding communities Bluebird Kid’s Yoga! We will be starting our yoga classes with two 6 weeks child/parent series. Each class will incorporate poses, breathing techniques and purposeful postures to strengthen the body, calm the nervous system and teach a fun way to exercise. It is our hope that with each child/parent class we are also able to further enhance the child/parent relationship. Each class series is designed to meet the needs and skills of children with and without disabilities. If you have any further questions please email Danielle at bluebirdtherapy@gmail.com.

Dance Without Limits

(ad on page 11) 63 Midtown Park East, Mobile (located in the Azalea City Center for the Arts bld) (251) 391-0244; dancewithoutlimits@aol.com Offering dance classes exclusively to the special needs community! We will offer a preschool class for ages 3-5, hip hop classes ages 6-11 (or based on cognitive level), and a teen/adult class. Classes are led by Kerrie Benson, a dance teacher for over 20 years and mom to a special needs child along with occupational therapists Mia Manning and Victoria Rowan. Tuition rates are $50 per month there will be a few scholarships available provided by our generous donors. Most classes will be assisted - meaning each dancer will have a volunteer helper to work with them through class. These volunteers are dancers at Broadway South, Camp Smile counselors, special ed teachers and speech and OT students at South. All dancers will perform at the Broadway South Dance recital at the Mobile Civic Center on May 7 and at community events throughout the year. Call (251) 391-0244 or email dancewithoutlimits@ aol.com for more info!

Exceptional Arts Drama by Sunnyside Theater

(ad on page 11) 63 Midtown Park East, Mobile (251) 510-1808; www.azaleacityarts.com Sunnyside Theater proudly presents Exceptional Arts Drama. Drama and Theater classes for adults and children with special needs ages 8 – 80! Exceptional Arts Drama is committed to providing fun and creative theater opportunities for children and adults with special needs! We adapt roles to give each cast member the chance to showcase their unique talents on stage. Our actors learn how to put on a play, memorize scripts, perform choreography, and role play during dress up! With Azalea City Center for the

44

Arts, cast members and volunteers work together with the common goal of putting on a great show for our families and friends! Tuesday nights from 6:00pm-8:00pm. $50/ month. At end of semester we will present a full length play. Come learn more at our informational meeting August 25 at 6:00! For more information please contact Chris Paragone, azaleacity@mindspring.com or call 510-1808.

give Mob par skil spe of b mo

Celisse’s School of the Equestrian 2568 Sollie Rd., Mobile (251) 289-1244; www.kcequestrianarts.com We provide Therapeutic Riding Lessons to those with special needs (mental or physical), blind or deaf, and recovering from injury. It is our goal that everyone who wants to experience, learn, and benefit from horses is able to do so.

Spe 540 (25 The vide of O who ties exp and ath Spe telle me por thro the

City of Mobile Parks and Rec Center 261 Rickarby St. (Woodcock School Building), Mobile (251) 208-1670; www.cityofmobile.org/parks; specialactivities@live.com Therapeutic Programs for Special Needs. Classes vary so call or check our website for more information.

Hope Outdoors 453 Deerpatch Road, Chatom (251) 769-0711 or (251) 769-5642; www.hopeoutdoors.org Glenn & Karen Sansing, Alabama Chapter Directors Hope Outdoors has a passion to spread the love of God and provide the fun of the great outdoors to those who may be ill or challenged. Some are looking to be re-introduced into an activity they once loved, while others are discovering a new and exciting way to live life to its fullest.

We provide opportunities for fishing, deer hunts, archery shoots, bird and turkey hunts, and other ways to get close to nature and enrich lives no matter the challenges life may have given you. We now have chapters in Alabama, Arkansas, Tennessee, Missouri, and 3 chapters in Mississippi. All events are free to participants and their families.

Hope Outdoors provides all meals, game processing and licenses. Participants are only responsible for travel to and from the event. Applications can be found on our website.

To find out how you can be a part of Hope Outdoors call or visit our website today. Visit us on Facebook for photos and event updates.

Inner Strength Martial Arts 9120 Airport Blvd # H, Mobile (251) 776-1978; www.innerstrengthmartialarts.info Taekwondo for children and adults of all levels. Rick Hoadley, Master Instructor 7th Degree Black Belt in the martial art of Taekwondo has over 35 years of professional experience. Also offering program for special needs children.

Kallie’s Cheer & Gymnastics 8680 Howells Ferry Rd, Semmes, (251) 401-5841 kalliescheerandgymnastics.vpweb.com Mobile’s first Christian Studio. The services we offer are: Cheerleading, Gymnastics, Tumbling, Ballet, Jazz, Hip Hop, Praise Dance, Tap, Baton, Power Tumbling, Homeschool Gymnastics, Birthday Parties, Summer Camps, Private Lessons, Special Needs, Handicapped Dance & Gymnastics.

Langan Park 4901 Zeigler Boulevard, Mobile This is a Boundless Playground. The Boundless Playground is designed so that children of all abilities can enjoy the park. There is a Pedestrian Bridge connects the playground and park area of Langan Park to the Mobile Museum of Art across Three Mile Creek.

Planet Gymnastics 900 Schillinger Road, S., Mobile (251) 650-0699; www.PlanetGymnastics.com; planetgymnasticsAL@comcast.net In addition to their regular schedule, Planet Gymnastics is proud to offer classes for special needs children ages 5 and up. Please call for details.

SNAP (251) 680-1394; www.snapofalabama.com Special Needs Athletes Programs –Our mission is to

www.mobilebayparents.com

Spr 109 Spr des Imp

The 287 (25 Foll Fou org and pro mu ava high age 8:0

The 641 Mom ope on wel own and

Tur 488 (25 Wh We indi for

VSA ww VSA cate and Alab tic d mo par in t visi

We Bud info Thi me to e

he s

ust

eero so.

org

-

st. y se

,

s.

nd e. or and

dal eri-

op,

es-

he

is and

om

give developmentally disabled citizens in the greater Mobile, Baldwin County Alabama area, the opportunity to participate in a recreational sport with others of the same skill level and to have fun doing it. We work to partner our special athletes with mentors to help them learn the game of bowling, to develop their skills and to be a positive role model.

environment structured to their abilities. More than the skills of baseball learned through the experience, the value of the Babe Ruth Buddy Ball in the proven therapeutic and socialization benefits of participating in sports, the strengthening of participants’ self-esteem, the opportunities to mainstream into other divisions of play, and the disciplines of teamwork, sportsmanship and fair play.

Special Olympics Mobile County 5401 Cottage Hill Rd. Suite D, Mobile (251) 221-5185; mobilecountyspecialolympics.org The mission of Special Olympics of Mobile County is to provide year-round sports training and competition in a variety of Olympic-type sports for people with intellectual disabilities who wish to participate, giving them continuing opportunities to develop physical fitness, demonstrate courage, experience joy and participate in the sharing of gifts, skills, and friendship with their families, other Special Olympics athletes, and the community. The ultimate objective of Special Olympics of Mobile County is to help people with intellectual disabilities participate as productive and respected members of society at large, by offering them a fair opportunity to develop and demonstrate their skills and talents through sports training and competition, and by increasing the public’s awareness of their capabilities and needs.

RECREATION CAMPS

Springhill Taekwondo – Super Samaris 109 Furr Street, Mobile, (251) 554-5425 Springhill Taekwondo Super Samaris – a taekwondo class designed for special needs. Ages 6+. Tuesdays at 5:30pm.

Improve gross motor skills and build confidence!

The Exceptional Foundation of the Gulf Coast 28788 North Main Street Daphne, Al 36526 (251) 625-8955; www.exceptionalfoundationgc.org Follow us on Facebook and Twitter. The Exceptional Foundation of the Gulf Coast is a 501 (c)(3) non- profit organization dedicated to enhancing the social, recreational and artistic abilities of the special needs community. EFGC provides daily programs, which include arts & crafts, music, social events and Special Olympics. Our program is available to the special needs individual upon completion of high school. We also offer a summer program for schoolaged children. Our Hours are Monday and Thursday from 8:00 a.m. – 6:00 p.m.

The Watermelon Patch 6417 Hillcrest Park Court, Mobile, (251) 633-3288 Mommy and Me classes at The Watermelon Patch are open for children of all abilities. In our classes families work on sensory perception and fine / gross motor skills. We welcome special needs groups who would like to have their own play group and or field trip where we do art, cooking and other projects with families.

Turning Point Dance Academy 4880 Lakeland Drive Suite D, Mobile (251) 422-0262; www.tpdadancefamily.com Why should you choose to be a part of the TPDA family?

We are a conservative studio that gives each child the individual attention that they deserve. Special needs class for all ages.

VSA of Alabama, Art Partners www.vsaalabama.org VSA Alabama is a statewide, nonprofit organization dedicated to “serving children and adults with chronic illnesses and disabilities through the arts.” Programs offered by VSA Alabama include: visual arts, music therapy, therapeutic drumming & rhythm, art therapy, drama, creative movement, and creative writing. This program is FREE to participants! The Eastern Shore Art Center has participated in this unique program since its inception. For information, visit www.esartcenter.com.

Westside’s Challenger League – Babe Ruth Buddy Ball info@westsidebaseball.com; www.westsidebaseball.com This Division of Babe Ruth Buddy Ball is a program for mentally and physically challenged youth, helping them to enjoy the full benefits of participation in an athletic

Camp ASCCA

(ad on page 22) (256) 825-9226, (800) THE-CAMP; www.campascca.org ASCCA is an acronym that stands for Alabama’s Special Camp for Children and Adults. Beginning in 1976, Camp ASCCA has been a nationally recognized leader in therapeutic recreation and is known throughout the world for its superior quality services. Providing camping experiences for children and adults with disabilities, Camp ASCCA is open year-round. Within its barrier-free environment, Camp ASCCA offers 230 wooded acres on the shores of beautiful Lake Martin in Alabama. Camp ASCCA serves an average of 7,000 people annually. Activities include horseback riding, fishing, tubing, swimming, environmental education, arts and crafts, canoeing, a “splash pad”, outdoor adventure elements like the zip-line, and much more.

Camp Bridges 1600 7th Avenue South, Birmingham Located at Children’s Harbor, Lake Martin, AL (205) 558- 2090; www.campbridges.org Our mission is to provide camps and programs to pre and post transplant children, teens, young adults and their families from Alabama and neighboring states. We create a fun and educational environment for heart, kidney, liver and lung transplant recipients that encourage positive self image and healthy transplant living. For more information email info@campbridges.com.

Camp Mash (251) 599-5688; www.campmash.org Camp M.A.S.H. is a week-long recreational program for children ages 7 to 17 with a form of juvenile arthritis or a related auto-immune disease. Our camp is planned specifically for the needs of our campers in order to empower them to live life to the fullest and to build friendships with other folks who are on similar journeys with their conditions. Camp M.A.S.H. is offered at NO COST to our families.

We have some set activities that are just everyone’s favorite things to do like fishing, swimming and the ropes course, as well as horses, archery, and arts & crafts. All activities and accommodations are fully accessible, and a medical staff team is on site around the clock. Camp MASH is open to children living in Alabama, Mississippi, the Florida Panhandle, and on a case by case basis other kids.

Camp-Rap-A-Hope (251) 476-9880; www.camprapahope.org Camp Rap-A-Hope is an organization that provides a weeklong summer camp in Mobile, Alabama and is open to children between the ages of 7 and 17 who have or have ever had cancer. The camp is offered at no cost to the campers and their families as cancer has been costly enough. Each year the children enjoy a typical summer camp environment that includes swimming, kayaking, horseback riding, arts and crafts and many other activities depending on the theme for the year. Many of these children have forgotten what it’s like to be a ‘kid’ because much of their childhood has been spent hearing the sounds and seeing the inside of hospitals. It is our privilege to give a part of their childhood back to them through fun-filled camping activities.

Camp Smile-a-Mile (205) 323-8427, (888) 500-7920; www.campsam.org Year round challenging, recreational and educational experiences for young cancer patients, their families as well as young adult survivors from Alabama at no cost. Our purpose is to provide these patients, families and survivors with avenues for fellowship, to help them cope with their disease, and to prepare them for life after cancer.

45

Camp Sugar Falls & Camp Seale Harris (205) 402-0415; www.campsealeharris.org Southern Diabetes Education Services camps and local community programs provide needed diabetes education, encouragement, and friendships for children with diabetes and their families. Camp is a place where having diabetes is the norm; where you can compare and share stories with peers; and where you don’t have to explain diabetes all the time because everyone here “gets it.” They understand exactly what it’s like living with diabetes, because they live with diabetes too. Children learn independence in managing blood sugar levels and medication, making healthy food choices, and being physically active. Trained adult volunteer counselors with diabetes are joined by physicians, nurses, diabetes educators, nutritionists, and pharmacists to provide safe supervision and real time feedback. Camps include fun activities that vary by location. Local programs include safe family-oriented recreation throughout the year.

Lakeshore Foundation 4000 Ridgeway Drive, Birmingham (205) 313-7400; www.lakeshore.org Lakeshore is a 501(c) 3 non-profit organization which serves people with physical disabilities throughout Alabama, across the country and around the world. Since 1984, Lakeshore has helped advance and promote the impact of positive, long-term physical and emotional effects of physical fitness on people with disabilities. From infants to seniors, to injured soldiers and elite-level athletes, every participant is free to discover his or her own potential.

Our mission is to enable people with physical disability and chronic health conditions to lead healthy, active and independent lifestyles through physical activity, sport, recreation and research.

Space Camp and Aviation Challenge (800) 637-7223, (256) 837-3400; www.spacecamp.com/ specialprograms. Camps are available for fourth grade through high school-age students. Additional programs are offered for trainees who are blind or visually impaired, deaf or hard of hearing and have other special needs.

DISABILITY SPECIFIC RESOURCES ADD-ADHD

(also see schools and educational resources) Attention Deficit Disorder Assoc. (ADDA) (800) 939-1019; www.add.org The Attention Deficit Disorder Association provides information; resources and networking opportunities to help adults with Attention Deficit Hyperactivity Disorder lead better lives. We provide hope, empowerment and connections worldwide by bringing together science and the human experience for both adults with ADHD and professionals who serve them. For information call or email info@add.org.

Children and Adults with Attention Deficit Disorders (CHAD) (800) 233-4050; www.chadd.org Provides education, advocacy and support for individuals. In addition to our informative Web site, CHADD also publishes a variety of printed materials to keep members and professionals current on research advances, medications and treatments affecting individuals with AD/HD. Feingold Association of the United States (800) 321-3287; www.feingold.org Provides informational materials, online/telephone support, and resources. Helps families introduce low-additive dietary programs for children with learning/behavior problems and chemically sensitive adults.

Focus-MD, Inc. 3930–F Airport Boulevard, Mobile (251) 378-8635; www.focus-md.com Focus is a medical practice for kids and young people with ADHD and related problems. Dr. James Wiley started FOCUS so that he would have more time to devote to the

www.facebook.com/mobilebayparentsmagazine

diagnosis and treatment of these patients. Focus provides objective testing, medical treatment as well as behavior modification strategies.

Learning Disabilities Association of America (412) 341-1515; www.ldaamerica.org; Offers support programs for parents, an information and referral network, legislation and school program development.

Autism Autism Diagnostics Clinic USA Children’s and Women’s Hospital

(ad on Inside Front Cover) Pediatric Developmental Medicine Center (PDMC) 1707 Center Street, Suite 201, Mobile, (251) 415-8577 www.usahealthsystem.com/autism-diagnosis The USA Autism Diagnostic Clinic sees patients with referral from a physician or other medical/educational professional.

The mission of this clinic is to improve the lives of children with Autism Spectrum Disorders in the greater Gulf Coast area through early identification and diagnosis, as well as to provide educational outreach to families, physicians, daycare centers, churches and other organizations who serve children in the community. Autism Spectrum Disorders include Autistic Disorder, Asperger’s Syndrome, and Pervasive Developmental Disorder-Not Otherwise Specified (PDD-NOS). The USA Autism Diagnostic Clinic evaluates patients up to ten years of age. Services include: Medical Assessments-By Developmental-Behavioral Pediatricians to evaluate health-related conditions; Cognitive EvaluationTo determine current developmental level of functioning; Speech/Language Evaluation--To assess communication level; Autism Diagnostic Observation Schedule (ADOS)-To observe social skills and communication abilities during a play session; Genetics Evaluation-To obtain a detailed family history and pertinent genetic laboratory tests; Occupational Therapy Evaluation-To evaluate motor skills, sensory processing abilities, and self care skills; Assistance with Community Resources-Upon completion of the evaluation, the staff will assist the family in obtaining appropriate community services; Consultation-By affiliated specialists with expertise in autism-related conditions.

Autism Society of Alabama

(ad on page 25) (251) 259-5553, (877) 4AUTISM www.autism-alabama.org; Our mission is to improve services for persons with Autism Spectrum Disorders and their families through education and advocacy. Our current programs and services include, but are not limited to the following: toll free information and referral hotline, resource directory -a preliminary directory of service providers, activities, disability organizations, etc. ,education (parents, providers, family members, etc.) through our quarterly newsletter, exhibitions, speaking engagements, etc., parent Networking Groups in approximately 20 counties around the state, innovative website has a direct link to our e-mail addresses, annual Alabama Autism conference for parents, doctors, teachers, service providers, and students, and collaboration efforts with other state agencies to provide services for persons with autism spectrum disorders.

Alabama Autism & Asperger’s Statewide Info & Support Network www.alabamaautism.org We are uniting, making connections and sharing knowledge and support for all 67 counties in our state & the world. A hub for Autism related events, videos, & support.

American Autism and Rehabilitation Center 8909 Rand Ave. Daphne, AL 36526 (251) 210-1632; www.Americanautismcenter.com The American Autism Center provides therapeutic, clinical, and pharmaceutical services to children and adults affected

by Autism and other disorders.

Auties & Aspies of LA- Lower Alabama Community Support Group, Fairhope www.facebook.com/AutiesandAspiesofLA

Mobile Bay Parents I September 2015

A community dedicated to support for and awareness of those on the Autism Spectrum and their families in lower Alabama. Our intention is to create a community for families in the lower Alabama area who have members on the spectrum. The goal is to be able to share information, support, inspiration, and prayers with other families who are living similar experiences. Visit and Like our page on Facebook for updates.

Autism Alabama www.alex.state.al.us/autismAL An initiative of Special Education Services, Alabama Department of Education provides on-line training resources for parents and educational professionals on autism and Autism Spectrum Disorder (ASD).

Autism Society of America (800) 328-8476; www.autism-society.org Autism Society of America provides services in the areas of advocacy, education, awareness and research.

Autism Speaks (888) 288-4762; www.autismspeaks.org At Autism Speaks, our goal is to change the future for all who struggle with autism spectrum disorders. We are dedicated to funding global biomedical research into the causes, prevention, treatments and a possible cure for autism. We strive to raise public awareness about autism and its effects on individuals, families, and society.

Sacred Heart Children’s Hospital Autism Center Seton Medical Office Park; (850) 416-4933 5190 Bayou Boulevard, Building 2, Pensacola www.sacred-heart.org/childrenshospital/autismcenter At the Sacred Heart Autism Center, we offer a range of direct services for children on the autism spectrum, all with a family-centered approach to learning. Research shows when families are involved, children do better. Our services include: Direct, individualized Applied Behavior Analysis (ABA) therapy. ABA is a research-based, systematic method for improving socially significant skills and behaviors; Parent instruction and hands-on training; Social skills groups for various ages; Group training for families and professionals.

TACA (Talk About Curing Autism) (855) 726-7810, (949) 640-4401; www.tacanow.org Talk About Curing Autism (TACA) is a national non-profit 501(c) (3) organization dedicated to educating, empowering and supporting families affected by autism. For families who have just received the autism diagnosis, TACA aims to speed up the cycle time from the autism diagnosis to effective treatments. TACA helps to strengthen the autism community by connecting families and the professionals who can help them, allowing them to share stories and information to help improve the quality of life for people with autism.

University of South Alabama Psychology Clinic 307 University Blvd North, UCOM 2000, Mobile (251) 460-7149; www.southalabama.edu/colleges/artsandsci/psychology; Email: PsychologyClinic@Southalabama.edu As a training clinic for the USA Clinical and Counseling Psychology doctoral training program, USA Psychological Clinic also offers low-cost services for children, adults, and families, including psychological testing and counseling, martial counseling, and stress management. Under the supervision of Licensed Psychologists, graduate students provide a variety of clinical services, offering reduced fees (therapy $5-$25/session, evaluations $250-$500).

Psychology faculty members also see clients for a fee and accept some insurance. Services offered include Individual Therapy, Family Therapy, Group Therapy, The JAGSS Group (Junior Autism Group for Social Skills), Parent Child Interaction Therapy, Evaluations and Assessments.

CdLS CdLS Foundation (Cornelia de Lange Syndrome) (800) 753-2357; www.cdlsusa.org

46

The Cornelia de Lange Syndrome (CdLS) Foundation is a family support organization that exists to ensure early and accurate diagnosis of CdLS, promote research into the causes and manifestations of the syndrome, and help people with a diagnosis of CdLS make informed decisions throughout their lives.

Cerebral Palsy Cerebral Palsy 4 My Child (800) 692-4453; www.cerebralpalsy.org Our Mission: to provide you with the most comprehensive resource and compassionate voice for all things related to caring for a child with cerebral palsy, and other neurological conditions. We provide a comprehensive resource, including a website and call center that parents and caregivers can turn to for needed, non-legal help and resources.

United Cerebral Palsy of Mobile 3058 Dauphin Sq. Connector, Mobile (251) 479-4900; www.ucpmobile.org UCP of Mobile is dedicated to advancing the independence of people with disabilities. UCP offers a wide range of services for people of all ages, starting with one of our early intervention programs and continuing through adulthood with our supported employment program.

Cystic Fibrosis Cystic Fibrosis Foundation Alabama Chapter (205) 870-8565; Alabama.cff.org The Cystic Fibrosis Foundation is the world’s leader in the search for a cure for cystic fibrosis. We fund more CF research than any other organization, and nearly every CF drug available today was made possible because of Foundation support.

Down Syndrome Down Syndrome Alabama (205) 988-0810; www.downsyndromealabama.org Down Syndrome Alabama’s mission is to promote awareness, acceptance and advocacy for individuals with Down syndrome of all ages.

Down Syndrome Society of Mobile 10 Westminster Way, Mobile (888) 454-0317; www.dssmc.org Our mission is to provide enrichment through education, networking opportunities, advocacy, and emotional support for individuals with Down syndrome, their families and the greater community.

Dyslexia Read-Write

(ad on page 18) 15 Midtown Park West, Mobile; (251) 287-1822 1048 Stanton Road, Suite G, Daphne (251) 625-4020 www.dyslexiaspecialist.net At Read-Write, we offer educational consulting, screening and one-on-one therapy for students and adults with language based learning disabilities such as dyslexia. We also offer reading readiness for 4and 5 year olds.

Alabama Branch of the International Dyslexia Association, The (855) 247-1381; www.idaalabama.org Promoting literacy through research, education and advocacy.

Bright Beginnings School 1901 Schillinger Road, Mobile (251) 689-8253; www.brightdyslexics.com Bright Beginnings School was developed to give parents an alternative for their children’s education. Each child is unique and should be taught in unique ways. At Bright Beginnings each child is individually challenged and taught

www.mobilebayparents.com

to m plan gro dys

Lea (33 The non indi pro

Lea (41 Sup net

Ep

Epi (25 The edu fam and Thi with ing adv com peo

Epi (80 The volu the and

p s

ve o ical ds

ce ry d

F

to meet his/her specific needs. An individual educational plan is developed for each child and is taught in small group settings. Full day academic program specializing in dyslexia. All subjects. Serving grades 1-5.

people with seizures are able to participate in all life experiences; to improve how people with epilepsy are perceived, accepted and valued in society; and to promote research for a cure.

Learning Disabilities Association of Alabama (334) 277-9151; www.ldaal.org The Learning Disabilities Association of Alabama is a non-profit grassroots organization whose members are individuals with learning disabilities, their families, and the professionals who work with them.

Muscular Dystrophy

Learning Disabilities Association of America (412) 341-1515; www.ldaamerica.org Support programs for parents, an information and referral network, legislation and school program development.

Epilepsy Epilepsy Foundation of Alabama (251) 341-0170; www.epilepsyfoundationalabama.org The Epilepsy Foundation of Alabama has as its mission to educate and support individuals with epilepsy and their families, to increase awareness in the general community and to facilitate prevention and management of epilepsy.

This includes providing services and programs for people with epilepsy and their families; educating and increasing awareness about epilepsy; providing leadership in advocacy for epilepsy issues and collaborating with other community resources in support of the mission of the people with seizure disorders.

Epilepsy Foundation (800) 332-1000; www.epilepsyfoundation.org The Epilepsy Foundation of America® is the national voluntary health agency dedicated solely to the welfare of the more than 2 million people with epilepsy in the U.S. and their families. The organization works to ensure that

Alabama Muscular Dystrophy Association (205) 823-8191; www.mdausa.org MDA is the nonprofit health agency dedicated to finding treatments and cures for muscular dystrophy, ALS and related diseases by funding worldwide research. The Association also provides comprehensive health care and support services, advocacy and education.

Sickle Cell Sickle Cell Disease Assoc. of America – Mobile Chapter, Inc. (251) 432-0301; www.scdmobile.org The mission of the Association is to “Empower clients and their families with knowledge, through quality comprehensive programs and services.” In carrying out this mission, the Association provides the following services to individuals throughout nine counties in southwest Alabama, including Mobile, Baldwin, Escambia, Choctaw, Conecuh, Clarke, Covington, Washington, and Monroe counties. For individuals with sickle cell disease: Case management services, Transportation to/from medical appointments, medical and pharmacy assistance for those without insurance. Career assistance, After School Tutorial Program (ages 6-18), Summer Enrichment Program, Client support groups and fun activities. For the general public: Sickle cell screenings, lab onsite, Genetic counseling for those who test positive for sickle cell trait, Educational seminars and certification program. ***All services provided free of charge.

Spina Bifida Spina Bifida Association of Alabama www.sbaofal.org The mission of the SBA of AL is to promote the prevention of Spina Bifida and to enhance the lives of all affected.

Tourette Syndrome National Tourette Syndrome Association (718) 224-2999; www.tsa-usa.org Our mission is to identify the cause of, find the cure for and control the effects of Tourette Syndrome. We offer resources and referrals to help people and their families cope with the problems that occur with TS. Our membership includes individuals, families, relatives, and medical and allied professionals working in the field.

ORGANIZATIONS FOR PARENTS Alabama Parent Education Center (APEC) (866) 532-7660; www.alabamaparentcenter.com We believe that parents have the greatest impact on their children’s lives. APEC provides families with the training, information and support they need to help them ensure that their children become productive, well-educated citizens.

Family Voices of Alabama (877) 771-3862; www.familyvoicesal.org Family Voices of Alabama (FV of AL) aims to achieve family-centered care for all children and youth with special health care needs and/or disabilities. Through our national network, we provide families tools to make informed decisions, advocate for improved public and private policies, build partnerships among professionals and families, and serve as a trusted resource on health care. MBP

n

ort he

h e

s

ght

om

47

www.facebook.com/mobilebayparentsmagazine

4.

Te “I sh cre ac to to en in to co

5.

de of br ov Ba wi tak be mo

6.

yo se

1. Know Yourself. Overestimating your abilities will

In my adult life, nothing has sapped my self-confidence like motherhood.

Just when I think I’ve got it figured out, the kids grow and change in a new direction. And watching other moms only makes matters worse. I spend my days sucking up cereal with a hand-held vacuum while Supermom posts to-diefor pictures on Pinterest.

Of course, it is perfectly normal to feel insecure at times. But self-doubt can create a vicious, downward spiral.

To lift yourself up, you’ve got to tap in to your inner core of confidence. Here’s

cause you to crash and burn like an American-Idol wannabe, says Lynn Kennedy Baxter, B.S.N., M.A., a licensed marriage and family therapist in Colorado Springs, Colo. And underestimating your abilities may cause you to pass up chances to stretch your skills. “Get reality checks from people you trust to give you good, honest feedback,” says Baxter. You may be holding yourself back.

2. Get Passionate. Fuel your confidence by investing in your own interests. Take dance classes, start a blog, or finish your college degree. “When we’re passionate about something – about anything – we become more attractive to others, and more importantly, we become more attractive to ourselves,” says certified life coach and inspirista Jennifer Tuma-Young of Edison, NJ. Do what lights your fire.

3. Stop Comparing. “If you feel like your life is a seesaw, perhaps you’re depending on other people for your ups and downs,” says communication consultant Sam Horn, author of What’s Holding You Back? 30 Days to Having the Courage and Confidence to Do What You Want, Meet Whom You Want, and Go Where You Want. Comparing yourself to others generates feelings of inferiority or superiority, neither of which is helpful. Be accountable to your own wishes and values.

how.

Mobile Bay Parents I September 2015

48

www.mobilebayparents.com

$

be, ge eso t

4. Banish Limiting Language.

Telling yourself “I can’t,” “I’ll never,” or “I always,” reinforces your flaws and shortcomings, says Baxter, and can create a self-fulfilling prophecy. “Either accept your inadequacies, or choose to develop the trait or skill you’d like to have.” Ask yourself, “What words of encouragement would I offer a friend in the same situation?” then say them to yourself. Optimistic self-talk inspires confidence.

5. Rest Up. “Research clearly demonstrates that even a few days of too-little sleep causes a part of the brain called the amygdala to go into overdrive with fear and anxiety,” says Baxter. Instead of responding to stress with worry and panicked preparation, take a warm bath then get to bed. You’ll be ready to move mountains in the morning.

6. Affirm Your Attributes. List your top ten qualities. “They can be serious – like ‘I’m a great listener’ – or

silly, like ‘I always call people back,’ ‘I read with my kids every night,’ or ‘My cookies sell out first at the bake sale,” says Tuma-Young. Celebrating your own unique, special skills makes you feel fabulous.

7. Coach Yourself. There will be times when you don’t live up to your own expectations, like when you scream at your 4-year-old for washing the dog with pricey salon shampoo.

“The key to a more productive approach lies in these two little words: next time,” says Horn. Focusing on how you’ll act differently in the future frees you from shame and self-blame.

8. Speak Up. When you’re unhappy, you have three options: you can whine, you can wait, or you can take responsibility, says Horn. Be proactive rather than passive. Tell the PTA president “No” if you don’t want to be in charge of the silent auction this spring. Staying true to yourself minimizes feelings of burnout and resentment.

9. Make a Difference. Giving to others increases feelings of competence and connectedness. TumaYoung volunteers with Enchanted Makeovers, a non-profit organization that offers inside-out makeovers to women and children living in shelters.

“It’s not about giving to the needy,” says Tuma-Young. “We’re all needy.

When we help each other, we heal our own lives.”

10. Be Positive. It may seem like other people have easier lives, but that’s just an illusion. Pay attention to small victories, like making a homecooked meal that everyone in the family will eat. Celebrate improvement rather than focusing on perfection. And give yourself permission to feel disappointed when setbacks happen. Just don’t let them stop you from starting again. And again. MBP

Heidi Smith Luedtke is a personality psychologist and mother of two. She is the author of Detachment Parenting.

$12 per person

Oct 3rd - Oct 31st

o o

n,

m

Magnolia Farms Paintball Now Open! www.magnoliafarmspaintball.com

r d

om

49

www.facebook.com/mobilebayparentsmagazine

A Page in a Book Sharing the Joy of Generosity A pacifier, a bottle, a favorite toy, a security blanket; these are some of the first things that a young child senses are uniquely their own. But as toddlers age into the years of interactive play with their peers, and their landscape of ‘things’ broadens, learning to share can be the difference between frustrated tears and peace in the realm. The following titles explore the natural feelings children experience regarding their possessions (or things they want to possess) and open up positive conversations about sharing. With a focus on the good feelings that sharing can generate, these books give a boost to the joy of generosity!

S

Bernice Gets Carried Away

by Hannah E. Harrison (Dial / Penguin) Bernice is having a lousy time at her friend’s party. She receives the only piece of cake without a frosting rose. The pinata is opened before she even has a chance to take a swing at it (and the only candy she finds from it is one stepped-on gumdrop). But when the balloons arrive, Bernice isn’t taking any chances. She grabs all the balloons – which quickly lift her up and away from the party! As Bernice floats away, she passes others who are having equally bad days. Sharing her bounty of balloons becomes the key to boosting the moods of others as well as getting Bernice back down to the party. Touching on the real feelings that can spark possessive reactions, Harrison’s expressive illustrations relate the journey to generosity with warm humor that will delight both children and adult read-aloud partners.

Red Panda’s Candy Apples

by Ruth Paul (Candlewick Press) Red Panda makes the best sticky and sweet candy apples. So he decides to make some to sell, looking forward to the reward of coins in his jar. But he soon discovers that it’s hard to let go of something that you’d like to keep (and eat) yourself. Red Panda’s brisk business quickly leaves him with only one apple left, and his last two customers fighting over it. When the struggle over the last apple turns to tears, Red Panda remembers a secret solution that will let everyone enjoy a candy apple. Exploring the mixed feelings that we get when we share the things we love, the real joy of giving comes to the fore in this sweet title.

Llama Llama Time to Share

by Anna Dewdney (Viking / Penguin) Children playing together for the first time can be a dance of mutual discovery as they feel out each others boundaries, seek out common interests, and learn what things are sometimes hard to share.

When Llama Llama meets new neighbor Nelly Gnu for the first time, he’s not sure what they will both enjoy playing together. After a cautious start, the two slowly discover a shared interest in building blocks and it looks like the play date is going to be successful. But when Nelly starts to play with Llama Llama’s beloved Fuzzy Llama doll, all bets are off as tears (the wet kind) and tears (the ripping kind) erupt between the new playmates. With parents to help guide the way, Llama Llama and Nelly find a path toward sharing that mends the moment and paves the way toward smoother shared play in the future for these new friends.

Find more A Page in a Book recommendations at www.PageBookReviews.com.

Mobile Bay Parents I September 2015

50

www.mobilebayparents.com

new nat ph ar sto I lo cau ver ab say you com flea me enj few tre can fro Im few sty it m it’s you on. tha wh Wh tip

Se

clo sho ing

k

st

d-

ve

nd

ll

m

ch

ks a’s

ard e

om

Save Money on Your Style:

Shop Vintage Vintage clothing is described as new or second hand garments originating from a different era of time. The phrase is also used in connection with a retail outlet, e.g. “vintage clothing store.” One reason I love vintage is because I can have a very unique yet affordable style. Now I’m not saying everything in your wardrobe needs to come from your favorite flea market/consignment store, but you can enjoy shopping for a few of these pre-loved treasures. Vintage items can cost anywhere from 50 cents to $12.

I myself have found a few items to add to my style, and not only does it make it fun to shop, it’s also an amazing complement when you have people noticing what you have on. The best thing is that only you know that your outfit cost much less than what you would pay in a high end store.

When you shop vintage here are a few tips to use.

Set a BudgetWhether you’re shopping in a used clothing store or looking online, you should try setting a budget before buying anything. Besides, that’s what the

point is anyway, saving money and finding a fun new style. The best part about setting a budget is that if you under spend you can save the money for your next shopping trip.

What are you looking forLook through current designer items and find something that you love now. Then you can look for that same designer’s previous seasons for a similar look at a fraction of the current cost. Chances are, they will have made something similar in the past, especially considering that many styles cycle back every three to five years.

in with your current style. This updates your vintage look a bit more.

AlterationsBe sure that the quality of clothing is durable enough to be altered if needed. You want your clothes to fit properly whether they are vintage or not.

Find a buddyThere is nothing wrong with bringing a friend along. It’s always a great idea to get opinions from your BFF’s.

And rummaging through all those treasures might end up being a fun day for all involved.

Wash your clothes-

Check with friends or familyEnjoy plundering through the closets of friends or family who might have the perfect vintage item for you. If they are still hanging around then its probably a good sign that the clothing/accessories are well taken care of.

Check the quality before buyingEven designer label vintage clothing won’t be valuable if it’s in poor condition. It is important to check for tears, strains and anywhere that the garment has been mended.

Know how to wear current-

Yes, be sure the clothing you purchase can be washed or dry-cleaned.

There is a reason the clothes are called vintage.

Just as you can find vintage pieces to compliment the current fashion trends, you can also use vintage to go against them. With vintage you find classics that have never gone out of style, or you can find off the wall pieces to set yourself apart from the mainstream. So enjoy shopping vintage!

Have fun with the styles and set yourself apart from everyone else. You don’t have to spend a lot of money to look fabulous. Make your style a story to tell.

Laura Handey is an independent clothing consultant in Pike Road, Alabama. You may reach her by email at laura@ centsiblysouthern. com or visit her website at www. centsiblysouthern. com.

If you buy items of clothing that are vintage be aware of how to mix them 51

www.facebook.com/mobilebayparentsmagazine

Family Calendar Ongoing

Civil War Fort Gaines Historic Site, Dauphin Island. For more info call (251) 861-6992. www.dauphinisland.org.

Concerts in the Park Sponsored by Mobile Pops Band. For more info call (251) 679-4876. www.mobilepopsband.com.

Fort Conde Welcome Center Sponsored by Mobile Convention & Visitors Corp.

Mobile. For more info call (251) 208-7658. www.mobile.org.

Gulf Coast Exploreum Science Center Government St. Mon. - Fri. 9 - 5; Sat. 10 - 5; Sun. noon - 5. Adults (19 - 59)/ $14; youth (13 - 18) & senior citizens (60+)/ $12.50; children/ $12; Combo tickets include a viewing of an IMAX film: $18; $17; $15.50.

HandsOn South Alabama (Formerly Volunteer Mobile, Inc.). For information on Local Volunteer Opportunities, contact 251-433-4456, www.handsonsal.org.

History Museum of Mobile • Exhibit “Art of India” open through September 1. “Ark of India: An Alabama Artist Explores Southern Asia” is an exhibit about personal discovery and exploration. It is an account of late 19th and early 20th century India as seen by Alabama artist, Roderick D. MacKenzie, using his paintings, drawings, sculptures, and most importantly, photographs, and writings. Please visit www.museumofmobile.com for more information.

Joe Jefferson Players Mobile. (251) 471-1534. www.jjp.com.

LODA Artwalk Second Fridays in Downtown – LoDa Arts District.

Exhibitions (with receptions) and entertainment in a variety of downtown galleries and other venues. City of Mobile Neighborhood and Community Services.

6 - 9 p.m. Check NCS website for complete list of activities/map after noon the day of the event. For more information, please contact: 251-208-7443 or visit www.ncsmobile.org.

Mobile Ballet For information about performances call (251) 342-2241 or visit www.mobileballet.com.

Mobile International Speedway Irvington. For information call (251) 957-2026. www.mobilespeedway.com.

Mobile Opera Mobile. For information call (251) 476-7372. www.mobileopera.org.

Mobile Symphony Mobile. For information call (251) 432-2010. www.mobilesymphony.org.

Oakleigh Museum House Mobile. For information call (251) 432-1281. www.historicmobile.org.

Richards-Dar House Museum Mobile. For information call (251) 208-7320.

USS Alabama Battleship 2703 Battles Parkway, Mobile. (251) 433-2703. www.ussalabama.com.

VSA Arts & Easter Festival Mobile. For information call (251) 343-0958.

Classes/Meetings

APAC - Mobile County Adoptive Family Group Meets the 4th Friday of each month from 6 - 7:30 p.m.

Regency Church of Christ, 501 S. University Blvd., Mobile. Parent, Youth/Teen Group and Childcare Is Provided. Topic Discussions & ceu’s for foster families are offered. For more information please call 251-460-2727 * 1-800-489-1886 * or estokes@childrensaid.org.

Azalea City Harmony Chorus of Sweet Adelines Meets/rehearses each Tuesday at 7 p.m. at Mobile Christian School, The Leopard’s Den. For more info call 251-380-0579 or visit www.azaleacityharmony.com.

La Leche League Mobile Bay Area Breastfeeding support meetings are held the second Tuesday of each month at 10:30 a.m. and the fourth Monday of each month at 6:30 p.m. Meetings are free and open to all women with an interest in breastfeeding. Babies and children are welcome. For information or support contact a leader. 251-689-2085, amandaLLLmobile@yahoo.

Mobile Bay Parents I September 2015

August/September 2015

com, meghanLLL@yahoo.com, or michelleLLLmobile@ yahoo.com. Facebook: La Leche League Mobile Bay Area.

Mobile Bay Area La Leche League Meetings are the second Tuesday of the month at 10:30 a.m. The number to call for the location is 251689-2085. We can also be found on Facebook at mobile bay area la leche league.

Parent-Child Worship Service Each Wednesday in January and February, Dauphin Way United Methodist Church will offer a new Parent-Child Worship Service from 9:15-10:00 a.m. (room E207) for parents and their children ages birth to four-years-old.

Relaxed and filled with music, prayer, a Bible story and coloring, this new program is a wonderful opportunity to worship with your precious little ones. The program will be short, and then kids can play while parents enjoy social time. Contact Dauphin Way UMC at 251-471-1511 for more information. Dauphin Way UMC is located at 1507 Dauphin Street, Mobile.

The Family Center The Family Center’s classes in Mobile and Daphne are free and offer free childcare WITH minimum 24-HOUR RESERVATION. Night class includes supper and giftcards.

All classes provide a certificate of completion.

The Family Center of Mobile *Nurturing Parenting course teaches parenting skills such as teaching cooperation and peaceful bedtimes.

Wednesdays, 9:30-11:30 a.m., 12-week rotating series.

Call 251-479-5700 to register. *The Responsible Fatherhood Program (RFP) classes are Mondays, Tuesdays and Thursdays from 6-8 p.m., but REQUIRE ADVANCE INTAKE APPOINTMENT. See daily listings for class topics. *Mondays: Together We Can, a cooperative parenting course, 8 weeks. *Tuesdays: Quenching the Father Thirst, (Four things every dad needs to know), 12 weeks. *Thursdays: Chill Skills Stress/Anger Management training, 4 weeks. 251-479-5700 for information on all Family Center classes. All held at 601 Bel Air Blvd, Suite 100, Mobile. www.familycentermobile.org or www.Facebook.com/ FatherhoodMobile Mobile Infirmary Hospital For complete information about class dates, times, and locations, or to schedule a tour of our maternity center, please call (251) 435-2000.

• Alzheimer’s Support Group Meetings for families and caregivers of patients with Alzheimer’s disease. Meets every second Thursday of every month. E.A. Roberts Alzheimer’s Center, 169 Mobile Infirmary Blvd. Preregistration Not required. Free. Call 251-435-6950 for more information. 10-11 a.m.

• Birthing Basics Class This course is for parents who either have already experienced childbirth or who prefer to attend just one class because of time constraints. The four-hour weekend session (with breaks) includes a tour and all birthing information. The fee is $30 for patients delivering at Mobile Infirmary. Pre-registration is required; call 435-2000.

Every last Sunday of the month. 3:30 p.m. - 7:30 p.m.

• Cancer Support Group Meets every 4th Tuesday of the month from 10-11 a.m.

• Gastric Band Support Meets every 3rd Thursday of the month from 6-7 p.m.

• Gastric Bypass Support Meets every 2nd Thursday of the month from 6-7 p.m.

• Preparation for Childbirth Series This series of classes includes all aspects of labor including natural coping skills and epidural anesthesia. Class participants will practice comfort measures and learn about post-delivery and newborn care. A maternity tour is included.

Providence Hospital: www.providencehospital.org Providence Hospital is pleased to offer a variety of classes on childbirth issues. All classes are located in Conference Room I (located just inside the main lobby doors of the hospital beside the Gift Shop) unless otherwise specified.

To register for classes or for more information, you may call 639-2938 to speak with our Childbirth Educator, Kathy Wade RN, or email kwade@providencehospital.org. For Daytime Breastfeeding classes only, you may call Marcia Ranew RN, our Lactation Consultant at 633-1749 or email mranew@providencehospital.org.

52

F

Support Groups • Providence Hospital Breast “Friends” Meets the second Friday of every month at noon in the Moore Conference Room. The Moore Conference Room is located in the cafeteria. Call Robi Jones for more information, 251-639-2852.

• Diabetes Support Group Classes meet in the Diabetes Center, Suite D-436 in the Providence Medical Office Plaza. Call 251-633-1987 for more information.

wor Thu beh Cre are clas Wo St.,

Spring Hill Medical Center: www.springhillmedicalcenter.com • Better Breathers Support Group Meeting For people with pulmonary disorders. Meets on the fourth Monday of each month. 2-3 p.m. Gerald Wallace Auditorium. For more information, call 461-2438.

• Breastfeeding Class One Wednesday per month. 6:30-8:30 p.m. at The Family Center. Benefits of breastfeeding, getting started, going back to work and FAQs are covered. Call 340-7770 early to pre-register.

• Childbirth Preparation Classes Four consecutive Mondays (6:30-9 p.m.) at The Family Center. Register early. The class covers onset of labor, inductions, Cesarean sections, relaxation, anesthesia and postpartum. Includes a tour of the maternity units. Cost: $25 if delivering at Springhill Hospital. Call 340-7769 early to pre-register.

• Childbirth Preparation: Accelerated Course One Saturday per month. 8:30 a.m. – 3 p.m. at The Family Center. Ideal for those who live out of town or will be delivering soon. $25. Call 340-7769 early to pre-register.

• Me, Too! A Tour for Siblings Noon on the First Sunday of the month. Join us for an individualized tour and instruction for siblings ages 9 and younger. The event includes a tour of the maternity areas and tips on helping parents with the new baby. Parents must remain with their children. By Appointment ONLY. Call 340-7769 to schedule an appointment.

• Infant CPR Learn this potentially life-saving technique while you are pregnant or soon after your baby’s birth. Covers infant CPR and choking. $5 if delivering at SMC. 6:30 p.m. - 8 p.m. The Family Center (Bldg. 2, Fourth Floor). Call 3407769 early to pre-register.

• NAMI Mobile Support Group A support group for family members of those who suffer from mental illness. Meetings are held the third Monday of every month. For more information: Diane Kent at 5918021. 6-7 p.m., Spring Hill Baptist Church Activity Center.

• Resolve Through Sharing For parents who have lost a child before or immediately after birth. Meets the fourth Monday of every month, 7-8 p.m. Gerald Wallace Auditorium. Call 460-5323.

Scr Join Spr to f yea and you com fest for Libr Joh HU Com 6S mo

USA Children’s & Women’s Hospital www.usahealthsystem.com/usacwh Classes: Advance reservations are required and may be made by calling 415-1069. No children at classes, please. Class size is limited. Advanced payment required to secure your reservation. If you are expecting multiples or having a c-section, please call for additional class information.

• Preparing for Childbirth All-day Saturday class for the expectant mother and her support person (coach). Topics include: pregnancy changes, labor, role of the support coach, relaxation and breathing techniques, vaginal and cesarean births, postpartum care, and a tour of the maternity areas. Fee per couple: $30. You should plan on beginning the 3-week series when you are approximately 28 weeks pregnant. Class will meet in the CWEB2 Building behind the hospital. Every other month, 9-2.

• Childbirth in a Nutshell This class includes a brief overview of labor and a tour of the maternity areas. Class meets first Tuesday every other month from 6:30-9 p.m. in the CWEB2 Building behind the hospital. Fee per couple: $15.

• Breastfeeding This one-night class is for expectant and newly delivered mothers and their support persons who want to learn about breastfeeding. Topics include advantages, myths and facts, getting started, correct positioning, latching on, engorgement, returning to

www.mobilebayparents.com

S

S

5R Dis and film Sou of f Riv Ple Fift Op We del –8 per Ope

M

HU Ru HU 7:3 com Au Wi Aud will from Poe The Chr mid dat info

W

Au Wi See

T

Mo 201 Mo by Exp the pre to s larg

15

Family Calendar work and problem-solving. Class meets second Thursday from 6:30-8:00 p.m. in the CWEB2 Building behind the hospital Fee: $5. Registration Information: Credit card payments are accepted by calling 415-1685. Mail payments for classes to: University of South Alabama, Children’s & Women’s Hospital, Education Department, 1700 Center St., Mobile, AL 36604.

Saturday, August 22

ily to

d : rly

mily

.

d as

8 -

1r.

8

be

are

ur ery g

t

om

Screen on the Green Join us for family-friendly movies on Dorn Field at Spring Hill College - FREE! Our movie line-up is geared to families with children. Do something different this year, grab your kids and a few of their friends, blankets and chairs and watch a movie under the stars! Thank you to Rouses Supermarket who has generously committed to being the sponsor of the 2015 film festival events! Thank you also to Spring Hill College for letting use Dorn Field (located behind the Moorer Library). Movie will be Home playing at 7:45.

John Hiatt and The Combo and Taj Mahal Trio HUKA Entertainment Presents John Hiatt and The Combo and Taj Mahal trio at the Saenger Theatre, 6 South Joachim Street, Mobile. Please visit www. mobilesaenger.com for more information.

Sunday, August 23

5 Rivers KID’S Sunday Matinee Disney’s, “The Emperor’s New Groove”. Come out and join us every Sunday for a free family, friendly film. This week’s program is a Disney favorite about a South American emperor that experiences a reversal of fortune when his advisor turns him into a llama. 5 Rivers (30945 Five Rivers Boulevard, Spanish Fort).

Please visit www.Alabama5Rivers.com for information.

Fifth Annual Summer Sunday Soiree for Mobile Opera We hope you will join us for a great evening of delicious dining and great music. Join us from 5:30 – 8:00 p.m. at Ruth’s Chris Steakhouse. Cost $125 per person. Reservations required. Please call Mobile Opera (251) 432-6772 for more information.

Monday, August 24

HUKA Entertainment & AEG present Todd Rundgren HUKA Entertainment & AEG present Todd Rundgren at 7:30 at the Saenger. Please visit www.mobilesaenger. com for more information.

Auditions for Playhouse in the Park Fall and Winter Shows Auditions for “Edgar Allan Poe” and “A Christmas Carol” will be held Monday and Wednesday, August 24 and 26 from 6:30 – 8:00 p.m. at the Playhouse. “Edgar Allen Poe” auditions are open to ages 13 to mid-twenties.

The show runs the last two weekends in October. “A Christmas Carol” auditions are open to ages 6 through mid-20s. The show runs in early December; final dates TBA. Check the website for updates! For more information, please visit www.playhouseinthepark.org.

Wednesday, August 26 Auditions for Playhouse in the Park Fall and Winter Shows See August 24 for more information.

Thursday, August 27

Mobile Chamber of Commerce Business Expo 2015 Mobile Chamber of Commerce Business Expo presented

by Blue Cross and Blue Shield of Alabama, the Business Expo is Thursday, August 27 from Noon - 5 p.m. at the Arthur R. Outlaw Mobile Convention Center. This premier annual event gives members an opportunity to showcase their products and services at Mobile’s largest business-to-business trade show. Last year’s

August/September 2015

event sold out with 230 companies participating! Please visit www.mobileconventions.com for more information.

Friday, August 28

Reel Hope Classic Fishing Tournament The inaugural Reel Hope Classic fishing tournament is set for August 28-29 at the Orange Beach Marina (27075 Marina Road). This event hosted by the Mobile Big Game Fishing Club, will benefit patients treated at the Alabama Center for Childhood Cancer and Blood Disorders at Children’s of Alabama. The Reel Hope Classic will kick off the tournament weekend with the Captains’ Meeting and pre-party at 6:30 p.m. on Friday, August 28, at the Orange Beach Marina. Participating crew members can bring one guest each to enjoy dinner, drinks, live music, and a live auction. On Saturday, four-man teams can compete in categories including inshore fishing for $250 per boat and offshore fishing for $500 per boat. A jackpot category is also available for an additional $25 per boat. All boats must be under the bridge at Orange Beach Marina by 6 p.m.

Weigh-in will run from 4-8 p.m. Individuals can register under the “Land Lubber” category to fish from the Gulf State Park Pier in Gulf Shores for $25 per person. To register or get more information about the tournament, visit give.childrensal.org/reelhope or call Kerrie Benson at (251) 610-4969. Facebook page (facebook.com/ ReelHopeClassic).

Saturday, August 29

MDA Muscle Walk Through MDA Muscle Walk, you can join forces with others to raise critical dollars that will make a real difference in the lives of people fighting life-threatening muscle disease in your community and across the nation. Funds raised through the Muscle Walk program build on decades of MDA research progress, helping push science to its limits in the search for treatments and cures. The dollars we raise also support MDA’s lifeenhancing programs, including state-of-the-art clinics, support groups and MDA summer camp — where kids with muscle disease can enjoy “the best week of the year.” 4:00 p.m. at Hank Aaron Stadium. Please contact Emilee Long at (334) 396-4534 or elong@mdausa.org.

The Dauphin Street Beer Festival Grab your friends, grab your mug and get ready to taste a bevy of brews! That’s right, the Dauphin Street Beer Festival is back and we are gearing up for a record year. With only craft beer offerings, we expect quite a few new beers to be on the sampling menu.

Time is 6-9 p.m. Call (251) 208-1550.

Reel Hope Classic Fishing Tournament See August 28 for more information.

Sunday, August 30

5 Rivers Sunday Matinee “Animal Misfits” Come out and join us every Sunday for a free family, friendly film. This week’s program looks at a collection of implausible creatures at first glance seem illequipped for survival. Somehow these creatures are able to thrive, and prove that being different and highly specialized can give you an edge. 5 Rivers (30945 Five Rivers Boulevard, Spanish Fort). Please visit www.

Alabama5Rivers.com for more information.

Alabama Cruise Terminal in Mobile. Guests will enjoy the favorite dishes of some of our area’s most prestigious chefs, live entertainment by Roman Street, a vast silent auction, and complimentary beer, wine and spirits. All proceeds from Chef Challenge are used to help those in need within our 24-county service area along the Central Gulf Coast. If you’d like information about Chef Challenge, or if you are interested in participating, contact Stephanie Snyder at (251) 653-1617 ext. 141 or ssnyder@ bayareafoodbank.org.

Night Market at Mobile Museum of Art MMofA hosts a quarterly Night Market of artist and artisan wares. Bring a keen eye for detail and become known for the unique gifts you give. Rack your friends with jealousy for your rare, artful home décor. Support your local artists and join the party and shopping fun with great food, drink, and live music. The Mobile Museum of Art, 4850 Museum Drive. 5:00 p.m. - 9:00 p.m. Please visit www. mobilemuseumofart.com for more information.

The Archduke Trio Concert The Archduke Trio in concert presenting music of Haydn, Schumann and Shostakovich will perform at 7:30 p.m. at the University of South Alabama Laidlaw Performing Arts Center Recital Hall. Concert admission, $8 general admission and $5 for USA students/faculty/staff /senior citizens/youths under 18. For more information, please visit www.southalabama.edu/music.

Wednesday, September 9

Learning Lunch at History Museum of Mobile Join us to explore new perspectives on the history and culture of Mobile, Southern Alabama, and the Gulf Coast. Each program begins at noon – bring your lunch and enjoy complimentary beverages! 12:00 p.m. 1:00 p.m. at 111 S. Royal Street. For more information about the Learning Lunch program, contact: Howard McPhail, Curator of Minority History at (251) 208-7557 or howard.mcphail@cityofmobile.org.

Fall Brown Bag in Bienville Square See September 2 for more information.

Thursday, September 10

Girls Just Wanna Have Fun for Ronald McDonald House ‘Girls Just Wanna Have Fun’ fundraiser benefits the Ronald McDonald House Charities of Mobile on from 5:30 – 9:00 p.m. at the Alabama Cruise Terminal.

This “must do” event is an evening for ladies 21 years of age and older and features heavy hors d’oeuvres from local area chefs and restaurants, McTini’s and an unforgettable evening of manicures, make-overs, shopping, entertainment and more. Tickets for Girls Just Wanna Have Fun are available for $50 in advance or for $60 at the door. Attendees also have the opportunity to purchase tickets for a stylish “PurseOnality” at $25 or $50 which includes a purse – and a surprise gift inside valued at that (or more!). Please visit rmhcmobile.org/girls-just-wanna-have-fun for more information.

Mobile Museum of Art – Docent Tours Take a guided docent tour of the exhibition Black Hands: I Am in our Regional Gallery featuring pottery by regional and acclaimed artist Charles Smith. This is a free Thursday night program. Sign up in person for a tour at either 5, 6, 7 or 8 p.m. Mobile Museum of Art (4850 Museum Drive). Please visit www. mobilemuseumofart.com for more information.

Wednesday, September 2 Friday, September 11 Fall Brown Bag in Bienville Square Fall is back and so is live jazz! Brown Bag your lunch and sit under the swirl of the oak trees in Bienville Square. Live music provided by the City of Mobile Special Events Dept. and Catt Sirten. Wednesdays, Sept 2 through Oct 28 from 11:30 a.m. - 1:30 p.m.

Thursday, September 3 17th Annual Chef Challenge The 17th annual Chef Challenge will be held at the

53

LoDA Artwalk Second Fridays in the LoDA Art District have become quite a popular time and place to be! With the LoDa ArtWalk in its 8th year, the event seems to be getting better each month. Join downtown art galleries, institutions, studios and unique shops as they open their doors and welcome you inside to see beautiful artwork, sample delicious foods and hear the sounds of the LoDa Artwalk. Join us downtown. For more information, please visit www.ncsmobile.org.

www.facebook.com/mobilebayparentsmagazine

Family Calendar “Never Forget” Free Lunch for First Responders The Original Oyster House restaurants will honor Mobile and Baldwin County law enforcement, firefighters, paramedics and sheriff officers by offering a free “Never Forget” Lunch at either the Gulf Shores or Mobile Causeway location on Friday, September 11, from 11 a.m. to 4 p.m. Just show your ID or better yet wear your uniform so we may recognize you with a handshake or pat on the back,” stated Joe Roszkowski, CEO and president of Superb Foods/Original Oyster House restaurants. In memory of 9/11, LifeSouth Community Blood Centers will also be on hand at the Causeway restaurant for blood donations.

Saturday, September 12

Screen on the Green Movie Join us for family-friendly movies on Dorn Field at Spring Hill College - FREE! Our movie line-up is geared to families with children. Do something different this year, grab your kids and a few of their friends, blankets and chairs and watch a movie under the stars! Thank you to Rouses Supermarket who has generously committed to being the sponsor of the 2015 film festival events! Thank you also to Spring Hill College for letting use Dorn Field (located behind the Moorer Library). Movie will play at 7:15 p.m.

Black Jacket Symphony presents Allman Brothers Band Eat a Peach Black Jacket Symphony presents Allman Brothers Band Eat a Peach at 8:00 p.m. at the Saenger Theatre (6 South Joachim St). Please visit www.mobilesaenger.com.

Mobile Heart Walk 2015 The Mobile Heart Walk takes place at 9:00 a.m. at the University of South Alabama Mitchell Center (5950 Mitchell Center). Visit mobileheartwalk.kintera.org for information.

Hurricane Run 5K and Fun Run Hurricane Run 5K and Fun Run starts at Dauphin Island Sea Lab, Dauphin Island organized by the Port City Pacers.

The 5K starts at 8:10 a.m. and the Fun Run at 9:00 a.m. Register by mail (entries should be postmarked by September 5), in person at McCoy Outdoor or Run-N-Tri in Mobile or Running Wild in Fairhope until noon on the Thursday, September 10, or online (go.events.com/#/ event/1616) until 4 a.m. Friday, September 11. Packet pick-up and race day registration at DI Sea Lab from 6:45 - 7:40 a.m.

Wednesday, September 16 The Price is Right – Live Stage Show The Price Is Right Live is the hit interactive stage show that gives eligible individuals the chance to “Come On Down” to win. Prizes may include appliances, vacations and possibly a new car! Play classic games from television’s longest running and most popular game show from Plinko, to Cliffhangers, to The Big Wheel, and even the fabulous Showcase. Playing to near sold out audiences for nearly nine years, The Price Is Right Live! has given away more than 10 million dollars in cash and prizes and sold more than 1.2 million tickets. If you enjoy the rush of emotions experienced while watching the show on television, just imagine the possibilities if you were actually in the audience watching it live. Saenger Theatre (6 Joachim Street) at 7:30 p.m. Please visit www.mobilesaenger.com for more information.

Fall Brown Bag in Bienville Square See September 2 for more information.

Thursday, September 17

Food and Folly Event Join us from 6:30-9:30 p.m. at Fort Whiting for United Cerebral Palsy of Mobile’s Food and Folly. Its Mardi Gras in September and everyone is invited. Enjoy a variety of dishes from local eateries. Live music from the Excelsior Band. A wine grab, silent auction, and wine tasting. Please contact Kenny Sheets at (251) 479-4900 or ksheets@ ucpmobile.org or visit squareup.com/market/ucpmobile to purchase tickets.

Live at the Museum Enjoy a night of live music at Live at the Museum featuring musician Gregg Fells at the Mobile Museum of Art. A local

Mobile Bay Parents I September 2015

August/September 2015

Mobilian, Gregg Fells has captivated audiences with his soulful blues and his passionate melodies. This Thursday night event will have an admission of $10, and beer and wine by donation. Mobile Museum of Art (4850 Museum Dr.) at 7:00 p.m. Please visit www.mobilemuseumofart.com for more information.

Mobile Theatre Guild presents One Act Festival Last Season, we brought you our first One Act Festival, and it was an unqualified hit! Since you can’t get too much of a good thing, we’re opening the stage again to a selection of new directors who are anxious to show their talent and bring something a little different to our stage!

You’ll have an opportunity to see a variety of shows over the course of an amazing, fun-filled weekend! September 17-20 at Mobile Theatre Guild (14 Lafayette St). Please visit mobiletheatreguild.org for more information.

Friday, September 18

Artworks The Throwdown Mobile Arts Council is hosting one-of-a-kind silent auction/ loud party features a competition like none other seen in Mobile. Five artists will compete in a battle of creativity. While watching the competition and bidding, party goers can enjoy dancing to the spins of local D.J. Hunter Clark, food provided by Heroes and The Royal Scam, plenty of beer, wine and, of course, MAC’s signature cocktail: “The Red Rooster”.

ART Works is the Mobile Arts Council’s largest annual fundraiser. All proceeds go to support our mission of bringing people and art together. Tickets available at brownpapertickets.com.

Drawdown for the Clown It’s time for our Fifth Annual Drawdown! This year all proceeds will benefit our local Ronald McDonald House.

Tickets & T-Shirts will be on sale this week. Please invite your friends and family - this will be a fun night for a great cause. Meat Boss will provide the food and Ryan Balthrop will be playing so go ahead and put it on your calendar! Location: The Grand Hall (3556 Halls Mill Road) at 6:00pm. Please visit www.facebook.com/ events/855038911254378 for more information.

Mobile Theatre Guild presents One Act Festival See September 17 for more information.

Saturday, September 19

Go Run 5K/1 Mile Fun Run The annual “GO” for Gynecologic Oncology, a 5K and one mile Fun Run/Walk presented by Catranis Family Charitable Foundation, will be held at 8 a.m. (5K) and 9:00 a.m. (Fun Run) at the University of South Alabama Moulton Tower & Alumni Plaza to benefit gynecologic cancer research at the University of South Alabama Mitchell Cancer Institute (MCI). The event will include prizes, music, vendor booths, food, and children’s activities. Families, schools, corporations and friends are encouraged to form teams of six or more to participate. Each team will be eligible to win awards for a variety of categories for example team with most members, most spirited team, best dressed team, and many more. Individual awards will also be given in all age categories. For sponsorship and registration information visit www.usamci.com/gorun.

28th Annual Alabama Coastal Cleanup The Alabama Department of Conservation and Natural Resources (ADCNR) along with Alabama People against a Littered State (AL PALS) will sponsor the 28th Annual Alabama Coastal Cleanup from 8 a.m. to noon. The event gives residents in Mobile and Baldwin counties, as well as inland counties, the opportunity to give back to the environment and their surrounding communities by cleaning up along the coast and waterways and within their cities. Volunteers—involved citizens, community organizations, businesses, individuals, school groups and families—are needed to help with the Coastal Cleanup. Participants can find a cleanup zone near them at www.AlabamaCoastalCleanup.com.

All supplies are provided, and volunteers who come out early will receive a free t-shirt.

MSPCA Run for Rescues 5K and Fun Run Join us at Medal of Honor Park for MSPCA Run for

54

Rescues 5K and Fun Run. All proceeds go to the Mobile SPCA. Please visit www.productionsbylittleredhen.com for more information.

Mobile Theatre Guild presents One Act Festival See September 17 for more information.

Sunday, September 20

Mobile Theatre Guild presents One Act Festival See September 17 for more information.

Wednesday, September 23 Southwest Alabama Workforce Development Council (SAWDC) Worlds of Opportunity A project of the Southwest Alabama Workforce Development Council (SAWDC), the SAWDC Worlds of Opportunity is a hands-on career expo for 8th grade students in the eight counties of Southwest Alabama held at the Civic Center in Mobile. The 5th annual event held in September 2014 hosted 9,700 students, 970 teachers, counselors and parents. The purpose of the event is to expose students to careers available locally and to demonstrate what each career involves through an interactive, engaging series of activities. The decision to target 8th grade students was a strategic one; eighth grade is a critical year for students as they are deciding on coursework pathways for the remainder of their high school years and beyond. For More Information Visit: www.worldsofopportunity.com.

Fall Brown Bag in Bienville Square See September 2 for more information.

Thursday, September 24

Mobile Fashion Week Mobile Fashion Week (MFW) celebrates its 5th anniversary with shows being held on location at the Warehouse District at Mobile Aeroplex. Mobile Fashion Week’s opening night is Thursday, September 24th to include local salons during the famed Hair Show. Friday, September 25th presents the popular Fashion’s Night Out and Saturday, September 26th will conclude Mobile Fashion Week with The Finale. Doors will open each night at 6 p.m. Showtime is set for 7 p.m. and events will conclude each night at 10 p.m. Sponsors for Mobile Fashion Week 2015 include: Mobile Airport Authority, 92ZEW, Coca Cola and Southern Light. While the event offers the fashion community along the Gulf Coast to showcase their collections, it also serves as a fundraiser for charity. Proceeds are distributed to the following charities: Camp Rap-A-Hope, Eye Heart World, and Children with Hair Loss. For more information visit us at: www.mobfashionweek.com.

CCA Fall Out 2015 Fall Out 2015 is hosted by Coastal Conservation Association Alabama’s Eastern Shore Chapter and will be held at Five Rivers Delta Resource Center (30945 Five Rivers Boulevard, Spanish Fort). This event will be held from 5:30-9:00 p.m.

Please visit www.ccaalabama.org for more information.

Mobile Museum of Art – Docent Tours Join us for a docent-led tour through two exhibitions: Landscapes from the Collection of MMofA and The New Landscape. See paintings, prints, photography and mixed media approaches to our southern scenery past and present. This is a free Thursday night program.

Sign up in person for a tour at either 5, 6, 7 or 8 p.m.

Location: Mobile Museum of Art (4850 Museum Drive).

Please visit www.mobilemuseumofart.com for more information.

Southwest Alabama Workforce Development Council (SAWDC) Worlds of Opportunity See September 23 for more information.

Friday, September 25 Mobile Fashion Week See September 24 for more information.

Saturday, September 26 St Jude’s Walk/Run to End Childhood Cancer Join St. Jude supporters in Mobile/Baldwin County and

www.mobilebayparents.com

F

in 5 End Chi Aw the can Eas Spa mo Gu Gu 26.

Ba Bay Sat the 5K at 9 Foo rac priz info mo Mo Ro Int ma sea per for pro Pin exh are mo Ta Com fab

15

bile om

l

l

23

of

ent

he ly gh

r om.

ry

ng s

Family Calendar in 58 cities nationwide in the St. Jude Walk/Run to End Childhood Cancer to raise money for St. Jude Children’s Research Hospital. During Childhood Cancer Awareness Month, we‘ll help St. Jude change the way the world understands, treats and defeats childhood cancer and other life-threatening diseases. Location: Eastern Shore Centre, 30500 State Highway 181, Spanish Fort. Please visit www.stjude.org/walkrun for more information.

Gulf Quest National Maritime Museum Opening Gulf Quest Museum opening is scheduled for September 26. Please visit gulfquest.org for more information.

BayFest 5K & Fun Run BayFest will host its 9th Annual 5K Run/Walk on Saturday, September 26th to kick off the beginning of the 2015 BayFest Music Festival on September 26. The 5K race will start at 8:00 a.m. and Fun Run will start at 9:00 a.m. in Bienville Square in downtown Mobile.

Food, beverages, and music will be provided after the race. All registered participants will be eligible for door prize drawings - you must be present to win. For more information, Please visit www.bayfest.com/5k.php for more information.

Mobile Symphony Orchestra presents Under the Roman Sky Internationally renowned guitarist Pablo Sainz Villegas makes a triumphant return to Mobile to kick off the season with music inspired by southern climates. Pablo performs a new guitar concerto written especially for him by the legendary guitarist Sergio Assad. The program ends as Respighi’s awe-inspiring tone poem Pines of Rome conjures up the most glorious and exhilarating images of southern Europe. Performances are September 26 and 27. Please visit www. mobilesymphony.org for more information.

Taste of the Bayou Come join Taste of the Bayou from 6-10 p.m.! Sample fabulous food prepared with the freshest ingredients

August/September 2015

harvested in our own backyard-the Gulf of Mexico.

Bayou La Batre Community Center at 12745 Padgett Switch Rd., Irvington. Please visit tasteofthebayou.org for information.

27th Annual Jubilee Festival The Jubilee Festival will feature up to 130 of the finest artists and craftsmen in the region. The Eastern Shore Chamber expects more than 30,000 patrons to attend this year. Those attending will also find a delicious assortment of unique festival foods. Kids Art at Jubilee Festival returns to Centennial Park again this year. It is a great opportunity to provide children hands-on experience in learning and exploring their creative side.

Kids enjoy such activities as fence painting, creating wooden structures, fish prints, puppet making, and more. As always, the fantastic entertainment on stage at the Jubilee Fest showcases the best acts in the region.

September 26th & 27th, 10:00 a.m. - 5:00 p.m. Main Street (Scenic 98) in Olde Town Daphne, in front of City Hall and in Centennial Park. For more information call the Eastern Shore Chamber of Commerce at (251) 6218222 or visit www.eschamber.com.

Mobile Fashion Week See September 24 for more information.

Sunday, September 27

Mobile Symphony Orchestra presents Under the Roman Sky See September 26 for more information.

Tuesday, September 29

USA Symphony Band and Wind Ensemble Concert USA Symphony Band and Wind Ensemble Concert will be held at 7:30 p.m. at the University of South Alabama Laidlaw Performing Arts Center Recital Hall.

Concert admission is $8 general admission and $5 for USA students, faculty, staff, senior citizens and youths under 18. Visit www.southalabama.edu/music.

Wednesday, September 30 The 12th Annual Alabama Coastal BirdFest The 12th Annual Alabama Coastal BirdFest is Sept.

30–Oct. 3. This year, the festival expands to offer more of what you love about “LA” (Lower Alabama) by becoming a “birding & nature festival!” We will still offer your favorite expertly guided birding trips to prime spots along the Alabama Coastal Birding Trail, but we are adding exciting new trips—on foot and by boat—that focus on more of our great outdoors. You’ll see and learn more about alligators, dolphins, wildflowers, pitcher plants, pine forests, butterflies, snakes, turtles, and more. This year’s expanded Alabama Coastal BirdFest features 15 brand new trips and adventures.

Visit www.alabamacoastalbirdfest.com.

Fall Brown Bag in Bienville Square See September 2 for more information.

We make every effort to ensure the accuracy of this information.

However, you should always call ahead to confirm dates, times, location, and other information.

Monday, September 28

Please send your calendar events to lynn@ mobilebayparents.com.

City of Semmes Presents “The Mobile Pops” The City of Semmes presents “The Mobile Pops” free concert at 7:00 p.m. at Mary G. Montgomery High School (4275 Snow Rd N, Semmes). Please visit www. cityofsemmes.org for more information.

me

: n ng es e

DOWNTOWN

s

MOBILE, ALABAMA

ion e ard, m.

New VIP options are available while they last! Amenities include private parking, reserved front of stage seating, a separate cash bar and air-conditioned restrooms!

e).

om

SHINEDOWN • CAGE THE ELEPHANT • JUSTIN MOORE • THREE DAYS GRACE • KIP MOORE • SLASH FEAT. MYLES KENNEDY & THE CONSPIRATORS SEETHER • RANDY HOUSER • ELI YOUNG BAND • TRAVIS TRITT • GEORGE CLINTON AND PARLIAMENT FUNKADELIC • ST. PAUL & THE BROKEN BONES

JOHNNY GILL • CHRISETTE MICHELE • ERIC PASLAY • BLACK STONE CHERRY • WILLIE CLAYTON • MANCHESTER ORCHESTRA • CALVIN RICHARDSON • OB BUCHANA • THE SWON BROTHERS GRAMMY ALL-STAR NIGHT FEAT. MALCOLM JAMAL WARNER, BARRINGTON “BO” HENDERSON & DENNIS “FINGER ROLL” NELSON • WENDELL B • VICK ALLEN • MS. JODY • THE VESPERS • KRISTY LEE & DIRT ROAD REVIVAL

THE JOE TAYLOR GROUP • CRYSTAL PISTOL • AND MANY MORE!

For more information, festival line-up and general admission tickets, visit www.bayfest.com 55

www.facebook.com/mobilebayparentsmagazine

Fantastic Four

Shaun the Sheep Movie

MPAA Rating: PG-13 Overall: BViolence: D+ Sexual Content: ALanguage: C Alcohol / Drug Use: C+ The MPAA has rated Fantastic Four PG-13 for sci-fi action violence and language.

Reed Richards (Owen Judge) and Ben Grimm (Evan Hannemann) are grade school chums who manage to build a device that can transport a small object to some unknown destination and then bring it back. At a high school science fair a few years later the miracle leaves their teachers unimpressed, however it does catch the attention of Dr. Franklin Storm (Reg Cathey), the director of a government sponsored research program for young prodigies. He is intrigued to discover these young men have figured out the missing piece for a stalled project his team has been working on.

Certain he can convince the board to resume funding for the “Quantum Gate”, Storm offers Reed (Miles Teller) and Ben (Jamie Bell) a scholarship at the Baxter Foundation where they are invited to help complete the experiment.

Although Ben declines, Reed enthusiastically accepts and is soon working with Storm’s scientist daughter Sue (Kate Mara) and lab technician son Johnny (Michael B. Jordan). The doctor also brings back an expelled student named Victor Von Doom (Tony Kebbell) because the rebellious young adult is the original brain behind the matter-moving machine.

In short order the team pulls together to create a transporter big enough to send a life form to the mysterious destination. After a chimpanzee returns alive, the group is convinced the device is ready for human travel. And they want to be first to explore what they are sure is a new world in a different dimension. However, their success has been brought to the attention of the bureaucrats who now demand the project be turned over to NASA. Of course Reed, Johnny and Victor are not happy with that suggestion. After late night drinking, they make the impulsive decision to use the transporter without permission. Bringing Ben along, they head out on the adventure of a lifetime.

It turns out getting there is easier than expected. Full of pride at their achievement, the gang can’t help but take a selfie. Nor can they resist the urge to do a little exploring of the new realm. Yet in their eagerness they make contact with a strange energy force so powerful that only three of them manage to make it back. Victor is left for dead. And upon their return, Sue is also exposed to the remains of the powerful surge. Like a box of assorted chocolates, the experience affects each person very individually, leaving them with a unique ability. The military is quick to look for ways to exploit these new capabilities until a new and more formidable foe emerges.

The latter portion of the script is consumed with a showdown between this ultimate villain and the four fledgling super heroes. The resulting violence is quite graphic. This, along with periodic scatological slang and other profanities, constitute a few reasons why parents may want to be cautious.

MPAA Rating: PG Overall: B Violence: BSexual Content: B+ Language: A Alcohol / Drug Use: AThe MPAA has rated Shaun the Sheep Movie PG for rude humor.

You can take the sheep off the farm and send them to town... but things are likely to get a little woolly. At least they do for Shaun the Sheep (voice of Justin Fletcher) and the rest of his flock.

Like many people stuck on the treadmill of life, Shaun is a little tired of the daily farm routine. Sleep. Eat. Sleep. Repeat. He wants a day off -a day to kick back and turn on the telly. The only problem is Farmer Sparks (voice of John Sparkes) is a firm believer in maintaining a schedule.

After enduring another to-do list day, Shaun decides to take things into his own cloven hooves. Lulling the farmer to sleep with the old counting sheep trick, he and the rest of the flock lock the man inside a travel trailer and take over the house. However just as they are about to settle down with a movie and pizza, the trailer begins to roll down the road and into The Big City with the snozer inside.

Aardman Animations has made a name for itself with charming claymation films such as the dog and master duo Wallace & Gromit, and a coop full of escapees in Chicken Run. Now the studio is giving television star Shaun the Sheep a shot at the big screen. Twenty animators were hired to work on the project, each creating about two seconds of footage a day.

While the film has the same look as their other productions, there is no dialogue other than some grunts, groans and animal sounds. The lack of narrative makes this film easy to follow as long as you keep your eyes on the screen. It also means the jokes in this film are all sight and sound gags. Droopy pants, exposed underwear, a man on a toilet and a few other slightly distasteful scenes are played for laughs, along with some burps and flatulence. While the plot includes moments of peril and violence, the scariest depiction for very young children will likely be the animal containment officer (voice of Omid Djalili) who uses a high-powered gun to capture his victims.

Overall Shaun the Sheep is a less complicated and less entertaining movie that previous Aardman animations. Still, the lack of language may also mean it may have a broader appeal to audiences of all ages and cultures.

What Parents need to know about Shaun the Sheep...

What Parents need to know about Fantastic Four...

Violence: An animal bylaw officer snares his victims with a large clasp.

Later he uses a taser-like weapon to stun his victims. He also chases animals with a large scythe. Characters experience numerous moments of peril.

Sexual Content: A man’s droopy pants reveal part of his buttocks on several occasions. A man flirts with a woman. Some mild sexual innuendo is included. A character is photographed in the nude for a magazine spread (no actually nudity is shown).

Language: None noted.

Alcohol / Drug Use: A character mixes a drink and serves it in a martini glass. A character is given a bottle of wine. One character sips wine during dinner.

Violence: A child is verbally abused and slapped. Experiments result in explosions, property damage and power failures. An animal used in an experiment looks frightened, but is unharmed. Victims of an accident suffer from injuries and strange mutations. A body is shown engulfed in flames, but is not consumed by the fire. Characters are used as weapons to achieve military goals – some combat situations are shown. Characters are killed on screen -- splatted blood, gruesome burns and battered corpses shown. Characters engage in a battle using super powers; injuries and deaths ensue. A black hole sucks up people.

Sexual Content: A naked character is shown; no private body parts revealed.

Language: A sexual hand gesture is shown. The script includes the use of mild profanities, scatological slang, crude words and terms of deity.

Alcohol / Drug Use: Characters drink alcohol and become inebriated.

Mobile Bay Parents I September 2015

56

www.mobilebayparents.com

Back to school, back to the dentist!

Visiting the dentist is just another important item on your child’s back to school list. Oral health issues can cause dental pain, absences from school for kids and work for parents, and poor performance in the classroom. So, give your child the best shot at a bright smile and a bright future with a trip to the dentist this fall.

Remember Medicaid covers dental care. To find a Medicaid dental provider visit www.adph.org/oralhealth and click “Find a dentist.�