The new international magazine about corrosion control and prevention
Protective Coatings ÂŽ
ISSN 2282-1767
ipcm_PC digital on
www.myipcm.com 2015 4th Year Quarterly N°16-December
Pipeline Coating 2016 Images courtesy of: Shawcor, Canusa-CPS, Dhatec, a Shawcor Company, LOGSTOR Oil and Gas Division and Bayou Wasco Insulation, LLC
Global conference on pipeline protection technology and markets
Key speakers include: ExxonMobil Development Co., Osaka Gas, N.V. Nederlandse Gasunie, Shawcor, Aegion, Tenaris, Welspun and many more ...
16-18 February 2016 Austria Trend Hotel Savoyen, Vienna, Austria
SPECIAL OFFER: Save ₏110 if you register before 18th December 2015 HEADLINE SPONSOR
Organised by: Applied Market Information Ltd.
Also sponsored by:
Media supporters:
For more information contact: Becca Utteridge, Senior Conference Organiser at rju@amiplastics.com +44 117 314 8111
Una realtà nuova, forte di venticinque anni di esperienza, nella produzione di pitture per cicli di protezione anticorrosiva di opere nuove e per interventi manutentivi di strutture quali: • • • • • • •
Ponti e viadotti Impianti per la produzione di energia elettrica Impianti petrolchimici Impianti siderurgici Impianti petroliferi e trattamento gas Industria alimentare Complessi di edilizia industriale
La gamma di prodotti Brega Srl comprende: • Primer alchidici e sintetici • Primer zincanti organici e inorganici • Primer epossidici a rapida essicazione “surface tolerant” • Intermedi epossidici e clorocaucciù • Finiture alchidiche e clorocaucciù – alchidiche DE • Finiture epossidiche ed epossi – viniliche A SE V O NU • Finiture poliuretaniche • Pitture per alte temperature • Pitture epossicatrame • Rivestimenti a basso tenore di solvente
Brega Srl a socio unico - Via Marchi 58 - 26039 Vescovato (CR) - tel. +39 0372 81118 - fax +39 0372 830166 Nuova Sede: Via delle Vigne - 26843 Castelnuovo Bocca d’Adda (LO) info@bregaanticorrosione.com www.bregaanticorrosione.com
15 - 17 MARCH 2016 - ANTWERP EXPO, ANTWERP
The world’s leading international event for the tank terminal industry
REGISTER FREE TODAY Meet with suppliers, source the latest products and keep up-to-date with industry trends. www.stocexpo.com
Official port supporter
Show supporters
Show sponsors
DOME-ROOF-SEAL
Serving the tank storage community globally Serving the tank storage community globally
Organised g byy
Register now gg www.stocexpo.com
DECEMBER 2015 EDITORIAL ANALYSIS
02
Composites and Motorboat Sports: Tech & Safety Compositi e sport motonautici: Tech & Safety
BRAND-NEW HIGHLIGHTS OF THE MONTH
pag. 12
14
Innovative Graco Electric Pump Provides Risk-Free Operation Una pompa elettrica innovativa di Graco assicura un’operatività priva di rischi
18
Hercules: Innovative Portable Coating System for the Concrete Industry Hercules: innovativo sistema di rivestimento portatile per l’industria del cemento
20
Hugo Boss Racing Yacht All in Black Due to Functional Pigments Made by BASF La barca a vela di HUGO BOSS completamente in nero con i pigmenti funzionali di BASF
© Coatsol Ltd.
FOCUS ON TECHNOLOGY
24
Specific Shot-Blasting Solutions for the Surface Finishing of Pipes Sistemi di granigliatura specifici per pipeline
28
A Huge Bell to Store the Biogas Produced by the Water Purification Plant of Grenoble Una enorme campana per catturare il biogas prodotto dal sito di depurazione di Grenoble
32
New Surface Tolerant Technology Solves Maintenance Dilemma Una nuova tecnologia surface tolerant risolve il dilemma della manutenzione
pag. 20 © Mark Lloyd
INNOVATIONS
pag. 54 © AkzoNobel
CONTENTS
36
Resource Efficient Corrosion Protection: A Life Cycle Assessment of a Silicone-Epoxy Hybrid Resin Based Coating Protezione dalla corrosione a basso impatto ambientale: ciclo di vita di un rivestimento a base di una resina ibrida epossi-siliconica
44
An Introduction to Thermal Spray – Part 2 Introduzione alla termospruzzatura – Parte 2
50
Redefining Anti-Corrosive Protection with Activated Zinc Ridefinire la protezione anticorrosiva con lo zinco attivato
54
Thermosetting Powders for the Rail Industry Polveri termoindurenti per il settore ferrotranviario
EXHIBITIONS CALENDAR ZOOM ON EVENTS
eos eos
MKTG & COMMUNICATION MKTG & COMMUNICATION
PROTECTIVE COATINGS | EDITORIAL
T
his is the final issue of 2015 and, although I do not normally like taking stock of the past years, some general considerations are due on what we have sensed in the industrial world over the last twelve months while visiting dozens of industries and exhibitions in all major European countries. Our readers will have realised that, in order to build interesting issues and inform them accurately and on time on what is happening in the surface treatment field, ipcm®_ Protective Coatings’ editorial staff travels a lot and visits numerous firms that are then presented in its technical case studies. The choice of such companies may be justified by the investments that they are making in innovative technologies; by the improvements they are bringing to existing technologies; by the implementation of certain processes to replace technologies that are well-established but no longer able to meet the criteria for environmental friendliness and sustainable development; or by the fact that they already excel in their field and have now decided to focus on surface treatments as an innovation booster. The most important aspect that has jumped to our eyes during this busy period is that, although the last five years have been undeniably difficult in terms of economy and global finance, all these companies have talked about development, growth (sometimes very rapid), conquest of new markets or, at worst, substantial maintenance of market shares. The reasons for this? Internationalisation, search for an increasingly high quality level to conquer niche markets with higher margins and, above all, investment in innovation – which, incidentally, is also the means to improve quality. Since ipcm®_ Protective Coatings is now in its fourth year of publication and while admitting that only in the past two or three years the number of our international case studies has significantly increased, it is natural to ask ourselves a question: Are such investments a symptom of the renewed confidence in the market growth and in the arrival of a long-awaited stability or have they been the key that has enabled these companies not to succumb to the general mistrust at all levels, and especially in media? We firmly believe that the right answer is the second one and we are very pleased to have contributed to convey positivity and industrial enthusiasm at a time when many media have based their editorial policy on defeatism. Although the recent events and the serious political and social instability – not only in “hot spots” but also in old Europe – do not suggest the arrival of a stable period also in financial terms, our wish to our readers for 2016 is not to lose the curiosity, enthusiasm and ambition needed to grow… In spite of everything.
Q
uesto è l’ultimo numero del 2015 e, sebbene non ami fare bilanci, è doveroso fare alcune considerazioni di carattere generale su quanto abbiamo percepito a livello industriale nel corso di quest’anno, visitando decine di industrie e manifestazioni in tutti i principali paesi europei. I nostri lettori si saranno resi conto che, per costruire numeri interessanti e informare in modo preciso e puntuale su quanto accade nel settore del trattamento delle superfici, la redazione di ipcm®_ Protective Coatings viaggia molto e visita numerose aziende su cui poi costruisce case-study tecniche. La scelta delle aziende da visitare può essere motivata dagli investimenti che esse effettuano in tecnologie innovative; dalla rilettura migliorativa o evolutiva che sanno dare di tecnologie esistenti; dalla dimostrazione di come siano effettivamente attivi certi processi di sostituzione di tecnologie consolidate ma non più rispondenti a criteri di ecocompatibilità o sviluppo sostenibile; infine, per il fatto di essere eccellenze nel proprio settore che hanno scelto di puntare sul trattamento delle superfici come motore di innovazione. L’aspetto più importante che è balzato all’occhio durante questo anno intenso è che, benché reduci da un quinquennio innegabilmente complesso dal punto di vista dell’economia e della finanza globale, tutte queste aziende ci hanno parlato di sviluppo, crescita (talvolta sostenuta), conquista di nuovi mercati o, nel peggiore dei casi, di sostanziale mantenimento delle quote di mercato. I motivi? Internazionalizzazione, ricerca di una qualità sempre più spinta per conquistare nicchie di mercato con margini più alti e, soprattutto, investimenti in innovazione, che sono poi lo strumento per aumentare la qualità. Dal momento che ipcm®_ Protective Coatings è ormai giunta al quarto anno di pubblicazione e pur ammettendo che è negli ultimi due/tre anni che il numero delle nostre case study internazionali è aumentato di molto, viene spontaneo porsi una domanda: gli investimenti sono il sintomo di una rinnovata fiducia nella crescita del mercato e nell’arrivo della tanto agognata stabilità o, piuttosto, sono stati la chiave che ha permesso alle aziende di non soccombere al clima di sfiducia e scoramento imperante a tutti i livelli e soprattutto nell’informazione? Noi siamo fermamente convinti che la risposta sia la seconda e siamo molto soddisfatti di aver contribuito a comunicare positività ed entusiasmo industriale in anni in cui molti organi di informazione hanno costruito la propria politica editoriale sul disfattismo. Sebbene i recenti fatti di cronaca e la grave instabilità politica e sociale, non più solo nelle aree “calde” ma anche nella vecchia Europa, non lascino intravedere l’arrivo di un periodo stabile nemmeno a livello finanziario, l’augurio per i nostri lettori per Alessia Venturi il 2016 è di non perdere la curiosità, l’entusiaEditor-in-chief smo e l’ambizione necessari per crescere. Direttore Responsabile Nonostante tutto.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
01
PROTECTIVE COATINGS | ANALYSIS
COMPOSITES AND MOTORBOAT SPORTS: TECH & SAFETY Compositi e sport motonautici: Tech & Safety
1
The relationship between speed and pressure. Rapporto tra velocità e pressione.
Composite materials, understood as a combination of fibres and a matrix (structural resins), have a relatively short history, especially when compared with other construction materials. Their use in the marine sector is almost contemporary with the first applications of GRP as a structural material, at the end of the 1940s. The first applications were radar parables, followed by the first crafts (often called “plastic” boats, a term that has always made 1 the specialists’ skin crawl). These were small crafts and powerboats with shapes similar to those of their predecessors made in wood, the main material used in nautical construction until that moment.
The duration of composite materials The longevity of composite materials has become a problem in the last few decades. Their disposal, reuse and recycling is a very broad issue. Many studies and solutions are now available and often entail considerable disassembly costs, especially when dealing not with simple resin and glass fibre structures, but rather with complex, furnished and motorised boats. Back to our topic, the use of GRP required the creation of a model, generally not able to sail, made in plywood and often lined with a thin layer of mat and resin to fix and protect it; it was designed, built and polished to obtain a perfect forming mould, whereas, nowadays, it is preferable to start directly from an NC 02
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
S
toria e curiosità sull’uso dei materiali compositi nelle competizioni motonautiche offshore. Dal materiale di costruzione degli scafi in vetroresina all’uso per la realizzazione delle Safety Cell in carboresina. I materiali compositi, intesi come unione di fibre e matrice (resine strutturali), hanno una storia relativamente recente, soprattutto se riferita agli altri materiali di costruzione. L’uso nel comparto nautico è quasi coevo alle prime applicazioni della PRFV (fine anni ’40 dello scorso secolo) come materiale strutturale. Le prime applicazioni furono le parabole per i radar alle quali seguirono le prime imbarcazioni (spesso chiamate barche in “plastica”, termine che da sempre fa accapponare la pelle agli addetti ai lavori). Si trattava di piccole lance e piccoli motoscafi mutuati, come forme, dalle preesistenti costruzioni in legno, materiale principe fino ad allora nelle costruzioni nautiche. © Studio Sergio Abrami & C.
H
istory and facts about the use of composite materials in offshore powerboating, from fiberglass hulls to carbon fibre safety cells.
La durata dei materiali compositi La longevità del materiale composito negli ultimi decenni è divenuto un problema. Smaltimento, riuso, riciclo dei materiali è un tema che ci porterebbe lontano. Studi e soluzioni sono ormai disponibili e comportano spesso costi di disassemblaggio non indifferenti, soprattutto quando non si tratta di semplici costruzioni realizzate essenzialmente da resine e fibre di vetro, ma complesse unità arredate e motorizzate. Ma torniamo alla nostra storia. La costruzione in PRFV richiedeva la creazione di un modello, generalmente non navigante, in legno compensato spesso rivestito di un leggero strato di mat e resina per bloccarlo e proteggerlo; modello che veniva stuccato, avviato e lucidato, al fine di ottenere uno stampo di formatura perfetto (ora spesso si preferisce partire direttamente da uno stampo realizzato da fresatura a CN - controllo numerico). Lo stampo era realizza-
Sergio Abrami YD UIM Technical & Safety Officer sergioabrami_yd@libero.it
milled mould. The mould was also made of GRP, often reinforced with metal or plywood to move and rotate it with ease. This required a significant initial economic investment (more than three times the cost of a oneoff construction) and a discrete mass production to amortise such initial costs. This was not compatible with the construction of sports competition boats, which often required changes to their hulls even after having building. This explains the delay in the use of composite materials especially in offshore competitions: whereas in the Class 1 Offshore (the highest category) races most boats have been built in light aluminium alloy (often with welded bottoms and riveted sides and decks) since the early 1990s, in the lower categories the boat hulls kept being built in wood. Paradoxically, therefore, the first constructions made in advanced composites (sandwich structures with outer skins in GRP or composite material and core in expanded PVC or aramid paper honeycomb, – Nomex) were precisely seen in Class 1 competitions, with 12 to 15 m long boats. On the other hand, it was in this category (in its golden years) that it was possible to make large investments. The best manufacturers 2 worldwide were Italian (e.g. Cantiere Tencara, which built the “Moro di Venezia” boat, known for its participation in the America’s Cup) and set a standard for the whole field. Currently, in categories such as X-Cat, the most active one at the international level, the boats used are entirely made of advanced composite in UAE but technicians are often Italians, with extensive use of carbon fibre. How did it come to this? Originally, the composite material employed was a simple single skin GRP. The boats’ hulls started being built in one mould-laminated piece. This enabled to “mass produce” sports boats, which often had little to do with the building of pleasure boats such as catamarans. However, contrary to what one might think, such lighter and stronger structures did not improve the boats’ safety, especially in circuit categories. Fatalities multiplied because the hulls did not shatter and absorb the impact energy, as did the marine plywood ones. Up to 1990, in offshore races, the pilots remained standing, protected by a deflector or, at best, a half fairing: Their safety came from
to anch’esso in PRFV, spesso con rinforzi in CPM o in metallo per movimentarlo e ruotarlo con facilità. Si trattava di una costruzione che richiedeva un discreto investimento economico iniziale (più del triplo del costo di una costruzione one off) e necessitava di una discreta produzione in serie per ammortizzare i costi iniziali. Tutto ciò non era compatibile con la costruzione di mezzi sportivi da competizione, che spesso necessitavano di modifiche allo scafo anche a barca costruita. Questo spiega il ritardo, specie negli Offshore, dell’uso delle costruzioni in composito: mentre nella Classe 1 Offshore, la classe regina, fin dall’inizio degli anni ’90 la maggior parte delle imbarcazioni era costruita in LL (Lega Leggera di alluminio – spesso con fondi saldati e fianchi e coperta rivettati), nelle classi minori si continuò a costruire scafi in legno. Paradossalmente, le prime costruzioni in compositi avanzati, strutture a sandwich (pelli esterne con anima in PVC espanso o in nido d’ape di carta aramidica – Nomex) nascono negli imponenti Class1, barche dai 12 ai 15 m di lunghezza. Classe dove, negli anni d’oro dell’Offshore, erano possibili grandi investimenti. I migliori costruttori a livello mondiale sono gli italiani (Cantiere Tencara - costruttori dell’imbarcazione Moro di Venezia che © WPPA ha partecipato alla Coppa America), che faranno scuola. Attualmente, classi come la X-Cat, la più attiva a livello internazionale, sono interamente realizzate negli UAE in compositi avanzati con ampio uso di fibra di carbonio. Il personale tecnico di cantiere è prevalentemente italiano. Ma come si è arrivati progressivamente a ciò? Il materiale nuovo, il composito, inizialmente era semplice PRFV single skin. Le imbarcazioni, le carene, sono diventate un pezzo unico laminato in stampi. Questo ha permesso di “costruire in serie” imbarcazioni sportive che spesso avevano poco a che vedere con la produzione in serie di motoscafi da diporto, come ad esempio i catamarani. Ma contrariamente a quanto si possa pensare, la struttura più leggera e robusta non aveva migliorato la sicurezza, soprattutto nelle categorie in circuito. Si moltiplicarono gli incidenti mortali causati dal mancato assorbimento di energia dello scafo che non si disintegrava più assorbendo energia come succedeva prima con gli scafi in compensato marino. Per quanto riguarda l’offshore, fino al 1990 si correva in piedi protetti da un deflettore o, nei casi migliori, da un semi cu-
2
The component most subject to dangerous failures is the access door to the canopy, the hatch. La componente più soggetta a pericolosi cedimenti è il portello di accesso al canopy, l’hatch.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
03
PROTECTIVE COATINGS | ANALYSIS
Creating a St Andrew’s cross shaped reinforcing structure on the inside of a hatch. Creazione di una struttura di rinforzo a croce di Sant’Andrea sulla parte interna di un hatch.
04
polino, e la sicurezza derivava dall’essere sbalzati fuori dall’abitacolo, affidandosi a salvagenti con protezioni sulla schiena. Le velocità erano però aumentate considerevolmente: le pressioni, sia sulla running surface dello scafo che sulla schiena del pilota sbalzato fuori, aumentano con il quadrato della velocità, con conseguenze disastrose (fig. 1).
Almost simultaneously, although with some delay in offshore races, the pilots started do protect themselves with 5-6 point belts (as in rally racing cars), connected to an ergonomic/protective seat located in a more robust and protective part of the boat. This was the “man in the box” concept, explained in the Mark Lavin Memorial Guide Lines (MLMGL) over 25 years ago – in the US, these are the bible of passive safety. They have been issued by a foundation established in memory of Mark Lavin, who lost his life in an offshore accident in Key West, Florida, on November 7th, 19861. His boat, called Jesse James, had been equipped with numerous safety innovations 3 designed after the fatal accident of Still Crazy, occurred again in Key West on November 13th, 1985. The special shockproof capsule/cockpit, safety belts and full face helmets had been designed to protect the crew in this type of accident, the slipping into a wave, which at that time was typical of offshore races; however, they were not enough. Nonetheless, the “defective” canopies of F16 jets continued to be mounted on the boats’ decks, often open, for many years2. It should also be noted that the offshore and the circuit races have been completely separated for many years.
Con un percorso quasi in parallelo, anche se con un certo ritardo nell’offshore, si iniziò a concepire di guidare legati con cinture di sicurezza a 5-6 punti (come nel rally), affrancati ad una seduta ergonomica/protettiva all’interno di una parte di imbarcazione più robusta e protettiva. Era il criterio dell’uomo nella scatola, “l’uomo nella scarpa”, concetto illustrato nelle Mark Lavin Memorial Guide Lines di oltre 25 anni fa. La MLMGL (Mark Lavin Memorial Guide Lines) negli USA è una bibbia sulla sicurezza passiva. È una fondazione che nasce in memoria di Mark Lavin, che perse la vita in un incidente offshore a Key West, Florida, il 7 novembre 19861. La loro barca, denominata Jesse James, era stata dotata di numerose innovazioni di sicurezza progettate in risposta al fatale incidente di Still Crazy, sempre a Key West, il 13 novembre 1985. Una particolare capsula/pozzetto resistente agli urti, cinture di sicurezza e caschi full-faced, erano destinati a proteggere l’equipaggio in questo tipo di incidente tipico dell’offshore di allora, l’infilata nell’onda, ma non risultò sufficiente. Per anni, comunque, si continuò ad utilizzare i canopy “difettosi” dei caccia F16 montati sulle coperte, spesso aperti2. Va sottolineato che offshore e circuito per molti anni viaggiarono per scompartimenti separati. In circuito si cercò di standardizzare le caratteristiche dei pannelli che
1 The author of this article and the much more famous Antonio Del Monte (the Scientific Director of the Institute of Sports Science of C.O.N.I., the Italian National Olympic Committee) were the only Italians in the working group of the Mark Lavin Safety Foundation, led by the American Dr. Houghton.
1 L’autore e il ben più famoso prof. Antonio Del Monte (Direttore Scientifico dell’Istituto di Scienza dello Sport del C.O.N.I.) sono stati gli unici italiani nel gruppo di lavoro della Mark Lavin Safety Foundation, condotto dallo statunitense Dott. Houghton.
2 MIL specs of the canopies used for such purposes, or MIL-P-83310 Impact qualification 4 pound bird at 350 knots Test Procedure TIP – 345. “Longevity and Failure Requirements”: 1) Field Life equals only three years. Canopies must be replaced after three years of service with manufacturer recommended upkeep. 2) A .002 inch deep interior cut or crack extending more than ½ inch will result in canopy failure do to impact flex. Canopies found with this or greater damage will be required to replace the unit before further competition.
2 Caratteristiche MIL dei canopy impiegati per tali usi, oppure MIL – P- 83310 Impact qualification 4 pound bird at 350 knots Test Procedure TIP – 345. “Longevity and Failure Requirements”: 1) Field Life equals only three years. Canopies must be replaced after three years of service with manufacturer recommended upkeep. 2) A .002 inch deep interior cut or crack extending more than ½ inch will result in canopy failure do to impact flex. Canopies found with this or greater damage will be required to replace the unit before further competition.
© Studio Sergio Abrami & C.
3
being thrown out of the cockpit and relying on life jackets with back protections. The average speed, however, had considerably increased: The pressures on both the hull’s running surfaces and the thrown out pilots’ backs increased with the square of the speed, with disastrous consequences (Fig. 1).
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Sergio Abrami YD UIM Technical & Safety Officer sergioabrami_yd@libero.it
The latter, however, tried to standardise the characteristics of the panels that made up the cockpit (the “box” protecting the pilot). The first standard imposed was 1000 N, which then became 2000 N, 3000 N and finally 4000 N; this value represents the load that a 100 mm wide panel leaning on rollers placed at 500 mm from each other must bear without exceeding a 25 mm deflection before collapsing. For the offshore races, the test reference values are 20 kN for the Class 1 and 10 kN for the X-Cat and V1 races. In the circuit races, the crash box was adopted in 2008 to protect the pilot from any intrusion into the cockpit. In the offshore ones, in a few years the pilots stopped standing and started sitting, wearing belts and protecting themselves with a windshield (a half fairing at first, and then a whole but open fairing): In this case, a side-by-side solution was chosen, resulting in a few accidents that proved the dangers of large windows. The switch in the materials used in such races, from light aluminium alloys to composites, meant that the boats did not sank anymore, although seriously damaged. With the years and the average speed, also the types of accidents changed: From the (stuff) slipping into a wave (which claimed the lives of Pironi and his crew, Jean-Claude Guenard and the sportswriter Bernard Giroux, during the Cowes Torquay race in 1987, or of Stefano Casiraghi in Montecarlo in 1990 ) to (barrel roll) rollovers during mark roundings (due to modifications to the races, now including inshore tracks with many changes in direction for both safety and spectacularity reasons) and, more recently, flips (wheelies and landings in reverse, often against the direction of travel, which until a few years ago only happened with light boats from circuit categories such as F1 and F2).
costituivano il cockpit (la famosa scarpa protettiva attorno al pilota). Il primo standard imposto fu quello dei 1000 N, per passare poi allo standard 2000 N - 3000 N e infine 4000 N (il valore dello standard rappresenta il carico che deve sopportare un pannello largo 100 mm semplicemente appoggiato su rulli posti a 500 mm di intervallo senza superare i 25 mm di inflessione prima di cedere), mentre in offshore i valori di riferimento nei test sono di 20 kN per i Class1 e di 10 kN per gli X-Cat. ed i V1. Per quanto riguarda il circuito, nel 2008 venne adottato il crash box per proteggere il pilota da intrusioni nel cockpit. In offshore, dove in pochi anni si passò dalla guida in piedi a quella seduta e legata con un semi cupolino, prima, e ad un cupolino integrale ma aperto poi, ci si indirizzò verso una soluzione side by side, non senza incidenti che dimostrarono la pericolosità delle grandi finestrature. Il cambio di materiali in offshore, il passaggio dalle leghe leggere di alluminio ai compositi, fece sì che le barche non affondassero più, anche se gravemente danneggiate. Con gli anni e la velocità cambiarono anche le tipologie di incidenti: non più le infilate nell’onda che costarono la vita a Pironi e al suo equipaggio (Jean-Claude Guenard e il giornalista sportivo Bernard Giroux), Cowes Torquai 1987, o nel 1990 a Stefano Casiraghi a Montecarlo, ma a causa della modifica delle gare (percorsi con molte virate in circuiti sotto costa per esigenze di sicurezza e di spettacolarità televisiva) si verificarono ribaltamenti ai giri di boa e, più recentemente, flip (impennate e atterraggi in reverse, spesso contro il senso di marcia). Incidente, quest’ultimo, appannaggio fino a pochi anni fa solo delle imbarcazioni leggere di circuito come i F1 – F2.
Critical issues
I punti critici
The component most subject to dangerous failures (although not necessarily for the crew, as in the case of Figure 2) is the access door to the canopy, the hatch, which in the picture is white with fluorescent orange edges. It is a sensitive part of the protective capsule, consisting of a simply supported large panel (hinged at the fore and equipped with one or two locking systems at the aft). The opening minimum size required (to facilitate the extraction of the crew in case of accident) is 550 x 825 mm, but several dangerously larger doors have been built in the past. In most cases, the hatch was (badly) made with a sandwich structure: During my inspections, I have often seen good, or even excellent, quality components, but designed without taking into consideration any structural calculation.
La componente più soggetta a pericolosi cedimenti (non necessariamente con danni all’equipaggio, come nel caso della figura 2) è il portello di accesso al canopy, l’hatch, che nella figura vedete in bianco bordato di arancio fluo. Si tratta di una porzione sensibile della capsula protettiva costituita da un pannello semplicemente appoggiato (incernierato a prua e vincolato da uno o due sistemi di chiusura a poppa) di rilevanti dimensioni. Il minimo richiesto per motivi di facilità di estricazione dell’equipaggio in caso di incidente è un’apertura di 550 x 825 mm, ma in passato furono realizzati anche portelli pericolosamente più grandi. Il portello, nella maggior parte dei casi, è (malamente) realizzato con struttura a sandwich. Ho scritto malamente perché spesso nelle ispezioni ho trovato pezzi realizzati con una buona, se non ottima, manualità di esecuzione, ma senza il minimo criterio di calcolo strutturale.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
05
PROTECTIVE COATINGS | ANALYSIS
Rendering of a three-seat safety cell. Rendering di una safety cell con soluzione a tre posti.
06
Frequentemente c’è un uso abbondante e improprio di fibra di carbonio sulla pelle esterna e poche pelli di vetro all’interno, con un’anima spesso di basso spessore e densità: un ottimo isolamento termico, ma una scarsa protezione. Come ben sanno gli strutturisti, in una “vera” struttura a sandwich l’anima lavora a taglio: la resistenza al taglio dell’anima è direttamente proporzionale alla densità della schiuma (in genere PVC espanso cross-linked) e una “vera” struttura a sandwich deve essere, per quanto possibile, bilanciata e simmetrica. Personalmente, per esperienza e per scienza, preferisco avere come strato esterno un layer di vetro E (possibilmente un twill) che protegge localmente la fibra di carbonio multiassiale sottostante, un’anima con densità 130 kg/mc (un buon compromesso tra spessore e densità), una pelle interna in multiassiali di carbonio HR con, a finire, un layer di aramidico (Kevlar o Tawaron), sempre con lo stile di tessitura twill. Quest’ultimo strato in aramidico non ha tanto funzioni strutturali quanto protettive in caso di malaugurata rottura: spesso i piloti e soprattutto gli operatori del rescue team rimangono feriti da schegge di carbonio durante le operazioni di estricazione dell’equipaggio incidentato.
Emergency structural changes
Gli interventi strutturali di emergenza
It may happen that there is no time to build a perfect hatch. Three seasons ago, during a dry pit stop, a hatch that did not meet the minimum requirements was subjected to a very simple and fast change on my instructions: The creation of a St Andrew’s cross shaped reinforcing structure on the inside. This allowed to maintain a 120 mm clearance between the pilot’s helmet and the hatch itself, and to obtain smaller portions of the plating discharging the energy on the arms of the X (these were constituted by a flat arch in high modulus unidirectional carbon fibre and connected to a high resistance carbon beam’s core with an angle of 45°). It was a relief of about 25 mm: A simple, fast and effective solution. It required a vacuum process, but it was possible to implement it also on the contest ground, as evidenced by the photographs available (Fig. 3). Nowadays, the use of third generation composites (sandwich structures and carbon skins) is often limited to the safety cells of offshore boats, that is, the survival cells consisting of the canopy (the part that protrudes from the deck) and the cockpit (the “box” that protects the pilots under the deck). This module
Può capitare che non ci sia tempo per realizzare un portello a regola d’arte. Tre stagioni fa, con addirittura operazioni sul campo, nel dry pit, si è intervenuti su mia indicazione realizzando un rimedio molto semplice e veloce: la creazione di una struttura di rinforzo a croce di Sant’Andrea sulla parte interna di un hatch che non aveva i requisiti minimi richiesti. Questa soluzione permette di conservare la clearance di 120 mm tra casco pilota e portello e di realizzare porzioni più piccole di fasciame che scaricano sui bracci della X, costituiti da una piattabanda in fibra di carbonio unidirezionale ad elevato modulo, collegati con un’anima della trave così creata in bidirezionale a 45°, di carbonio ad elevata resistenza. Stiamo parlando indicativamente di un rilievo di circa 25 mm, semplice, veloce da realizzare ed efficace. Si tratta di una lavorazione sotto vuoto ma realizzabile, come testimoniano le fotografie, anche sul campo gara (fig. 3). Ora, l’utilizzo dei compositi di terza generazione (struttura a sandwich e pelli in carbonio) è destinato soprattutto alle “safety cell” delle imbarcazioni offshore, ovvero la cellula di sopravvivenza costituita dal canopy (la parte che sporge dal piano di coperta) e dal cockpit (la “scatola” che protegge i piloti sotto il piano di coperta).
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
© Studio Sergio Abrami & C.
4
Frequently, there is a misuse of carbon fibre on the boats’ outer skins and few glass skins on the inside, often with a low density and thickness core, providing excellent thermal insulation, but little protection. As structural engineers know, in a “real” sandwich structure the core works to shear: Its shear strength is directly proportional to the density of the foam (generally, cross-linked expanded PVC); such a structure, moreover, should be as balanced and symmetrical as possible. Personally, based on my experience and what science says, I prefer the following system: A layer of E-glass, possibly with a twill weave, as an outer layer to locally protect the underlying multiaxial carbon fibre; a core with a 130 kg/mc density (a good compromise between thickness and density); an inner skin in multiaxial HR carbon layer; and an aramid (Kevlar or Twaron) layer, again with a twill weave. This aramid layer does not play a functional, but 4 rather a protective role in the unfortunate event of rupture: The pilots and especially the rescue team operators are often injured by slivers of carbon fibre during the crew extraction operations.
Sergio Abrami YD UIM Technical & Safety Officer sergioabrami_yd@libero.it
has been conceived as a refitting for already existing boats: It enables to upgrade vessels used in different categories, from X-Cat to Class 1. The space for the pilots, the equipment and the instrumentation are almost identical. However, the pressures involved change (since they are related to the square of the speed as shown in Fig. 1): Therefore, the lamination of plates and reinforcements is modified, but not their shapes. The front windows are flat to enable the use of high thicknesses without affecting the external visibility. The three-seat solution shown in the rendering (Fig. 4) is not common: It is often used for monohull boats participating in offshore long-distance marathon races; generally, safety cells include two seats put side by side. In this case, the sandwich structure is built with carbon skins and epoxy resin, obviously by infusion. As already mentioned, the most critical points are the windows made with PC (polycarbonate) sheets; the supporting and anchoring flanges are very important and are the subject of studies and accurate laboratory tests. In the past, the windows were quite large and, above all, bolted (each bolt is a potential break point due to the concentration of loads); now, in compliance with the rules issued by UIM - Union Internationale Motonautique - the International Powerboating Federation, they are bonded with appropriate structural adhesives. Many spectacular crashes have only resulted in damage to the hulls, without any 5 consequences for the crews. This is due to the greater and constant attention paid to the elements that contribute to active and passive safety, but also, and above all, to the use of advanced composite materials for the safety cells (Fig. 5). One aspect that some might consider “frivolous”, but that is not secondary, is the modules’ surface finish: Generally, epoxy resins are chosen and often, therefore, no gelcoat finish is used. The modules are prepared with the appropriate basic processes and treated with twocomponent coatings. The hulls of the boats, especially the Class 1 ones in the past, were often decorated not only with sponsor logos, but also with fanciful designs evoking speed and the power of the sea. These were particularly appreciated in the US, where the powerboat races are often turned into festive (and dangerous) carnivals on the water. The use of coloured films, easily replaceable if the sponsors change, has revolutionised this aspect of the speedboat finishing. ‹
Questo modulo nasce come refitting per una imbarcazione preesistente. Questo sistema permette l’upgrade di imbarcazioni di diverse classi che vanno dall’X-Cat ai Classe 1. Gli ingombri dei piloti, le dotazioni e la strumentazione sono pressoché identici. Variano le pressioni in gioco (legate al quadrato della velocità come mostrato in fig. 1), e di conseguenza varia la laminazione dei fasciami e dei rinforzi, ma non le geometrie del pezzo. Le finestrature frontali sono piane per permettere l’uso di spessori abbastanza importanti senza pregiudicare la visibilità esterna. La soluzione a tre posti visibile nel rendering (fig. 4) non è comune: è utilizzata spesso da imbarcazioni monocarena che partecipano a gare Marathon offshore su lunga distanza (in genere le safety cell sono a due posti affiancati). La struttura in questo caso è realizzata a sandwich con pelli in carbonio e resina epossidica, ovviamente per infusione. Come già detto, i punti critici sono le finestrature costituite da lastre di PC (policarbonato); le flange di appoggio e incollaggio rivestono grande importanza e sono oggetto di studio e di accurate prove di laboratorio. Le finestrature che in passato erano piuttosto ampie e, soprattutto, imbullonate (ogni bullone, causa la concentrazione dei carichi, diventa un punto critico di rottura) ora per regolamento UIM (Union Internationale Motonautique, Federazione Internazionale Motonautica) sono incollate con appropriati adesivi strutturali. Incidenti spettacolari si sono risolti con soli danni allo scafo, senza © Studio Sergio Abrami & C. conseguenze per gli equipaggi. Questo è dovuto alla maggiore e costante attenzione sugli elementi che contribuiscono a creare sicurezza attiva e passiva e anche - e soprattutto - alla creazione della safety cell (fig. 5) in materiali compositi avanzati. Un aspetto che qualcuno potrebbe ritenere “frivolo”, ma assolutamente non secondario, è quello dedicato alla finitura superficiale del modulo, realizzato generalmente con resine epossidiche e quindi spesso senza finitura in gelcoat. Il modulo viene quindi preparato con appropriati cicli di base e di verniciatura bicomponente. Gli scafi, soprattutto i grandi Class1 del passato, erano spesso decorati non solo con i loghi degli sponsor, ma anche con decorazioni fantasiose che evocavano velocità e potenza sul mare. Decorazioni molto apprezzate negli USA dove di frequente le gare motonautiche sono festose (e pericolose) kermesse sull’acqua. L’uso delle pellicole colorate (facilmente sostituibili con il cambiare dello sponsor) ha rivoluzionato questo aspetto della finitura delle costruzioni motonautiche da competizione. ‹
5
An accident during a competition in 2011. A boat’s underbody broke and the hull was blown up by water. The safety cell saved the pilots. Incidente durante una competizione nel 2011. Uno scarpone si è rotto e l’acqua ha fatto esplodere lo scafo. La safety cell ha salvato i piloti.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
07
PROTECTIVE COATINGS | BRAND-NEW
CORTEC’S CORSHIELD® VPCI®-649: ENVIRONMENTALLY SAFE SOLUTION FOR HEATING AND COOLING SYSTEMS CorShield® VpCI®-649 di Cortec: soluzione ecologica per sistemi di riscaldamento e raffreddamento
C
C
© Cortec
ortec’s CorShield® VpCI®-649 is a water-soluble, nitrite-free corrosion orShield® VpCI®-649 di Cortec è un inibitore della corrosione solubiinhibitor for open and closed looped cooling systems. This unique le in acqua e privo di nitrito per sistemi di raffreddamento a circuipowder formulation provides long-term protection of copper, steel, to aperto e chiuso. La formulazione unica della polvere offre a ra® ® zinc, and aluminum. CorShield VpCI -649 combines contact and volatile me, acciaio, zinco e alluminio una protezione a lungo termine. CorShield® VpCI®-649 unisce gli inibitori volatili e da contatto della corrosione per assicucorrosion inhibitors to provide effective protection for a broad range of applications. This product contains a blend of organic-based scale inhibitors, rare una protezione efficace per un’ampia varietà di applicazioni. Questo prodotto contiene una miscela di inibitori delle incrostazioni a base organica che which prevents scale formation in pipes and towers. CorShield® VpCI®-649 ne previene la formazione in tubi e torri. CorShield® VpCI®-649 è un sostituto is an effective, environmentally safe replacement for hazardous nitrite, bromate, or chromate-based formulations. This non-toxic formulation does efficace ed ecologico alle formulazioni a base di sostanze pericolose come nitrito, bromato e cromo. Questa formulazione atossica non contiene metalli not contain any heavy metals; and the low concentration effectiveness of pesanti e la sua efficacia a basse concentrazioni consente trattamenti ecothe product provides economical treatment. The patented Vapor phase ® nomici. La tecnologia brevettata di inibizione della corrosione in fase vapore Corrosion Inhibiting (VpCI ) technology enables protection in areas that (Vapor phase Corrosion Inhibiting, VpCI®) permette di proteggere aree che gli contact inhibitors cannot reach. inibitori da contatto non possono raggiungere. CorShield® VpCI®-649 is easy to apply CorShield® VpCI®-649 è facile da applicare e altamente efand highly effective for a broad range ficace per un’ampia gamma di applicazioni, come i sisteof applications such as district heating mi di teleriscaldamento e gli impianti di raffreddamento e systems, central cooling and heating riscaldamento centralizzati (come negli aeroporti o in altri systems - like airports and other large luoghi molto frequentati), i motori dei camion diesel, macgathering facilities, truck diesel engines, off chine movimento terra e agricole, attività minerarie, atroad and agricultural machinery, mining, trezzature per la lavorazione di cellulosa e carta. Può esseand pulp and paper process equipment. re utilizzato anche per prevenire la corrosione dovuta alla It can also be used for preventing water1 deposizione di acqua sul fondo nei serbatoi di stoccagbottom corrosion in oil storage tanks, firegio petroliferi, nei sistemi antincendio, prove idrostatiche extinguishing systems, hydrostatic testing of 1 dei tubi, involucri, serbatoi, valvole e molto altro (fig. 1). pipelines, casings, tanks, valves, and many CorShield® VpCI®-649 offers long-term CorShield® VpCI®-649 offre un’eccellente protezione dalmore (Fig. 1). CorShield® VpCI®-649 provides Cortec’s protection for heating and cooling systems. la corrosione per la manutenzione periodica delle torri di excellent corrosion protection for the lay-up CorShield® VpCI®-649 di Cortec offre protezione raffreddamento. Essendo un prodotto ecologico, aiuta of cooling towers. Being environmentally a lungo termine per sistemi di riscaldamento e raffreddamento. a risolvere il problema dello smaltimento, in particolare safe, it helps solve the problem of disposal, per grandi quantità d’acqua. particularly for large quantities of water. Questo prodotto è stato sviluppato da Cortec® Laboratories per offrire una This product was developed by Cortec® Laboratories to provide multi-metal protezione anticorrosiva multimetal utilizzando la tecnologia di Cortec. corrosion protection using Cortec’s Technology. The VpCI® technology is La tecnologia VpCI® è un’opzione innovativa, ecologica, efficace dal punto an innovative, environmentally safe, cost-effective option for corrosion protection. Cortec® products protect with a thin, monomolecular protective di vista dei costi per la protezione dalla corrosione. I prodotti di Cortec proteggono con una barriera protettiva sottile monomolecolare che si auto-ribarrier. The barrier re-heals and self-replenishes, and can be combined with para e auto-riempie, e che può essere unita ad altre proprietà funzionali per other functional properties for added protective capabilities. capacità protettive aggiuntive. VpCI® forma un legame fisico con la superfiVpCI® forms a physical bond on the metal surface creating a barrier layer cie metallica creando una barriera contro gli ioni aggressivi. against aggressive ions. La polvere CorShield® VpCI®-649 è disponibile in sacchetti solubili in acCorShield® VpCI®-649 Powder is available in 5 pound (2.3 kg) water-soluble qua da 2,3 kg e in pacchetti da 22 kg e 45 kg. È conforme allo standard bags, 50 pound (22 kg), and 100 pound (45 kg) packages. It conforms to NACE RP 0487-2000 e a RoHS. NACE Standard RP 0487-2000 and is RoHS compliant. Per maggiori informazioni: www.cortecvci.com ‹ For further information: www.cortecvci.com ‹ 08
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
PANGBORN GROUP ANNOUNCES NEW PARTNERSHIP Il Gruppo Pangborn annuncia una nuova partnership he Pangborn Group, a global leader in surface preparation solutions, announces new ownership by United Generations, LLC (UG). Led by owner Doug Basler and headquartered in Waukegan, IL USA, UG is a well-established, family-owned group of companies specializing in engineering, manufacturing and after sales parts and service support. Pangborn customers will continue to benefit from the same experienced, strong management team of the Pangborn Group worldwide organization. Continued emphasis will be placed on long term customer service and support, along with providing innovative surface preparation solutions that the company has been known for since 1873. Doug Basler, Chairman of UG LLC, says: “We believe that bringing the Pangborn Group into the United Generations family is the next step in continuing to build upon the success which Pangborn Group is recognized for in the marketplace. We are enthusiastic to offer blast solution equipment, replacement parts and exceptional service for the long term needs of our customers.” “This is a major milestone in the continued development of Pangborn Group as a world leader in surface preparation equipment”, says Joe Camerata, the newly promoted CEO of Pangborn Group and member of the Pangborn Executive Leadership Team since joining the group in 2007. The Pangborn Group will continue operating from its headquarters in Fairburn, GA (Atlanta metro area) and at its other locations in Germany, the UK, Italy and China.
T
l Gruppo Pangborn, leader mondiale nelle soluzioni per la preparazione delle superfici, annuncia il passaggio di proprietà alla United Generations, LLC (UG). Guidata dal proprietario Doug Basler e con sede a Waukegan, IL (USA), UG è una realtà solida, controllata dalla famiglia Basler, che raggruppa società specializzate nella progettazione, nella produzione e nel servizio post-vendita nel settore industriale. La clientela di Pangborn potrà continuare ad avvalersi dell’organizzazione del Gruppo Pangborn che annovera, a livello mondiale, un team di manager competenti e qualificati. Punto essenziale continueranno ad essere l’assistenza tecnica e il servizio a lungo termine alla clientela, parallelamente alla fornitura di soluzioni innovative per la preparazione delle superfici per le quali l’azienda è conosciuta fin dal 1873. Doug Basler, Presidente di UG LLC, ha dichiarato: “Crediamo che l’integrazione del Gruppo Pangborn all’interno della famiglia United Generations sia l’ulteriore passo per capitalizzare il successo per il © Pangborn Group quale il Gruppo è conosciuto sui mercati. Siamo entusiasti di offrire soluzioni tecniche per la granigliatura, ricambi ed un servizio eccezionale per le esigenze di lungo termine della nostra clientela.” “Si tratta di una tappa fondamentale nel continuo sviluppo del Gruppo Pangborn quale leader mondiale nel settore degli impianti per la preparazione delle superfici”, ha affermato Joe Camerata, recentemente nominato CEO del Gruppo Pangborn e membro del team dirigenziale sin da quando ne è entrato a far parte nel 2007. Il Gruppo Pangborn continuerà ad operare dalla sede centrale di Fairburn, GA (Area metropolitana di Atlanta) e dalle altre sedi in Germania, Italia, Regno Unito e Cina.
I
About the Pangborn Group
Il Gruppo Pangborn
The Pangborn Group designs, manufactures and services shot blast and surface preparation machines and related products for a range of industries, including foundry and forge, metalworking and descaling, automotive and heavy truck, ship and rail, defence and energy. The company has led the way in all aspects of the surface preparation industry with unique designs, heavy-duty applications, and best-inclass service and support. The Pangborn Group is headquartered in Fairburn, Georgia, and includes leading surface preparation brands: Berger Strahltechnik, Pangborn, Pangborn China, Pangborn Europe, Pangborn SES, and V+S Vogel and Schemmann. For further information: www.pangborngroup.com ‹
Il Gruppo Pangborn progetta, produce e offre assistenza tecnica per impianti di granigliatura e trattamento delle superfici, inclusi prodotti complementari, per vari settori industriali tra cui fonderie e forge, lavorazione dei metalli e preparazione delle superfici, automotive e veicoli industriali, navale e ferroviario, difesa ed energia. Da sempre all’avanguardia nelle tecnologie per la preparazione delle superfici con soluzioni specifiche, applicazioni “heavy duty” ed assistenza tecnica e service di alta qualità, il Gruppo Pangborn, con sede a Fairburn, Georgia, raggruppa i marchi: Berger Strahltechnik, Pangborn, Pangborn China, Pangborn Europe, Pangborn SES, e V+S Vogel & Schemmann. Per maggiori informazioni: www.pangborngroup.com ‹
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
09
PROTECTIVE COATINGS | BRAND-NEW SAPICI AND WANHUA JOINTLY ANNOUNCE AN AGREEMENT ON DISTRIBUTION AND TOLLING COOPERATION FOR ALIPHATIC POLY-ISOCYANATES FOR THE EUROPEAN, MIDDLE EAST AND AFRICAN MARKETS Sapici e Wanhua annunciano congiuntamente un accordo sulla distribuzione e sulla collaborazione in conto lavorazione dei poli-isocianati alifatici per i mercati dell’Europa, del Medio Oriente e dell’Africa apici and Wanhua sign an agreement on distribution and tolling cooperation for aliphatic poly-isocyanates for the European, Middle East and African markets. Under the agreement, Sapici will warehouse and distribute Wanhua’s poly-isocyanates (HDI-trimer and HDI-biuret) portfolio throughout EMEA region. Also Wanhua will have access to Sapici’s manufacturing capacities and technical resources. “Combining the production know-how and superior quality of Wanhua’s aliphatic poly-isocyanate portfolio with Sapici’s local manufacturing capabilities, market access and technical know-how will be a winning formula for our European customers”, said Marc Daniel Block, General Manager International Business ADI. “We at SAPICI recently implemented our state-of-the-artplant in order to increase the aliphatic poly-isocyanate production. Together with Wanhua as a valuable partner we will leverage up our just mentioned recent investment and we will continue to expand our portfolio and create even more value for our customers”, added Cristian Furiosi, CEO of Sapici.
S
apici e Wanhua hanno sottoscritto un accordo di distribuzione e collaborazione in conto lavorazione per i poli-isocianati alifatici per il mercato europeo, medio orientale e africano. In base all’accordo, Sapici si occuperà dello stoccaggio e della distribuzione del portfolio di poli-isocianati Wanhua (HDI-trimer and HDI-biuret) in tutta la regione EMEA. Allo stesso modo Wanhua avrà accesso alle capacità produttive di Sapici e alle sue risorse tecniche. “Combinare il know-how produttivo e la qualità superiore del portfolio di poli-isocianati di Wanhua con le capacità produttive locali, l’accesso al mercato e il know-how tecnico di Sapici sarà una formula vincente per i nostri clienti europei”, ha affermato Marc Daniel Block, General Manager International Business ADI. “In SAPICI abbiamo recentemente implementato il nostro impianto all’avanguardia al fine di accrescere la produzione di poli-isocianati. Con Wanhua come partner prezioso, faremo leva finanziaria sul nostro suddetto recente investimento e continueremo ad espandere il nostro portfolio creando un valore ancora maggiore per i nostri clienti”, ha aggiunto Cristian Furiosi, CEO di Sapici.
About SAPICI
SAPICI
Established in Italy in 1936, S.A.P.I.C.I. S.p.A. is a global innovation and full-quality driven developer and manufacturer of advanced and high-performance polyurethane products for such applications as Coating, Flexible Packaging, Industrial Adhesives, Prepolymers, Inks, and more. SAPICI combines its product offering with direct and tailored services to its customers worldwide including continued technical assistance, research and development, and industrialization. SAPICI technical know-how and testing and analysis equipment allow its highly qualified workforce to anticipate and satisfy the needs and requirements of its most demanding customers, contributing to paving their way to further sustainable success. Over 160 SAPICI employees located in the company’s commercial offices and in the three production sites in Italy and China serve their customers supported by a capillary technical and commercial global organization. For further information: www.sapici.it ‹
Fondata in Italia nel 1936, S.A.P.I.C.I. S.p.A. è un’azienda globale animata da innovazione e alta qualità che sviluppa e produce prodotti poliuretanici ad alte prestazioni per applicazioni quali Rivestimenti, Packaging flessibile, Adesivi Industriali, Pre-polimeri, Inchiostri e molto altro. SAPICI combina la propria offerta di prodotti con un servizio diretto e su misura ai suoi clienti in tutto il mondo, inclusa l’assistenza tecnica continua, la ricerca e lo sviluppo, e l’industrializzazione. Il know-how tecnico di SAPICI e le sue dotazioni di prova e analisi consentono alla sua forza lavoro qualificata di anticipare e soddisfare i bisogni e le richieste dei suoi clienti più esigenti, contribuendo ad aprire la loro strada per un ulteriore successo sostenibile. Oltre 160 dipendenti SAPICI negli uffici commerciali dell’azienda e nei tre siti produttivi in Italia e in Cina servono i loro clienti supportati da una capillare organizzazione tecnica e commerciale a livello globale. Per ulteriori informazioni: www.sapici.it ‹
10
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
S
SUCCESSFUL PARTICIPATION OF TECAM GROUP AT ADIPEC ABU DHABI 2015 Successo per la partecipazione di Tecam Group ad ADIPEC Abu Dhabi 2015
T
L
© Tecam Group
he international exhibition for the Oil & Gas industry, ADIPEC a fiera internazionale per l’industria Oil & Gas ADIPEC 2015, 2015, held from 9-12 November in Abu Dhabi, United Arab svoltasi dal 9 al 12 novembre ad Abu Dhabi, Emirati Arabi Uniti, Emirates (UAE), was a big success for Tecam Group. è stata un grande successo per Tecam Group. Tecam Group presented its clean technology for Exhaust Air Tecam Group ha presentato la sua clean technology per il trattamento Treatment and for Industrial Waste Incineration, specifically for dell’aria di scarico e per l’incenerimento dei rifiuti industriali, specifithe Oil & Gas and Petrochemical industries. At the stand (Fig. 1), ca per le industrie Oil & Gas e petrolchimiche. Presso lo stand (fig. 1), visitors were able to learn more about how to reduce industrial i visitatori hanno imparato come ridurre le emissioni industriali e i emissions and learn about the advantages of safe industrial waste vantaggi dell’incenerimento sicuro dei rifiuti per gestire al meglio le incineration to help them deal with environmental issues. criticità ambientali. According to Tecam Group Sales Secondo Bernat Sala, sales director Director, Mr. Bernat Sala: di Tecam Group: “L’interesse per la “There was a high interest in clean technology di Tecam Group è Tecam Group’s clean technology stato molto alto all’edizione 2015 at ADIPEC 2015 and we were able di ADIPEC. Siamo riusciti ad auto strengthen our brand exposure mentare la popolarità del marchio among industry experts from the tra gli esperti dell’industria nella region”. regione”. In terms of technologies, Tecam A livello tecnologico, Tecam Group Group offers Regenerative Thermal offre ossidatori termici rigeneraOxidizers (RTO) for VOC emissions tivi (RTO, Regenerative Thermal abatement, as well as Regenerative Oxidizers) per l’abbattimento del1 Catalytic Oxidizers (RCO) and le emissioni COV, ossidatori cataliZeolite Rotor-concentrators tici rigenerativi (RCO, Regenerative 1 + RTO, etc., adapted 100% to Catalytic Oxidizers), rotoconcenThe stand of Tecam Group at ADIPEC trade fair. customer’s technical requirements tratori a zeoliti + RTO, ecc., adattaLo stand di Tecam Group alla fiera ADIPEC. and specifications, designed to ti al 100% alle esigenze tecniche e eliminate up to 99,8% of polluting specifiche dei clienti e progettati VOC emissions. Moreover, Tecam Group also designs and supplies per eliminare fino al 99,8% delle emissioni inquinanti COV. Inoltre, incineration systems to safely incinerate industrial waste generated Tecam Group progetta e fornisce sistemi per incenerire in modo siduring production processes. curo i rifiuti industriali generati dai processi produttivi. For further information: www.tecamgroup.com ‹ Per maggiori informazioni: www.tecamgroup.com ‹
PROTECTIVE LININGS
SPECIALIST COATINGS
COMPOSITE REPAIRS
COLD BONDING
B S
PROTECTIVE COATINGS | BRAND-NEW
© Coatsol Ltd.
ENVIRAWRAP: THE EFFECTIVE PROTECTION SOLUTION BY COATSOL LTD. Envirawrap: una efficace protezione anticorrosione proposta da COATSOL Ltd.
1 1
Envirawrap: Designed to provide simple high-speed installation for a multitude of subsea and onshore applications. Envirawrap: il sistema è concepito per consentire un’applicazione molto rapida in una grande varietà di installazioni sommerse e fuori terra.
nduced tension wrap systems provide an effective retrofit method of corrosion or environmental protection of risers, piles, and certain specific sections of subsea pipe work (Fig. 1).
I
F
Easy installation
Facile installazione
Designed to provide simple high-speed installation for a multitude of subsea and onshore applications. Installation topside, underwater or in a pipeline trench is carried out with pneumatically or hydraulically operated tools, driving a reuseable closure caliper.
Il sistema è concepito per consentire un’applicazione molto rapida in una grande varietà di installazioni sommerse e fuori terra. L’applicazione sulla “splash zone”o in trincea di condutture avviene mediante l’ausilio di utensili pneumatici o idraulici, atti al serraggio di un rivestimento riutilizzabile. Il tempo tipico di applicazione sui giunti di tuba-
12
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
asciature a tensione indotta permanente che costituiscono un efficace metodo per il ripristino della protezione anticorrosione di “Risers”, palificazioni e particolari tratte di tubazioni sommerse (fig. 1).
Typical installation times for joint coating pipe diameters of 200–610 mm are 8 minutes per joint depending on diameter. Cold-applied – no hot work permit required. Does not require shotblast substrate preparation.
zioni nella gamma di diametri fra 200 e 610 mm è di 8 minuti. Si applica a freddo e quindi non è necessario alcun permesso per l’utilizzo di fiamme o sistemi analoghi. Non è nemmeno richiesta una preparazione superficiale del substrato mediante sabbiatura.
Extreme performance
Prestazioni estreme
Independently tested to operate in the temperature range of up to 120°C. Low-temperature versions are available for above-ground applications where ambient temperatures can be as low as –40°C.
Provvisto di certificazione indipendente per operare a temperature fino a 120°C. È anche disponibile in versione resistente alle basse temperature per applicazioni fuori terra sino a -40°C di temperatura ambiente.
Closure around the joint is via a thermally formed flange, designed to follow field joint contours. Hoop tension induced into the fabric during installation locks the system in place.
Un rivestimento su misura
© Coatsol Ltd.
Perfect fit
La chiusura intorno alla tubazione avviene mediante il serraggio di una speciale flangia termo-formata. La forza cerchiante che viene indotta nel tessuto della fascia durante l’installazione blocca il sistema in maniera permanente.
Applicazioni a disegno Custom applications The product provides an ultrafast alternative field joint coating solution on the lay barge and tie-in coating stations, or it may be applied subsea by divers, when used as a coating repair method. High-temperature, hydrophobic corrosioninhibiting gel prevents water entrapment during underwater applications.
2 2
How Envirawrap works. Come funziona Envirawrap.
Il prodotto rappresenta un’alternativa estremamente rapida per il rivestimento dei giunti a bordo di navi posa-tubi e stazioni di realizzazione dei “tie-in” oppure, nel caso debba essere utilizzato come ripristino del rivestimento ammalorato può essere applicato anche sott’acqua da parte di operatori subacquei. Il gel inibitore di corrosione, idrofobico e resistente all’alta temperatura, previene l’intrappolamento dell’acqua durante le applicazioni sommerse.
Come funziona? How Does It Work? 1. Outer polyurethane layer: Highly abrasion-resistant and UV-stable; long-term environmental outer barrier (Fig. 2). 2. Memory-enhanced polyamide reinforcing scrim: During installation, the scrim create hoop-tension forces sufficient to resist long-term creep, as well as one-hundred year storms. 3. Inner polyurethane layer 4. Polyester or polypropylene felt inner layer: When tightening the wrap, we create tension as the fabric stretches. Forces created within this fabric act upon the gel which has been pre-impregnated into the absorbent inner layer causing it to flow and “wet-out” on the pile/riser surface. The hydroscopic properties of the gel expel water and create a long-term, flexible, temperature resistant seal. It has been company’s policy since the wrap concept was developed in 1985 to continue incorporating the latest advances in materials technology with Envirawrap, creating the 4th generation of perfection. For further information: www.coatsol.com ‹
1. Strato esterno poliuretanico: altamente resistente all’abrasione e stabile agli UV, costituisce una barriera di lunga durata da sollecitazioni ambientali (fig. 2). 2. Trama di rinforzo in poliammide a memoria di forma: durante l’applicazione, questo strato intermedio induce una forza cerchiante sufficiente per resistere a lungo allo snervamento, ma anche a condizioni ambientali estreme che potrebbero verificarsi nell’arco di cento anni. 3. Strato interno poliuretanico 4. Rivestimento interno in feltro di poliestere o polipropilene: a seguito del serraggio, le forze indotte nello strato di feltro forzano il gel di cui è impregnato facendolo fluire in tutti gli interstizi sulla superficie della palificazione o del “riser”, espellendo l’acqua e creando una sigillatura di lunga durata, flessibile e resistente agli sbalzi di temperatura. Sin dal momento in cui questo sistema di rivestimento è stato concepito nel 1985, ha sempre fatto parte della politica aziendale quella di implementare nel sistema Envirawrap tutte le ultime innovazioni tecnologiche in fatto di materiali, arrivando a realizzare la 4a generazione di perfezionamento del prodotto. Per maggiori informazioni: www.coatsol.com ‹
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
13
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH
INNOVATIVE GRACO ELECTRIC PUMP PROVIDES RISK-FREE OPERATION Una pompa elettrica innovativa di Graco assicura un’operatività priva di rischi
© Graco
Opening photo: Graco’s Husky™ 1050e electric double diaphragm pump. Foto di apertura: la pompa elettrica a doppia membrana Husky™ 1050e di Graco.
14
P
ump failures are a frustrating waste of time, energy and money. So it comes as no surprise to find that Graco, a world leader in fluid handling systems and components, has devoted considerable resources to attempt to eliminate them. In addition, Graco constantly seeks to improve the energy efficiency of pumps and create a quieter working environment for operators and nearby employees. Does this seem like an impossible combination? Not with Graco’s new Husky™ 1050e electric double diaphragm pump, which has been designed to meet such a mix of demanding requirements (Ref. opening photo). “The Graco Husky 1050e is the only electric diaphragm pump on the market that will stall under pressure, to prevent pump failures from clogged lines or closed valves,” says Walter Leeten, Product Marketing Specialist Process at Graco. “Its energy efficient electric drive reduces energy consumption by up to five times compared to traditional air operated diaphragm pumps. In addition, the 1050e can be set to reduce pulsations, so you no longer need a pulsation dampener – which contributes to its low noise levels.” The thinking behind developing an electric double diaphragm pump certainly makes sense.
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
L
a rottura di una pompa è uno spreco frustrante di tempo, energia e denaro. Non deve quindi sorprendere che Graco, azienda leader mondiale nei sistemi e componenti di gestione dei fluidi, abbia devoluto ingenti risorse nel tentativo di eliminare questo problema. Inoltre, Graco cerca costantemente di migliorare l’efficienza energetica delle pompe e creare un ambiente di lavoro più silenzioso per gli operatori e per i lavoratori nelle vicinanze. Vi sembra un combinazione impossibile? Non con la nuova Husky™ 1050e, pompa elettrica a doppia membrana concepita per soddisfare tali requisiti stringenti (rif. foto d’apertura). “La Graco Husky 1050e è l’unica pompa elettrica a membrana sul mercato che si blocca sotto pressione, per prevenire la rottura della pompa in caso di tubazioni ostruite o valvole chiuse,” afferma Walter Leeten, Product Marketing Specialist Process di Graco. “Il suo propulsore elettrico, efficiente dal punto di vista energetico, riduce il consumo di energia fino a cinque volte se comparato alle tradizionali pompe a diaframma azionate ad aria. Inoltre, la 1050e può essere regolata per ridurre le pulsazioni; quindi non è più necessario uno smorzatore di pulsazioni, il che contribuisce a raggiungere i suoi bassi livelli di rumorosità.” Le considerazioni dietro allo sviluppo di una pompa elettrica a doppia membrana hanno sicuramente un senso.
Walter Leeten Graco communications@graco.be
It will immediately remove the significant costs of purchasing, running and maintaining an air compressor. And of course you might need to run a pump in locations where no air is available – or will take a lot of time and logistics to get an air supply up and running. In these situations an electric pump is an excellent alternative.
Essa elimina immediatamente I costi connessi all’acquisto, gestione e manutenzione di un compressore d’aria. Inoltre, si può presentare la necessità di utilizzare una pompa laddove non è disponibile aria compressa o dove richiederebbe molto tempo e molta logistica ottenere una fornitura di aria compressa funzionante. In queste situazioni una pompa elettrica rappresenta un’eccellente alternativa.
How it works
Funzionamento
The Husky 1050e is an electric operated 1” double diaphragm pump (EODD). It works like a conventional air-operated double diaphragm pump (AODD) (Fig. 1). However, don’t view the 1050e merely as an AODD connected to the nearest electricity supply instead of an air compressor. There’s some innovative stand-out technology inside. The 1050e consists of the same fluid parts as a conventional AODD. Where it differs is that it uses an air pressurized center. “Compare it to a bicycle wheel,” explains Leeten. “You need to load the pump with air to start it working, but after that you don’t need a constant supply of air to keep it running. In fact you only need 0.6 liters of air a day”. When the pressure pushing on the outside of the diaphragm (fluid pressure) is equal to or greater than the center section (air) pressure, the pump will stall, removing the risk of pressure being built up. This avoids damaging the pump or the production line. If then the air pressure in the center section increases so that it is greater than the fluid pressure, or the fluid pressure decreases so that it is less than the air pressure, the pump will start pumping again. The motor will keep running all the time.
La Husky 1050e è una pompa a doppia membrana a 1” azionata elettricamente (EODD). Lavora come una pompa a doppia membrana convenzionale azionata ad aria (AODD) (fig. 1). Tuttavia, la 1050e non va considerata semplicemente come una AODD connessa alla più vicina rete elettrica al posto di un compressore d’aria. Al suo interno risalta una tecnologia innovativa. La 1050e ha le stesse parti per il fluido di una AODD convenzionale. Ciò che la differenzia è che essa utilizza un centro ad aria pressurizzata. “Paragonatela alla ruota di una bicicletta,” spieha Leeten. “Dovete caricare la pompa con l’aria per iniziare a farla funzionare, ma in seguito non avete bisogno di un’alimentazione costante di aria per mantenerla in funzione. Anzi, avete bisogno di soli 0,6 litri di aria al giorno”. Quando la pressione che spinge sull’esterno della membrana (la pressione del fluido) è uguale o maggiore della pressione (aria) della sezione centrale, la pompa si blocca, evitando il rischio di un aumento della pressione. Ciò evita il danneggiamento della pompa o della linea produttiva. Se poi la pressione dell’aria della sezione centrale aumenta fino ad essere nuovamente maggiore della pressione del fluido, o se la pressione del fluido decresce fino a diventare inferiore alla pressione dell’aria, la pompa ricomincerà a pompare. Il motore continuerà a funzionare per tutto il tempo.
Interesting advantages over AODDs One of the key advantages of the Husky 1050e is that it stalls under pressure. Historically, pneumatic diaphragm pumps stall under pressure, which makes them unique. Electric motors typically do not stall under pressure, but the 1050e does; the only electric diaphragm pump to do so. Stalling under pressure avoids the risk of damaging the pump or pipeline when it’s blocked or a valve is closed. It also negates the necessity for installing an extra pressure sensor. The 1050e also comes into its own in applications that require low pulsation and a smooth flow. The patented air charged drive allows for the elimination or reduction of pulsation without expensive pulsation dampeners or surge tanks.
Vantaggi interessanti rispetto alle pompe AODD Uno dei vantaggi chiave della Husky 1050e è che sotto pressione si blocca. Storicamente, le pompe pneumatiche a membrana si bloccano sotto pressione, cosa che le rende uniche. I motori elettrici tipicamente non stallano sotto pressione, ma la 1050e sì, ed è l’unica pompa a membrana a farlo. Stallare sotto pressione evita il rischio di danneggiamenti alla pompa o alla tubazione quando questa è bloccata o quando la valvola è chiusa. Evita anche la necessità di installare un sensore di pressione extra. La 1050e ha successo anche nelle applicazioni che richiedono basse pulsazioni e un flusso ininterrotto. Il propulsore brevettato caricato ad aria consente l’eliminazione o la
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
15
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH
© Graco
It also gives a good level of control – especially important for metering and batching. And there is no risk of contamination of products due to the absence of hydraulic backing. Its seal-less diaphragm pump design eliminates leaking rotational seals and failures due to run-dry pump conditions. Other advantages include the lack of exhaust air, the ability to handle abrasives, and its quietness, making it ideal for applications in close proximity to people.
Significant cost savings
1
Its energy efficient electric drive reduces energy consumption by up to five times compared to traditional air operated diaphragm pumps. Il suo propulsore elettrico efficiente riduce il consumo di energia fino a cinque volte rispetto alle pompe a membrana tradizionali azionate ad aria.
16
riduzione della pulsazione senza l’impiego di costosi smorzatori o serbatoi di compensazione. Consente anche un buon livello di controllo, aspetto di speciale importanza per misurazione elettronica e dosaggio. E non vi è alcun rischio di contaminazione dei prodotti grazie all’assenza di arretramento idraulico. Il design senza tenuta della pompa a membrana elimina le perdite dalle guarnizioni rotazionali nonché i guasti causati da situazioni di funzionamento a secco. Altri vantaggi includono l’assenza di aria di scarico, la capacità di gestire gli abrasivi, e la sua silenziosità, cosa che la rende ideale per le applicazioni in prossimità delle persone.
Now let’s look at the bottom line: Operating costs. It’s interesting to compare the 1050e EODD 1” with a conventional 1” AODD; both operating for 24 hours at a flow rate of 95 liters per minute and a fluid pressure of 3.5 bar. The required air for the 1050e is a paltry 0.6 liters per day. Compare this to the air required for a 1 conventional 1” AODD, which needs 700 liters per minute. This corresponds to an annual operating cost for the 1050e of 460 EUR, compared to 2300 EUR for the conventional 1050 AODD: a 5x cost saving.
Ora diamo uno sguardo ai conti: i costi operativi. È interessante paragonare la 1050e EODD da 1” con una AODD da 1” tradizionale; entrambe operanti per 24 ore a una portata di flusso di 95 litri al minuto e a una pressione del fluido di 3.5 bar. L’aria richiesta per la 1050e è pari a 0.6 miseri litri al giorno. Comparate questo dato con l’aria necessaria per una AODD da 1” convenzionale, che necessita di 700 litri al minuto. Ciò corrisponde a un costo operativo annuo per la 1050e di 460 euro, rispetto ai 2300 euro per una tradizionale 1050 AODD: un risparmio di costo di 5 volte tanto.
Suitable for a wide range of applications
Adatta a un’ampia gamma di applicazioni
“We see the 1050e as highly suitable for the waste water treatment industry – for applications such as the pumping of sludge and slurry – where it can replace large peristaltic pumps,” says Leeten. “In applications where saving energy is the key driving force, the 1050e is an interesting replacement for AODD pumps running in continuous duty applications. Moreover, the 1050e can handle particles up to 3.2 mm.” If lack of air is your specific challenge, then the 1050e, with its small air requirement, is the
“Riteniamo che la 1050e sia particolarmente adatta all’industria del trattamento delle acque, per applicazioni come il pompaggio di fanghi e liquami, dove può sostituire le grosse pompe peristaltiche,” afferma Leeten. “In applicazioni dove il risparmio di energia è una componente fondamentale, la 1050e è un’interessante sostituta delle pompe AODD che funzionano per applicazioni in servizio continuo. Inoltre, la 1050e può gestire particelle fino a 3.2 mm.” Se l’assenza di aria è la vostra sfida, allora la 1050e, con la sua piccola richiesta di aria, è la soluzione ideale.
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Risparmi significativi
Walter Leeten Graco communications@graco.be
ideal solution. For example, you may have no additional compressor capacity, or an installation where air is simply not available. You may have a temporary lack of air due to compressor maintenance or shutdown. Or you may simply want to save the cost of a large compressor. In all these situations, the 1050e is perfect. Another area of use is where more control is required from process pumps. You can get more control through replacing your existing electrically driven pumps with the 1050e, and at the same time you will get improved metering accuracy.
Ad esempio, potreste non avere una capacità ulteriore del compressore, oppure un impianto dove semplicemente l’aria compressa non è disponibile. Potreste avere una mancanza temporanea di aria a causa della manutenzione al compressore o del suo spegnimento. O potreste semplicemente voler risparmiare il costo di un grosso compressore. In tutte queste situazioni, la 1050e è perfetta. Un’altra area di utilizzo è dove si richiede maggior controllo delle pompe di processo. È possibile avere più controllo attraverso la sostituzione della pompa azionata elettricamente esistente con la 1050e. Allo stesso tempo, otterrete anche una migliore accuratezza della misurazione elettronica.
Flexible and efficient
Flessibile ed efficiente
The 1050e is available in brushless DC, AC and AC ATEX options. The brushless 2HP DC motor, for example, offers increased control, maintenance and alarm notification, batch operation, and meets API 675 and ANSI 7.1-7.5. The electric 2HP AC motor offers increased efficiency, ATEX options, and runs on 110V, 220V or 480V. The center section can be aluminium or stainless steel, while the fluid section can be aluminium, polypropylene or stainless steel. Maximum fluid working pressure is 4.8 bar (0.48 MPa / 70 psi). Air pressure operating range is 1.4 to 5.5 bar (0.14 to 0.55 MPa / 20 to 80 psi). Cart mounted systems are available. A final point to remember is that this highly energy efficient electric pump runs up to five times more efficiently than other air operated diaphragm pumps.
La 1050e è disponibile con i motori brushless DC, AC e AC ATEX. Il motore brushless 2HP DC, ad esempio, offre un maggiore controllo, la notifica della manutenzione e dell’allarme, operazioni a batch, e soddisfa le normative API 675 e ANSI 7.1-7.5. Il motore elettrico 2HP AC offre una maggiore efficienza, opzioni ATEX, e funziona a 110V, 220V or 480V. La sezione centrale può essere in alluminio o acciaio inox, mentre la sezione del fluido può essere in alluminio, polipropilene o acciaio inox. La pressione massima di lavoro è 4,8 bar (0,48 MPa / 70 psi). Il range operativo della pressione dell’aria è da 1,4 a 5,5 bar (da 0,14 a 0.55 MPa / 20 a 80 psi). Sono disponibili sistemi carrellati. Un punto finale da ricordare è che questa pompa elettrica altamente efficiente funziona in modo 5 volte più efficiente rispetto alle pompe azionate ad aria.
La Camerini & C., fondata nel 1922, inizia e sviluppa la sua attività come produttore di prodotti vernicianti per anticorrosione, volti principalmente alla protezione di strutture quali edifici, elettrodotti, strutture off-shore, ponti, impianti chimici, condotte forzate, centrali elettriche e raffinerie.
La 1050e in campo The 1050e in the field The 1050e was tested in a water treatment facility where it was used to pump lime slurry. In this application, one 1050e replaced two size 4 eccentric pumps. It racked up more than 24 million pumping cycles at a fluid flow rate of 68 liters per minute and a fluid pressure of 2.8 bar. With the previous eccentric pumps, hoses were having to be replaced every two to six weeks. In eight months of operation, there was no need to replace a single diaphragm of the Husky 1050e. All in all, the Graco Husky 1050e electric double diaphragm pump looks set to have a major and long-lasting impact in industry. ‹
La 1050e è stata testata su un impianto di trattamento acque dove è stata impiegata per pompare liquami di calce. In questa applicazione, una 1050e ha sostituito due pompe eccentriche di taglia 4. Ha accumulato oltre 24 milioni di cicli di pompaggio a una portata di flusso del fluido di 68 litri al minuto e a una pressione del fluido di 2,8 bar. Con le precedenti pompe eccentriche, i tubi dovevano essere sostituiti ogni due-sei settimane. In otto mesi di funzionamento, non vi è stata alcuna necessità di sostituire una singola membrana della Husky 1050e. Tutto considerato, la pompa elettrica a doppia membrana Husky 1050e di Graco sembra pronta per avere un grande e duraturo impatto sull’industria. ‹
Via Cavatigozzi, 11 26028 SESTO ED UNITI (Cremona) tel + 39 0372 710705/710707 fax + 39 0372 710725 info@camerini.it www.camerini.it
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH
© Tecno Supply – a division of IBIX Srl
HERCULES: INNOVATIVE PORTABLE COATING SYSTEM FOR THE CONCRETE INDUSTRY Hercules: innovativo sistema di rivestimento portatile per l’industria del cemento
Opening photo: Hercules is an innovative portable coating system specifically designed to produce a polymeric coating using IBIX® POLYFUSION thermal plastic powder. Foto d’apertura: Hercules è un innovativo sistema portatile di verniciatura specificamente progettato per produrre un rivestimento polimerico utilizzando le polveri termoplastiche IBIX® POLYFUSION.
18
he Hercules flame spray coater (Fig. 1) is a revolutionary coating system that virtually eliminates all of traditional plaster and paint coating shortcomings. It is resistant to chipping, peeling and scratching. It cures in seconds and is extremely durable. The Hercules flame spray coater is developed and produced by Tecno Supply (a division of IBIX), a company based in S. Maria in Fabriago (RA, Italy) that provides experience and expertise in the field of surface treatment systems and environmentally-friendly products for anti-corrosive coatings. IBIX® POLYFUSION flame spray coating powder is a thermal plastic coating that is applied pneumatically. The raw materials is in a dry powder form that is propelled through a gun-type applicator and heated onto building surface. The material dries almost instantaneously. Hercules flame spray coater (Ref. opening photo) was specifically designed to produce a polymeric anti-osmotic coating using our IBIX® POLYFUSION thermoplastic powder. The finishes are easily applied with our proven installation methods and the end result is a smooth and durable astoundingly beautiful finish, that will last for many years to come. This revolutionary flame spray coating system is suitable for concrete flooring (Fig. 2), tanks, metal substrates and other surfaces.
T
impianto di spruzzatura a fiamma Hercules (fig. 1) è un sistema rivoluzionario in grado di eliminare tutte le carenze derivanti dai rivestimenti tradizionali in intonaco e vernici. È resistente a scheggiature, sfaldature e graffi, solidifica in pochi secondi ed è estremamente duraturo. Il sistema di spruzzatura a fiamma Hercules è sviluppato e prodotto da Tecno Supply (divisione di IBIX), azienda con sede a S. Maria in Fabriago (RA) che offre esperienza e competenza nel settore dei sistemi di trattamento delle superfici e prodotti eco-compatibili per rivestimenti anticorrosivi. Le polveri termoplastiche IBIX® POLYFUSION per spruzzatura a fiamma sono applicate pneumaticamente. Le materie prime, in forma di polvere asciutta, sono convogliate attraverso una pistola e riscaldate sulla superficie della struttura: il materiale si asciuga quasi istantaneamente. Il sistema di spruzzatura a fiamma Hercules (rif. foto d’apertura) è stato specificamente progettato per produrre un rivestimento polimerico anti-osmotico utilizzando le polveri termoplastiche IBIX® POLYFUSION. Le finiture sono facilmente applicate con i nostri metodi collaudati: il risultato finale è una finitura liscia, duratura e dall’aspetto piacevole, in grado di durare diversi anni. Il rivoluzionario sistema di spruzzatura a fiamma è adatto a pavimentazioni in cemento (fig. 2), vasche, substrati metallici e altre superfici.
The Hercules system offers: - Long lasting protective coatings of concrete surfaces, ecological, UV resistant, anti-osmotic, flexible and repairable. - Perfect adhesion thanks to the special epoxy primer sealing the substrate and specially formulated thermoplastic coating powders. - Proven coating cycle.
Il sistema Hercules offre: - rivestimenti protettivi di lunga durata per superfici di cemento, ecologici, resistenti ai raggi UV, anti-osmotici, flessibili e riparabili; - adesione eccellente grazie allo speciale primer epossidico che sigilla il substrato in cemento e alle polveri termoplastiche di rivestimento specificamente formulate; - ciclo di verniciatura collaudato.
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
L’
Susanna Giovannini Tecno Supply, a division of IBIX Srl, Santa Maria in Fabriago (RA, Italy) susanna.giovannini@tecnosupply.com
Ciclo di verniciatura
These are the stages of the coating cycle: - Removal of existing coating. - Surface preparation. - Surface blasting and cleaning. - Heating of the surface to about 50°C. - Application of the special epoxy primer POLYRES 505, for sealing the substrate and enhancing adhesion. - Flame spraying of IBIX® POLYFUSION thermoplastic coating powder, specially formulated for coating concrete surfaces. - No curing, no drying: The coated surfaces will be immediately ready for service.
Le fasi del ciclo di verniciatura: - rimozione del rivestimento presente; - preparazione della superficie; - sabbiatura e pulitura della superficie; - riscaldamento della superficie fino a 50°C; - applicazione dello speciale primer epossidico POLYRES 505, per sigillare il substrato e migliorare l’adesione; - spruzzatura a fiamma della polvere termoplastica di rivestimento IBIX® POLYFUSION, formulata specificamente per superfici in cemento; nessuna polimerizzazione o asciugatura: le su-n perfici rivestite saranno immediatamente pronte p aall’uso.
© Tecno Supply – a division of IBIX Srl
Coating Cycle
1
Technical Data
1
The Hercules flame spray coater. Il sistema di spruzzatura a fiamma Hercules.
Dati tecnici te
Characteristics of the system: - Overall Dimensions: Width: 700 mm (27.56 inch.); length: 650 mm (25.59 inch.); height: 1050 mm (41.34 inch.). - Only requires compressed dry air and LPG. - Portable and easy to use. - Very high powder flow feeding system. - Large wheels for easier transport on rough terrain. - Quick connect, colour coded hoses to machine. - Controls fixed on the machine casing.
Caratteris Caratteristiche del sistema: - dimensioni generali: larghezza: 700 mm; lunghezza: 650 mm; altezza: 1050 mm; - richiede soltanto aria compressa essiccata e GPL; - portatile e facile da usare; - sistema di alimentazione a elevato flusso di polvere; - ruote grandi per un facile trasporto su terreni accidentati; - connessione rapida tramite tubi identificabili in base al colore collegati alla macchina; - controlli fissati sull’involucro della macchina.
Gun sizes
Dimensione delle pistole
Three application gun sizes (small, medium and large) Tre pistole applicative di diverse dimensioni (piccola, media, with different flow rates are grande) e con diverse portate soavailable in several versions no disponibili in svariate versioni (featuring straight flow or (con flusso dritto o ampio getto wide spray pattern), fully di spruzzatura a ventaglio), cominterchangeable: These pletamente intercambiabili: sono guns are equipped with dotate di fessure sulla parte termi“vents” on the gun tip, nale per ottimizzare la ventilaziooptimizing air ventilation ne dell’aria nelle pistole, mante2 © Tecno Supply – a division of IBIX Srl in the gun and keeping the nendole più fredde. gun cooler. Pistole – versioni speciali: Special gun versions: - nuova pistola “Centurion”: la pistola attualmente più poten- New Centurion gun: The most powerful gun of its te per una spruzzatura a ventaglio più ampia, un getto più time for wider spray pattern, faster spraying and veloce e strati più uniformi; sovrapposizione più facile delle more uniform layers, easier overlapping of passes passate e migliore erogazione della polvere; nessuna “striand better powder flowing out, without any powder scia” di polvere; “lines” or “stripes”. - nuovo sistema di raffreddamento “Extra Cooling” con mag- New Extra-Cooling System: With heat exchanger for giore capacità: con scambiatore di calore per una spruzzaprolonged flame spraying. ‹ tura a fiamma prolungata. ‹
2
Hercules flame spray coating system is suitable for concrete flooring. Il sistema di spruzzatura a fiamma Hercules è adatto per pavimentazioni in cemento.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
19
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH
HUGO BOSS RACING YACHT ALL IN BLACK DUE TO FUNCTIONAL PIGMENTS MADE BY BASF La barca a vela di HUGO BOSS completamente in nero con i pigmenti funzionali di BASF
© Mark Lloyd
Opening photo: Functional pigments made by BASF were used to formulate the coating. They ensure that surfaces that are painted in dark colors can remain significantly cooler on hot days as they reflect rather than absorb heat. Foto d’apertura: i pigmenti funzionali di BASF sono stati utilizzati per formulare il rivestimento. Assicurano che le superfici verniciate con colori scuri restino significativamente più fredde nei giorni caldi, riflettendo il calore invece di assorbirlo.
20
W
hether the new racing yacht of the fashion house HUGO BOSS is going to be the fastest sailing boat in the world is yet to be seen. But one thing is certain: Skippers and sailing fans around the world will not be able to ignore this state-of-the-art yacht. Alex Thomson Racing’s new IMOCA 60 racing yacht – also sponsored by the premium automobile brand Mercedes-Benz – is the first entirely black IMOCA 60 yacht in the world. This was made possible by painting the deck with a coating developed by BASF, which is based on the functional pigments made by the company. The yacht, skippered by leading British sailor Alex Thomson, competed in its first Ocean Masters World Championship Race, The Transat Jacques Vabre, which had started in October 2015.
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
C
he il nuovo yacht da regata della casa di moda HUGO BOSS sia la barca a vela più veloce al mondo è ancora da dimostrare, ma una cosa è certa: gli skipper e i fan della vela non potranno ignorare questa imbarcazione all’avanguardia. Il nuovo yacht da competizione IMOCA 60 di Alex Thomson Racing - sponsorizzato anche da MercedesBenz - è il primo modello IMOCA 60 al mondo completamente nero. Questo risultato è stato possibile verniciando il ponte con un rivestimento sviluppato da BASF basato su pigmenti funzionali creati dall’azienda. Lo yacht, comandato da un importante marinaio britannico, Alex Thomson, ha partecipato alla sua prima “Ocean Masters World Championship Race, The Transat Jacques Vabre”, che era iniziata a ottobre 2015.
Joerg Zumkley, BASF Coatings, Münster, Germany, joerg.zumkley@basf.com Philipp Schnorbus, BASF Dispersions & Pigments, Ludwigshafen, Germany, philipp.schnorbus@basf.com
Yachts that feature black sails or a black hull are not altogether new. A deck structure that is entirely black, however, is a novelty because heavy sun exposure tends to heat up the dark surfaces enormously. This can lead to a heat build-up in the cabins below deck, which would make living conditions onboard extremely uncomfortable and can even affect the structural integrity of the composite materials. Hence, it was decided to use the functional pigments made by BASF to formulate the coating. They ensure that surfaces that are painted in dark colors can remain significantly cooler on hot days as they reflect rather than absorb heat. The ship builders used the special pigments that are sold under the Paliogen® brand, which are transparent for Near Infrared Light (NIR), as well as functional NIRreflecting pigments from the Sicopal® range.
Gli yacht caratterizzati da vele o scafi neri non sono una novità. Tuttavia, una struttura del ponte completamente nera rappresenta una novità assoluta poiché l’elevata esposizione al sole tende a riscaldare notevolmente le superfici scure. Questo può portare all’aumento della temperature nelle cabine che si trovano sotto il ponte, fattore che renderebbe le condizioni di vita a bordo estremamente disagevoli e che metterebbe a rischio l’integrità strutturale dei materiali compositi. Per questo motivo è stato deciso di utilizzare pigmenti funzionali realizzati da BASF per formulare il rivestimento. Essi assicurano che le superfici verniciate con colori scuri rimangano significativamente più fredde nei giorni caldi grazie alla loro capacità riflettente, invece che assorbente, del calore. I costruttori dell’imbarcazione hanno utilizzato pigmenti speciali commercializzati con il marchio Paliogen®, che sono trasparenti per il vicino infrarosso (Near Infrared Light, NIR), oltre a pigmenti funzionali che riflettono il vicino infrarosso della gamma Sicopal®.
Reflecting most of the sunlight The pigments are an innovative solution for solar heat management: Through their use, the dark surfaces of the deck reflect a large part of the sunlight that they are exposed to. The sun beams penetrate the base coat whilst the filler below reflects the sunlight and ensures that the temperatures on the coated surfaces as well as inside the boat are significantly lower than they would be if conventional black pigments had been used (Ref. opening photo). “The black coating of the deck has been made possible by the development of this coating technology based on functional pigments,” explains Arno Tuchbreiter, Head of Pigment Marketing for Industrial Coatings at BASF. “Otherwise, the radiation of the sun would lead to an unbearable build-up of heat in the windowless cabin and the interior of the boat. The deck too would become too hot and people would struggle to walk on it barefooted without getting burned.”
Riflettere la maggior parte della luce solare
Great potential in the automotive sector
Grande potenziale per il settore automotive
The paint, based on functional pigments, is not only suitable for yachts and ships, but also highly interesting to the automotive sector. “Therefore, Mercedes-Benz has been involved in the development process at BASF from the very
Questi pigmenti rappresentano una soluzione innovativa per la gestione del calore solare: con il loro utilizzo, le superfici scure del ponte riflettono la maggior parte della luce a cui sono esposte. I raggi del sole penetrano la mano di fondo, mentre il filler sottostante riflette la luce solare e assicura che le temperature sulle superfici verniciate e all’interno della barca siano significativamente più basse di quanto sarebbero con l’utilizzo di pigmenti neri convenzionali (rif. foto d’apertura). “Il rivestimento nero del ponte è stato possibile grazie allo sviluppo di una tecnologia di rivestimento a base di pigmenti funzionali”, spiega Arno Tuchbreiter, Head of Pigment Marketing for Industrial Coatings di BASF. “Altrimenti, la radiazione del sole porterebbe a un aumento insopportabile del calore nella cabine senza finestre e all’interno dell’imbarcazione. Anche il ponte diventerebbe troppo caldo e sarebbe difficile camminarci sopra a piedi nudi senza scottarsi”.
La vernice, a base di pigmenti funzionali, non è adatta soltanto a yacht e navi, ma è interessante anche per il settore automobilistico. “Per questo motivo sin dall’inizio Mercedes-Benz è stata coinvolta da BASF nel processo di sviluppo. Abbiamo condotto test approfonditi usando questa vernice sui nostri veicoli.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
21
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH © Cleo Barnham
start, and we have La nostra intenconducted extensive zione è di usarla testing of this paint su diversi modelli on our vehicles. Our nei prossimi anintention is to use it ni”, spiega Martin on various models Bremer, Head of over the next few Color and Trim di years,” says Martin Mercedes-Benz Bremer, Head of Design. Poiché Color and Trim l’interno dei veiMercedes-Benz coli si scalda noDesign. Because the tevolmente mevehicle interior heats no, l’esigenza di up considerably raffreddamento less, there is a attraverso l’uso lower requirement dell’impianto di for cooling by the condizionamento air conditioning sarà inferiore, elesystem. This will mento che avrà have a particularly un impatto partipositive effect on colarmente posifuel consumption tivo sul consumo in countries with di carburante dei high average Paesi con tempetemperatures, at the rature medie più same time reducing alte riducendo al vehicles’ CO2 tempo stesso le emissions. emissioni CO2 dei The HUGO BOSS veicoli. racing yacht, La barca da regata designed by the HUGO BOSS, proFrench company gettata dall’azien1 VPLP/Verdier, da francese VPLP/ had its unique Verdier, deve il 1 black aesthetical suo design estetiBASF is now also official partner of the offshore yacht racing team design created by co nero e unico a Alex Thomson Racing. Konstantin Grcic, Konstantin Grcic, BASF è ora partner ufficiale del team di regate d’altura Alex Thomson a world famous famoso designer inRacing. industrial designer. dustriale. Lo yacht The yacht was è stato presentalaunched in September 2015. “We were delighted to to a settembre 2015. “Siamo molto soddisfatti di aver work with renowned industrial designer Konstantin lavorato con Konstantin Grcic, rinomato designer induGrcic on this project and we were very keen to ensure striale, su questo progetto e ci siamo impegnati tutti we could deliver his creative vision,” says Stewart al massimo per assicurarci che la sua visione creativa Hosford, Managing Director of sports consultancy prendesse forma”, afferma Stewart Hosford, Managing 5 West Ltd. “Working with BASF has allowed us to Director di sports consultancy 5 West Ltd. “Lavorare con create a truly unique design that would have not BASF ci ha permesso di creare un design davvero uniotherwise been possible without BASF’s technical co che non sarebbe stato possibile senza le loro conocapability and ability to deliver.” scenze e capacità tecniche”. 22
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Joerg Zumkley, BASF Coatings, Münster, Germany, joerg.zumkley@basf.com Philipp Schnorbus, BASF Dispersions & Pigments, Ludwigshafen, Germany, philipp.schnorbus@basf.com
BASF now official partner of Alex Thomson Racing
BASF partner ufficiale di Alex Thomson Racing
BASF is now also official partner of the offshore yacht racing team Alex Thomson Racing (Fig. 1). The first race of the British sailor Alex Thomson on his new yacht is the Transat Jacques Vabre, a double handed 5,000 miles race from France to Brazil, started on October 25, 2015. In November 2016, Thomson will set sail in the pinnacle of offshore racing: The Vendée Globe. This race is 26,000 miles long, solo, non-stop, unassisted around the world. BASF and Alex Thomson Racing have signed a two-year partnership, which will include Thomson’s 2016 Vendée Globe campaign. BASF and Alex Thomson Racing will work together on the marketing of the pigments and the development of new design concepts. ‹
BASF è ora il partner ufficiale del team di regate d’altura Alex Thomson Racing (fig. 1). La prima gara del velista britannico Alex Thomson sulla sua nuova barca a vela è la Transat Jacques Vabre, una competizione in doppio di 5.000 miglia dalla Francia al Brasile, iniziata il 25 ottobre 2015. A novembre 2016, Thomson salperà per il culmine delle regate d’altura: The Vendée Globe, competizione in solitaria intorno al mondo, lunga 26.000 miglia, non-stop e senza assistenza. BASF e Alex Thomson Racing hanno siglato una partnership di due anni, che include la campagna 2016 Vendée Globe di Thomson. BASF e Alex Thomson Racing lavoreranno insieme sul marketing di questi pigmenti e sullo sviluppo di nuovi concept di design. ‹
Your partner for the design, production and application of anticorrosive lining in ebonite, natural and synthetic rubber. Since 1969 Anti-corrosive and anti-abrasive lining in ebonite, natural and synthetic rubber
Sand-blasting and painting
Vessel and piping in reinforced plastics Via Veneziana Badalasco 73 - 24045 Fara Gera D’Adda (BG) - Italy - Tel. +39 0363 399 266 - Fax +39 0363 398 360 - info@pessina.it
w w w. p e s s i n a . i t
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
SPECIFIC SHOT-BLASTING SOLUTIONS FOR THE SURFACE FINISHING OF PIPES Sistemi di granigliatura specifici per pipeline
© Turbotecnica
Opening Photo: The Shot-blasting unit AC-1 PR for threads treatment developed by Turbotecnica. Foto d’apertura: il sistema AC-1 PR progettato da Turbotecnica per il trattamento dei filetti interni ed esterni dei tubi.
24
I
n the pipelines industry, the shot-blasting of internal and external threads is a key production step. The pipe threads are shot-blasted before applying a special anti-friction product that ensures a perfect seal, thus avoiding the use of grease and oils. Thanks to this improvement, the process of installation does not imply the use of substances polluting and harmful to the environment.
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
N
el settore del piping, la granigliatura delle filettature interne ed esterne dei tubi petroliferi è una fase molto importante. Le parti filettate sono “irruvidite” durante il pretrattamento per consentire l’adesione sui filetti di uno speciale prodotto antiattrito, che assicura una perfetta tenuta ed evita così l’utilizzo di grassi e oli lubrificanti. Con questo sistema il processo di posa non include l’utilizzo di sostanze nocive ed inquinanti per l’ambiente.
Francesco Stucchi ipcm®
© Turbotecnica
Turbotecnica S.p.A, with its 35 years of experience in the Turbotecnica Spa, azienda italiana con 35 anni d’econstruction of shot-blasting systems and machines, sperienza nella costruzione di macchine e sistemi di has developed an automatic machine able to roughen granigliatura, ha sviluppato una macchina completathe internal and external threads of the pipes for the mente automatica dedicata proprio all’irruvidimento oil&gas industry (Ref. Opening picture). dei filetti delle tubazioni per il settore oil & gas (rif. “Our company boasts a big experience in the production foto d’apertura). of special equipment tailored “La nostra azienda vanta to the customer’s needs. una grande esperienza nelThe design priority is to la realizzazione di impiandevelop machines with a ti speciali su misura per il simple construction so as cliente. La nostra priorità to significantly reduce the assoluta nella progettaziorisk of failure and wear of ne è quella di sviluppare the components”, explains macchinari di semplice coRosaldo Pezzoni, founder of struzione in modo tale da the company. “Turbotecnica diminuire in maniera imworked hard and goes on portante i rischi di rottuworking in partnership ra e usura dei componenwith leading suppliers of ti”, spiega Rosaldo Pezzoni, components to implement fondatore di Turbotecnica. the best final product”. “L’intensa collaborazione, in “Five plants of this kind with fase progettuale, con i midifferent applications for gliori fornitori della compoeach company have been nentistica, ci ha permesso installed on the international di raggiungere la massima market. They work in a qualità finale delle nostre continuous service, meeting macchine”. the programming and “Sul mercato internazionale production requirements sono stati installati cinque and ensuring the required impianti con varie appliroughening (Ra)”, goes on cazioni di utilizzo per ogni Pezzoni. azienda. Lavorano ininterThe unit is fully automatic. It rottamente rispettando i consists of a mobile cabinet tempi di programmaziowith wear-resistant coating ne, di produzione, e garanand a fixed high pressure tiscono il grado di ruvidi1 sandblaster connected to a tà (Ra) richiesto”, continua cyclone able to recover the Pezzoni. 1 abrasive and separate it from L’impianto, completamenFixed high pressure sand blaster connected to a cyclone the dust (Fig. 1). The filter te automatico, è composto able to recover the abrasive and separate it from the dust. unit has 4 cartridges and its da una cabina mobile con task is to remove the dust rivestimento antiusura e, La granigliatrice ad alta pressione a cui è collegato un ciclone in grado di recuperare l’abrasivo separandolo produced during the shotseparatamente, da una gradalla polvere. blasting process and which is nigliatrice fissa ad alta presthen intercepted by the cyclone. sione a cui è collegato un ciclone in grado di recuThe self-cleaning filters cartridge type FCA perform perare l’abrasivo separandolo dalla polvere (fig.1). dry de-dusting of the air intake from the shot-blasting Il filtro a 4 cartucce ha il compito di rimuovere la polplants, ensuring compliance with the regulations related vere che si genera durante il processo di lavorazione to the emissions into the atmosphere. e successivamente intercettata dal ciclone.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
25
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
© Turbotecnica
A pulse system of compressed air assures I filtri a cartucce autopulenti tipo FCA eseguono la dethe cleaning of the cartridges: The powder is polverazione a secco dell’aria aspirata dagli impianti di collected in a wheeled container under the granigliatura, garantendo il rispetto delle vigenti norhopper of the filter. An electronic control unit mative in termini di emissione in atmosfera. Un sistema runs the washing pulses. a impulsi d’aria compressa assicura la pulizia delle car“To reach the final plant a meticulous work tucce: la polvere si raccoglie quindi in un contenitore has been carried out. The key part is the carrellato posizionato sotto la tramoggia del filtro. Gli software management (Fig. 2). The software impulsi di lavaggio sono gestiti da una centralina elethas the task of managing different sensors tronica. on the machine such as the position of the “Per arrivare all’impianto finale è stato fatto un lavoro blasting lance, progress plant, tube size meticoloso. La parte fondamentale è il software di gedetection, rates of progress, rotation and stione (fig. 2), che ha il compito di gestire numerosi process. sensori sul macchinario, quali: posizione della lancia di The process granigliatura, is automatic”, avanzamento Pezzoni dell’impianto, continues. rilevamento di“After setting mensioni tubo, the recipe tempi di avanin the work zamento, roprogram, tazione e di the sensors processo”, condetect the type tinua Pezzoni. of pipe and “Il tutto funziocarries out na in maniethe blasting ra automatica: process. dopo aver imIt is possible postato la “rito input cetta” nel proup to 200 gramma di customizable lavoro, dei sen2 recipes in sori rilevano la 2 this type of tipologia di tusoftware. bo ed effettuaThe control pad of the software management of the unit. It is possible to add up to 200 customized “recipes”. After years of no la lavorazioIl quadro di comando del software attraverso il quale è possibile inserire fino a 200 experience ne. Per questo “ricette” di lavoro personalizzabili. in indoor tipo di modello and outdoor è possibile inblasting by compressed air, Turbotecnica serire fino a 200 ricette personalizzabili. Abbiamo svidesign department has developed a nozzle luppato, dopo anni di specializzazione nella sabbiatura with special profile and high resistance to interna ed esterna ad aria compressa, un ugello ad alwear. The nozzle is installed on a spear with ta resistenza di usura con profilo speciale. L’ugello innumerical control (Fig. 3) and is able to reach stallato su una lancia a controllo numerico (fig.3) è in all points of the thread, both internal and grado di raggiungere tutti i punti della filettatura, sia external corners. It is also able to perform gli spigoli interni che quelli esterni. È anche in grado precise and fast operations, to adapt to each di compiere operazioni precise e veloci, di adattarsi ad tube profile passing from internal to external ogni profilo di tubo passando da granigliatura interna blasting for pipes from 2” to 24” for this type ed esterna per tubi da 2” fino a tubi da 24” per questa and 36” for the type with bigger dimension”. tipologia e 36” per il modello di maggiori dimensioni”. 26
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Francesco Stucchi ipcm®
© Turbotecnica
3
Example of internal and external blasting for threads. Esempio di trattamento interno ed esterno dei filetti. 4
Turbine shot-blasting unit for pipes. Granigliatrice per tubi di grosso diametro.
3
© Turbotecnica
4
Shot-blasting turbine
Granigliatura a turbina
Turbotecnica also specializes in shot-blasting of pipes of large diameter (Fig. 4). “We manufacture machines able to treat pipes from 1” up to 96” with power starting from 5.5kW to 75kW with one or more turbines positioned on the top and on the lower position or fixed on a telescopic arm in case of internal shot blasting”, says Rosaldo Pezzoni. “The feature that sets us apart from competitors is the design and implementation of automated handling systems, automatic loading/unloading and progress through customized rolls conveyor. In addition, we are able to develop any type of automatic machines for any kind of application”.
Turbotecnica è anche specializzata nella granigliatura di tubazioni di grosso diametro (fig. 4). “Costruiamo macchine in grado di trattare tubi che partono da 1” fino a 96”, con potenze che variano da 5.5kW a 75kW con una o più turbine, posizionate nella parte superiore e nella parte inferiore o montate su un braccio telescopico quando si tratta di granigliatura interna”, prosegue Rosaldo Pezzoni “Ciò che ci contraddistingue dalla concorrenza è la progettazione e realizzazione al nostro interno di sistemi automatizzati di movimentazione, carico/scarico automatico e avanzamento tramite rulliere realizzate su misura. Siamo inoltre in grado di sviluppare macchine automatiche di qualsiasi tipo e per qualsiasi applicazione.”
Conclusions “In these years Turbotecnica has been confronting itself with international realities. The ability to coordinate and promote the highest standards ensured the technical improvements including the management and enhancement of the certification test. The resources and expertise of our technicians focus to increase the levels of construction for the benefit of the final users”, closes Pezzoni. ‹
Conclusioni “Nel corso di questi anni ci siamo confrontati con realtà internazionali. La capacità di coordinamento e di incentivare standard sempre più elevati hanno assicurato i perfezionamenti tecnici, compresa la gestione e il potenziamento dei test di certificazione. Le risorse e le conoscenze dei nostri tecnici si focalizzano per incrementare i livelli di costruzione, a vantaggio dei relativi utilizzatori”, conclude Pezzoni. ‹
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
27
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
A HUGE BELL TO STORE THE BIOGAS PRODUCED BY THE WATER PURIFICATION PLANT OF GRENOBLE Una enorme campana per catturare il biogas prodotto dal sito di depurazione di Grenoble
© Zetagi S.r.l.
T
Opening photo: On the right, the Grenoble mobile gasometric bell. Foto d’apertura: a destra, la campana mobile gasometrica di Grenoble.
28
he mobile gasometric bell of Grenoble (Ref. opening photo) can store 3,100 cubic meters of biogas; this is produced by the treatment-methanation of the sludge coming from the plant treating the waste water of Grenoble and the surrounding municipalities – a total of approximately 300,000 inhabitants. The biogas is used to heat such sludge in order to accelerate its reduction and to provide fuel to the furnace burning the sludge and turning it into ash; the residual gas, after a specific treatment, is recirculated into the city gas network to provide for about 2,500 users per year. This is in fact a huge mobile, vertically moving steel bell, with a 24-metre diameter, a 9,350-metre height and a 120-ton weight.
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
L
a campana mobile gasometrica di Grenoble (rif. foto d’apertura) è finalizzata allo stoccaggio di 3.100 metri cubi di biogas prodotto dall’impianto di trattamento-metanizzazione dei fanghi risultanti dal trattamento delle acque reflue di Grenoble e dei comuni limitrofi, complessivamente circa 300.000 abitanti. Il biogas viene utilizzato per riscaldare i fanghi in modo da accelerarne la riduzione, per fornire combustibile alla fornace che brucia i fanghi e li trasforma in cenere mentre il gas residuo, dopo specifico trattamento, viene immesso nella rete gas della città per fornire circa 2.500 utenze all’anno. Si tratta in effetti di una enorme campana mobile, a scorrimento verticale, in acciaio, con 24 metri di diametro e 9.350 metri d’altezza e del peso di 120 ton.,
Francesco Cavinato Colorificio Zetagì, Olmo di Creazzo (VI), Italy f.cavinato@zetagi.it
It has been built by Metalserbatoi dell’ing. F. Ciacci & C., a company based in Pontenuovo (Perugia, Italy). It has been created in a series of separate parts, then assembled on the site of Aquapole with the aid of two 350-ton mobile cranes. The bell, used for the storage of biogas at a constant pressure, is placed on a huge, 25 m diameter concrete tank, containing liquid sludge from the treatment of the waste water coming from the Grenoble area. The bell is set around the outer perimeter of the tank, on an interspace containing water (Fig. 1 and 2). During operation, gas tightness is ensured by the water head created between the inside and the outside of the bell due to the pressure of biogas. It is of extreme importance that the water level in the interspace is kept constant, because it affects the vertical travel range of the bell and, consequently, the volume of gas stored. The vertical sliding of the bell occurs by means of 12 helical guides made of round tubing and welded to the shell of the bell (Fig. 3 and 4).
realizzata da Metalserbatoi dell’ing. F. Ciacci & C. di Pontenuovo (Perugia) in una serie di parti separate e, quindi, assemblate nel sito di Aquapole con l’ausilio di due gru mobili da 350 ton. La campana, utilizzata per lo stoccaggio di biogas a pressione costante, è posta su una enorme vasca di calcestruzzo, del diametro di 25 metri, contenente fango liquido risultante dal trattamento delle acque reflue del circondario di Grenoble. La campana mobile trova alloggiamento nella parte perimetrale esterna della vasca in calcestruzzo, in corrispondenza di un’intercapedine contenente acqua (figg. 1 e 2). In fase di esercizio, la tenuta del gas è assicurata dal battente idraulico che si determina tra l’interno e l’esterno della campana, dovuto alla pressione del biogas. È di estrema importanza che sia mantenuta costante la quota del livello dell’acqua nell’intercapedine in quanto influenza l’escursione verticale della campana e, conseguentemente, il volume di gas stoccato. Lo scorrimento verticale della campana avviene per mezzo di 12 guide elicoidali realizzate con tubolare rotondo e saldate al mantello della campana (figg. 3 e 4). Le guide sono mantenute in posizione da ap-
1
A section of the bell. Sezione della campana. 2
The operation of the bell. 1
© Zetagi S.r.l.
2
© Zetagi S.r.l.
Funzionamento della campana.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
29
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY positi ruotismi registrabili posti sul bordo della vasca; le ruote di scorrimento sono in nylon fuso, materiale che le rende “anti-scintilla” e al tempo stesso “auto-lubrificanti”. La superficie esterna del tetto è completamente isolata al fine di ridurre al minimo la dispersione termica. La campana mobile è corredata di una serie di dispositivi di controllo e sicurezza: valvola di sovra-pressione e di depressione, arrestatore di fiamma, tubo di sicurezza, apparecchio di controllo di livello ad ultrasuoni, torcia per biogas ed altre apparecchiature che la preservano da eventuali disservizi. Tutte le parti strutturali in acciaio sono dimensionate nel pieno rispetto delle vigenti normative francesi ed europee. Tutta la struttura metallica è stata trattata sia internamente che esternamente al fine di preservarla dall’azione di agenti corrosivi. Entrando nel dettaglio, il trattamento della “campana gasometrica” di Grenoble è stato effettuato con prodotti Veneziani, brand di Zetagi S.r.l., in due fasi distinte: una prima fase in officina ed una seconda fase in cantiere. Il ciclo da applicare in officina ha previsto due trattamenti: 1 - sabbiatura al metallo quasi bianco al grado Sa2,5; 2 - applicazione del fondo TITANIA EP HB per uno spessore DFT di 50-60 micron.
This has been followed by a series of treatments performed at the construction site, namely: 1 - Sandblasting to Sa=2 in areas with the presence of welds, followed by the application of the TITANIA EP HB basecoat. An about 50 micron dry film thickness has been reached. 2 - Application of a further layer of the TITANIA EP HB basecoat with a 40-50 micron thickness,
Il ciclo prevedeva poi una serie di trattamenti da effettuare in cantiere, e precisamente: 1 - sabbiatura al grado Sa2 delle aree con presenza di saldature e successiva applicazione su dette aree del fondo TITANIA EP HB. L’applicazione è stata eseguita per uno spessore secco di 50 micron circa; 2 - applicazione di un ulteriore strato di fondo TITANIA EP HB per uno spessore di 40-50 micron in modo
© Zetagi S.r.l.
The guides are held in position by adjustable gearings placed on the edge of the tank; the sliding wheels are in cast nylon, a material that makes them nonsparking and selflubricating at the same time. The outer surface of the roof is completely insulated to minimise heat loss. Finally, the mobile bell is equipped with a series of control and safety devices: pressure and vacuum valve, flame arrester, safety tube, ultrasonic level control device, biogas torch and other equipment to prevent any failure. The size of all its steel structures complies with the current regulations in France and Europe. They all 3 have been treated against corrosion, both internally and externally. In detail, the treatment of the Grenoble gasometric bell has been performed with products supplied by Veneziani, a brand of Zetagi S.r.l., in two distinct phases: One in the workshop and the other at the construction site. The cycle carried out in the workshop included the following treatments: 1 - Sandblasting to near white metal with Sa=2.5. 2 - Application of a TITANIA EP HB basecoat with a 50-60 micron dry film thickness.
3
Helical guides for the vertical sliding of the bell. Le guide elicoidali per lo scorrimento verticale della campana.
30
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Francesco Cavinato Colorificio Zetagì, Olmo di Creazzo (VI), Italy f.cavinato@zetagi.it
so as to achieve a total dry thickness of 80-90 micron. 3 - Application of a layer of the FENOLIT AS PRIMER, a high thickness and high solid epoxy phenolic coating characterised by high resistance to aggressive chemicals and high temperatures. This layer has a 90-100 micron dry film thickness. 4 - Application of a protective layer of the FENOLIT AS FINISH, a high thickness and high solid epoxy vinyl finish with resistance characteristics that make it particularly suited to the coating of tanks containing gas or liquid chemicals. This layer has a 110 micron dry film thickness. 5 - Application of a further protective layer of the FENOLIT AS FINISH with a 110 micron dry film thickness. Each treatment step has been subjected to a series of controls and tests, before proceeding with the subsequent one. In particular, the adhesion value measured in 5 tests at different and significant points of the surface had to be higher than 3 MPa; the tests have been performed according to the standard ISO 4624. As for the thicknesses applied, the tests have been carried out in compliance with ISO 2808, method A6, with 20 measurements at different points to assess their correspondence to the thicknesses required by the specifications. ‹
4
da portare lo spessore secco totale, incluso lo strato precedentemente applicato, a 80-90 micron; 3 - applicazione di uno strato di primer FENOLIT AS PRIMER, un rivestimento epossifenolico ad alto spessore ed alti solidi caratterizzato da un’alta resistenza alle sostanze chimiche aggressive e alle alte temperature. Applicazione effettuata per uno spessore secco di 90-100 micron; 4 - applicazione di uno strato protettivo FENOLIT AS FINISH, una finitura epossifenolica ad alto spessore e alti solidi con caratteristiche di resistenza che la rendono particolarmente adatta al rivestimento di serbatoi contenenti gas o liquidi chimici. Applicazione effettuata per uno spessore secco di 110 micron; 5 - applicazione di un ulteriore strato protettivo epossifenolico FENOLIT AS FINISH per uno spessore secco di 110 micron.
© Zetagi S.r.l.
4
The helical guides are held in position by adjustable gearings placed on the edge of the tank. Le guide elicoidali sono mantenute in posizione da appositi ruotismi registrabili posti sul bordo della vasca.
Ogni fase di trattamento è stata sottoposta, prima di procedere al trattamento successivo, a una serie di controlli e collaudi. In particolare, il valore di adesione verificato su 5 test in punti diversi e significativi della superficie non doveva risultare inferiore al valore di 3 Mpa; le prove sono state eseguite in conformità alla norma ISO 4624. Relativamente agli spessori, le verifiche, effettuate in conformità con la norma ISO 2808 metodo A6, sono avvenute mediante 20 misure su punti diversi per controllare la corrispondenza agli spessori previsti dal capitolato di applicazione. ‹
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
31
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
NEW SURFACE TOLERANT TECHNOLOGY SOLVES MAINTENANCE DILEMMA Una nuova tecnologia surface tolerant risolve il dilemma della manutenzione
© Belzona Polymerics Ltd.
A Opening photo: Transformer oil storage tanks. Foto d’apertura: i serbatoi di stoccaggio dell’olio per trasformatori.
32
UK oil supplier was faced with a major dilemma when a transformer oil storage tank (Ref. opening photo) began to leak in several places. As the tank was located in a confined space, it would be highly dangerous to repair the damage in-situ using hot work. If the tank was removed and repaired offsite, not only would this incur large amounts of downtime, but the cost of welding alone would be over £15,000. The supplier required a bespoke in-situ repair solution that would safely repair and protect the steel tanks against corrosive attack for the long-term, whilst incurring minimum downtime. In addition to this, as the application area was
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
U
n fornitore di olio del Regno Unito ha dovuto affrontare un grande dilemma quando un serbatoio di stoccaggio di olio per trasformatori (rif. foto d’apertura) ha iniziato a perdere in diversi punti. Poiché il serbatoio era situato in uno spazio chiuso, sarebbe stato molto pericoloso riparare il danno sul posto con lavorazioni a caldo. Se il serbatoio fosse stato invece rimosso e riparato in un altro luogo, l’operazione avrebbe causato dei lunghi periodi di fuori servizio, mentre il costo della sola saldatura avrebbe superato i 20.000 euro. Il fornitore aveva quindi bisogno di una soluzione su misura di riparazione sul posto che avrebbe consentito di riparare e proteggere in sicurezza e a lungo termine i serbatoi di acciaio contro l’attacco corrosivo, riducendo al minimo
Chloe Hirst Belzona Polymerics Ltd., Harrogate, England chirst@belzona.com
highly contaminated with oil, the repair method needed to be compatible with this environment and provide a robust repair solution despite the contaminated surface.
i tempi di fermo. Inoltre, essendo l’area di applicazione altamente contaminata dall’olio, il metodo di riparazione avrebbe dovuto essere compatibile con questo tipo di ambiente e offrire una soluzione di riparazione affidabile nonostante la superficie contaminata.
Background Information
Application Specification Belzona 1212 was chosen to bond steel plates to the damaged areas followed by a protective coating using Belzona 5831 (ST-Barrier). Launched earlier 1 this year, Belzona 1212 represents a milestone for epoxy technology as not only does this material provide excellent, long-term corrosion resistance, but it achieves this even when applied to oil contaminated surfaces where grit blasting is not possible. Coupled with the rapid cure feature ensuring minimal downtime, Belzona 1212 is the ideal solution to repair the leaking tank. Belzona 5831 was chosen to coat the repaired area as this surface tolerant epoxy coating is specially designed for the protection of oil contaminated surfaces.
Informazioni di contesto Il fornitore ricicla milioni di litri di olio per trasformatori ogni anno. Questo processo lavora estraendo l’umidità dall’olio riciclato isolando i serbatoi dall’atmosfera. Questi ultimi sono poi connessi a serbatoi di gel di silice per rimuovere l’umidità. Come risultato della ripetizione di questo processo, diverse zone in prossimità delle giunture dei serbatoi di acciaio (fig. 1) stavano iniziando a corrodersi. © Belzona Polymerics Ltd.
The supplier recycles millions of liters of transformer oil every year. This process works by extracting the moisture from recycled oil by shutting the tanks off from the atmosphere. The tanks are then connected to silica gel tanks to remove the moisture. As a result of this repeated process, several areas located at the seams of the steel tanks (Fig. 1) were beginning to corrode.
Specifiche di applicazione Belzona 1212 è stato scelto per legare la lamiera di acciaio alle aree danneggiate, seguito dall’applicazione del rivestimento protettivo Belzona 5831 (ST-Barrier). Lanciato all’inizio del 2015, Belzona 1212 rappresenta un importante traguardo per la tecnologia epossidica poiché offre un’eccellente e duratura resistenza alla corrosione anche quando applicato a superfici contaminate dall’olio, dove la sabbiatura non è possibile. Grazie alla sua capacità di essicazione rapida - che assicura tempi di fermo macchina ridotti - Belzona 1212 è la soluzione ideale per riparare le perdite dei serbatoi. Belzona 5831 è stato scelto per rivestire l’area riparata poiché questo rivestimento epossidico surface tolerant è stato progettato specificamente per la protezione delle superfici contaminate dall’olio.
1
Leaking weld. Perdita da una saldatura.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
33
© Belzona Polymerics Ltd.
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
2
3
© Belzona Polymerics Ltd.
2
3
Leak sealed with surface tolerant technology.
Another leak sealed.
Fuoriuscita sigillata con tecnologia surface tolerant.
Un’altra perdita sigillata.
34
Fast and Simple Application Method
Metodo di applicazione veloce e semplice
The application was carried out by Belzona Technosol, Belzona’s application services division. Once the leaks were stemmed, the area was then cleaned and roughened to prepare the surface for the Belzona systems. Belzona 1212 was used to bond pre-manufactured steel plates onto the damaged areas. This was done by firstly applying a thin film of the epoxy system onto the prepared substrate, pushing the material well into the profile. Further material was then applied to the steel patch forming a peak of material at the centre. The patch was then pushed into place allowing the excess material to exude from beneath ensuring minimal air entrapment.
L’applicazione è stata eseguita da Belzona Technosol, la divisione di servizi di applicazione di Belzona. Dopo aver tamponato le perdite, l’area è stata pulita e irrugosita per preparare la superficie al sistema Belzona. Per legare le lamiere di acciaio prelavorate sulle superfici danneggiate è stato utilizzato Belzona 1212. A questo scopo, è stato prima applicato un film sottile del sistema epossidico sul substrato preparato, spingendo bene il materiale dentro al profilo. In seguito, è stato applicato altro materiale al rattoppo di acciaio, formando un accumulo di materiale al centro. Il rattoppo è stato poi spinto in posizione consentendo al materiale in eccesso di essudare dal basso, intrappolando meno aria possibile. Il materiale in eccesso è
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
The excess material was then removed and the system was allowed to cure before coating the area with Belzona 5831, providing long-term corrosion protection (Figs. 2 and 3).
We create better durability.
Together.
In-situ Repair Completed in Two Days Osian Jones, Belzona Field Sales Engineer, said: “If the oil supplier had chosen to use welding as the repair method, this could have taken weeks to complete, leading to big problems in terms of trying to stop moisture entering the tanks. The Belzona application was completed in just over two days without the tanks being taken offline. This ensured moisture ingress would not occur and allowed the plant to continue as normal with minimal disruption. Furthermore, the supplier was able to avoid a significant amount of capital expenditure as the Belzona repair method could be carried out at a fraction of the cost of welding.” ‹
stato in seguito rimosso e il sistema è stato fatto polimerizzare prima di rivestire la zona con Belzona 5831, offrendo una protezione dalla corrosione a lungo termine (figg. 2 e 3).
Riparazione completata in loco in due giorni Osian Jones, Field Sales Engineer di Belzona, ha dichiarato: “Se il fornitore di olio avesse scelto di utilizzare la saldatura come metodo di riparazione, sarebbero servite settimane per completare l’operazione, portando a gravi problemi collegati al tentativo di impedire all’umidità di entrare nei serbatoi. L’applicazione di Belzona è stata completata in soli due giorni, senza dover staccare i serbatoi dalla linea. Questo ha impedito all’umidità di entrare nei serbatoi e ha consentito all’impianto di continuare le attività normalmente, con disturbi minimi. Inoltre, il fornitore è stato in grado di evitare importanti spese in conto capitale. Il metodo di riparazione di Belzona, infatti, può essere effettuato a una frazione del costo di saldatura”. ‹
At Huntsman Polyurethanes, we believe that working in true collaboration with customers is the only way to solve complex problems and find the solutions that will deliver real innovation. So, we strive with a passion and determination to build the deep understanding of our customers that’s required to get to the heart of their needs and establish lasting partnerships. When it comes to creating better durability in critical structures such as bridges, we’ll work with you to produce tailored MDI-based coatings that provide enhanced structural integrity and protection against corrosion. Combine our knowledge of coatings with your expertise, and we’ll create better bridges… together.
www.huntsman.com/pu
PROTECTIVE COATINGS | INNOVATIONS
RESOURCE EFFICIENT CORROSION PROTECTION: A LIFE CYCLE ASSESSMENT OF A SILICONE-EPOXY HYBRID RESIN BASED COATING Protezione dalla corrosione a basso impatto ambientale: ciclo di vita di un rivestimento a base di una resina ibrida epossi-siliconica
36
he term resource efficiency is used widely in the paints and coatings market. The aim is to offer customers the products they need in order to produce resource-efficient paints and coatings. The term resource efficiency here characterizes the bundling of the environmental and economic pillars of sustainability. [1] More than any other sector, the corrosion protection market is showing the impact that the use of perfectly tailored pigments and binder systems can have on the function of the coating as a whole and also on the protection/durability of valuable objects.
T
I
Silicone-epoxy hybrid resin for corrosion protection applications
Resina epossi-siliconica ibrida per applicazioni contro la corrosione
Silicone-epoxy hybrid resins (one such product is SILIKOPON® EF offered by Evonik Resource Efficiency GmbH) can be used in corrosion protection applications. [2] In these applications, the coating must meet different requirements to fulfill the needed corrosion resistance. The coating must protect the underlying steel by adhering well while simultaneously preventing harmful substances from coming into contact with the substrate. The coating must, itself, be weather resistant. This means not only resistant to rain, snow and ice but also to the high energy UV component of sunlight. However, additional active protection of the steel, with for example a zinc primer, cannot be avoided. Conventional coating systems for heavy corrosion protection are based on a 3 layer application system built to reach the above mentioned requirements, specified in ISO 12944 (C5-I/M, high protection). The market standard is based on an epoxy zinc rich primer, an epoxy intermediate layer and a PU top coat. [3] Silicone-epoxy hybrid resins can be used as solvent-free, ultra high solids binders for resourceconserving in many different industrial top coat applications. This technology allows formulation of coating systems with significantly less than 250
Le resine epossi-siliconiche ibride (una di queste è la resina SILIKOPON® EF prodotta da Evonik Resource Efficiency GmbH) possono essere usate in applicazioni contro la corrosione. [2] In queste applicazioni, il rivestimento deve soddisfare diversi requisiti per poter raggiungere la necessaria protezione anticorrosiva. Il rivestimento deve proteggere l’acciaio sottostante, aderendo perfettamente alla superficie e prevenendo contemporaneamente che sostanze pericolose entrino in contatto con il substrato. La vernice deve essere resistente alle intemperie: non solo alla pioggia, alla neve e al ghiaccio, ma anche alla componente UV (altamente energetica) dei raggi solari. Non si esclude comunque, per un’ulteriore protezione dell’acciaio, l’uso ad esempio anche di un primer a base di zinco. I sistemi protettivi tradizionali per la protezione dalla corrosione si basano su un sistema applicativo a 3 strati studiato per ottenere i requisiti sopra citati, specificati nella norma ISO 12944 (C5-I/M, protezione elevata). Lo standard di mercato si basa quindi su di un primer epossidico a base di zinco, uno strato intermedio di resina epossidica e di una finitura poliuretanica. [3] Le resine epossi-siliconiche ibride possono essere impiegate come leganti ad altissimo solido, esenti da solventi, per preservare le risorse in diverse applicazioni per finiture industriali. Questa tecnologia permette di formulare sistemi vernicianti con un COV abbondantemente infe-
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
l termine Efficienza delle Risorse è oggi ampiamente utilizzato nel mercato delle vernici e alla base di questo concetto vi è lo scopo di offrire ai clienti i prodotti più idonei per realizzare rivestimenti a ridotto impatto ambientale. Il termine Efficienza delle Risorse rappresenta così l’insieme dei pilastri ambientali ed economici della sostenibilità. [1] Più che in qualsiasi altro settore, il mercato dei prodotti per la protezione dalla corrosione evidenzia come l’impiego di specifici pigmenti e leganti possa influire positivamente sulle funzioni di una vernice nel suo insieme e anche sulla protezione e durata di oggetti di pregio.
Björn Bröskamp, Florian Böss, Sascha Herrwerth, Christiane Cova-Hög Evonik Resource Efficiency GmbH, Essen, Germany bjoern.broeskamp@evonik.com, florian.boess@evonik.com, christiane.cova-hoeg@evonik.com
1
Advantages of siliconeepoxy hybrid resins. I vantaggi delle resine epossi-siliconiche ibride.
1
© Evonik Resource Efficiency GmbH
g/L (sometimes even less than 100 g/L) VOC as well as permitting isocyanate-free crosslinking. [3] The silicone-epoxy hybrid resin technology combines the positive effects of an aliphatic epoxy resin like corrosion protection and chemical resistance with the UV resistance and low yellowing characteristics of an alkoxy silicone resin. Together with an amino alkoxy silane hardener the abilities of the intermediate epoxy layer and the PU top coat can be combined (Fig. 1). Thus, new two layer corrosion protection systems with lower film thicknesses and the same corrosion protection abilities can be achieved. By reducing the film thickness, less coating material is needed. This led to the assumption that the two layer systems are more resource efficient than the market standard three layer systems. To prove that silicone-epoxy hybrid resins support resource efficient coating systems, the entire life cycle of a coating based on a silicone-epoxy hybrid resin was analyzed in an ISO certified life cycle assessment.
riore a 250 g/L (in alcuni casi perfino al di sotto di 100 g/L) ed una reticolazione esente da isocianati. [3] La tecnologia che si basa sulle resine epossi-siliconiche ibride combina gli effetti positivi di una resina alifatica epossidica come la protezione dalla corrosione e dagli agenti chimici, con la resistenza ai raggi UV ed una bassa tendenza all’ingiallimento di una resina alcossi-siliconica. Utilizzando come catalizzatore un ammino-silano si raggiungono le prestazioni combinate dello strato epossidico intermedio e della finitura PU (fig. 1). In questo modo si possono realizzare nuovi sistemi di protezione dalla corrosione a due strati con bassissimi spessori del film e con le medesime prestazioni contro la corrosione. Riducendo lo spessore del film, si riduce il consumo di vernice. Si giunge quindi alla conclusione che i sistemi a due strati contribuiscono maggiormente all’efficienza delle risorse rispetto a quelli tradizionali a tre strati. A dimostrazione del fatto che le resine epossi-siliconiche ibride supportano in modo considerevole i sistemi vernicianti a ridotto impatto ambientale, è stato analizzato l’intero ciclo di vita di un rivestimento a base di una resina epossi-siliconica ibrida e ottenuto un certificato ISO LCA (Life Cycle Assessment).
Concept of the life cycle assessment of a silicone-epoxy hybrid resin in a corrosion protection application
Ciclo di vita di una resina epossi-siliconica ibrida in un sistema applicativo contro la corrosione
A life cycle assessment (LCA) is an evaluation of inputs, outputs and the potential environmental impacts of a product system throughout its life cycle. The life cycle depends on the boundaries of the study. A Cradle-to-Gate LCA investigates all environmental impacts from feedstock over production until a product leaves the “gate” of
La valutazione del ciclo di vita di un prodotto (LCA) è uno studio volto ad analizzare i potenziali impatti ambientali di un prodotto nel corso del suo intero ciclo di vita, dalle origini allo smaltimento dello stesso. I confini dello studio dipendono dal ciclo di vita del prodotto. Una valutazione LCA Cradle-to-Gate analizza tutti gli impatti ambientali a partire dalle materie prime utilizzate fino all’uscita dallo
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
37
PROTECTIVE COATINGS | INNOVATIONS
© Evonik Resource Efficiency GmbH
2
System boundaries and life cycle stages of the study. Confini del sistema e passaggi all’interno dello studio sul ciclo di vita.
2
a manufacturing site. The system boundary of a Cradle-to-Gate LCA defines which “gate” of multiple steps within a supply chain is meant. The Cradle-to-Grave approach, on the other hand, additionally investigates the application (Usephase) and the End-of-Life of a product so that it covers the entire life cycle from raw material acquisition or generation from natural resources to the final disposal. The LCA study of the silicone-epoxy hybrid resin was conducted in accordance with ISO 14040 and 14044 and approved by an external review panel. It investigates the environmental impacts of corrosion protection coatings over their whole life cycle, from the raw material production, through coating formulation and production, as well as their application, and the end-of-life (Cradle-to-Grave). The system boundaries are displayed in Figure 2. The results are analyzed in a stepwise approach. First the preliminary Cradleto-Gate results of each coating layer are discussed. Afterwards, application and end-of-life are added to get the final results over the entire life cycle (Cradle-to-Grave). The study gives a comprehensive overview on the environmental impacts of the different coating systems. Nonetheless, special attention is drawn on the Global Warming Potential (GWP, also known as Carbon Footprint), Primary Energy Demand (PED) and Photochemical Ozone 38
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
stabilimento di produzione. Il sistema LCA Cradle-to-Gate definisce inoltre, in caso di passaggi multipli, quale sia l’ultimo passaggio da prendere in considerazione all’interno della catena di fornitura. Il sistema LCA Cradle-to-Grave, invece, svolge ulteriori ricerche sull’applicazione (fase di utilizzo) e sulla fine della vita di un prodotto, analizzando in modo più approfondito l’intero ciclo di vita, dall’acquisizione delle materie prime, anche provenienti da risorse naturali, fino allo smaltimento finale. La misurazione del ciclo di vita (LCA) della resina ibrida epossi-siliconica è stata effettuata in conformità con le norme ISO 14040 e14044 ed approvata da un ente certificatore. Questo studio analizza gli impatti ambientali dei rivestimenti anti-corrosivi durante il loro intero ciclo di vita, dalla produzione della materia prima, al processo formulativo e produttivo, fino all’applicazione e allo smaltimento finale del prodotto (Cradle-to-Grave). I confini del sistema sono illustrati nella figura 2. I risultati vengono analizzati attraverso un approccio graduale. Innanzitutto vengono esaminati i risultati dello studio preliminare Cradle-to-Gate di ciascun strato di vernice; successivamente vengono integrati i risultati ottenuti nella fase di applicazione e smaltimento, per ottenere così una valutazione finale sull’intero ciclo di vita del rivestimento (Cradle-to-Grave). Lo studio offre una panoramica approfondita sugli impatti ambientali di diversi sistemi vernicianti, con un’attenzione particolare al potenziale impatto sul riscaldamento globale (Global Warming Potential – GWP noto anche come Carbon Footprint), al consumo di energia primaria (Primary Energy Demand - PED) e all’inquinamento prodotto
Creation Potential (POCP). The POCP (also called summer smog) describes the change of the ozone concentration near ground level. VOC emissions from the drying process of coatings have a major impact on the POCP, hence this impact category is of special interest in this application. GWP and PED are the most common impact categories and will therefore generate a good understanding of the overall results. Other categories are not as closely analyzed even though qualitative and quantitative results are also given in the study. Two different coating systems are compared regarding their environmental performance. Reference System The reference system has three different layers and represents the market standard for a heavy duty corrosion protection coating. Each layer is applied in a different thickness. The NDFT (nominal dry film thickness) of epoxy zincrich primer is 80 μm, which is the same in both coating systems. The intermediate layer of this reference system is an epoxy based layer with the average coating thickness of 170 μm.
dall’ozono (Photochemical Ozone Creation Potential - POCP). Il POCP, chiamato anche inquinamento fotochimico, descrive i cambiamenti delle concentrazioni di ozono negli strati più bassi dell’atmosfera. In particolar modo le emissioni di solventi durante il processo di essiccamento hanno un considerevole impatto sul valore POCP, da qui il particolare interesse riservato a questa categoria di impatto ambientale. GWP e PED sono le più comuni categorie di impatto ed incidono in misura maggiore sui risultati generali. Altre categorie non sono analizzate così attentamente, nonostante i risultati qualitativi e quantitativi vengano comunque illustrati nello studio. In questo studio sono stati confrontati due diversi sistemi vernicianti, valutandone le loro prestazioni dal punto di vista ambientale. Sistema di riferimento Lo standard di mercato è rappresentato da un sistema di riferimento a tre strati utilizzato per ottenere una protezione anti-corrosione altamente resistente. Ogni strato viene applicato con differenti spessori. Lo spessore nominale del film essiccato (Nominal Dry Film Thickness – NDFT) di un primer zincante epossidico è di 80 μm, uguale per entrambi i sistemi. Lo strato intermedio di questo sistema di riferimento è una resina epossidica con uno spessore medio
© Evonik Resource Efficiency GmbH
PROTECTIVE COATINGS | INNOVATIONS
3 3
The two coating systems and their film thickness. Confronto tra i due sistemi e degli spessori applicati.
40
The two-pack PU top coat of this system is based on a hydroxy functional acrylic resin with a film thickness of 70 μm. [4] The international standard ISO 12944 (C5-I /M, high protection) describes not only the tests that need to be fulfilled to reach a certain level of corrosion protection, but it prescribes the film thickness that is mandatory to achieve a desired durability class at chosen corrosion category. The reference system, which was chosen here, fulfills all the specifications concerning the total NDFT according to ISO 12944 (C5-I/M, high protection).[4]
di 170 μm. La finitura è un sistema PU a due componenti a base di una resina acrilica ossidrilata e il film applicato di 70 μm. [4] Lo standard internazionale ISO 12944 (C5-I/M, protezione elevata) descrive non solo i test necessari per raggiungere un determinato livello di protezione dalla corrosione, ma allo stesso tempo prescrive lo spessore minimo del film per ottenere una determinata classe di durevolezza. Il sistema di riferimento preso in esame risponde a tutte le richieste inerenti lo spessore minimo del film essiccato (NDFT) in conformità alla norma ISO 12944 (C5-I/M, protezione elevata). [4]
Silicone-epoxy hybrid system The second system is a two layer system with an epoxy zinc-rich primer and a top coat that is based on the silicone-epoxy hybrid resin. The siliconeepoxy hybrid resin based top coat is applied with a nominal dry thickness of 100 μm. Since polysiloxane based paints are not included in ISO 12944 (C5-I/M, high protection) and therefore no recommendations for NDFT are available, the top coat was applied as thin as possible, while still achieving the same corrosion protection performance as the reference system. For the top coat of the silicone-epoxy hybrid system the
Sistema epossi-siliconico ibrido Il secondo sistema è a due strati e consiste in un primer zincante epossidico e una finitura a base di una resina epossi-siliconica ibrida. La finitura viene applicata con uno spessore nominale del film essiccato di 100 μm. Poiché i rivestimenti a base di polisilossani non sono contemplati nella norma ISO 12944 (C5-I/M, protezione elevata) e quindi non sono disponibili informazioni sullo spessore minimo raccomandato, la finitura viene applicata con uno strato il più sottile possibile, che garantisca le prestazioni anti-corrosione del sistema di riferimento. La formulazione utilizzata per questo tipo di finitura è quella riportata nell’articolo
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Björn Bröskamp, Florian Böss, Sascha Herrwerth, Christiane Cova-Hög Evonik Resource Efficiency GmbH, Essen, Germany bjoern.broeskamp@evonik.com, florian.boess@evonik.com, christiane.cova-hoeg@evonik.com
“Silicone-epoxy hybrid binders – a strong network against rust”. [3] Nella figura 3, sono evidenziati gli spessori dei due sistemi a confronto. Lo spessore del film è sempre indicato come valore nominale del film essiccato (NDFT).
Testing Both systems were tested according to ISO 12944 (C5-I /M, high protection). This includes exposure to chemicals in accordance with ISO 2812-1 for 168 h, determination of resistance to humidity (continuous condensation) according to ISO 6270 for 720 h and determination of resistance to neutral salt spray (fog) according to ISO 9227 for 1440 h. The results of the salt spray test are shown in Figure 4. Both coatings systems performed comparably in the above mentioned test methods, although they significantly differ in film thickness. Hence, these tests prove that the corrosion protection performance of both systems is similar. 4 This is the base for the comparison of the environmental impacts in the life cycle assessment of the two coating systems. [5]
Test Entrambi i sistemi sono stati testati secondo la norma ISO 12944 (C5-I/M, elevata protezione). Questo test comprende l’esposizione agli agenti chimici, in conformità alla norma ISO 2812-1 per 168 ore, la determinazione della resistenza all’umidità (condensazione continua) secondo norma ISO 6270 per 720 ore e la determinazione della resistenza alla nebbia salina secondo norma ISO 9227 per 1440 ore. I risultati del test di resistenza alla nebbia salina sono illustrati nella figura 4. Nei test sopra citati, entrambi i sistemi vernicianti offrono prestazioni paragonabili, nonostante differiscano in modo sostanziale nello spessore del film. Questi test provano quindi che le prestazioni anti corrosione di entrambi i sistemi sono equivalenti e questo rappresenta la base per un accurato confronto dell‘impatto ambientale all’interno dello studio sul ciclo di vita dei due sistemi vernicianti. [5]
Results of the Life Cycle Assessment
Risultati dello studio sul ciclo di vita
The Cradle-to-Gate results of each layer used for the two systems are shown in Figure 5. It shows the Global Warming Potential of the four different layers up to the point where the coatings leave the site of the coating manufacturer (Cradle-to-Gate). The silicone-epoxy hybrid resin shows the highest carbon dioxide emissions per kg liquid coating formulation, which is mainly because of the complex production process and its silicone based nature. However the carbon dioxide emissions per kg layer were just the results of a Cradle-to-Gate system boundary.
I risultati Cradle-to-Gate di ciascuno strato impiegato nei due sistemi comparati, sono illustrati nella figura 5. L’analisi mostra il potenziale riscaldamento globale dei quattro differenti sistemi applicati fino all’uscita della vernice dallo stabilimento di produzione (Cradleto-Gate). La resina epossi-siliconica ibrida mostra le più alte emissioni di anidride carbonica per ogni kg di rivestimento liquido, dovuto principalmente alla complessità del processo produttivo e alla sua natura siliconica. In ogni caso si tratta dell’emissione di anidride carbonica del ciclo di vita relativa alla fase Cradle-to-Gate.
© Evonik Resource Efficiency GmbH
formulation from the article “Silicone-epoxy hybrid binders – a strong network against rust” was used. [3] In Figure 3, the two systems are compared regarding their film thickness. The film thickness is always the Nominal Dry Film Thickness (NDFT).
4
Test results of the salt spray test according to ISO 9227 for 1440 h. Risultati del test di resistenza alla nebbia salina secondo norma ISO 9227 per 1440 ore.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
41
© Evonik Resource Efficiency GmbH
PROTECTIVE COATINGS | INNOVATIONS
5
Comparison of the Global Warming Potential of the used coating layers per kg layer (Cradle-to-Gate). Confronto tra il potenziale riscaldamento globale (GWP) degli strati di rivestimento usati per strato in kg (Cradle-toGate).
5
More significant results can be achieved with a system boundary over the entire life cycle. In a life cycle assessment with a Cradle-to Grave approach, the application phase and the end-of-life have to be considered as well. Also the functional unit which is investigated is not the kg of the layer but the coating of 1 m2 of coated metal substrate. The environmental impact on the Global Warming Potential of the two compared coating systems is shown in Figure 6. It shows that the CO2 emissions of the silicone-epoxy hybrid based coating system are up to 36% lower than the market standard system. Figure 6 shows that silicone-epoxy hybrid resin based coating can also reduce the Primary Energy Demand by up to 36%. A closer look at the two impact categories shows that the majority of the emissions are raw material related. Disposal of the systems is responsible for 25% of the CO2 emissions, and is a function of the amount of coating which must be removed and disposed of. These results prove that a reduction of film thickness reduces the environmental impact of this coating system over the entire life cycle. The third impact category that was analyzed in detail is the Photochemical Ozone Creation Potential. It represents the VOC emissions of a coating system. Figure 6 shows that the Photochemical Ozone Creation Potential (POCP) can be reduced by 65% within the thin siliconeepoxy hybrid resin system. Almost all the emissions are created in the application phase in which the coating is applied, dries and the solvent leaves the coating film. [5] 42
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Risultati più significativi si possono ottenere ampliando i limiti del sistema e analizzando l’intero ciclo di vita del rivestimento. In uno studio LCA Cradle-to-Grave vengono presi in esame sia la fase applicativa, sia lo smaltimento. Anche l’unità di misura di riferimento non sarà la massa espressa in kg dello strato, ma il rivestimento di 1 m2 di metallo verniciato. L’impatto ambientale sul potenziale riscaldamento globale (GWP) dei due sistemi vernicianti messi a confronto è illustrato nella figura 6. Si nota come le emissioni di CO2 del sistema a base di una resina epossi-siliconica ibrida siano fino al 36% inferiori rispetto al sistema di riferimento. La figura 6 mostra inoltre che il rivestimento a base di resina epossi-siliconica ibrida può ridurre il consumo di energia primaria fino al 36%. Uno sguardo più attento alle due categorie di impatto ambientale rivela che la maggior parte delle emissioni provengono dalle relative materie prime. Lo smaltimento dei sistemi è responsabile del 25% delle emissioni di CO2 e varia in funzione del quantitativo di vernice da rimuovere e quindi smaltire. Questi risultati dimostrano che una riduzione dello spessore del film riduce l’impatto ambientale del sistema verniciante lungo l’intero ciclo di vita. La terza categoria di impatto analizzata nel dettaglio è l’inquinamento fotochimico prodotto dall’ozono. Esso rappresenta le emissioni di COV di un rivestimento protettivo. La figura 6 mostra come l’inquinamento prodotto dall’ozono (POCP) possa essere ridotto del 65% attraverso un sistema a base di un solo strato sottile di resina epossi-siliconica ibrida. Quasi tutte le emissioni vengono prodotte durante la fase applicativa, quando la vernice asciuga e il solvente evapora. [5]
Björn Bröskamp, Florian Böss, Sascha Herrwerth, Christiane Cova-Hög Evonik Resource Efficiency GmbH, Essen, Germany
© Evonik Resource Efficiency GmbH
bjoern.broeskamp@evonik.com, florian.boess@evonik.com, christiane.cova-hoeg@evonik.com
Comparison of the environmental impacts in three different impact categories of coating of 1 m² for both systems (Cradle-to-Grave). Confronto dell‘impatto ambientale, nelle tre differenti categorie, di 1 m2 di vernice applicata con entrambi i sistemi (Cradle-to-Grave).
6
The life cycle assessment covers the environmental differences between the chosen systems. A coating system with just two layers provides several additional advantages over the conventional three layer systems, which are not covered quantitatively with the LCA results. Some examples are shorter curing times, less application time and fewer raw materials to purchase, store and carry for the professional painters.
6
All’interno dello studio sul ciclo di vita (LCA) si trovano le differenze ambientali tra i due sistemi messi a confronto. Sotto diversi aspetti, un sistema a due strati risulta più vantaggioso rispetto ad uno tradizionale a tre strati: per esempio si riducono i tempi di reticolazione e di applicazione, nonché il quantitativo di materia prima da acquistare, stoccare e movimentare.
In sintesi Results at a glance - Increasing trend towards ecologically-responsible business practices. - It is possible to achieve the same corrosion protection performance as the current market standard systems with just two layers and a much lower overall film thickness with a top coat which is based on silicone-epoxy hybrid resin. - Silicone-epoxy hybrid resins help reduce emissions from Cradle-to-Grave although they have higher Cradle-to-Gate emissions. The Carbon Footprint and Primary Energy Demand decrease by 36%, while the VOC emissions drop by 65%. ‹
- Miglior atteggiamento eco-responsabile con innovative resine epossi-siliconiche ibride. - Con una finitura a base di una resina epossi-siliconica ibrida, con solo due strati ed uno spessore del film più ridotto, è possibile ottenere le medesime prestazioni di protezione dalla corrosione di un sistema tradizionale. - Le resine epossi-siliconiche ibride riducono le emissioni durante l’intero ciclo di vita (Cradle-to-Grave), nonostante risultino avere un più elevato valore di emissioni rapportato all’analisi parziale Cradle-to-Gate. Il potenziale riscaldamento globale e il consumo di energia primaria si riducono del 36%, mentre le emissioni di COV del 65%. ‹
Literature
Bibliografia
[1] Evonik Resource Efficiency GmbH, The Big TEGO, 2013, 14-17. [2] www.tego.de, Technical data sheet TEGO “SILIKOPON® EF”. [3] D. Hinzmann, T. Klotzbach, S. Herrwerth, Silicone-epoxy hybrid binders – a strong network against rust, PAINTINDIA; 62, 11; 83-91. [4] International Organization for Standardization. (1998). Paints and varnishes - Corrosion protection of steel structures by protective paint, ISO 12944. Berlin: Beuth. [5] Florian Böss, Björn Bröskamp, Comparative Study - Life Cycle Assessment of Corrosion Protection Coating Systems, July 2014.
[1] Evonik Resource Efficiency GmbH, The Big TEGO, 2013, 14-17. [2] www.tego.de, Technical data sheet TEGO “SILIKOPON® EF”. [3] D. Hinzmann, T. Klotzbach, S. Herrwerth, Silicone-epoxy hybrid binders – a strong network against rust, PAINTINDIA; 62, 11; 83-91. [4] International Organization for Standardization. (1998). Paints and varnishes - Corrosion protection of steel structures by protective paint, ISO 12944. Berlin: Beuth. [5] Florian Böss, Björn Bröskamp, Comparative Study - Life Cycle Assessment of Corrosion Protection Coating Systems, July 2014.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
43
PROTECTIVE COATINGS | INNOVATIONS
AN INTRODUCTION TO THERMAL SPRAY – PART 2 Introduzione alla termospruzzatura – Parte 2
© Oerlikon Metco
his is the Part 2 of a four-part article. The first part was published in ipcm®_ Protective Coatings n. 15 (October 2015). The two parts remaining will be published respectively in ipcm®_Protective Coatings n. 17 (April 2016) and ipcm®_Protective Coatings n. 18 (June 2016).
T
Q
2.4 Thermal Spray Coating Processes There are several different processes used to apply a thermal sprayed coating [2]. They are: - Conventional flame spray - Electric arc wire spray - Plasma spray - High velocity oxy-fuel spray (HVOF).
2.4 Processi di rivestimento mediante termospruzzatura (Thermal Spray) Esistono diversi processi per applicare un rivestimento termospruzzato [2]. Questi sono: - spruzzatura convenzionale alla fiamma; - spruzzatura tramite arco elettrico a filo; - spruzzatura al plasma; - spruzzatura a fiamma ad alta velocità (HVOF).
uesta è la seconda parte di un articolo suddiviso in quattro capitoli. La prima parte è stata pubblicata su ipcm®_Protective Coatings n. 15 (ottobre 2015). Le restanti due parti saranno pubblicate rispettivamente in ipcm®_Protective Coatings n. 17 (aprile 2016) e ipcm®_Protective Coatings n. 18 (giugno 2016).
2.4.1 Conventional Flame Spray Process 2.4.1.1 Wire Flame Spray With the wire flame spray process (Fig. 4a), the wire spray material is melted in a gaseous oxygen-fuel flame. The fuel gas can be acetylene, propane, hydrogen or MAPP. The wire is fed 44
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
2.4.1 Processo di spruzzatura convenzionale alla fiamma 2.4.1.1 Spruzzatura a combustione con apporto di filo Con il processo di combustione alimentato a filo (fig. 4a), il materiale da spruzzare è fuso in una fiamma ossi-combu-
Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com
4a
concentrically into the flame, where it is melted and atomized by the addition of compressed air and directed towards the coating surface. 2.4.1.2 Powder Flame Spray This coating process (Fig. 4b) is based on the same operational principle as the wire flame spray process, with the difference that the coating material is a spray powder. Thus, a larger selection of spray materials is available, as not all spray materials can be manufactured in wire form. 2.4.2 Electric Arc Wire Spray With electric arc wire spray (Fig. 5), an arc is formed by contact of two oppositely charged metallic wires, usually of the same composition. This leads to melting at the tip of the wire material. Air atomizes the melted spray material and accelerates onto the substrate. The rate of spray is adjusted by appropriate regulation of the wire feed as it is melted, so a constant arc can be maintained. 2.4.3 Plasma Spray The principle of plasma spraying is shown schematically in Figure 6a. A high frequency arc is ignited between an anode and a tungsten cathode. The gas flowing through between the electrodes (i.e., Ar, He, H2, N2 or mixtures) is ionized such that
© Oerlikon Metco
4b
© Oerlikon Metco
stibile. Il gas combustibile può essere acetilene, propano, idrogeno o MAPP. Il filo è alimentato assialmente dentro la pistola di spruzzatura, dove viene fuso dalla fiamma. Un getto di aria compressa di opportuna pressione provvede ad atomizzare, accelerare e dirigere le particelle fuse sulla superficie da rivestire. 2.4.1.2 Spruzzatura a combustione con apporto di polvere Questo processo di rivestimento (fig. 4b) si basa sullo stesso principio operativo del processo di combustione alimentato a filo, con la differenza che il materiale di apporto è una polvere. È pertanto disponibile una più ampia scelta di materiali, in quanto non tutti quelli richiesti dalla termospruzzatura possono essere fabbricati in forma di filo.
4a
Schematic diagram of the wire flame spray process. Schema del processo di spruzzatura a combustione alimentato a filo. 4b
Schematic diagram of the powder flame spray process. Schema del processo di spruzzatura a combustione alimentato a polvere.
2.4.2 Termospruzzatura (Thermal Spray) ad arco elettrico alimentato a filo Nel processo ad arco elettrico (fig. 5), il contatto di due fili metallici (normalmente della stessa composizione) collegati a polarità distinte, genera una scarica nel punto di contatto. Si determina in tal modo la fusione della punta del materiale di ciascun filo. L’aria compressa atomizza il materiale fuso, lo accelera e lo proietta sul substrato. La quantità di materiale spruzzato è regolata agendo sulla velocità di avanzamento del filo, in modo da mantenere un arco costante durante il progredire della fusione. 2.4.3 Spruzzatura al plasma Il principio della spruzzatura al plasma è illustrato schematicamente nella figura 6a. Tra un anodo e un catodo al tungsteno si innesca un arco ad alta frequenza. Il gas che fluisce attraverso gli elettrodi (ovvero, Ar, He, H2, N2 o ipcm® Protective Coatings - 2015 DECEMBER - N. 16
45
PROTECTIVE COATINGS | INNOVATIONS
5
Schematic diagram of the electric arc wire spray process. Schema del processo di termospruzzatura ad arco elettrico alimentato a filo.
6a
Schematic diagram of the plasma spray process. Schema del processo di spruzzatura al plasma. 6b
VPS plasma spraying. Spruzzatura al plasma in camera ad atmosfera controllata.
6a
46
a plasma plume several centimeters in length develops. The temperature within the plume can reach as high as 16000 °K. The spray material is injected as a powder outside of the gun nozzle into the plasma plume, where it is melted, and hurled by the gas onto the substrate surface. For specialized applications, a variant of the process is to plasma spray in a controlled, low pressure atmosphere. In contrast to coating in air (atmospheric plasma spraying, or APS), the melted particles oxidize far less with vacuum plasma spraying (VPS, 5 Fig. 6b), resulting in coatings of considerably higher quality [3].
miscele) viene ionizzato in modo da sviluppare un dardo plasma lungo alcuni centimetri. La temperatura del dardo può raggiungere i 16.000° K nel punto più caldo. Il materiale d’apporto è iniettato in forma di polvere all’esterno dell’ugello della pistola, penetrando nel dardo plasma per essere fuso, accelerato e proiettato violentemente dal gas sulla superficie del substrato. Per applicazioni specialistiche, una variante del processo prevede la spruzzatura al plasma in atmosfera controllata a bassa pressione. Al contrario del rivestimento in aria (spruzzatura al plasma in ambiente atmosferico o APS), con la spruzzatura al plasma in camera a bassa pressione (VPS, fig. 6b) le © Oerlikon Metco particelle fuse si ossidano molto meno e producono rivestimenti di qualità notevolmente superiore [3].
2.4.4 High Velocity Oxy Fuel Spray (HVOF) The high velocity oxy-fuel spray (HVOF) process is a relatively recent addition to the family of thermal spray processes. As it uses a supersonic jet, setting it apart from conventional flame spray, the speed of particle impact on the substrate is much higher, resulting in improved coating characteristics. The mechanism differs from flame spraying by an expansion of the jet at the exit of the gun (Fig. 7). Fuel gases of propane, propylene, acetylene, hydrogen and natural gas can be used, as well as liquid fuels such as kerosene.
2.4.4 Spruzzatura a fiamma supersonica (HVOF) Il processo di spruzzatura a fiamma supersonica (HVOF) è una tecnica relativamente recente che si aggiunge agli altri processi di termospruzzatura (Thermal Spray). Poiché utilizza un getto supersonico del gas, differentemente dalla spruzzatura a fiamma convenzionale, la velocità d’impatto delle particelle sul substrato è notevolmente superiore e consente di ottenere caratteristiche del rivestimento decisamente migliori. Il meccanismo differisce dalla spruzzatura a fiamma convenzionale per l’espansione che subisce il getto del gas all’uscita della pistola (figura 7). Come combustibile è possibile utilizzare propano, propilene, acetilene, idrogeno e gas naturale (metano), nonché combustibili liquidi come il cherosene.
© Oerlikon Metco
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
6b
© Oerlikon Metco
Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com
2.4.5 Process Comparison The processes previously discussed differ fundamentally by the thermal and kinetic energy imparted to the spray particles by each process. The thermal energy is determined by the attainable flame temperature and the kinetic energy of the spray particle is a function of gas velocity. An energy comparison of the spray processes is represented in Figure 8. The high temperature of plasma spraying is particularly suitable for materials with a high melting point, such as ceramics. The HVOF process, having high kinetic energy and comparatively low thermal energy, results in a positive effect on the coating characteristics and is favorable for spray materials such as tungsten carbide coatings. The comparison of the processes is largely of interest in relation to the coatings that result. Table 3 lists some important coating characteristics, organized by material class.
2.4.5 Confronto dei processi I processi sopra descritti si differenziano l’un l’altro principalmente per l’energia termica e cinetica impartita alle particelle. L’energia termica è determinata dalla temperatura di fiamma ottenibile; l’energia cinetica della particella è funzione della velocità del gas. Un confronto tra le energie dei processi di spruzzatura è rappresentato nella figura 8. L’elevata temperatura raggiungibile all’interno del dardo plasma è particolarmente adatta per i materiali con un elevato punto di fusione, come la ceramica e i refrattari. Il processo HVOF, avendo un’elevata energia cinetica e una relativamente bassa energia termica, determina un effetto positivo sulle caratteristiche del rivestimento ed è particolarmente adatto, ad esempio, per quei materiali sensibili alle temperatura come i carburi. L’elevata energia cinetica consente inoltre di ottenere un riporto molto denso e compatto, con notevole adesione al substrato. Il confronto dei processi è particolarmente interessante in relazione ai rivestimenti che ne risultano. La tabella 3 elenca alcune importanti caratteristiche dei rivestimenti, organizzate per classi di materiale.
World Leaders
Have Responsibilities Too!
• Surface Preparation
A
• Concrete Reinforcement Protection
N
R
L
E
V
C
E
• Water Based Coatings • P ES ROTECT • PR
E
• Equipment Preservation
Cortec ® provides environmentally safe corrosion protection solutions.
A QU
LI TY
RE TE SYST EM REGIS
EN
SY ©
Cortec Corporation 2011
D
www.CortecVCI.com
ST
VIRO
NMENT
AL
EM REGISTER
ED
4119 White Bear Parkway St. Paul, MN 55110 651-429-1100 • 800-426-7832 info@cortecvci.com
PROTECTIVE COATINGS | INNOVATIONS 7
Schematic diagram of the high velocity oxy-fuel spray process (HVOF). Schema del processo di spruzzatura a fiamma supersonica (HVOF). 8
Energy comparison of thermal spray processes. Confronto energetico dei processi di termospruzzatura (Thermal Spray).
7
Table 3: Comparison of thermal spray process coating characteristics (approximate values).
Characteristics Gas temperature Spray rate Particle velocity
Bond strength
Coating thickness
Coating Type
8
© Oerlikon Metco
Tabella 3: confronto delle caratteristiche del rivestimento termospruzzato (valori approssimativi).
Powder Flame Spray
HVOF Spray
Electric Arc Wire Spray
Plasma Spray
[°C]
3000
2600 - 3000
4000 (Arc)
12000 - 16000
[°F]
5400
4700 - 5400
7200 (Arc)
21500 - 29000
[kg/h] [lb/h] [m/s] [ft/s] [MPa] [psi] [MPa] [psi] [MPa] [psi] [MPa] [psi] [MPa] [psi] [mm] [mil] [mm] [mil] [mm] [mil] [mm] [mil] [mm] [mil]
2-6 4.5 - 13 up to 50 up to 160 14 - 21 2000 - 3000 7 - 34 2000 - 5000 83+ (fused) 12000+ (fused) 14 - 34 4000 - 5000 34 - 48 5000 - 7000 0.05 - 2.0 2 - 80 0.05 - 5.0 2 - 200 0.15 - 2.5 6 - 100 0.25 - 2.0 10 - 75 0.15 - 0.8 6 - 30 35 20 30 - 60 40 - 65 45 - 55 3 - 10 3 - 10 < 2 (fused) 5 - 15 5 - 15
1–9 2 – 20 up to 700 up to 2300 48 - 62 7000 - 9000 48 - 62 7000 - 9000 70 - 80 10000 - 11500 ----83+ 12000+ 0.05 - 2.5 2 - 100 0.05 - 2.5 2 - 100 0.05 - 2.5 2 - 100 ----0.05 - 5.0 2 – 200 45 55 30 - 60 --55 - 72 <2 <2 <2 --<1
10 – 25 22 – 55 approx. 150 approx. 500 28 - 41 4000 - 6000 14 - 48 4000 - 7000 15 - 50 2200 - 7200 --------0.1 - 2.5 4 - 100 0.1 - 5.0 4 - 200 ------------40 35 ------3 - 10 3 - 10 -------
2 - 10 4.5 - 22 up to 450 up to 1500 21 - 34 --14 - 48 4000 - 7000 ----21 - 41 3000 - 6000 55 - 69 8000 - 10000 0.4 - 2.5 15 - 100 0.05 - 5.0 2 - 200 ----0.1 - 2.0 4 - 80 0.15 - 0.8 6 - 30 40 50 30 - 60 45 - 65 50 - 65 2-5 2-5 --1-2 2-3
Hardness (see Table A1 in the Appendix)
[HRc]
Porosity
[%]
48
© Oerlikon Metco
Ferrous alloys Non-ferrous alloys Self-fluxing alloys Ceramics Carbides Ferrous alloys Non-ferrous alloys Self-fluxing alloys Ceramics Carbides Ferrous alloys Non-ferrous alloys Self-fluxing alloys Ceramics Carbides Ferrous alloys Non-ferrous alloys Self-fluxing alloys Ceramics Carbides
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com
The third part of this article will be published in the next issue (ipcm®_Protective Coatings n. 17, April 2016). ‹
La terza parte di questo articolo sarà pubblicata nel prossimo numero (ipcm®_Protective Coatings n. 17, aprile 2016). ‹
APPENDIX
APPENDICE
Table A1 – Hardness within the range HRC 80 to 20 (approximate cross-reference values).
Tabella A1 - Durezza nell’intervallo HRC 80-20 (valori di riferimento incrociati approssimativi).
Rockwell HRC
Vickers HV
80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50
1865 1787 1710 1633 1556 1478 1400 1323 1245 1160 1076 1004 942 894 854 820 789 763 746 720 697 674 653 633 613 595 577 560 544 528 513
Brinell HB
620 599 580 570 551 532 515 495 485
Tensile strength Rm [N/mm2]
2180 2105 2030 1995 1920 1845 1780 1700 1665
Rockwell HRC
Vickers HV
Brinell HB
49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20
498 484 471 458 446 434 423 412 402 392 382 372 363 354 345 336 327 318 310 302 294 286 279 272 266 260 254 248 243 238
475 456 447 437 423 409 399 390 380 371 361 352 340 335 330 323 314 304 295 285 280 271 266 257 252 247 242 238 233 228
Literature references
Riferimenti bibliografici
[1] DIN EN 657; Thermal Spray – Begriffe, Einteilung; Beuth-Verlag, Berlin (1994) [2] H.D. Steffens, J. Wilden: “Moderne Beschichtungsverfahren”, DGM-Verlag, ISBN 3-88355-223-2, (1996) [3] P. Huber: “Vakuumplasmaspritzen”, Oberfläche surface, 10 (1992), 8 [4] H. Simon, M. Thoma: “Angewandte Oberflächentechnik für metallische Werkstoffe”, Hanser-Verlag, München (1985) [5] E. Lugscheider. H. Reymann: “Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiss-und Korrosionsschutz”, Schweissen und Schneiden, 50 (1998), 44 [6] DIN 50600; Metallographische Gefügebilder, Beuth-Verlag, Berlin DIN EN 582 Ermittlung der Haftzugfestigkeit, Beuth-Verlag, Berlin (1994) DIN EN 10109 Teil 1; Härteprüfung, Beuth-Verlag, Berlin (1995) DVS 2310 Teil 2; Anleitung zur Schliffherstellung, DVS, Düsseldorf, (1989)
[1] DIN EN 657; Thermal Spray – Begriffe, Einteilung; Beuth-Verlag, Berlin (1994) [2] H.D. Steffens, J. Wilden: “Moderne Beschichtungsverfahren”, DGM-Verlag, ISBN 3-88355-223-2, (1996) [3] P. Huber: “Vakuumplasmaspritzen”, Oberfläche surface, 10 (1992), 8 [4] H. Simon, M. Thoma: “Angewandte Oberflächentechnik für metallische Werkstoffe”, Hanser-Verlag, München (1985) [5] E. Lugscheider. H. Reymann: “Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiss-und Korrosionsschutz”, Schweissen und Schneiden, 50 (1998), 44 [6] DIN 50600; Metallographische Gefügebilder, Beuth-Verlag, Berlin DIN EN 582 Ermittlung der Haftzugfestigkeit, Beuth-Verlag, Berlin (1994) DIN EN 10109 Teil 1; Härteprüfung, Beuth-Verlag, Berlin (1995) DVS 2310 Teil 2; Anleitung zur Schliffherstellung, DVS, Düsseldorf, (1989)
Tensile strength Rm [N/mm2] 1630 1555 1520 1485 1450 1385 1350 1320 1290 1255 1220 1190 1150 1140 1115 1095 1060 1030 995 965 950 915 900 865 850 835 820 800 785 770
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
49
PROTECTIVE COATINGS | INNOVATIONS
REDEFINING ANTI-CORROSIVE PROTECTION WITH ACTIVATED ZINC Ridefinire la protezione anticorrosiva con lo zinco attivato
© Hempel
Opening photo: Hempel AvantGuard® can be used in all types of applications, but is specially aimed at structures in tough environments that will benefit from long maintenance intervals. Foto d’apertura: Hempel AvantGuard® può essere utilizzato in tutti i tipi di applicazioni, ma è particolarmente idoneo per le strutture in ambienti gravosi, le quali beneficeranno dei lunghi intervalli di manutenzione.
50
Z
inc coatings have a range of uses, including protecting industrial structures and equipment in tough C4 and C5 environments where saltwater and high humidity rapidly corrode unprotected steel. However, not much has changed within zinc coatings since they were first introduced the 1960s. In 2006, Hempel’s R&D team made an important discovery: Only around one-third of the zinc in a standard zinc epoxy has any anti-corrosive effect. As Pernille Lind Olsen, Group Protective Product Director at Hempel, explains, this discovery led Hempel to begin the search for a new solution. “When we realised that roughly two-thirds of the zinc is not utilised in zinc epoxies, we set out to develop a new technology that would increase zinc activation,” she says. “This would increase the
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
I
rivestimenti allo zinco possono essere usati per diverse applicazioni, per esempio per proteggere le strutture industriali e le attrezzature in ambienti C4 e C5 gravosi, in cui l’acqua salata e l’elevata umidità corrodono rapidamente l’acciaio non protetto. I rivestimenti allo zinco sono rimasti praticamente immutati dalla loro introduzione, negli anni ’60. Nel 2006, il team R&D di Hempel ha fatto una scoperta importante: solo circa un terzo dello zinco in un epossidico allo zinco standard ha un effetto anti-corrosivo. Come Pernille Lind Olsen, direttore dei prodotti di protezione di Hempel, spiega, questa scoperta ha spinto Hempel a ricercare una nuova soluzione. “Quando abbiamo capito che circa i due terzi dello zinco non sono usati negli epossidici allo zinco, abbiamo deciso di sviluppare una nuova tecnologia che aumentasse l’attivazione dello zinco”, afferma.
Hempel A/S Kongens Lyngby, Denmark communications@hempel.com
1
© Hempel
2
© Hempel
coating’s anti-corrosive protection, while also increasing its mechanical strength to improve durability, but we also aimed to make a coating that was easy to apply and as versatile as possible.” After thousands of hours in the lab, Hempel found the solution – and the new technology, known as AvantGuard®, could have huge benefits for a range of industries, from wind energy and infrastructure to oil & gas. AvantGuard® can be used in all types of applications, but is specially aimed at structures in tough environments that will benefit from long maintenance intervals (Ref. opening photo).
“Questo avrebbe inoltre aumentato la protezione anti-corrosione del rivestimento e anche la resistenza meccanica e quindi la durata, con migliori caratteristiche di applicazione e versatilità”. Dopo migliaia di ore in laboratorio, Hempel ha trovato la soluzione – e la nuova tecnologia, denominata AvantGuard®, che offre enormi vantaggi per una vasta gamma di settori, tra cui energia eolica, infrastrutture, petrolio e gas. AvantGuard® può essere utilizzato in tutti i tipi di applicazioni, ma è particolarmente idoneo per le strutture in ambienti gravosi, le quali beneficeranno dei lunghi intervalli di manutenzione (rif. foto d’apertura).
Why most of the zinc in your coating is not having any effect
Perché la maggior parte dello zinco nel rivestimento non ha alcun effetto
Zinc is less noble than iron and it acts as a sacrificial element in a zinc coating. When exposed to corrosive elements, such as water or oxygen, the zinc corrodes instead of the iron to leave the steel intact. However, this process, known as the galvanic effect, requires electrical contact between the zinc particles. “Zinc is the single most important protective
Lo zinco è meno nobile del ferro e funge da elemento sacrificale in un rivestimento. Quando viene esposto a elementi corrosivi quali l’acqua o l’ossigeno, è lo zinco a corrodere, e non il ferro, lasciando l’acciaio intatto. Tuttavia questo processo, noto come effetto galvanico, richiede un contatto elettrico tra le particelle di zinco. “Lo zinco è il singolo elemento di protezione più im-
1
Zinc epoxy with AvantGuard® technology. Epossidico allo zinco con tecnologia AvantGuard®. 2
Zinc epoxy without AvantGuard® technology. Epossidico allo zinco senza tecnologia AvantGuard®.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
51
© Hempel
PROTECTIVE COATINGS | INNOVATIONS
3 3
The glass spheres in the coating absorb the impact of the initial crack and stop it from propagating. The picture on the right shows an enlargement of the crack seen on the left. Cycles of 2 hours at +60ºC and 2 hours at -20ºC during 21 days. Le sfere di vetro sono in grado di assorbire la maggior parte dell’impatto della fessurazione iniziale, arrestandone lo sviluppo. L’immagine a destra mostra un ingrandimento della fessura, visibile sulla sinistra. Cicli di 2 ore a +60ºC e di 2 ore a -20ºC in 21 giorni (Crack = fessura; Hollow glass spheres = sfere di vetro vuote).
52
element in a zinc coating,” says Josep Palasi, Hempel’s R&D Director. “But our research showed that only the zinc in the first 20-30 microns of the coating can provide galvanic protection. As a normal zinc coating is around 60-80 microns, around two-thirds of the zinc is too far away from the point of corrosion to be able become oxidised, and so is not able to protect the steel. We knew that activating more of the zinc could improve the galvanic effect without increasing the zinc content, as this would increase the zinc particles’ ability to release electrons and ensure zinc throughout the film was providing anti-corrosive protection.”
portante in un rivestimento allo zinco”, spiega Josep Palasi, direttore R&D di Hempel. “Ma la nostra ricerca ha dimostrato che solo lo zinco nei primi 20-30 micron del rivestimento può fornire protezione galvanica. Poiché un normale rivestimento allo zinco è spesso circa 60-80 micron, due terzi dello zinco sono troppo distanti dal punto di corrosione per poter ossidarsi e proteggere l’acciaio. Sapevamo che attivare una maggiore quantità di zinco avrebbe potuto migliorare l’effetto galvanico senza aumentare il contenuto di zinco, in quanto in questo modo la capacità delle particelle di zinco di rilasciare elettroni sarebbe aumentata, assicurando una protezione anticorrosiva da parte di tutto lo zinco presente nel film”.
Redefining anti-corrosive protection
Ridefinire la protezione anticorrosiva
Hempel’s solution was to combine the elements used in traditional zinc epoxies with two new substances – hollow glass spheres and proprietary activators – and named it HEMPADUR AvantGuard®, the first activated zinc primers to take advantage of AvantGuard® technology. “In our extensive tests, HEMPADUR AvantGuard® outperformed zinc epoxies without AvantGuard® technology in almost all key performance and application areas”, says Palasi (Figs. 1 and 2).
La soluzione di Hempel è stata di combinare gli elementi utilizzati negli epossidici allo zinco tradizionali con due nuove sostanze - sfere di vetro cave e attivatori proprietari; il prodotto è stato denominato HEMPADUR AvantGuard®, il primo primer allo zinco attivato a sfruttare la tecnologia AvantGuard®. “Nei nostri test, HEMPADUR AvantGuard® ha offerto migliori prestazioni degli epossidici allo zinco senza tecnologia AvantGuard® in quasi tutte le aree prestazionali e di applicazione più importanti”, afferma Palasi (figg. 1 e 2).
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Hempel A/S Kongens Lyngby, Denmark communications@hempel.com
Redefining durability through selfhealing properties
Ridefinire la durata attraverso proprietà auto-riparatrici
In a typical zinc protective system, the zinc primer is the weakest mechanical point. As a result, cracks can form in the coating as the steel expands and contracts. AvantGuard® coatings are different due to a phenomenon that Palasi calls ‘self-healing’. “When we put HEMPADUR AvantGuard® through thermal cycling resistance tests, cracking tests and welding tests, we saw that it outperformed zinc epoxies without AvantGuard® by some distance. We thought it would be good, but not that good. The performance was extraordinary, and we were determined to find out why.” “When a crack forms, the first penetrating step requires the most energy. After that, it takes very little energy for the crack to widen and affect the integrity of the coating,” Palasi explains. “We discovered that the glass spheres can absorb most of the impact from the initial crack and stop it from developing. In addition, we observed that the sub-products formed during the zinc activation process actually occupy the space left by the micro-crack, preventing it from developing into a more serious crack. So we can say that AvantGuard® has a selfhealing effect on micro-cracks, which is something that we have never seen before (Fig. 3).”
In un normale sistema di protezione epossidico allo zinco, il primer allo zinco è l’anello meccanicamente più debole della catena, con possibile formazione di fessurazioni nel rivestimento a causa della dilatazione e della contrazione dell’acciaio. I rivestimenti AvantGuard® sono diversi a causa di un fenomeno che Palasi chiama “auto-riparazione”. “Quando abbiamo sottoposto HEMPADUR AvantGuard® a prove di resistenza ai cicli termici, test di fessurazione e di saldatura, abbiamo notato che offriva prestazioni notevolmente superiori rispetto agli epossidici allo zinco senza AvantGuard®. Sapevamo di avere un prodotto buono, ma non così buono. Le prestazioni erano straordinarie e quindi abbiamo deciso di scoprire il perché”. “Quando si forma una fessura, la prima fase di penetrazione richiede la maggiore quantità di energia. Da qui in poi la fessurazione si sviluppa velocemente compromettendo l’integrità del rivestimento”, spiega Palasi. “Abbiamo scoperto che le sfere di vetro sono in grado di assorbire la maggior parte dell’impatto della fessurazione iniziale, arrestandone lo sviluppo. Abbiamo inoltre osservato che i sottoprodotti formatisi durante il processo di attivazione allo zinco occupano lo spazio lasciato dalla micro-fessura, impedendole di svilupparsi ulteriormente. Possiamo quindi dire che AvantGuard® abbia un effetto auto-riparatore sulle micro-fessure, una caratteristica che non abbiamo mai osservato prima” (fig. 3).
HEMPADUR AvantGuard® coatings at a glance
I prodotti HEMPADUR AvantGuard® in sintesi
- Advanced corrosion protection due to the high level of activated zinc in the coating. - Excellent crack resistance in cyclic temperatures and varying humidity. - Selfhealing of microcracks prevents further propagation of cracks. - Requires the same application techniques as zinc epoxies. - Suitable for all applications and especially designed for tough conditions and C4 and C5 environments. - Three coatings currently available globally: HEMPADUR AvantGuard® 770, HEMPADUR AvantGuard® 750 and HEMPADUR AvantGuard® 550. ‹
- Protezione anti-corrosione avanzata grazie all’elevato contenuto di zinco attivato nel rivestimento. - Ottima resistenza alle fessurazioni a temperature cicliche e umidità variabile. - Auto-riparazione delle micro-fessure con prevenzione della diffusione delle cricche. - Medesime tecniche di applicazione degli epossidici allo zinco. - Idonei per tutte le applicazioni e appositamente progettati per le gravose condizioni degli ambienti C4 e C5. - Tre prodotti attualmente disponibili: HEMPADUR AvantGuard® 770, HEMPADUR AvantGuard® 750 e HEMPADUR AvantGuard® 550. ‹
PROTECTIVE COATINGS | INNOVATIONS
© Ortodoxfoto | Dreamstime.com
THERMOSETTING POWDERS FOR THE RAIL INDUSTRY Polveri termoindurenti per il settore ferrotranviario
Opening photo: AkzoNobel also offers industrial applications and approvals of powder systems that are suitable for the coating of outdoor rolling stock components. Foto d’apertura: AkzoNobel è dotata anche di applicazioni industriali ed omologazioni di cicli a polvere per la verniciatura delle parti esterne dei rotabili.
54
Preliminary remarks
Introduzione
The use of thermosetting powder coatings on rolling stock components is becoming more and more widespread in the rail industry, thanks to their characteristics, such as: - Excellent anti-corrosion properties. - Excellent surface hardness. - Resistance to light and weathering. - High ecological profile (absence of solvents). - Application simplicity and economy. In Italy, the railway sector mainly uses powder coatings for items intended for the cars’ inside areas (Fig. 1), i.e. interior fittings (tables, seats, etc.), and only rarely for the cars’ outside areas, as is common in many other countries. The interiors of the trains used in the public transport sector are exposed to various types of aggressions. Therefore, they require superior quality systems to ensure the protection and maintenance of the aesthetic and protective properties of the coatings applied throughout their life cycle. In particular, such coatings protect these surfaces against corrosion and the UV degradation caused by exposure to sunlight. They also protect them against both accidental damage caused by passengers (bumps, scratches and spills of various liquids) and intentional damage (dents and scratches). Finally, coatings also perform an important decorative function, creating the proper atmosphere inside the cars. Powder coatings are the ideal solution for the interior of trains: They ensure resistance to atmospheric agents and come in a wide range of colours, all VOC free to protect the environment.
L’impiego dei sistemi vernicianti a polvere termoindurente nella verniciatura dei componenti rotabili nel settore ferrotranviario sta diventando sempre di più una realtà consolidata grazie alle prerogative dei rivestimenti in polvere, quali: - ottime proprietà anticorrosive; - ottima durezza superficiale; - resistenza alla luce e alle intemperie; - alto profilo ecologico (assenza di solventi); - semplicità ed economicità applicativa. In Italia nel settore ferrotranviario i rivestimenti in polvere sono principalmente utilizzati per la verniciatura dei manufatti nelle aree cosiddette “interno cassa” (fig. 1), ovverosia parti destinate all’arredo interno dei treni (tavolini, sedili, ecc.) mentre è poco diffuso l’utilizzo per la verniciatura dei manufatti “esterno cassa” praticata invece comunemente in molti Paesi esteri. Gli interni dei treni utilizzati nel settore del trasporto pubblico sono esposti a una vasta gamma di aggressioni e richiedono un sistema di verniciatura di qualità superiore per la protezione e il mantenimento delle caratteristiche estetiche e protettive del rivestimento applicato, durante tutto il loro ciclo di vita. In particolare la verniciatura fornisce una protezione contro la corrosione e la degradazione UV causata dell’esposizione alla luce solare. Protegge inoltre sia contro i danni accidentali causati dai passeggeri (urti, graffi e versamenti vari di liquidi), che dai danni causati deliberatamente, quali ammaccature e graffiti. La vernice fornisce anche una importante funzione decorativa nel creare l’atmosfera corretta all’interno del vagone. Le vernici a polvere sono la soluzione ideale per gli interni dei treni, offrono resistenza agli agenti atmosferici e sono disponibili in una ampia gamma di colori tutti esenti da COV, rispettando così l’ambiente.
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Roberto Paganica AkzoNobel Powder Coatings Spa, Como, Italy Roberto.Paganica@akzonobel.com
I principali requisiti tecnici richiesti dal settore sono: - protezione dalla corrosione; - resistenza agli agenti atmosferici; - durezza superficiale; - proprietà antigraffiti.
AkzoNobel’s systems
Cicli AkzoNobel
AkzoNobel Powder Coatings’ product range, designed for the public transport market, includes: - Coatings with anti-graffiti properties from the Interpon EC line. - Anti-corrosion primers from the Interpon PZ and Interpon APP lines. - Polyester products for outdoors from the Interpon D1036 and Interpon D2525 lines. The Interpon® EC products are available in all RAL and NCS colours and with a gloss, semi-gloss or wrinkled finish upon request. Thanks to their high crosslinking density and low porosity (i.e. the film’s absorption capacity), these special polyurethane coatings prevent the penetration in the coating layer of both graffiti and the removers 1 used for cleaning, even several weeks after the application. In this way, all graffiti can be removed without compromising the coating’s characteristics of duration and resistance to atmospheric agents. The main features of the Interpon EC products are as follows: - Resistance to graffiti and to the detergents used to remove them - Excellent scratch resistance. - Excellent chemical resistance. - Good outdoor resistance. - Good corrosion protection. - Fire protection certifications: • BS6853 - Code of practice for fire precautions in the design and construction of passenger carrying trains. • DIN 5510 - Preventive fire protection in railway vehicles. • EN45545 - Fire protection on railway vehicles. • ISO5660 - Reaction-to- fire tests – Heat release, smoke production and mass loss rate. • ISO 5659 - Plastics – Smoke generation • ISO5658 - Reaction to fire tests – Spread of flame.
La gamma di prodotti AkzoNobel Powder Coatings, progettata per il mercato dei trasporti pubblici, prevede: - rivestimenti con proprietà antigraffiti della serie Interpon EC; - primer anticorrosivi della serie Interpon PZ e Interpon APP; - prodotti di natura poliestere per esterno della serie Interpon D1036 e Interpon D2525. I prodotti Interpon® EC, disponibili nei colori RAL ed NCS e su richiesta con finitura lucida, semilucida o raggrinzata, sono dei rivestimenti di natura poliuretanica speciale che, grazie all’alta densità di reticolazione e la bassa porosità (capacità di assorbimento del film) non permettono la penetrazione nel film di vernice sia ai graffiti che ai remover utilizzati per pulire la superficie anche dopo settimane dall’applicazione. In questo modo i graffiti possono essere rimossi senza compromettere le caratteristiche estetiche di durata e di resistenza agli agenti atmosferici del rivestimento. Le caratteristiche principali dei prodotti della serie Intepon EC sono: - resistente ai graffiti e detergenti utilizzati per la rimozione; - eccellente resistenza ai graffi; - eccellente resistenza chimica; - ottima resistenza all’esterno; - ottima protezione alla corrosione; - certificati per la protezione dal fuoco: • BS6853 - Code of practice for fire precautions in the design and construction of passenger carrying trains. • DIN 5510 - Preventive fire protection in railway vehicles. • EN45545 - Fire protection on railway vehicles. • ISO5660 - Reaction to fire tests - Heat release, smoke production and mass loss rate. • ISO 5659 - Plastics - Smoke generation • ISO5658 - Reaction to fire tests - Spread of flame.
© Wxin | Dreamstime.com
The main technical requirements imposed by the sector are: - Corrosion protection. - Weathering resistance. - Surface hardness. - Anti-graffiti properties.
1
In Italy, the railway sector mainly uses powder coatings for items intended for the cars’ inside areas. In Italia, nel settore ferrotranviario, i rivestimenti in polvere sono principalmente utilizzati per la verniciatura dei manufatti nelle aree cosiddette “interno cassa”.
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
55
PROTECTIVE COATINGS | INNOVATIONS The application fields of these products are as follows: - Doors. - Luggage racks. - Internal panels. - Fittings and accessories. - Air conditioning units. - Electrical cabinets. - Door and window frames. - Street furniture. - Seats. - Dumpsters. - Handrails. - Garage doors.
Gli ambiti applicativi finali di questi prodotti sono: - porte; - portabagagli; - pannellature interne; - raccordi ed accessori; - unità di condizionamento; - armadi elettrici; - serramenti; - arredi pubblici; - sedute; - cassonetti per immondizia; - corrimano; - porte di garage.
For this sector, AkzoNobel also offers complete anti-corrosion systems with one, two or three layers, which can provide an ideal solution for different surfaces and for various environments of use. These cycles typically include: - Zinc primer from the Interpon PZ line: thanks to its patented technology, AkzoNobel offers the highest degree of corrosion protection in all aggressive environments; - Zinc free primer from the eco-friendly Interpon APP Serie 120 line: It provides excellent corrosion protection. - Top coat from the following lines: • Interpon EC: polyurethane anti-graffiti products. • Interpon D: polyester coatings for standard architecture or super-durable coatings. Table 1 shows some examples of AkzoNobel’s powder coating systems approved by a train manufacturer, for components intended for the inside and outside of the rolling stock.
Per il settore AkzoNobel propone anche cicli anticorrosione, ovverossia sistemi di verniciatura a 1, 2 o 3 strati che possono fornire una soluzione ideale per substrati diversi e per i vari ambienti di utilizzo del manufatto. Questi cicli sono in genere costituti da: - Primer Zincante della serie Interpon PZ: grazie alla tecnologia brevettata AkzoNobel offre il più alto grado di protezione dalla corrosione in tutti gli ambienti particolarmente aggressivi; - Primer Zinc Free della serie Interpon APP serie 120 Eco-compatibile, esente da zinco offre una ottima protezione anticorrosiva. - Mano a finire della serie: • Interpon EC: poliuretanici antigraffiti. • Interpon D: rivestimenti poliestere per architettura standard o superdurabili. La tabella 1 riporta alcuni esempi di cicli di verniciatura a polvere AkzoNobel omologati da un costruttore di treni, per componenti destinati all’interno e all’esterno del rotabile.
Table 1: Examples of AkzoNobel’s powder coating systems approved by a train manufacturer, for components intended for the inside and outside of the rolling stock.
Tabella 1: esempi di cicli di verniciatura a polvere AkzoNobel omologati da un costruttore di treni, per componenti destinati all’interno e all’esterno del rotabile.
Rolling stock component
Details
Surface material
Coating system 1st coat
Car’s inside
In sight
Aluminium
Interpon EC
Steel Car’s outside
In sight (e.g. front and rear low side parts)
Diecast aluminium Aluminium
Steel Car’s outside
Not in sight (e.g. roof)
Diecast aluminium Aluminium
56
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Polyzinc 790 (zinc primer) Interpon APA 151 (degassing primer) Interpon 200 Interpon D1036 Interpon D2525 Polyzinc 790 (zinc primer) Interpon APA 151 (degassing primer) Interpon 200 Interpon D1036 Interpon D2525
2nd coat Interpon 200 Interpon D1036 Interpon D2525 Interpon D1036 Interpon D2525
Interpon EC Interpon D1036 Interpon D2525 Interpon D1036 Interpon D2525
Roberto Paganica AkzoNobel Powder Coatings Spa, Como, Italy Roberto.Paganica@akzonobel.com
Anti-graffiti products’ features
Caratteristiche prodotti antigraffiti
© AkzoNobel
As already mentioned, although they are primarily used to Come sottolineato, anche se usati soprattutto nella vernitreat items intended for the cars’ inside areas, a common ciatura dei “componenti interno cassa”, un requisito tectechnical requirement imposed by this industry to the nico comune del settore per i rivestimenti in genere è la coatings employed proprietà antigraffiis the anti-graffiti ti, cioè la possibilità Coating formulation property, that is, di poter rimuovere the possibility to ripetutamente con repeatedly remove opportuni pulitori Type of remover Type and conditioning (with suitable (removers) i graffiti and cleaning procedure of graffiti cleaners, or removers) dalla superficie ver2 any graffiti from niciata senza danthe coated surfaces neggiare la vernice. without damaging the coating itself. The anti-graffiti La performance antigraffiti dipende fondamentalmente performance depends on three key factors (Fig. 2). da tre fattori chiave (fig. 2). In the railway field, there are several regulations (Table 2) aimed at assessing the anti-graffiti properties of a coating. They all provide for a number of processes to be repeated several times, including the following steps: - Application of graffiti. - Conditioning of graffiti. - Cleaning of graffiti. - Reconditioning and repetition of the cycle. - Evaluation of results.
Esistono varie normative (tabella 2) nel settore per valutare le proprietà antigraffiti di un rivestimento, tutte prevedono una serie di cicli da ripetere più volte comprendenti le seguenti fasi: - applicazione del graffito; - condizionamento del graffito; - pulizia del graffito; - ricondizionamento e ripetizione del ciclo; - valutazione dei risultati.
Table 2: Main differences between two standards used in Italy.
Tabella 2: le principali differenze tra due normative utilizzate in Italia.
UNI 11246 – Aluminium and aluminium alloys – Evaluating procedures for permanent anti-graffiti products
ST373947 – Test method for the assessment of anti-graffiti coatings
Surface
Aluminium and aluminium alloys Undefined pre-treatment
Surface and treatment reproducing the end result
Graffiti
Lipstick, permanent marker, acrylic spray
Permanent marker, acrylic spray, nitro acrylic spray, alkyd spray, waterborne spray
Graffiti aging
2 hours at 80°C
8 hours at 40°C
Remover
Suggested by the paint supplier
Two tested and known by the end customer plus one suggested by the paint supplier
Reconditioning after cleaning
2 hours at room temperature
24 hours at room temperature
Number of cycles
10
10
At the end of the 10 test cycles, there should be no softening or chalking of the coating film. The performance is typically assessed by measuring the gloss and colour variation (expressed as ΔE), while compliance is assessed by comparing the measured values with the specifications of the standard taken into account (Fig. 3).
2
The three factors affecting the antigraffiti performance of a coating. I tre fattori che determinano le performance antigraffiti di un rivestimento.
Il film di vernice alla fine dei 10 cicli di test non deve evidenziare rammollimenti o sfarinamenti. La performance è in genere valutata misurando la variazione di brillantezza (gloss) e la variazione di colore (espressa in termini di ΔE), mentre la conformità è valutata confrontando i valori misurati rispetto alle specifiche dello standard preso in considerazione (fig. 3).
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
57
PROTECTIVE COATINGS | INNOVATIONS © AkzoNobel
3
Sample results at the end of a test (10 cycles) assessing an antigraffiti product on white coatings. Esempio di risultati al termine di un test (10 cicli) antigraffiti su rivestimenti bianchi.
PASS 100% cleanliness Gloss variation less than 5% Colour variation (ΔE) less than 1 3
FAIL 70 to 100% cleanliness Gloss variation less than 5% Colour variation (ΔE) higher than 1
FAIL Cleanliness less than 30% Gloss variation less than 20% Colour variation (ΔE) higher than 10
One regulation, on the other hand, requires the assessment of the properties of an anti-graffiti coating to be performed after weathering degradation: ASTM D6578/D6578M-13 (Standard Practice for Determination of Graffiti Resistance). In other words, it requires the graffiti cleaning processes to be carried out after the coating has been degraded by accelerated aging systems. As for the removers, however, it requires the use of pure chemicals (e.g. methyl ethyl ketone) that are not actually employed in the field (removers based on complex formulations interact differently with the graffiti). The anti-graffiti characteristics are therefore assessed with products that, in fact, do not simulate any actual cleaning process. However, this remains a useful procedure to assess how the performance of anti-graffiti coatings changes over time.
Esiste anche un’unica normativa che prevede di valutare le proprietà antigraffiti di una vernice dopo che questa sia stata sottoposta alla degradazione dovuta agli agenti atmosferici ed è la ASTM D6578/D6578M-13 (Standard Practice for Determination of Graffiti Resistance). In pratica questa norma precisa che i cicli di pulizia dai graffiti vengano eseguiti dopo che il rivestimento è stato degradato da sistemi di invecchiamento accelerato. Inoltre devono essere impiegati come agenti pulenti (remover) delle sostanze chimiche pure (es. metiletilchetone) che in realtà non sono utilizzate nel settore (infatti i remover basati su formulazioni complesse interagiscono in maniera diversa con il graffito). Ci si trova così a dover valutare le proprietà antigraffiti con prodotti che, in realtà, non simulano realmente la pulizia che avviene nel regolare esercizio del rivestimento. Ad ogni modo resta un’utile procedura per valutare come variano le performance dei rivestimenti antigraffiti nel tempo.
In addition to the anti-graffiti properties, the Interpon EC coatings ensure excellent anti-corrosion performance (Table 3), of course in the presence of an adequate surface preparation (pre-treatment) and after complete polymerisation of the coating. The approval of an anti-corrosion system must be performed by reproducing the surface and the pre-treatment used by the client.
Oltre alle proprietà antigraffiti, i rivestimenti della serie Interpon EC permettono di raggiungere ottime performance anticorrosive (tabella 3), chiaramente in presenza di un’adeguata preparazione (pretrattamento) del supporto e a condizione di una completa polimerizzazione del rivestimento. La validazione del ciclo anticorrosivo va eseguita riproducendo la situazione finale con supporto/pretrattamento utilizzato dal committente.
Table 3: Example of anti-corrosion test.
58
FAIL 30 to 70% cleanliness Gloss variation higher than 10% Colour variation (ΔE) higher than 5
Tabella 3: esempio di test anticorrosivo.
Test
Surface material
Method
Neutral salt spray
Steel sheet pre-treated and coated by the customer
ISO 9227 ISO 4628-2
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
Final check after 750 hours
Roberto Paganica AkzoNobel Powder Coatings Spa, Como, Italy Roberto.Paganica@akzonobel.com
Linee guida per la protezione dalla corrosione
In Italy, “AICQ - Rail transport sector” has recently issued its “Guidelines for Corrosion Protection in Railway Sector” (last update: 03/11/2014). This document includes very important information – from the planning stage to the anti-corrosion process control and the training of the personnel involved – based on the experience of various actors, such as train manufacturers, certification bodies and coating producers. This is a useful reference for the sector in Italy and may enable to overcome some problems arisen in the past, such as the lack of communication between customers and coating manufacturers. The guidelines also include some technical specifications to assess the quality of an anti-corrosion process. At the moment (cfr. Part 1 par. 7.7 e 7.8), they do not provide for the use of thermosetting powder coatings for the protection of components intended for the cars’ outside 4 areas. However, AkzoNobel also offers industrial applications and approvals (see Table 1) of powder systems that are suitable for the coating of outdoor rolling stock components (ref. opening photo).
In Italia, su iniziativa di “AICQ- Settore Trasporto su Rotaia” sono recentemente sorte le “Linee Guida Protezione dalla corrosione nel Settore Ferroviario” (ultima revisione 03-112014): in questo documento sono state riassunte (sulla base dell’esperienza di vari soggetti del settore quali costruttori di treni, enti certificatori e produttori di rivestimenti) informazioni molto importanti che vanno dalla progettazione al controllo dei processi anticorrosivi da applicare nel settore, fino al training del personale coinvolto. Questo documento è un utile riferimento in Italia per il settore e può permettere di superare le difficolta che si sono frequentemente evidenziate nel passato, quali ad esempio mancanza (o perdita) di una parte del flusso informativo tra il committente e il produttore del rivestimento. Le linee guida riportano inoltre delle specifiche tecniche di riferimento per valutare la qualità del processo anticorrosivo. Le linee guida non prevedono al momento (cfr. Parte 1 par. 7.7 e 7.8) l’utilizzo di rivestimenti in polvere termoindurente per la protezione dei componenti di rotabili nelle aree esterno cassa. Tuttavia, in AkzoNobel, abbiamo applicazioni industriali ed omologazioni (come riportato in tabella 1) di cicli a polvere per la verniciatura di parti esterne dei rotabili (rif. foto d’apertura).
Conclusions
Conclusione
As can be seen from the data and characteristics listed above, the use of new generation thermosetting powder coatings (anti-graffiti and with new multilayer systems) can now meet any technical and aesthetic requirement in the coating of rolling stock components. By way of example, and to confirm the above, fig. 4 summarizes in an indexed way the sales of Interpon EC in the last five years in the European market.
Come si può dedurre da tutti i dati e le caratteristiche sopra elencate, oggi l’impiego delle nuove generazioni di rivestimenti con polveri termoindurenti (antigraffiti e con i nuovi cicli multistrato) offre tutte le garanzie tecniche ed estetiche per poter soddisfare le esigenze di verniciatura di componenti di rotabili. A titolo di esempio, e per confermare quanto sopra, esponiamo un grafico (fig. 4) che riassume in modo indicizzato le vendite dei prodotti Interpon EC negli ultimi 5 anni in riferimento al mercato europeo.
Although the market is still in the early stage of development and despite the current economic crisis, the growth trend is positive. Based on these figures, the future of powder coatings in this market appears to be very promising. This, in turn, will stimulate further investment in the technological improvement of these products applied to the rail industry. ‹
© AkzoNobel
Guidelines for corrosion protection
4
Sales of Interpon EC products in the last five years in the European market. Vendite dei prodotti Interpon EC negli ultimi cinque anni sul mercato europeo.
Pur essendo il mercato ancora in fase iniziale di sviluppo e nonostante la crisi economica contingente, il trend mostra un indicatore positivo. Basandoci su queste indicazioni, riteniamo che questo mercato mostri per il settore delle vernici in polvere delle prospettive interessanti che stimoleranno ulteriormente ad investire sul miglioramento tecnologico di questi prodotti applicati al settore ferrotranviario. ‹
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
59
PROTECTIVE COATINGS | EXHIBITIONS CALENDAR
DECEMBER 2015
JANUARY 2016
PVPC EXPO MIDDLE EAST 2015 Abu Dhabi, UAE December 15-17, 2015 www.pvpcexpo.ae
SSPC 2016 San Antonio, TX, USA January 18-21, 2016 sspc2016.com
FEBRUARY 2016 16th MIDDLEAST CORROSION CONFERENCE & EXHIBITION Manam, Bahrain February 8-11, 2016 www.mecconline.org PIPELINE COATING 2016 Austria, Vienna February 16-18, 2016 www.amiplastics-na.com
NOG Nigeria Oil&Gas Conference & Exhibition Abuja, Nigeria February 22-25, 2016 www.cwcnog.com
Protective Coatings ®
media partner
MARCH 2016 CORROSION 2016 Vancouver, Canada March 06-10, 2016 nacecorrosion.org STOCEXPO 2016 Antwerp, Belgium March 15-17, 2016 www.stocexpo.com
GRINDTEC 2016 Augsburg, Germany March 16-19, 2016 www.grindtec.de Protective Coatings ®
media partner
APM Asia Pacific Maritime Singapore March 16-18, 2016 www.apmaritime.com
CHINA MARITIME 2016 Beijing, China March 29-31, 2016 www.chinamaritime.com.cn/en/ BRAZIL ROAD EXPO 2016 São Paulo, Brazil March 29-31, 2016 www.brazilroadexpo.com.br
APRIL 2016 MRO AMERICAS - AVIATION WEEK Dallas TX, USA April 05-07, 2016 mroamericas.aviationweek.com EXPOFERROVIARIA 2016 Torino, Italy April 05-07, 2016 www.expoferroviaria.com
60
INFRARAIL London, UK April 12-14, 2016 www.infrarail.com Protective Coatings ®
media partner
CITE 2016 London, UK April 12-14, 2016 www.cite-uk.com
CORROSION PROTECTION COATINGS Minsk, Russia April 05-08, 2016 www.minskexpo.com
SEA JAPAN Tokyo, Japan April 13-15, 2016 www.seajapan.ne.jp/en/
SEATEC-COMPOTEC 2016 Carrara, Italy April 06-08, 2016 www.sea-tec.it/uk/index.asp
IFHTSE 23rd Congress Savannah GA, USA April 18-22, 2016 www.ifhtse.org
TANK WORLD EXPO 2016 Dubai, UAE April 12-13, 2016 www.easyfairs.com
MOC - Mediterranean Offshore Conference & Exhibition Alexandria, Egypt April 19-21, 2016 www.moc-egypt.com
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
MAY 2016 SPE International Oilfield Corrosion Conference & Exhibition Aberdeen, UK May 09-10, 2016 www.spe.org/events/ofcs/2016 INLAND MARINE EXPO St. Louis, USA May 10-12, 2016 inlandmarineexpo.com EUROPEAN CONFERENCE ON HEAT TREATMENT Prague, Czech Republic May 11-13, 2016 www.htconference-prague2016.cz HTCPM Les Embiez Island, France May 15-20, 2016 www.htcpm2016.com SINOCORR Beijing, China May 16-19, 2016 www.sinocorr.org INTERCORR Búzios, Brazil May 16-20, 2016 www.abraco.org.br IMPA Singapore May 17-18, 2016 impasingapore.com COATINGS & CORROSION ASIA Kuala Lumpur, Malaysia May 17-19, 2016 www.coatcorrosionasia.com CORROSION PROTECTION St. Petersburg, Russia May 17-20, 2016 corrosion.expoforum.ru/en/ NAVALIA Vigo, Spain May 24-26, 2016 www.navalia.es 229th ESC Meeting San Diego, CA - USA May 29 - June 03, 2016 http://www.electrochem.org/meetings/biannual/229/ THE CORROSION SUMMER SCHOOL Dubrovnik, Croatia May 29 - June 03, 2016 cssd.squarespace.com
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
61
PROTECTIVE COATINGS | ZOOM ON EVENTS
STOCEXPO IS BACK WITH A BANG StocExpo ritorna con una formula esplosiva
1
© StocExpo
1
StocExpo 2016 takes place on 15-17 March 2016 at Antwerp Expo, Antwerp, Belgium. StocExpo 2016 si terrà dal 15 al 17 marzo 2016 ad Antwerp Expo, Antwerp, Belgio.
S
tocExpo (Figs. 1, 2), the world’s leading international event for the tank terminal industry, returns to the Antwerp Expo after two years in Rotterdam. The three-day event, which takes place on 15 – 17 March 2016, brings together the best and brightest from the bulk liquid storage industry, plus a top-flight conference programme and the most innovative suppliers from around the globe. StocExpo enables leading manufacturers and exhibitors to present their latest products and services to a captive international audience, whilst allowing visitors to discover the latest technologies, ideas and solutions to improve their businesses.
62
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
S
tocExpo (figg. 1, 2), evento internazionale leader nell’industria dei serbatoi terminali, ritorna ad Antwerp Expo dopo due anni a Rotterdam. La fiera di tre giorni, che si terrà dal 15 al 17 marzo 2016, raccoglie il meglio del settore dello stoccaggio dei liquidi, oltre a un programma di conferenze di primo livello e i fornitori più innovativi da tutto il mondo. StocExpo consente ai principali produttori ed espositori di presentare i loro ultimi prodotti e servizi a una platea internazionale interessata, permettendo ai visitatori di scoprire le ultime tecnologie, idee e soluzioni per migliorare le proprie attività.
Nick Powell, StocExpo & Tank Storage Portfolio Event Manager, commented: “Although the show is still 3 months out, we are pleased to say that Hall 4 has already sold out, and Hall 1 is filling up fast. We are delighted to have strong industry support from BATO and VOTOB, the Belgian and Dutch tank storage associations, plus we have the Port of Antwerp on board as Official Port Supporter. The show has firmly cemented its place in the diary of all tank storage professionals as the definitive international event for the bulk liquid industry. Our focus for 2016 is to make sure our show content is even more relevant, ensuring we attract the best speakers, as well as packing out our exhibition hall with more innovation than ever before. It is all looking good so far. All the major industry suppliers are onboard to exhibit and we’ve plenty of new names for our visitors too. We don’t take our position at the top lightly and we strive to improve the show each year, ensuring our visitors remain ahead of any industry trends.” Many exhibitors will be using StocExpo 2016 as the platform from which to launch new technologies and concepts or make major announcements to an international audience. It is therefore no surprise that over 150 companies from right across the tank storage supply chain have already signed-up for the show, with others coming on board fast. So far the show boasts major names including Scully Systems, CTS Netherlands BV, Mercon Steel Structures BV, Emerson Process Management, J. de Jonge Flowsystems BV, Emco Wheaton and Endress + Hauser to name a few. Returning exhibitor, Angeline Radley, Marketing Manager at Loadtec, remarked: “For Loadtec, StocExpo remains unrivalled in terms of the reach and exposure to our current and potential customers in the European storage market. However, it’s not all business as we feel the unique atmosphere and camaraderie amongst the exhibitors and visitors alike at StocExpo goes a long way in helping Loadtec establish critical business relationships with partners and customers alike. StocExpo is one of the shows we look forward most to attending”. The highly regarded StocExpo conference programme also returns with a who’s who of industry renowned speakers all looking to share their insights and experiences. Vopak, the Port of Antwerp, National Bank of Belgium and Zeeland Sea Ports are just some of the major names in the speaker line-up, which will have a regional and international feel, ensuring that visitors get highly relevant local content plus a global perspective. Karl-Heinz Schult-Bornemann, Assistant Professor at the Otto-von-Guericke Universitat, will take a look at the global energy outlook and fracking, whilst Earl Crochet, Director of Business Development at Kinder Morgan, will update attendees on terminal operations in North America. Maintaining the international emphasis will be Muthukrishnan Prabakaran, Global Head of Terminals at Gulf Petrochem, who will present
Nick Powell, StocExpo & Tank Storage Portfolio Event Manager, ha commentato: “Sebbene lo show sia ancora lontano 3 mesi, siamo lieti di affermare che il Padiglione 4 è già esaurito, mentre il Padiglione 1 si sta rapidamente riempiendo. Siamo contenti del forte supporto dell’industria datoci da BATO e VOTOB, l’associazione belga e tedesca dei serbatoi di stoccaggio; inoltre, anche Port of Antwerp sarà un supporter ufficiale (Official Port Supporter). L’evento è diventato un appuntamento fisso nel calendario di tutti i professionisti in quanto evento internazionale dell’industria dello stoccaggio dei liquidi. Nel 2016 ci impegneremo a rendere la fiera ancora più rilevante, assicurandoci i migliori relatori e riempiendo i padiglioni con sempre più innovazioni. Finora tutto funziona alla perfezione. Tutti i principali fornitori del settore saranno tra gli espositori e i visitatori potranno conoscere anche nuovi protagonisti. Non sottovalutiamo l’importanza della nostra posizione da leader: ogni anno ci impegniamo per migliorare l’evento, assicurandoci che i nostri visitatori siano aggiornati sulle ultime tendenze”. Molti espositori sfrutteranno StocExpo 2016 come piattaforma per il lancio di nuove tecnologie e concept oppure per importanti annunci davanti a un pubblico internazionale. Non è dunque una sorpresa che più di 150 aziende della catena di approvvigionamento dei serbatoi di stoccaggio abbiano già aderito alla fiera; molti altri saliranno presto a bordo. Finora, l’evento ha attirato nomi importanti come Scully Systems, CTS Netherlands BV, Mercon Steel Structures BV, Emerson Process Management, J. de Jonge Flowsystems BV, Emco Wheaton ed Endress + Hauser. Un espositore abituale, Angeline Radley, Marketing Manager di Loadtec, ha dichiarato: “Per Loadtec, StocExpo resta impareggiabile in termini di portata ed esposizione verso i nostri clienti attuali e potenziali del mercato europeo dello stoccaggio. Tuttavia, non si tratta solo di affari: l’atmosfera unica e lo spirito di squadra tra espositori e visitatori ha aiutato la nostra azienda a stabilire importanti relazioni di business con partner e clienti. StocExpo è uno degli eventi che attendiamo di più”. Anche il rinomato programma di conferenze di StocExpo tornerà con la partecipazione delle personalità più importanti dell’industria, che condivideranno visioni ed esperienze. Vopak, Port of Antwerp, la Banca Nazionale del Belgio e Zeeland Sea Ports sono soltanto alcuni dei nomi più rilevanti nella lista degli oratori che daranno un tocco regionale e internazionale all’evento, dando ai visitatori contenuti locali di alto livello e una prospettiva globale. Karl-Heinz Schult-Bornemann, Assistant Professor all’Università Otto-von-Guericke, offrirà uno sguardo sulle prospettive energetiche e di fracking globali, mentre Earl Crochet, Director of Business Development di Kinder Morgan, aggiornerà i partecipanti sulle operazioni dei terminali in Nord America. Muthukrishnan Prabakaran, Global Head of Terminals di Gulf Petrochem, manterrà l’enfasi sull’internazionalità presentando ‘The future of Fujairah as an oil and trading hub’. Durante la sua presentazione, discuterà degli attuali pro-
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
63
PROTECTIVE COATINGS | ZOOM ON EVENTS ‘The future of Fujairah as an oil and trading hub’. During his talk getti di espansione, le prestazioni dei terminali e la crescita della he will discuss current expansion projects, terminal performance domanda di petrolio; inoltre, valuterà il potenziale di crescita dello and the growth in oil demand, plus he will look at the potential stoccaggio del greggio e i più importanti progetti di raffinazione for crude storage growth and major refining projects in the in Medio Oriente che potrebbero avere un impatto sulla domanMiddle East that could impact demand. Michel Leyseele, da. Michel Leyseele, Manager Investments Oil & Chemicals di Port of Manager Investments Oil & Chemicals at the Port of Antwerp Antwerp, manterrà invece un approccio più regionale, mostranwill take a more regional approach, looking at the port itself as do come il porto possa essere un facilitatore per tutte le aziende a facilitator for all petrochemical industry shareholders. George petrolchimiche coinvolte. George Van Gastel, Head of Service della Van Gastel, Head of Service at National Bank of Belgium will Banca Nazionale del Belgio, approfondirà questo tema parlando continue this theme, discussing the economic importance of dell’importanza economica dei porti del Belgio. Durante la sua reBelgian ports. During his talk he will touch upon the evolution lazione affronterà l’evoluzione del traffico, i cambiamenti strutturaof traffic, the structural shifts, direct and indirect value added li, valore diretto e indiretto degli investimenti e gli sviluppi futuri. investments and any future developments. Looking towards the A guardare verso il futuro sarà Boudewijn Siemons, Managing Direcfuture will be Boudewijn Siemons, Managing Director of Vopak tor di Vopak Belgium, con la relazione ‘Interesting times for the Belgium, who will discuss storage market – what ‘Interesting times for the next for 2016?’, menstorage market – what next tre Charles Smissaert, for 2016?’ while Charles Managing Director di Botlek Smissaert, Managing Tank Terminal, presenterà Director at Botlek Tank la relazione “Still room for Terminal, will consider growth in Europe’. whether there is ‘Still room Come sempre, la sicurezfor growth in Europe’. za giocherà un ruolo imAs always, safety continues portante nel settore delto play an important role lo stoccaggio dei liquidi. within the bulk liquid sector. Sandra De Bont, Executive Sandra De Bont, Executive Director di VOTOB, mostreDirector at VOTOB will rà in dettaglio il suo Safe2 © StocExpo detail its Safety Maturity ty Maturity Tool e i beneTool and the benefits it fici che apporta, con uno 2 brings, including terminal sguardo sulle prestazioni StocExpo 2016 features a top-flight conference programme. performance insight, dei terminali dal punto di StocExpo 2016 sarà caratterizzata da un programma di conferenze di primo livello. in terms of ‘hardware, vista hardware, software e ‘software’ and ‘mindware’. ‘mindware’. Presenterà le She will present the findings from the 2014 report and analyse sue scoperte contenute nel report 2014 e analizzerà le azioni che sothe 2015 actions that have been undertaken. Also delivering no state intraprese nel 2015. Anche Mike O’Brien, Head of Marketing safety content will be Mike O’Brien, Head of Marketing at Newson di Newson Gale, affronterà il tema della sicurezza presentando le ulGale, who will present the latest European (2015) and US (2014) time guide europee (2015) e statunitensi (2014) per la prevenzione guidance for preventing fires and explosions caused by static degli incendi e delle esplosioni causate dall’elettricità statica. electricity. Ahmet Yavuz, Inspection Superintendent – Tank Farm/Oil Movements Ahmet Yavuz, Inspection Superintendent – Tank Farm/Oil di Tupras, presenterà la relazione “Inspection and maintenance Movements at Tupras will discuss ‘Inspection and maintenance planning’, esplorando le pratiche operative di sicurezza per la maplanning’. He will explore the safe operating practices for nutenzione dell’integrità dei serbatoi, gli standard, le pratiche e le maintaining tank integrity, tank standard practices and variabili oltre ai sette stadi dei sistemi di gestione dell’integrità dei variables, plus the seven steps of tank integrity management serbatoi. systems. Nick Powell ha commentato il programma della conferenza: “Alcuni Nick Powell comments on the conference programme: eventi si concentrano soltanto su notizie e tendenze locali, ma noi “Some events simply focus on the more regional news or trends, abbiamo rotto questa consuetudine offrendo anche un contenubut we have broken this mould, by providing international to internazionale. Attiriamo visitatori da 61 Paesi: StocExpo è cono64
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
content too. We attract visitors from 61 countries and StocExpo is acknowledged as the world’s major tank storage event. So we felt that it was important to not only explore critical regional issues but to also provide a global perspective. It’s our most comprehensive and international programme yet.” StocExpo 2016 also features a packed exhibition hall, with over 200 suppliers from across the globe using the show to launch products & services into the market. StocExpo 2016 takes place on 15-17 March 2016 at Antwerp Expo, Antwerp, Belgium. For further information: www.stocexpo.com ‹
sciuta come la più grande fiera del settore dei serbatoi di stoccaggio. Per questo abbiamo ritenuto importante non solo esplorare le criticità regionali ma fornire anche una prospettiva globale. Il programma dell’edizione 2016 è il più completo e internazionale che abbiamo creato finora”. StocExpo 2016 è caratterizzata anche da un padiglione espositivo con più di 200 fornitori da tutto il mondo che sfruttano l’evento per lanciare prodotti e servizi sul mercato. StocExpo 2016 si terrà dal 15 al 17 marzo 2016 ad Antwerp Expo, Antwerp, Belgio. Per maggiori informazioni: www.stocexpo.com ‹
THE “CORROSION SUMMER SCHOOL DUBROVNIK” La “Corrosion Summer School Dubrovnik”
T
he “Corrosion Summer School Dubrovnik” (CSSD) is a week long event (May 29 – June 3 2016), held in Dubrovnik (Croatia), where a group of most prominent academics, researchers and industrial experts in the field of corrosion hold lectures on selected topics. Four to five lecturers participate each year, selected from a broader pool of experts committed to the CSSD. The topics cover fundamental aspects of corrosion as well as applied topics related to a specific industry. The practical focus in 2016 will be the oil and gas industry. Mornings and early afternoons are reserved for lectures, each day covering a distinct topic, followed by a panel discussion in the afternoon on the same topic, where all the lecturers and course takers participate in an open exchange of ideas and questions focused around practical aspects of corrosion and corrosion protection. Up to thirty course takers are expected to come mostly from the industry (worldwide) with varying degrees of experience and background in the field of corrosion. In addition, up to ten additional places are reserved for graduate students doing research in the field of corrosion. The “Corrosion Summer School Dubrovnik” is organized and held at the Inter-University Center, an independent international institution for advanced studies structured as a consortium of universities with a mission to organize and promote contact and exchange through projects, study programs, courses and conferences across a wide range of scientific concerns. Program directors and resource persons come from 170 member universities worldwide. For further information: cssd.squarespace.com ‹
L
a “Corrosion Summer School Dubrovnik” (CSSD) è un evento di una settimana (29 maggio - 3 giugno 2016) che si svolgerà a Dubrovnik (Croazia), nel quale un gruppo di importanti accademici, ricercatori ed esperti nel campo della corrosione terranno delle conferenze su alcuni temi selezionati. Ogni anno partecipano da quattro a cinque oratori scelti da un ampio pool di esperti di CSSD. I temi coprono aspetti fondamentali della corrosione e i casi applicativi relativi a specifiche industrie. Il focus dell’edizione 2016 sarà sull’industria Oil & Gas. Le mattinate e la prima parte dei pomeriggi saranno dedicati alla presentazioni, che affronteranno un tema diverso ogni giorno, seguite da un dibattito pomeridiano sullo stesso soggetto nel quale tutti gli oratori e i partecipanti potranno scambiarsi idee e domande sugli aspetti pratici della corrosione e della protezione anticorrosiva. Sono attesi fino a 30 partecipanti da tutto il mondo in questo settore, con diversi gradi di esperienza e background nel campo della corrosione. Inoltre, sono stati riservati fino a dieci posti aggiuntivi per gli studenti diplomati in questo campo. La “Corrosion Summer School Dubrovnik” è organizzata da InterUniversity Center, un’istituzione indipendente internazionale per studi avanzati strutturata come un consorzio di università con la missione di organizzare e promuovere contatti e scambi attraverso progetti, programmi di studio, corsi e conferenze in un’ampia gamma di ambiti scientifici. I direttori dei programmi e i referenti provengono da 170 università di tutto il mondo. Per maggiori informazioni: cssd.squarespace.com ‹
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
65
PROTECTIVE COATINGS | ZOOM ON EVENTS
© Expo Ferroviaria
EXPO FERROVIARIA 2016 ATTRACTS LEADING INDUSTRY NAMES EXPO Ferroviaria 2016 attrae le aziende leader del settore
1 1
EXPO Ferroviaria 2016 will took place from 5 to 7 April 2016 in Turin, Italy, at Lingotto Fiere. EXPO Ferroviaria 2016 si terrà dal 5 al 7 aprile 2016 a Torino, presso Lingotto Fiere.
B
y early November, the number of companies planning to exhibit at the EXPO Ferroviaria 2016 show (Fig. 1) in Turin had risen to nearly 180 – and there was continuing strong demand for stand space. 2016 exhibition at the city’s Lingotto Fiere from 5 to 7 April will be the seventh of these popular and successful events, and as Italy’s only regular exhibition covering the entire market for railway technology, products and services, it has again attracted many of the industry’s best known names. Global rail systems suppliers Bombardier Transportation and Siemens will be taking part, as will AnsaldoBreda and Ansaldo STS, now part of Hitachi Rail Europe. Alpiq EnerTrans, which acquired Balfour Beatty Rail, and Sécheron will also be among high-profile names at the show.
66
N. 16 - 2015 DECEMBER - ipcm® Protective Coatings
S
ono circa 180 all’inizio di novembre le società partecipanti ad EXPO Ferroviaria 2016 a Torino (fig. 1) e continua ad esserci una grande richiesta di spazi espositivi. La settima edizione di questa famosa esposizione di successo si terrà dal 5 al 7 aprile del 2016 al Lingotto Fiere di Torino e si conferma nuovamente come unica vetrina italiana per le tecnologie, i prodotti e i sistemi ferroviari ancora in grado di attrarre molti dei grandi nomi del settore. I fornitori globali di sistemi ferroviari Bombardier Transportation e Siemens prenderanno parte all’evento, così come AnsaldoBreda e Ansaldo STS, ora parte di Hitachi Rail Europe. Alpiq EnerTrans, che ha acquisito Balfour Beatty Rail, e Sécheron faranno parte della importante lista di società che parteciperanno alla fiera. EXPO Ferroviaria 2016 avrà un carattere internazionale, con aziende provenienti da 16 Paesi, che fanno già parte della lista espositori.
There will be a strong international flavour too, with firms representing 16 countries already on the list of exhibitors. Among them there are infrastructure specialists such as Eurailscout, Plasser & Theurer with Plasser Italiana and Vossloh group companies plus Dako-CZ and PESA from the rolling stock sector. The exhibition has also attracted nearly 40 organisations taking part in EXPO Ferroviaria for the first time, many expected to bring new ideas to the market. Among them, Business France Milan, promoting the capabilities of French suppliers, major Italian rail infrastructure construction company SALCEF and two rolling stock firms from the Czech Republic – locomotive builder CZ Loko and freight wagon manufacturer Legios. EXPO Ferroviaria 2016 will occupy two halls at Lingotto Fiere. Special features of the show will include the Infrastructure Area in Hall 2, focusing on products and services specifically for fixed railway assets, and the On Track Display – equipment and machinery related to track construction and maintenance, presented on sections of full size track. Noting the rapid growth in exhibitor numbers, Exhibition Director Olivia Griscelli said: “The level of support we are receiving for next year’s exhibition both from Italian and foreign companies confirms the attractiveness of the rail market in Italy – and the important role this event plays for the industry. It is also good to see so many firms joining EXPO Ferroviaria for the first time. We are looking forward to a very interesting and busy show.” An extensive programme of activities alongside the exhibition will include conferences and seminars within the two halls, B2B meetings and technical visits to local railway sites.
Tra queste troviamo gli specialisti delle infrastrutture Eurailscout, Plasser & Theurer con Plasser Italiana e del materiale rotabile con le aziende del gruppo Vossloh, Dako-CZ e PESA. L’evento conta circa 40 aziende che prenderanno parte per la prima volta ad EXPO Ferroviaria, molte delle quali porteranno sicuramente nuove idee nel mercato. Tra queste Business France Milan, ente promotore di aziende francesi, SALCEF, principale costruttore italiano di infrastrutture ferroviarie, e due aziende produttrici di materiale rotabile dalla Repubblica Ceca: il costruttore di locomotive CZ Loko e il produttore di vagoni merci Legios. EXPO Ferroviaria 2016 occuperà due padiglioni presso il centro espositivo Lingotto Fiere. Due delle caratteristiche principali dell’evento saranno l’Area Infrastrutture e l’Area Binari. La prima è un’area interamente dedicata ai prodotti e servizi delle infrastrutture ferroviarie, mentre la seconda vede la presenza di due sezioni di binari che permetteranno agli espositori di presentare apparecchiature per la manutenzione dei binari in un contesto autentico. Considerando il rapido aumento del numero di espositori, la Direttrice di EXPO Ferroviaria, Olivia Griscelli, commenta: “Il livello di supporto che stiamo ricevendo sia da aziende italiane che straniere per l’evento del prossimo anno conferma l’attrattività del mercato ferroviario in Italia e il ruolo importante che questo evento gioca per l’industria. È inoltre interessante vedere così tante aziende entrare a fare parte di EXPO Ferroviaria per la prima volta. Ci troviamo di fronte ad un evento che sarà molto interessante e positivamente stimolante.” Un programma intensivo di attività si svolgerà in concomitanza con l’esposizione e includerà conferenze e seminari all’interno dei due padiglioni, incontri B2B e visite tecniche ai siti ferroviari della zona.
Show partners EXPO Ferroviaria is supported by many of the organisations shaping the rail sector in Italy. Show partners include national railway company Ferrovie dello Stato Italiane, the Ministry of Infrastructure and Transport, ASSTRA Associazione Trasporti and Ceipiemonte-Centro Estero Internazionalizzazione Piemonte. Also backing the event are the Association of Italian Railway Engineers (CIFI), ASSIFER – the Italian railway industries association, ANIAF – the Italian national association of trackwork contractors, and Tunnel Euralpin Lyon Turin, which is implementing the new cross-border rail link between Turin and Lyon. Supporting the show at a regional level are the Federmobilità regional and urban transport forum, Regione Piemonte, the City of Turin, Infra.To, which is responsible for Turin’s public infrastructure, and local public transport company GTT. EXPO Ferroviaria is organised by Mack Brooks Exhibitions. A world leader in the management of trade events for the rail industry, the company stages successful regular shows including SIFER in Lille, France, Railtex and Infrarail, both in the UK, and Exporail in Moscow, Russia. For further information: www.expoferroviaria.com ‹
Partner dell’esposizione EXPO Ferroviaria è sostenuta da molte organizzazioni coinvolte nel settore ferroviario italiano. I partner dell’esposizione comprendono le Ferrovie dello Stato Italiane, il Ministero delle Infrastrutture e dei Trasporti, ASSTRA Associazione Trasporti e Ceipiemonte-Centro Estero Internazionalizzazione Piemonte. Rinnovano la loro presenza: CIFI - Collegio Ingegneri Ferroviari Italiani, ASSIFER - Associazione dell’Industria Ferroviaria, ANIAF - Associazione Nazionale Imprese Armamento Ferroviario e TELT - Tunnel Euralpin Lione Torino, impegnato nella costruzione del nuovo collegamento ferroviario transalpino tra Torino e Lione. A sostegno dell’evento a livello regionale troviamo Federmobilità, forum per il trasporto regionale e urbano, Regione Piemonte, la Città di Torino, Infra.To, responsabile delle infrastrutture pubbliche di Torino, e l’azienda di trasporti pubblici locali GTT. EXPO Ferroviaria è organizzata da Mack Brooks Exhibitions. Leader mondiale nella gestione di eventi commerciali per il settore ferroviario, la società organizza regolarmente eventi di successo tra cui SIFER a Lille, in Francia, Railtex e Infrarail, nel Regno Unito e Exporail a Mosca, in Russia. Per maggiori informazioni: www.expoferroviaria.com ‹
ipcm® Protective Coatings - 2015 DECEMBER - N. 16
67
Protective Coatings ®
Eos Mktg&Communication srl www.ipcm.it info@ipcm.it
Questo periodico è associato all’Unione Stampa Periodica Italiana
TECHNICAL ADVISORY BOARD
Redazione - Sede Legale: Via Giacomo Matteotti, 16 20811 - Cesano Maderno (MB) - Italy
Antonio Amati:
Ing. Ilario Maconi:
Tank lining and special coatings
Materials Engineer, Nace inspector lev.2 quality inspections of coatings
Enzo Dell’Orto: Shot-blasting technologies
Loris Loschi: Protective coatings application
Vittorio Grassi: Heat treatment
Ing. Angelo Locaspi: EDITOR IN CHIEF / DIRETTORE RESPONSABILE ALESSIA VENTURI venturi@ipcm.it
Fluorinated Coatings ISSN 2282-1767
The new international magazine about corrosion control and prevention
Protective Coatings ®
ipcm_PC digital on
www.myipcm.com 2015 4th Year Quarterly N°16-December
EDITORIAL DIRECTOR / DIRETTORE EDITORIALE M.d.L. PAOLO RAMI paolorami@hotmail.it
EDITORIAL OFFICE / REDAZIONE
EDITORIAL BOARD Prof. Massimiliano Bestetti:
Massimo Cornago:
Department of Chemistry, Material and Chemical Engineering, Politecnico of Milan – Section of Applied Chemistry and Physics
Oil & Gas Specialist
Edoardo Tevere: Indipendent Nace inspector lev. 3 QC/QA
PAOLA GIRALDO giraldo@ipcm.it
Prof. Paolo Gronchi:
LUCA ANTOLINI antolini@ipcm.it
Department of Chemistry, Material and Chemical Engineering, Politecnico of Milan – Chemical Engineering Section
Dr. Antonio Tolotto:
Ivano Pastorelli:
Ing. Luca Valentinelli:
MONICA FUMAGALLI info@ipcm.it
MEDIA SALES FRANCESCO STUCCHI stucchi@ipcm.it NICOLE KRAUS kraus@ipcm.it
The new international magazine about corrosion control and prevention
Measurement and quality control
La nuova rivista internazionale sul controllo e la prevenzione della corrosione
Prof. Fabrizio Pirri:
Marine and industrial anticorrosive coating cycles
Materials Engineer, PhD, Nace inspector lev.3
Department of Material Sciences and Chemical Engineering, Politecnico of Turin, Micro and Nanosystems, Nanomaterials and Surfaces
Registrazione al Tribunale di Monza N° 4 del 26 Marzo 2012 Eos Mktg&Communication srl è iscritta nel Registro degli Operatori di Comunicazione con il numero 19244
POSTE ITALIANE SPA – SPED. IN A.P. 70% LO/MILANO SERVICE SUBSCRIPTION - SERVIZIO ABBONAMENTI: Sale only on subscription - Vendita solo su abbonamento E.mail info@ipcm.it Subscription Rates 2016 - Tariffe Abbonamento 2016: Annual subscription: EMEA 60,00 € (postage included) Rest of world 200,00 € (fast airmail shipping included) Abbonamento annuale: EMEA 60,00 € (spese postali incluse) Resto del mondo 200,00 € (spedizione via aerea inclusa) Subscription Rates 2016 digital version: 35,00 € Abbonamento 2016 versione digitale: 35,00 € + iva Single copy: 15,00 € EMEA (postage included) - Rest of world (postage excluded) Back issues: 30,00 € EMEA (postage included) - Rest of world (postage excluded) Fascicolo singolo: 15,00 € EMEA (spese postali incluse) - resto del mondo (spese postali escluse) Arretrati: 30,00 € EMEA (spese postali incluse) - resto del mondo (spese postali escluse)
LAYOUT/ IMPAGINAZIONE LASER GRAFICA DIGITAL srl www.lasergrafica.it
PRINT/ STAMPA A.G. PRINTING SRL www.agprinting.it
Subscriptions can be made by bank transfer to the following account: Eos Mktg&Communication Srl IBAN IT97F0844033270000000084801. SWIFT CODE CRCBIT22. The VAT on subscriptions and sale of single copies is over Gli abbonamenti possono essere sottoscritti versando il relativo importo a mezzo b/b IBAN IT97F0844033270000000084801 intestato a eos Mktg&Communication Srl. L’Iva sugli abbonamenti, nonchè sulla vendita di singole copie è assolta ai sensi dell’art.74 comma 1 lett. C DPR 633/72, DM 29/12/1989.
It is forbidden to reproduce articles and illustrations of “ipcm®” without authorization and without mentioning the source. The ideas expressed by the authors do not commit nor magazine nor eos Mktg&Communication S.r.l and responsibility for what is published is the authors themselves. È vietata la riproduzione di articoli e illustrazioni di “ipcm®” senza autorizzazione e senza citarne la fonte. Le idee espresse dagli autori non impegnano nè la rivista nè eos Mktg&Communication S.r.l e la responsabilità di quanto viene pubblicato rimane degli autori stessi.
7ª Esposizione internazionale dell’industria ferroviaria 5 - 7 aprile 2016, Lingotto Fiere, Torino Padiglioni 1 e 2
L’evento chiave dell’industria ferroviaria in Italia! Q
Oltre 200 espositori di tutti i settori ferroviari
Q
7,000 visitatori provenienti da tutto il mondo
Q
22,000 m² di spazio espositivo
Q
Conferenze CIFI, FERPRESS
Q
3 giorni di presentazioni espositori e visite tecniche
Q
Sezioni di binario per l’esposizione di tecnologie per l’infrastruttura
Email: expoferroviaria@mackbrooks.com www.expoferroviaria.com
Venite a discutere degli ultimi prodotti e sistemi ferroviari con i fornitori leader dell’industria Informatevi riguardo i trend tecnologici e gli sviluppi delle politiche ferroviarie Instaurate preziosi contatti commerciali in un’occasione di networking unica nel suo genere Unitevi ai leader del settore all’evento ferroviario più importante d’Italia!
Registratevi subito online per la vostra entrata gratuita
Partner Mediali: Con il Patrocinio del Ministero delle Infrastrutture e Trasporti
Partner dell’esposizione: