The new international magazine about corrosion control and prevention
Protective Coatings ÂŽ
ISSN 2282-1767
ipcm_PC digital on
www.myipcm.com 2016 5th Year Quarterly N°18-June
Zaniolo CdA - 03.16
soluzioni che valgono nel tempo lasting solutions
PONTE VALDARNO, SIENA
INDUSTRIAL & PROTECTIVE COATINGS I cicli di protezione industriale Retron Acrilico e Veneziani protective coatings comprendono una gamma di vernici, rivestimenti e prodotti intumescenti con elevate prestazioni in termini di protezione anticorrosiva e finitura estetica, resistenza agli agenti chimici, all’abrasione ed al fuoco. Presentano facilità di applicazione e rapidità di essicazione, perfetta aderenza, resistenza al deperimento cromatico ed elevata resistenza fisico-chimica; valenze che sono la migliore difesa dalle aggressioni esterne anche in ambienti industriali particolarmente difficili. Retron Acrilico industrial protective systems and Veneziani protective coatings includes a wide range of paints, linings and intumescent coatings featuring high performances in terms of anticorrosive protection and cosmetic finish, chemical, abrasion and fire resistance for steel structures are easy to apply and quick drying. The formulations ensure perfect adhesion, excellent gloss and color retention, high resistance to physical and chemical attacks, features which are the best defense against external factors, even in very aggressive industrial environments.
Cicli Zetagì e Veneziani accreditati: EDISON - ENI - ENEL - SNAM RETEGAS - ANAS - PETROBRAS - ACQPA - RFI - SAIPEM
Colorificio Zetagì Srl - Olmo di Creazzo (VI) - Tel. 0444.228300 - Fax 0444.228366 - zg@zetagi.it - www.zetagi.it
piĂš di 100.000 soluzioni
un solo fornitore finitura superficiale vibrofinitura . granigliatura rosler-it@rosler.com www.rosler.it
Una realtà nuova, forte di venticinque anni di esperienza, nella produzione di pitture per cicli di protezione anticorrosiva di opere nuove e per interventi manutentivi di strutture quali: • • • • • • •
Ponti e viadotti Impianti per la produzione di energia elettrica Impianti petrolchimici Impianti siderurgici Impianti petroliferi e trattamento gas Industria alimentare Complessi di edilizia industriale
La gamma di prodotti Brega Srl comprende: • Primer alchidici e sintetici • Primer zincanti organici e inorganici • Primer epossidici a rapida essicazione “surface tolerant” • Intermedi epossidici e clorocaucciù • Finiture alchidiche e clorocaucciù – alchidiche • Finiture epossidiche ed epossi – viniliche SEDE A V NUO • Finiture poliuretaniche • Pitture per alte temperature • Pitture epossicatrame • Rivestimenti a basso tenore di solvente Brega Srl a socio unico - Sede legale: via Repubblica 2 - 25026 Pontevico (BS) Sede operativa (nuova sede): via Cascina Vigna snc - 26843 Castelnuovo Bocca d’Adda (LO) tel. +39 0377 702262 - fax. +39 0377 702804 info@bregaanticorrosione.com www.bregaanticorrosione.com
JUNE 2016 EDITORIAL BRAND-NEW HIGHLIGHTS OF THE MONTH
16
Prepare to Coat Preparazione alla verniciatura
20
Technological Innovations of the QNix Range Le novità tecnologiche della gamma produttiva QNix
pag. 16 FOCUS ON TECHNOLOGY
© Graco
pag. 30
24
A High-quality Anti-corrosion System and a Leading Coating Applicator Help Give Back Milan One of its Iconic Locations, the Vigorelli Velodrome Un ciclo anticorrosivo di alta qualità e un applicatore leader per restituire un’icona alla sua città: Il Velodromo Vigorelli
30
Anti-corrosion Coatings and Steel Production-processing Rivestimenti anticorrosivi e produzione-lavorazione dell’acciaio
38
Road Bridge Maintenance: The Lombardo Pasquale e Figli S.r.l. Case Study Manutenzione dei ponti stradali: il caso studio ditta Lombardo Pasquale e Figli S.r.l.
42
Over 500 Flanges Protected with New Encapsulating Technology Oltre 500 flange protette con una nuova tecnologia di incapsulamento
© ipcm
INNOVATIONS
46
An Introduction to Thermal Spray – Part 4 Introduzione alla termospruzzatura – Parte 4
54
Preventing Chemical Spills by Protecting Secondary Containment Areas: Chemical Resistant Crack-Bridging Technology Prevenire il versamento di sostanze chimiche proteggendo le aree di contenimento secondario: tecnologia di crack-bridging resistente agli agenti chimici
EXHIBITIONS CALENDAR
pag. 54 © Belzona
CONTENTS
ZOOM ON EVENTS
Vapor Abrasive Blasting TM
Maximum blast power, Minimal dust
ECOQUIP™ 2 ‡ Same performance as sandblasting ‡ 92% less dust minimizing tenting and containment ‡ Up to 75% of blast media savings
ip
Qu
o Ec
DISCOVER HOW ECOQUIP 2 OPTIMIZES YOUR BLASTING JOB
™
s
EQ
TM
www.gracoblasting.com
PROTECTIVE COATINGS | EDITORIAL
Thank you, Ivano!
Grazie Ivano!
In the words of Jim Morrison, each of us has a pair of wings, but only those who dream learn to fly.
Ognuno di noi ha un paio di ali, ma solo chi sogna impara a volare, diceva Jim Morrison.
I wish to dedicate this issue’s editorial to the memory of Ivano Pastorelli, who passed away on 23rd June 2016. Ivano had a deep knowledge of surface treatments and coatings and was a man of enormous spirit who knew both how to dream and how to fly during his lifetime.
Voglio dedicare l’editoriale di questo numero al ricordo di Ivano Pastorelli, scomparso lo scorso 23 giugno 2016. Ivano era un profondo conoscitore dei trattamenti di superficie e della verniciatura nonché uomo di grande spirito, che nella sua vita ha saputo sognare e volare molto in alto.
Recognised as one of the major experts in the paint and coatings industry, starting in 1970 Ivano was a manager and consultant for the technical and sales departments of several important companies in the sector. From the beginning, his activity as consultant was accompanied by his role as a trainer and instructor at various professional institutes. In 1980 he started Cierrepi, a consulting firm designed to put his 30-year experience to work on behalf of the entire paint and coatings industry. Author of the book, “Verniciatura e controllo qualità” (Painting and quality control), published by Hoepli in 2004, in 2011 he took on a fundamental role in the creation and teaching of professional training courses of ipcm_Academy, the training division of the magazine ipcm®. Thanks to his guidance, ipcm_Academy has become a point of reference for Italian companies that need to train technicians and operators in industrial paint and coatings.
Riconosciuto come uno dei maggiori esperti del settore verniciatura, a partire dal 1970 ha ricoperto il ruolo di manager e consulente per l’organizzazione tecnica e commerciale di alcune importanti aziende del settore. All’attività di consulenza ha affiancato fin da subito quella di formatore, assumendo la docenza presso vari istituti professionali. Nel 1980 ha fondato Cierrepi, studio di consulenza nato per mettere a disposizione di tutto il settore della verniciatura la propria esperienza trentennale. Autore del libro “Verniciatura e controllo qualità” pubblicato dalla casa editrice Hoepli nel 2004, a partire dal 2011 ha svolto un ruolo fondamentale nell’ideazione e realizzazione dei corsi di formazione professionale di ipcm_Academy, divisione formazione della rivista ipcm®. Grazie alla sua direzione, ipcm_Academy è diventata un riferimento per le aziende italiane che necessitano di formare tecnici e operatori di verniciatura industriale.
His “pupils” – as he was fond of calling the participants in his training courses – and the heads of companies who called on him to provide valuable advice on how to optimise painting processes, appreciated not only his technical skills, but also his candid and direct manner, his speaking style able to capture the attention of listeners for long periods of time, and his skilful way of transitioning from theory to practice
I suoi “corsisti” - come amava definire i partecipanti ai suoi corsi di formazione - e i responsabili delle aziende che richiedevano la sua preziosa consulenza per ottimizzare i processi di verniciatura, ne apprezzavano, oltre alle competenze tecniche, il modo di fare schietto e diretto, la dialettica in grado di catalizzare l’attenzione delle persone per molto tempo e la capacità di passare sapientemente dalla teoria alla pratica.
A long-time aviation enthusiast, he obtained his Italian General Aviation pilot’s license.
Da sempre appassionato di volo, ha ottenuto il brevetto di pilota dell’Aviazione Generale Italiana.
Ivano was a person of great generosity and simplicity. He has left a void in all of us and we will try to fill it by continuing his educational and professional path.
Persona generosa e di grande simpatia, ha lasciato un vuoto in tutti noi, che cercheremo di colmare proseguendo il suo percorso formativo e professionale.
For us, he was a true friend and great colleague. We shall remember him always.
Per noi è stato un vero amico e un grande collaboratore. Lo ricorderemo sempre.
Alessia Venturi and staff of ipcm®
Alessia Venturi e lo staff di ipcm®
ipcm® Protective Coatings - 2016 JUNE - N. 18
01
PROTECTIVE COATINGS | BRAND-NEW
A SMARTER WAY OF COATING (S.W.O.C.) FOR FBE+PP/PE COATING OF FITTINGS Una Smarter Way Of Coating (S.W.O.C.) per il rivestimento FBE+PP/PE dei raccordi
I
L
a crescita del mercato pipeline è sostenuta da ecosistemi industriali interconnessi, volontà di assicurarsi molteplici fonti di energia, nuove scoperte di giacimenti di idrocarburi e dalla moltiplicazione di punti di produzione più piccoli. La maggior parte delle reti dedicate al trasporto di acqua, vapore, gas e petrolio sono situate sottoterra o sotto il mare per minimizzarne l’impatto e i rischi associati. Per assicurare una lunga vita di servizio delle infrastrutture, limitare ispezioni e operazioni di manutenzione costose e complesse, è necessaria un’adeguata progettazione, costruzione e installazione.
© Donelli Alexo
nterconnected industrial ecosystems, willingness to secure multiple sources of energy, successful hydrocarbon discoveries and multiplying of smaller points of production are driving the pipeline market growth. Most networks dedicated to transportation of water, steam, gas and oil run underground or below sea to minimize impact and associated risks. They require adequate engineering, manufacturing and installation to ensure extended lifetime of infrastructures to limit
1
1
The Certificate with the Seal of Excellence received by Donelli Alexo for the S.W.O.C. procedure. Il certificato con il Marchio di Eccellenza ricevuto da Donelli Alexo per la procedura S.W.O.C.
02
N. 18 - 2016 JUNE - ipcm® Protective Coatings
costly and complex inspection and maintenance operations. This has led the anti-corrosion coating industry to develop highly corrosive and mechanical resistant systems to protect pipelines. While coatings used are identical, the application methods for straight pipes greatly differ from those used for fittings (i.e. primarily bends, but also buckle arrestors). In fact, while the former consists of fully automated, mature technology-based, large scale application plants, the latter still lies on manual application methods given the limited number and heterogeneous dimensions if compared to straight pipes. This results in a large variability of application, limiting corrosion and mechanical resistant performances as well as in greater care to comply with HSE (Health Safety and Environmental) standards. After two years invested in various trials, hiring of new human capital, identification of partners and detailed engineering of a prototype equipment, Donelli Alexo has developed a coating procedure called SWOC “Smarter Way Of Coating”. This new procedure resolves these problems by proposing a new coating method based on an automatic induction heating process and an automatic application and quenching system for underground and underwater fittings. SWOC allows ALEXO to introduce innovative coated fittings meeting market demand by: - Automating the most critical steps of powder coating application - Improving the corrosion and mechanical properties of the final product - Significantly reducing HSE impact (qualitative impact), coating material waste (by 50%) and energy consumption (by 50%). Various companies involved in pipeline and fittings for energy and oil&gas sectors were involved in the developments. Detailed engineering of prototype was defined in late 2015. The project was presented within a European Union Call under Horizon2020 program in the area of accelerating the uptake of nanotechnologies, advanced materials or advanced manufacturing and processing technologies by SMEs. The project has received the Seal of Excellence (Fig. 1). For further information: www.donelli.it ‹
Questo ha portato l’industria dei rivestimenti anticorrosivi a sviluppare sistemi con elevata resistenza alla corrosione e meccanica per proteggere le pipeline. Sebbene i rivestimenti utilizzati siano identici, i metodi di applicazione per i tubi dritti variano notevolmente rispetto a quelli utilizzati per i raccordi (soprattutto curve e buckle arrestor). Infatti, mentre i primi consistono in impianti di applicazione su larga scala, completamente automatizzati e basati su tecnologie rodate, i raccordi si affidano ancora a metodi di applicazione manuali, a causa del numero limitato e delle dimensioni eterogenee rispetto ai tubi diritti. Questo comporta un’elevata variabilità di applicazione, limitando le prestazioni in fatto di resistenza alla corrosione e meccanica, e una maggiore attenzione necessaria per raggiungere la conformità agli standard HSE (Health Safety and Environmental). Dopo due anni investiti in diverse prove, nuove assunzioni, identificazione di partner e progettazione dettagliata di attrezzature prototipo, Donelli Alexo ha sviluppato una procedura di verniciatura chiamata S.W.O.C., “Smarter Way of Coating”. Questo nuovo metodo risolve questi problemi proponendo una nuova procedura di verniciatura che si basa su un processo automatico di riscaldamento a induzione, con sistema automatico di applicazione e raffreddamento per raccordi sotterranei e sottomarini. SWOC consente ad ALEXO di presentare raccordi rivestiti innovativi che soddisfano le esigenze del mercato attraverso: - l’automatizzazione delle fasi più critiche dell’applicazione delle vernici in polvere; - il miglioramento delle proprietà anticorrosive e meccaniche del prodotto finale; - la riduzione significativa dell’impatto HSE (impatto qualitativo), degli sfridi (del 50%) e del consumo energetico (del 50%). Diverse aziende leader nei settori energia ed oil&gas sono state coinvolte nello sviluppo di questa nuova tecnologia. La progettazione dettagliata del prototipo è stata definita alla fine del 2015. Il progetto è stato presentato all’interno del programma Horizon2020 dell’Unione Europea, nel settore dedicato all’accelerazione della diffusione di nanotecnologie, materiali, produzione e tecnologie avanzate tra le piccole e medie imprese. Il progetto ha ricevuto il Marchio di Eccellenza (fig. 1). Per maggiori informazioni: www.donelli.it ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
03
PROTECTIVE COATINGS | BRAND-NEW
SPARE A THOUGHT FOR CRITICAL SPARES: CORTEC® OFFERS INNOVATIVE SOLUTIONS TO GLOBAL COMPANIES L’importanza dei componenti di ricambio critici: Cortec® offre soluzioni innovative alle imprese globali
P
I
© Cortec
© Cortec
ump failures at oil production facilities globally guasti alle pompe negli stabilimenti di produzione del petrolio in tutto il be it the Persian Gulf or the Mexican Gulf - are mondo – che siano nel Golfo Persico o nel Golfo del Messico – costituiscoan occupational hazard, resulting in halted production no un rischio che si traduce nella sospensione del lavoro e nella perdita di and the loss of several thousand dollars of revenue and migliaia di dollari di fatturato e di produttività. È quindi fondamentale che la productivity for the business. It is mission critical to get the produzione riprenda il suo ciclo rapidamente e alla perfezione (fig. 1). Sebproduction line up and running bene queste situazioni si verifichino con quickly (Fig. 1). frequenza, molte aziende non riescono While this scenario occurs a prevenirle. Di conseguenza, le squadre frequently, many companies fail di manutenzione sono spesso occupate to anticipate it. Consequently, a cercare i pezzi di ricambio che, se premaintenance crews are usually senti, sono rimasti molto probabilmente scrambling to find spare parts, stoccati per alcuni anni e sono ora ricowhich if on hand, are likely to perti di ruggine. Se la squadra è fortunata, have been in storage for a few il pezzo di ricambio funziona; in caso conyears, and are now covered in trario, si perderanno altro tempo e soldi rust. If the crew is lucky, the spare nel cercare di riparare il pezzo vecchio part works. If not, more time and o nel cercarne uno nuovo. Con gli ingemoney is lost in trying to fix the gneri concentrati sulle operazioni, queold part or find a new one. sto scenario non è raro quanto dovrebbe 1 With engineers focused on essere. I servizi di supporto come la conoperations, this scenario is not servazione dei componenti sono spesso 1 as rare as it should be. Support trascurati e considerati di bassa priorità. A pumping facility. services such as preservation of Molto frequentemente i componenti di Una struttura di pompaggio. spares are often overlooked and riserva critici sono stoccati senza alcuna considered of low priority. Too often, critical spares are stored protezione. Le responsabilità sono divise tra i dipartimenti, e le discussioni su with no protection at all. Responsibilities are divided between chi sia responsabile del budget si protraggono. Sfortunatamente, la natura departments, and discussions on whose budget they fall under non smette di compiere il suo corso durante queste discussioni e le attrezare protracted. Unfortunately, nature does not pause for such zature continuano lentamente a degradarsi. Questa situazione disastrosa discussions, and equipment continues to slowly but surely può essere evitata con un minimo di previdenza e pianificazione, minimizdegrade. This disastrous scenario can be avoided with a little zando i tempi di fermo e assicurando così che le operazioni continuino a forethought and planning, minimizing svolgersi al massimo delle prestazioni. downtime and ensuring operations are Gli specialisti della conservazione di Cortec® lakept running at peak performance. vorano con i proprietari degli asset nello svilupPreservation specialists at Cortec® po delle soluzioni migliori, con zero difetti e baswork with asset owners in developing si costi di conservazione. Poiché molte attività di best in class, zero-defect, low-cost produzione di petrolio, gas ed energia elettrica 2 preservation solutions. Since many oil, hanno dei magazzini pieni di pezzi di ricambio Non-toxic rust removers such as VpCI®-422 can effectively gas, and power gen operations have che potrebbero essere già arrugginiti, la conserwarehouses full of spares that may have clean the rust off parts to restore them to usable vazione dei componenti di riserva critici spescondition on the same day. already rusted, critical spare preservation so inizia con il ripristino. I prodotti antiruggine Prodotti antiruggine atossici come VpCI®-422 possono often starts with restoration. Non-toxic atossici come VpCI®-422 possono rimuovere rimuovere efficacemente la ruggine dai pezzi per rust removers such as VpCI®-422 can efficacemente la ruggine dai pezzi per renderli renderli di nuovo utilizzabili il giorno stesso. 04
N. 18 - 2016 JUNE - ipcm® Protective Coatings
© Cortec
© Cortec
effectively clean the rust di nuovo utilizzabili il giorno off parts to restore them stesso (fig. 2). I detergento usable condition on ti a base biologica come the same day (Fig. 2). EcoLine® Cleaner Degreaser Biobased cleaners such rimuovono grassi, oli e altri as EcoLine® Cleaner contaminanti per preparare Degreaser remove i pezzi alla conservazione. greases, oils, and other Una volta che i componencontaminants to ti di ricambio critici sono pri3 prepare the parts for vi di ruggine, è disponibile preservation. un’ampia gamma di proOnce the critical dotti di prevenzione della spares are rust free, ruggine a base di inibitori an extensive range of della corrosione in fase vaVapor phase Corrosion pore (VpCI®), come schiuInhibitor (VpCI®) rust me, emettitori, additivi e preventives, foams, film che consentono una emitters, additives, and conservazione delle attrezfilms allow the cost zature efficiente dal punto efficient preservation of di vista dei costi – sia quelle 4 equipment - whether on stoccate all’interno sia quelle indoor racks or in open stoccate in piazzali all’aper3 4 outdoor yards (Figs. 3 to (figg. 3 e 4). La facilità di Preservation of power generators starts with and 4). Ease of removal rimozione rende i pezzi di restoration and ends up with the application of VpCI® renders this equipment ricambio operativi in pochi rust preventives. operationally ready in minuti piuttosto che nel La conservazione dei generatori di elettricità inizia a matter of minutes corso di alcuni giorni. Alcuni con il ripristino e si conclude con l’applicazione di prodotti antiruggine VpCI®. rather than days. Some trattamenti VpCI® di Cortec® Cortec® VpCI® water a base acqua sono famobased treatments have even been known to si addirittura per superare le prestazioni delle protezioni outperform oil based protection. Spares may also a base di olio. I componenti di ricambio possono anche benefit from temporary VpCI® coatings that can beneficiare dei rivestimenti temporanei VpCI®, facilmente easily be removed by alkaline spray or may be rimovibili con uno spray alcalino, oppure abbastanza inviunnoticeable enough to leave on for installation. sibili da essere lasciati anche per l’installazione. I pezzi di riSpares that are effectively preserved with Cortec® cambio che sono efficacemente conservati con i prodotti VpCIs will be ready for rapid installation the next VpCI® di Cortec®, in caso di guasto di un componente critime a critical operating part fails. Instead of tico saranno pronti per una rapida installazione. Invece di continuing to lose millions of dollars while plant continuare a perdere milioni di dollari durante la sospenoperation is suspended and personnel scramble sione delle attività dell’impianto e mentre il personale è to deal with a rusty replacement part, workers occupato con un pezzo di ricambio arrugginito, gli opecan simply unwrap the VpCI®-preserved critical ratori possono semplicemente scartare il pezzo di riserspare and install it as quickly as a completely new va conservato con un prodotto VpCI® e installarlo tanto part. This not only saves expensive downtime velocemente quanto un pezzo nuovo. Questo consente losses but also lowers labor and preservation di evitare perdite dovute ai tempi di fermo e di abbassare costs through more efficient protective materials. i costi di conservazione attraverso materiali protettivi più In order to avoid massive operational losses and efficienti. Per evitare perdite operative massicce e grandi headaches like these, it is definitely worth sparing problemi, è importante tenere attentamente in considea thought for critical spares. razione i pezzi di ricambio critici. For furtner information: www.cortecvci.com ‹ Per maggiori informazioni: www.cortecvci.com ‹ 05
PROTECTIVE COATINGS | BRAND-NEW
ECCO 68AS PRO ZINC Ecco 68AS Pro Zinc
E
E
© Ecco Finishing
cco Finishing AB, un’azienda svedese specializzata in soluzioni di verniciatura, sta lanciando una pistola di spruzzatura automatica destinata ad applicare i primer a base di zinco. Inizialmente, questa pistola di spruzzatura era stata progettata in particolare per un cliente americano, attivo nell’industria della costruzione di navi. Questo tipo di primer
© Ecco Finishing
cco Finishing AB, a Swedish company specializing in paint finishing solutions, is launching an automatic spray gun designed to apply zinc based primer. Initially this spray gun was especially designed for an US customer in the ship building industry. This type of primer is inherently difficult to spray as the
1
2 2
1
The Ecco 68 ProZinc spray gun
Application of a zinc based primer with the new Ecco 68 ProZinc spray gun whose construction avoid the clogging of the nozzle. L’applicazione del primer a base di zinco con la nuova pistola di spruzzatura Ecco 68 ProZinc, la cui struttura evita l’ostruzione dell’ugello.
zinc immediately adhere to all metal surfaces and consequently clogs a conventional spray gun (Fig. 1). After the customer tried a number of existing guns with insufficient results, Ecco Finishing was challenged to come up with a spray gun that would meet all criteria. The solution was Ecco 68 ProZinc (Fig. 2) where all wetted parts are made of a special plastic material. The outer metallic parts of the gun body are anodized with a non-stick material preventing the zinc from binding to the surface. In addition, dual paint channels allow for internal paint circulation preventing the zinc from solidifying when the spraying is interrupted. Peter Krantz, R&D Engineer at Ecco Finishing conclude: “We specialize in adapting Ecco products to specific customer’s needs, and to solve application problems which may occur for example when spraying aggressive materials, or when spraying in confined spaces. Since we are a relative small and very flexible organization, we can quickly respond to difficult request’s and alter a standard product or develop a new solution according to unique requirements.” For more information www.eccofinishing.com ‹ 06
N. 18 - 2016 JUNE - ipcm® Protective Coatings
La pistola di spruzzatura Ecco 68 ProZinc.
è per sua natura difficile da spruzzare dato che lo zinco aderisce immediatamente a tutte le superfici metalliche e di conseguenza ostruisce una pistola di spruzzatura convenzionale (fig. 1). Dopo la prova di numerose pistole già esistenti con risultati insufficienti, il cliente ha sfidato Ecco Finishing a inventarsi una pistola di spruzzatura che soddisfacesse tutti i criteri. La soluzione è stata Ecco 68 ProZinc (fig. 2) nella quale tutte le parti bagnabili sono costituite da un particolare materiale plastico. Le parti metalliche esterne del corpo della pistola sono anodizzate con un materiale antiaderente che previene l’adesione dello zinco alla superficie. Inoltre, i doppi canali di verniciatura permettono la circolazione interna della vernice evitando che lo zinco si solidifichi quando la spruzzatura è interrotta. Peter Krantz, R&D Engineer di Ecco Finishing, ha concluso: “Siamo specializzati nell’adattare i prodotti Ecco ai bisogni specifici del cliente e nel risolvere i problemi di applicazione che possono presentarsi, per esempio quando si spruzzano materiali aggressivi o quando si spruzza in spazi ristretti. Dal momento che siamo una piccola organizzazione famigliare e molto flessibile, possiamo rispondere velocemente alle richieste difficili e modificare il prodotto standard o sviluppare una nuova soluzione a seconda delle necessità specifiche.” Per maggiori informazioni: www.eccofinishing.com ‹
FUTURISTIC INTERMODAL STATION PROTECTED BY HEMPEL Futuristica stazione intermodale protetta da Hempel
T
he Belgian city of Mons is undergoing a major transformation to link the historic heart of the old town with the new Grands-Prés development estate, a project that involves the construction of a geothermically-heated intermodal railway station, conference centre, hotel, technological park and new private housing. The key landmark in this development is the futuristic train station that serves as an all-weather bridge between the two embankments of the railway line. The uniqueness of the new station lies in the pedestrian bridge. It is lined with shops and services and created with approximately 4,500 tonnes of steel structures that overarch the railway tracks. The station is equally designed to link road and rail networks, with a shared platform for trains and buses, the latter sharing a platform with taxis and a passenger drop-off zone for private vehicles. It combines two underground carparks, with 560 and 360 spaces each, as well as a direct connection to the motorway on the Grands-Prés side. The aesthetics of the new station, designed by Spanish architect Santiago Calatrava, are paramount, with a steel and glass shell that allows natural light to sculpt the blue stone and wooden interior of the pedestrian bridge and platform shelters. Naturally, such an ecologically and architecturally forward-thinking design is required to encompass the highest standards of safety and passive fire protection for the general public, which is why Hempel is proud to have been chosen as supplier of 40,000 litres of Hempacore intumescent coatings for this new landmark that already handles daily traffic flows of approximately 20,000 people. The fast-drying Hempacore One FD 43601 applied on this project is a one-component, solvent-borne, acrylic coating that provides up to 120 minutes resistance on steel beams and columns in cellulosic fires and is approved to European standards EN 13501-1 and EN 13381-8. It is specifically designed to fire-protect steel sections (open, square and circular) in temperatures between 350°C and 750°C, as well as affording Hempel’s exceptional standards of corrosion-protection. The fact that it is fast-drying is an important factor for the entire paint system supplied to this project, which also includes Hempadur Fast Dry 17410, a two-component, high build epoxy primer that offers short drying times in mild to medium atmospheric environments, and a topcoat of Hempathane HS 55610 polyurethane to ensure supreme aesthetics and durability for this public thoroughfare. When completed, the Mons train station will meet the two basic criteria that are now emblematic of the renovation/construction of Belgium’s major stations: enhanced intermodal operation. Having already opened the Conference Centre in the summer of 2014, Mons is sure to make a worthy impression on all visitors to 2015 Cultural Capital of Europe. For further information: www.hempel.com ‹
L
a città belga di Mons sta attraversando un periodo di grande trasformazione: un nuovo progetto è in corso per collegare il centro storico della città vecchia al centro commerciale di Grands-Prés, che sarà dotato di una stazione ferroviaria intermodale riscaldata geotermicamente, un centro congressi, hotel, parco tecnologico e nuove abitazioni private. Il punto di riferimento di questo nuovo sviluppo è la futuristica stazione ferroviaria che servirà da ponte fra le due massicciate della linea ferroviaria, in tutte le stagioni. La novità della nuova stazione è il suo ponte pedonale, costellato di negozi e servizi, realizzato con circa 4.500 tonnellate di strutture in acciaio che formano un arco soprastante i binari della ferrovia. La stazione è stata progettata per collegare le reti stradali e ferroviarie con una piattaforma condivisa da treni, autobus e taxi e una zona di drop-off dei passeggeri per i veicoli privati. È dotata di due parcheggi sotterranei, con 560 e 360 posti ciascuno e di un collegamento diretto con l’autostrada che porta a GrandsPrés. Notevole attenzione è stata prestata all’estetica della nuova stazione, progettata dall’architetto spagnolo Santiago Calatrava e dotata di un guscio in acciaio e vetro che consente alla luce naturale di “scolpire” la pietra blu e gli interni in legno del ponte pedonale e delle pensiline delle piattaforme. Per un design così ecologicamente e architettonicamente lungimirante è stato necessario ricorrere ai più alti standard di sicurezza e di protezione passiva dal fuoco per il pubblico, motivo per cui Hempel è orgogliosa di essere stata scelta come fornitore di 40.000 litri di pittura Hempacore Intumescent per questo nuovo punto di riferimento storico, che già gestisce un flusso di traffico giornaliero di circa 20.000 persone. Hempacore One FD 43601, la pittura a rapida essiccazione utilizzata per questo progetto, è un prodotto acrilico mono-componente, a base di solvente, che offre fino a 120 minuti di protezione per travi e colonne in acciaio in incendi cellulosici ed è approvato conformemente agli standard europei EN 13501-1 e EN 13381-8. È stato specificamente progettato per la protezione antincendio delle sezioni di acciaio (aperte, quadrate e circolari) a temperature comprese tra 350°C e 750 °C, offrendo allo stesso tempo gli eccezionali standard di protezione dalla corrosione di Hempel. Le sue qualità di rapida essiccazione sono un fattore importante per l’intero ciclo di pitturazione di questo progetto, che include anche Hempadur Fast Dry 17410, un primer epossidico bicomponente ad alto spessore che offre brevi tempi di essiccazione in ambienti atmosferici da scarsamente a mediamente corrosivi e un topcoat di Hempathane HS 55610, un prodotto poliuretanico in grado di garantire una splendida finitura estetica e una lunga durata. Al suo completamento, la stazione ferroviaria di Mons soddisferà i due criteri di base ritenuti fondamentali per la ristrutturazione/costruzione delle più importanti stazioni belghe: traslatività e operazioni intermodali ottimizzate. Con il Centro Congressi già inaugurato nell’estate del 2014, Mons sarà sicuramente apprezzata dai visitatori della Capitale della cultura europea del 2015. Per maggiori informazioni: www.hempel.com ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
07
PROTECTIVE COATINGS | BRAND-NEW
BREAKTHROUGH COATING WINS ROYAL SEAL OF APPROVAL Una vernice innovativa vince il sigillo reale di approvazione
T
he development of a new product which is helping to change the face of the energy and infrastructure markets in Europe has won world-class coatings manufacturer Sherwin-Williams the Queen’s Award for Enterprise: Innovation 2016. The breakthrough was made by Sherwin-Williams Protective and Marine Coatings through its new coating Dura-Plate 301W which has unique surface, humidity and temperature tolerant properties designed to protect assets in the harshest of environments, offering a longer painting calendar, increased efficiencies and reduced overall project costs. The cost of downtime on maintenance has long been an issue in many offshore European locations, with shortened seasons for coating depending on how low temperatures have fallen in winter. Working with key customers, the technical team developed a cold curing expansion of the surface and humidity tolerant epoxy technology, keeping the same broader field of application covering its use in immersion as well as atmospheric service
L
o sviluppo di un nuovo progetto che sta aiutando a cambiare il volto dei mercati di energia e infrastrutture in Europa ha permesso al produttore di vernici a livello mondiale SherwinWilliams di vincere il Queen’s Award for Enterprise: Innovation 2016. L’innovazione introdotta da Sherwin-Williams Protective and Marine Coatings è il suo nuovo rivestimento Dura-Plate 301W, che possiede proprietà superficiali e tolleranti a umidità e temperatura uniche, concepite per proteggere gli asset negli ambienti più aggressivi, offrendo una stagione di verniciatura più lunga, aumentando l’efficienza e riducendo complessivamente i costi del progetto. I costi di fermo-impianto dovuti alla manutenzione sono stati a lungo una criticità in molti impianti offshore europei, con periodi in cui la verniciatura è possibile più corti a seconda di quanto scendono le temperature in inverno. Lavorando con i clienti chiave, il team tecnico ha sviluppato una tecnologia epossidica polimerizzabile a freddo, tollerante all’umidità e alla dilatazione della superficie, mantenendo lo stesso ampio campo di applicazione che comprende sia il suo utilizzo in immersione che in condizioni atmosferiche operative tipiche delle applicazioni offshore marine, industriali e per le infrastrutture (fig. 1).
Onshore and offshore installations can be protected with Dura-Plate 301W. Le installazioni offshore e onshore possono essere protette con Dura-Plate 301W.
08
1
N. 18 - 2016 JUNE - ipcm® Protective Coatings
© Sherwin Williams
1
OIL&GAS
Dura-Plate 301W offre una polimerizzazione a freddo fino a 0°C e una riverniciabilità estesa a oltre sei mesi, due dei maggiori progressi raggiunti da questa tecnologia. Ian Walker (fig. 2), Amministratore Delegato di SherwinWilliams Protective & Marine Coatings Europe, Middle East and Africa (EMEA), ha dichiarato: “Questo premio rappresenta un riconoscimento per l’intero team e testimonia la natura veramente innovativa di questo prodotto, di come è stato concepito e sviluppato per riempire uno specifico vuoto nel mercato. Siamo particolarmente orgogliosi di aver vinto un premio così prestigioso: capiamo quanto sia difficile essere riconosciuti a questo livello e cosa ciò significa. I nostri clienti ora stanno vedendo i vantaggi di questo rivestimento, la differenza che offre in termini di estensione della stagione di verniciatura e i vantaggi finanziari. Abbiamo cercato di fornire un equilibrio agli utilizzi della tecnologia Dura-Plate 301W in modo da aumentare le possibilità di scelta sia ai proprietari degli asset sia agli appaltatori della manutenzione a livello globale e in particolare in Europa.” Sherwin-Williams Protective and Marine Coatings Division EMEA, con sede a Bolton nella contea di Greater Manchester, è leader nello sviluppo delle vernici per la protezione passiva dal fuoco per applicazioni nei settori oil&gas, ponti e autostrade.
Queen’s Award for Enterprise
Queen’s Award per l’impresa
249 Queen’s Awards (QA) have been announced this year for outstanding business achievement in the fields of International Trade, Innovation and Sustainable Development. Winners of The Queen’s Awards can expect an invitation to attend a special reception at Buckingham Palace. The awards are made annually by HM The Queen and are only given for the highest levels of excellence demonstrated in each category. For further information: www. sherwin-williams.com/protectiveEMEA ‹
Quest’anno sono stati annunciati 249 Queen’s Awards (QA) per gli straordinari risultati aziendali raggiunti nei settori del Commercio Internazionale, dell’Innovazione e dello Sviluppo Sostenibile. I vincitori del Queen’s Awards sono invitati a partecipare a un ricevimento speciale a Buckingham Palace. I premi sono conferiti annualmente da Sua Maestà la Regina e sono consegnati unicamente per il più alto livello di eccellenza dimostrato in ogni categoria. Per maggiori informazioni: www.sherwin-williams.com/protectiveEMEA ‹
© Sherwin Williams
conditions in offshore, marine, industrial and infrastructure applications (Fig. 1). Dura-Plate 301W offers cold curing down to 0ºC and extended re-coatability of up to six months, two important extensions of this 2 technology reach. Ian Walker (Fig. 2), managing 2 director of Sherwin-Williams Ian Walker Protective & Marine Coatings Europe, Middle East and Africa (EMEA), said: “This award is testament to the whole team and the truly innovative nature of this product, how it was conceived and developed to meet a specific gap in the market. “We’re particularly proud that we have won such a prestigious honour, we understand how tough it is to be recognised at this level and what it means”. “Our customers are now seeing the benefits of this coating, the difference it offers in terms of the extended season and the financial advantages”. “We have sought to provide a balance of uses for the Dura-Plate 301W technology to add to the options for the asset owner and maintenance contractor worldwide and in Europe particularly.” Sherwin-Williams Protective and Marine Coatings Division EMEA, based at Bolton in Greater Manchester, is a leader in the development of coatings for passive fire protection, oil & gas and bridges and highways applications.
NEW CENTURION GUN THE MOST POWERFUL GUN OF ITS TIME POWERED BY IBIX® Nuova pistola Centurion, la più potente di sempre, powered by IBIX® Il primo balzo tecnologico da anni nel settore del rivestimento tubi con polvere termoplastica PP e PE
WIDE SPRAY PATTERN
THE FIRST TECHNOLOGICAL ADVANCE IN THE PIPE JOINT PP & PE COATING INDUSTRY IN YEARS
® IBIX FLAME SPRAYING SYSTEM FOR THE INSTANT POWDER COATING GLADIATOR AND HERCULES, THE INNOVATIVE PORTABLE SYSTEMS FOR THE COATING OF METALS AND CONCRETE SUFACES
Sistema flame spray ® IBIX per il rivestimento istantaneo a polvere. Gladiator e Hercules gli innovativi sistemi portatili per il rivestimento di metalli e superfici cementizie. AUTOMATION: THE FLAME SPRAY COATING PROCESS CAN BE AUTOMATED FOR BUCKLE ARRESTORS, PIPE SECTIONS, BENDS, ETC. Automazione: Il processo di rivestimento a fiamma può essere automatizzato per buckle arrestors, tubi e curve
a division of
09
WWW.TECNOSUPPLY.COM - INFO@TECNOSUPPLY.COM
PROTECTIVE COATINGS | BRAND-NEW
CORTEC® CORRLUBE™ VPCI® LITHIUM EP GREASE: LONGER LASTING LUBRICANT OFFERS CORROSION PROTECTION ON ELECTRICAL CONNECTIONS CorrLube™ VpCI® Lithium EP Grease di Cortec®: lubrificante di maggiore durata per la protezione anticorrosiva dei collegamenti elettrici
W
hen it comes time to lubricate bearings, fans, chassis, or other metal areas where grease is applied (Fig. 1), Cortec’s CorrLube™ VpCI® Lithium EP Grease offers longer lubrication enhanced with superior corrosion protection even for use on electrical connections. CorrLube™ VpCI® Lithium EP Grease (Fig. 2) is a lithium complex grease formulated with premium quality, severely hydro treated base stock. It provides excellent resistance to oxidation and has
P
er la lubrificazione di cuscinetti, ventole, chassis o altri componenti di metallo sui quali si deve applicare del grasso (fig. 1), CorrLube™ VpCI® Lithium EP Grease di Cortec® offre una lubrificazione più duratura caratterizzata da una superiore protezione contro la corrosione, anche per l’utilizzo su collegamenti elettrici. CorrLube™ VpCI® Lithium EP Grease (fig. 2) è un grasso al litio complesso formulato con base severamente idrotrattata di primissima qualità. Offre un’eccellente resistenza all’ossidazione ed è stabile a temperature eleva-
© Cortec
1
Typical applications of CorrLube™. Applicazioni tipiche di CorrLube™.
high temperature stability; it is suitable for both operating and layup conditions. This lubricant’s formula is specifically designed with superior corrosion inhibiting properties against salt water, brine, H2S, HCl, and other corrosive agents. In addition, it incorporates Vapor phase Corrosion Inhibitors (VpCI®) for areas not in direct contact with the grease. Advantages of CorrLube™ VpCI® Lithium EP Grease include a cleaner application experience with decreased dripping and spattering. It lubricates for longer periods of time and increases the effectiveness of seals to keep out contaminants. This is an excellent product for use on equipment that operates intermittently. CorrLube™ VpCI® Lithium EP Grease remains effective even in extreme operating conditions (i.e., high temperature, high pressure, low speed/high pressure, and shock loading) and aids in the suspension of solid additives such as graphite, molybdenum, 10
N. 18 - 2016 JUNE - ipcm® Protective Coatings
te. Il prodotto è adatto sia per condizioni operative che di stoccaggio. La formula di questo lubrificante è stata progettata specificamente con proprietà superiori di inibizione della corrosione, contro acqua marina, acqua salata, H2S, HCl e altri agenti corrosivi. Inoltre, incorpora gli inibitori della corrosione in fase vapore (VpCI®) per le aree che non sono a diretto contatto con il grasso. Uno dei vantaggi di CorrLube™ VpCI® Lithium EP Grease è un’applicazione più pulita con meno sgocciolamenti e schizzi. Lubrifica per periodi più lunghi e aumenta l’efficacia della sigillatura mantenendo i contaminanti all’esterno. Si tratta di un prodotto eccellente per l’utilizzo su attrezzature che operano a intermittenza. CorrLube™ VpCI® Lithium EP Grease è efficace anche in condizioni operative estreme (per esempio alte temperature, alta pressione, bassa velocità/alta pressione e carico d’urto) e supporta la sospensione di additivi solidi come grafite, molibdeno, solfuro, ecc. Il maggiore spessore del suo
2
CorrLube™ VpCI® Lithium EP Grease is specifically designed with superior corrosion inhibiting properties.
2
disulfide, etc. Its thicker film consistency allows it to operate on worn parts, provide surface protection against movement, and reduce noise level. Specific applications of CorrLube™ VpCI® Lithium EP Grease include the following: • Metal-to-metal • Lubricating sleeves • Ball and roller bearings • Vehicle/equipment chassis • Fans • Bushings • Pulley bearings • Sliding high-friction areas • Generator end bearings. CorrLube™ VpCI® Lithium EP Grease has been under successful use by a major mining equipment manufacturer in Finland. The company had been using grease from one of Cortec’s competitors to protect electrical connections in control boxes. However, the grease was not performing well, and several areas were still corroding. Cortec’s representative was able to offer CorrLube™ VpCI® Lithium EP Grease as a more effective product that would meet requirements of a dielectric test while being flame retardant (control boxes are located in mining equipment where burning chemicals cannot be used). Test results according to the ASTM D149 Dielectric Strength and Breakdown Voltage method exceeded expectations. The product was applied to vulnerable areas from a custom-designed tube at different coating thicknesses, depending on the extent of an area’s corrosion exposure. Excellent results were obtained in the field. Cortec® CorrLube™ VpCI® Lithium EP Grease was easily applied, easily removed, and continues to give long lasting reliable performance. For further information www.cortecvci.com ‹
© Cortec
CorrLube™ VpCI® Lithium EP Grease è specificamente progettato con proprietà superiori di inibizione della corrosione.
film consente al prodotto di operare su parti usurate, protegge la superficie contro il movimento e riduce i livelli di rumore. Le applicazioni specifiche di CorrLube™ VpCI® Lithium EP Grease comprendono: • metallo su metallo; • manicotti di lubrificazione; • cuscinetti a rulli e a sfera; • chassis di veicoli/attrezzature; • ventole; • boccole; • carrucole con cuscinetti; • aree di scorrimento ad alta frizione; • cuscinetti per generatori. CorrLube™ VpCI® Lithium EP Grease è stato utilizzato con successo da un importante produttore di attrezzature per l’estrazione mineraria in Finlandia. L’azienda utilizzava il grasso di un concorrente di Cortec per proteggere le connessioni elettriche nelle centraline di controllo. Tuttavia, le prestazioni del grasso non erano soddisfacenti, e molte aree erano ancora in fase di corrosione. Il rappresentante di Cortec® ha presentato CorrLube™ VpCI® Lithium EP Grease, un prodotto più efficace che avrebbe soddisfatto i requisiti del test dielettrico, con proprietà di ritardante di fiamma (le centraline elettriche sono posizionate nelle attrezzature di estrazione mineraria, dove non si possono utilizzare sostanze chimiche combustibili). I risultati dei test secondo la metodologia ASTM D149, rigidità dielettrica e tensione di rottura, hanno superato le aspettative. Il prodotto è stato applicato alle zone vulnerabili attraverso un tubo progettato su misura, con spessori di rivestimento diversi a seconda dell’estensione dell’area di esposizione alla corrosione: sono stati ottenuti degli ottimi risultati sul campo. CorrLube™ VpCI® Lithium EP Grease di Cortec® è stato applicato e rimosso con facilità, e continua a fornire prestazioni durature e affidabili. Per maggiori informazioni: www.cortecvci.com ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
11
PROTECTIVE COATINGS | BRAND-NEW
EXCEPTIONAL FINISH FROM SHERWIN-WILLIAMS’ SCRIM FREE INDUSTRY-LEADING FIRETEX® FX9500 Finitura eccezionale con il prodotto scrim-free leader nel settore: FIRETEX® FX9500 di Sherwin-Williams
12
N. 18 - 2016 JUNE - ipcm® Protective Coatings
F
IRETEX® FX9500 (fig. 1) è l’intumescente epossidico scrimfree di nuova generazione di Sherwin-Williams che consente un design flessibile e la riduzione dei costi di progetto. FIRETEX® FX9500 offre protezione contro il fuoco di tipo cellulosico, nei progetti nei quali è importante una durabilità all’esterno di lunga durata. Il nuovo rivestimento copre periodi di tempo di 60, 90 e 120 minuti su un’ampia selezione di sezioni in acciaio con carichi elevati. È resistente e duraturo, offre spessori elevati ed elevata resistenza alla colatura, utilizza un’unità di spruzzatura airless single leg, è mesh free, con un volume di solidi 95%; inoltre, è privo di acido borico. Quando l’applicatore ha provato il prodotto sul campo, ha scoperto che in confronto ai prodotti concorrenti FX9500 è stato molto facile da applicare con una pompa single leg; inoltre, l’odore presente era molto tenue e la finitura eccezionale. Per raggiungere la stessa finitura con un prodotto concorrente sarebbe stato necessario applicare uno spessore superiore che in seguito avrebbe dovuto essere rimosso, portando a un grande spreco di prodotti e a un ambiente di lavoro meno sicuro. La finitura della serie FX è così ottima che la generazione precedente del rivestimento, M95, è stata utilizzata in ambiente C5 sulla struttura di acciaio esterna dell’edificio Leadenhall di Londra. Il team Sherwin-Williams di Fire Estimation and Engineering è disponibile a lavorare con il cliente e a essere coinvolto nel processo di progettazione per assicurare che sia scelto il sistema di rivestimento corretto per il progetto, e che questo possa offrire i vantaggi necessari. Per maggiori informazioni: sherwin-williams.com/protectiveEMEA ‹ © Sherwin-Williams
F
IRETEX® FX9500 (Fig. 1) is the next generation scrim free epoxy intumescent from Sherwin-Williams allowing flexible design and a reduction in a project’s costs. FIRETEX® FX9500 offers protection against cellulosic fires, on projects where external long term durability is a concern. The new coating covers 60, 90 & 120 minute time periods on a wide selection of steel sections with has competitive loadings. It is tough and durable, has high build & high sag resistance, uses a single leg airless spray, is mesh free, 95% volume solids and is boric acid free. When in field trial the applicator found, (compared with competitive products) that FX9500 was very easy to apply through a single leg pump, there was very little odour and that the finish was exceptional. To achieve the same finish with a competitor’s product a higher film would have to be applied then sanded off, leading to a great deal of wasted product and a less safe working environment. The 1 finish of FX series is so FIRETEX® FX9500 finishes. fine that the previous Le finiture di FIRETEX® FX9500. generation of the coating, M95, was used in a C5 environment on the external steel work of the Leadenhall building in London. Sherwin-Williams’ Fire Estimation and Engineering Team are available to work with you and become involved in the design process to ensure the correct coatings system is chosen for a project and that it will offer the necessary benefits. For further information: sherwin-williams.com/protectiveEMEA ‹
WHITFORD ANNOUNCES WORLDWIDE MANAGEMENT CHANGE Whitford annuncia il cambio di management a livello mondiale
© Whitford
W
hitford Worldwide, produttore della più grande e completa linea al mondo di rivestimenti a base di fluoropolimeri (nonstick e decorativi) per il settore industriale e consumer, ha annunciato un cambiamento nella sua struttura manageriale globale. In un recente Consiglio di Amministrazione, Anne S. Willis (fig. 1) è stata eletta all’unanimità Presidente e CEO della società a livello globale. La signora Willis è stata direttore generale di Whitford per l’Europa per 24 anni, oltre che responsabile del Global Management Team. David P. Willis Jr (fig. 2), fondatore e presidente di Whitford per 50 anni, diventa presidente del consiglio di amministrazione. Dave Willis ha dichiarato: “Sto per compiere 80 anni, ed è tempo che l’azienda compia il prossimo e logico passo per la sua crescita. Anne ha dimostrato il suo talento nei difficili mercati europei, e sono sicuro che sia prontissima ad affrontare le nuove responsabilità. Ora è lei a capo della nostra azienda: in questo modo io potrò lavorare e viaggiare meno. Tuttavia, Anne potrà consultarmi ogni volta che lo desidera”. Anne Willis ha dichiarato: “Sarà una sfida impegnativa, ma grazie alla squadra dirigenziale globale che abbiamo e alle nuove tecnologie che sveleremo, non ho dubbi che continueremo a far crescere notevolmente Whitford come avvenuto negli ultimi anni”. Per maggiori informazioni: www.whitfordww.com ‹ © Whitford
W
hitford Worldwide, manufacturer of the world’s largest, most complete line of fluoropolymer coatings (nonstick and decorative) for industrial and consumer industries, has announced a change in its worldwide management structure. At a recent Board of Directors meeting, Anne S. Willis (Fig. 1) was unanimously elected to the positions of president and chief executive officer of the worldwide company. Ms. Willis had been Whitford’s manager of Europe for the past 24 years, as well as head of the Global Management Team. David P. Willis Jr (Fig. 2), founder and president of Whitford for 50 years, moves to chairman of the board. Said Dave Willis: “I’m about to 1 turn 80, and it was time for the next logical step in the 1 company’s growth. Anne has Anne S. Willis. proven her talents in the tough European markets, and I have every confidence that she is more than ready for the increased responsibilities. She is now in charge of the business, so I can work fewer hours and cut my travel schedule way back. Nevertheless, I will be available to consult with Anne whenever she wishes.” Anne Willis said, “I’ve got quite an act to follow, but given the worldwide management team we have in place, and the new technologies we’re announcing, I have no doubt we will continue the remarkable growth that Whitford has enjoyed for many 2 years.” 2 For further information: www.whitfordww.com ‹ Dave P. Willis Jr.
ipcm® Protective Coatings - 2016 JUNE - N. 18
13
PROTECTIVE COATINGS | BRAND-NEW
BASF’S LEADING-EDGE PROTECTION FOR ROTOR BLADES PASSES 50 HOURS RAIN TEST La tecnologia all’avanguardia di BASF per le pale del rotore supera il test della pioggia di 50 ore
B
B
© Belzona
© BASF
© BASF
ASF supports the wind energy sector with special systems ASF supporta il settore dell’energia eolica con sistemi e prodotti and products and has launched an innovative coatings speciali e ha lanciato una soluzione innovativa di rivestimento per solution for rotor blades (Fig. 1): RELEST® Wind LEP S. le pale dei rotori (fig. 1): RELEST® Wind LEP S. Questo prodotto ha It has recently passed an external 50 hours rain erosion test by a infatti recentemente superato una prova di 50 ore in esterno per l’erorenowned institute from Denmark and thus outperformed other sione dovuta alla pioggia, svolta da un rinomato istituto della Danimarwell-known rain erosion resistant coatings. ca, surclassando altri noti rivestimenti resistenti a questo fenomeno. The stress loads to which rotor blades are exposed during the Le pale dei rotori sono sottoposte a carichi di sollecitazione enormi duoperation are enormous: at top speeds of up to 300 kilometers rante la loro attività: con velocità che raggiungono i 300 chilometri orari per hour at the blade tips, gigantic forces act upon the blades. alle estremità, le pale sono sottoposte a forze gigantesche. Inoltre, fatMoreover, weather influences such as rain, snow, tori metereologici come pioggia, neve, grandine, hail, sand, heat and UV radiation wear out the sabbia, calore e radiazioni UV consumano le pale e blades and lead to more frequent repair and portano a intervalli di riparazione e manutenzione maintenance intervals. To prevent the material più frequenti. Per prevenire che il materiale subisca from damages caused by these influences, dei danneggiamenti causati da questi elementi, la the Coatings division of BASF has developed a divisione Coatings di BASF ha sviluppato una solusolution for long-lasting protection. The system – zione per la protezione a lungo termine. Il sistema consisting of a gel coat, a filler, an edge protection – costituito da gel coat, filler, una protezione all’avanand a topcoat – is based entirely on solvent-free, guardia e una mano a finire – si basa completamentwo-component polyurethane compounds, thus te su composti poliuretanici bicomponente senza complying with present VOC directives. Within solvente, in conformità con le attuali direttive COV. BASF’s coatings portfolio for the wind energy All’interno del portfolio dei rivestimenti di BASF per sector, RELEST Wind LEP S stands for excellent il settore dell’energia eolica, RELEST Wind LEP S risalsustainable and efficient leading edge protection. ta per la sua eccellente sostenibilità e una protezio1 RELEST Wind LEP S provides rotor blades ne all’avanguardia ed efficiente. with the optimum protection due to its excellent RELEST Wind LEP S dona alle pale dei rotori una prorain erosion resistance. The recent test showed tezione ottimale grazie alla sua eccellente resistenza 1 that with a speed of up to 160 m/s all’erosione causata dalla pioggia. La recente prova BASF has launched an innovative (approx. 570 km/h), the rain did not cause ha dimostrato che con una velocità fino a 160 m/s coatings solution for rotor blades: any significant damage on the coating. (circa 570 km/h), la pioggia non causa alcun danno RELEST® Wind LEP S. The material is virtually solvent-free as well as significativo al rivestimento. Il materiale è praticaBASF ha lanciato una soluzione innovativa di rivestimento per le pale being exceptionally durable and UV stable. mente privo di solventi, eccezionalmente resistendei rotori: RELEST® Wind LEP S. Perfectly suited for OEMs, the material can be te e stabile ai raggi UV. Perfettamente adatto per le easily applied directly on the rotor blade. aziende OEM, il materiale può essere applicato diRELEST Wind LEP S improves the efficiency of the wind turbine rettamente sulle pale dei rotori. RELEST Wind LEP S migliora l’efficienza operation by providing an effective erosion protection, thus delle turbine eoliche offrendo un’efficace protezione dall’erosione, ridureducing potential maintenance costs. With its low film thickness cendo così i potenziali costi di manutenzione. Con il suo basso spessore and easy application, it is the ideal material matching e la facilità di applicazione, rappresenta il materiale ideale per soddisfare the customers’ requirements. i bisogni dei clienti. BASF supplies the matching coating system for all components BASF offre il sistema di rivestimento adeguato per tutti i componenti under the trade name RELEST, from the base of the wind power sotto la denominazione commerciale RELEST, dalla base dell’impianto plant to the rotor blade edge and thus provides innovative di energia eolica fino alle estremità delle pale del rotore: prodotti innoproducts for the energy of the future. vativi per l’energia del futuro. For further information: www.basf-coatings.com ‹ Per maggiori informazioni: www.basf-coatings.com ‹ 14
N. 18 - 2016 JUNE - ipcm® Protective Coatings
The Company Brega Srl of Castelnuovo Bocca D’Adda, Lodi (Italy), specialising in the production of anti/corrosion paints and coatings,
SELLS No. 1 seven-tank Vibromac hydraulic dispersion system, 3 carbon steel tanks with capacity 1,200 litres and 4 carbon steel tanks with capacity 800 litres. Price € 25,000.00
No. 1 Vibromac hydraulic dispersion system mounted on load cells, with two 4,000-litre and two 2,000-litre insulated stainless steel tanks. Price € 75.000,00
No. 4 separate motorised tanks with a capacity of approx. 8,000 litres each. Price € 3,500.00 each. No. 6 motorised tanks with capacity 4,000 litres each on a pedestal. Price € 20,000.00
All machines are ATEC-compliant. The cost for disassembling and transporting the equipment will be at the purchaser’s charge. Those interested in purchasing it, may see the equipment for sale on display at the Brega Srl production facility upon appointment. Brega Srl a socio unico - Registered office: via Repubblica 2 - 25026 Pontevico (BS, Italy) Operating office: Via Cascina Vigna snc - 26843 Castelnuovo Bocca d’Adda (LO, Italy) – tel. +39 0377 702262 – fax. +39 0377 702804 info@bregaanticorrosione.com www.bregaanticorrosione.com
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH
© Graco
PREPARE TO COAT Preparazione alla verniciatura
Opening picture: vapor blasting process with Graco’s EcoQuip system. Foto d’apertura: processo di sabbiatura abrasiva a vapore con il sistema EcoQuip di Graco.
16
here’s much more to optimum corrosion protection than using a high-quality protective coating. Preparation of the substrate is absolutely critical. Graco focuses on both areas. Its new EcoQuip 2 vapor abrasive blaster ensures excellent surface preparation; its new e-Xtreme electric driven airless sprayers provide an outstanding finish with quiet operation.
T
P
Vapor abrasive blasting is similar to dry blasting, except that the blast media is moistened prior to impacting the surface. A key benefit is that it creates significantly less dust than dry blasting; up to 92% less! Because dust is minimized, less containment is required and media clean-up time can be reduced. Since vapor abrasive blasting uses less water than slurry or other waterbased technologies, pools of water are not left behind, and there is less need to worry about toxic runoff. The end result is a cleaner, better contained process (Ref. Opening picture).
La sabbiatura abrasiva a vapore è simile alla sabbiatura a secco, a eccezione del fatto che l’abrasivo viene inumidito prima di colpire la superficie. Questa operazione crea molta meno polvere rispetto a quanto avviene con la sabbiatura a secco: fino al 92% in meno. Poiché la formazione di polvere è ridotta, sono necessarie misure di contenimento inferiori e il tempo di pulizia dall’abrasivo può essere ridotto. Siccome la sabbiatura a vapore utilizza una minore quantità di acqua rispetto ad altre tecnologie come la sabbiatura a umido convenzionale, non rimangono pozze d’acqua e non ci sono emissioni tossiche di cui preoccuparsi. Il risultato finale è un processo più pulito e meglio contenuto (rif. foto d’apertura).
Vapor blast with EcoQuip
Sabbiatura a vapore con EcoQuip
EcoQuip is Graco’s vapor abrasive blasting equipment. It’s been proven suitable in different industries for a range of applications such as the removal of paint, rust, corrosion, graffiti, industrial coatings and linings, and roadway markings. It’s ideal for cleaning general metal, stone and woodwork; restoring monuments and artifacts; lead and asbestos abatement; and building and site maintenance. In all these applications, EcoQuip has been demonstrated to reduce project costs and increase the speed, efficiency and productivity of blasting.
EcoQuip è la soluzione di Graco per la sabbiatura abrasiva a vapore. Si è dimostrata adatta in diverse industrie per un’ampia gamma di applicazioni, come la rimozione di vernice, ruggine, corrosione, graffiti, rivestimenti industriali e segnaletica orizzontale. È ideale per la pulizia del metallo in generale, pietra e parti in legno; ripristino di monumenti e manufatti; abbattimento di piombo e amianto; manutenzione di edifici e siti. In tutte queste applicazioni, EcoQuip ha dimostrato di ridurre i costi del progetto e aumentare velocità, efficienza e produttività della sabbiatura. Negli ultimi due anni, Graco ha studia-
N. 18 - 2016 JUNE - ipcm® Protective Coatings
er una protezione dalla corrosione ottimale, non è sufficiente utilizzare un rivestimento protettivo di alta qualità: la preparazione della superficie è infatti assolutamente fondamentale. Graco è concentrata su entrambe le aree. Il suo nuovo sistema EcoQuip 2 di sabbiatura abrasiva a vapore assicura un’eccellente preparazione della superficie; i nuovi spruzzatori airless ad azionamento elettrico e-Xtreme offrono una finitura eccezionale con un funzionamento silenzioso.
Stephan Rindfleisch Graco EMEA, Maasmechelen, Belgium stephan.rindfleisch@graco.com
For the past two years, Graco has researched how to make EcoQuip even faster, easier to use and more reliable in the field. As part of this research, Graco surveyed its distributors, field tested at several customer sites, and spent hundreds of hours doing competitive and product testing. The result is EcoQuip 2.
to come rendere EcoQuip ancora più veloce, facile da usare e affidabile in cantiere. Come parte di questa ricerca, Graco ha interpellato i suoi distributori, con prove in cantiere presso diversi loro clienti e centinaia di ore passate a eseguire prove comparative e di prodotto. Il risultato di queste operazioni è EcoQuip 2.
What’s new with EcoQuip 2?
Quali sono le novità di EcoQuip 2?
A new factory-set pot pressure is easy to use, with no in-field adjustments necessary, leading to more consistent blast power. A new ventless pot produces a more consistent blast pattern and 50% more usable pot capacity than EcoQuip 1. Set-up and pot pressurization is fast and hassle-free with no external vent plugging. The pot incorporates a new dual-layer coating for maximum corrosion resistance. A new and improved Abrasive Meter and MediaTrak™ leads to quicker and easier set-up, and enables the consumption of abrasive to be easily and accurately monitored. The unit’s controls are simplified, making EcoQuip 2 even easier and more intuitive to operate than its predecessor. Maximum blast pressure has been increased from 8.3 bar (120 psi) to 10.3 bar (150 psi) to give increased power for maximum production. The blast circuit is engineered for a minimal pressure drop with fast-take-down design, faster removal rates and easier service. The new pinchstyle abrasive valve is capable of handling coarse and fine media (12-150 grit), giving increased versatility for more applications. On the Elite models, the shelf, step and pot fill design has been optimized to improve bag loading and management. The results are impressive: 50% faster reload process after running empty and 30% faster media fill speed than EcoQuip 1. Also on the Elite models, a
Il nuovo contenitore con pressione settata in fabbrica, rende la macchina facile da usare ed elimina la necessità di regolazioni in cantiere: il tutto si traduce in una potenza di sabbiatura più costante. Il nuovo contenitore privo di sfiato produce un ventaglio di sabbiatura più omogeneo e una capacità di utilizzo maggiore del 50% rispetto a EcoQuip 1. Il set-up e la pressurizzazione del contenitore sono processi rapidi e senza problemi; inoltre non è necessario collegare una ventola esterna. Il contenitore presenta un nuovo rivestimento a doppio strato per la massima resistenza alla corrosione. Un sistema nuovo e migliorato di dosaggio del materiale abrasivo, insieme a MediaTrak™, consentono un settaggio più veloce e semplice, oltre a un monitoraggio facile e accurato del consumo di abrasivo. I controlli dell’unità sono semplificati e rendono EcoQuip 2 ancora più facile e intuitivo da utilizzare rispetto al suo predecessore. La pressione massima di sabbiatura è stata aumentata da 8,3 bar (120 psi) a 10,3 bar (150 psi) per offrire una maggiore potenza e massimizzare la produzione. Il circuito dell’abrasivo è progettato per avere un calo di pressione minimo e un design dalla manipolazione veloce per una rimozione più rapida e un’operatività più semplice. La nuova valvola a pinza dell’abrasivo è in grado di gestire sia abrasivi grossolani che sottili (12-150 grit), dando una maggiore flessibilità ad applicazioni diverse. Sui modelli Elite, il design del ripiano, del sostegno e del sistema di riempimento del contenitore è stato ottimizzato per migliorare il caricamento e la gestione del sacco. I risultati sono impressionanti: processo di ricaricamento 50% più veloce dopo lo svuotamento
1
The EcoQuip EQs Elite model. Il modello EcoQuip EQs Elite. 2
The EcoQuip EQm portable system. Il sistema portatile EcoQuip EQm. 3
3
© Graco
2
© Graco
1
© Graco
The e-Xtreme Ex45 electric driven airless sprayer . Lo spruzzatore airless con funzionamento elettrico e-Xtreme Ex45.
ipcm® Protective Coatings - 2016 JUNE - N. 18
17
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH water dose meter has been added for additional dust suppression (Fig. 1).
e velocità di riempimento dell’abrasivo maggiore del 30% rispetto a EcoQuip 1. Inoltre, sui modelli Elite è stato aggiunto un dosatore dell’acqua per un’ulteriore soppressione della polvere (fig. 1).
One mobile and two skid units
18
Un’unità mobile e due unità skid
EcoQuip 2 EQm is Graco’s compact, fully portable entrylevel unit (Fig. 2) with a built-in hand truck with oversized wheels for easy maneuverability around the job site. Its blast pressure ranges from 1.7-12.1 bar (25-175 psi) and its pot size of 100 liters holds approximately eight 25 kg bags of media. Graco EcoQuip 2 skid units are available in two versions. The standard model – EcoQuip 2 EQs – incorporates a coated carbon steel crash frame with basic features. EcoQuip 2 EQs Elite has a stainless-steel frame and enclosure with additional features for easy and fast set-up. Both skid versions have a 185-liter pot holding approximately sixteen 25 kg bags of media.
EcoQuip 2 EQm è l’unità entry-level di Graco compatta, completamente portatile (fig. 2) con un carrello integrato dotato di ruote di grandi dimensioni per una facile manovrabilità sul luogo di lavoro. La sua pressione di sabbiatura varia da 1,7 a 12,1 bar (25-175 psi) e il suo contenitore da 100 litri contiene circa otto sacchi da 25 kg di abrasivo. Le unità skid di Graco EcoQuip 2 sono disponibili in due versioni. Il modello standard – EcoQuip 2 EQs – è costituito da un telaio per usi gravosi in acciaio al carbonio rivestito, con caratteristiche base. EcoQuip 2 EQs Elite è dotato di un telaio in acciaio inossidabile e chiusure con caratteristiche aggiuntive, per un settaggio facile e rapido. Entrambe le versioni skid hanno un contenitore da 185 litri che contiene circa sedici sacchi da 25 kg di abrasivo.
Ready to spray?
Siete pronti alla spruzzatura?
Having prepared your substrate, you might now want to spray it with a corrosive protective coating. Graco’s new e-Xtreme electric-driven airless sprayers have been specifically designed for protective coatings (Fig. 3). e-Xtreme sprayers offer a flexible alternative to conventional air operated sprayers. Thanks to their electric drive, noise levels are lower and icing belongs to the past. e-Xtreme sprayers are extremely energy efficient, with a low KWh per liter sprayed. Compared to air-driven airless units, e-Xtreme will reduce energy consumption by up to 80%. Powerful enough to spray most common medium to high solid materials, they provide sufficient volume for the most popular tip sizes (80% of all Graco tips are 0.021” or smaller). They work on a standard residential 240 V, 16 A single-phase power supply. Rugged and reliable, they have the same “look and feel” as existing Graco airless sprayers, and are ATEX and IECEx approved for use in hazardous locations or where generating a spark is a concern.
Dopo aver preparato la superficie, è dunque possibile spruzzarla con un rivestimento protettivo anticorrosivo. I nuovi spruzzatori airless con funzionamento elettrico e-Xtreme sono stati specificamente progettati per i rivestimenti protettivi (fig. 3). Gli spruzzatori e-Xtreme offrono un’alternativa flessibile ai convenzionali spruzzatori pneumatici. Grazie ai loro motori elettrici, i livelli di rumorosità sono più bassi e i tempi di fermo dovuti a congelamento appartengono al passato. Gli spruzzatori e-Xtreme sono estremamente efficienti dal punto di vista energetico, con un numero di KWh ridotto per litro spruzzato. In confronto alle unità airless con funzionamento pneumatico, e-Xtreme riduce il consumo energetico fino all’80%. È sufficientemente potente da spruzzare sia rivestimenti comuni sia rivestimenti ad alto solido, e offre un volume sufficiente per tutte le dimensioni più popolari degli ugelli (l’80% di tutti gli ugelli Graco hanno dimensioni 0,021” o inferiori). Operano con tensione standard 240 V, 16 A, alimentazione monofase. Robusti e affidabili, hanno lo stesso aspetto degli attuali spruzzatori Graco airless e sono approvati da ATEX e IECEx per l’utilizzo in zone pericolose o nelle quali si possano generare scintille.
Extremely innovative features
Caratteristiche estremamente innovative
The unit’s software minimizes pressure drop effects during change-over. This leads to a significantly smoother and more uniform spray pattern. It also reduces the pulsation transmitted to the painter, resulting in reduced operator fatigue. Operator experience is also enhanced by the reduced noise levels of the electric motor. The e-Xtreme runs at 68 dBA; much lower than the OSHA hearing conservation threshold
Il software dell’unità riduce gli effetti dei cali di pressione durante il cambio. Questo consente un pattern di spruzzatura più uniforme e fluido. Riduce inoltre la pulsazione trasmessa al verniciatore, diminuendo la fatica dell’operatore. L’esperienza dell’operatore risulta inoltre migliorata grazie ai livelli di rumore ridotti del motore elettrico. e-Xtreme opera a 68 dBA: molto inferiori rispetto alla soglia di conservazione dell’udito OSHA di 90 dBA. Gli operatori possono così restare vicini all’unità
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Stephan Rindfleisch Graco EMEA, Maasmechelen, Belgium stephan.rindfleisch@graco.com
of 90 dBA. Operators can thus stay close to the unit for a longer time, which increases job productivity. The unit’s electronics are protected against extreme temperatures to avoid motor failures. The extended stall time under pressure will move the unit into a standby mode, which is cleared when fluid moves through the gun again.
per un tempo più lungo, aumentando la produttività. I componenti elettronici dell’unità sono protetti dalle temperature estreme per evitare il danneggiamento del motore. Un tempo esteso di stallo sotto pressione porterà l’unità in modalità standby, dalla quale uscirà quando i fluidi riprenderanno a fluire dentro la pistola.
Flexible range
Gamma flessibile
Two versions are available: e-Xtreme 35 has a maximum working pressure of 240 bar (3500 psi) and a dynamic spray pressure at the pump of 220 bar (3200 psi). The e-Xtreme 45 extends those values to 310 bar (4500 psi) and 270 bar (4000 psi) respectively. Both pressure versions are available in 12 different configurations: • Cart-mounted package with or without hose/gun and with or without integrated filter, and with suction set for 20-liter pails (4 versions) • Cart-mounted package with or without hose/gun and with or without integrated filter, and with stainless steel hopper kit (4 versions) • Wall-mounted package with or without hose/gun and with or without integrated filter. No suction set is included (4 versions). ‹
Sono disponibili due versioni: e-Xtreme 35 ha una pressione di lavoro massima di 240 bar (3500 psi) e una pressione di spruzzatura dinamica alla pompa di 220 bar (3200 psi). E-Xtreme 45 porta questi valori rispettivamente fino a 310 bar (4500 psi) e 270 bar (4000 psi). Entrambe le versioni sono disponibili in 12 diverse configurazioni: • unità caricata su carrello con o senza tubo/pistola e con o senza filtro integrato, e con set di aspirazione per fusti da 20 litri (4 versioni); • unità caricata su carrello con o senza tubo/pistola e con o senza filtro integrato, e con kit di montaggio della tramoggia in acciaio inossidabile (4 versioni); • unità montata a parete con o senza tubo/pistola e con o senza filtro integrato. Il set di aspirazione non è incluso (4 versioni). ‹
Your partner for the design, production and application of anticorrosive lining in ebonite, natural and synthetic rubber. Since 1969 Anti-corrosive and anti-abrasive lining in ebonite, natural and synthetic rubber
Sand-blasting and painting
Vessel and piping in reinforced plastics Via Veneziana Badalasco 73 - 24045 Fara Gera D’Adda (BG) - Italy - Tel. +39 0363 399 266 - Fax +39 0363 398 360 - info@pessina.it
w w w. p e s s i n a . i t
ipcm® Protective Coatings - 2016 JUNE - N. 18
19
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH
© Automation Dr. Nix
TECHNOLOGICAL INNOVATIONS OF THE QNIX RANGE Le novità tecnologiche della gamma produttiva QNix
Foto d’apertura: la famiglia di prodotti QNix 4000.
1
QNix 8500. QNix 8500.
20
A
N. 18 - 2016 JUNE - ipcm® Protective Coatings
U
n mercato che, dopo anni di crisi, sembra potersi riprendere anche se non in modo veloce come si sperava, lascia sul terreno disfunzioni e perdite produttive che difficilmente si potranno colmare in un breve periodo. Infatti, se le produzioni a basso costo permettono di mantenere competitività grazie all’automazione, incluso il processo di verniciatura, per la produzione di alta gamma, che richiede un know how frutto di anni di esperienza nei distretti industriali, non si prospettano facili soluzioni, sebbene sia di primaria importanza che esse rimangano sul territorio. Per questo uno strumento che non potrà essere omesso nel processo di verniciatura è lo spessimetro o misuratore di spessore. La gamma produttiva QNix (rif. foto d’apertura), prodotta da Automation Dr. Nix e commercializzata in Italia da Tecno Supply, permette di offrire prodotti di alta qualità per la misurazione del riporto in modo non distruttivo. Infatti, oltre ad essere garantiti 3 anni, gli strumenti non necessitano la calibrazione e rispondono alle normative ISO. L’affidabilità e la robustezza sono assicurate dalla presenza di un rubino all’interno dello strumento. Questo, unito ai severi test di qualità, garantisce uno strumento efficiente anche dopo milioni di misurazioni. © Automation Dr. Nix
Opening photo: the QNix 4000 family of products.
fter a long slump, this market seems to be making a turnaround though not as fast as many have hoped, leaving in its wake dysfunction and production losses that will be hard to make up for in the short term. In fact, if low-cost production makes it possible to maintain competitiveness thanks to automation, including the coating process, the high-end production, which requires a know-how developed over years of experience in the industrial districts, sees no easy solutions. A critical factor, however, is that these solutions remain local, and to achieve this goal, one instrument that cannot be omitted in the coating process is the thickness measuring gauge. The QNix production range (Ref. opening photo) produced by Automation Dr. Nix and sold in Italy by Tecno Supply, offers high-quality products for measuring coating layers in a non-destructive manner. Besides a three-year warranty, the instruments do not require calibration and meet ISO standards. Their reliability and durability are assured by a ruby placed inside the instrument. This, in addition to the stringent quality tests, guarantees an efficient instrument even after millions 1 of measurements.
Adriano Antonelli Tecno Supply div. of Ibix Srl, Santa Maria in Fabriago (RA), Italy adriano.antonelli@tecnosupply.com
2
© Automation Dr. Nix
3
© Automation Dr. Nix
2
QNix 8500
QNix 8500
The search for perfection Germans are known for has led to important innovations in the sector of non-destructive measurements. The QNix 8500 (Fig. 1), supplied with the RF probe – giving the possibility to measure using a wireless probe separated from the gauge and to load data onto a PC – has been significantly upgraded, replacing the 16s version with the current 17b firmware. This innovation now enables options previously considered impossible: - the measurement taken with the wireless probe can be displayed by several QNix 8500 at the same time. This represents a considerable advantage because during inspections just a single measurement can allow several persons to verify the thicknesses; - memory has been expanded from 13,000 to 30,000 measurements. It is also now possible to catalogue the measurements in groups up to a maximum of 250 compared to the 200 of the previous version; - any RF or standard probe is compatible without having to check production batches; - 120 measurements per minute can be carried out. This High Speed Technology is one of the most interesting factors of this technology; - higher durability of the instrument thanks to the scratchproof display. The instrument also features a new accessory: The silicone protection and the Velcro. Because the gauge, thanks to the RF wireless probe, allows freedom when performing measurements, a probe holder which can be wrapped around the wrist allows the instrument to be used in any situation. In addition, the silicone protection significantly reduces shocks due to impact. The software has also been improved and updated with the intention of delivering clear and precise representation especially when there are multiple measurements.
La ricerca della perfezione tedesca ha portato notevoli innovazioni nel settore delle misurazioni non distruttive. Lo strumento QNix 8500 (fig. 1), che ha in dotazione la sonda RF – cioè la possibilità di misurare con sonda staccata dalla strumento senza fili e possibilità di scaricare i dati sul PC – è stato notevolmente potenziato rimpiazzando la versione 16s con l’attuale firmware 17b. Questo permette notevoli opzioni prima impensabili: - la misura presa con la sonda wireless senza fili può essere visualizzata da più QNix 8500 contemporaneamente. Questo è un notevole vantaggio perché durante le ispezioni, con una sola misurazione, più persone potranno verificare gli spessori; - è stata ampliata la memoria, che passa da 13.000 valori misurati a 30.000. Ora, inoltre, è possibile catalogare le misurazioni in gruppi fino a un massimo di 250 rispetto ai 200 della versione precedente; - qualsiasi sonda RF o standard è compatibile senza dover verificare i lotti produttivi; - è possibile effettuare 120 misurazioni al minuto. Questa High Speed Technology è uno dei fattori più interessanti di questa tecnologia; - maggiore robustezza dello strumento grazie al display anti-graffio. Lo strumento dispone di un nuovo accessorio: la protezione siliconica e il velcro. Dato che il macchinario, grazie alla sonda RF senza fili, permette libertà nella misurazione, un porta sonda che è possibile avvolgere al polso consente di utilizzare e misurare lo strumento in qualsiasi situazione. Inoltre, è stato rilevato che la protezione siliconica permette di diminuire in modo significativo gli shock derivanti dagli urti. Anche il software è stato migliorato e aggiornato cercando di dare una rappresentazione chiara e precisa soprattutto quando le misurazioni sono molteplici.
QNix 4500. QNix 4500. 3
QNix 4200. QNix 4200.
ipcm® Protective Coatings - 2016 JUNE - N. 18
21
PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH 4
QNix 4500
Qnix 1500. Qnix 1500.
22
QNix 4500
The QNix 4500 (Fig. 2), like the QNix 4200 (Fig. 3), does not require settings. After being positioned on the support, it automatically gives a reading of the thickness. The new product launched on 4 the market in 2013 was the QNix 4500/4200 with wire. The aim of this design was to increase the flexibility of the instrument, which is one of the best sold of its kind around the world. Many new features were added to this instrument for 2014: - the High Speed technology was incorporated also for this model, thus allowing 120 readings/min.; - higher durability thanks to the scratch-proof display.
Il QNix 4500 (fig. 2), come già il QNix 4200 (fig. 3), non richiede impostazioni. Una volta appoggiato sul supporto, legge automaticamente lo spessore. La novità offerta sul mercato per il 2013 è stata il QNix 4500/4200 con filo. © Automation Dr. Nix In questo modo si è voluta aumentare la flessibilità dello strumento, che rimane uno dei più venduti a livello globale della sua categoria. Le novità anche in questo strumento per il 2014 sono molteplici: - la tecnologia High Speed tecnhology è stata inglobata anche per questo modello. Perciò è possibile effeffuare 120 letture al minuto; - la robustezza è maggiore grazie al display anti-graffio.
QNix 1500
QNix 1500
Another thickness gauge of the range, the QNix 1500 (Fig. 4) from Automation Dr. Nix, is the only non-destructive gauge for measuring the coating and is homologated by Daimler, Chrysler and Volkswagen. A leader in the automotive industry for the recognition of quality among the prominent car manufacturers, the gauge gets high marks in the coatings sector in general. Its unique shape aided by the two independent probes Fe and NFe also allows measurements in spots that are very difficult to access. It is used for large surfaces and can measure up to 5000 micron. This manageable instrument, easy to use and extremely reliable, turns off and on automatically. It operates with a 9 Volt battery and no calibration is necessary. The gauge comes with a certificate of self-calibration. It weighs only 150 grams including battery and allows the operator to perform hundreds of measurements correctly. The three-year warranty is proof of the quality of this measuring instrument. The gauge can also be supplied with the QNix 1500 M memory. In this case, a USB can be simply used to interface the instrument with the computer and the QNix software to be downloaded, in this way allowing the user to download and archive all performed measurements. In the event that only ferrous surfaces are measured, the more economical version, QNix 1200, is available.
Un altro spessimetro della gamma, il Qnix 1500 (fig. 4) di Automation Dr. Nix, è l’unico strumento non distruttivo per la misurazione del riporto omologato Daimler, Chrysler e Volkswagen. Lo strumento, leader nel settore dell’automotive proprio per il riconoscimento di qualità accordato dalle prestigiose case automobilistiche, è apprezzato anche nel settore del rivestimento in genere. La sua particolare forma, infatti, con l’ausilio delle due sonde indipendenti Fe e NFe, permette di misurare anche in punti di difficile accesso. È utilizzato per le grandi superfici e può misurare fino a 5000 micron. Lo strumento maneggevole, facile nell’utilizzo e soprattutto affidabile si spegne e si accende automaticamente. Funziona con una batteria da 9 Volt. La calibrazione non è richiesta. Lo strumento è correlato di certificato di auto-calibrazione. Il peso di soli 150 gr, inclusa la batteria, permette all’operatore di effettuare centinaia di misurazioni in modo appropriato. I 3 anni di garanzia accordati sono la prova della qualità dello strumento. Lo strumento può essere fornito anche con la memoria QNix 1500 M. In questo caso sarà sufficiente una USB per interfacciare lo strumento al computer e il software QNix da scaricare. Si potranno così scaricare ed archiviare tutte le misurazione effettuate. Nel caso si dovesse misurare solamente superfici ferrose è disponibile la versione più economica, QNix 1200.
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Nome indirizzo mail
QNix Handy Those searching for cost-effective measuring instruments on the market never have to settle for unreliable or inefficient gauges. Even when trying to reduce costs, users must make sure they are operating efficient products that guarantee a precise result. The QNix Handy gauge, for example, aims to satisfy the requirements of users seeking the best value for money. As with the whole production range, QNix Handy offers a three-year warranty, in addition to other special features such as sturdiness guaranteed by the presence of a ruby inside the probe, the non-necessity of calibration, simple operation, easy handling, and especially a competitive price. Handy measures Fe and Nfe supports. It turns on and off automatically and operates with two AA batteries. No calibration is needed and to validate this the gauge comes with a certificate of calibration issued by the manufacturer. The thickness gauge, differing from the whole other QNix range, is the only one to have a 10 micron in 10 micron resolution with respect to the tolerances of +/- 1 micron of the rest of the range. It is ideal for measurements that do not require precision to the micron or for controls at the end of the production line when making an initial measurement. ‹
QNix Handy La ricerca di strumenti economici sul mercato non deve assolutamente portare all’acquisto di misuratori non affidabili o non efficienti: anche in fase di contenimento dei costi, è necessario assicurarsi di utilizzare prodotti efficaci che garantiscano la sicurezza del risultato. Lo strumento QNix Handy, ad esempio, cerca di soddisfare le esigenze di chi ricerca il miglior rapporto qualitàprezzo. Come per tutta la gamma produttiva, QNix Handy offre 3 anni di garanzia, oltre alle altre particolari caratteristiche quali la robustezza, garantita dalla presenza di un rubino all’interno della sonda, la non necessità di calibrazione, la facilità d’uso, la maneggevolezza, ma soprattutto, un prezzo competitivo. Handy misura supporti Fe e Nfe, si accende e si spegne automaticamente e funziona con due pile stilo. La calibrazione non è necessaria, per questo lo strumento è corredato dal certificato di calibrazione emesso dal produttore. Lo spessimetro, a differenza dell’intera gamma QNix, è l’unico però ad avere una risoluzione di 10 micron in 10 micron rispetto alle tolleranze di +/- 1 micron del resto della gamma. Uno strumento dunque che è ideale per misurazioni che non necessitano la precisione al micron o per rilevamenti a fine linea produttiva per una prima misurazione. ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
23
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
© Vigorelli
A HIGH-QUALITY ANTI-CORROSION SYSTEM AND A LEADING COATING APPLICATOR HELP GIVE BACK MILAN ONE OF ITS ICONIC LOCATIONS, THE VIGORELLI VELODROME Un ciclo anticorrosivo di alta qualità e un applicatore leader per restituire un’icona alla sua città: Il Velodromo Vigorelli
A
Opening photo: Milan’s historic Maspes-Vigorelli Velodrome. On June 2nd 40 bicycles and a host of former champions celebrated the revival of the track which was the site for races between Coppi and Maspes. Foto d’apertura: il leggendario velodromo milanese Maspes-Vigorelli. Lo scorso 2 giugno 40 biciclette e tanti ex campioni hanno celebrato il ritorno alla vita dell’anello che fu teatro delle sfide tra Coppi e Maspes.
24
fter 15 years of inactivity, the legendary Maspes-Vigorelli Velodrome in Milan was reopened for one day on June 2nd. 40 bicycles and a host of former champions celebrated the revival of the track that saw epic races between cyclists Coppi and Maspes (Ref. opening photo). The Maspes-Vigorelli Velodrome (also known as the Vigorelli) is a historic sports arena in Milan originally used for track cycling and today primarily used for American football games. The Vigorelli was built in 1935 following the demolition of the antiquated Sempione Velodrome built at the turn of the century. The idea of erecting a semi-covered velodrome was that of Giuseppe Vigorelli, former track cyclist, industrialist and councillor of sport for the City of Milan during the administration of Luigi Mangiagalli. From the outset, the Vigorelli became the major site of important races and an arena frequented by many spectators and fans. Over the years, however, its fortunes suffered ups and downs.
N. 18 - 2016 JUNE - ipcm® Protective Coatings
D
opo 15 anni di inattività, lo scorso 2 giugno è stato riaperto per un giorno il leggendario velodromo milanese Maspes-Vigorelli: 40 biciclette e tanti ex campioni hanno celebrato il ritorno alla vita dell’anello che fu teatro delle sfide tra Coppi e Maspes (rif. foto d’apertura). Il velodromo Maspes-Vigorelli (conosciuto anche come il Vigorelli) è un impianto sportivo storico della città di Milano dedicato in origine al ciclismo su pista e oggi utilizzato principalmente per le partite di football americano. Il velodromo Vigorelli fu costruito nel 1935 in seguito alla demolizione dell’antiquato Velodromo Sempione (a sua volta costruito all’inizio del secolo). L’idea di costruire un velodromo semicoperto fu di Giuseppe Vigorelli, ex-corridore su pista, industriale e assessore allo sport al Comune di Milano nella giunta Luigi Mangiagalli. Il Vigorelli divenne fin dal principio teatro di importanti corse nonché frequentato da moltissimi spettatori appassionati, tuttavia nel corso dei decenni visse vicende alterne.
Alessia Venturi ipcm®
Il Velodromo continuò la sua attività sino al 1975, quando fu chiuso, per poi rinascere nel 1984. Sotto la nevicata del gennaio 1985 la tettoia che ricopre le tribune crolla sul parquet della pista: è l’inizio del declino dell’impianto. Dopo tre anni di attività ridotta, il Velodromo è definitivamente chiuso all’attività ciclistica nel gennaio del 1988. Parole, idee e promesse si susseguono nel corso degli anni, ma di volta in volta la mancanza di fondi o la priorità assegnata ad altri progetti distolgono l’attenzione dalle sorti del Vigorelli1. Fino al 2000 si susseguono sporadici eventi sportivi e parziali ristrutturazioni, fino alla chiusura definitiva nel 2001. Con il decreto n. 0010693 del 03110/2013 l’immobile del Vigorelli nel suo complesso, compresa la pista, è stato dichiarato di interesse © Vigorelli artistico e storico e di interesse storico-relazionale e storico-identitario ai sensi dell’art. 10, commi l e 3 del DLgs. 42/2004, dalla Direzione Regionale per i Beni Culturali e Paesaggistici della Lombardia. Dapprima oggetto di diversi “piani” di recupero, il più ambizioso dei quali prevedeva la creazione di un centro polifunzionale completo di museo e negozi, l’amministrazione comunale milanese ha poi optato per un restauro conservativo della struttura che prevede il completo ripristino con materiali originali dell’anello in legno, il ripristino della copertura metallica (fig. 1) tramite sabbiatura e verniciatura anticorrosiva, il rifacimento del campo sintetico e la riqualificazione di tribune e sottotribune (fig. 2). I lavori di ripristino del Vigorelli, in carico alla società CityLife Spa a scomputo di parte degli oneri di urbanizzazione dell’intervento di grande rilevanza urbana che sta sorgendo alle spalle del Vigorelli, sono stati affidati all’impresa di costruzioni Faggion Antonio
1 Source: www.vigorelli.eu
1 Fonte: www.vigorelli.eu
1
The condition of the roof before the makeover. Lo stato della copertura prima del suo rifacimento.
© Vigorelli
The Velodrome continued its activity until 1975, when it was closed, to then reopen in 1984. During the snowfall of January 1985, the roof over the stands collapsed on the parquet track, marking the beginning of its decline. After three years of reduced use, the Velodrome shut down its cycling activity in January 1988. Discussions, ideas and promises were tabled over the years that followed but each time a lack of funds or another project priority diverted attention from the fate of the Vigorelli1. Up until 2000 the Velodrome hosted events on a sporadic basis and underwent partial renovation until its definitive close in 2001. With decree no. 0010693 of 03110/2013 the entire Vigorelli structure, including the track, was declared of artistic and 1 historical, historicalrelational, and historicalidentity making interest in accordance with Art. 10, sub-paragraph 1 and 3 of Italian Law Decree 42/2004 by the Regional Office of Cultural and Landscape Heritage of Lombardy. Initially the Velodrome was targeted for several “recovery plans,” the most ambitious of which provided for the creation of a mixed-used facility including a museum, shops and municipal administrative offices. In the end, the decision was made to perform a conservative restoration of the structure, including a full renovation with original material form the wood track, overhaul of the metal roofing (Fig. 1) by sanding and application of anti-corrosive paint, the makeover of artificial turf and the renewal of the stands and areas under the stands (Fig. 2). 2 Works to restore the Vigorelli, managed by the company CityLife Spa as part of the agreement regarding the urbanization charges for the intervention of great urban relevance that is rising behind the Vigorelli, have been entrusted to
2
Beams and columns with completely deteriorated surface. Travi e colonne con il rivestimento completamente ammalorato.
ipcm® Protective Coatings - 2016 JUNE - N. 18
25
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
3
One of the columns after treatment performed by FES Sabbiature e Verniciature Srl with cycles provided by Fair Vernici, Hempel distributor for Lombardy. Una delle colonne dopo il trattamento eseguito dalla FES Sabbiature e Verniciature Srl con cicli forniti da Fair Vernici, distributore per la Lombardia di Hempel.
4
Panoramic view of the roof upon completion. In the background, the skyscrapers of the construction site City Life. Panoramica della copertura a fine lavori, sullo sfondo si notano i grattacieli del grande cantiere denominato CityLife.
26
the construction company Faggion Antonio Srl, Tezze sul Brenta (VI, Italy). The first lot of works regarding the overhaul of the roofing and of the hystoric wood track started in the first days of February 2016.
Srl di Tezze sul Brenta (VI). Il primo lotto di lavori riguardanti appunto il recupero della copertura e della storica pista in legno ha avuto inizio i primi giorni del mese di febbraio 2016.
Renewing the anti-corrosive protection of the Vignorelli’s roof
Ripristino della protezione anticorrosiva della copertura Vigorelli
Roof renovation works were one of the most complex parts of the Velodrome’s restoration project due both to the volume of surface involved – over 20,000 sq. m of iron from beams, columns (Fig. 3) and sheet metal – and the operating procedures, all performed on site and in the city centre near CityLife (Fig. 4), another big construction site. The current roof on the Velodrome dates back to 1990, when it was given a fully modern renovation for the time, including pillars and solid web beams, braced and set on pre-existing reinforced concrete structures and horizontal surfaces in waterproofed corrugated sheet metal. From visual inspections and surveys, the roof proved to be in good state of preservation despite practically no maintenance performed in the last decade, 3 the only problems being extended and uniform deterioration of the surface finish2. Works management thus called for a far-ranging maintenance intervention on the finishes over the whole surface of the roof (underneath the corrugated sheet 4 metal) and over the reachable surfaces of the visible structures.
Il lavoro di ripristino della copertura è stata una delle parti più complesse del piano di restauro del velodromo, sia per il volume della superficie da trattare - oltre 20.000 mq di ferro fra travi, colonne (fig. 3) e lamiera - sia per le modalità operative, tutte in cantiere e in centro città, nei pressi dell’altresì grande cantiere CityLife (fig. 4). L’attuale copertura del Velodromo risale al 1990, quando fu totalmente rifatta, con tipologia strutturale moderna per l’epoca, costituita da pilastri e travi ad anima piena, controventate e posate sulle strutture in cemento armato preesistenti e superficie orizzontale in lamiere grecate, impermeabilizzate superiormente. Dalle indagini visive e strumentali effettuate, è risultato che la copertura era, in rapporto alla manutenzione © ipcm pressoché nulla subita nell’ultimo decennio, in buone condizioni di conservazione, con problematiche di solo degrado della finitura estese ed uniformi2. La direzione lavori ha così previsto un intervento manutentivo pressoché totale sulle finiture che ricoprono l’intera su© ipcm perficie della copertura (piano inferiore delle lamiere grecate) e su tutte le superfici raggiungibili delle strutture visibili.
2 Source: General Project Report of the City of Milan Department of Sports
2 Fonte: Relazione Generale di Progetto dell’Assessorato allo Sport del Comune di Milano
N. 18 - 2016 JUNE - ipcm® Protective Coatings
5
The contract to perform these complex works within a precise timetable was assigned by the company Faggion Antonio Srl to FES Srl, owned by Massimo Farinon, one of the most dynamic and interesting coating applicators operating in the field of protective coatings, anti-corrosive coatings and fire retardants specialised in on-site projects (Figs. 5 and 6). FES Srl, based in Lonato del Garda (Brescia, Italy), has a special relationship with Hempel, a multinational manufacturer of anti-corrosive paints, and came up with a paint finish cycle best suited to the works management of the Vigorelli restoration. The company also created the samples and drew up the paint specifications in collaboration with Fair Vernici from Verano Brianza, the Hempel distributor for Lombardy. “Along with Massimo Farinon we devised a cycle of anti-corrosive coatings categorised as C4, high durability,” explains Saul Comalli, owner of Fair Vernici and Hempel agent for Lombardy and Veneto. “We proposed the application of a cycle with a total thickness of 240 micron, divided in 150 micron of primer surface tolerant - Hempadur Mastic 45880 and 90 micron of polyurethane finish - Hempatane 5561 in the colour specified by the architect.” “The project was executed in three months all on site by dividing the roof into sectors,” says Massimo Farinon of FES. “The rectilinear segment and the curves were divided into two parts each and every single sector was segmented and protected to limit the noise level of the works and to reduce the limited amount of dust from sanding. For sanding we decided to use an abrasive garnet that produces little residue. Qualitative sampling was performed on-site and in the presence of Fair Vernici who provided coating products and drew up the specifications.”
© FES
© FES
Alessia Venturi ipcm®
6
L’appalto per questo lavoro articolato e con tempistiche di realizzazione piuttosto ristrette è stato affidato dall’impresa Faggion Antonio Srl alla società FES Srl di Massimo Farinon, uno degli applicatori italiani più dinamici e interessanti, che opera nel settore dei rivestimenti protettivi, anticorrosivi, di protezione dal fuoco e che è specializzato in operazioni in cantiere (figg. 5 e 6). La società FES di Lonato del Garda (Brescia), ha una relazione privilegiata con Hempel, multinazionale produttrice di pitture anticorrosive, e si è incaricata di proporre il ciclo di verniciatura più adatto alla direzione lavori del restauro del Vigorelli, nonché di realizzare le campionature e stendere le specifiche di pitturazione in collaborazione con Fair Vernici di Verano Brianza, distributore per la Lombardia di Hempel. “Con Massimo Farinon abbiamo messo a punto un ciclo anticorrosivo in categoria C4 durabilità alta”, spiega Saul Comalli, titolare di Fair Vernici e agente Hempel per Lombardia e Veneto. “Abbiamo proposto l’applicazione di un ciclo con uno spessore totale di 240 micron, suddivisi fra 150 micron di primer surface tolerant - Hempadur Mastic 45880 - e 90 micron di finitura poliuretanica - Hempatane 5561 nel colore specificato dall’architetto progettista”. “Il lavoro è durato tre mesi ed è stato realizzato tutto in cantiere suddividendo la copertura in diversi settori”, interviene Massimo Farinon di FES. “Il rettilineo è stato diviso in due parti così come le curve e ogni settore è stato di volta in volta compartimentato e protetto per contenere la rumorosità delle operazioni e per abbattere la poca polvere derivante dalla sabbiatura, per cui abbiamo scelto di usare un abrasivo garnet che produce poco residuo”. “Tutti i rilevamenti qualitativi sono stati eseguiti on site a campione da noi e con la presenza di Fair Vernici che ha fornito i prodotti vernicianti e steso le specifiche”.
5
The sandblasting phase. La fase di sabbiatura. 6
The coating phase. La fase di verniciatura.
ipcm® Protective Coatings - 2016 JUNE - N. 18
27
© ipcm
© FES
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
7
8
7
The roof was treated with a cycle of a total 240 microns, divided between 150 microns of a primer surface tolerant - Hempadur Mastic 45880 – and 90 microns of polyurenthane finish Hempatane HS 5561. La copertura è stata trattata con un ciclo di 240 micron totali, suddivisi fra 150 micron di un primer surface tolerant Hempadur Mastic 45880 - e 90 micron di finitura poliuretanica Hempatane HS 5561. 8
The FES team at work during the intervention operations. La squadra di FES all’opera durante le operazioni di intervento.
28
FES performed also the surface preparation of the hystoric wood track, i.e. the microsanding of over 2,000 m2 of surface as well as the under track protection against infestation of xylophagous fungi, blue stain and decay by means of impregnation and encapsulation with appropriate wood coating systems.
FES si è anche occupata delle lavorazioni di preparazione superficiale della storica pista in legno, ossia delle operazioni di microsabbiatura per circa 2.000 mq di superficie, così come della protezione dell’intero sotto pista contro l’attacco di funghi xilofogi, fungo dell’azzurramento e della marcescenza attraverso impregnazione e incapsulamento con cicli appositi per legno.
Products used
I prodotti utilizzati
HEMPADUR MASTIC 45880 is a two-component polyamide epoxy product with a high content of solids and a thick application. It catalyses even at low temperatures by forming a compact and resistant coating with good properties of penetration. It is a selfpriming and surface tolerant that can be applied as an intermediate coating to be finished in cycles with a high mechanical resistance where the requirement is for a high build thickness and low emission of volatile substances. The product is exclusively applied to a dry and clean surface with a temperature higher than dew point to avoid the formation of condensation and only where the application and the catalysis take place at temperatures over - 5°/23°F, preferably over 0°C. The temperature of the paint must be 15°C or higher. For the Vigorelli cycle, the roof was painted over with HEMPATHANE HS 55610, a two-component acrylic polyurethane finish that catalyses with aliphatic isocyanate. It has good colour retention and gloss and contains zinc phosphates. As a finish with a high content of solids in compliance with C.O.V. standards, it is ideal for the protection of structural steel in a corrosive environment. It may be specified as a one coat “direct to metal” system in environments classified as C2 and C3, whereas in combination with the primer it has a durability of C4. This surface finish must be applied only to a dry and clean
HEMPADUR MASTIC 45880 è un prodotto bicomponente epossidico poliammidico addotto ad elevato contenuto di solidi, applicabile ad elevato spessore. Catalizza anche a basse temperature formando un rivestimento compatto e resistente, con buone proprietà di penetrazione. È un prodotto autoprimerizzante e surface tolerant applicabile come mano intermedia e a finire nei cicli ad alta resistenza meccanica, ove siano richiesti un elevato spessore e una bassa emissione di sostanze volatili. Il prodotto va applicato esclusivamente su una superficie asciutta e pulita con una temperatura superiore al punto di rugiada per evitare la formazione di condensa e solamente ove l’applicazione e la catalisi avvengono a temperature superiori a - 5°/23°F, preferibilmente superiore a 0°C. La temperatura della vernice deve essere pari a 15°C o superiore. Nel ciclo del Vigorelli, è stato sovraverniciato con HEMPATHANE HS 55610, una finitura bicomponente poliuretanica acrilica che catalizza con isocianato alifatico. Presenta una buona ritenzione del colore e della brillantezza e contiene fosfati di zinco. Come finitura ad elevato contenuto di solidi, conforme alla normativa C.O.V., è ideale per la protezione dell’acciaio strutturale in ambiente corrosivo. Può essere specificato come mano unica direttamente su metallo in ambienti classificati C2 e C3, mentre in combinazione con il primer raggiunge una durabilità C4. Questa finitura va applicata esclusivamente su una superfi-
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Alessia Venturi ipcm®
surface with a temperature over dew point to avoid the formation of condensation. The minimum temperature for catalysis is: -10°C/14°F. Corresponding to the freezing point and with lower temperatures, it is necessary to pay attention to the risk of ice formation on the surface, which prevents adhesion. The formation of film may be compromised by light rain, high humidity and/or condensation during application and during the interval following application: 24 hours, 20°C/68°F.
cie asciutta e pulita con una temperatura superiore al punto di rugiada per evitare la formazione di condensa. La temperatura minima per la catalisi è: -10°C/14°F. In corrispondenza del punto di congelamento e con temperature inferiori, è necessario fare attenzione al rischio di formazione del ghiaccio sulla superficie che impedisce l’adesione. La formazione del film può essere compromessa da pioggia leggera, elevata umidità e/o condensa durante l’applicazione e durante il seguente intervallo dopo l’applicazione: 24 ore, 20°C/68°F.
Conclusions
Conclusioni
In early June, works to the roof were completed along with the 397 metres of track (Fig. 7). The work sites will reopen now until May 2018 for the installation of the playing field, rooms and stands. “We are very satisfied with the work performed by FES,” states Eng. Paolo Mazzarolo, Technical Director of the site, Faggion Antonio Srl, “because the collaboration, the rapidly performed operations and the professionalism demonstrated by this company enabled us to succeed in achieving a great result and to comply with the schedule for project completion” (Fig. 8). ‹
Con l’inizio di giugno, sono terminati i lavori alla copertura e ai 397 metri di pista (fig. 7). Adesso i cantieri riapriranno fino a maggio 2018 per la sistemazione del campo da gioco, dei locali interni e delle tribune. “Siamo molto soddisfatti del lavoro eseguito da FES”, afferma il Direttore Tecnico del Cantiere, Ing. Paolo Mazzarolo, dell’impresa Faggion Antonio Srl, “poiché la collaborazione, la rapidità operativa e la professionalità dimostrata da questa azienda ci hanno consentito di raggiungere un ottimo risultato e di restare perfettamente nei tempi di realizzazione previsti dal progetto” (fig. 8). ‹
Your expectations
our solutions for infrastructure!
Coating. Bonding. Sealing. Efficiency and highest quality. www.wagner-group.com
ipcm® Protective Coatings - 2016 JUNE - N. 18
29
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
ANTI-CORROSION COATINGS AND STEEL PRODUCTION-PROCESSING Rivestimenti anticorrosivi e produzione-lavorazione dell’acciaio
© ipcm
S
Opening photo: a product coated entirely in ebonite. Foto d’apertura: un manufatto rivestito internamente in ebanite.
30
Steel in all its variants, forms and qualities is widely used in all fields of manufacturing. The transformation and finishing processes allow steel to come into our homes in the form of objects of daily use such as electrical appliances. Obviously, many processes are involved before obtaining the finished product. In the early phases of processing, the surface of the steel is cleaned with highly corrosive products, which by remaining in contact with the surface of the metal for a limited time, produce the desired effect of cleaning, deoxidization, degreasing and surface conversion. These treatments are performed in immersion plants with full vats of active baths that not only pre-treat the steel from which the different products will be manufactured, but also damage and corrode the steel of the containers if they are not suitably protected. A similar problem arises with storage tanks or steel components involved in the passage of fumes and acid vapours. The corrosive effect of mixes of products such as hydrochloric acid, sulphuric acid, hydrofluoric acid, etc. combined in different percentages and with variable operating temperatures is not something to underestimate. In these situations the linings produced and applied
N. 18 - 2016 JUNE - ipcm® Protective Coatings
L
’acciaio in tutte le sue varianti, forme e qualità è ampiamente utilizzato in tutti i campi produttivi. I processi di trasformazione e finitura consentono all’acciaio di arrivare nelle nostre case sotto forma di oggetti d’uso quotidiano, come gli elettrodomestici. Naturalmente, prima di ottenere il prodotto finito sono necessarie innumerevoli lavorazioni. Nelle prime fasi di trasformazione, ad esempio, si procede alla pulizia superficiale dell’acciaio con prodotti altamente corrosivi che, rimanendo a contatto con la superficie del metallo per un tempo limitato, generano l’effetto desiderato di pulizia, disossidazione, sgrassaggio o conversione superficiale. Questi trattamenti si effettuano in impianti ad immersione con vasche piene di bagni attivi in grado non solo di pretrattare l’acciaio da cui si deriveranno i diversi manufatti ma anche di attaccare e corrodere l’acciaio delle strutture stesse di contenimento, se non adeguatamente protette. Un problema analogo si presenta con i serbatoi di stoccaggio o i componenti in acciaio coinvolti dal passaggio di fumi e vapori acidi. L’effetto corrosivo di miscele di prodotti come acido cloridrico, solforico, fluoridrico ecc. combinati in diverse percentuali e con temperature d’esercizio variabili, non è da sottovalutare. In queste situazioni intervengono i rivestimenti prodot-
Luca Galimberti Pessina Angelo Srl, Fara Gera d’Adda (BG), Italy luca.galimberti@pessina.it
by Pessina Angelo Srl, with its wide choice of anti-corrosive treatments, offers a technically valid solution for protection that has been extensively tested, also in particularly critical cases. Pessina linings in graphite ebonite AP0018 or elastomer rubbers such as the Pessina chloroprene rubber AP158 or else the Pessina butyl rubber are an optimum solution to the problem and to be chosen according to the specific operating conditions and in collaboration with Pessina technicians (Ref. opening photo).
1
© ipcm
Product specifications
ti e applicati da Pessina Angelo Srl, che con la sua ampia scelta di trattamenti anticorrosivi propone una soluzione di protezione tecnicamente valida ed ampiamente collaudata anche in casi particolarmente critici. I rivestimenti in ebanite grafitata qualità Pessina AP0018 o le gomme elastomeriche come la gomma cloroprenica qualità Pessina AP158 o la gomma butilica qualità Pessina AP200 rappresentano un’ottima soluzione al problema, da scegliersi in funzione delle specifiche condizioni d’esercizio e in collaborazione con i tecnici Pessina (rif. foto d’apertura). © ipcm
Hard Rubber Graphite AP0018
Natural rubber, the raw material for the production of graphite ebonite AP0018. La gomma naturale, materia prima per la produzione di ebanite grafitata AP0018.
Specifiche di prodotto Ebanite Grafitata AP0018
Graphite ebonite made of natural rubber NR/IR with high characteristics of chemical resistance (Fig. 1). Used for over 40 years as 2 anticorrosive lining for plants that use inorganic acids or bases, seawater, suitable for hydrofluoric acid. Demolition fumes tower with operating temperature to 100°C (Fig. 2).
Ebanite grafitata a base di gomma naturale NR/ IR con elevate caratteristiche di resistenza chimica (fig. 1). Da oltre 40 anni utilizzata come lining anticorrosivo per impianti che utilizzano acidi o basi di natura inorganica, acqua di mare, idonea per acido fluoridrico. Torri abbattimento fumi con T di esercizio sino a 100° C (fig. 2).
Table 1: AP0018 tests of product characterization
Tabella 1: prove di caratterizzazione del prodotto AP0018
Technological characterization Colour Hardness (h) Tensile strength Elongation at break (ar) Density Adhesion to rigid substrates Mooney viscosity Abrasion resistance Test voltage each mm of lining thickness
1
Measure units
Test standards
Shore D MPa % gr/cm3 MPa ML 1+4 100° C mm3 Volt
ASTM D 2240 ASTM D 412 ASTM D 412 ASTM D 297 ASTM D 429 A ASTM D 1646 ASTM D 5963 BS 6374 part.5
2
Tanks awaiting treatment at Pessina Angelo Srl. Serbatoi in attesa del trattamento presso Pessina Angelo Srl.
Result Black silver 78 ± 5 24.0 3.8 1.26 ± 0.03 9.6 30 500 3000
ipcm® Protective Coatings - 2016 JUNE - N. 18
31
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
3
Preparation of tanks before later processing. La fase di preparazione dei serbatoi prima delle successive lavorazioni.
32
3
© ipcm
Vulcanization conditions: in autoclave with saturated steam at a temperature of about 140°C (standard cycle), under pressure in autoclave – we pressurize autoclave – with hot water under hydraulic force; chemical vulcanization at ambient temperature with auto vulcanization product. Recommended thickness is 4 mm but linings can be realized from 3 mm to a maximum of 10 mm. Resistance at maximum operating temperature is 100°C (this temperature depends on type of fluid); minimum temperature is 0°C. The design and construction of ebonite devices must comply with international standards (BS 6374 part. 5 – DIN 28051 – DIN 28053 – DIN 28055) and with Pessina internal procedure PS1701. Before proceeding with sandblasting it is necessary to control that metal surfaces are perfectly clean and dry. If contaminants such as grease, oil, dust, paint residues or others are on the surface, they must be removed prior to sandblasting because they can compromise the adhesion. The minimum degree of preparation is SSPC-SP10/ISO 8501-1 SA 2.5, whereas the grit-blasting profile is between 50 ÷ 85 μm (ISO 8503) (Fig. 3).
Condizioni di vulcanizzazione: in autoclave con vapore saturo alla temperatura di circa 140°C (ciclo standard), a pressione in autoclave - pressurizzando l’apparecchio con acqua calda sotto lieve battente idraulico; a freddo con catalisi chimica. Lo spessore raccomandato è di 4 mm ma si possono comunque realizzare rivestimenti personalizzati nello spessore da un minimo di 3 mm ad un massimo di 10 mm. Resistenza alla temperatura massima di esercizio è di 100°C (tale temperatura va valutata sulla base del tipo di fluido) mentre la temperatura minima è di 0°C. La progettazione e le costruzioni di apparecchiature ebanitate devono rispettare le normative internazionali (BS 6374 part. 5 – DIN 28051 – DIN 28053 – DIN 28055) nonché la procedura interna Pessina PS1701. Prima di procedere alla granigliatura è necessario assicurarsi che le superfici metalliche siano pulite ed asciutte. Se presenti su metallo inquinanti quali grasso, oli, sporcizia, residui di verniciatura od altri contaminanti questi devono essere rimossi prima della sabbiatura perché potrebbero compromettere l’adesione. Il grado di pulizia minimo richiesto è SSPC-SP10/ISO 8501-1 SA 2,5, mentre il profilo di granigliatura è compreso fra 50 ÷ 85 μm (ISO 8503) (fig. 3).
Polychloroprene Rubber AP158
Gomma Policloroprenica AP158
Polychloroprene rubber lining with high characteristics of chemical resistance. Used for over 35 years as anticorrosive lining for plants
Rivestimento in gomma policloroprenica con elevate caratteristiche di resistenza chimica. Da oltre 35 anni utilizzata come lining anticorrosivo per impianti che
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Luca Galimberti Pessina Angelo Srl, Fara Gera d’Adda (BG), Italy luca.galimberti@pessina.it
that use inorganic acids or bases, saline solution and demineralized water. Excellent resistance to seawater.
utilizzano acidi o basi di natura inorganica, soluzioni saline in genere, acqua demineralizzata. Ottima resistenza all’acqua di mare.
Table 2: AP158 tests of product characterization
Tabella 2: prove di caratterizzazione del prodotto AP158
Technological characterization Colour Hardness (h) Tensile strength Elongation at break (ar) Density Adhesion to rigid substrates Adhesion to rigid substrates Adhesion to rigid substrates Abrasion resistance Test voltage each mm of lining thickness Variation in weight after immersion in water at ambient temperature for 166 hours
Measure units
Test standard
Shore A MPa % gr/cm3 N / mm MPa mm/s for 25 mm of width under a load of 243 N mm3 Volt
ASTM D 2240 ASTM D 412 ASTM D 412 ASTM D 297 ASTM D 429 B ASTM D 429 A ASTM D 429 E Static Mass Method ASTM D 5963 BS 6374 part.5
%
ASTM D471
Vulcanization conditions: in the autoclave with saturated steam at about 140°C (standard cycle);
Result Dark grey 70 ± 5 12.5 660 1.33 ± 0.03 6 11 0.4 420 5000 <2
Condizioni di vulcanizzazione: in autoclave con vapore saturo alla temperatura di circa 140°C (ciclo standard);
VERNICIATURA, SIGILLATURA, INCOLLAGGIO Pistole a spruzzo manuali ed automatiche – EcoGun
www.verind.it
Eccellenti apparecchiature di applicazione per tutti i settori industriali, specifiche per prodotti vernicianti e prodotti ad alta viscosità ove è richiesta la protezione da corrosione, nonché la sigillatura e l’incollaggio.
ipcm® Protective Coatings - 2016 JUNE - N. 18
33
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY chemical vulcanization at ambient temperature with auto vulcanization product. Recommended thickness is 4 mm but customized linings can be realized from 3 mm to a maximum of 10 mm of thickness. Resistance at maximum operating temperature is 70°C (this temperature depends on type of fluid); minimum temperature is 0°C. The design and construction of ebonite devices must comply with international standards (EN 14879 - BS 6374 part. 5 – DIN 28051 – DIN 28053 – DIN 28055) and with Pessina internal procedure PS1701. Before proceeding with sandblasting it is necessary to control that metal surfaces are perfectly clean and dry. If contaminants such as grease, oil, dust, paint residues or others are on the surface, they must be removed prior to sandblasting because they can compromise the adhesion. The minimum degree of preparation is SSPC-SP10/ISO 8501-1 SA 2.5, whereas the grit-blasting profile is between 50 ÷ 85 μm (ISO 8503).
vulcanizzazione chimica a temperatura ambiente con prodotto autovulcanizzante. Lo spessore raccomandato è di 4 mm ma si possono comunque realizzare rivestimenti personalizzati nello spessore da un minimo di 3 mm ad un massimo di 10 mm. Resistenza alla temperatura massima di esercizio è di 70°C (tale temperatura va valutata sulla base del tipo di fluido) mentre la temperatura minima è di 0°C. La progettazione e le costruzioni di apparecchiature gommate devono rispettare le normative internazionali (EN 14879 - BS 6374 part. 5 – DIN 28051 – DIN 28053 – DIN 28055) nonché la nostra procedura PS1701. Prima di procedere alla granigliatura è necessario assicurarsi che le superfici metalliche siano pulite ed asciutte. Se presenti su metallo inquinanti quali grasso, oli, sporcizia, residui di verniciatura od altri contaminanti questi devono essere rimossi prima della sabbiatura perché potrebbero compromettere l’adesione. Il grado di pulizia minimo richiesto è SSPC-SP10/ISO 8501-1 SA 2,5, mentre il profilo di granigliatura è compreso fra 50 ÷ 85 μm (ISO 8503).
Butyl Rubber AP 200
Gomma Butile AP 200
Butyl rubber lining made of synthetic rubber type BIIR bromobutyl with high characteristics of chemical resistance. Used for over 20 years as anticorrosive lining for desulfonation plant, thermo-combustion of waste materials plants, felling fumes tower, plants with seawater, saline solutions.
Rivestimento in gomma butilica - a base di gomma sintetica tipo bromobutile BIIR con elevate caratteristiche di resistenza chimica. Da oltre 20 anni utilizzata come lining anticorrosivo per impianti di desolfonazione, impianti di termocombustione rifiuti, torri di abbattimento fumi, impianti con acqua di mare, soluzioni saline in genere.
Table 3: AP 200 tests of product characterization
Tabella 3: prove di caratterizzazione del prodotto AP 200
Technological characterization Colour
Measure units
Test standard
Result Dark grey
Hardness (h)
Shore A
ASTM D 2240
65 ± 5
Density
g/cm3
ASTM D 297
1.38 ± 0.03
Elongation at break (ar)
%
ASTM D 412
340
Tensile strength
MPa
ASTM D 412
6.11
Adhesion to rigid substrates
MPa
ASTM D 429 A
6
3
Abrasion resistance
mm
ASTM D5963
480
Test voltage each mm of lining thickness
Volt
BS 6374 part.5
3000
Vulcanization conditions: in the autoclave with saturated steam at about 140°C (standard cycle). Recommended thickness is 4 mm but customized linings can be realized from 3 mm to a maximum of 10 mm of thickness. 34
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Condizioni di vulcanizzazione: in autoclave con vapore saturo alla temperatura di circa 140°C (ciclo standard). Lo spessore raccomandato è di 4 mm ma si possono comunque realizzare rivestimenti personalizzati nello spessore da un minimo di 3 mm ad un massimo di 10 mm.
Luca Galimberti Pessina Angelo Srl, Fara Gera d’Adda (BG), Italy luca.galimberti@pessina.it
4
© ipcm
5
© Pessina Angelo Srl
Resistance at maximum operating temperature is 80°C (this temperature depends on type of fluid); minimum temperature is 0°C. Vulcanization: under pressure in autoclave – we pressurize autoclave – with hot water under hydraulic force; chemical vulcanization at ambient temperature with auto vulcanization product. The design and construction of rubber devices must comply with international standards (EN 14879 BS 6374 part. 5 – DIN 28051 – DIN 28053 – DIN 28055) and with Pessina internal procedure PS1701. Before proceeding with sandblasting it is necessary to control that metal surfaces are perfectly clean and dry. If contaminants such as grease, oil, dust, paint residues or others are on the surface, they must be removed prior to sandblasting because they can compromise the adhesion. The minimum degree of preparation is SSPC-SP10/ISO 8501-1 SA 2.5, whereas the grit-blasting profile is between 50 ÷ 85 μm (ISO 8503).
Resistenza alla temperatura massima di esercizio è di 80°C (tale temperatura va valutata sulla base del tipo di fluido) mentre la temperatura minima è di 0°C. Vulcanizzazione A pressione in autoclave - pressurizzando l’apparecchio - con acqua calda sotto lieve battente idraulico oppure a freddo con mescola autovulcanizzante – catalisi a temperatura ambiente. La progettazione e le costruzioni di apparecchiature gommate devono rispettare le normative internazionali (BS 6374 part. 5 – DIN 28051 – DIN 28053 – DIN 28055) nonché la nostra procedura PS1701. Prima di procedere alla granigliatura è necessario assicurarsi che le superfici metalliche siano pulite ed asciutte. Se presenti su metallo inquinanti quali: grasso, oli, sporcizia, residui di verniciatura od altri contaminanti questi devono essere rimossi prima della sabbiatura perché potrebbero compromettere l’adesione. Il grado di pulizia minimo richiesto è SSPC-SP10/ISO 8501-1 SA 2,5, mentre il profilo di granigliatura è compreso fra 50 ÷ 85 μm (ISO 8503).
Lining procedure
Procedura di rivestimento
Following are the main points that characterize the Pessina Angelo Srl processing cycles for anticorrosive linings: • definition of type of lining best suited to the specific case; • quality control (certified to UNI EN ISO 9001:2008) from delivery of the raw materials, to production of lining rolls through to all processing phases; • internal production of all materials that will be applied (formulated in-house at our laboratory) (Fig. 4);
Di seguito i punti salienti che caratterizzano i cicli di lavorazione della Pessina Angelo Srl per l’esecuzione dei rivestimenti anticorrosivi: • definizione del tipo di rivestimento più idoneo al singolo caso specifico; • controllo qualità (certificato UNI EN ISO 9001:2008) dal ricevimento delle materie prime, passando per la produzione dei rotoli di rivestimento, a tutte le fasi di lavorazione; • produzione interna di tutti i materiali che verranno applicati (formulati su nostra ricetta grazie al laboratorio interno) (fig. 4);
4
The lining material is produced in-house at Pessina Angelo Srl. Il materiale di rivestimento è prodotto all’interno di Pessina Angelo Srl. 5
Application of internal lining. L’applicazione del rivestimento interno.
ipcm® Protective Coatings - 2016 JUNE - N. 18
35
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY 6
Products are introduced into autoclaves for vulcanization of the ebonite and/or rubbers. I manufatti sono introdotti nelle autoclavi per la vulcanizzazione dell’ebanite e/o delle gomme.
6
36
© ipcm
• control of metal parts in accordance with our Pessina PS1701 internal procedure and with international standard; • control of environmental conditions; • sandblasting of metal parts with angular metallic grit (min. requirement SA 2½); • application of adhesives cycle; • application of anticorrosive lining (Fig. 5); • testing before vulcanization; • vulcanization in PLC-controlled autoclave with graphic display “parameters displayed: temperature – pressure – time” (Fig. 6); • lining finishing; • final testing and inspection (appearance, adhesion, hardness, dielectric test, thickness). All data are provided on the test certificate delivered in copy to the customer. • if requested, external painting will be performed. This procedure is performed entirely at the Pessina Angelo Srl factory, subjected to quality control with the supervision of a qualified FROSIO / NACE Level 3 in-house inspector (Fig. 7).
• controllo delle parti metalliche in accordo alla nostra procedura interna Pessina PS1701 oltre che alla normativa internazionale; • controllo delle condizioni ambientali; • sabbiatura delle parti metalliche con graniglia metallica di tipo angolosa (requisito minimo SA 2½); • applicazione del ciclo di adesivi; • applicazione del rivestimento anticorrosivo (fig. 5); • collaudi prima della vulcanizzazione; • vulcanizzazione in autoclave comandata da PLC, con elaborazione grafico “parametri riportati temperatura – pressione – tempo” (fig. 6); • finitura del rivestimento; • collaudi finali (aspetto visivo, adesione, durezza, controllo dielettrico, spessore). Tutti i dati sono poi riportati sul certificato di collaudo che verrà consegnato, in copia, al cliente. • se richiesto, si procede con l’attività di verniciatura esterna. Anche questa fase è svolta interamente presso lo stabilimento di Pessina Angelo Srl, in regime di controllo qualità, con la supervisione di un ispettore interno qualificato FROSIO / NACE di III Livello (fig. 7).
Conclusions
Conclusioni
The validity of the linings described above is proven by their extensive use in all steel manufacturing plants in Italy and abroad,
La validità dei rivestimenti sopra descritti è confermata dall’ampio utilizzo che ne viene fatto in tutti gli stabilimenti di produzione dell’acciaio presenti in Italia e all’estero, dai
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Luca Galimberti Pessina Angelo Srl, Fara Gera d’Adda (BG), Italy luca.galimberti@pessina.it
7
Pessina Angelo Srl also performs external painting at customer’s request. Pessina Angelo Srl esegue anche la verniciatura esterna se richiesta dal cliente.
7
from large-scale to small-scale plants such as cutting centres or small, customized pickling plants. Using Pessina Angelo Srl linings makes it possible to perform procedures directly at the facility where the plants will be installed in order to complete lining in correspondence with joints made in-situ or for later repair procedures. ‹
© Pessina Angelo Srl
grossi centri fino alle realtà più di dettaglio come i centri di taglio o i piccoli impianti di decapaggio personalizzati. L’utilizzo dei rivestimenti di Pessina Angelo Srl consente di eseguire anche interventi direttamente presso lo stabilimento finale di installazione degli impianti, sia per completare il rivestimento in corrispondenza di giunzioni eseguite in loco che per eventuali interventi successivi di riparazione. ‹
RIVESTIMENTI A RAPIDA ESSICCAZIONE t $JDMJ DPNQMFUJ QFS BNCJFOUJ EJGGFSFOUJ t &DDFMMFOUJ QSPQSJFUË BOUJDPSSPTJWF t 3BQJEB FTTJDDB[JPOF F CSFWJ JOUFSWBMMJ EJ SJDPQFSUVSB QFS JODSFNFOUBSF MB QSPEVUUJWJUË t .BOJQPMB[JPOF F USBTQPSUP QJá WFMPDJ DIF NBJ VIENNA INTERNATIONAL AIRPORT - Hanger nº 7 t "TTJTUFO[B UFDOJDB QSPGFTTJPOBMF REALISATION: 2012 - 2014 F TV NJTVSB hempel.it
COATING SYSTEM DESCRIPTION: HEMPADUR FAST DRY 17410 HEMPACORE ONE FD 43601 ipcm® Protective Coatings - 2016 JUNE - N. 18 37 HEMPATHANE 55210
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
© IBIX Srl
ROAD BRIDGE MAINTENANCE: THE LOMBARDO PASQUALE E FIGLI S.R.L. CASE STUDY Manutenzione dei ponti stradali: il caso studio ditta Lombardo Pasquale e Figli S.r.l.
O Opening picture: The construction company Lombardo Pasquale e Figli S.r.l. at work with IBIX technology. Foto d’apertura: l’impresa edile Lombardo Pasquale e Figli S.r.l. all’opera con tecnologie IBIX.
38
ne of the most widely employed IBIX applications regards metal treatment and stripping. This is also thanks to the fact that blasting allows to speed up some operations that would otherwise require a very long time or the use of substances that are aggressive and dangerous for operators. A fundamental characteristic in metal treatment is the compliance with international standards on surface processing (for instance, the Swedish standard on sandblasting SIS055900-1967). IBIX technology and IBIX Art ensure compliance with the SA 2 - 2 ½ standard for metal sandblasting in a short time and with absolutely consistent results. Moreover, by using IBIX technology it is possible to perform multiple operations with the same machine, with remarkable savings in terms of time and without further encumbrance getting in the way of
N. 18 - 2016 JUNE - ipcm® Protective Coatings
U
na delle applicazioni IBIX di più largo impiego riguarda il trattamento e la sverniciatura del metallo. Questo grazie al fatto che tramite l’aeroabrasione è possibile velocizzare alcune operazioni che altrimenti richiederebbero lunghi tempi di intervento o l’utilizzo di sostanze aggressive e pericolose per gli operatori. Caratteristica fondamentale nel trattamento del metallo è il raggiungimento degli standard internazionali in materia di preparazione delle superfici (per esempio, sabbiatura standard svedese SIS055900-1967). Le tecnologie IBIX, con l’uso di IBIX Art, garantiscono il raggiungimento dello standard SA 2 - 2 ½ per la sabbiatura del metallo in breve tempo e con una assoluta uniformità del risultato. Attraverso l’utilizzo delle tecnologie IBIX inoltre è possibile svolgere più operazioni con lo stesso macchinario, con un notevole risparmio di tempo e senza ingombri
Riccardo Gigli IBIX Srl, Santa Maria in Fabriago Lugo (RA), Italy info@ibix.it
ulteriori che possono rendere difficoltoso il lavoro in cantiere. Sono proprio queste le caratteristiche che hanno convinto l’impresa edile Lombardo Pasquale e Figli S.r.l. ad adottare le tecnologie IBIX per un importante lavoro di manutenzione (rif. foto d’apertura). L’impresa doveva operare la manutenzione di quattro differenti ponti in varie località dell’Emilia Romagna (fig. 1). Le operazioni avrebbero riguardato la sverniciatura di piloni in acciaio, la pulitura dei ferri di armatura delle strutture dove il calcestruzzo si era deteriorato e infine la riverniciatura e il trattamento anticorrosivo delle strutture in metallo e cemento. Dopo alcune prove, l’impresa ha deciso di adottare le tecnologie IBIX già nei lavori delle prime due strutture, fra Ca’ di Lugo e Santa Maria in Fabriago, nella provincia di Ravenna. Il capocantiere di Lombardo Pasquale e Figli S.r.l., Pasquale Cocomello, racconta così il procedere dei lavori: “Inizialmente ci siamo affidati a un’idrosabbiatrice in grado di operare a 250 bar di potenza. L’impiego dello strumento si è rivelato una spiacevole perdita di tempo: il macchinario si è, infatti, dimostrato del tutto inefficace sull’acciaio dei piloni. Le strutture erano piuttosto ammalorate. L’assenza di una vernice protettiva adeguata aveva lasciato spazio, nel corso del tempo, ad un persistente e tenace strato di ruggine che non veniva scalfito dalla sabbia e dall’acqua in pressione della pulitrice. L’altra ipotesi in campo era l’impiego di una sabbiatrice tradizionale, ma avevamo escluso dal principio questa soluzione a causa degli ingombri che il macchinario avrebbe determinato in cantiere. Avendo l’esigenza di lavorare su una piattaforma aerea sottoponte, manovrare macchine pesanti e di grandi dimen-
1
Maintenance work involved four bridges and different operations. I lavori di manutenzione hanno riguardato quattro ponti e diverse operazioni.
© IBIX Srl
production. These are the characteristics that convinced the developer Lombardo Pasquale e Figli S.r.l. to adopt IBIX technology solutions for an important and major maintenance project (Ref. opening picture). The company had to service four different bridges in various locations of Emilia Romagna (Italy) (Fig. 1). The operations consisted of steel pillars stripping, reinforcement rod cleaning in the parts where concrete had deteriorated and finally the coating and anti-corrosive treatment of metal and concrete structures. After some tests, the 1 company decided to adopt IBIX technology already for the first two projects, between Ca’ di Lugo and Santa Maria in Fabriago, near Ravenna (Italy). The foreman of Lombardo Pasquale e Figli S.r.l., Pasquale Cocomello, tells us how the works unfolded: “At the beginning we used a hydro sandblaster capable of operating at 250 bar. Using this tool turned out to be an unpleasant waste of time: indeed the machine proved to be utterly inefficient on steel pillars. The structure was quite damaged. The lack of a suitable protective coating had made way over time to a persistent and quite stubborn layer of rust, which effectively resisted the pressurised sand and water coming out of the sandblaster. The other option was the use of a traditional sandblaster, though we thought this could not work because of the encumbrance caused by such a machine in a construction site. Manoeuvring heavy and bulky machines could be a problem since we needed to work on a suspended platform under the bridge.
ipcm® Protective Coatings - 2016 JUNE - N. 18
39
2
3
2
Deteriorated concrete structure with exposed, rusted up reinforcement rods. Struttura in calcestruzzo deteriorata con i ferri di armatura scoperti arrugginiti. 3
Steel pillar stripping. Pulitura dei piloni in acciaio.
40
© IBIX Srl
© IBIX Srl
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
We started looking for other solutions and found out about IBIX. We were immediately impressed by the small size of the devices and therefore we set up a test to look into the efficacy of this method we didn’t know about. The result was excellent. Unlike the hydro sandblaster, IBIX technology turned out to be very effective”. Bridge maintenance implied a number of operations and the treatment of different surfaces. In some areas the reinforced concrete structure was deteriorated, leaving reinforcement rods exposed and completely rusty (Fig. 2). Therefore, we had to remove reinforced concrete residues from the damaged parts in order to clean the rods up until clean metal, and then restore the concrete layer and apply a protective coating. The rod cleaning operation was quite fast, both for getting rid of concrete residues and preparing the rods. This was a remarkable result since, done manually, these operations would have required a lot of time and work. Other operations involved steel pillar coat stripping and cleaning (Figs. 3 and 4) and the following coating with two layers of two-part epoxy primer. Other metal parts were supposed to be treated, such as the bridge parapets, which were also covered by a previous layer of rust-proof coating. To make things complicated, we needed to work on a suspended platform under the bridge (Fig. 5). Cocomello describes the operations: “We were immediately impressed by how handy the IBIX 60 machine is. The machine is very easy to move thanks
N. 18 - 2016 JUNE - ipcm® Protective Coatings
sioni sarebbe stato estremamente problematico per noi. Informandoci su altre possibili soluzioni, abbiamo scoperto IBIX. Siamo subito rimasti colpiti dalle dimensioni contenute delle apparecchiature, e questo ci ha convinto ad organizzare una prova per valutare l’efficacia di questo metodo che non conoscevamo. Il risultato è stato ottimale. Al contrario della idrosabbiatrice, la tecnologia IBIX si è dimostrata estremamente efficace”. La manutenzione del ponte prevedeva una serie di operazioni e il trattamento di differenti superfici. In alcune aree, la struttura in calcestruzzo appariva deteriorata lasciando scoperti i ferri di armatura che si erano completamente arrugginiti (fig. 2). Occorreva pertanto asportare i residui di calcestruzzo dalle parti danneggiate, ripulire i ferri fino al metallo bianco, ripristinare il calcestruzzo e stendere un protettivo. L’operazione di pulitura dei ferri è stata rapida, sia nell’eliminazione dei residui di cemento che nella preparazione dei ferri. Un risultato importante perché queste operazioni eseguite manualmente avrebbero richiesto molto tempo e lavoro. Altri interventi riguardavano la sverniciatura e la pulitura dei piloni in acciaio (figg. 3 e 4) e la successiva verniciatura su due strati con primer epossidico bicomponente. C’erano anche altre parti in metallo da trattare, come i parapetti del ponte, dove occorreva eliminare anche un precedente strato di antiruggine. A complicare le operazioni, la necessità di lavorare in sospensione, su una piattaforma area sottoponte (fig. 5). Cocomello descrive così le operazioni: “Siamo rimasti subito colpiti dalla grande maneggevolezza del macchinario IBIX 60. La macchina si sposta facilmente gra-
Riccardo Gigli IBIX Srl, Santa Maria in Fabriago Lugo (RA), Italy
to the wheels and once the working site has been prepared, the machine loaded and the compressor turned on, the equipment has quite a remarkable capacity and the operator no longer needs to set the system. A single operator can perform the treatment alone, while the length of the tube allows to operate by simply using the nozzle: this is of great help when working on a suspended platform”. “Another important characteristic”, continues Cocomello, “is the guaranteed performance. The IBIX eco sandblaster was quick at processing the steel surface of the pillars, where the hydro blaster used previously had turned out to be useless. Moreover, the machine proved to be very versatile: with the same device we cleaned the parapets and the reinforcement rods of the bridge. Another new feature in comparison with sandblasting as we know it is the material it uses in the process. The IBIX Art aggregate that was offered for the process is a material of mineral origin; it appears as a red coloured stone. This innovative material ensures unprecedented efficiency in combination with silica sand, without considering that it is environmentally friendly, does not contain silica, is not toxic or dangerous for operators and the environment”. “In conclusion”, states Cocomello, “IBIX was a great discovery: thanks to this technology we immediately solved those issues that were causing us delays and problems. Being practical, handy and versatile, it can really make a difference for specific operations, such as in the bridge maintenance project we were involved in”. ‹
© IBIX Srl
4
© IBIX Srl
info@ibix.it
5
zie alle ruote e una volta predisposta l’area di lavoro, caricata la macchina e acceso il compressore, la strumentazione garantisce un’ottima autonomia, senza dover più intervenire sui macchinari. Un solo operatore è sufficiente per realizzare il trattamento, mentre la lunghezza del tubo garantisce di poter operare movimentando solo la pistola: un’importante comodità quando si sta sospesi su una piattaforma”. “Un altro aspetto da sottolineare”, continua Cocomello, “è la resa garantita dal macchinario. La eco-sabbiatrice IBIX ha preparato velocemente le superfici in acciaio dei piloni, dove la idrosabbiatrice precedentemente utilizzata si era rivelata inutile. Il macchinario si è inoltre dimostrato versatile: con la stessa pulitrice abbiamo trattato i parapetti e i ferri d’armatura della struttura del ponte. Un’altra novità rispetto alla sabbiatura che conoscevamo è rappresentata dal materiale utilizzato per l’abrasione. L’inerte IBIX Art che ci è stato proposto per i trattamenti è un materiale di origine minerale che si presenta come una pietra di colore rosso. Questo innovativo abrasivo garantisce un’efficienza impensabile con sabbia silicea, senza contare che si tratta di un materiale ecologico, che non contiene silice e non è né tossico né pericoloso per l’ambiente e gli operatori”. “In conclusione”, afferma Cocomello, “IBIX è stata un’importante scoperta: grazie alle tecnologie che ci sono state proposte abbiamo subito risolto i problemi che stavano causando ritardi e disagi. Praticità, maneggevolezza e versatilità possono fare davvero la differenza in ambiti di intervento particolari, come nel caso dei ponti di cui abbiamo curato la manutenzione”. ‹
4
A single operator is required to use the machine IBIX 60. The length of the tube allows the operator to use the nozzle only. Per utilizzare la macchina IBIX 60 è sufficiente un solo operatore. La lunghezza del tubo garantisce di poter operare movimentando solo la pistola. 5
Operations on pillars took place on a suspended platform. Le operazioni relative ai piloni si sono svolte su una piattaforma in sospensione.
ipcm® Protective Coatings - 2016 JUNE - N. 18
41
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
© Belzona
OVER 500 FLANGES PROTECTED WITH NEW ENCAPSULATING TECHNOLOGY Oltre 500 flange protette con una nuova tecnologia di incapsulamento
O Opening Picture: Flange damaged by corrosion. Foto d’apertura: flangia danneggiata dalla corrosione.
42
ver the years, the repair and maintenance industry has employed many different techniques to combat the problem of flange corrosion (Ref. Opening Picture). Conventional paints, mechanical covers and clamps, polymer tapes, hot-melt thermoplastics, polymer bags with VCIs all offer solutions to protect flanges from corrosion, but they are not without their drawbacks. These techniques can be costly and complicated to install, and can also fail to provide the level of corrosion resistance required to successfully protect flanges and pipework within harsh environments.
N. 18 - 2016 JUNE - ipcm® Protective Coatings
N
el corso degli anni, il settore della riparazione e della manutenzione ha utilizzato diverse tecniche per combattere il problema della corrosione delle flange (rif. foto d’apertura). Vernici convenzionali, coperture meccaniche ed elementi di fissaggio, nastri polimerici, materiali termoplastici a caldo, sacchi in polimero con tecnologia VCI: si tratta di soluzioni per proteggere le flange dalla corrosione che presentano però degli svantaggi. Queste tecnologie possono essere costose e complesse da installare, e possono inoltre non essere in grado di offrire il livello di resistenza alla corrosione necessario per proteggere con successo flange e tubi in ambienti severi.
Chloe Hirst Belzona Polymerics Ltd, Harrogate, UK
1
© Belzona
© Belzona
msilva@belzona.com
1
2 2
Surface prepared, Belzona 8411 applied and bolt caps installed on a flange.
Application of first coat of Belzona 3411.
Superficie preparata, Belzona 8411 applicato e cappucci installati sui bulloni.
Applicazione del primo strato di Belzona 3411.
Indeed, due to the cost and time implications of deploying a specialist application team to reinstall a spray protection system on hundreds of flanges at a gas supplier in Oman, the owner sought an alternative solution that would bypass these expenses, as well as the lengthy downtime that would be incurred.
Infatti, a causa delle implicazioni in fatto di costi e tempo nell’utilizzo di una squadra di applicazione specializzata per reinstallare un sistema di protezione a spruzzo su centinaia di flange presso un fornitore di gas in Oman, il proprietario ha trovato una soluzione alternativa per aggirare queste spese e i lunghi tempi di fermo che si sarebbero verificati altrimenti.
Corrosion-resistant system overcomes drawbacks of conventional methods
Sistema resistente alla corrosione supera gli svantaggi dei metodi convenzionali
As Belzona 3411 (Encapsulating Membrane) facilitates a quick and simple installation and inspection method-which can be completed with minimal manpower by the company’s own maintenance staff, the gas supplier decided to commission this system for the protection over 500 flanges on the site. Following an inspection by Belzona representatives, this flexible and peelable coating was chosen as it will completely encapsulate the several hundred flanges no matter the size or shape, protecting them from moisture as well as crevice, galvanic and atmospheric corrosion. When used in conjunction with the corrosion inhibitor Belzona 8411, the brush and cold applied system will successfully fortify the flanges with long-term corrosion protection. In terms of inspection, this solvent free coating can be easily cut and peeled back to allow access to fastenings and on completion of the maintenance work, it can simply be reinstated with the application of a further layer of material.
Poiché Belzona 3411 (Encapsulating Membrane) favorisce un’installazione rapida e semplice nonché un metodo di ispezione che può essere completato con una forza lavoro minima dallo staff manutentivo dell’azienda stessa, il fornitore di gas ha deciso di commissionare questo sistema per la protezione di più di 500 flange sul sito. In seguito a un’ispezione dei rappresentanti di Belzona, è stato scelto questo rivestimento flessibile e pelabile che avrebbe rivestito completamente le diverse centinaia di flange, indipendentemente dalla loro dimensione o forma, proteggendole da umidità, corrosione interstiziale, galvanica e atmosferica. Se utilizzato in combinazione con l’inibitore della corrosione Belzona 8411, il sistema applicato a pennello a freddo fortifica le flange contro la corrosione per un lungo periodo. In termini di ispezione, questo rivestimento privo di solvente può essere facilmente tagliato e rimosso per consentire l’accesso agli elementi di fissaggio e, per completare il lavoro di manutenzione, può essere ripristinato con l’applicazione di un ulteriore strato di materiale.
ipcm® Protective Coatings - 2016 JUNE - N. 18
43
© Belzona
PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY
© Belzona
3
5
4
© Belzona
6
© Belzona
3 4 5 6
Belzona 3411 successfully installed on over 500 flanges with different shapes and configurations. Belzona 3411 installato con successo su più di 500 flange con diverse forme e configurazioni.
44
Fast and simple application technique
Tecnica di applicazione veloce e semplice
1) Firstly, the surfaces were cleaned with Belzona 9111 (Cleaner Degreaser) and the surfaces were thoroughly abraded with abrasive paper to remove any gloss. Once surface preparation was completed, the bond area was degreased again with Belzona 9111. 2) To seal the gap between the flange faces, a strip of Belzona 9431 (Instant Bridging Tape) was used. Masking tape was applied over the two bond areas to protect these sections of pipe from accidental overspray of Belzona 8411. 3) Belzona 8411 was then applied onto the flange, pipe and fastenings ensuring the
1) In primo luogo, le superfici sono state pulite con Belzona 9111 (Cleaner Degreaser) e poi abrase a fondo con carta abrasiva per rimuovere qualsiasi patina. Una volta completata la preparazione della superficie, l’area di giunzione è stata sgrassata di nuovo con Belzona 9111. 2) Per sigillare il vuoto tra le facce delle flange, è stata utilizzata una striscia di Belzona 9431 (Instant Bridging Tape). È stato applicato un nastro di mascheratura sopra le due aree di giunzione per proteggere queste sezioni del tubo dall’accidentale overspray di Belzona 8411. 3) Belzona 8411 è stato in seguito applicato su flangia, tubo ed elementi di fissaggio assicurando che la co-
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Chloe Hirst Belzona Polymerics Ltd, Harrogate, UK msilva@belzona.com
film coverage was even and complete (Fig. 1). Once the Belzona 8411 was touch dry after one hour, the masking tape was removed and plastic caps were fitted over the nuts and bolts. A further strip of Belzona 9311 (Reinforcement Sheet) was applied to bridge the gap between the flange faces and two strips were applied to the bond area. 4) Belzona 3411 was mixed and using a short bristled brush, the material was applied over the area to be protected at a thickness between 30 and 40 mils (750-1000μ). While the first layer of Belzona 3411 (Fig. 2) was still wet, strips of Belzona 9311 (Reinforcement Sheet) were embedded into the Belzona 3411 around the flange circumference and at both ends of the repair where it bonds to the pipe to add strength to the system. 5) Once the first coat had cured after one hour, the second coat of Belzona 3411 was mixed and applied to the same thickness as the first coat (in grey colour) and was left to cure.
pertura del film fosse uniforme e completa (fig. 1). Trascorsa un’ora, con Belzona 8411 asciutto al tatto, il nastro di mascheratura è stato rimosso e sono stati applicati cappucci di plastica sui bulloni. È stata applicata un’ulteriore striscia di Belzona 9311 (Reinforcement Sheet) per riempire lo spazio tra le facce delle flange, mentre due strisce sono state applicate nell’area di giunzione. 4) Belzona 3411 è stato miscelato e, usando un pennello con setole corte, il materiale è stato applicato sull’area da proteggere con uno spessore tra 30 e 40 mils (750-1000μ). Mentre il primo strato di Belzona 3411 (fig. 2) era ancora bagnato, le strisce di Belzona 9311 (Reinforcement Sheet) sono state integrate in Belzona 3411, attorno alla circonferenza della flangia e a entrambe le estremità dell’area di riparazione dove si collega al tubo, per rafforzare il sistema protettivo. 5) Una volta asciutto il primo strato, dopo un’ora, è stato miscelato il secondo strato di Belzona 3411 e applicato con lo stesso spessore del primo (in colore grigio), lasciandolo a polimerizzare.
Peelable system facilitates easy inspection
Sistema pelabile per un’ispezione facile
Had the owner decided to use the previous spray applied system, this would have required a specialist application team to carry out the reinstallation. Not only would this have required significant financial expenditure to mobilise the installers, but this would have also incurred lengthy shutdowns and downtime, leading to further costs. The cold-applied Belzona flange protection system on the other hand, was able to protect the 520 flanges in just 45 days (Figs. 3, 4, 5 and 6), a fraction of the time that would have been required had the flanges been protected with the sprayable system. As Belzona 3411 enables simple inspection by just cutting the system at the flanged joint and peeling it back, this allows the company’s own maintenance staff to carry out any future inspection work. Maintenance staff can also reseal the flange protection themselves by simply adding a further layer of Belzona 3411, successfully eliminating the need to deploy specialist applicators and saving the company valuable downtime as well as capital expenditure. ‹
Se il proprietario avesse scelto di utilizzare il sistema precedente applicato a spruzzo, sarebbe stata necessaria una squadra di applicazione specializzata per effettuare il ripristino. Questo non solo avrebbe comportato le spese di mobilitazione degli installatori, ma avrebbe comportato anche lunghi fermi impianto, aumentando i costi. Il sistema Belzona applicato a freddo, al contrario, è stato in grado di proteggere 520 flange in soli 45 giorni (figg. 3, 4, 5 e 6), una frazione del tempo altrimenti necessario a proteggere le flange con un sistema a spruzzo. Poiché Belzona 3411 consente ispezioni semplici, è lo staff di manutenzione stesso dell’azienda che può effettuare tutte le ispezioni future semplicemente tagliando il sistema al giunto flangiato e rimuovendolo. Inoltre, lo staff manutentivo può risigillare la protezione della flangia aggiungendo semplicemente un ulteriore strato di Belzona 3411, eliminando così favorevolmente il bisogno di ingaggiare applicatori specializzati e risparmiando all’azienda costi in termini di fermo impianto e denaro. ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
45
PROTECTIVE COATINGS | INNOVATIONS
©Oerlikon Metco
AN INTRODUCTION TO THERMAL SPRAY – PART 4 Introduzione alla termospruzzatura – Parte 4
T
his is the Part 4 of a four-part article. The previous parts were published in ipcm®_ Protective Coatings n. 15 (October 2015), ipcm®_Protective Coatings n. 16 (December 2015) and ipcm®_Protective Coatings n. 17 (April 2016).
Q
uesta è la quarta parte di un articolo suddiviso in quattro capitoli. I capitoli precedenti sono stati pubblicati rispettivamente in ipcm®_Protective Coatings n. 15 (Ottobrer 2015), ipcm®_Protective Coatings n. 16 (Dicembre 2015) e ipcm®_Protective Coatings n. 17 (Aprile 2016).
3 Applications In order to use thermal sprayed coatings to get the best advantage, the coating material has to be properly selected, the coating process has to be chosen and the process parameters developed. Also, the component to be coated has to be correctly dimensioned for coating. The preferred geometries for coatings are disks, flat panels and rotationally symmetrical components, as illustrated in Figure 14.
3 Applicazioni Per utilizzare al meglio i riporti termospruzzati è necessario selezionare il corretto materiale di rivestimento, scegliere il processo applicativo più appropriato e svilupparne i parametri. Inoltre, il componente da rivestire deve essere correttamente dimensionato per il rivestimento. Le geometrie preferite per i rivestimenti sono dischi, superfici piane e componenti a simmetria rotazionale, come illustrato in figura 14.
3.1 Production Applications 3.1 Applicazioni di produzione 3.1.1 Hard Chrome Alternative Because of growing requirements for environmental protection, plating shops are subject to ever tougher restrictions. As an 46
N. 18 - 2016 JUNE - ipcm® Protective Coatings
3.1.1 Alternativa alla cromatura dura I rivestimenti HVOF termospruzzati possono essere utilizzati in alternativa alla cromatura dura come pro-
Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com
14
Favorable coating geometries for coating.
14
alternative to hard chrome plating, thermal spray coatings can be used to provide wear and corrosion protection. Both pure chrome and various carbide coatings can be used [5]. In order to achieve corrosion resistance as close as possible to that of chrome plate, the high velocity oxy-fuel process is used. The characteristics of HVOF coatings, in part, exceed those of chrome plate, however, to obtain the reflective surface appearance of hard chrome plating the coating can be ground and lapped. Examples of applications where thermal spray is used to replace hard chrome plate are: Components of landing gear for airplanes; pistons of hydraulic cylinders used on earth moving vehicles; etc. Figure 15 shows a WC/CoCr coated nose landing gear of an F5 Tiger.
©Oerlikon Metco
Geometrie di rivestimento preferite.
tezione antiusura e anticorrosione utilizzando rivestimenti metallici e vari tipi di carburo [5]. In parte, le caratteristiche dei rivestimenti HVOF superano quelle della cromatura e i loro tempi di applicazione sono in genere significativamente inferiori. L’aspetto superficiale riflettente della cromatura dura può essere ottenuto levigando e lappando il rivestimento HVOF. Un esempio di applicazione dove la spruzzatura termica è utilizzata per sostituire la cromatura dura sono i componenti dei carrelli di atterraggio dei velivoli, come illustrato nella figura 15. 3.1.2 Protesi medicali Per un ancoraggio robusto e duraturo delle protesi ortopediche, come l’articolazione artificiale dell’anca, la finitura superficiale è di grande importanza. I riporti Metco™PLANT di Oerlikon Metco, applicati utilizzan-
ipcm® Protective Coatings - 2016 JUNE - N. 18
47
15
15
Nose gear of an F5 Tiger with a WC/CoCr coating. Carrello anteriore di un F5 Tiger con un rivestimento WC/CoCr. 16
Biocompatible titanium coating, Metco™PLANT, on a hip implant. Rivestimento Metco™PLANT in titanio biocompatibile su protesi d’anca.
3.1.2 Medical Implants For strong and durable anchoring of orthopedic implants, such as artificial hip joints, surface finish is of great importance. Coatings, applied using the vacuum plasma process, are purposely sprayed with a very fissured surface that allows the bone to grow into it. There are coatings, Metco™PLANT, that act as a biocompatible titanium coating (Fig. 16), or bioactive hydroxyapatite coatings, wh ich actively accelerates the growth of the natural bone into the surface of the prosthesis. 3.1.3 Textile Machinery Metco™TEX Coatings for textile machinery components were developed as the result of many years of cooperation with textile machinery manufacturers. These coatings are characterized by a precise definition of the morphology produced using various handling methods and the topology of the surface. The surface texture is of particular importance for production components in contact with thread. In order to maximize fiber production,
16
© Oerlikon Metco
© Oerlikon Metco
PROTECTIVE COATINGS | INNOVATIONS
do il processo al plasma in camera a bassa pressione e atmosfera controllata, sono intenzionalmente spruzzati con una superficie molto fessurata che consente la crescita dell’osso al suo interno. Esistono rivestimenti Metco™PLANT che sono riporti di titanio biocompatibile (fig. 16), oppure rivestimenti bioattivi di idrossiapatite, che accelerano attivamente la crescita dell’osso naturale sulla superficie della protesi. 3.1.3 Macchine tessili I riporti Metco™TEX sono il risultato di molti anni di collaborazione con i produttori di macchine tessili. Questi rivestimenti sono caratterizzati da una precisa definizione della morfologia prodotta, utilizzando diversi metodi di movimentazione e la topologia della superficie. La struttura della superficie è di particolare importanza per i componenti di macchine a contatto con i filati. Per massimizzare la produzione di fibre si utilizzano rivestimenti di ossidi ceramici, solitamente con uno strato ancorante di una lega di nichel che fornisce protezione contro la corrosione. La figura 17 illustra alcuni esempi di applicazione.
17
Various textile machinery components.
Coated gas turbine vanes. Palette rivestite di turbina a gas.
48
17
N. 18 - 2016 JUNE - ipcm® Protective Coatings
18
© Oerlikon Metco
18
© Oerlikon Metco
Diversi componenti di macchine tessili.
Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com
coatings of ceramic oxides are used, usually with a nickel bond coat that provides corrosion protection. Sample applications are represented in Figure 17.
3.1.4 Turbine a gas Per le turbine a gas, sia aeronautiche che per la produzione d’energia, i rivestimenti termospruzzati si utilizzano in molte posizioni e per molte funzioni diverse. Rivestimenti protettivi per resistere alla corrosione ad alta temperatura, rivestimenti per isolamento termico, rivestimenti per il controllo dei giochi e per la riparazione di componenti in superlega con materiali di composizione analoga sono solo alcuni esempi (fig. 18).
3.1.4 Gas Turbines In both stationary and flight gas turbines, thermal sprayed coatings are used in many different places and for many different functions. Protective coatings for high temperature corrosion resistance, thermally insulating coatings, clearance control coatings and the repair of superalloy components with coatings of similar composition are just some examples (Fig. 18).
3.1.5 Industria grafica I rulli e i cilindri rivestiti hanno ampio utilizzo nelle macchine per la stampa. In collaborazione con i clienti del settore carta e stampa, sono stati realizzati numerosi rivestimenti Metco™PRINT. I rivestimenti di ossido di cromo applicati mediante spruzzatura al plasma sui rulli inchiostratori (Anilox) presentano una microstruttura molto fine che può essere successivamente incisa al laser per produrre un reticolo di cavità molto piccole e di elevata densità lineare (fig. 19).
3.1.5 Printing Industry Coated rollers and cylinders are used extensively for printing machinery. In partnership with customers from the paper and printing industry, several Metco™PRINT coatings types were developed. Plasma sprayed chrome oxide coatings for inking rollers exhibit very fine microstructures, which can then be laser engraved with a very small and tight pattern (Fig. 19).
World Leaders
Have Responsibilities Too!
• Surface Preparation
A
• Concrete Reinforcement Protection
N
R
L
E
V
C
E
• Water Based Coatings • P ES ROTECT • PR
E
• Equipment Preservation
Cortec ® provides environmentally safe corrosion protection solutions.
www.CortecVCI.com D
A QU
LI TY
TE SYST EM REGIS
EN
SY ©
Cortec Corporation 2011
ST
VIRO
NMENT
AL
EM REGISTER
ED
RE
4119 White Bear Parkway St. Paul, MN 55110 651-429-1100 • 800-426-7832 info@cortecvci.com 49
ipcm® Protective Coatings - 2016 JUNE - N. 18
© Oerlikon Metco
© Oerlikon Metco
PROTECTIVE COATINGS | INNOVATIONS
19
20
19
20
Anilox printing roll with a laser engraved Metco™PRINT coating.
Bearing shaft with a babbitt coating.
Rullo di stampa Anilox con rivestimento Metco™PRINT inciso al laser.
Albero di supporto con rivestimento in metallo bianco antifrizione.
3.1.6 General Industrial Uses The largest variety of applications is for machinery industry. Figure 20 shows a bearing shaft coated with a Babbitt coating used in cement plants. This special, particularly porous coating is designed for oil lubrication, providing a reservoir to prevent seizure. Other examples of applications are piston rings for diesel engines, piston rods in compressors, pump bearings, valve covers, etc.
3.1.6 Usi industriali generali La più ampia varietà di applicazioni riguarda le macchine industriali. La figura 20 illustra un albero di supporto rivestito con metallo antifrizione, utilizzato nei cementifici. Questo rivestimento speciale, particolarmente poroso, è stato sviluppato per facilitare la lubrificazione a olio, poiché agisce da serbatoio per prevenire il grippaggio. Altri esempi di applicazione sono le fasce elastiche per i motori diesel, le bielle nei compressori, i cuscinetti nelle pompe, i copri-valvola, ecc.
3.1.7 Consumer Goods Although most uses for thermal spray coatings were developed for very specialized components, there are also applications within the consumer goods industry. An iron sole plate, on which a ceramic coating was applied as protection from wear is shown in Figure 21. A coating of an antistick material is subsequently applied. Similar coatings are also applied to non-stick frying pans.
3.1.7 Beni di consumo Sebbene la maggior parte degli utilizzi dei rivestimenti termospruzzati siano stati sviluppati per componenti specialistici, esistono anche applicazioni nell’ambito del settore dei beni di consumo. Nella figura 21 è illustrata una piastra di ferro da stiro sulla quale è stato applicato un rivestimento ceramico come protezione antiusura. Successivamente è applicato un materiale antiaderente. Analoghi rivestimenti antiaderenti sono applicati anche alle padelle.
3.1.8 Automotive Industry Next to the coating of numerous small parts, the newest break-through development of Oerlikon Metco are the coatings for aluminum engine blocks. The cylinder bores of the engines are coated by means of a special rotating plasma gun manipulator (Fig. 22), which can apply the coating to the interior of the small bores with a wear resistant surface. 50
N. 18 - 2016 JUNE - ipcm® Protective Coatings
3.1.8 Settore automobilistico Oltre al rivestimento di molti componenti di piccole dimensioni, la nuova frontiera applicativa per Oerlikon Metco è costituita dai rivestimenti sui blocchi motore in alluminio. Le canne cilindro dei motori sono rivestite grazie a uno speciale manipolatore, che permette di far ruotare la pistola plasma (fig. 22) in modo da depositare un riporto antiusura all’interno dei fori.
Oerlikon Metco Wohlen, Switzerland
© Oerlikon Metco
23
© Oerlikon Metco
21
© Oerlikon Metco
info.metco@oerlikon.com
22
© Oerlikon Metco
24 21
22
23
Coated household steam iron soleplate.
Dual-RotaPlasma™.
HVOF coating of a sink roll.
Dual-RotaPlasma™.
Piastra rivestita di un ferro da stiro a vapore per uso domestico.
Rivestimento HVOF di un rullo sommerso per linea di produzione lamiera galvanizzata. 24
Metco™CAL coating after superfinishing.
3.1.9 Steel Industry The rolls used in the steel industry must withstand very heavy thermal loads generated by the hot steel. In addition to the heat it has to be considered the slag generated during the steel production as well as the corrosive attack from molten zinc in the galvanizing lines. Several different Metco™STEEL coatings have been qualified for use on both new parts and repair applications. (Fig. 23).
3.1.9 Industria siderurgica I rulli utilizzati nel settore della lavorazione dell’acciaio devono gestire carichi termici molto pesanti causati dall’acciaio caldo che vi scorre sopra. Inoltre, devono essere considerate le scorie derivanti dal processo di produzione dell’acciaio e, nella produzione dello zinco, l’attacco corrosivo dello zinco fuso. Numerosi sistemi di rivestimento Metco™STEEL sono stati qualificati per l’impiego sia su componenti nuovi sia per le riparazioni (fig. 23).
Rivestimento Metco™CAL dopo la superfinitura.
ipcm® Protective Coatings - 2016 JUNE - N. 18
51
© Oerlikon Metco
PROTECTIVE COATINGS | INNOVATIONS
25
25
Combustion Chamber. Camera di combustione. 26
Repair procedure. Procedura di riparazione.
26
3.1.10 Paper Industry Rollers in the paper industry are subject to the most diverse operating environments, including wear, chemical attack from dyes, thermal stress on heated rollers and mechanical stress from doctor blades. At the same time, they must exhibit a high surface finish as long as possible. Metco™CAL coatings were developed to meet these requirements, particularly for calendar rolls (Fig. 24). 3.1.11 Aerospace Besides those components already mentioned for gas turbines, there are additional coatings used on airplanes. Figure 25 shows a coating on the interior of a combustion chamber of a jet engine. 3.2 Salvage and Restoration Thermal spray can be used also in repair procedures (Fig. 26) to restore components to their original dimensions. The coatings can be finished by turning, grinding and honing to the final size and roughness. Ni-Cr, Ni-Al or NiCr-Al are used as repair materials for alloyed steels. Many other compositions can be selected according to the required surface properties and the acceptable finishing methods.
4 Summary With thermal spray, probably more than any other coating technology, there is almost no limitation in the number of options available for 52
N. 18 - 2016 JUNE - ipcm® Protective Coatings
© Oerlikon Metco
3.1.10 Industria della carta I rulli nell’industria cartaria sono esposti ai più svariati ambienti operativi che comportano usura, attacco chimico da parte delle tinture, sollecitazione termica sui rulli riscaldati e sollecitazione meccanica indotta dalle lame raschiatrici e pattinatrici. Al contempo, devono presentare una finitura superficiale elevata per la massima durata possibile. I rivestimenti Metco™CAL sono stati sviluppati per soddisfare questi requisiti, in particolare per i rulli di calandra (fig. 24). 3.1.11 Settore aerospaziale Oltre ai componenti già citati per le turbine a gas, sui velivoli si utilizzano molti altri rivestimenti. La figura 25 illustra un riporto ceramico all’interno di una camera di combustione. 3.2 Recupero e ripristino La spruzzatura termica può essere utilizzata anche per ripristinare le dimensioni originali dei componenti (fig. 26). I rivestimenti possono essere torniti o rettificati alla dimensione finale. Ni-Cr, Ni-Al o Ni-Cr-Al sono utilizzati come materiali di riparazione per gli acciai legati.
4 Riepilogo Con la spruzzatura termica, probabilmente più che con qualsiasi altro processo di rivestimento, non esistono praticamente limiti al numero di opzioni disponibili per le combinazioni di substrato e materiale di rivestimento. I rivestimenti applicati me-
Oerlikon Metco Wohlen, Switzerland
Nome indirizzo
info.metco@oerlikon.com
substrate and coating material combinations. As a result, thermal spray coatings lend themselves to a broad scope of applications, both for the manufacturing of new components and for repair. The characteristics of the coatings can be varied within a wide range to suit specific application requirements. However, this implies many years of experience and the know-how of specialists. ‹
Literature references [1] DIN EN 657; Thermal Spray – Begriffe, Einteilung; Beuth-Verlag, Berlin (1994) [2] H.D. Steffens, J. Wilden: “Moderne Beschichtungsverfahren”, DGM-Verlag, ISBN 3-88355223-2, (1996) [3] P. Huber: “Vakuumplasmaspritzen”, Oberfläche surface, 10 (1992), 8 [4] H. Simon, M. Thoma: “Angewandte Oberflächentechnik für metallische Werkstoffe”, Hanser-Verlag, München (1985) [5] E. Lugscheider. H. Reymann: “Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiss-und Korrosionsschutz”, Schweissen und Schneiden, 50 (1998), 44 [6] DIN 50600; Metallographische Gefügebilder, Beuth-Verlag, Berlin DIN EN 582 Ermittlung der Haftzugfestigkeit, Beuth-Verlag, Berlin (1994) DIN EN 10109 Teil 1; Härteprüfung, Beuth-Verlag, Berlin (1995) DVS 2310 Teil 2; Anleitung zur Schliffherstellung, DVS, Düsseldorf, (1989)
diante spruzzatura termica risultano pertanto utilizzabili in una vasta gamma di applicazioni, sia per la fabbricazione di componenti nuovi sia le riparazioni. Per soddisfare requisiti specifici per l’applicazione di interesse, le caratteristiche dei rivestimenti possono essere variate entro un ampio intervallo. Questo presuppone, tuttavia, una consolidata esperienza e il know-how di specialisti. ‹
Riferimenti bibliografici [1] DIN EN 657; Thermal Spray – Begriffe, Einteilung; Beuth-Verlag, Berlin (1994) [2] H.D. Steffens, J. Wilden: “Moderne Beschichtungsverfahren”, DGM-Verlag, ISBN 3-88355223-2, (1996) [3] P. Huber: “Vakuumplasmaspritzen”, Oberfläche surface, 10 (1992), 8 [4] H. Simon, M. Thoma: “Angewandte Oberflächentechnik für metallische Werkstoffe”, Hanser-Verlag, München (1985) [5] E. Lugscheider. H. Reymann: “Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiss-und Korrosionsschutz”, Schweissen und Schneiden, 50 (1998), 44 [6] DIN 50600; Metallographische Gefügebilder, Beuth-Verlag, Berlin DIN EN 582 Ermittlung der Haftzugfestigkeit, Beuth-Verlag, Berlin (1994) DIN EN 10109 Teil 1; Härteprüfung, Beuth-Verlag, Berlin (1995) DVS 2310 Teil 2; Anleitung zur Schliffherstellung, DVS, Düsseldorf, (1989)
ipcm® Protective Coatings - 2016 JUNE - N. 18
53
PROTECTIVE COATINGS | INNOVATIONS
© Belzona
PREVENTING CHEMICAL SPILLS BY PROTECTING SECONDARY CONTAINMENT AREAS: CHEMICAL RESISTANT CRACK-BRIDGING TECHNOLOGY Prevenire il versamento di sostanze chimiche proteggendo le aree di contenimento secondario: tecnologia di crack-bridging resistente agli agenti chimici
T
Opening picture: Buncefield fire Foto d’apertura: l’incendio di Buncefield.
54
anks and drums containing hazardous and flammable liquids require secondary and tertiary protection to prevent potential accidents, such as the Buncefield fire in 2006 (Ref. Opening Picture). Lessons learned from that accident were translated into effective and practical guidance that industry would implement as rapidly as possible. This guidance, titled “Safety and environmental standards for fuel storage sites” (Part 42, p 16), suggests that insufficient secondary containment contributed to the accident progression and states: “Bund wall and floor construction and penetration joints should be leak-tight. Surfaces should be free from any cracks, discontinuities and joint failures that may allow relatively unhindered liquid trans-boundary migration. As a priority, existing bunds should be checked and any damage or disrepair, which may render the structure less than leak-tight, should be remedied.”
N. 18 - 2016 JUNE - ipcm® Protective Coatings
S
erbatoi e fusti contenenti liquidi pericolosi e infiammabili richiedono una protezione secondaria e terziaria per prevenire potenziali incidenti, come l’incendio di Buncefield del 2006 (rif. foto d’apertura). Le lezioni imparate da quell’incidente si sono tradotte in una guida pratica efficace che l’industria ha implementato il più rapidamente possibile. Questa guida, intitolata “Standard di sicurezza e ambientali per i siti di stoccaggio del combustibile” (parte 42, p. 16), suggerisce che un contenimento secondario insufficiente ha contribuito all’evolversi dell’incidente e dichiara: “Il bacino di contenimento, la pavimentazione e i giunti devono essere a tenuta stagna. Le superfici dovrebbero essere prive di fratture, discontinuità e giunzioni danneggiate che possano far tracimare i liquidi relativamente senza ostacoli. Come priorità, i contenimenti già costruiti dovrebbero essere controllati e ogni danno o stato di degrado che possa inficiarne la tenuta stagna dovrebbe essere riparato”.
Marina Silva Belzona Polymerics Ltd, Harrogate, UK msilva@belzona.com
The EU Seveso II Directive holds a database of reported chemical related accidents and near misses of its member organisations. In July 1999, 16.561 tonnes of 30% solution of sodium cyanide at a top-tier COMAH site was released through a leak in the tank to its bund. Of that quantity only 4.260 tonnes were recovered with the remaining material lost to the ground and water. Recommendation again called for improvements to the secondary containment area. The entry does not state what level of protection this bund had if any, but it can be assumed that since three quarters of the leaked material escaped the bund, the protection was either not there, its chemical resistance was insufficient, or this protection developed cracks allowing for the chemicals to seep through the bund.
La direttiva Seveso II dell’Unione Europea contiene un database degli incidenti e dei potenziali incidenti conosciuti dei suoi membri relativi alle sostanze chimiche. A luglio 1999, presso un sito COMAH top-tier, 16.561 tonnellate di una soluzione di cianuro di sodio al 30% è stata rilasciata attraverso una perdita del serbatoio e ha raggiunto il bacino di contenimento. Del totale, soltanto 4.260 tonnellate sono state recuperate, mentre il materiale restante si è disperso nella terra e nell’acqua. Anche in questo caso, erano stati raccomandati interventi di miglioramento dell’area di contenimento secondario. La nota non dichiara quale fosse il livello di protezione (e se ce ne fosse alcuna) del bacino di contenimento ma, poiché tre quarti del materiale fuoriuscito l’hanno superato, è possibile presumere che non ci fosse alcuna protezione, che la sua resistenza chimica non fosse sufficiente oppure che nella protezione si fossero sviluppate fratture consentendo alle sostanze di filtrare attraverso il bacino.
National Codes of Practice Following dangerous occurrences varying in scale from minor near misses to those with catastrophic consequences, many countries have adopted codes of practice directed at installing and maintaining suitable secondary containment. US Environmental Protection Agency (EPA) for instance refers to stationary tank bunds in the Resource Conservation and Recovery Act (RCRA) Subpart J, Tank Systems (40 CFR 264. 193). “Secondary containment systems must be: (b, 1) Designed, installed, and operated to prevent any migration of wastes or accumulated liquid out of the system to the soil, ground water, or surface water at any time during the use of the tank system; and (b, 2) Capable of detecting and collecting releases and accumulated liquids until the collected material is removed.” To meet these requirements, the secondary containment area must be: (C, 1) “Constructed of or lined with materials that are compatible with the waste(s) to be placed in the tank system […]” and (e, 1, iii) “free of cracks or gaps”. In the UK, Control of Pollutions Regulations 2001 also states that “the container must be situated within a secondary containment system which satisfies the following requirements […] (c) its base and walls must be impermeable […]”. Secondary containment areas are typically constructed using concrete, because it is cost-effective and provides good structural strength. However, due to its porosity, concrete can be easily permeated and has poor chemical resistance, making it susceptible to deterioration through chemical attack. In addition, concrete is highly prone to cracking due to substrate movement and freeze-thaw cycles.
Codici di regolamentazione nazionali A seguito di pericolosi accadimenti, variabili in una scala da incidenti minori, incidenti sfiorati fino a incidenti con conseguenze catastrofiche, molti Paesi hanno adottato dei codici di regolamentazione diretti all’installazione e alla manutenzione di un contenimento secondario adeguato. L’agenzia statunitense Environmental Protection Agency (EPA), per esempio, fa riferimento ai bacini per cisterne fisse nel Resource Conservation and Recovery Act (RCRA, Subpart J, Tank Systems, 40 CFR 264. 193). “I sistemi di contenimento secondari devono essere: (b, 1) Progettati, installati e utilizzati per prevenire la migrazione di scorie o liquidi accumulati fuori dal sistema fino a terreno, falde acquifere, acque superficiali, in ogni momento in cui la cisterna sia utilizzata”; e (b, 2) “In grado di rilevare e raccogliere perdite e liquidi accumulati finché il materiale raccolto non sia rimosso”. Per soddisfare questi requisiti, l’area di contenimento secondaria deve essere: (C, 1) “Costituita oppure rivestita con materiali compatibili con le scorie presenti nel sistema di stoccaggio […]” e (e, 1, iii) “priva di fratture o aperture”. Nel Regno Unito, la normativa del 2001, Control of Pollutions Regulations, dichiara inoltre che “il contenitore deve essere situato all’interno di un sistema secondario di contenimento che soddisfi i seguenti requisiti […] (c) la sua base e le sue pareti devono essere impermeabili […]”. Le aree di contenimento secondarie sono solitamente costruite in cemento, poiché è efficiente dal punto di vista dei costi e offre una buona resistenza strutturale. Tuttavia, a causa della sua porosità, il cemento può essere facilmente permeato e ha una bassa resistenza chimica, fattore che lo rende suscettibile al deterioramento per attacco chimico. Inoltre, il cemento si frattura facilmente a causa del movimento del substrato e dei cicli di congelamento-scongelamento.
ipcm® Protective Coatings - 2016 JUNE - N. 18
55
1
1
Crack in concrete. Una frattura nel cemento. 2
ASTM D412 testing. Test ASTM D412.
56
© Belzona
© Belzona
PROTECTIVE COATINGS | INNOVATIONS
2
Barrier Coatings for Secondary Containment Areas
I rivestimenti-barriera per le aree di contenimento secondarie
As concrete does not address the requirement for chemical resistance, an additional barrier atop is needed to prevent potential spillages from permeating the secondary containment area. Over the years, a variety of solutions have been trialled, from bitumen based paints to epoxy resin based systems. The right solution would depend on the type of media stored within the tank, size of the containment area, expected traffic and weather conditions, among others. Where the highest chemical resistance is required in case of extremely aggressive chemicals, such as concentrated mineral acids, alkali, amines and alcohols; solvent-free epoxy novolac resin based coatings are typically specified. The drawback of these coatings, however, has long been associated with the very feature that made them chemically resistant their rigidity. The chemical reaction between the base and solidifier creates an almost impenetrable “physical barrier”. Subsequently, once hardened and cured, these epoxy systems become completely liquid-impermeable and will have excellent resistance to immersion and exposure to a wide range of oil and chemical spillages. Rigidity of these coatings, however, also makes them inflexible and not best suited for heavy trafficked areas or in cases where the underlying concrete develops cracks. Concrete can develop cracks for many reasons, from excessive loading, to thermal expansion/ contraction or during freeze/thaw cycles, which lead
Poiché il cemento non risponde al requisito di resistenza chimica, è necessario che su di esso sia presente un’ulteriore barriera per prevenire che potenziali fuoriuscite permeino l’area di contenimento secondario. Nel corso degli anni sono state testate diverse soluzioni, dalle vernici a base di bitume fino ai sistemi con resine epossidiche. La soluzione corretta dipende, per esempio, dal tipo di sostanza stoccata all’interno del serbatoio, dalla dimensione dell’area di contenimento, dal traffico e dalle condizioni metereologiche previste. Laddove è necessaria una resistenza chimica elevata, in caso di stoccaggio di sostanze chimiche estremamente aggressive come acidi minerali concentrati, alcali, ammine e alcoli, sono solitamente specificati rivestimenti a base di resine epossidiche novolac privi di solvente. Lo svantaggio di questi rivestimenti, tuttavia, è stato a lungo associato proprio con la caratteristica che li rende resistenti agli attacchi chimici: la loro rigidità. La reazione chimica tra la base e il solidificatore crea una “barriera fisica” quasi impenetrabile. Di conseguenza, una volta induriti e polimerizzati, questi sistemi epossidici diventano completamente impermeabili ai liquidi e possiedono un’eccellente resistenza all’immersione e all’esposizione a un’ampia gamma di versamenti, da oli a sostanze chimiche. La rigidità di questi rivestimenti, tuttavia, li rende anche non flessibili e inadatti ad aree altamente trafficate, o nei casi in cui il cemento sottostante sviluppi fratture. Il cemento può sviluppare fratture per molte ragioni: dal carico eccessivo, all’espansione/contrazione termica o durante i cicli di congelamento/scongelamento, che portano
N. 18 - 2016 JUNE - ipcm® Protective Coatings
Marina Silva Belzona Polymerics Ltd, Harrogate, UK msilva@belzona.com
to the concrete’s movement and settlement (Fig. 1). A rigid coating would crack with the concrete, thus terminating chemical protection in case of a spill. Recent advancements in polymer technology have resulted in the development of a hybrid epoxy coating, which combines high cross-linking with rubbery domains in the polymer chain, giving the coating a desired degree of flexibility.
al movimento e assestamento del cemento (fig. 1). Un rivestimento rigido, quindi, si fratturerebbe insieme al cemento ponendo fine alla protezione chimica in caso di versamento. I recenti progressi nella tecnologia dei polimeri hanno portato allo sviluppo di un rivestimento epossidico ibrido, che unisce un’elevata reticolazione con domini gommosi nella catena polimerica, dando alla soluzione il grado desiderato di flessibilità .
New Material Development
Nuovo materiale sviluppato
One of the recently introduced coatings to successfully incorporate these features comes from Belzona Polymerics Ltd and is known as Belzona 4361. To determine the coating’s crack-bridging abilities, Belzona 4361 was first tested for elongation, measured in accordance with ASTM D412. When cured at 20°C/68°F, Belzona 4361’s residual elongation was recorded at 20%, which would be sufficient to bridge a typical crack. To ensure the coating maintains its flexibility at low temperatures, a mandrel bend test in accordance with ASTM D552 was also performed (Fig. 2), resulting in a pass at temperatures down to 0°C/32°F.
Uno dei rivestimenti recentemente introdotti per incorporare con successo queste caratteristiche è di Belzona Polymerics Ltd, conosciuto con il nome di Belzona 4361. Per determinare le capacità di crack-bridging del rivestimento, questa soluzione è stata sottoposta per prima cosa al test di allungamento, misurato secondo lo standard ASTM D412. Quando polimerizza a 20°C/68°F, l’allungamento residuo di Belzona 4361 è stato valutato al 20%, sufficiente a coprire una frattura tipica. Per assicurare che il rivestimento mantenga la sua flessibilità a basse temperature, è stata eseguita anche la prova di piegatura con mandrino secondo lo standard ASTM D552 (fig. 2), superata a temperature inferiori a 0°C/32°F.
The world‘s leading expo for wind energy 27 – 30 SEPTEMBER 2016 Teaming up with
WindEnergy Hamburg is the global meeting point for onshore and offshore experts. The combination of the world’s leading expo for wind energy in conjunction with WindEurope‘s leading industry conference represents a one-stop shop for business, QHWZRUNLQJ SROLF\PDNHUV DQG WKH VFLHQWLĂ€F FRPPXQLW\ 6DYH WKH GDWH in co-operation with
ipcmÂŽ Protective Coatings - 2016 JUNE - N. 18
57
3
3
Containment area. Area di contenimento. 4
Bund protected with Belzona 4361. Bacino protetto con Belzona 4361.
58
4
To further test this coating’s crack-bridging abilities, Belzona 4361 was submitted for a long-term testing at the University of Stuttgart, Germany. The university carries out testing to award a German Federal Water Act (WHG) Approval which is part of a German water law for protecting surface water and groundwater. Only chemical containment coatings with WHG Approval can be used in areas where strict regulations are in place, in order to protect ground water against chemical pollutants. The testing takes two years to complete and consists of a combination of crack-bridging, chemical resistance and aging tests. Crack-bridging tests are first performed by creating a crack within the concrete and ensuring the coating remains intact. This is followed by chemical resistance testing where the chemical is positioned onto the test coating so that the crack in the concrete is directly underneath. Signs of chemical attack are visually observed, in particular to see if the chemical reagent attacks the test coating severely enough to penetrate through the crack due to the reduction in film thickness over the crack. To replicate real life exposure or aging, the coated test blocks are stored in damp sand and placed outdoors. After six months and two years respectively of aging exposure, crack-bridging and chemical resistance tests are repeated. Belzona 4361 passed the crack-bridging and chemical resistance tests after six months of aging exposure, which will be repeated again to complete the two year’s testing. WHG presents rigorous independent testing and the results will be equally relevant in Europe and globally. Chemical resistance was tested by coating rods and immersing them in specified chemicals for a period of up to 12 months.
N. 18 - 2016 JUNE - ipcm® Protective Coatings
© Belzona
© Belzona
PROTECTIVE COATINGS | INNOVATIONS
Per testare ulteriormente le capacità di questo rivestimento crack-bridging, Belzona 4361 è stato sottoposto a una prova a lungo termine presso l’Università di Stoccarda, Germania. L’università effettua le prove per assegnare la certificazione tedesca Federal Water Act (WHG), parte della legge tedesca per la protezione dell’acqua di superficie e delle falde acquifere. Soltanto i rivestimenti per il contenimento chimico con la certificazione WHG possono essere utilizzati nelle aree con regolamentazioni severe, con l’obiettivo di proteggere le falde dagli inquinanti chimici. Il test è stato completato in 2 anni e consiste in una combinazione di crack-bridging, resistenza chimica e prove d’invecchiamento. Le prove di crack-bridging sono eseguite per prime con la creazione di una frattura all’interno del cemento e verificando che il rivestimento resti intatto. Questo test è seguito dalle prove di resistenza chimica, nelle quali delle sostanze sono posizionate sul rivestimento campione in modo che la frattura nel cemento si trovi esattamente sotto. Si possono così osservare visivamente i segni di attacco chimico, in particolare per vedere se il reagente attacca abbastanza duramente il campione fino a penetrare attraverso la frattura a causa della diminuzione dello spessore del film al di sopra di essa. Per replicare l’esposizione reale o l’invecchiamento, i blocchi di prova rivestiti sono stoccati in sabbia umida e posti all’esterno. Dopo rispettivamente sei mesi e due anni di esposizione all’invecchiamento, i test di crack-bridging e resistenza chimica sono stati ripetuti. Belzona 4361 ha superato le prove di crackbridging e resistenza chimica dopo 6 mesi di esposizione all’invecchiamento, che saranno ripetute per completare la prova di due anni. WHG effettua test indipendenti rigorosi e i risultati sono validi allo stesso modo in Europa e nel resto del mondo. La resistenza chimica è stata testata rivestendo delle barre e immergendole in specifiche sostanze chimiche per un periodo fino a 12 mesi.
Marina Silva Belzona Polymerics Ltd, Harrogate, UK msilva@belzona.com
Table 1 illustrates obtained results for some of the tested chemicals.
La tabella 1 illustra i risultati ottenuti con alcune delle sostanze utilizzate nelle prove.
Table 1. Chemical Resistance of Belzona 4361
Tabella 1: resistenza chimica di Belzona 4361
Chemical
Belzona 4361 length of resistance
93% Sulphuric Acid
52 weeks and beyond
37% Hydrochloric Acid
52 weeks and beyond
43% Phosphoric Acid
4 weeks
25% Phosphoric Acid
39 weeks
10% Acetic Acid
1 week
2% Acetic Acid
52 weeks and beyond
25% Ammonia
4 weeks
Ethyl Acetate
52 weeks and beyond
Ethanolamine
1 week
Oil, Petrol and Diesel
52 weeks and beyond
Ethanol
52 weeks and beyond
Methanol
17 weeks
The coating is perfectly suitable to resist aggressive chemicals, as protection is only required to last until the leaked chemical can be recovered from the bund. Best practice reports in some countries do not specify a universal length of time the coating needs to resist the spilled chemical and some documents state 72 hours as an acceptable length of protection, see the U.S Environmental Protection Agency proposal, 40 CFR 112.7(c).
Il rivestimento è perfettamente adeguato per resistere alle sostanze chimiche aggressive, poiché la protezione deve durare soltanto fino a quando il versamento è stato recuperato dal bacino. In alcuni Paesi, i rapporti sulle best practice non specificano in modo universale il periodo di resistenza del rivestimento alle sostanze, mentre alcuni documenti riportano 72 ore come una durata di protezione accettabile (U.S Environmental Protection Agency proposal, 40 CFR 112.7(c)).
Chemical Protection in Action
Protezione chimica in azione
Following its introduction in 2015, Belzona 4361 has been applied to protect the most critical assets. A secondary containment area in a Missouri, U.S. power plant was coated with Belzona 4361 after the existing chemical protection had failed. The bund in place to contain spillages from a 93% sulphuric acid tank (Fig. 3) experienced splashes, spills and poor clean-up procedures, in addition to movement which resulted in small gaps forming between the floor and bottom of the wall inside the containment area. The power station has already been using a variety of Belzona materials ever since six years ago Belzona Gateway Inc, the local Belzona Distributor, solved a major leak problem bringing their water treatment plant back in service. It then came as no surprise that this long standing customer turned to their local Belzona representative for a solution. After assessing the problem, Belzona Gateway proposed to use Belzona 4361 due to its excellent chemical resistance, flexibility and good adhesion facilitating long-term sealing between the bund’s wall and floor
A seguito della sua introduzione nel 2015, Belzona 4361 è stato applicato per proteggere gli asset più critici. In Missouri (USA), l’area di contenimento secondario di una centrale elettrica è stata verniciata con Belzona 4361 dopo il fallimento del precedente sistema di protezione dalle sostanze chimiche. Il bacino di contenimento, installato per contenere i versamenti di un serbatoio di acido solforico al 93% (fig. 3), ha mostrato perdite, versamenti e procedure di pulizia insufficienti, oltre a movimenti che hanno causato la formazione di piccoli vuoti tra il pavimento e il fondo della parete all’interno dell’area di contenimento. La centrale elettrica utilizzava diversi prodotti Belzona già da 6 anni, quando Belzona Gateway Inc, il distributore locale di Belzona, aveva risolto un grave problema di versamento riportando in servizio il loro impianto di trattamento delle acque. Non è dunque una sorpresa se questo cliente di lungo corso si è rivolto al rappresentante locale di Belzona per una soluzione. Dopo aver valutato il problema, Belzona Gateway ha proposto l’utilizzo di Belzona 4361 per le sue eccellenti caratteristiche di resistenza chimica, flessibilità e buona adesio-
ipcm® Protective Coatings - 2016 JUNE - N. 18
59
PROTECTIVE COATINGS | INNOVATIONS
© Belzona
5
Acid tanks, outer view. Serbatoi di acido, esterno.
5
(Fig. 4). The application was carried out in March 2015 and inspected recently, revealing that the Belzona protection was fully intact. 100% solids epoxy materials adhere well not only to concrete, but can be successfully used to protect a metal substrate from the chemicals. Added flexibility of the coating expands and contracts in sympathy with the underlying metal substrate. This second case study comes from China, where Belzona 4361’s chemical resistance and flexibility were put to the test when it was used to line two acid tanks at an oil field’s power plant (Fig. 5). The acid tanks contain 37% hydrochloric acid and were previously protected with an elastomer lining. In winter, when the plant transferred the hydrochloric acid from cold environment (<-0°C/32°F) to room temperature (>20°C/68°F), the dramatic temperature change caused the existing elastomer lining to crack and, as a result, the tanks started leaking. Belzona 4361 was used to line two tanks in October 2015 (Fig. 6) and the client requested another two tanks to be coated in 2016. Utilising coatings which provide chemical resistance as well as crack-bridging ability is crucial to both comply with relevant standards and to guarantee lasting protection from spills. As the industry keeps improving the safety of their operations, material manufacturers need to keep up and continue to innovate by utilising novel raw materials. Of course, provision of an adequate 60
N. 18 - 2016 JUNE - ipcm® Protective Coatings
ne, che facilitano la sigillatura a lungo termine tra la parete e il pavimento del bacino (fig. 4). L’applicazione è stata effettuata nel marzo 2015 e ispezionata recentemente: la protezione di Belzona era ancora completamente intatta. I materiali epossidici 100% solidi aderiscono bene al cemento ma posso essere usati con successo anche per proteggere le superfici in metallo dalle sostanze chimiche. Il rivestimento flessibile si espande e contrae insieme al metallo che ricopre. Il secondo caso di successo viene dalla Cina, dove la flessibilità e la resistenza di Belzona 4361 sono stati messi alla prova quando il prodotto è stato usato per rivestire due serbatoi di acido in una centrale elettrica a petrolio (fig. 5). I serbatoi di acido contengono acido cloridrico al 37% e in precedenza erano stati protetti con un rivestimento elastomerico. In inverno, quando l’impianto ha trasferito l’acido cloridrico dall’ambiente freddo (<-0°C/32°F) a temperatura ambiente (>20°C/68°F), lo sbalzo drastico di temperatura ha causato la frattura del rivestimento elastomerico, causando la fuoriuscita di materiale dai serbatoi. Belzona 4361 è stato usato per rivestire questi serbatoi a ottobre 2015 (fig. 6), e il cliente ha richiesto il rivestimento di altri due serbatoi per il 2016. L’utilizzo di rivestimenti che offrono sia resistenza chimica sia proprietà di crack-bridging è cruciale sia per essere conformi agli standard più importanti sia per garantire una protezione duratura contro le perdite. Mentre l’industria continua a migliorare la sicurezza delle operazioni, i produttori di materiali devono stare al passo e continuare a innovare utilizzando
Marina Silva Belzona Polymerics Ltd, Harrogate, UK msilva@belzona.com
6
Belzona 4361 applied.
© Belzona
Belzona 4361 applicato.
6
secondary containment area is only one of the many improvements that can be done to manage hazards and minimise risks. Some of the other areas to consider include system automation and software, with leak detection technologies and alarm sounding. Such systems can dramatically reduce human error, which was found to be a major contributing factor in the progression of several accidents described in the Seveso Directive. Enhancing safety protocols will ultimately ensure that accidents such as Buncefield do not happen again. ‹
nuove materie prime. Naturalmente, disporre di un’area di contenimento secondario è soltanto uno dei miglioramenti che si possono effettuare per gestire i pericoli e minimizzare i rischi. Alcune tra le altre aree da considerare includono i sistemi di automazione e i software, con tecnologie di rilevamento delle perdite e allarmi sonori. Sistemi come questi possono ridurre drasticamente l’errore umano, una delle cause principali di diversi incidenti descritti nella Direttiva Seveso. Il miglioramento dei protocolli di sicurezza assicurerà infine che incidenti come quello di Buncefield non accadano di nuovo. ‹
References:
References:
1. Broder, M.F., Technical Report: Building a Secondary Containment System, United States, Tennessee Valley Autority, 1994 2. Rivers, K., Buncefield Standards Task Group Final Report: Safety and Environmental Standards for Fuel Storage Sites, http://www.hse.gov.uk/comah/buncefield/ bstgfinalreport.pdf, 2007 (Accessed on 1 January 2016) 3. European Commission, The Seveso Directive, http://ec.europa.eu/environment/ seveso/, 2015 (Accessed on 10 December 2015) 4. 40 CFR 264.193 – Containment and Detection of Releases, https://www.law. cornell.edu/cfr/text/40/264.193, 2015 (Accessed on 20 December 2015) 5. Grainger, W. W., Secondary Containment Requirements: Quick Tips, https://www. grainger.com/content/qt-secondarycontainment-requirements-182, 2015, (Accessed on 20 December 2015) 6. Water Resources, England, The Control of Pollution (Oil Storage) (England) Regulations 2001, http://www.legislation.gov.uk/uksi/2001/2954/pdfs/ uksi_20012954_en.pdf, 2001, (Accessed on 20 December 2015) 7. NCC Bund Lining, Bund Lining Materials, http://www.bundlining.co.uk/ BundLiningMaterials.html, 2014 (Accessed on 10 January 2016)
1. Broder, M.F., Technical Report: Building a Secondary Containment System, Stati Uniti, Tennessee Valley Autority, 1994 2. Rivers, K., Buncefield Standards Task Group Final Report: Safety and Environmental Standards for Fuel Storage Sites, http://www.hse.gov.uk/comah/buncefield/ bstgfinalreport.pdf, 2007 (accesso l’1 gennaio 2016) 3. Commissione Europea, The Seveso Directive, http://ec.europa.eu/environment/ seveso/, 2015 (accesso il 10 dicembre 2015) 4. 40 CFR 264.193 – Containment and Detection of Releases, https://www.law. cornell.edu/cfr/text/40/264.193, 2015 (accesso il 20 dicembre 2015) 5. Grainger, W. W., Secondary Containment Requirements: Quick Tips, https://www. grainger.com/content/qt-secondarycontainment-requirements-182, 2015, (accesso il 20 dicembre 2015) 6. Water Resources, Inghilterra, The Control of Pollution (Oil Storage) (England) Regulations 2001, http://www.legislation.gov.uk/uksi/2001/2954/pdfs/ uksi_20012954_en.pdf, 2001, (accesso il 20 dicembre 2015) 7. NCC Bund Lining, Bund Lining Materials, http://www.bundlining.co.uk/ BundLiningMaterials.html, 2014 (accesso il 10 gennaio 2016)
ipcm® Protective Coatings - 2016 JUNE - N. 18
61
PROTECTIVE COATINGS | EXHIBITIONS CALENDAR
JULY 2016
AUGUST 2016
OIL&GAS AFRICA Dar-es-Salaam, Tanzania July 07-09, 2016 www.expogr.com/tanzania/oilgas/
ISE ANNUAL MEETING The Hague, The Netherlands August 21-26, 2016 http://annual67.ise-online.org/
AFRICORR Midrand, South Africa July 25-29, 2016 www.africorr.org.za
ONS Stavanger, Norway August 29 - September 01, 2016 www.ons.no
SEPTEMBER 2016 NACE EGYPT CORROSION CONFERENCE Cairo, Egypt September 06-08, 2016 http://egyptcorrosion.nace.org
CORROSION TECHNOLOGY WEEK Houston, TX, USA September 25-29, 2016 http://ctw.nace.org
SMM HAMBURG Hamburg, Germany September 06-09, 2016 www.smm-hamburg.com
MCHT&SE Portorož, Slovenia September 26-28, 2016 www.mchtse2016.com
EUROCORR Montpellier, France September 11-15, 2016 www.eurocorr.org
Protective Coatings ®
media partner
TANK STORAGE ASIA Singapore September 27-28, 2016 www.easyfairs.com/events_216/tank-storage-asia-2016_82861/tank-storage-asia-2016_82862/
MARINTEC SOUTH AMERICA Rio de Janerio, Brazil September 19-21, 2016 http://marintecsa.com.br/en/
INTERNATIONAL PIPELINE EXPOSITION Calgari, Canada September 27-29, 2016 internationalpipelineexposition.com
CORRUS Moscow, Russia September 19-22, 2016 www.corrus.ru
WIND ENERGY Hamburg, Germany September 27-30, 2016 www.windenergyhamburg.com
OCTOBER 2016 OFFSHORE MARINTEC RUSSIA Saint Petersburg, Russia October 04-07, 2016 www.offshoremarintec-russia.com
SAOGE Dammam, Saudi Arabia October 17-19, 2016 www.saoge.org
KIOGE Almaty, Kazakhstan October 05-07, 2016 www.kioge.kz/en/
OFFSHORE KOREA Busan, Korea October 19-21, 2016 www.okkorea.org/eng
BRING ON THE HEAT CHINA Shanghai, China October 11-14, 2016 www.asiacoat.com/bothchina
RIO OIL&GAS Rio de Janeiro, Brazil October 24-27, 2016 www.riooilgas.com.br
NACC - NORTH AFRICAN COATINGS CONGRESS Casablanca, Morocco Protective October 12-13, 2016 Coatings media partner www.coatings-group.com/congress/nacc/ ®
62
N. 18 - 2016 JUNE - ipcm® Protective Coatings
OFFSHORE ENERGY Amsterdam, The Netherlands October 25-26, 2016 www.offshoreenergytoday.com
Protective Coatings ®
media partner
OCTOBER 2016 LATINCORR Mexico City, Mexico October 25-28, 2016 www.latincorr2016.com TMP - 5TH INTERNATIONAL CONFERENCE ON THERMOMECHANICAL PROCESSING Milan, Italy - October 26-28, 2016 www.aimnet.it/tmp2016.htm
NOVEMBER 2016 ADIPEC Abu Dhabi, UAE November 07-10, 2016 www.adipec.com CORROSION & PREVENTION Auckland, New Zealand November 13-16, 2016 http://acaconference.com.au IPTC INTERNATIONAL PETROLEUM TECHNOLOGY CONFERENCE Bangkok, Thailand November 14-16, 2016 www.iptcnet.org/2016 OGT EXPO Ashgabat, Turkmenistan November 15-17, 2016 www.ogtexpo.com TANK STORAGE GERMANY Protective Hamburg, Germany Coatings media partner November 16-17, 2016 www.easyfairs.com/events_216/tank-storagegermany-2016_84435/tank-storage-germany-2016_84436/ 速
MARINTEC INDONESIA Jakarta, Indonesia November 23-25, 2016 http://marintecindonesia.com VALVE WORLD EXPO D端sseldorf, Germany November 29 - December 01, 2016 www.valveworldexpo.com
Protective Coatings 速
media partner
OSEA ASIA Singapore November 29 - December 02, 2016 http://osea-asia.com SUBSEA ASIA Singapore November 29 - December 02, 2016 http://subseaasia.org
ipcm速 Protective Coatings - 2016 JUNE - N. 18
63
PROTECTIVE COATINGS | ZOOM ON EVENTS
LEADING GERMAN TANK STORAGE EVENT IS BACK WITH A BANG Il principale evento in Germania dedicato ai serbatoi di stoccaggio torna con una formula di successo
T
ank Storage Germany 2016, the leading event for the German bulk liquid storage industry, returns to The Hamburg Messe, Hamburg, on 16 & 17 November. The show brings together over 80 suppliers and a dedicated audience of decision makers and senior buyers, all looking to attend the highly anticipated conference programme and source the latest in tank storage solutions. Nick Powell, StocExpo & Tank Storage Portfolio Event Director, comments: “We were delighted with the growth we achieved last year since our launch in 2014, proving the need for an event dedicated to the German market increasing visitor numbers by 15 per cent and exhibitors by 20 percent. The show has firmly established itself as the leading event of its kind for the German market and we plan to grow again this year, with an expanded showfloor, a bigger conference programme and more innovation on show than ever before. The show brings together the best and brightest from German bulk liquid storage industry, providing the perfect opportunity for leading manufacturers and suppliers to showcase their innovative products and services to a captive audience. “The seminar content we have on offer is more relevant than ever, with leading experts from Oiltanking, Arcadis, Vopak, Deloitte and Tanquid taking to the stage to discuss all things storage. We have worked tirelessly to provide our visitors with the biggest names in the industry, ensuring that there is something for everyone. Stay tuned as there is much more to come from us!”. Germany has a total storage capacity of over 70 million m3, yet with much of it being geared towards supporting the inland supply chain, the market dynamics are very different to those in the ARA (Amsterdam, Rotterdam and Antwerp). The two-day conference programme will provide visitors with an insight into the industry’s critical issues, as well as debate the latest trends and market forecasts. Alongside the educational seminar sessions will be a packed exhibition hall, showcasing an array of international suppliers, including Actemium, Börger GmbH, Ivens NV, Siemens, Mueller-Behaelterbau, M+F Technologies, IfI Technology GmbH and Remondis. Many of these will be using the show to launch new technologies or make major announcements to an international audience. For further information: www.tankstoragegermany.com ‹ 64
N. 18 - 2016 JUNE - ipcm® Protective Coatings
T
ank Storage Germany 2016, il più importante evento per il settore tedesco dello stoccaggio dei liquidi, ritorna alla Fiera di Amburgo dal 16 al 17 novembre. La manifestazione riunisce oltre 80 fornitori e un pubblico attento costituito da decision maker e acquirenti di alto livello, tutti alla ricerca di un modo per partecipare all’attesissimo programma di conferenze e conoscere le ultimissime soluzioni di stoccaggio. Nick Powell, Direttore di StocExpo & Tank Storage, commenta: “Siamo stati molto soddisfatti dai progressi ottenuti l’anno scorso: dal lancio dell’evento nel 2014 il numero dei visitatori è aumentato del 15% e quello degli espositori del 20%, prova della necessità di un evento dedicato al mercato tedesco. La manifestazione si è affermata come il più importante evento del genere per il mercato tedesco e progettiamo di crescere ancora quest’anno, con uno spazio espositivo ampliato, un programma di conferenze più vasto e il numero più alto di innovazioni presenti finora”. L’evento raccoglie il meglio dell’industria tedesca per lo stoccaggio dei liquidi e rappresenta l’occasione perfetta per i principali produttori e fornitori per presentare i propri prodotti e servizi innovativi ad un pubblico interessato. “I temi offerti dal seminario saranno i più interessanti di sempre, con i più grandi esperti come Oiltanking, Arcadis, Vopak, Deloitte e Tanquid, che porteranno sul palco tutti gli argomenti riguardanti lo stoccaggio. Abbiamo lavorato senza sosta per offrire ai nostri visitatori i più grandi nomi dell’industria, in modo che ci sia un tema interessante per tutti. Riveleremo presto anche molte altre sorprese”. La Germania ha una capacità totale di stoccaggio di oltre 70 milioni di m3, molta della quale mirata a supporto della catena di approvvigionamento interna: le dinamiche di mercato sono molto diverse invece nei tre porti di Amsterdam, Rotterdam e Antwerp (ARA). Il programma della conferenza di due giorni offrirà ai visitatori una panoramica delle situazioni critiche nell’industria, oltre a dibattiti sulle ultime tendenze e le previsioni di mercato. Insieme alle sessioni di seminari formativi sarà presente una ricca area espositiva, dove esporrà una vasta gamma di fornitori internazionali, tra cui Actemium, Börger GmbH, Ivens NV, Siemens, Mueller-Behaelterbau, M+F Technologies, IfI Technology GmbH e Remondis. Molte di queste aziende sfrutteranno l’evento per lanciare nuove tecnologie o per fare grandi annunci al pubblico internazionale. Per maggiori informazioni: www.tankstoragegermany.com ‹
ASIA’S LEADING TANK STORAGE EVENT GATHERS MOMENTUM Prende slancio il principale evento in Asia sui serbatoi di stoccaggio
T
ank Storage Asia 2016, the leading event for the Asian tank storage industry, returns to The Marina Bay Sands, Singapore, on 27 & 28 September, with an expanded show floor, improved conference programme and more international suppliers than ever before. The show brings together the best and brightest from the Asian bulk liquid storage industry, providing the perfect opportunity for leading manufacturers and suppliers to showcase their innovative products and services to a captive audience of international buyers and decision-makers. Over 65 leading organisations are signed up to exhibit at the 2016 show already, including Colfax Fluid Handling, Concrete Canvas, Emco Wheaton, Fort Vale Engineering, Hitachi Critical Facilities Protection, Maide Machine and Siemens. Many of these will use the show to launch new products and services to the tank storage market. For instance, RPR Technologies will be showcasing its latest Induction Disbonder, which offers a unique and fast induction system for the removal of most types of coatings on steel. For the stripping of thick coatings in storage tanks it is up to three times faster than traditional methods, using grit or high pressure water. The steel is heated up by moving an induction head over the surface, resulting in fast disbonding of the coatings, with thickness up to 20-25 mm. Removal is done by scraping off, with easy bagging for disposal. BIOex will be launching its new formula, Ecopol F3 HC. It is the first fluorine-free 3 per cent foam concentrate, suitable for use on hydrocarbon fires. It performs better than any AFFFs, is biodegradable and is exceptionally fast acting. Timm Elektronik will be unveiling its new Marine Grounding System, SEK-3, which offers the highest safety during the loading and unloading of vessels. It has a compact design, good visibility of status lamps, both on device and clamp, as well as a multifunctional status display. The Marine Grounding System has EX certification according to ATEX and IECEx standard. The system has been developed in collaboration with The Hamburg University of Applied Science. Loadtec Engineered Systems will be presenting the Loadtec Service, its new servicing company aimed at providing quality lifetime servicing and support for road, sea and marine loading and access equipment. The Tank Storage Asia 2016 exhibition runs alongside a two-day conference programme, which features over 20 global authorities from the bulk liquid storage sector. Experts from companies such as Nexant, Tri-Zen, Aurecon and Peaker Energy will provide visitors with an insight into the industry’s critical issues on a local and global scale. For more information: www.tankstorageasia.com ‹
T
ank Storage Asia 2016, il più importante evento in Asia per l’industria dei serbatoi di stoccaggio, ritorna a Marina Bay Sands, Singapore, il 27 e il 28 settembre, con uno spazio espositivo ampliato, un programma di conferenze migliorato e un numero di fornitori internazionali più ampio che mai. L’evento riunisce i migliori protagonisti dell’industria asiatica dello stoccaggio di liquidi, offrendo una perfetta opportunità ai principali produttori e fornitori per mostrare i loro prodotti e servizi innovativi a un pubblico attento composto da buyer e decision-maker internazionali. Oltre 65 importanti organizzazioni hanno già siglato un contratto per esporre all’edizione del 2016, tra cui Colfax Fluid Handling, Concrete Canvas, Emco Wheaton, Fort Vale Engineering, Hitachi Critical Facilities Protection, Maide Machine e Siemens. Molte di queste aziende sfrutteranno l’evento per lanciare nuovi prodotti e servizi sul mercato dei serbatoi di stoccaggio. Per esempio, RPR Technologies mostrerà il suo ultimo Induction Disbonder, che offre un sistema di induzione unico e veloce per la rimozione della maggior parte dei rivestimenti su acciaio. Per la sverniciatura di rivestimenti spessi nei serbatoi di stoccaggio, è tre volte più veloce rispetto ai metodi tradizionali che utilizzano abrasivi oppure acqua ad alta pressione. L’acciaio è riscaldato attraverso il movimento di un dispositivo ad induzione sopra la superficie, che facilita il distacco delle vernici con spessori fino a 20-25 mm. La rimozione è effettuata tramite raschiatura, con insaccamento facile per lo smaltimento. BIOex lancerà la sua nuova formula, Ecopol F3 HC. Si tratta del primo concentrato schiumogeno al 3% senza fluoro, adatto per l’utilizzo con incendi da idrocarburi. Ha prestazioni migliori rispetto a qualsiasi AFFF, è biodegradabile e ad azione super rapida. Timm Elektronik svelerà il suo nuovo Marine Grounding System, SEK-3, che offre il più alto livello di sicurezza durante il carico e lo scarico delle navi. Ha un design compatto, buona visibilità degli indicatori di controllo, sia sul dispositivo sia sulla morsa, oltre a un display di controllo multifunzione. Il Marine Grounding System è certificato EX secondo gli standard ATEX e IECEx. Il sistema è stato sviluppato in collaborazione con l’Università di Scienze Applicate di Amburgo. Loadtec Engineered Systems presenterà Loadtec Service, la sua nuova azienda di assistenza che ambisce a offrire assistenza di qualità per ciclo vita ai carichi su strada e per mare, oltre ai mezzi di accesso. L’esposizione Tank Storage Asia 2016 si svolge in contemporanea con un programma di conferenze di due giorni, caratterizzato da oltre 20 autorità globali del settore dello stoccaggio dei liquidi. Gli esperti provenienti da aziende come Nexant, Tri-Zen, Aurecon e Peaker Energy offriranno ai visitatori una panoramica dei problemi critici dell’industria su scala locale e globale. Per maggiori informazioni: www.tankstorageasia.com ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
65
PROTECTIVE COATINGS | ZOOM ON EVENTS
EUROCORR 2016 IS APPROACHING EUROCORR 2016 si sta avvicinando
E
UROCORR, l’evento annuale dell’European Federation of Corrosion, è il principale congresso sulla corrosione in Europa che progressivamente attira un pubblico sempre più internazionale. Nel 2016, EUROCORR si svolgerà a Montpellier, Francia, dall’11 al 15 settembre 2016. EUROCORR 2016, organizzato da CEFRACOR, in collaborazione con Chimie ParisTech, si occuperà di tutti gli aspetti della scienza della corrosione, tecnologia e ingegneria, ponendo particolare attenzione al tema principale: i progressi nel collegare la scienza all’ingegneria (figg. 1 e 2). L’evento riunirà gli esperti della corrosione provenienti da università, centri di ricerca e industrie, diventando un forum per la presentazione e la discussione dei progressi nella comprensione dei fenomeni corrosivi e degli sviluppi nella prevenzione della corrosione. Il programma prevede conferenze plenarie, relazioni, presentazioni orali e poster in tutte le aree coperte dai gruppi di lavoro EFC, con workshop su temi attuali. È in programma una grande esposizione dedicata agli ultimi sviluppi dei materiali resistenti alla corrosione, monitoraggio della corrosione, rivestimenti, inibitori e protezione catodica.
E
List of topics: • Corrosion and Scale Inhibition • Corrosion by Hot Gases and Combustion Products
Elenco degli argomenti: • inibizione di corrosione e scaglie; • corrosione da gas caldi e prodotti della combustione; © Eurocorr
UROCORR, the annual event of the European Federation of Corrosion, is the premier Corrosion Congress in Europe, attracting an ever increasing international audience. In 2016, EUROCORR will take place in Montpellier, France, from 11 to 15 September, 2016. EUROCORR 2016, organized by CEFRACOR, in cooperation with Chimie ParisTech, will cover all aspects of corrosion science, technology, and engineering, with emphasis on a main theme: Advances in linking science to engineering (Figs. 1 and 2). It will bring together corrosion experts from universities, research centers, and industries, and will be a forum for presentation and discussion of advances in understanding corrosion phenomena and progress in corrosion prevention. The program will include plenary lectures, keynote lectures, oral and poster presentations in all the areas covered by the EFC working parties, with additional topical workshops. A large exhibition is planned, which will feature the latest developments in corrosion resistant materials, corrosion monitoring, coatings, inhibitors, and cathodic protection.
1
1
EUROCORR 2016 will take place in Montpellier, France, from 11 to 15 September, 2016. EUROCORR 2016 si terrà a Montpellier, Francia, dall’11 al 15 settembre 2016.
66
N. 18 - 2016 JUNE - ipcm® Protective Coatings
• corrosione nucleare; • frattura sensibile all’ambiente; • meccanismi di corrosione, metodi e modellazione; • formazione sulla corrosione; • corrosione marina • corrosione microbica; • corrosione delle armature nel calcestruzzo; • corrosione nella produzione Oil & Gas; • Rivestimenti: - rivestimenti metallici; - rivestimenti inorganici; - rivestimenti organici; - pretrattamenti; - rivestimenti autorigeneranti; • rivestimenti per alte temperature; • rivestimenti e protezione catodica delle condotte e dei serbatoi; • corrosione nelle raffinerie; • protezione catodica; • protezione catodica in ambiente marino; • protezione catodica delle armature nel calcestruzzo; • corrosione nel settore Automotive; • tribocorrosione; • corrosione dei materiali polimerici; • polimeri e materiali compositi nelle industrie di raffineria, petrolchimiche e chimiche; • corrosione e protezione contro la corrosione dei sistemi di acqua potabile; • corrosione dei manufatti archeologici e storici; • controllo della corrosione nel settore aerospaziale; • test di corrosione accelerata, scienza – laboratorio e sul campo; • metodi analitici avanzati per la ricerca sulla corrosione; • corrosione e protezione delle leghe di magnesio; • problemi di corrosione per le energie rinnovabili; • affidabilità dei dispositivi elettronici e dei materiali corrosi; • miglioramento del controllo della corrosione per le navi; • corrosione CO2 in applicazioni industriali di cattura, trasporto e utilizzo; • problemi nella preparazione della superficie relativi alle prestazioni di protezione dalla corrosione. Per maggiori informazioni: www.eurocorr.org ‹ © Lilian Martorell
• Nuclear Corrosion • Environment Sensitive Fracture • Corrosion Mechanisms, Methods and Modelling • Corrosion Education • Marine Corrosion • Microbial Corrosion • Corrosion of Steel in Concrete • Corrosion in Oil & Gas Production • Coatings: - Metallic Coatings - Inorganic Coatings - Organic Coatings - Pretreatments - Self-healing Coatings • Coatings for High Temperatures • Coatings and Cathodic Protection of Pipelines and Tanks • Corrosion in the Refinery Industry • Cathodic Protection • Cathodic Protection in Marine Environment • Cathodic Protection of Steel in Concrete • Automotive Corrosion • Tribocorrosion • Corrosion of Polymer Materials • Polymer and Composite Materials in Refinery, Petrochemical and Chemical Industries • Corrosion & Corrosion Protection of Drinking Water Systems • Corrosion of Archaeological 2 and Historical Artefacts • Corrosion Control in Aerospace Congress center “Le Corum”. • Accelerated Corrosion Testing, Il centro congressi “Le Corum”. Science - Lab & Field • Advanced Analytical Methods for Corrosion Research • Corrosion and Protection of Magnesium Alloys • Corrosion Issues for Renewable Energies • Corrosion Reliability of Electronics Devices and Materials • Improving Corrosion Control of Ships • CO2-Corrosion in Industrial Capture, Transportation and Utilization Applications • Surface Preparation Issues Related to Corrosion Protection Performance For further information: www.eurocorr.org ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
67
PROTECTIVE COATINGS | ZOOM ON EVENTS
IVS 2017, INDUSTRIAL VALVE SUMMIT: THE SECOND EDITION OF THE MOST IMPORTANT INTERNATIONAL EVENT FOCUSED ON INDUSTRIAL VALVES IVS 2017, Industrial Valve Summit: la seconda edizione del più importante evento internazionale dedicato alle valvole industriali
T
M
ercoledì 15 giugno è stata presentata a Milano, presso la sede della Commissione Europea, la seconda edizione di IVS Industrial Valve Summit, il più importante evento internazionale organizzato in Italia dedicato alle tecnologie delle valvole industriali e alle soluzioni di flow control, promosso da Confindustria Bergamo ed Ente Fiera Promoberg, che si svolgerà a Bergamo il 24 e 25 maggio 2017 (fig. 1). È stata confermata la formula vincente della prima edizione, costituita dalla presenza contestuale di: - un’esposizione fieristica di alto livello che si auspica raggiunga i 7000 m2 netti di esposizione per equivalenti 7000 visitatori previsti; - la presenza di un Congresso Internazionale promosso e organizza-
© MGP & Partners
he second edition of IVS Industrial Valve Summit, the most important international event focused on industrial valves, technologies and flow control solutions, has been presented in Milan in the European Commission headquarters on Wednesday, 15th June (Fig. 1). The exhibition is promoted by Confindustria Bergamo and Ente Fiera Promoberg, and it will be held in May 24th and 25th 2017 in Bergamo. The last edition winning formula has been suggested again, and it is compound of the contextual presence of: - A high-level trade exhibition, which is hoped to reach 7,000 net square meters per 7,000 expected visitors; - The presence of an international congress, organized and
1 1
The second edition of the international trade fair IVS, Industrial Valve Summit (Bergamo, from 24th to 25th May 2017) has been presented in Milan on Wednesday, 15th June. La conferenza stampa per la presentazione della seconda edizione della fiera internazionale IVS, Industrial Valve Summit (Bergamo, 24-25 maggio 2017) si è tenuta il 15 giugno scorso a Milano.
68
N. 18 - 2016 JUNE - ipcm® Protective Coatings
promoted by ISA (The International Society of Automation); - An international conference themed “The valve industry: knowledge exchange and visions for a global future” and split into six subjects; - Several workshops related to the sector in question’s current themes. The training program Valvecampus (www.valvecampus.com), which was developed during the first IVS edition in order to offer a continuing education and updates to sector experts, will be also held for the 2017 edition and will offer: - 4 training days/visits in firms; - 12 industrial valves’ business-oriented courses in 2016/2017, with a presence of highly specialized Professors and Fondimpresa certificated courses with possible financial support for the participants. “Without any doubt – says Guido Venturini, Confindustria Bergamo President – the second IVS edition vouches the oil&gas enterprises (mostly from Milan and Bergamo) will to confirm themselves again as international excellences and reference points. Making system is the emerging message from enterprises which will join the exhibition and which have been capable of attracting traders and specialized technicians from all over the world”. Ivan Rodeschini, Promoberg President, says that teaming is a strength point and the territory a fundamental structural factor; the city of Bergamo perfectly embodies this example, for an international event: it locates itself near the Exhibition ground, it is linked to the Highway towards one of the most relevant airport in Northern Italy. The ambition of Fabio Casiraghi, IVS commercial manager, is going over Italy and Europe in order to fulfill the last years’ achieved goals and accomplish the aims for the 2017 edition. “After overcoming the initial doubts, IVS shows itself as a winning project where every supply chain’s enterprise has been and will be present, and the common point for everyone was the international growing appreciation towards the ‘made in Italy’”. Internationality: this is the word for the exhibition’s payoff, commercial, communication and congressional strategy. For this reason, the sponsorship and cooperation signed with ICE (Istituto per il Commercio Estero - Foreign Trade Institute) – which is represented by Marinella Loddo (Milan Director) and by Pier Luigi D’Agata (Managing Director of Confindustria Assafrica e Mediterraneo) - are a warranty for international activities and collaboration. “At last, Valve Campus offers itself as an important market player and innovative association model, aiming to offer a continuing training to enterprises, involving the whole Oil&gas supply chain” concludes Simone Brevi, Valvecampus Vice President. For further information: www.industrialvalvesummit.com ‹
to da ISA (The International Society of Automation); - una Conferenza Internazionale dal tema “The valve industry: knowledge exchange and visions for a global future” - numerosi workshop inerenti tematiche di stretta attualità per il settore in oggetto. Completa l’offerta di IVS 2017 il programma formativo di Valve Campus (www.valvecampus.com), spin off creato in occasione della prima edizione con l’obiettivo di fornire aggiornamenti e formazione continua ai tecnici di settore, che vedrà l’organizzazione anche per l’edizione 2017 di: - 4 giornate di training/visite in azienda; - 12 corsi per le aziende del settore nel 2016/2017 con la presenza di docenti altamente specializzati e corsi attestati Fondimpresa con canali di finanziamento a disposizione delle aziende aderenti. “Non vi è dubbio – sostiene Guido Venturini, Presidente di Confindustria Bergamo – che la seconda edizione di IVS attesti ancora una volta la volontà delle imprese appartenenti alla filiera dell’oil&gas, per buona parte milanesi e bergamasche, di riconfermarsi realtà di eccellenza e punto di riferimento internazionale. Fare sistema è il messaggio che emerge dalle aziende che hanno aderito all’iniziativa e che sono state capaci di attrarre operatori commerciali e tecnici specializzati provenienti da tutto il mondo”. Che la squadra sia la forza e il territorio un fattore strutturale importante lo conferma anche Ivan Rodeschini, Presidente Promoberg che, nel ricordare la vicinanza del Quartiere fieristico alla bretella autostradale e ad uno dei principali aereoporti del Nord Italia, riconferma la posizione strategica per un evento di caratura internazionale. “Andare oltre l’Italia e oltre l’Europa – ambizione di Fabio Casiraghi, Responsabile Commerciale di IVS – per superare gli obiettivi raggiunti che ci eravamo dati per la prima edizione e soddisfare le mete – ambiziose – raggiungibili per l’edizione 2017. Superate le perplessità iniziali, IVS si è dimostrato un progetto vincente, dove tutte le aziende appartenenti alla filiera sono state e saranno presenti e dove il minimo comun denominatore è rappresentato dall’avere un punto produttivo in Italia a riconferma della rilevanza del made in Italy”. Internazionalità: termine presente nel payoff della fiera e nella strategia commerciale, congressuale e di comunicazione della manifestazione. In tal senso il patrocinio e la collaborazione siglati con l’ICE (Istituto per il Commercio Estero), oggi rappresentato dal Direttore di Milano Marinella Loddo, e con Confindustria Assafrica e Mediterraneo nella persona del Direttore Generale Pier Luigi D’Agata sono garanzia di un’operatività effettiva oltre confine. Non ultima la formazione, core business di Valve Campus “che – conclude Simone Brevi, Vice Presidente dell’Associazione – si pone sul mercato come player importante e modello di associazionismo innovativo volto a rispondere alle esigenze delle aziende di formazione continua e che coinvolge l’intera filiera dell’Oil&Gas italiana”. Per maggiori informazioni: www.industrialvalvesummit.com ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
69
PROTECTIVE COATINGS | ZOOM ON EVENTS
THE NORTH AFRICAN COATINGS CONGRESS OPENS NEW MARKETS WITH LESS COMPETITION Il North African Coatings Congress apre nuovi mercati con meno concorrenza
Positive feedback from both delegates and exhibitors was received for the latest North African Coatings Congress, held in 2014 (Fig. 1). Comments from the exhibiting companies shared common themes: to establish a presence in the Moroccan market and make new business contacts; meeting quality visitors and introduce their companies to the Moroccan paint industry. With the NACC growing year-on-year, with the much-appreciated support of influential, well known and respected speakers at the event, the congress has gained the reputation of meeting the needs of the coatings industry on the latest technology. For more information: coatings-group.com/congress/nacc/ ‹ 70
N. 18 - 2016 JUNE - ipcm® Protective Coatings
I
l North Africa Coatings Congress 2016 (NACC) si svolgerà presso l’hotel Hyatt Regency a Casablanca, in Marocco, il 12 e 13 ottobre 2016. L’evento offre le ultime esperienze commerciali abbinando una conferenza di 2 giorni con l’esposizione fieristica e rappresenta per i fornitori una piattaforma unica dove esporre i propri prodotti e servizi ed incontrare faccia a faccia i più influenti decision maker operanti nel mercato in un ambiente intimo e rilassato. Il North African Coatings Congress è uno dei più efficaci mezzi per stabilire e mantenere rapporti con i clienti di questa area. Presenta caratteristiche differenti dalle altre fiere per i seguenti motivi: - l’evento di qualità serve una nicchia esclusiva e redditizia; - target mirato di visitatori e delegati, selezionati con cura e invitati personalmente per garantire la qualità dell’evento; - nuovi mercati, minore concorrenza; - ampie opportunità di sviluppo di nuove attività commerciali; - il mercato delle vernici sta per vedere una rapida fase di crescita.
1
© DMG Events
T
he North African Coatings Congress 2016 (NACC) will take place at the Hyatt Regency Hotel in Casablanca, Morocco from October 12-13, 2016. It provides the ultimate business experience combining a 2-day Conference and Exhibition. The event gives a unique platform for suppliers to present their products and services and be face-to-face with the most influential decision makers operating within the market in a relaxed, intimate environment. The North African Coatings Congress is one of the most effective mediums for establishing and maintaining customer relations within this region. It is different from other shows for the following reasons: - Qualitative event serving an exclusive and lucrative niche; - Visitors and delegates are especially targeted, carefully selected and personally invited to ensure the quality of the event; - New markets, less competition; - Ample opportunities for new business development; - Paint market is about to witness a rapid growth phase.
1
The Conference during the North African Coatings Congress 2014. La Conferenza svoltasi durante il North African Coatings Congress 2014.
Feedback positivi sono arrivati sia dai delegati che dagli espositori dell’ultima edizione del North Africa Coatings Congress, svoltasi nel 2014 (fig. 1). I commenti delle aziende espositrici hanno condiviso aspetti comuni: stabilire una presenza nel mercato marocchino e creare nuovi contatti commerciali; incontrare visitatori di valore e introdurre le proprie aziende nel mercato marocchino delle vernici. Grazie ad uno sviluppo che cresce di anno in anno e al sostegno molto apprezzato degli influenti, noti e rispettati relatori dell’evento, NACC si è guadagnato la reputazione di soddisfare le esigenze del settore dei rivestimenti per quanto riguarda le ultime tecnologie. Per maggiori informazioni: coatings-group.com/congress/nacc/ ‹
IIS SEMINAR ON INDUSTRIAL APPLICATIONS FOR THERMAL SPRAY AND METALLISATION PROCESSES Seminario IIS dedicato alle applicazioni industriali dei processi di thermal spray e metallizzazione
W
I
© ipcm
ithin its technical IS, l’Istituto Italiano della Saldatutraining curriculum ra, nell’ambito della sua attività di the IIS - Italian Welding formazione tecnica, ha organizzaInstitute - held a technical seminar to il 21 aprile scorso presso la sede di last 21 April on “Thermal Spray and Legnano il seminario tecnico intitolametallisation: a focus on industrial to “Thermal Spray e metallizzazione: applications” at its Legnano facility. applicazioni in ambito industriale”. 1 The programme for the event Il programma dell’evento ha viincluded prominent experts and sto protagonisti i rappresentanti di 1 representatives from leading importanti aziende (Lucchini RS, businesses (Lucchini RS, Metalvar Picture taken at the IIS seminar held on 21 April at the Legnano facility. Metalvar New e Weir Gabbioneta) Uno dei momenti del seminario IIS del 21 aprile presso la sede di New and Weir Gabbioneta) who affiancati dagli interventi degli Legnano. will give talks next to experts from esperti dell’Istituto (fig. 1). the Institute (Fig. 1). “Al pari della saldatura - ha spiegato Paolo Baccarini (IIS Progress) nella “Like welding – explained Paolo Baccarini (IIS Progress) in the sua introduzione - i processi di verniciatura e metallizzazione (thermal introductory speech - coating and metallisation processes (thermal spray e zincatura a caldo) sono processi speciali: per poter attestare la lospray and hot dip galvanising) are special processes: in order to confirm ro corretta esecuzione e la conformità ai requisiti di progetto richiedono their correct execution and compliance with design requirements they una serie di verifiche e controlli che vanno ben oltre la semplice misura need to undergo a number of checks and tests that go well beyond dello spessore finale e dell’adesione del rivestimento al substrato”. measuring final thickness and coating adhesion to the substrate”. Dopo la presentazione dei processi di metallizzazione e spruzzatura After presenting thermal spraying and metallisation processes, termica, Dimitri Sala di Lucchini RS ha approfondito gli aspetti relativi Dimitri Sala from Lucchini RS delved further into all matters all’applicazione del processo di metallizzazione in ambito ferroviario, concerning metallisation applications in the railway industry, analizzando le caratteristiche e i benefici del molibdeno spruzzato terby analysing the characteristics and benefits of thermally micamente sulle portate degli assili ferroviari. sprayed molybdenum on railway axle journals. Fabio Crivelli di Metalvar New ha documentato il processo di flammizFabio Crivelli from Metalvar New described the thermal spraying zazione impiegato in azienda come soluzione alternativa alla proteprocess they use as an alternative method against corrosion. zione anticorrosiva. The morning session ended with Giovanni Battista Garbarino Ha concluso la sessione mattutina Giovanni Battista Garbarino (IIS Progress), who talked specifically about the main regulations (IIS Progress), specificando le principali normative di qualifica degli applicable for operator, process and supervisor qualification applied operatori, dei processi e dei supervisori per i processi di metallizzazione to thermal spray and metallisation processes. e thermal spray. The first talk of the afternoon was held by Giuseppe Basile of Weir Il primo intervento del pomeriggio è stato sostenuto da Giuseppe Gabbioneta, who went into the details of designing, manufacturing Basile di Weir Gabbioneta, che ha spiegato in modo dettagliato la proand operating a coating system for part processing in the Oil&Gas gettazione, la realizzazione e la messa in funzione di un impianto per industry. riporti dedicato alla lavorazione di particolari per il settore Oil&Gas. The day’s programme ended with presentations by Paolo Baccarini Il programma della giornata si è concluso con le relazioni di Paolo Baccarini and Eduardo Adile (IIS Progress), respectively about corrosion coating e di Eduardo Adile (IIS Progress), rispettivamente sui riporti anticorrosivi e for the furniture industry and coating checking methodologies. per finiture d’arredo e sulle metodologie dei controlli da eseguire sui riporti. During the final Q&A the audience further discussed the most Nel dibattito finale i partecipanti hanno potuto approfondire gli aspetinteresting topics emerged during the seminar, asking questions ti più interessanti del seminario, ponendo domande e acquisendo le and acquiring useful information. informazioni più utili. For further information: www.iis.it ‹ Per maggiori informazioni: www.iis.it ‹
ipcm® Protective Coatings - 2016 JUNE - N. 18
71
Protective Coatings ®
Eos Mktg&Communication srl www.myipcm.com info@ipcm.it
Questo periodico è associato all’Unione Stampa Periodica Italiana
TECHNICAL ADVISORY BOARD
Redazione - Sede Legale: Via Giacomo Matteotti, 16 20811 - Cesano Maderno (MB) - Italy
Antonio Amati:
Ing. Ilario Maconi:
Tank lining and special coatings
Materials Engineer, Nace inspector lev.2 quality inspections of coatings
Enzo Dell’Orto: Shot-blasting technologies
Loris Loschi: Protective coatings application
Vittorio Grassi: Heat treatment
EDITOR IN CHIEF / DIRETTORE RESPONSABILE ALESSIA VENTURI venturi@ipcm.it
ISSN 2282-1767
The new international magazine about corrosion control and prevention
Protective Coatings ®
2016 5th Year Quarterly N°18-June
EDITORIAL DIRECTOR / DIRETTORE EDITORIALE M.d.L. PAOLO RAMI paolorami@hotmail.it
LUCA ANTOLINI antolini@ipcm.it
Oil & Gas Specialist
Edoardo Tevere:
Department of Chemistry, Material and Chemical Engineering, Politecnico of Milan – Chemical Engineering Section
Dr. Antonio Tolotto:
Ivano Pastorelli:
Ing. Luca Valentinelli:
Measurement and quality control
MONICA FUMAGALLI info@ipcm.it
NICOLE KRAUS kraus@ipcm.it
Massimo Cornago:
Department of Chemistry, Material and Chemical Engineering, Politecnico of Milan – Section of Applied Chemistry and Physics
Indipendent Nace inspector lev. 3 QC/QA
PAOLA GIRALDO giraldo@ipcm.it
FRANCESCO STUCCHI stucchi@ipcm.it
Prof. Massimiliano Bestetti:
Prof. Paolo Gronchi:
EDITORIAL OFFICE / REDAZIONE
MEDIA SALES
EDITORIAL BOARD
ipcm_PC digital on
www.myipcm.com
Marine and industrial anticorrosive coating cycles
Materials Engineer, PhD, Nace inspector lev.3
Prof. Fabrizio Pirri: The new international magazine about corrosion control and prevention La nuova rivista internazionale sul controllo e la prevenzione della corrosione
Department of Material Sciences and Chemical Engineering, Politecnico of Turin, Micro and Nanosystems, Nanomaterials and Surfaces
Registrazione al Tribunale di Monza N° 4 del 26 Marzo 2012 Eos Mktg&Communication srl è iscritta nel Registro degli Operatori di Comunicazione con il numero 19244
POSTE ITALIANE SPA – SPED. IN A.P. 70% LO/MILANO SERVICE SUBSCRIPTION - SERVIZIO ABBONAMENTI: Sale only on subscription - Vendita solo su abbonamento E.mail info@ipcm.it Subscription Rates 2016 - Tariffe Abbonamento 2016: Annual subscription: EMEA 60,00 € (postage included) Rest of world 200,00 € (fast airmail shipping included) Abbonamento annuale: EMEA 60,00 € (spese postali incluse) Resto del mondo 200,00 € (spedizione via aerea inclusa) Subscription Rates 2016 digital version: 35,00 € Abbonamento 2016 versione digitale: 35,00 € + iva Single copy: 15,00 € EMEA (postage included) - Rest of world (postage excluded) Back issues: 30,00 € EMEA (postage included) - Rest of world (postage excluded) Fascicolo singolo: 15,00 € EMEA (spese postali incluse) - resto del mondo (spese postali escluse) Arretrati: 30,00 € EMEA (spese postali incluse) - resto del mondo (spese postali escluse)
LAYOUT/ IMPAGINAZIONE LASER GRAFICA DIGITAL srl www.lasergrafica.it
PRINT/ STAMPA A.G. PRINTING SRL www.agprinting.it
Subscriptions can be made by bank transfer to the following account: Eos Mktg&Communication Srl IBAN IT97F0844033270000000084801. SWIFT CODE CRCBIT22. The VAT on subscriptions and sale of single copies is over Gli abbonamenti possono essere sottoscritti versando il relativo importo a mezzo b/b IBAN IT97F0844033270000000084801 intestato a eos Mktg&Communication Srl. L’Iva sugli abbonamenti, nonchè sulla vendita di singole copie è assolta ai sensi dell’art.74 comma 1 lett. C DPR 633/72, DM 29/12/1989.
It is forbidden to reproduce articles and illustrations of “ipcm®” without authorization and without mentioning the source. The ideas expressed by the authors do not commit nor magazine nor eos Mktg&Communication S.r.l and responsibility for what is published is the authors themselves. È vietata la riproduzione di articoli e illustrazioni di “ipcm®” senza autorizzazione e senza citarne la fonte. Le idee espresse dagli autori non impegnano nè la rivista nè eos Mktg&Communication S.r.l e la responsabilità di quanto viene pubblicato rimane degli autori stessi.
NACC NORTH AFRICAN COATINGS CONGRESS
Hôtel Hyatt Regency, Casablanca, Morocco 12 – 13 October 2016
THE PREMIER FORUM FOR THE COATINGS INDUSTRY IN NORTH AFRICA Giving you with a unique platform to get face-toface with the most influential decision makers operating within the market in a relaxed, intimate environment.
organised by
sponsored by
www.coatingsgroup.com