Skip to main content

ipcm® Protective Coatings n. 17, 2016

Page 1

The new international magazine about corrosion control and prevention

Protective Coatings ÂŽ

ISSN 2282-1767

ipcm_PC digital on

www.myipcm.com 2016 5th Year Quarterly N°17-April


Vapor Abrasive Blasting TM

Maximum blast power, Minimal dust

EcoQuip

TM

sage/title

Same performance as sandblasting 92% less dust minimizing tenting and containment Up to 75% of blast media savings

TM

EcoQuip

Discover how EcoQuip optimizes your blasting job TM

gracoblasting.com


Zaniolo CdA - 03.16

soluzioni che valgono nel tempo lasting solutions

PASSERELLA PEDONALE EXPO 2015, MILANO

INDUSTRIAL & PROTECTIVE COATINGS I cicli di protezione industriale Retron Acrilico e Veneziani protective coatings comprendono una gamma di vernici, rivestimenti e prodotti intumescenti con elevate prestazioni in termini di protezione anticorrosiva e finitura estetica, resistenza agli agenti chimici, all’abrasione ed al fuoco. Presentano facilità di applicazione e rapidità di essicazione, perfetta aderenza, resistenza al deperimento cromatico ed elevata resistenza fisico-chimica; valenze che sono la migliore difesa dalle aggressioni esterne anche in ambienti industriali particolarmente difficili. Retron Acrilico industrial protective systems and Veneziani protective coatings includes a wide range of paints, linings and intumescent coatings featuring high performances in terms of anticorrosive protection and cosmetic finish, chemical, abrasion and fire resistance for steel structures are easy to apply and quick drying. The formulations ensure perfect adhesion, excellent gloss and color retention, high resistance to physical and chemical attacks, features which are the best defense against external factors, even in very aggressive industrial environments.

Cicli Zetagì e Veneziani accreditati: EDISON - ENI - ENEL - SNAM RETEGAS - ANAS - PETROBRAS - ACQPA - RFI - SAIPEM

Colorificio Zetagì Srl - Olmo di Creazzo (VI) - Tel. 0444.228300 - Fax 0444.228366 - zg@zetagi.it - www.zetagi.it


21-23 GIUGNO 2016

EUROPA

MiCo MILANO MILANO, ITALIA

CONFERENZA & ESPOSIZIONE

SCOPRITE IL POTENZIALE DEL VOSTRO BUSINESS NEL SETTORE ENERGETICO EUROPEO Il settore energetico europeo è in evoluzione: si stanno trovando nuovi usi per alcune tradizionali forme di generazione e le tecnologie innovative stanno raggiungendo la maturità. Scoprite come convivono queste due tendenze e come il vostro business può trarre vantaggio dalla presenza a POWER-GEN Europe and Renewable Energy World Europe, che si svolgerà a Milano nel mese di giugno. • Partecipate al dibattito durante le conferenze e scoprite le innovazioni tecnologiche che saranno presentate • Scoprite quali sono le ultime tendenze, quali settori sono in crescita e incontrate chi può aver bisogno delle vostre competenze

Venite a Milano per sfruttare tutte le opportunità che il nuovo orizzonte dell’energia in Europa può offrire al vostro business. Visita www.powergeneurope.com per maggiori informazioni CON IL PATROCINIO DI

DI PROPRIETÀ E PRODOTTA DA

Presentato da:


APRIL 2016 EDITORIAL BRAND-NEW HIGHLIGHTS OF THE MONTH

14

Flexible Coatings Help Protect Marine Structures Rivestimenti flessibili per la protezione delle strutture in ambiente marino

18

Smart Coatings from Trieste to Conquer the US Market Le vernici intelligenti da Trieste alla conquista del mercato USA

pag. 14 © Rhino Linings

pag. 20

FOCUS ON TECHNOLOGY

20

Hempel’s Fast Drying Coatings: Maximum Protection with Minimum Application Times Prodotti a rapida essiccazione Hempel: massima protezione con tempi di applicazione ridotti

24

Belzona SuperWrap II Saves Failing Seawater Filter Vessel Belzona SuperWrap II salva una cisterna danneggiata per il filtraggio dell’acqua di mare

28

Successful and Safe Removal of Hazardous Coatings with RPR Induction Method on Kanmon Bridge in Japan Rimozione sicura e di successo di vernici pericolose con il metodo a induzione di RPR sul ponte Kanmon in Giappone

32

Epoxy Systems Curb Cavitation Threat: Polymeric Composites and Coatings Transform Heavily Corroded Rudders Sistemi epossidici bloccano il rischio di cavitazione: compositi e rivestimenti polimerici trasformano timoni fortemente corrosi

36

Liquid Coating Application Booth for Core Boxes Cabina per l’applicazione di vernici liquide nelle casse d’anima

© Hempel

INNOVATIONS

38

Blast with Less Dust Sabbiare con meno polvere

44

An Introduction to Thermal Spray – Part 3 Introduzione alla termospruzzatura – Parte 3

52

Bristle Blasting Surface Preparation Method for Maintenance Bristle Blasting: metodo di preparazione della superficie per la manutenzione

pag. 38 © Graco BVBA

CONTENTS

EXHIBITIONS CALENDAR ZOOM ON EVENTS


Una realtà nuova, forte di venticinque anni di esperienza, nella produzione di pitture per cicli di protezione anticorrosiva di opere nuove e per interventi manutentivi di strutture quali: • • • • • • •

Ponti e viadotti Impianti per la produzione di energia elettrica Impianti petrolchimici Impianti siderurgici Impianti petroliferi e trattamento gas Industria alimentare Complessi di edilizia industriale

La gamma di prodotti Brega Srl comprende: • Primer alchidici e sintetici • Primer zincanti organici e inorganici • Primer epossidici a rapida essicazione “surface tolerant” • Intermedi epossidici e clorocaucciù • Finiture alchidiche e clorocaucciù – alchidiche DE • Finiture epossidiche ed epossi – viniliche A SE V O U N • Finiture poliuretaniche • Pitture per alte temperature • Pitture epossicatrame • Rivestimenti a basso tenore di solvente

Brega Srl a socio unico - Via Marchi 58 - 26039 Vescovato (CR) - tel. +39 0372 81118 - fax +39 0372 830166 Nuova Sede: Via delle Vigne - 26843 Castelnuovo Bocca d’Adda (LO) info@bregaanticorrosione.com www.bregaanticorrosione.com


PROTECTIVE COATINGS | EDITORIAL

O

n April 17, a few days before the release of this issue of ipcm®_ Protective Coatings , a spill of 680,000 litres of crude oil caused pollution of the Pianego brook and the Fegino and Polcevera streams during its pumping from the tanker to the pipeline of the Iplom refinery in Genoa (Italy). There was even a danger that the hydrocarbons reached the sea. This happened precisely while the Italian people were called to vote in a referendum on the renewal of drilling concessions in the Mediterranean Sea within 12 miles from the coast (any new drilling within this distance is already prohibited by Italian law). The referendum failed. If it had not, the platforms currently placed in the sea less than 12 miles from the coast would have been dismantled after the expiry of the grant, regardless of the fact that the gas (the majority) or oil fields were exhausted or not. Beyond any political analysis, which is not up to us, the pro-referendum campaign asking to vote YES to say NO to drilling has mainly leveraged the electorate’s sensitivity, offering images of environmental disasters due to oil spills and accidents on drilling platforms while leaving out any other economic, industrial or employment analysis. This speaks volumes about the people’s perception of the Oil & Gas industry. It is seen as indispensable in order to continue to enjoy the comforts we have acquired, but also as dangerous to humans and the environment, dirty, and highly impacting on the ecosystem. In other words, to be condemned even in the absence of viable energy alternatives capable of supporting the modern energy requirements. It is undeniable that the extraction of oil and gas and their distribution (crucial for their use even on a territory without extraction facilities) are as important as problematic in terms of safety and environmental impact. However, nowadays there are many technologies able to ensure the solid construction, corrosion protection and fire safety of oil and gas plants and reservoirs. Of course, the conservation state of these installations must always be monitored with the utmost attention. Nothing like constant maintenance and careful inspection of the system, platform and pipeline conditions can prevent human and environmental disasters. On the pages of this ipcm®_ Protective Coatings issue, you will find several articles on highly efficient maintenance technologies that can also be used in difficult conditions with the maximum yield for the repair of corrosion damage. In particular, we will continue our study of the thermal spray technology, widely used for corrosion protection in the Oil & Gas industry and whose benefits may extend to many other applications in the corrosion industry.

I

l 17 aprile, pochi giorni prima della stampa di questa edizione di ipcm®_ Protective Coatings, uno sversamento di 680 mila litri di greggio durante il suo pompaggio dalla nave cisterna che lo trasportava all’oledotto della raffineria Iplom di Genova, ha causato l’inquinamento del rio Pianego, del torrente Fegino e del Polcevera, con il pericolo che la scia di idrocarburi arrivi al mare. Ciò avveniva nelle stesse ore in cui gli italiani erano chiamati a votare un referendum sul rinnovo delle concessioni di trivellazione nel mar Mediterraneo entro le 12 miglia dalla costa (le nuove perforazioni entro questa distanza sono già proibite dalla legge italiana). Il referendum non è passato ma se lo fosse, le piattaforme piazzate attualmente in mare a meno di 12 miglia dalla costa sarebbero state smantellate una volta scaduta la concessione, indipendentemente dal fatto che i giacimenti di gas (la maggioranza) o petrolio fossero esauriti o meno. Al di là di ogni analisi politica che qui non ci compete, la campagna proreferendum che domandava a gran voce di votare SI per dire NO alle trivellazioni faceva leva principalmente sull’emotività dell’elettorato, proponendo immagini di disastri ambientali dovuti a sversamenti di petrolio e di incidenti sulle piattaforme di perforazione, tralasciando qualsiasi altra analisi di natura economica, industriale o sulle ricadute occupazionali. Ciò la dice lunga sulla percezione che la gente ha dell’industria dell’Oil&Gas: irrinunciabile, certo, per poter continuare a godere delle proprie comodità acquisite, tuttavia pericolosa per uomo e ambiente, sporca, altamente impattante sull’ecosistema quindi da condannare senza possibilità di difesa, anche in assenza di valide alternative energetiche in grado di sostenere il fabbisogno energetico moderno. È innegabile che l’industria dell’estrazione di gas e petrolio e della loro distribuzione (imprescindibile per il loro utilizzo, anche se su un territorio non dovessero esserci impianti di estrazione) siano due settori tanto importanti quanto problematici dal punto di vista della sicurezza e dell’impatto ambientale, tuttavia oggi esistono tecnologie in grado di garantire la solidità costruttiva, la protezione dai danni della corrosione e le necessarie misure di sicurezza al fuoco degli impianti e dei serbatoi Oil&Gas. Certo, l’allerta sullo stato di conservazione di detti impianti deve sempre rimanere altissima. Nulla come una manutenzione costante e un’ispezione attenta e frequente delle condizioni di impianti, piattaforme e condutture può mettere al riparo da disastri umani e ambientali. Sulle pagine che seguono di questa edizione di ipcm®_ Protective Coatings troverete numerosi articoli su tecnologie di manutenzione altamente efficienti, che possono essere impiegate anche in condizioni difficili con la massima resa per la riparazione dei danni dovuti alla corrosione. In particolare, continueremo il nostro approfondimento della tecnologia del thermal spray, largamente impiegata per la Alessia Venturi protezione dalla corrosione nel settore Oil&Gas Editor-in-chief e i cui vantaggi possono estendersi a molte altre Direttore Responsabile applicazioni dell’industria dell’anticorrosione.

ipcm® Protective Coatings - 2016 APRIL - N. 17

01


PROTECTIVE COATINGS | BRAND-NEW

CORTEC’S MCI® HPRS® PRODUCES AMAZING RESULTS AND SHARPLY LOWERS CORROSION RATES IN CONCRETE MCI® HPRS® di Cortec produce risultati sorprendenti e riduce drasticamente il tasso di corrosione del cemento

S

L

© Cortec

palling or deterioration of reinforced concrete does a scheggiatura o il deterioramento del cemento armato non senot inevitably signal the end of concrete structures. gnalano inevitabilmente la fine delle strutture in cemento. Con With Cortec’s High Performance Repair System (HPRS®) High Performance Repair System (HPRS®) (fig. 1) di Cortec è pos(Fig. 1), it is possible to greatly reduce a structure’s corrosion sibile ridurre notevolmente il grado di corrosione di una struttura e prorate and extend useful service life. Cortec’s highly durable, lungarne la vita utile. I sistemi di protezione Cortec, altamente duraturi, multifunctional, and compatible protection systems maximize multifunzionali e compatibili, ottimizzano la concentrazione delle molethe concentration of Migrating Corrosion Inhibitor (MCI®) cole Migrating Corrosion Inhibitor (MCI®) per riparazioni più efficaci. molecules for the most effective repairs. HPRS® utilizza una sequenza speciale per ottimizzare le prestazioni deHPRS® utilizes a special sequence to maximize performance of gli MCI® nelle riparazioni del cemento. Questo processo inizia con una MCI® in concrete repairs. This process begins with base surface preparazione superficiale di base per rimuovere tutto il cemento schegpreparation to remove all spalled, loose, and deteriorated concrete. giato, staccato o deteriorato. La ruggine sui tondini esposti è eliminata Rust on exposed rebar is eliminated with VpCI®-426 rust remover or grazie all’antiruggine VpCI®-426 o trattata con CorrVerter® Rust Primer. treated with CorrVerter® Rust Primer. Two coats of anti-corrosion Si consiglia di applicare due strati di anti-corrosivo MCI® su ogni tondino MCI® grout are recommended on any exposed o metallo esposto, seguita dall’applicazione di diverrebar or metal, followed by the application of se malte di riparazione a base di MCI® per ripristinavarious MCI® repair mortars to the concrete re la struttura in calcestruzzo. Una volta che le malte structure. Once the repair mortar is cured, MCI®di riparazione sono asciutte, viene spruzzata o appli2020’s powerful formula is sprayed, brushed, or cata a spazzola o a rullo la potente formula di MCI® rolled on in order for MCIs to penetrate through 2020, in modo da far penetrare gli MCI nel cemento concrete and attach to and protect the surface e farli aderire per proteggere la superficie dell’acciaio of embedded reinforcing steel. After sufficient di rinforzo incorporato. Dopo un sufficiente assorbiabsorption, other materials such as coatings or mento, è possibile applicare sopra altri materiali cowater repellants may be applied on top. me rivestimenti o sostanze idrorepellenti. A successful example of the HPRS® system in Un esempio vincente del sistema HPRS® in azione è action is highlighted in Cortec’s Case History 496 evidenziato dal case history 496 di Cortec sul ripristion the restoration and protection of concrete no e la protezione di condotte in cemento in Spagna. pipelines in Spain. The customer, C.A.T. (Consorci Il cliente, C.A.T. (Consorci d’Aigües de Tarragona), posD’Aigües De Tarragona), had a network of sedeva da almeno trent’anni una rete di tubazioni prefabricated reinforced concrete pipes at prefabbricate in cemento armato con problemi di 1 least thirty years old that were experiencing corrosione. Dopo la rimozione del cemento deteCortec’s High Performance Repair corrosion problems. After removal of damaged riorato e della ruggine, Quimilock, boiacca passivanSystem (HPRS®) brochure cover page. concrete and rust, Quimilock passivating te contenente MCI® 2006 NS, è stata applicata sul Copertina della brochure Cortec grout containing MCI®-2006 NS was applied tondino esposto. In seguito è stata utilizzata la malta relativa alla soluzione High Performance Repair System (HPRS®). to exposed rebar. Quimilock repair mortar di riparazione Quimilock con MCI® 2006 NS e, sucwith MCI®-2006 NS was used next, followed by cessivamente, è stato applicato MCI®-2020 su tutta MCI®-2020 application on the entire surface. Test results showed la superficie. I risultati delle prove hanno mostrato la diminuzione della decreased corrosion rates, and the customer was very pleased with velocità di corrosione, e il cliente è stato molto soddisfatto dei risultati the results of Cortec’s innovative MCI® products. ottenuti dai prodotti innovativi MCI® di Cortec. Case History 496 is only one example of the active corrosionIl case history 496 è solo un esempio del potere anticorrosivo di MCI®. inhibiting power of MCI®. Cortec® looks forward to providing more Cortec® sarà entusiasta di fornire ulteriori risultati positivi riguardo i fupositive results in the future use of MCI® HPRS® for concrete repairs. turi utilizzi di MCI® HPRS® per le riparazioni del calcestruzzo. For further information: www.cortecvci.com ‹ Per maggiori informazioni: www.cortecvci.com ‹ 02

N. 17 - 2016 APRIL - ipcm® Protective Coatings


COATING SPECIALIST ACHIEVES INDUSTRY STANDARDS Specialista di rivestimenti ottiene gli standard di settore

A

A

© Austin Hayes

coatings and finishing specialist has achieved three ustin Hayes, specialista di rivestimenti e finiture, ha ottenuto OneSubsea standards. tre standard OneSubsea. 60-year old firm, Austin Hayes (Fig. 1) is a market leader in L’azienda Austin Hayes (fig. 1), presente da 60 anni, è leader di the refurbishment of ammunition containers. With more than 30 mercato nel ripristino di contenitori di munizioni. Con oltre 30 anni years’ experience in providing specialised surface coatings services di esperienza nella fornitura di servizi specializzati di trattamento suacross a diverse range of industry sectors, the standards will enable perficiale per una vasta gamma di settori industriali, gli standard conthe company to continue to go from strength sentiranno alla società di continuare a crescere to strength and take on more work destined for e acquisire più commesse destinate ad ambienharsh environments. ti severi. Avendo lavorato direttamente con Having worked with OneSubsea direct and OneSubsea e attraverso una serie di loro clienti, through a number of its own clients, Austin Austin Hayes ha affrontato un percorso rigoroHayes endured a rigorous process which so che ha incluso la presentazione di una proincluded submitting a detailed procedure, cedura dettagliata, che documentasse le modocumenting how compliance would be dalità di raggiungimento della conformità. ensured. Once this was accepted, test plates for Una volta accettata questa procedura, i lamieeach coating system within each specification rini di prova per ciascun sistema di rivestimenwere processed under the independent witness to all’interno di ogni specifica sono stati elaof the OneSubsea inspection team. borati sotto la testimonianza indipendente del The standards, A-018036-()-(), introduced gruppo di ispezione OneSubsea. Le norme, in 2016 as OneSubsea Leeds new standard, A-018.036-()-(), introdotta nel 2016 come nuovo A-018089-()-(), for ENI S.p.A Projects and standard OneSubsea Leeds, A-018.089-()-(), per i A-018090-()-(), for Chevron Projects will allow progetti di Eni S.p.A. e A-018.090-()-(), per i proAustin Hayes to carry out further coatings work getti Chevron, permetteranno a Austin Hayes di within the oil and gas industry. svolgere ulteriori operazioni di rivestimento nel 1 As such, there is a substantial quantity settore oil & gas. of inspection tests required by these In quanto tali, vi è una notevole quantità di pro1 specifications, which are typical of the high ve di controllo richieste da queste specifiche, Julie Bickerdyke, Managing Director of standard required by the oil and gas sector. tipiche per l’elevato livello richiesto dal settore Austin Hayes. Examples of the tests include the cleanliness of oil & gas. Esempi di prove includono la pulizia Julie Bickerdyke, Managing Director the compressed air, the surface cleanliness of dell’aria compressa, la pulizia della superficie di Austin Hayes. the surface after blasting including the degree dopo la sabbiatura, compreso il livello di scaglie of mill scale and residual dust remaining, the di laminazione e polveri residue, il profilo susurface profile achieved, for possible salt contamination, the wet perficiale ottenuto, l’eventuale presenza di sali, lo spessore del film and dry film thickness, for adhesion obtained and if any pinholes asciutto e bagnato, l’adesione ottenuta e per l’eventuale presenza are present. di pinhole. Austin Hayes Technical Director Tonia Parris said: “Our shop Tonia Parris, direttore tecnico di Austin Hayes, ha dichiarato: “Il nostro floor team did an excellent job, and all of the tests passed with team del reparto di produzione ha fatto un ottimo lavoro e ha superaflying colours. The lead visiting inspector even commented on to tutti i test a pieni voti. L’ispettore, che ha visitato l’azienda, ha anche how smoothly the process was managed by Austin Hayes, our commentato l’eccellente gestione del processo, senza difficoltà, da professionalism and our excellent level of preparation for the tasks. parte di Austin Hayes, la nostra professionalità e il nostro eccellente liThe whole team put a lot of work into these qualifications, and vello di preparazione. Tutta la squadra ha lavorato molto per ottenere all will be very pleased to receive these endorsements of approval, queste qualifiche e tutti saranno molto lieti di ricevere queste approacknowledging the high standard we work to.” vazioni, che riconoscono l’elevato livello al quale lavoriamo.” For further information: www.austinhayes.com ‹ Per maggiori informazioni: www.austinhayes.com ‹

ipcm® Protective Coatings - 2016 APRIL - N. 17

03


PROTECTIVE COATINGS | BRAND-NEW

ABCITE 1060 AND ABCITE X60 PROVIDE BEST-IN-CLASS CORROSION PROTECTION, EVEN UNDER THE MOST SEVERE CONDITIONS Abcite 1060 e Abcite X60 forniscono la migliore protezione della categoria contro la corrosione anche nelle condizioni più difficili

A

A

© Axalta Coating Systems

bcite® 1060 and Abcite X60, from Axalta Coating bcite® 1060 e Abcite X60 di Axalta Coating Systems, tra i magSystems, a leading global manufacturer of liquid and giori produttori a livello globale di vernici liquide e in polvere, powder coatings, provide best-in-class and highlyforniscono una protezione duratura contro la corrosione su durable corrosion protection to aluminium, steel, copper alluminio, acciaio, rame ed altri metalli persino nelle condizioni più and other metals, even in the most severe and extremely estreme come gli ambienti marini abrasivi e in mare aperto. corrosive conditions including abrasive marine and offshore Abcite 1060 e Abcite X60 fanno parte della famiglia Abcite di vernici environments. in polvere termoplastiche progettate per essere robuste e resistenti Abcite 1060 and Abcite X60 are part of the Abcite family ai danni senza l’utilizzo di primer. Questi prodotti forniscono un’ecof engineered thermoplastic powder coatings, which are cellente protezione contro la corrosione e possono essere applicadesigned for toughness and chip-resistance without the ti tramite verniciatura a spruzzo elettrostatica o immersione in letto use of a primer. They provide excellent corrosion protection fluido. and can be sprayed Oltre al loro eccellente lielectrostatically or fluidvello di protezione conbed dipped. tro la corrosione, Abcite In addition to their 1060 e Abcite X60 sono excellent corrosion caratterizzati da eccezioprotection, Abcite 1060 nali qualità di resistenza and Abcite X60 deliver agli agenti atmosferici e outstanding weatherai raggi UV che li rendoand UV-resistance, no ideali per una lunga which make them ideal esposizione all’aperto. coatings for long-term Lo strato di vernice fornioutdoor exposure. sce grande durabilità in The coated layer caso di stress meccanici provides high durability e chimici, elementi acidi against mechanical e alcalini inclusi. Questa and chemical stress, durabilità significa che la 1 including acids and vernice non richiede maalkalis. This durability nutenzione per il ciclo 1 means the coating vitale del sistema o del Petroleum piping in an oil refinery. typically is maintenancecomponente verniciato, Condotte di petrolio in una raffineria petrolifera. free during the lifetime of con una relativa riduziothe coated component ne dei costi operativi. or system, helping to reduce operational costs. Marcel Melis, Sales Manager di Axalta per Sud Europa, Medio OrienMarcel Melis, Axalta Sales Manager for Southern Europe, te e Africa, ha detto: “Abcite 1060 e Abcite X60 dimostrano un’ecMiddle East and Africa, says: “Abcite 1060 and Abcite X60 cezionale durabilità che, abbinata alla resistenza contro abrasione demonstrate exceptional durability, and coupled with their e impatti, può realmente aiutare i nostri clienti ad ottenere prestaabrasion- and impact-resistance, these powder coatings can zioni senza eguali.” really help our customers achieve an unmatched performance.” Abcite 1060 può essere applicato tramite immersione in un letto Abcite 1060 can be applied in a fluidised bed while Abcite X60 fluido mentre Abcite X60 è applicato con una normale pistola a is applied with a conventional spray gun, which is particularly spruzzo – molto comodo se si tratta di verniciare elementi partiadvantageous when coating very large or geometrically colarmente grandi o con sezioni geometricamente complesse.

04

N. 17 - 2016 APRIL - ipcm® Protective Coatings


OIL&GAS

NEW CENTURION GUN THE MOST POWERFUL GUN OF ITS TIME POWERED BY IBIX® Nuova pistola Centurion, la più potente di sempre, powered by IBIX® Il primo balzo tecnologico da anni nel settore del rivestimento tubi con polvere termoplastica PP e PE

2

WIDE SPRAY PATTERN

THE FIRST TECHNOLOGICAL ADVANCE IN THE PIPE JOINT PP & PE COATING INDUSTRY IN YEARS

© Axalta Coating Systems

2

A carousel spinning in a park. Una giostra girevole in movimento in un parco. ®

complex parts. In both application processes, the powder is applied on the pre-heated surface to achieve good coverage in corners, on edges and other difficult areas. The heat stored in the metal causes the powder to melt and to build a homogeneous, non-porous coating layer. The average film thickness achieved in one pass is between 300μm and 600μm. Abcite 1060 and Abcite X60 perform exceptionally well in extremely corrosive and abrasive marine and offshore environments (Fig. 1). But Abcite, which has passed ISO 12944-6 [C5-M High and Im3] and ISO 20340 [C5-M], provides outstanding corrosion protection in other industries too. It is successfully used to coat components and piping - inside and outside - for potable water and sewage transportation, traffic and road facilities such as traffic lights and traffic signs, vessels, buildings and industrial plants, as well as fences and outdoor furniture (Fig. 2). For further information: www.powder.axaltacs. com, www.axaltacoatingsystems.com ‹

In ambedue i processi, per avere una buona copertura di angoli, bordi ed altre aree difficili la polvere viene applicata su superfici pre-riscaldate. Il calore immagazzinato nel metallo fa sciogliere la polvere creando uno strato di vernice omogeneo e non poroso. In media lo spessore del film che si raggiunge in un solo passaggio è tra 300μm e 600μm. Abcite 1060 e Abcite X60 mostrano ottimi livelli prestazionali in ambienti marini estremamente corrosivi ed abrasivi (fig. 1). I prodotti Abcite, che possono vantare le certificazioni ISO 12944-6 [C5-M High e Im3] e ISO 20340 [C5-M], forniscono una protezione ottimale contro la corrosione anche in altri settori. Vengono infatti utilizzati con successo per l’applicazione su componenti e tubazioni – all’interno e all’esterno – utilizzati per i sistemi di trasporto di acqua potabile e per le fognature, su semafori e segnaletica stradale, navi, palazzi e impianti industriali oltre che su staccionate e mobili da esterno (fig. 2). Per maggiori informazioni: www.powder.axaltacs.com, www.axaltacs.com/it/ ‹

IBIX® FLAME SPRAYING SYSTEM FOR THE INSTANT POWDER COATING GLADIATOR AND HERCULES, THE INNOVATIVE PORTABLE SYSTEMS FOR THE COATING OF METALS AND CONCRETE SUFACES

Sistema flame spray ® IBIX per il rivestimento istantaneo a polvere. Gladiator e Hercules gli innovativi sistemi portatili per il rivestimento di metalli e superfici cementizie. AUTOMATION: THE FLAME SPRAY COATING PROCESS CAN BE AUTOMATED FOR BUCKLE ARRESTORS, PIPE SECTIONS, BENDS, ETC. Automazione: Il processo di rivestimento a fiamma può essere automatizzato per buckle arrestors, tubi e curve

a division of

WWW.TECNOSUPPLY.COM - INFO@TECNOSUPPLY.COM


PROTECTIVE COATINGS | BRAND-NEW

HEMPEL’S DYNAMIC DELIVERS FUEL SAVINGS FOR LEMISSOLER Dynamic di Hempel consente a Lemissoler di risparmiare carburante

G

L

lobal shipmanagement company, Lemissoler Navigation, a società globale di gestione navale Lemissoler Navigation, attravervia its affiliated and managed company Frontmarine Co. Ltd, so la sua azienda consociata e controllata Frontmarine Co. Ltd, ha has achieved significant fuel savings from coating its ottenuto un notevole risparmio di carburante utilizzando per le sue newbuild 58,500dwt supramax bulk carriers with Hempel’s nuove navi portarinfuse supramax da 58,500 dwt il prodotto antivegetatiDynamic antifouling product. vo Dynamic di Hempel. As part of an environmental efficiency drive, Lemissoler has Come parte della sua filosofia di efficienza ambientale, Lemissoler ha adotadopted a unique hull design for the new vessels, fitted them with tato per le sue nuove navi uno scafo con un design unico, le ha equipagfuel-efficient propellers and coated the undersides with Hempel’s giate con eliche efficienti dal punto di vista energetico e ha verniciato la Dynamic antifouling. carena con il prodotto antivegetativo Dynamic di Hempel. According to the design specification, fuel consumption was Secondo le specifiche di progetto, il consumo di carburante in zavorra era calculated at 24.7 tonnes per day at 14.2 knots in ballast condition. stato previsto in 24,7 tonnellate al giorno a 14,2 nodi di velocità. Grazie alle Thanks to the eco-innovations, these vessels in sea trials are innovazioni ecologiche adottate, queste navi nelle prove in mare hanno achieving a fuel consumption of just 23 tonnes. consumato soltanto 23 tonnellate di carburante. Lemissoler Navigation has coated Lemissoler Navigation ha pitturato quattro four of the eight newbuilds with delle otto nuove imbarcazioni con il prodotDynamic and, based on its successful to antivegetativo Dynamic e, in base alle ottiperformance, is planning to coat the me prestazioni riscontrate, sta pianificando la remaining four vessels with the same verniciatura delle restanti quattro navi con lo product. stesso prodotto. Andreas Glud, Group Product Hempel’s Group Product Manager, Manager di Hempel, spiega perché Dynamic Andreas Glud, explains why (fig. 1) ha così successo: “L’antivegetativa Dynamic (Fig. 1) has been so Dynamic è basata sull’idrolisi della matrice successful: “Dynamic is a low friction, silil-acrilata. È un prodotto a basso coefficienhydrolysing silyl acrylate, which te d’attrito che, oltre ad offrire ai nostri clienti 1 © Hempel gives our customers an outstanding un’eccellente protezione antivegetativa, conantifouling service and delivers sente loro di risparmiare in media fino al 4% di 1 average fuel savings of up to 4 carburante. Inoltre, la nostra tecnologia breHempel’s Dynamic antifouling product is a low friction, per cent. Our patented microfiber vettata con microfibre, parte fondamentale hydrolysing silyl acrylate which gives an outstanding technology, which is integral to della sua formulazione, le conferisce un’ecceantifouling service and delivers average fuel savings of up to this paint, gives it an exceptional zionale resistenza meccanica che riduce dra4 per cent. mechanical strength that reduces Dynamic, antivegetativa di Hempel, è un prodotto a basso sticamente i fenomeni di cracking e peeling. coefficiente d’attrito basato sull’idrolisi della matrice cracking and peeling. Based on the Sulle nuove navi Frontmarine, il nostro prosilil-acrilata. Offre un eccellente effetto antivegetativo e fuel savings demonstrated in these dotto antivegetativo Dynamic è risultato esconsente di risparmiare in media fino al 4% di carburante. trials, our Dynamic antifouling is a sere un fattore determinante nel consentire, contributing factor to an overall fuel saving of 7 per cent for the durante le prove in mare, un risparmio complessivo del 7%”. new Frontmarine vessels.” Dimitris Solomonides, Technical Manager del Gruppo Lemissoler, afferLemissoler Group’s Technical Manager, Mr. Dimitris Solomonides ma: “Siamo lieti dei risultati raggiunti nelle ultime prove in mare effetsays: “We are delighted with the results of the recent sea trials of the tuate con le prime quattro nuove navi. Diminuire l’impatto ambientale first four new vessels. Lessening the environmental impact of our delle nostre attività e migliorare l’efficienza nel consumo di carburante activities and improving fuel efficiency is one of our top priorities sono tra le nostre priorità principali. Siamo convinti che il design innovatiand we believe that the innovative design of the newbuilds, the fuel vo delle nuove navi, l’efficienza energetica delle eliche e l’antivegetativa efficient propeller and Hempel’s Dynamic antifouling have proved Dynamic di Hempel abbiano dimostrato di essere una combinazione to be a winning combination in delivering these efficiencies.” vincente per raggiungere questi obiettivi”. For further information www.hempel.com ‹ Per maggiori informazioni: www.hempel.com ‹ 06

N. 17 - 2016 APRIL - ipcm® Protective Coatings


PERSTORP ENABLES CUSTOMERS TO COMMERCIALIZE INNOVATIVE POLYURETHANE SOLUTIONS FASTER Perstorp consente ai clienti di commercializzare soluzioni innovative in poliuretano più rapidamente

P

erstorp is the market leader in caprolactone products, bringing over 40 years of experience to the market. Its unique production process developed over many years provides caprolactones with improved properties and exceptional consistency that enable durable and long-lasting polyurethane products. Increased demand for high performance polyurethanes has led Perstorp to embark on numerous initiatives in preparation for future customer needs. These initiatives include an investment in a fully equipped application lab; recruitment of expert resources to further support customer development and collaboration; and signing of a distribution partnership with Nexeo Solutions to increase speed of Perstorp products to the market. “The new laboratory equipment and expert resources will enable our customers to work more closely with us as well as for us to better understand and support their future needs. Along with our recent investments in a pilot plant facility, this is an exciting way for us to develop solutions for the future together with our customers where they can shorten time to market with innovative products”, says Stephen Lewis, Vice President, Business Unit Capa™, Perstorp. The new laboratory will further enhance Perstorp formulation capabilities for two-component polyurethane systems as well as prepolymers for hot-cast elastomers. As a response to specific customer requests as well as general market trends for longer life and more durable polyurethanes, Perstorp is in the forefront of bringing these new innovative polyol technologies forward. Caprolactone based polyurethanes are known for their exceptional properties in terms of durability and long-lasting performance. Capa™ polyols add value to the end-products by delivering qualities such as endurance and longevity. Capa™ provides cost savings for industrial parts where longer-lasting properties lead to lower maintenance and failure costs. The ability to perform in harsh conditions could also help build greater brand confidence for consumer products. Perstorp signed a partnership with Nexeo Solutions last September. “This agreement has enabled us to work even closer with customers and help them increase speed to market”, says Robert Magro, Sales Director Americas, Perstorp. Nexeo Solutions is responsible for distributing the Capa™ product line in several United States regions. “Our partnership with Perstorp is highly complementary to our polyurethane portfolio,” says Joey Gullion, VP End Market, Chemicals for Nexeo Solutions, “Our customers are appreciative of the quick sample turn-around time and access to product specialists from Perstorp.” For further information: www.perstorp.com ‹

P

erstorp è leader di mercato nel settore dei caprolattoni, con oltre 40 anni di esperienza sul mercato. Il suo processo produttivo unico, sviluppato nel corso di diversi anni, fornisce caprolattoni con proprietà migliorate e un’eccellente costanza, fattori che consentono la produzione di prodotti poliuretanici resistenti e duraturi. L’aumento della domanda dei poliuretani ad alte prestazioni ha portato Perstorp a intraprendere numerose iniziative in preparazione delle esigenze future dei clienti. Queste iniziative includono: l’investimento in un laboratorio applicativo completamente attrezzato; assunzione di esperti per supportare ulteriormente lo sviluppo dei clienti e la collaborazione; firma di una partnership di distribuzione con Nexeo Solutions per portare i prodotti Perstorp più velocemente sul mercato. “Le nuove attrezzature di laboratorio e il personale esperto consentiranno ai nostri clienti di lavorare a stretto contatto con noi. In questo modo, potremo meglio comprendere e sostenere le loro esigenze future. Insieme ai nostri recenti investimenti in un impianto pilota, questo rappresenta per noi uno stimolo per sviluppare le soluzioni del futuro insieme ai nostri clienti, sostenendoli nella riduzione dei tempi di commercializzazione con prodotti innovativi”, dichiara Stephen Lewis, Vice President, Business Unit Capa™, Perstorp. Il nuovo laboratorio migliorerà ulteriormente le capacità di formulazione di Perstorp per sistemi poliuretanici bicomponenti e per i prepolimeri dedicati agli elastomeri hot cast. In risposta alle richieste specifiche dei clienti nonché alle tendenze generali del mercato per poliuretani di maggiore durata e più resistenti, Perstorp è in prima linea nello sviluppare ulteriormente queste nuove tecnologie innovative a base di polioli. I poliuretani a base di caprolattone sono noti per le loro eccezionali proprietà in termini di durabilità e di prestazioni di lunga durata. I polioli Capa™ aggiungono valore ai prodotti finali fornendo caratteristiche come la resistenza e la longevità. Capa™ consente di risparmiare sui costi per i pezzi industriali, poiché le proprietà di maggiore durata portano a ridurre i costi relativi a manutenzione e guasti. Per i prodotti di consumo, la possibilità di operare in condizioni severe potrebbe inoltre aiutare ad aumentare la fiducia nel marchio. Perstorp, lo scorso settembre, ha firmato una partnership con Nexeo Solutions. “Questo accordo ci ha permesso di lavorare ancora più vicini ai clienti, aiutandoli ad aumentare la velocità di commercializzazione dei prodotti”, afferma Robert Magro, Sales Director Americas, Perstorp. Nexeo Solutions è responsabile della distribuzione della linea di prodotti Capa™ in diverse regioni degli Stati Uniti. “La nostra partnership con Perstorp è altamente complementare alla nostra gamma di poliuretani”, afferma Joey Gullion, VP End Market, Chemicals di Nexeo Solutions. “I nostri clienti sono contenti dei tempi rapidi di consegna dei campioni e di avere accesso agli specialisti di prodotto di Perstorp”. Per ulteriori informazioni: www.perstorp.com ‹

ipcm® Protective Coatings - 2016 APRIL - N. 17

07


PROTECTIVE COATINGS | BRAND-NEW

COVERING AND PROTECTING LONDON WALL PLACE Rivestire e proteggere il London Wall Place

P

© Sherwin-Williams

aint and coatings leader Sherwin-Williams has secured a further contract working on a major landmark development in the capital for the project London Wall Place (Fig. 1). This follows projects for iconic buildings including The Shard, The Leadenhall Building, Tower Bridge, St Pancras Station, Heathrow and the Olympic Park. For this project, Sherwin-Williams Protective and Marine Coatings Europe, Middle East and Africa (EMEA) will provide Epigrip C400V3 multi-functional epoxy zinc phosphate coating, FIRETEX FX2003 intumescent coating, FIRETEX M95 epoxy intumescent coating, FIRETEX M71V2, Resistex C137V2 special finish and Resistex C237 sheen finish. Rick Perkins, FIRETEX Project Development Manager for Sherwin-Williams Protective & Marine Coatings Europe, Middle East and Africa (EMEA), said: “This is another 1 iconic project that requires the very 1 highest levels of quality products, and The London Wall Place under construction. Il London Wall Place in fase di realizzazione. we will be working closely with our partners to ensure the very best in protection for the future.” The London Wall Place development is a 500,000 sq ft destination that will provide two landmark commercial buildings and an acre of landscaped public realm. The new open space will create a unique destination for the area through a series of new gardens set amongst historic landmarks including the Roman City Wall and St Alphage Church Tower ruins. The site extends for over two acres and is located on London Wall between Moorgate and the Barbican. A unique feature of the London Wall Place project will be the 08

N. 17 - 2016 APRIL - ipcm® Protective Coatings

S

herwin-Williams, leader nel settore vernici e rivestimenti, si è assicurata un’ulteriore commessa nello sviluppo di una importante pietra miliare nella capitale per il progetto London Wall (fig. 1). Questo segue altri progetti per edifici emblematici, tra cui The Shard, The Leadenhall Building, Tower Bridge, la stazione di St Pancras, Heathrow e il Parco Olimpico. Per questo progetto, Sherwin-Williams Protective and Marine Coatings Europe, Middle East and Africa (EMEA) fornirà Epigrip C400V3, rivestimento epossidico multifunzionale ai fosfati di zinco, FIRETEX FX2003, rivestimento intumescente, FIRETEX M95, rivestimento intumescente epossidico, FIRETEX M71V2, Resistex C137V2 finitura speciale e Resistex C237 finitura brillante. Rick Perkins, Responsabile Sviluppo Progetti FIRETEX per Sherwin-Williams Protective & Marine Coatings Europe, Middle East and Africa (EMEA), ha dichiarato: “Questo è un altro progetto significativo che richiede il più alto livello di qualità dei prodotti, e noi lavoreremo a stretto contatto con i nostri partner al fine di garantire la migliore protezione per il futuro.” Il progetto del London Wall Place è un’area di 500.000 piedi quadri (oltre 46.400 m2) che ospiterà due importanti edifici commerciali e un acro di verde pubblico. Il nuovo spazio aperto costituirà un’area unica per il territorio attraverso una serie di nuovi giardini incastonati tra monumenti storici, tra cui le mura della città romana e le rovine del campanile della chiesa di San Alphage. Il sito si estende per oltre due acri e si trova sul London Wall, tra Moorgate e il Barbican. Una caratteristica unica del progetto London Wall Place sarà il ripristino di strutture e passerelle per il passaggio pedonale; queste attraver-


reinstated walkway structures, or highwalks, that will cross the site to re-establish links to other parts of the City’s high-level walkways. Seven walkway structures fabricated from weathering steel will be installed as part of William Hare’s steel package. The building to be known as 1 London Wall Place is a 300,000 sq ft building arranged over 12 storeys. The innovative design provides floor plates of 9,000 sq ft to 42,000 sq ft and includes over 35,000 sq ft of roof terraces for exclusive tenant use. Main contractor is Brookfield Multiplex, and steelwork sub-contractor is William Hare. Architect for the development is Make. At 2 London Wall Place is a 16-storey tower providing floors of 12,000 sq ft including vertical glazing strips and a spectacular triple height space at the top of the building. Each building will include the construction of a deep basement made of concrete, while a steel frame will form the office floor plates, roof and terraces above ground. A striking feature of both buildings will be the cantilevering of the steel frame out above London Wall allowing a user-friendly public thoroughfare. For further information: www.sherwin-williams.com ‚

seranno il sito per ristabilire i collegamenti con le altre passerelle delle altre zone della città . Saranno installate sette passerelle pedonali in acciaio autopassivante (Cor-Ten), facenti parte del pacchetto di strutture in acciaio fornite da William Hare. L’edificio conosciuto come London Wall Place 1 è un edificio di 300.000 piedi quadri (quasi 28.000 metri quadri) disposto su 12 piani. Il design innovativo prevede lastre di pavimentazione da 9.000 a 42.000 piedi quadri (da circa 836 m2 a circa 3.900 m2) e comprende oltre 35.000 piedi quadri (circa 3.250 m2) di terrazze ad uso esclusivo degli inquilini. Il committente principale è Brookfield Multiplex e la carpenteria subappaltatrice è William Hare. Lo studio di architettura addetta allo sviluppo è Make. Il London Wall Place 2 è una torre di 16 piani che occupa 12.000 piedi quadri (circa 1.110 m2), comprese le vetrate verticali e uno spazio spettacolare a tripla altezza in cima all’edificio. Ogni edificio prevede anche la realizzazione di un profondo basamento in cemento, mentre un telaio in acciaio formerà le lamiere per la pavimentazione degli uffici, tetto e terrazze. Una caratteristica sorprendente di entrambi gli edifici sarà lo sbalzo dei telai in acciaio sopra il London Wall, che consentiranno l’apertura di una strada transitabile pubblica user-friendly. Per maggiori informazioni: www.sherwin-williams.com ‚

6WUXPHQWL WDVFDELOL SHU OD PLVXUD GHOOR VSHVVRUH GHL ULYHVWLPHQWL D LQGX]LRQH PDJQHWLFD H R D FRUUHQWL LQGRWWH D QRUPD ',1 (1 ,62 H R

'8$/6&23( 03 5 H 03 5 )3 '8$/6&23( 03 5 H 03 5 )3 '8$/6&23( 03 5 H 03 5 )3 '8$/6&23( 03 5 H 03 5 )3 '8$/6&23( 03 5 H 03 5 )3 '8$/6&23( 03 5 H 03 5 )3 /D VHULH GL VWUXPHQWL WDVFDELOL 03 H 03 5 q LGHDOH SHU LO /D VHULH GL /D VWUXPHQWL VHULH GL WDVFDELOL VWUXPHQWL 03 WDVFDELOL H 03 5 03 q H LGHDOH 03 5 SHU q LGHDOH LO SHU LO FRQWUROOR TXDOLWj QHOOD YHULILFD GHOOR VSHVVRUH GHL ULYHVWLPHQWL QHO /D VHULH GL VWUXPHQWL WDVFDELOL 03 H 03 5 q LGHDOH SHU LO /D VHULH GL VWUXPHQWL WDVFDELOL 03 H 03 5 q LGHDOH SHU /D VHULH GL VWUXPHQWL WDVFDELOL 'RWDWL 03 GL H 03 5 LGHDOH R SHU LO FRQWUROOR TXDOLWj QHOOD YHULILFD GHOOR VSHVVRUH GHL ULYHVWLPHQWL QHO FRQWUROOR TXDOLWj QHOOD YHULILFD GHOOR VSHVVRUH GHL ULYHVWLPHQWL QHO VHWWRUH DQWLFRUURVLRQH VRQGD q LQWHJUDWD HVWHUQD D LO FRQWUROOR TXDOLWj QHOOD YHULILFD GHOOR VSHVVRUH GHL ULYHVWLPHQWL QHO FRQWUROOR TXDOLWj QHOOD YHULILFD GHOOR VSHVVRUH GHL ULYHVWLPHQWL QHO VHWWRUH DQWLFRUURVLRQH VHWWRUH DQWLFRUURVLRQH 'RWDWL GL VRQGD 'RWDWL LQWHJUDWD GL VRQGD R LQWHJUDWD HVWHUQD D R HVWHUQD D FRQWUROOR TXDOLWj QHOOD YHULILFD GHOOR VSHVVRUH GHL ULYHVWLPHQWL QHO VHFRQGD GHOOÂśHVLJHQ]D PLVXUDQR VLD VX EDVL PHWDOOLFKH IHUURVH VHWWRUH DQWLFRUURVLRQH 'RWDWL GL VRQGD LQWHJUDWD R HVWHUQD VHWWRUH DQWLFRUURVLRQH GL LQWHJUDWD R D HVWHUQD D D GHOOÂśHVLJHQ]D VHFRQGD GHOOÂśHVLJHQ]D PLVXUDQR VLD PLVXUDQR VX VRQGD EDVL VLD PHWDOOLFKH EDVL IHUURVH PHWDOOLFKH IHUURVH VHWWRUH VHFRQGD DQWLFRUURVLRQH 'RWDWL GL 'RWDWL VRQGD LQWHJUDWD R VX HVWHUQD FKH VX EDVL PHWDOOLFKH QRQ IHUURVH PLVXUDQR VLD EDVL PHWDOOLFKH IHUURVH VHFRQGD GHOOÂśHVLJHQ]D FKH VX EDVL PHWDOOLFKH QRQ IHUURVH FKH VX EDVL PHWDOOLFKH QRQ IHUURVH VHFRQGD GHOOÂśHVLJHQ]D PLVXUDQR VLD VX VX EDVL PHWDOOLFKH VHFRQGD GHOOÂśHVLJHQ]D PLVXUDQR VLD VX EDVL PHWDOOLFKH IHUURVH IHUURVH FKH VX EDVL PHWDOOLFKH QRQ IHUURVH FKH VX EDVL PHWDOOLFKH QRQ IHUURVH

FKH VX EDVL PHWDOOLFKH QRQ IHUURVH /R VWUXPHQWR ULFRQRVFH DXWRPDWLFDPHQWH LO PDWHULDOH GL EDVH VRWWR LO ULSRUWR H

/R XWLOL]]D LO FRUUHWWR PHWRGR GL PLVXUD $SSOLFDELOH VROR DJOL VWUXPHQWL 'XDOVFRSHŠ

VWUXPHQWR ULFRQRVFH /R VWUXPHQWR DXWRPDWLFDPHQWH ULFRQRVFH DXWRPDWLFDPHQWH LO PDWHULDOH GL LO EDVH PDWHULDOH VRWWR LO GL ULSRUWR EDVH VRWWR H LO ULSRUWR H XWLOL]]D LO FRUUHWWR PHWRGR GL PLVXUD $SSOLFDELOH VROR DJOL VWUXPHQWL 'XDOVFRSHŠ

XWLOL]]D LO FRUUHWWR PHWRGR GL PLVXUD $SSOLFDELOH VROR DJOL VWUXPHQWL 'XDOVFRSHŠ

/R VWUXPHQWR ULFRQRVFH DXWRPDWLFDPHQWH LO PDWHULDOH GL EDVH VRWWR LO ULSRUWR H %DVVD LQIOXHQ]D DOOD SHUPHDELOLWj PDJQHWLFD FRQGXFLELOLWj HOHWWULFD H JHRPHWULD • /R VWUXPHQWR ULFRQRVFH DXWRPDWLFDPHQWH LO PDWHULDOH GL LO EDVH VRWWR /R VWUXPHQWR ULFRQRVFH DXWRPDWLFDPHQWH LO PDWHULDOH GL EDVH VRWWR ULSRUWR H LO ULSRUWR H %DVVD LQIOXHQ]D DOOD SHUPHDELOLWj PDJQHWLFD FRQGXFLELOLWj HOHWWULFD H JHRPHWULD %DVVD LQIOXHQ]D DOOD SHUPHDELOLWj PDJQHWLFD FRQGXFLELOLWj HOHWWULFD H JHRPHWULD XWLOL]]D LO FRUUHWWR PHWRGR GL PLVXUD $SSOLFDELOH VROR DJOL VWUXPHQWL 'XDOVFRSHŠ

GHO PDWHULDOH GL EDVH &XUYDWXUD VSHVVRUH HFF

XWLOL]]D LO FRUUHWWR PHWRGR GL PLVXUD $SSOLFDELOH VROR DJOL VWUXPHQWL 'XDOVFRSHŠ

XWLOL]]D LO FRUUHWWR PHWRGR GL PLVXUD $SSOLFDELOH VROR DJOL VWUXPHQWL 'XDOVFRSHŠ

GHO PDWHULDOH GL EDVH &XUYDWXUD VSHVVRUH HFF

GHO PDWHULDOH GL EDVH &XUYDWXUD VSHVVRUH HFF

7DVFDELOH SHU PLVXUH DIILGDELOL DQFKH LQ DUHH GLIILFLOL GD UDJJLXQJHUH 3HVD VROR • %DVVD LQIOXHQ]D DOOD SHUPHDELOLWj PDJQHWLFD FRQGXFLELOLWj HOHWWULFD H JHRPHWULD %DVVD LQIOXHQ]D DOOD SHUPHDELOLWj PDJQHWLFD FRQGXFLELOLWj HOHWWULFD H JHRPHWULD 7DVFDELOH SHU PLVXUH DIILGDELOL DQFKH LQ DUHH GLIILFLOL GD UDJJLXQJHUH 3HVD VROR 7DVFDELOH SHU PLVXUH DIILGDELOL DQFKH LQ DUHH GLIILFLOL GD UDJJLXQJHUH 3HVD VROR %DVVD LQIOXHQ]D DOOD SHUPHDELOLWj PDJQHWLFD FRQGXFLELOLWj HOHWWULFD H JHRPHWULD GHO PDWHULDOH GL EDVH &XUYDWXUD VSHVVRUH HFF

J R] VHQ]D EDWWHULH

GHO PDWHULDOH GL EDVH &XUYDWXUD VSHVVRUH HFF

J R] VHQ]D EDWWHULH

J R] VHQ]D EDWWHULH

GHO PDWHULDOH GL EDVH &XUYDWXUD VSHVVRUH HFF

• 7DVFDELOH SHU PLVXUH DIILGDELOL DQFKH LQ DUHH GLIILFLOL GD UDJJLXQJHUH 3HVD VROR 'RSSLR GLVSOD\ SHU XQD YLVXDOL]]D]LRQH FRQIRUWHYROH GHO ULVXOWDWR 7DVFDELOH SHU PLVXUH DIILGDELOL DQFKH LQ DUHH GLIILFLOL GD UDJJLXQJHUH 3HVD VROR 'RSSLR GLVSOD\ 'RSSLR SHU GLVSOD\ XQD YLVXDOL]]D]LRQH SHU XQD YLVXDOL]]D]LRQH FRQIRUWHYROH FRQIRUWHYROH GHO ULVXOWDWR GHO ULVXOWDWR 7DVFDELOH SHU PLVXUH DIILGDELOL DQFKH LQ DUHH GLIILFLOL GD UDJJLXQJHUH 3HVD VROR J R] VHQ]D EDWWHULH

9DOXWD]LRQH VWDWLVWLFD D VFKHUPR J R] VHQ]D EDWWHULH

9DOXWD]LRQH VWDWLVWLFD D VFKHUPR 9DOXWD]LRQH VWDWLVWLFD D VFKHUPR J R] VHQ]D EDWWHULH

6RIWZDUH )LVFKHU GDWD FHQWHU • 'RSSLR GLVSOD\ SHU XQD YLVXDOL]]D]LRQH FRQIRUWHYROH GHO ULVXOWDWR 'RSSLR GLVSOD\ SHU XQD YLVXDOL]]D]LRQH GHO ULVXOWDWR 'RSSLR 6RIWZDUH )LVFKHU GDWD FHQWHU GLVSOD\ SHU 6RIWZDUH )LVFKHU GDWD FHQWHU XQD YLVXDOL]]D]LRQH FRQIRUWHYROH FRQIRUWHYROH GHO ULVXOWDWR &ROOHJDPHQWR D 3& WUDPLWH SRUWD 86% .LW GDWL RS]LRQDOH

• 9DOXWD]LRQH VWDWLVWLFD D VFKHUPR )&-.65 '*4$)&3 4 S M &ROOHJDPHQWR D 3& WUDPLWH SRUWD 86% .LW GDWL RS]LRQDOH

&ROOHJDPHQWR D 3& WUDPLWH SRUWD 86% .LW GDWL RS]LRQDOH

9DOXWD]LRQH VWDWLVWLFD D VFKHUPR 6RIWZDUH )LVFKHU GDWD FHQWHU &DPSLRQL FHUWLILFDWL RS]LRQDOL SHU YHULILFD H WDUDWXUD VWUXPHQWDOH 9DOXWD]LRQH VWDWLVWLFD D VFKHUPR • 7JB ( EJ 7JUUPSJP &DPSLRQL FHUWLILFDWL RS]LRQDOL SHU YHULILFD H WDUDWXUD VWUXPHQWDOH &DPSLRQL FHUWLILFDWL RS]LRQDOL SHU YHULILFD H WDUDWXUD VWUXPHQWDOH 6RIWZDUH )LVFKHU GDWD FHQWHU • &ROOHJDPHQWR D 3& WUDPLWH SRUWD 86% .LW GDWL RS]LRQDOH

4FTUP 4BO (JPWBOOJ .* 6RIWZDUH )LVFKHU GDWD FHQWHU &ROOHJDPHQWR D 3& WUDPLWH SRUWD 86% .LW GDWL RS]LRQDOH

5FM • &DPSLRQL FHUWLILFDWL RS]LRQDOL SHU YHULILFD H WDUDWXUD VWUXPHQWDOH &ROOHJDPHQWR D 3& WUDPLWH SRUWD 86% .LW GDWL RS]LRQDOH

&DPSLRQL FHUWLILFDWL RS]LRQDOL SHU YHULILFD H WDUDWXUD VWUXPHQWDOH www.helmut-fischer.com FNBJM JUBMZ!IFMNVUGJTDIFS DPN &DPSLRQL FHUWLILFDWL RS]LRQDOL SHU YHULILFD H WDUDWXUD VWUXPHQWDOH

6SHVVRUH

$QDOLVL GHL 0DWHULDOL

0LFUR 'XUH]]D

3URYH GHL 0DWHULDOL


PROTECTIVE COATINGS | BRAND-NEW

BIOCORR® RECEIVES EU TRADEMARK APPROVAL BioCorr® riceve dall’UE l’approvazione per il marchio registrato

C

C

Typical Applications

Applicazioni tipiche

- Biodegradable preservative for machines and equipment - Temporary coating for storage and shipment - Protection of pipes, flanges, gears - Cast iron, sheets, and coils

- Conservante biodegradabile per macchine e attrezzature. - Rivestimento temporaneo per lo stoccaggio e la spedizione. - Protezione di tubazioni, flange, ingranaggi. - Adatto a ghisa, lastre e bobine.

ortec® Corporation proudly announces that its ortec® Corporation è lieta di annunciare che il suo antiruggibiobased and biodegradable rust preventative ne prodotto con materie prime rinnovabili e biodegradabili - BioCorr® - has received registered trademark BioCorr® - ha ricevuto l’approvazione per la registrazione del approval from EU’s Office of Harmonization. BioCorr® (Fig. 1) marchio da parte dell’Ufficio per l’Armonizzazione dell’UE. BioCorr® is a water based, ready to use formulation intended for (fig. 1) è un prodotto a base acqua; la sua formulazione pronta all’upreservation of metals so è finalizzata alla conserin storage and during vazione dei metalli durante transportation (Fig. 2). lo stoccaggio e il trasporto This innovative solution is (fig. 2). Questa soluzione formulated with renewable innovativa è formulata con raw materials and contains materie prime rinnovabili e 64% biobased content. contiene il 64% di sostanIt provides multi-metal ze bio. Esso fornisce protecorrosion protection by zione contro la corrosione combining film-forming multi-metal, combinando adadditives with Vapor ditivi filmogeni e inibitiori delphase Corrosion Inhibitors la corrosione in fase vapore (VpCI®s). (VpCI®s). BioCorr® is an BioCorr® è un’alternativa environmentally sound ecologica rispetto ai pericoalternative to hazardous losi prodotti derivati dal pepetroleum derived trolio. Questa formulazione products. This ready-to-use pronta all’uso può fornire 1 © Cortec formulation can provide protezione fino a due anprotection for up to two ni per lo stoccaggio interno 1 years of indoor storage or oppure durante le spedizioBioCorr® is an environmentally sound alternative to hazardous petroleum derived during shipments (Fig. 3). ni (fig. 3). Diversamente daproducts. Unlike rust preventative oils, BioCorr® è un’alternativa ecologica rispetto ai pericolosi prodotti derivati dal gli oli antiruggine, BioCorr® water-based BioCorr® leaves petrolio. è a base acqua e lascia sula dry film on the surface of la superficie del metallo un the metal that is virtually undetectable. This feature helps to film secco, che è praticamente inosservabile. Questa caratteristica create a clean workplace and prevent material waste. contribuisce a creare un ambiente di lavoro pulito e prevenire gli BioCorr® is VOC free and it’s biodegradable formulation sprechi di materiale. enables eliminating expensive disposal costs associated BioCorr® è senza COV (composti organici volatili) e la sua formula with hazardous mineral oils and flammable solvents. biodegradabile consente di eliminare i dispendiosi costi di smaltiBioCorr® does not contain any chlorinated compounds, mento associati ai pericolosi oli minerali e ai solventi infiammabili. chromates, or nitrites. It has been awarded USDA BioCorr® non contiene composti di cloro, cromati, o nitriti. Ha ricevuBioPreferredSM designation (www.preferred.gov). to il titolo di USDA BioPreferredSM (www.preferred.gov).

10

N. 17 - 2016 APRIL - ipcm® Protective Coatings


Case study

Case Study

© Cortec

Daughter company of global manufacturer Daido Metal Una consociata del produttore mondiale Daido Metal stava speriwas experiencing corrosion problems during exporting of mentando problemi legati alla corrosione durante l’esportazione automotive parts using sea going containers. The end users di pezzi per automobili utilizzando container marittimi. Gli utilizof bearings, zatori finali di cubushings and scinetti, boccothrust washers le e rondelle di are engine spinta sono proproducers: Volvo duttori di motoand Ford. Time ri: Volvo e Ford. in transit from Il tempo per il manufacturer’s transito dal luolocation in go di produzioMontenegro ne in Monteneto the engine gro agli impianti assembly plants di assemblaggio is typically 2-4 del motore è in months. The genere dai 2 ai traditional rust 4 mesi. Gli oli 2 inhibiting oils tradizionali andid not prevent tiruggine non 2 oxidation impedivano l’osBioCorr® is intended for preservation of metals in storage and during transportation. and pitting sidazione e il BioCorr® è fi nalizzato alla conservazione di metalli durante lo stoccaggio e il trasporto. of the special pitting della lega aluminum alloy speciale di alluused to produce these high-tech engine components. minio utilizzata per la produzione di questi componenti per moThis resulted in significant losses from production delays tori ad alta tecnologia. Ciò ha provocato perdite significative a and rejected parts. The customer tested BioCorr® in their causa di ritardi di produzione e pezzi scartati. laboratory with promising results and a pilot plant trial Il cliente ha testato BioCorr® nel proprio laboratorio ottenendo was initiated. This prompted risultati promettenti ed ha cothe customer’s decision to sì avviato una sperimentazioimplement a plant-wide, ne su un impianto pilota. Ciò full scale implementation ha indotto il cliente a prendeof BioCorr® to replace rust re la decisione di industrializinhibiting oils. Corrosion zare BioCorr® su larga scala per problems during storage sostituire gli oli antiruggine. I and shipping are solved. problemi di corrosione durante The bearings, bushings and lo stoccaggio e il trasporto so3 © Cortec thrust washers have shown no stati risolti. Cuscinetti, bocno sign of corrosion, even cole e rondelle di spinta non 3 after extended field testing up hanno mostrato alcun segno BioCorr® test results. to twelve months. As a result di corrosione, anche dopo aver BioCorr®: risultati delle prove. delivered parts are oil free, dry esteso il test fino a dodici mesi. to the touch and protected with Di conseguenza i pezzi sono very cost-effective method. ora consegnati senza olio, asciutti al tatto e protetti con un meBioCorr® also enables the company to demonstrate todo molto conveniente. BioCorr® permette inoltre all’azienda di their clients and local community their environmental dimostrare ai propri clienti e alla comunità locale la propria sostesustainability and awareness. nibilità e coscienza ambientale. For further information: www.cortecvci.com ‹ Per ulteriori informazioni: www.cortecvci.com ‹

ipcm® Protective Coatings - 2016 APRIL - N. 17

11


PROTECTIVE COATINGS | BRAND-NEW

EXCEPTIONAL DURABILITY FROM THE NEW SHERWIN-WILLIAMS WATER BASED BLAST PRIMER Durabilità eccezionale con il nuovo blast primer a base acqua di Sherwin-Williams

T

he newly-released Pro-Cryl 7000 by Sherwin-Williams is a water-based pre-fabrication blast primer, which provides temporary protection for steel surfaces (Fig. 1) prepared by abrasive blast cleaning. Pro-Cryl’s durability far exceeds any competitive waterbased product, giving long-term weather resistance leading to an extended fabrication window. Compared to its closest competitive product, Pro-Cryl 7000 offers a 40% reduction in the amount of corrosion seen on a panel when corrosion tested over a period of seven days (50 μm dft blast clean to Sa2½ BS EN ISO 8501-1:2007).

1

S

herwin-Williams ha rilasciato un nuovo prodotto, Pro-Cryl 7000, un blast primer di pre-fabbricazione a base acqua che offre la protezione temporanea delle superfici in acciaio (fig. 1) preparate mediante sabbiatura.

© Sherwin-Williams

1

La durata di Pro-Cryl supera abbondantemente quella di qualsiasi prodotto concorrente a base acqua, offrendo una resistenza alle intemperie maggiore che porta a beneficiare di una finestra di lavorazione più ampia. Rispetto ai prodotti più strettamente in concorrenza, Pro-Cryl 7000 riduce del 40% la quantità di corrosione osservata su un pannello testato per un periodo di 7 giorni (50 μm dft blast clean to Sa2½ BS EN ISO 8501-1:2007).

Pro-Cryl 7000 is a water-based pre-fabrication blast primer, which provides temporary protection

Sherwin-Williams Sherwin-Williams ha for steel surfaces prepared by abrasive blast cleaning. It’s designed for use in shop applications. aims to develop come obiettivo lo sviPro-Cryl 7000 è un blast primer di pre-fabbricazione a base acqua che offre la protezione products which luppo di prodotti che temporanea delle superfici in acciaio preparate mediante sabbiatura. provide the attributes offrano ai produttori which fabricators le caratteristiche di cui need: With this in mind Pro-Cryl is a fast-drying product hanno bisogno: in quest’ottica, Pro-Cryl è un prodotto ad asciugawhich is touch-dry after only 15 minutes, has low VOC and tura rapida, secco al tatto dopo soli 15 minuti, con contenuto COV is easy to apply. ridotto e facile da applicare. Designed for use in shop applications, it is fully weldable and the product of choice when environmental regulations are of prime importance to the user.

È progettato per applicazioni in officina, è completamente saldabile e rappresenta la prima scelta quando le normative ambientali sono di primaria importanza per l’utente.

For further information: www.sherwin-williams.com/ protectiveEMEA ‹

Per maggiori informazioni: www.sherwin-williams.com/ protectiveEMEA ‹

12

N. 17 - 2016 APRIL - ipcm® Protective Coatings


®

BUSINESS CARD N° 17 - April

... On the road to ipcm®_ Protective Coatings n. 17... ... Verso ipcm®_ Protective Coatings n. 17...

ipcm® Protective Coatings - 2016 APRIL - N. 17

13


PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH

FLEXIBLE COATINGS HELP PROTECT MARINE STRUCTURES Rivestimenti flessibili per la protezione delle strutture in ambiente marino

© Rhino Linings

B

Opening photo: Applying a Rhino Linings spray-applied coating to a rig platform. Foto di apertura: applicazione di un rivestimento di Rhino Linings su una piattaforma di trivellazione.

14

oth abrasive and corrosive, the marine environment is unforgiving of maritime structures such as offshore platforms and rigs, and ocean-going vessels - all of which are major investments for the companies operating them. All activities in a marine environment are impacted by corrosion; the prevention, control and remediation of which costs industry billions of dollars each year. One way to minimise and mitigate the effect of some types of corrosion is through the use of flexible surface coatings that are resistant to chemical attack from petroleum products and salts. According to Denis Baker, Special Projects Engineer at Gold Coast-based Rhino Linings Australasia (RLA): “A corrosion barrier has to have durability and flexibility in addition to being impermeable to the wide range of agents that affect maritime structures.” An offshore structure is also harsh on surface coatings, both in terms of how they wear and also how they are applied. Some of the areas most affected are the decks, superstructure, ballast tanks and anchor or chain wells. These are both exposed to salt and other chemical agents as well as to abrasion as people and equipment move about. To enhance safety for personnel moving around an offshore structure or vessel, spray applied surface coatings with anti-slip properties can easily be applied to decks to provide safe walkways.

N. 17 - 2016 APRIL - ipcm® Protective Coatings

E

ssendo sia abrasivo sia corrosivo, l’ambiente marino è inclemente con strutture quali piattaforme, impianti di trivellazione offshore e navi d’altura, che inoltre rappresentano degli enormi investimenti per le aziende che li gestiscono. Tutte le attività che si svolgono in un ambiente marino sono colpite dalla corrosione: la prevenzione, il controllo e il ripristino ogni anno costano all’industria miliardi di dollari. Un modo per minimizzare e mitigare l’effetto dovuto ad alcune tipologie di fenomeni corrosivi è l’utilizzo di rivestimenti superficiali flessibili, resistenti agli attacchi chimici derivanti dai prodotti petroliferi e dai sali. Secondo Denis Baker, Special Projects Engineer di Rhino Linings Australasia (RLA), con sede centrale a Gold Coast: “Un rivestimento barriera contro la corrosione deve essere duraturo e flessibile oltre che impermeabile all’ampia gamma di agenti che colpiscono le strutture marittime”. Una struttura offshore inoltre è un ambiente molto difficile per i rivestimenti superficiali, sia per come si usurano sia per la loro applicazione. Alcune delle zone più colpite sono il ponte, la sovrastruttura, le casse zavorra, l’ancora oppure il gavone. Questi elementi sono esposti all’attacco del sale e di altri agenti chimici, oltre che all’abrasione dovuta al frequente spostamento di persone e macchinari. I rivestimenti a spruzzo dotati di proprietà antiscivolo possono essere facilmente applicati ai ponti per fornire passaggi pedonali si-


Rhino Linings Australasia Molendinar, Queensland, Australia dbaker@rhinolinings.com.au

According to Baker, it is possible to minimise some of the curi, al fine di migliorare la sicurezza del personale che opeeffects of drilling operations by applying two particular ra su una piattaforma offshore oppure su una nave. Rhino Linings coatings that have been developed for Secondo Baker, è possibile minimizzare alcuni degli effetti maritime structures used in the oil and gas industry dovuti alle operazioni di trivellazione applicando due parti(Ref. opening photo). colari rivestimenti di Rhino Linings sviluppati per le strutture On an oil production rig, the areas where the 14 metre marittime dell’industria oil & gas (rif. foto d’apertura). lengths of drill pipe are laid out before being dragged Su una piattaforma petrolifera, le aree dove le aste di perfoacross the deck and pulled up for drilling operations razione da 14 metri sono disposte prima di essere trascinate are prone to a large amount of damage. Most surface lungo il ponte e sollevate per le operazioni di trivellazione coatings are quickly abraded away exposing the bare sono soggette a un’elevata usura. La maggior parte dei rivemetal to corrosion. stimenti superficiali sono rapidamente abrasi, esponendo To prepare these working areas for treatment with the così il metallo nudo alla corrosione. Rhino Linings coatings, the platform deck has to be Per preparare queste zone di lavoro al trattamento con i riabrasive blasted to clean off any existing coatings and also vestimenti di Rhino Linings, il ponte della piattaforma deve profile the surface for optimal adhesion of the primer and essere sottoposto a sabbiatura per rimuovere ogni residuo protective coating. Zinc-rich primers can then be applied di vernice e creare un profilo della superficie per un’adesioto the prepared metal surface, over which a proprietary ne ottimale del primer e del rivestimento protettivo. In seguiRhino Linings primer is rapidly sprayed. Rhino 161 or 251 to è possibile applicare i primer ricchi di zinco alla superficie are good choices di metallo preparata, sulfor this type of la quale si può spruzzare application because velocemente un primer di they have no volatile Rhino Linings. Rhino 161 organic component o 251 costituiscono delle (VOC) properties buone scelte per questo tiand can be easily po di applicazione poiché and quickly applied. non hanno componenFor maximum ti organici volatili (COV) e protection, Rhino possono essere applicati Pure Polyurea (for facilmente e rapidamente. example Extreme In seguito, per ottenere la or PP1195) is then massima protezione, si ap1 © http://www.123rf.com/profile_nitimongkolchai applied over the plica sull’area primerizzaprimed area to a ta la Poliurea Pura di Rhino nominal thickness of 3000 microns on the deck surface. (per esempio Extreme o PP1195) con uno spessore nominaThis final coating was chosen for its resistance to weather le di 3000 micron sulla superficie del ponte. Questo rivestiextremes, excellent flexibility and high impact strength. mento finale è stato scelto per la sua resistenza a condizioni The ability to walk on a Rhino Linings surface in a matter climatiche estreme, l’eccellente flessibilità e l’elevata resistenof minutes means that a facility can be back on line za all’urto. Se è possibile camminare su una superficie rivestisooner. ta con prodotti Rhino Linings già dopo pochi minuti, signifiA major consideration in applying any surface treatment ca che la struttura può tornare operativa ancora prima. to a structure is the requirement to minimise downtime. Un importante elemento da tenere in considerazione Spray coating enables quicker application and less quando si esegue un trattamento superficiale su una strutdisruption to a client’s operations. “The beauty of our tura è la minimizzazione del tempo di fermo. Il rivestimento coatings is that they are rapid setting,” said Baker. “We a spruzzo consente applicazioni più rapide e meno interrucan spray them on and they cure in as little as 6 seconds.” zioni nelle operazioni dei clienti. “La forza dei nostri rivestiUnlike all other coatings, Pure Polyureas are not affected menti risiede nella loro rapidità di asciugatura”, ha affermaby ambient moisture or temperature while being applied to Baker. “Quando sono spruzzati, polimerizzano in soli 6 which is an important consideration when operating secondi”. Diversamente da tutti gli altri rivestimenti, la pooffshore. liurea pura non viene influenzata dall’umidità ambientale

1

Oil drilling pipes stacked aboard an oil rig. Tubi per l’estrazione del petrolio impilati a bordo di una piattaforma petrolifera.

ipcm® Protective Coatings - 2016 APRIL - N. 17

15


PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH

2

Rubber boots of deck penetrations treated with a flexible, spray-applied Pure Polyurea coating. Guaine di gomma per le interconnessioni del ponte trattate con un rivestimento applicato a spruzzo Pure Polyurea.

16

“Pure Polyurea is a versatile and adaptable material that is an ideal method of protecting offshore structures,” Baker added. “To encourage further uptake by the maritime market, RLA has a portfolio of projects demonstrating the benefits and cost effectiveness of Pure Polyurea.” Where pipes and other equipment penetrate the deck areas of offshore structures, it is important that liquids do not run down the pipes to the ocean below (Fig. 1). Most offshore rigs cover these penetrations with a butyl rubber ‘boot’ that is taped to the pipe and the deck. However, the rubber of the boot and the adhesive can be degraded by UV and salt exposure in a matter of months. To extend the operational life of the deck penetration boots, the butyl rubber and the adjacent steel surfaces are usually scuffed and cleaned prior to the appropriate Rhino Linings primer being applied. It is important that all loose coatings, oils and dirt are thoroughly removed before applying the new flexible membrane. Similarly, the surrounding equipment, piping and deck surfaces must be masked off to protect against over spray. One suitable coating 2 material to use with the boots is Rhino Pure Polyurea (PP1195). According to Baker, when applied at a thickness of 2000 microns or greater, and extending 50 mm up the pipe and 100 mm onto the deck, creates a liquid tight, weather resistant, flexible interface on all deck penetrations from 100 mm in diameter with the long term durability demanded by the marine industry (Fig. 2). RLA has been working with spray-applied polyurethane and Pure Polyurea since the mid1990s and now manufactures a range of consistent formulations in Australia which are suitable for a diverse range of applications. “Pure Polyurea is a relatively modern material that has been developing rapidly during the past 15 years,” Baker said. Pure Polyureas are formed when a liquid isocyanate is mixed under high pressure with an amine-driven resin solution. Isocyanates are reactive because the double covalent bond attaching the carbon atom to nitrogen

N. 17 - 2016 APRIL - ipcm® Protective Coatings

oppure dalla temperatura durante l’applicazione, un fattore molto importante nelle operazioni offshore. “La poliurea pura è un materiale versatile e adattabile, un metodo ideale per la protezione delle strutture offshore”, ha dichiarato Baker. “Per incoraggiarne un maggiore utilizzo nel mercato marittimo, RLA ha un portfolio di progetti che dimostrano i benefici e il rapporto costo-efficacia della poliurea pura”. Quando tubi e altre attrezzature si interconnettono ai ponti delle strutture offshore, è importante che nessun liquido fuoriesca dalle tubazioni fino all’oceano (fig. 1). La maggior parte delle piattaforme di trivellazione offshore copre queste aree di interconnessione con una guaina in gomma butilica aderente al tubo e al ponte. Tuttavia, la gomma della guaina e l’adesivo possono degradarsi in pochi mesi a causa dell’esposizione ai raggi UV e al sale. Per aumentare la vita operativa delle guaine del ponte, prima di applicare un primer di Rhino Linings appropriato, la gomma butilica e le superfici in acciaio adiacenti sono in genere grattate e pulite. È importante che tutti i residui di vernice, oli e sporco siano rimossi completamente prima di applicare la nuova membrana flessibile. Allo stesso modo, le attrezzature, i tubi e le superfici circostanti del ponte devono essere mascherate per essere protette dalla spruzzatura. Un materiale di verniciatura adegua© Rhino Linings to per l’utilizzo con le guaine è Rhino Pure Polyurea (PP1195). Secondo Baker, quando applicato con uno spessore di 2000 micron o maggiore ed estendendolo per 50 mm sopra il tubo e per 100 mm sul ponte, crea un’interfaccia a tenuta stagna, resistente alle intemperie e flessibile su tutte le aree di interconnessione del ponte da 100 mm di diametro con una lunga durata, come richiesto dall’industria marittima (fig. 2). RLA lavora con poliuretani e poliurea pura applicati a spruzzo dalla metà degli anni ’90 e ora produce in Australia una gamma completa di formulazioni, adatte a diversi ambiti di applicazione. “La poliurea pura è un materiale relativamente moderno che si è sviluppato rapidamente durante gli ultimi 15 anni”, ha affermato Baker. La poliurea pura si forma quando un isocianato liquido viene miscelato sotto una pressione elevata con una soluzione di resina con ammine. Gli isocianati sono reattivi perché il doppio legame covalente connette l’atomo di carbonio all’azoto; gli atomi di ossigeno si rompono facilmente per


Rhino Linings Australasia Molendinar, Queensland, Australia dbaker@rhinolinings.com.au

and oxygen atoms is easily broken to form single bonds in the more stable tetrahedral configuration around the carbon atom. The Rhino Pure Polyurea comes as a two-part solution that is mixed under high temperature and pressure (3000 psi at 65°C) in a specially designed spray apparatus. When applied, the excellent chemical cross-linking produces a dense but flexible surface. The high density makes the coating almost impervious to abrasion, water and chemicals. Pure Polyurea coatings ‘snap cure’ to form a solid surface in a few seconds and can be walked on without damage in less than a minute. Another advantage is the ability for it to be sprayed up to 6000 microns thick (and greater) on a sloping or vertical surface without sagging or running. The surface of a RLA coating is easy to maintain, clean and recoat if necessary. Whereas epoxies and paints form a solid, rigid shell, the flexibility of Pure Polyurea coatings allows them to move with the expansion and contraction of the underlying structure as temperatures change. ‹

formare legami singoli intorno all’atomo di carbonio nella configurazione tetraedrica più stabile. Il prodotto Rhino Pure Polyurea è parte di una soluzione in due parti miscelata in condizioni di alta temperatura e pressione (3000 psi a 65°C) in un sistema a spruzzo appositamente progettato. Quando applicato, l’eccellente reticolazione chimica produce una superficie densa ma flessibile. L’elevata densità rende il rivestimento quasi insensibile ad abrasione, acqua e sostanze chimiche. I rivestimenti Pure Polyurea polimerizzano rapidamente per formare una superficie solida in pochi secondi, sulle quali è possibile camminare senza problemi in meno di un minuto. Un altro vantaggio consiste nella possibilità di spruzzarle con uno spessore di 6000 micron o superiore su una superficie inclinata o verticale senza colature. La superficie dei rivestimenti RLA, se necessario, è facile da manutenere, lavare e riverniciare. Mentre le vernici e le resine epossidiche formano un involucro solido e rigido, la flessibilità dei rivestimenti in poliurea pura consente loro di adeguarsi all’espansione e contrazione della struttura sottostante provocata dai cambiamenti di temperatura. ‹

Your partner for the design, production and application of anticorrosive lining in ebonite, natural and synthetic rubber. Since 1969 Anti-corrosive and anti-abrasive lining in ebonite, natural and synthetic rubber

Sand-blasting and painting

Vessel and piping in reinforced plastics Via Veneziana Badalasco 73 - 24045 Fara Gera D’Adda (BG) - Italy - Tel. +39 0363 399 266 - Fax +39 0363 398 360 - info@pessina.it

w w w. p e s s i n a . i t

ipcm® Protective Coatings - 2016 APRIL - N. 17


PROTECTIVE COATINGS | HIGHLIGHT OF THE MONTH

SMART COATINGS FROM TRIESTE TO CONQUER THE US MARKET Le vernici intelligenti da Trieste alla conquista del mercato USA

O

© ag visuell - Fotolia.com

ver 4 million Euro R&D investments in the last few years, aimed at obtaining innovative patents in 22 countries (especially in USA, Mexico, Japan, China, Russia, Europe, Eurasia and Israel) in the field of flame retardant additives, nextgeneration smart coatings, corrosion-resistant products and innovative materials. Other 60 patents pending approval. And now an agreement that will accelerate the company’s international development process. Nanto Cleantech Spa – an Italian manufacturer of advanced materials and functional coatings, i.e. the nanotechnology products behind the new generation special paints – and the US investment fund LCV Capital Management LLC – a firm established in 2009, investing in companies listed on Wall Street – have formalised an agreement that will revolutionise an industry sector that is worth 13 billion dollars. Through its subsidiary Peerless Systems Corp, LCV will participate in Nanto’s US newco initiating a process of international expansion aimed at its listing on Wall Street within two years. A financial “head” in America, an industrial “heart” in Italy and a technological “driving force” in Israel, where the research and development activities will be maintained: This will be Nanto’s new structure. “Such an important leap will enable the company to confront the large global players (such as Sherwin Williams, PPG, Azko Nobel, DuPont and Dow Chemical) with the appropriate tools. For a few years now, our sector has been witnessing a profound transformation due to the advent of nanotechnology and of highly innovative start-ups specialising in new generation materials,” so the management. 18

N. 17 - 2016 APRIL - ipcm® Protective Coatings

O

ltre 4 milioni di euro di investimenti in ricerca e sviluppo negli ultimi anni, mirati a ottenere brevetti innovativi in 22 Paesi (in particolare in USA, Messico, Giappone, Cina, Russia, Europa, Eurasia, Israele) nel segmento degli additivi ritardanti di fiamma e di vernici intelligenti di nuova generazione, anticorrosivi e materiali innovativi, e altri 60 brevetti in corso di approvazione. E ora un accordo che mette il turbo al processo di sviluppo internazionale. Nanto Cleantech Spa - società italiana produttrice di “advanced material” e “functional coating”, i materiali nanotecnologici alla base delle vernici speciali di nuovissima generazione - e il fondo di investimenti statunitense LCV Capital Management LLC, società fondata nel 2009 che investe in società quotate a Wall Street, hanno formalizzato un accordo finalizzato a rivoluzionare un comparto industriale che vale 13 miliardi di dollari. LCV, attraverso la controllata Peerless Systems Corp, parteciperà la newco statunitense di Nanto dando l’avvio a un percorso di espansione internazionale che prevede entro due anni la quotazione a Wall Street. Testa finanziaria in America, cuore industriale in Italia e motore tecnologico in Israele, dove resteranno le attività di ricerca e sviluppo: si disegna così la nuova struttura di Nanto, «un salto concettuale e dimensionale importante che le permetterà di confrontarsi con strumenti adeguati con i grandi player mondiali (quali Sherwin Williams, PPG, Azko Nobel, DuPont e Dow Chemical) all’interno di un comparto che da qualche anno vive una profonda trasformazione per effetto dell’avvento delle nanotecnologie e di startup altamente innovative, specializzate nei materiali di nuova generazione», fanno sapere in sede.


Barbara Ganz Il Sole 24 Ore

Nanto Cleantech was established in Italy and Israel as a research project conducted by a group of specialists from Trieste – lead by Roberto Cafagna, the company’s CEO – together with a team from the Shenkar College of Tel Aviv – lead by Professor Sam Kenig, the current Technical Manager. Its core business are flame retardant additives and next-generation smart coatings. These are based on nanotechnology materials that are capable of reacting to changing environmental conditions, have a three times longer service life than traditional ones, and are cheaper as well as less polluting. Their features could revolutionise an industry sector that has remained almost unchanged for a century. Nanto Protective Coating, firmly anchored in Italy even after this operation, conceived the original project, Nanto Paint, back in 2009. In 2014, Simest entered the parent company’s capital: Its participation lasted until March of this year. Thanks to this, Nanto started the internationalisation process that led it to win two important international awards. It has won the “Best Corrosion Innovation of the Year” prize awarded in Salt Lake City by NACE – a global authority in the corrosion field – and has been the first European firm to win the “Top Three Finalist WPC Excellence Award”, assigned in Moscow by the World Petroleum Council – representing over 95% of the oil&gas, marine and infrastructure industries, including companies such as Taloil, Petrol Lavori, Autovie Venete and IES Refineries (MOL Group). During this phase of growth, Nanto has also been entrusted with the most important research project on innovative materials ever funded by the EU through the Horizon 2020 program, in partnership with 17 leading European companies including Acciona. In September 2015, along with Fincantieri, the Italian Government and the Israeli Government, it was among the four signatories of a major industrial agreement for the development of new multifunctional, anti-corrosion and anti-friction coatings. The operation with the LCV fund will now accelerate Nanto’s international development process, with an expected investment of around 10 million in the next year and an expected turnover of over 100 million, also through external growth. ‹

Nanto Cleantech nasce tra Italia e Israele da un progetto di ricerca condotto da un gruppo di specialisti triestini del settore, guidato da Roberto Cafagna, CEO della società, e un team della Shenkar College di Tel Aviv, guidato dal professor Sam Kenig, attuale direttore tecnico. Il business verte sulla produzione di additivi ritardanti di fiamma e di vernici intelligenti di nuova generazione, gli “smart coating”, basate su materiali nanotecnologici, capaci di reagire al variare delle condizioni ambientali, con una durata tre volte superiore a quelle tradizionali, più economiche e molto meno inquinanti, caratteristiche che promettono di rivoluzionare un comparto industriale pressoché immutato da un secolo. Il progetto originario (Nanto Paint), ideato dalla Nanto Protective Coating – saldamente ancorata in Italia anche dopo questa operazione – risale al 2009. La prima discontinuità avviene nel 2014, con l’ingresso di Simest nel capitale della capogruppo; la partecipazione è durata fino a marzo di quest’anno. Grazie agli strumenti previsti da Simest, Nanto ha avvia l’internazionalizzazione che l’ha portata a vincere due importanti riconoscimenti internazionali: il premio “Best Corrosion Innovation of the Year”, assegnato a Salt Lake City dal NACE (autorità mondiale sul tema della corrosione dei materiali) e, prima società europea, il premio “Top Three Finalist WPC Excellence Award”, assegnato a Mosca dal World Petroleum Council, che rappresenta oltre il 95% dell’industria oil&gas, navale e infrastrutture: tra i più importanti Taloil, Petrol Lavori, Autovie Venete e IES Refineries (MOL Group). Durante questa fase di crescita Nanto diventa inoltre assegnataria del più importante progetto di ricerca sui materiali innovativi finanziato dalla UE attraverso il programma Horizon 2020, in partnership con 17 aziende leader europee tra cui Acciona e, nel settembre 2015, insieme a Fincantieri, Governo italiano e Governo israeliano, è tra i quattro firmatari di un importante accordo industriale per lo sviluppo di nuovi coating multifunzionali, anticorrosione e antiattrito. L’operazione con il fondo LCV accelera lo sviluppo internazionale di Nanto, con un investimento previsto di circa 10 milioni nel prossimo anno e con un fatturato atteso a regime di oltre 100 milioni anche attraverso crescita esterna. ‹

This article was originally published on ilsole24ore.com (http://www.ilsole24ore.com/art/impresa-e-territori/2016-04-05/le-vernici-intelligenti-trieste-conquista-mercato-usa--161443.shtml?uuid=AC5sHZ1C), in the Impresa&Territori section, on April, 5 2016. Author: Barbara Ganz. © Copyright Il Sole 24 Ore Republication courtesy of Il Sole 24 Ore.

Questo articolo è stato pubblicato originariamente su ilsole24ore.com (http://www.ilsole24ore.com/art/impresa-e-territori/2016-04-05/le-vernici-intelligenti-trieste-conquista-mercato-usa--161443.shtml?uuid=AC5sHZ1C), sezione Impresa&Territori, il 5 aprile 2016. Autrice: Barbara Ganz. © Copyright Il Sole 24 Ore Ripubblicazione per gentile concessione de Il Sole 24 Ore

ipcm® Protective Coatings - 2016 APRIL - N. 17

19


PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

HEMPEL’S FAST DRYING COATINGS: MAXIMUM PROTECTION WITH MINIMUM APPLICATION TIMES Prodotti a rapida essiccazione Hempel: massima protezione con tempi di applicazione ridotti

© Hempel

Opening photo: Cranes for handling cargo of ships. Foto di apertura: gru per la movimentazione delle merci su una nave.

A

t Hempel, we constantly strive to offer our customers new ways of improving productivity, while maintaining the same high quality of coating finish and longlasting protection in a variety of environments, of which our latest range of extra fast drying coatings is a perfect example. These coatings offer fast drying and short overcoating times for increased productivity, faster handling and transportation than ever before, excellent anticorrosion properties and backed by reliable and committed technical assistance (Table 1).

20

N. 17 - 2016 APRIL - ipcm® Protective Coatings

H

empel cerca costantemente di offrire ai propri clienti nuovi modi per migliorare la produttività. La nostra nuova gamma di prodotti a rapida essiccazione è in grado di assicurare allo stesso tempo una qualità della finitura elevata e una protezione di lunga durata in vari ambienti. I nostri prodotti offrono una rapida essiccazione e brevi tempi di ricopertura, per una maggiore produttività, una manipolazione e un trasporto più veloci, con eccellenti proprietà anti-corrosione, il tutto supportato da un’assistenza tecnica affidabile e sempre disponibile (tabella 1).


Hempel A/S Lingby, Denmark hempel@hempel.com

Table 1: The new Hempel’s extra fast drying coatings range. Products Hempel’s Speed-dry Alkyd 43140/1 Hempadur Avantguard® 750/550 Hempadur Fast Dry 45410 Hempathane Fast Dry 55750 Hempadur Speed-dry ZP 500

Tabella 1: la nuova gamma di prodotti Hempel a rapida essicazione.

Properties A very quick-drying anticorrosive primer/topcoat, with good adhesion to steel. Matt and semi-gloss versions available. Two-component epoxy primers with our innovative activated zinc Avantguard® technology. A two-component, high build epoxy paint, pigmented with zinc phosphate. A 2-component polyurethane, cured with aliphatic Isocyanates with good gloss, colour retention and zinc phosphate. A two-component, high build epoxy paint which combines high volume solids with a short drying time. An MIO pigmented version is also available.

Hempel’s Technical Service team works closely with customers to ensure the right products are specified and applied. This selection of case studies illustrates the various companies and industries where our range of fast drying products have been used.

Il team di assistenza tecnica di Hempel lavora a stretto contatto con i clienti per assicurare che siano specificati e applicati i prodotti giusti. Questa selezione di case study illustra le varie aziende e settori in cui la nostra gamma di prodotti a rapida essiccazione è stata utilizzata.

Shanghai Zhenhua Heavy Industry CO.

Shanghai Zhenhua Heavy Industry CO.

Shanghai Zhenhua Heavy Industry CO., Ltd. (ZPMC) is the world’s largest manufacturer of cargo handling equipment including specialised cranes (Ref. opening photo). These need a heavy-duty anti-corrosive coating system to protect them from the harsh saltwater atmosphere. ZPMC decided on Hempadur Avantguard® 750 for these super-post-Panamax container cranes, because it offers superior corrosion protection, ease of application and greater mechanical strength than traditional zinc rich systems.

Shanghai Zhenhua Heavy Industry CO., Ltd. (ZPMC) è il più grande produttore al mondo di attrezzature per la movimentazione di merci, incluse le gru specialistiche (rif. foto di apertura). Queste attrezzature necessitano di un ciclo di pitturazione anticorrosivo “heavy duty” per proteggerle dalle condizioni gravose dell’atmosfera, ricca di acqua salata. ZPMC ha scelto Hempadur Avantguard® 750 per queste gru per container super-post-Panamax, in quanto offre una protezione superiore contro la corrosione, facilità di applicazione e una maggiore resistenza meccanica rispetto ai tradizionali cicli ricchi di zinco.

Danieli Group

Gruppo Danieli

The Danieli Group, in Buttrio, Italy, a major global supplier of iron and steel making plants has just completed its first turn-key plant in Algeria, for AQS-Algerian Qatari Steel. The steelwork for this was supplied by Omba Impianti & Engineering Spa (Italy), and NOE SA, Greece, which used Hempadur Speed-dry ZP 500 - high build epoxy for protection. The product encompasses high volume solids with a short drying time and is optimised for in-shop application, to give fast throughput and decreased total processing time. It incorporates zinc phosphate for anti-corrosion and its lower solvents emissions meets the low environmental impact requirements.

Il Gruppo Danieli, situato a Buttrio, in Italia, un importante fornitore di impianti siderurgici a livello globale, ha avviato il suo primo progetto “chiavi in mano” in Algeria, per AQS - Algerian Qatari Steel. Le strutture in acciaio per questo progetto sono state fornite da Omba Impianti & Engineering Spa, e NOE SA, Grecia, che ha utilizzato Hempadur Speed-dry ZP 500, un epossidico ad alto spessore, per la protezione. Il prodotto contiene un’alta percentuale di solidi, offre brevi tempi di essiccazione ed è ottimizzato per applicazioni in officina, per una migliore produttività e ridotti tempi di processo. Contiene inoltre fosfato di zinco per l’anticorrosione e le basse emissioni di solventi soddisfano i requisiti per un ridotto impatto ambientale.

ipcm® Protective Coatings - 2016 APRIL - N. 17

21


© Hempel

PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

1 1

The plant of Volkswagen AG in Kaluga, Russia. Lo stabilimento di Volkswagen AG a Kaluga, in Russia.

22

Volkswagen AG

Volkswagen AG

Volkswagen AG has recently completed a new automobile plant in Kaluga, Russia (Fig. 1). Hempel’s Speed-Dry Alkyd 43140, primer/finish met both the technical and commercial requirements of the project perfectly. Its unique advantage is its extremely short drying time of less than 2 hours, which enabled an effective reduction in the duration of the works.

Volkswagen AG ha recentemente completato una nuova fabbrica di automobili a Kaluga, in Russia (fig. 1). Speed-Dry Alkyd 43140 di Hempel, un primer/mano a finire, ha soddisfatto alla perfezione sia i requisiti tecnici sia i requisiti commerciali del progetto. L’esclusivo vantaggio offerto da questo prodotto è la sua rapida essiccazione, in poco meno di 2 ore, una caratteristica che ha consentito di ridurre la durata dei lavori.

CCC

CCC

When Poland’s leading footwear and accessories retail chain, CCC, needed to protect their offices and logistics centre in Polkowice against corrosion, whilst still requiring appealing and long-lasting

Quando CCC, una delle catene di negozi di calzature e accessori più importanti della Polonia, ha deciso di proteggere i propri uffici e il centro logistico di Polkowice contro la corrosione, preservando

N. 17 - 2016 APRIL - ipcm® Protective Coatings


O&S

parts2clean aesthetics, their contractor, Smulders Polska Sp.z o.o turned to Hempel. One of the main technical requirements for the project was that the steel construction had to be fully painted in a relatively short time period. Hempel, therefore, recommended a 160 μm DFT system based on its fast drying high build epoxy primer, followed by Hempathane Fast Dry 55750 polyurethane topcoat, which met the production schedule and gave the required high aesthetic finish. These are just a few examples of where Hempel’s fast drying products have provided shorter execution times on top of their unrivalled long-term protection against corrosion. Our customers agree. Bartosz Noworyta, co-owner of ARMA Firma Inżynierska sp.j., Poland, stated : “I have used Hempel’s products for almost two decades and am very satisfied with their performance. During application, time is just as important as quality, which is why I was pleased to come across and use the all-new, speed-optimised line of Hempel products. A perfect example would be Hempadur Speeddry ZP 500: With its impressive drying time and DFT, I would recommend it to all applicators”. ‹

allo stesso tempo l’accattivante estetica degli edifici, il loro contractor, Smulders Polska Sp.z o.o, si è rivolto a Hempel. Uno dei principali requisiti tecnici del progetto era che la struttura in acciaio dovesse essere interamente pitturata in un periodo relativamente breve. Hempel ha quindi raccomandato un ciclo con un DTF di 160 μm basato sul suo primer epossidico a rapida essiccazione e alto spessore, seguito dal topcoat poliuretanico Hempathane Fast Dry 55750, due prodotti che hanno consentito di rispettare il programma di produzione e hanno offerto l’attraente finitura estetica richiesta. Questi sono solo alcuni esempi dei progetti in cui i prodotti a rapida essiccazione di Hempel hanno consentito tempi di esecuzione più brevi, oltre a offrire una ineguagliabile protezione a lungo termine contro la corrosione. E i nostri clienti sono d’accordo. Bartosz Noworyta, co-proprietario di ARMA Firma Inżynierska sp.j., Polonia, ha affermato: “Usiamo i prodotti di Hempel da quasi due decenni e siamo molto soddisfatti della loro performance. Durante l’applicazione, i tempi sono importanti quanto la qualità, e quindi siamo stati estremamente contenti di avere trovato la nuova linea di prodotti Hempel, ottimizzati per una rapida applicazione. Un esempio perfetto è Hempadur Speed-dry ZP 500, con i suoi impressionanti tempi di essiccazione e DFT; lo consiglieremmo a tutti gli applicatori”. ‹

Fiera internazionale per il trattamento delle superfici e i rivestimenti Guardate dietro la superficie: ■ Soluzioni e tendenze attuali ■ Tecnologie innovative ■ Nuovi contatti

31 maggio – 2 giugno 2016 Stoccarda ▪ Germania OundS-messe.de In con a a rane tempo clean parts2


PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

© Belzona Polymerics Ltd.

BELZONA SUPERWRAP II SAVES FAILING SEAWATER FILTER VESSEL Belzona SuperWrap II salva una cisterna danneggiata per il filtraggio dell’acqua di mare

D Opening photo: Belzona SuperWrap II applied as per engineered design. Foto di apertura: Belzona SuperWrap II applicato secondo quanto previsto dalla specifica.

24

uring March 2015, an offshore Oil and Gas platform contacted Belzona requiring a unique solution for the repair of a seawater bulk media filter vessel. Located in the Gulf of Mexico, USA, the bottom of the vessel was suffering from an internal leak due to galvanic corrosion inside the internally coated filter, experiencing internal corrosion at coating holidays. Furthermore, the damage involved a combination of both thin and a through-wall defect, posing a repair dilemma without emptying the entire vessel’s contents.

N. 17 - 2016 APRIL - ipcm® Protective Coatings

N

el marzo 2015 una piattaforma offshore per l’estrazione di gas e petrolio ha contattato Belzona chiedendo una soluzione speciale per riparare il serbatoio di filtrazione grossolana dell’acqua di mare. Il fondo del serbatoio, situato nel Golfo del Messico (USA), stava subendo danni a causa di una perdita interna dovuta a corrosione galvanica dentro il filtro rivestito internamente. Si erano infatti presentati fenomeni di corrosione interna con piccoli fori sul rivestimento. Inoltre, il danneggiamento comprendeva sia difetti superficiali sia perforanti: come ripararlo senza svuotarlo completamente era un dilemma.


Tom Belli Belzona Polymerics Ltd., Harrogate, England tbelli@belzona.com

In terms of functionality, seawater bulk media filter In termini di funzionalità, i serbatoi per la filtraziovessels simply remove the sediment and grit from the ne grossolana dell’acqua di mare rimuovono i deseawater pumped up to the platform. As the seawater positi e la sabbia dall’acqua pompata alla piattaforenters at the top of the vessel, it passes through the ma. L’acqua marina, entrando dall’alto nel serbatoio, bulk media, leaving the unwanted remains trapped passa attraverso il materiale di filtraggio grossolano, in the beads lasciando i residui of the media. non desiderati inSubsequently, trappolati nelle sfethis lean liquid re filtranti. In seguiis collected and to, il liquido filtrato drained for many è raccolto e drenauses that cover to per diversi utilizboth on board zi riguardanti sia le and off board procedure a bordo procedures. sia fuori bordo. Suspended particles Le particelle soin the seawater can spese nell’acqua di cause continuous mare possono cauabrasion to the sare una continua vessel lining, which abrasione del rivein combination stimento del serbawith the highly toio; insieme all’accorrosive salt qua salina, quindi, water, creates si crea un ambienan extremely te altamente cordestructive rosivo. Nel caso in environment. In esame, questi fatthis instance, it had tori hanno provocaused the vessel to cato perdite nel leak due to a failure serbatoio a cauwith the underdrain sa del danneggiasystem (Fig. 1). mento del sistema 1 Consequently, di scarico inferiore © Belzona Polymerics Ltd. the asset owner (fig. 1). Di conse1 decided to use guenza, il proprieLeaking seawater filter vessel. a bolt to arrest tario ha deciso di Il serbatoio con perdite per il filtraggio dell’acqua di mare. the leak, until utilizzare un bulloa permanent ne per arrestare la compliant perdita, in attesa di solution was implemented. Following investigation implementare una soluzione definitiva. Dopo avere of alternatives, evidence suggested that competitor analizzato diverse alternative, il cliente ha realizzato products were unable to provide a sufficient che i prodotti dei competitor sul mercato non eracomposite patch; therefore the customer selected no in grado di offrire un patch composito sufficiente: Belzona SuperWrap II in order to complete the repair. per questo ha scelto Belzona SuperWrap II per comAfter careful selection, supported by an engineered pletare la riparazione. design, the application was carried out in compliance Dopo un’attenta selezione, e grazie all’ingegnerizwith ASME standards. At the outset, the bolt plugging zazione del sistema, l’applicazione è stata effettuata the hole was removed, allowing the remainder of the in conformità con gli standard ASME. Nella prima fafiltered water to be drained and complete access to the se, è stato rimosso il bullone che tamponava il buco,

ipcm® Protective Coatings - 2016 APRIL - N. 17

25


PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

2

© Belzona Polymerics Ltd.

2

Belzona 1212 heals thin and through-wall defects. Belzona 1212 ripara difetti superficiali e perforanti.

defected area. The through-wall defect was plugged first using Belzona 1291 (ES-Metal), a malleable epoxy compound that was shaped to fit the prescribed affected area. Highly adhesive and water resistant, the compound provided an excellent temporary solution to stop the vessel’s leak. The original vessel coating was then removed by hand sanding before the carbon steel substrate’s thin and through-wall failings were rebuilt with Belzona 1212 (Fig. 2). Designed to adhere to wet, oil contaminated and underwater substrates, this surface tolerant material was the most suitable repair solution for the aqueous environment. 26

N. 17 - 2016 APRIL - ipcm® Protective Coatings

consentendo il drenaggio dei residui dell’acqua filtrata e il pieno accesso all’area danneggiata. Il difetto perforante è stato inizialmente tamponato utilizzando Belzona 1291 (ES-Metal), un composto epossidico malleabile modellato per adattarsi perfettamente all’area danneggiata. Il composto, altamente adesivo e resistente all’acqua, ha rappresentato un’eccellente soluzione temporanea in grado di arrestare la perdita del serbatoio, il cui rivestimento originale è stato in seguito rimosso per mezzo di sabbiatura manuale prima del ripristino sia dei difetti superficiali sia di quello perforante della superficie in acciaio al carbonio con


Following the thin and through-wall repair, the substrate was then cleaned to the requirements of SSPC SP 10 (NearWhite Metal) by abrasive blasting. In reference to the design, three wraps (6 layers) of Belzona SuperWrap II were applied to the repair area to reinforce the bottom of the filter vessel. This composite wrap was chosen because of its application versatility and proven efficiency with repairing weakened and holed tank walls. Using Belzona 1121 (Super XL-Metal) epoxy resin to create a mould of the vessel’s surface, the Belzona SuperWrap II repair (Ref. opening photo) was consolidated by applying pressure against the template, creating a secure and tight seal around the defect. The customer chose Belzona SuperWrap II because of the long design life and overall ease of the repair process versus traditional welding methods, which can incur a number of health and safety issues. By using a composite patch they were able to avoid emptying the entire vessel, including filter media, hence saving a considerable amount of downtime and labour. ‹

Belzona 1212 (fig. 2). Progettato per aderire a superfici bagnate, contaminate da oli oppure situate sott’acqua, questo materiale surface tolerant si è rivelato la soluzione di riparazione più adeguata per l’ambiente marino. Dopo la riparazione dei difetti, la superficie è stata pulita in base ai requisiti SSPC SP 10 (Near-White Metal) con sabbiatura abrasiva. In base alla specifica, sono stati applicate tre ricoperture (6 strati) di Belzona SuperWrap II all’area riparata per rinforzare il fondo del serbatoio del filtro. La copertura composita è stata scelta per la sua versatilità di applicazione e la comprovata efficienza nella riparazione delle pareti indebolite o forate dei serbatoi. La resina epossidica Belzona 1121 (Super XL-Metal) è stata utilizzata per creare un calco della superficie del serbatoio; in seguito, la soluzione Belzona SuperWrap II (rif. foto d’apertura) è stata consolidata applicando una pressione sulla sagoma, creando così una sigillatura sicura e aderente intorno al difetto. Il cliente ha scelto Belzona SuperWrap II per la sua lunga vita utile e per la semplicità della procedura di riparazione rispetto ai metodi tradizionali di saldatura, che invece possono causare diversi problemi per la salute e la sicurezza. Utilizzando un patch composito il cliente è riuscito a evitare di svuotare tutto il serbatoio, incluso il materiale filtrante, risparmiando così tempo e lavoro. ‹

We create better durability.

Together.

At Huntsman Polyurethanes, we believe that working in true collaboration with customers is the only way to solve complex problems and find the solutions that will deliver real innovation. So, we strive with a passion and determination to build the deep understanding of our customers that’s required to get to the heart of their needs and establish lasting partnerships. When it comes to creating better durability in critical structures such as bridges, we’ll work with you to produce tailored MDI-based coatings that provide enhanced structural integrity and protection against corrosion. Combine our knowledge of coatings with your expertise, and we’ll create better bridges… together.

www.huntsman.com/pu


PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

© Ocean Tec

SUCCESSFUL AND SAFE REMOVAL OF HAZARDOUS COATINGS WITH RPR INDUCTION METHOD ON KANMON BRIDGE IN JAPAN Rimozione sicura e di successo di vernici pericolose con il metodo a induzione di RPR sul ponte Kanmon in Giappone

Opening photo: The Kanmon Bridge, Japan. Foto di apertura: il ponte Kanmon, in Giappone.

28

he RPR Technologies distributor in Japan, e-Energy Corporation, presented the results of a successful project for a steel bridge in Japan. The work was executed by Ocean Tec, one of the first RPR customers in Japan. They have in total 3 RPR units: Two of them were delivered in 2009 and the last one was in 2014.

T

l distributore di RPR Technologies in Giappone, e-Energy Corporation, ha presentato gli ottimi risultati di un progetto realizzato per un ponte di acciaio. Il lavoro è stato effettuato da Ocean Tec, uno dei primi clienti giapponesi di RPR. In totale, l’azienda possiede 3 unità RPR: due consegnate nel 2009, una nel 2014.

Introduction

Introduzione

In 2013, Ocean Tec (OT) introduced the new RPR induction paint removal method to the road owner NEXCO-West and their prime contractor company, Yokogawa Construction.

Ocean Tec (OT) ha presentato, nel 2013, il nuovo metodo di sverniciatura a induzione a NEXCO-West, società che possiede e gestisce strade, e al loro appaltatore principale, Yokogawa Construction.

N. 17 - 2016 APRIL - ipcm® Protective Coatings

I


K. Inoue E-Energy Corporation Tokyo, Japan inoue@e-energy.co.jp

Their intention was to get the RPR solution as an approved paint removal method for the Kanmon Bridge project (Ref. opening photo). In this method, the induction disbonder works by the principle of induction. Heat is generated in the steel substrate and the bonding is broken. The coating is then removed entirely without disintegrating and completely free from contaminating agents, i.e. blast media. This obviously makes disposal and recycling of waste easier and cheaper. Even inside pittings and cracks in the surface, 1 the coating is disbonded. As a result of their continued efforts by several demonstrations and presentations of test results data, the RPR method was finally approved by NEXCO as a VE (Value Engineering) solution for the project. Meanwhile, both use of stripping methods by sand and water (UHP) had been banned due to the risk of contamination of air and water. Consequently, shortly after Ocean Tec received the official order for the use of RPR as subcontractor of the project. The key selling points for the introduction of RPR equipment in the Kanmon Bridge project were: - Reduction of waste disposal, because the paint material on the Kanmon Bridge included some levels of PCB and lead. - Cost reduction due to high efficiency and low disposal costs. - Much less dust than traditional blasting. - Usable at any time of year. - Chemical removal less efficient under cold conditions. - New environmental friendly technology.

La loro intenzione era di fare in modo che la soluzione RPR fosse approvata come metodo di sverniciatura per il progetto del ponte Kanmon (rif. foto d’apertura). Con questo sistema, il distacco della vernice avviene per mezzo del principio di induzione. Il calore viene generato nel substrato di acciaio e il legame si rompe. Il rivestimento è in seguito rimosso senza disintegrarsi e senza agenti contaminanti, come la graniglia. Questo, naturalmente, rende lo smaltimento e il riciclo dei residui più facile ed economico. La vernice è distaccata persino all’interno di fori e fratture.

1

The steel beams of the bridge. Le travi di acciaio del ponte.

Grazie al loro impegno costante, alla svariate dimostrazioni e alle presentazioni dei dati ricavati dai test, il metodo di RPR è stato infine approvato da NEXCO come soluzione di elevato valore ingegneristico per questo progetto. Contemporaneamente, l’uso di metodi di sverniciatura a base di sabbia e acqua (UHP) sono stati banditi a causa del rischio di contaminare aria e acqua. Di conseguenza, poco tempo dopo Ocean Tec ha ricevuto l’ordine ufficiale per l’utilizzo delle unità RPR in veste di subappaltatore del progetto. I punti di forza che hanno permesso alle attrezzature di RPR di essere approvate per il progetto del ponte Kanmon sono stati: - riduzione delle scorie da smaltire. Il materiale di verniciatura utilizzato per il ponte, infatti, conteneva una certa quantità di PCB e piombo; - riduzione dei costi grazie all’elevata efficienza e ai bassi costi di smaltimento; - presenza di polvere nettamente inferiore rispetto alla tradizionale sabbiatura; - tecnologia utilizzabile in ogni periodo dell’anno; - sverniciatura chimica meno efficiente in caso di freddo intenso; - tecnologia nuova ed ecologica. © Ocean Tec

ipcm® Protective Coatings - 2016 APRIL - N. 17

29


© Ocean Tec

PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

2

3

2

© Ocean Tec

3

A moment of the paint removal work. Un momento delle operazioni di sverniciatura.

In total, 25,000 m2 of surface were stripped with 3 RPR units in about 10 months. In totale, in circa 10 mesi è stata sverniciata una superficie di 25.000 m2 con 3 unità RPR.

Kanmon Bridge: Project Facts

Ponte Kanmon: informazioni sul progetto

The Kanmon Bridge (Fig. 1), which connects with Honshu-island and Kyushu-island, was built in 1973 and a complete refurbishment project started in 2011. It is divided in 10 sections and the project will continue over a period of 10 years. To date, Ocean Tec has performed the paint stripping work in section 3 and 4 (20,000 m2) as subcontractor (Figs. 2 and 3). The success of the work (speed, efficiency and no emissions) is likely going to continue when new sections are due for refurbishment. The paint stripping work of the 3rd section of the bridge was completed between August 21, 2014 and March 31, 2015; the 4th section was completed between April 10, 2015 and August 20, 2015. The total surface treated amounted to 25,000 m². The teams were formed by 3-4 persons per unit (operating, scraping, handling person), working 7 hours per day, 6 days per week (including in the count some non-working days due to owner’s reason or weather conditions).

Il ponte Kanmon (fig. 1), che collega l’isola di Honshu e l’isola di Kyushu, è stato costruito nel 1973. Nel 2011 è stato avviato un progetto di rinnovamento completo del ponte. Diviso in 10 sezioni, il progetto durerà per un periodo di 10 anni. Finora, Ocean Tec ha effettuato le operazioni di sverniciatura nelle sezioni 3 e 4 (20.000 m2) in qualità di subappaltatore (figg. 2 e 3). Il lavoro con ogni probabilità continuerà con successo (velocità, efficienza e nessuna emissione) quando ulteriori sezioni saranno sottoposte al ripristino. La sverniciatura della terza sezione del ponte è stata completata tra il 21 agosto 2014 e il 31 marzo 2015; la quarta sezione è stata completata tra il 10 aprile 2015 e il 20 agosto 2015. La superficie totale trattata è stata di 25.000 m2. Le squadre erano formate da 3-4 persone per unità addette alle operazioni, alla sverniciatura e alla gestione, operative 7 ore al giorno per 6 giorni alla settimana (nel conteggio sono state incluse alcune giornate non lavorative per motivi riconducibili al proprietario oppure alle condizioni meteorologiche).

The types of coatings that were applied to the bridge structures included: Zinc spray coating; 30

N. 17 - 2016 APRIL - ipcm® Protective Coatings

Le tipologie di vernici applicate alle strutture del ponte comprendevano: rivestimento zincante applicato a spruzzo; zincante fenolico a base di cromo; vernici fe-


K. Inoue E-Energy Corporation Tokyo, Japan inoue@e-energy.co.jp

phenolic zinc chromate anticorrosive paint; phenolic micaceous iron oxide paint and chlorinated rubber paint. The coating thickness was 500-2000 micron. The paint removal scope was on ordinary area and excluded splicing parts and fillet weld zones. The zinc spraying layer was needed to remain. Splicing parts and fillet weld zones were treated by chemical remover. Subsequent surface preparation was done with sodium bicarbonate blasting. The paint removed in this work contained some levels of PCB (Polychlorinated biphenyl) and lead. Consequently, it was very beneficial for the owner to use RPR units. The result was excellent. In total, 25,000 m2 of surface were stripped with 3 RPR units in about 10 months, at an average speed of 40 m2 a day per unit. The work was successfully completed within the contractual time limit. ‹

noliche con ossido di ferro micaceo e vernici a base di gomma clorurata. Lo spessore del rivestimento si attestava tra 500 e 2.000 micron. L’ambito della sverniciatura con unità RPR ha riguardato zone ordinarie, escludendo dunque le parti di giunzione e le zone con saldature ad angolo: era necessario conservare lo strato di vernice zincante applicata a spruzzo, mentre le parti di giunzione e le zone con saldature ad angolo sono state trattate con uno sverniciatore chimico. Dopo le operazioni, la superficie è stata preparata attraverso sabbiatura a base di bicarbonato di sodio. La vernice rimossa in questo progetto conteneva una certa quantità di PCB (policlorobifenili) e piombo. Il committente, quindi, ha tratto un grande beneficio dall’utilizzo delle unità di RPR. Il risultato è stato eccellente. In totale, è stata sverniciata una superficie di 25.000 m2 con 3 unità RPR in circa 10 mesi, a una velocità media di 40 m2 al giorno per unità. Il lavoro è stato completato con successo nei tempi contrattualmente previsti. ‹

VERNICIATURA, SIGILLATURA, INCOLLAGGIO Soluzioni per applicazione materiale 2K – EcoDose 2K

Visitateci presso XyleXpo dal 24 al 28.05.16 a Milano, stand Homag nella hall 3

www.verind.it

Eccellenti apparecchiature di applicazione per tutti i settori industriali, specifiche per prodotti vernicianti e prodotti ad alta viscosità ove è richiesta la protezione da corrosione, nonché la sigillatura e l’incollaggio.


PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

© Belzona Polymerics Ltd.

EPOXY SYSTEMS CURB CAVITATION THREAT: POLYMERIC COMPOSITES AND COATINGS TRANSFORM HEAVILY CORRODED RUDDERS Sistemi epossidici bloccano il rischio di cavitazione: compositi e rivestimenti polimerici trasformano timoni fortemente corrosi

I

Opening photo: First coat of Belzona 2141 applied. Foto di apertura: il primo strato applicato di Belzona 2141.

32

n the Marine industry, cavitation commonly occurs on hydrofoils, rudders, stabilizers, as well as on propulsion systems. Cavitation damage can lead to severe erosion problems and render equipment useless if left untreated. Millions are spent every year on replacing equipment damaged by cavitation. This is not only expensive and time consuming, but the like-for-like replacement solution will not solve the problem. Repair methods involving welding will not stop the problem from reoccurring either, and the heat introduced can cause HAZ (Heat Affected Zones) and stress corrosion cracking. As a result, a repair and protection alternative able to withstand the cavitation forces for the long term is required.

N. 17 - 2016 APRIL - ipcm® Protective Coatings

N

el settore marino la cavitazione si verifica solitamente su aliscafi, timoni, stabilizzatori e sui sistemi di propulsione. I danni da cavitazione possono causare seri problemi di erosione che, se non viene trattata, può rendere inutilizzabili le attrezzature. Ogni anno la sostituzione delle attrezzature danneggiate dalla cavitazione costa milioni di euro: oltre a essere costosa in termini di tempo e denaro, la sostituzione in sé non risolve il problema. Nemmeno i metodi di riparazione che prevedono l’uso della saldatura riescono ad impedire al fenomeno di ripresentarsi; inoltre, il calore prodotto può causare problemi di HAZ (Heat Affected Zones) e tensocorrosione. È quindi necessaria una soluzione alternativa di riparazione e protezione in grado di resistere a lungo alle forze di cavitazione.


Chloe Hirst Belzona Polymerics Ltd., Harrogate, England chirst@belzona.com

© Belzona Polymerics Ltd.

1 2

Metal pitting caused by cavitation and corrosion. Crateri nel metallo causati da cavitazione e corrosione.

1

2

© Belzona Polymerics Ltd.

System Selection: Flexible and Durable Materials

Scelta del sistema: materiali durevoli e flessibili

Due to its simple and quick application procedure, the navy base decided to repair and protect the damaged rudders with a combination of cold-curing Belzona polymeric systems. Following inspection by Belzona representatives, Belzona Technical Services Engineer, Yusuke Nishi said: “It was decided that the pitted areas should be rebuilt using Belzona 1311 (Ceramic R-Metal). This ceramic filled, epoxy-based composite will provide the 3 level of strength 3 and durability necessary to Substrate tested for Chloride content. ensure the Superficie sottoposta ad analisi per substrate will verificare il contenuto di cloruri.

La base navale ha deciso di riparare e proteggere i timoni danneggiati con una combinazione di sistemi polimerici Belzona con polimerizzazione a freddo grazie alla loro procedura di applicazione semplice e rapida. Dopo l’ispezione dei rappresentanti di Belzona, Yusuke Nishi, Technical Services Engineer di Belzona, ha dichiarato: “Per ricostruire le aree bucherellate è stato scelto il prodotto Belzona 1311 (Ceramic R-Metal). Questo materiale composito a base epossidica e contenente ceramica, 4 offre il livello di re4 sistenza e di durabilità necessario Surface profile test. ad assicurare che il Test del profilo della superficie. substrato rimanga © Belzona Polymerics Ltd.

I timoni di una imbarcazione di una base navale statunitense in Giappone, dopo aver riportato danni dovuti a erosione e corrosione alveolare (figg. 1 e 2), avevano urgente bisogno di una soluzione resistente alla cavitazione sul lungo periodo. Era necessario un lavoro di manutenzione esteso (una superficie totale di 58 m2), e l’applicazione, come richiesto dalla base navale, doveva essere effettuata con il minor tempo di fermo possibile, in modo da non fermare l’operatività delle navi.

© Belzona Polymerics Ltd.

Suffering with erosion and corrosion pitting damage (Figs. 1 and 2), the rudders on a vessel at a US navy base in Japan were in urgent need of a longterm, cavitation-resistant solution. While extensive maintenance work was needed, totalling a surface area of 58m², the navy base required the application to be carried out with as minimal downtime as possible, so as not to impede on the vessels operations.

ipcm® Protective Coatings - 2016 APRIL - N. 17

33


PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

Pit filling with Belzona 1311. Crateri riempiti con Belzona 1311.

6

Anti-corrosion coating Belzona 1341. Rivestimento anticorrosione Belzona 1341.

34

Fast and Simple Application Procedure

© Belzona Polymerics Ltd.

5

remain robust, even when subjected to the aggressive marine conditions. To encapsulate this, a corrosionresistant coating, Belzona 1341 (Supermetalglide) was chosen. Finally, two coats of Belzona 2141 (ACR-Fluid Elastomer) were further specified. The flexible yet robust properties of this elastomeric system will enable the rudders to resist cavitation, even at ultra-high velocities, successfully fortifying the vessel for the long term.”

resistente anche quando soggetto a condizioni ambientali marine aggressive. Per raggiungere l’obiettivo, inoltre, è stato scelto anche Belzona 1341 (Supermetalglide), un rivestimento resistente alla corrosione. Infine, sono stati specificati due ulteriori strati di Belzona 2141 (ACR-Fluid Elastomer). Le proprietà solide eppure flessibili di questo sistema elastomerico consentiranno ai timoni di resistere alla cavitazione, anche a velocità molto elevate, irrobustendo la nave per un lungo periodo”.

Procedura di applicazione veloce e semplice

Firstly, the rudders were sprayed In primo luogo, i timoni sono stati using a high pressure (41.4 - 68.9 spruzzati utilizzando un getto d’acqua MPa/6,000-10,000psi) water ad alta pressione (41.4 - 68.9 MPa/6,000jet to remove all loose rust and 10,000psi) per rimuovere tutta la rugchlorides. The substrate was then gine diffusa e i cloruri. Il substrato è tested using an Elcometer 134S stato in seguito analizzato utilizzando (Chloride Ion Test Kit) to ensure Elcometer 134S (kit test ione cloruro) the chloride content was less per garantire che il contenuto di cloruro than 20mg/m² (Fig. 3). fosse inferiore a 20 mg/m² (fig. 3). 5 The substrate was then grit Il substrato è stato poi sabbiato per ragblasted to give Swedish Standard giungere lo standard svedese Sa2 ½ Sa2 ½ (near white metal finish), (near white metal finish), ottenendo un ensuring a 75-125 μm (3-5 mil) profilo di 75-125 μm (3-5 mil). Utilizzanprofile was achieved. Using Testex do il nastro replica Testex, è stata misurareplica tape, the surface profile to il profilo della superficie per assicurarsi was measured to ensure the che si fosse raggiunto il profilo corretto, correct surface profile, as detailed come specificato in precedenza (fig. 4). above, was achieved (Fig. 4). Belzona 1311 è stato poi utilizzato per Belzona 1311 was then used riparare le aree bucherellate e riportare to rebuild the pitted areas back il timone alle dimensioni originali, riemto the original dimension of piendo correttamente i buchi e lascianthe rudder, taking care to fill in do una superficie liscia senza increspathe pits correctly and to leave ture (fig. 5). a smooth surface free of ridges Successivamente, su tutte le zone dan(Fig. 5). neggiate dalla cavitazione è stato apNext, Belzona 1341 was applied plicato Belzona 1341, con un singolo 6 © Belzona Polymerics Ltd. on all cavitation damaged areas strato di 250μm (10 mil). Dopo otto ore, with a single 250μm (10mil) coat. una volta che il rivestimento si è indurito After eight hours, once the coating was firm and dry, the e asciugato, l’area è stata sovraverniciata con Belzona 2941 area was over coated with Belzona 2941 (SP Conditioner). (SP Conditioner). Per assicurare che lo strato di prodotto apTo ensure this was applied as thinly as possible, a brush plicato fosse il più sottile possibile, è stato utilizzato un penwith bristles 12mm long was used (Fig. 6). nello con setole lunghe 12 mm (fig. 6). Finally, Belzona 2141 was applied in two coats (black on Infine, sono stati applicati due strati (nero e verde) di Belzona green) (Ref. opening photo). This flexible elastomeric 2141 (rif. foto di apertura). Questo sistema elastomerico system was applied to the substrate with a thickness of flessibile è stato applicato alla superficie con uno spessore di 500-750μm (20-30mil) per coat (Fig. 7). 500-750μm (20-30mil) per strato (fig. 7).

N. 17 - 2016 APRIL - ipcm® Protective Coatings


Inspection After Two Years Confirms Durability of Belzona Coating

© Belzona Polymerics Ltd.

The application was inspected after two years in service and was mostly found to be in perfect condition, with only minor mechanical damage in localised areas. The chosen repair and protection system had overcome the major cavitation and erosion problems, successfully protecting the asset for the long term. The application itself required only five days to complete, with just ten and a half hours of manual labour, and did not require hot work as the complete Belzona system is cold applied. This facilitated a quick repair ensuring minimal downtime was incurred. ‹

7 7

Application completed. Applicazione completata.

L’ispezione effettuata 2 anni dopo conferma la durabilità del rivestimento di Belzona L’applicazione è stata ispezionata dopo 2 anni di servizio, ed è stata trovata in condizioni quasi perfette, con soltanto piccoli danni meccanici in zone localizzate. Il sistema di riparazione e protezione scelto ha superato i problemi di erosione e cavitazione maggiori, proteggendo con successo i manufatti per un lungo periodo. L’applicazione è stata completata in soli cinque giorni, con soltanto dieci ore e mezza di lavoro manuale; inoltre, non sono state necessarie lavorazioni a caldo poiché il sistema di Belzona è applicato a freddo. Questo ha facilitato l’esecuzione rapida della riparazione, con un tempo di fermo minimo. ‹


PROTECTIVE COATINGS | FOCUS ON TECHNOLOGY

© Geinsa

LIQUID COATING APPLICATION BOOTH FOR CORE BOXES Cabina per l’applicazione di vernici liquide nelle casse d’anima

A

Opening photo: The interior of the booth, with the light signalling the entrance of the workpieces. Foto di apertura: interno della cabina con indicatore luminoso che segnala l’ingresso dei pezzi.

36

n industrial group specialising in the design and production of die cast parts for a wide variety of manufacturers, especially from the automotive sector, and Tier 1 suppliers, has relied on Geinsa for the installation of a spray paint booth to coat its core boxes. The parts enter the booth by means of trolleys running on rails. Two operations are performed in this area: The application of the liquid paint (in the pressurised booth and with filtered air) and the drying stage (with hot air recirculation).

N. 17 - 2016 APRIL - ipcm® Protective Coatings

U

n gruppo industriale specializzato nella progettazione e fabbricazione di pressofusioni lavorate per un’ampia varietà di costruttori, soprattutto del settore automotive e per i fornitori Tier 1, ha riposto la sua fiducia in Geinsa per l’installazione di una cabina per l’applicazione di vernice nelle sue casse d’anima. I pezzi sono introdotti nella cabina per mezzo di carrelli disposti su rotaie. In quest’area si realizzano due operazioni: applicazione della vernice liquida in cabina pressurizzata per mezzo di aria filtrata e asciugatura con ricircolo di aria calda.


Reyes Marquiegui Geinsa, Erandio – Bilbao (Spain) r.marquiegui@geinsa.com

The machine’s enclosure, panels, roof and doors have been built with self-extinguishing modular panels in order to ensure maximum safety.

La chiusura del perimetro, così come i pannelli, il tetto e le porte sono stati realizzati con pannelli modulari autoestinguenti al fine di garantire la massima sicurezza all’azienda. La cabina è equipaggiata con un interruttore per le richieste di ingresso dei pezzi e segnale luminoso all’interno (rif. foto di apertura): in questo modo, l’operatore viene informato dell’arrivo di un altro pezzo. Allo stesso modo, un segnale luminoso rosso posto all’esterno (fig. 1) della cabina indica agli operatori che la fase di aspirazione è in corso; il segnale verde, invece, ne indica il termine.

© Geinsa

The booth is equipped with a switch for the workpieces’ entrance requests and with an internal light (Ref. opening photo) informing the operator of the arrival of another part. In the same way, a red light on the outside of the 1 booth (Fig. 1) signals that the 1 suction phase The exterior of the spray paint booth. is in progress; a Esterno della cabina di verniciatura. green light, on the other hand, signals its end. A pressure switch located in the outlet duct enables to control the air pressure and is equipped with an audible alarm in case of failure. A pressure sensor installed in the extraction duct is connected to the computer that controls the gun’s compressed air supply: When the average pressure is less than the set value, supply is interrupted to ensure the users’ safety, in compliance with the regulations. Finally, the booth has an electrical control cabinet (Fig. 2) equipped with a computer and a touch panel that simplifies the management of the plant. ‹

Un pressostato posizionato nel condotto di uscita consente di controllare la pressione dell’aria ed è equipaggiato con un allarme sonoro in caso di guasto. Un sensore di pressione installato nel condotto di estrazione è connesso al computer che controlla l’alimentazione dell’aria compressa della pistola: quando la pressione media è inferiore al valore stabilito, la sua alimentazione viene interrotta per garantire la sicurezza dell’utilizzatore della cabina, secondo la normativa.

2

© Geinsa

La cabina è completata da un armadio elettrico (fig. 2) di controllo dotato di computer e pannello touch che semplifica la gestione dell’impianto. ‹

2

The electrical control cabinet with its touch screen panel. Armadio elettrico di controllo con pannello touch.

ipcm® Protective Coatings - 2016 APRIL - N. 17

37


PROTECTIVE COATINGS | INNOVATIONS

© Graco BVBA

BLAST WITH LESS DUST Sabbiare con meno polvere

M

Opening photo: The Graco EcoQuip EQ 600S machine. Foto di apertura: l’unità Graco EcoQuip EQ 600S.

38

any different techniques are used to prepare a surface for effective corrosion protection. Sandblasting is the most common. This can be either conventional, or low pressure wet abrasive sandblasting. Other material used for blasting includes high pressure water (hydroblasting), compressed air and bicarbonate of soda based media (soda blasting), compressed air with carbon dioxide (dry ice blasting), and even a vacuum. Why have so many methods been developed? Mainly to overcome the major disadvantage of sandblasting: The vast quantity of dust produced. Apart from the health and safety issues of clouds of dust – not only for the operators but people in the immediate vicinity – dust disposal is costly. The cost and disposal of the abrasive also has to be taken into account.

N. 17 - 2016 APRIL - ipcm® Protective Coatings

P

er preparare una superficie al fine di ottenere una protezione anticorrosiva efficace si possono utilizzare molte tecniche differenti. La sabbiatura è il metodo più comune: può essere convenzionale oppure a umido a bassa pressione. Altri materiali utilizzati per la sabbiatura sono l’acqua ad alta pressione (idrosabbiatura), aria compressa e abrasivi a base di bicarbonato di sodio (soda blasting), aria compressa con anidride carbonica (sabbiatura con ghiaccio secco), e anche il vuoto. Perché sono stati sviluppati così tanti metodi? Principalmente per superare il più grande svantaggio della sabbiatura: l’elevata quantità di polvere prodotta. Le nuvole di polvere, oltre a presentare criticità legate alla salute e alla sicurezza per gli operatori e per le persone nelle immediate vicinanze, sono costose da smaltire. Inoltre, è necessario prendere in considerazione anche il costo e lo smaltimento dell’abrasivo.


Stephan Rindfleisch Graco BVBA, Maasmechelen, Belgium communications@graco.be

Graco has been concerned with these issues for a number of years and has developed a revolutionary alternative to sandblasting: Vapor abrasive blasting with EcoQuip™.

Graco ha studiato queste problematiche per diversi anni e ha sviluppato un’alternativa rivoluzionaria alla sabbiatura convenzionale: la sabbiatura a vapore con EcoQuip™.

What is vapor abrasive blasting?

Che cos’è la sabbiatura abrasiva a vapore?

The difference between vapor abrasive blasting and sandblasting is the use of water. There is nothing new about wet abrasive blasting: It’s been around since 1941. However, the process was never perfected. Graco has taken an existing technology and greatly improved it. Graco’s new developments in wet and vapor abrasive blast technologies include increasing production rates to decrease water consumption; optimizing the air, water and media ratio for optimal performance; and achieving the same profile compared to traditional blasting methods. In a nutshell, Graco’s approach to vapor abrasive blasting involves adding water simultaneously with the abrasive media in a pressure pot. The abrasive becomes suspended in water, and the mixture is then projected at high velocity by a forceful flow of compressed air. By encapsulating each blast particle with water, extra weight is added to the media which enlarges the impact of the blast media on the substrate. In addition, the removal and feathering of the material goes smoother and less media is used. The water reduces splash back and traps the dust being produced.

La differenza tra sabbiatura a vapore e sabbiatura convenzionale risiede nell’utilizzo dell’acqua. La sabbiatura a umido non è una novità: è stata introdotta intorno al 1941. Tuttavia, il processo non è mai stato perfezionato. Graco ha quindi preso una tecnologia già esistente e l’ha nettamente migliorata. Le innovazioni di Graco nelle tecnologie di sabbiatura a umido e a vapore comprendono l’aumento della produttività, la diminuzione del consumo di acqua e l’ottimizzazione del rapporto tra aria, acqua e abrasivo per una prestazione ottimale; inoltre, è possibile ottenere lo stesso profilo superficiale che si otterrebbe con i metodi di sabbiatura tradizionali. In poche parole, l’approccio di Graco alla sabbiatura a vapore consiste nell’aggiungere l’acqua e l’abrasivo contemporaneamente nel serbatoio in pressione. L’abrasivo è così sospeso nell’acqua, e la miscela è in seguito proiettata ad alta velocità da un forte flusso di aria compressa. Poiché ogni particella è incapsulata nell’acqua, l’abrasivo diventa più pesante: in questo modo, aumenta l’impatto del getto sul substrato. Inoltre, la rimozione e la diffusione del materiale è più semplice e si utilizza una minore quantità di abrasivo. L’acqua riduce gli schizzi e cattura la polvere prodotta.

Introducing EcoQuip

EcoQuip

Graco’s vapor abrasive blast equipment is sold under the name EcoQuip. It provides a performance equivalent to sandblasting but with 92% less dust, thus minimizing the need for PPE, tenting and containment, and decreasing environmental impact. It uses up to 75% less blast media and far less water than wet blasting, and creates little run-off, thus there is no large slurry mess to clean-up and dispose. It is effective in rain and high humidity, and efficiently removes coatings without damaging the sub-surface. The bottom line is that EcoQuip reduces project costs while increasing the speed, efficiency and productivity of blasting.

L’apparecchiatura di Graco per la sabbiatura a vapore è commercializzato con il nome EcoEquip. Offre prestazioni equivalenti alla sabbiatura convenzionale ma con il 92% in meno di polvere, minimizzando così il bisogno di PPE, teli e contenimenti vari e riducendo l’impatto ambientale. Consente fino al 75% di risparmio sugli abrasivi di sabbiatura e utilizza una quantità nettamente inferiore di acqua rispetto alla sabbiatura a umido, creando meno gocciolamenti e, quindi, meno fanghiglia da pulire e smaltire. È efficace sia in caso di pioggia sia di elevata umidità, e rimuove in modo efficiente le vernici senza danneggiare la superficie. In conclusione, EcoQuip riduce i costi totali aumentando al tempo stesso velocità, efficienza e produttività della sabbiatura.

ipcm® Protective Coatings - 2016 APRIL - N. 17

39


© Graco BVBA

PROTECTIVE COATINGS | INNOVATIONS

1

2

1

Pipe spool before vapor blasting. Un raccordo prima della sabbiatura a vapore. 2

Result of Vapor Blasting with EcoQuip. Risultato della sabbiatura a vapore con EcoQuip.

40

© Graco BVBA

EcoQuip in practice

EcoQuip in pratica

Two applications of EcoQuip in the Middle East illustrate its efficiency and eco credentials. Lloyds Engineering of Sharjah, Dubai designs and fabricates steel structures, tanks, pipe spools, pressure vessels and process skids for both onshore and offshore facilities. When blasting was required, outside contractors were used, but neither Lloyds Engineering nor their customers were satisfied at the quality levels obtained. The company therefore decided to construct their own blasting room, and started looking for a supplier of a more efficient, dust-free blasting solution that could give them higher quality blasting. Graco distributor BITEC was contacted, and BITEC Branch Manager Mohammed Nayaz organized a demonstration at Lloyds Engineering of vapor blasting using EcoQuip EQ 600S (Ref. opening photo). It made a big impression, with its clear benefit of a reduction of environmental concerns through not using sand or water (Figs. 1 e 2). BITEC followed up the demo with a training program for all the 125 technical staff at the Sharjah site. EcoQuip EQ 600S is now being use as the standard high quality vapor blasting equipment by Lloyds Engineering, to the satisfaction of their customers.

Due applicazioni di EcoQuip, nel Medio Oriente, illustrano la sua efficienza e le sue caratteristiche ecologiche. Lloyds Engineering, azienda di Sharjah, Dubai, progetta e costruisce strutture di acciaio, serbatoi, raccordi, contenitori a pressione e skid di processo onshore e offshore. Per effettuare la sabbiatura, in precedenza l’azienda si affidava a società esterne, ma né Lloyds Engineering né i suoi clienti erano soddisfatti del livello qualitativo raggiunto. La società ha quindi deciso di costruire una propria camera di sabbiatura e ha iniziato a cercare un fornitore con una soluzione di sabbiatura più efficiente e senza polvere in grado di offrire una maggiore qualità. Mohammed Nayaz, Branch Manager di BITEC, il distributore di Graco contattato da Lloyds Engineering, ha organizzato una dimostrazione di sabbiatura a vapore presso l’azienda utilizzando l’unità EcoQuip EQ 600S (rif. foto d’apertura). L’operazione, di grande successo, ha mostrato chiaramente i benefici derivanti dal punto di vista ambientale senza l’utilizzo di sabbia o acqua come nei metodi convenzionali (figg. 1 e 2). BITEC ha fornito, dopo la dimostrazione, un programma di formazione per le 125 persone dello staff tecnico del sito di Sharjah. EcoQuip EQ 600S è ora utilizzato da Lloyds Engineering come attrezzatura standard di alta qualità per la sabbiatura a vapore, con grande soddisfazione dei suoi clienti.

A similar situation existed at Technical Resources Est, part of the Alwardy Group. Services provided include the refurbishment of generator canopies and containers. Blasting operations for this activity

Una situazione simile si è verificata presso Technical Resources Est, parte del Gruppo Alwardy. I servizi offerti da questa azienda comprendono il ripristino di coperture e contenitori per generatori. Anche questa società si affida-

N. 17 - 2016 APRIL - ipcm® Protective Coatings


Stephan Rindfleisch Graco BVBA, Maasmechelen, Belgium communications@graco.be

were also carried out by outside contractors – unfortunately to a low quality level and with a significant environmental burden. For Technical Resources, BITEC also provided a demonstration of EcoQuip’s capabilities. The result was a very positive evaluation. Technical Resources first rented an EcoQuip EQ 600S for three weeks, before purchasing their own unit (Fig. 3). BITEC gave in-depth training to 14-strong technical team of Technical Resources, allowing the company to provide its own blasting services to its customers, to a much higher quality level and with ecological benefits in terms of reduced sand and water usage.

va a terzisti per le operazioni di sabbiatura, ma sfortunatamente con una bassa qualità e con un significativo impatto ambientale. BITEC ha offerto a Technical Resources una dimostrazione delle capacità di EcoQuip, e il risultato è stato molto positivo. L’azienda ha infatti noleggiato EcoQuip EQ 600S per tre settimane e in seguito ha acquistato un’unità (fig. 3). BITEC ha fornito un programma di formazione approfondito ai 14 membri dello staff tecnico di Technical Resources, consentendo all’azienda di offrire un servizio interno di sabbiatura ai propri clienti con un livello qualitativo più alto e con vantaggi ambientali derivanti dal minore utilizzo di sabbia e acqua.

Less dust: It’s proven

Meno polvere: è provato

EcoQuip’s reduced dust production has been proved by a 3-day study conducted in 2014 by Applied Environmental Sciences, Inc. It compared airborne particulate concentrations produced by vapor abrasive blasting versus dry abrasive blasting. Over the course of the three days, multiple air

La ridotta produzione di polvere di EcoQuip è stata dimostrata da uno studio di 3 giorni condotto nel 2014 da Applied Environmental Sciences, Inc., nel quale sono state confrontate le concentrazioni di particelle sospese nell’aria prodotte attraverso sabbiatura abrasiva a vapore con quelle prodotte con sabbiatura abrasiva a secco.

RIVESTIMENTI A RAPIDA ESSICCAZIONE t $JDMJ DPNQMFUJ QFS BNCJFOUJ EJGGFSFOUJ t &DDFMMFOUJ QSPQSJFUË BOUJDPSSPTJWF t 3BQJEB FTTJDDB[JPOF F CSFWJ JOUFSWBMMJ EJ SJDPQFSUVSB QFS JODSFNFOUBSF MB QSPEVUUJWJUË t .BOJQPMB[JPOF F USBTQPSUP QJá WFMPDJ DIF NBJ VIENNA INTERNATIONAL AIRPORT - Hanger nº 7 t "TTJTUFO[B UFDOJDB QSPGFTTJPOBMF REALISATION: 2012 - 2014 F TV NJTVSB hempel.it

COATING SYSTEM DESCRIPTION: HEMPADUR FAST DRY 17410 HEMPACORE ONE FD 43601 ipcm® Protective Coatings - 2016 APRIL - N. 17 HEMPATHANE 55210


PROTECTIVE COATINGS | INNOVATIONS

3

© Graco BVBA

3

Refurbishing of a generator canopy with EcoQuip. Ripristino della copertura di un generatore con EcoQuip.

samples were collected in the vicinity of the Graco EcoQuip EQ 300S vapor abrasive blasting machine and a commonly used competitor’s dry blasting machine. The study was designed to collect triplicate airborne dust samples during multiple, randomly ordered runs using all possible combinations of the two abrasive blasting machines, three different blasting media (garnet, glass bead and coal slag) and one blasting target (a steel plate). Samples were submitted to an accredited laboratory for analysis of total airborne particulate concentrations. The results show that average airborne particulate concentrations were lower when using the EcoQuip vapor abrasive blasting equipment than those produced by the competitor’s dry blasting equipment. In the case of garnet and coal slag blasting media, reductions in weight of total airborne particulates generated were 91% and 92% respectively, compared to the competitor’s machine. When using the glass bead abrasive medium, the EcoQuip yielded a 71% reduction in airborne dust. These numbers support the claim that a substantial portion of the cloud observed when using the EcoQuip equipment is, in fact, water mist. 42

N. 17 - 2016 APRIL - ipcm® Protective Coatings

Durante questi tre giorni, sono stati raccolti diversi campioni di aria in prossimità dell’unità di sabbiatura abrasiva a vapore Graco EcoQuip EQ 300S e di un’unità di sabbiatura a secco di un competitor, comunemente utilizzata. Lo studio ha previsto la raccolta di tre campioni di polvere sospesa nell’aria in diversi momenti casuali delle operazioni, utilizzando tutte le combinazioni possibili per le due macchine di sabbiatura abrasiva, tre diversi tipi di abrasivi (granato, sfere di vetro, scorie di carbone) e una piastra in acciaio come bersaglio del getto. I campioni sono stati inviati a un laboratorio accreditato per l’analisi delle concentrazioni totali di particelle sospese nell’aria. I risultati mostrano che le concentrazioni medie di queste particelle sospese erano inferiori durante l’utilizzo dell’unità EcoQuip per la sabbiatura a vapore rispetto a quelle prodotte dal macchinario di sabbiatura a secco del competitor. Nel caso del granato e delle scorie di carbone, il peso delle particelle sospese totali generate è risultato più basso rispettivamente del 91% e del 92% rispetto all’unità del concorrente. Con le sfere di vetro, invece, EcoQuip ha fatto registrare una diminuzione del 71%. Questi numeri confermano che una porzione sostanziale della nuvola osservata durante l’utilizzo di EcoQuip è, di fatto, acqua nebulizzata.


Stephan Rindeisch Graco BVBA, Maasmechelen, Belgium communications@graco.be

A solution for every application

Una soluzione per ogni applicazione

EcoQuip is supplied as standard in a stainless steel frame and roll cage, with a galvanized blast pot, integrated water tank and easy-to-use control panel. It comes as a portable unit (100M) or skidded units (300S, 600S). Air consumption varies between 4.7 and 17 m3/min. Blast pot media capacity is up to 184 liters and blast pressure up to 8.3 bar. Water supply is a 38 liter buffer tank on the portable unit and a 435 liter storage tank on the 300S and 600S units. EcoQuip vapor abrasive blasting equipment is considered suitable for a range of applications in different industries. Examples include the removal of paint layers, marine coatings, rust and corrosion, roadway markings, and industrial coatings and linings. It can be used for general metal, stone and wood cleaning, lead and asbestos abatement, building and site maintenance, and for restoring artifacts and removing graffiti. ‚

EcoQuip, come standard, è fornito con telaio e gabbia in acciaio inossidabile, vasca di sabbiatura galvanizzata, serbatoio dell’acqua integrato e un pannello di controllo facile da usare. Ăˆ disponibile sia in versione portatile (100M) sia per skid (300S, 600S). Il consumo di aria varia tra 4,7 e 17 m3/min. La capacitĂ di contenimento della vasca di sabbiatura arriva fino a 184 litri, mentre la pressione del getto fino a 8,3 bar. Sull’unitĂ portatile, l’acqua viene alimentata da un serbatoio di accumulo di 38 litri, mentre sulle versioni 300S e 600S il serbatoio di stoccaggio ha una capacitĂ di 435 litri. L’unitĂ EcoQuip per la sabbiatura abrasiva a vapore è adatta per un’ampia gamma di applicazioni in diverse industrie. Tra i suoi utilizzi, la rimozione di strati di pittura, rivestimenti per ambiente marino, ruggine e corrosione, segnaletica stradale orizzontale oltre a vernici e rivestimenti industriali. Può essere utilizzata per la pulizia di metallo generico, pietra e legno, abbattimento di piombo e amianto, manutenzione di edifici e siti, ripristino di manufatti e rimozione dei graffiti. ‚

The world‘s leading expo for wind energy 27 – 30 SEPTEMBER 2016 Teaming up with

WindEnergy Hamburg is the global meeting point for onshore and offshore experts. The combination of the world’s leading expo for wind energy in conjunction with WindEurope‘s leading industry conference represents a one-stop shop for business, QHWZRUNLQJ SROLF\PDNHUV DQG WKH VFLHQWLĂ€F FRPPXQLW\ 6DYH WKH GDWH in co-operation with

ipcmÂŽ Protective Coatings - 2016 APRIL - N. 17


PROTECTIVE COATINGS | INNOVATIONS

AN INTRODUCTION TO THERMAL SPRAY – PART 3 Introduzione alla termospruzzatura – Parte 3

© Oerlikon Metco

44

his is the Part 3 of a four-part article. The first two parts were published in ipcm®_ Protective Coatings n. 15 (October 2015) and ipcm®_Protective Coatings n. 16 (December 2015). The final part will be published in ipcm®_Protective Coatings n. 18 (June 2016).

T

Q

2.4.6 Infrastructure (System Requirements) Besides the principal item of a coating system, that of the spray gun, there are numerous other items necessary to apply coatings in an industrial environment. Figure 9 shows a coating system. The spray cabin serves as a shield for the sound and dust produced by the spray gun during spraying. The cabin has inlet ports for the power, gas supply and the process monitoring and control equipment. Usually, the gun is mounted on a robot, with movement programmed for the specific components to be coated. The component to be sprayed is usually mounted on a manipulation unit, such as a turntable. Therefore, it is possible to apply coatings to very complex geometries. The ventilation system with its filtering unit is

2.4.6 Infrastruttura (requisiti dell’impianto) Oltre al componente principale di un impianto di rivestimento - la pistola di spruzzatura - vi sono molti altri componenti necessari per l’applicazione dei rivestimenti in un ambiente industriale. La figura 9 illustra un impianto di rivestimento. La cabina di lavoro serve da schermo per il rumore, la polvere e le radiazioni (nel caso del processo al plasma e ad arco elettrico) prodotte dalla pistola di spruzzatura durante il funzionamento. La cabina è dotata di passaggi di ingresso per l’alimentazione di energia elettrica, gas e delle attrezzature di monitoraggio e controllo del processo. La pistola è generalmente montata su un robot, il cui movimento programmato consente di rivestire il componente specifico in lavorazione. Il componente da rivestire è generalmente montato su un dispositivo di manipolazione, come una tavola rotante. Il movimento com-

N. 17 - 2016 APRIL - ipcm® Protective Coatings

uesta è la terza parte di un articolo suddiviso in quattro capitoli. Le prime due parti sono state pubblicate rispettivamente in ipcm®_Protective Coatings n. 15 (ottobre 2015) e ipcm®_Protective Coatings n. 16 (dicembre 2015). La parte finale sarà pubblicata in ipcm®_Protective Coatings n. 18 (giugno 2016).


Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com

binato pistola-pezzo permette quindi di applicare i rivestimenti a geometrie molto complesse. Da non dimenticare il sistema di ventilazione con la relativa unità filtro, che consente di aspirare e abbattere la “polvere in eccesso”, ovvero quella che non aderisce alla superficie del pezzo. Il filtrato di alcuni tipi di materiale può incendiarsi. In queste situazioni l’intero impianto deve essere pertanto ignifugo e a prova di esplosione. La figura 10 illustra un moderno impianto di rivestimento automatizzato ad alta produttività.

2.5 Coating Structure Thermal sprayed coatings exhibit a certain amount of process-dependent porosity. The highest porosity values develop for flame and electric arc spray. HVOF coatings, however, produce very dense layers with porosity under 0.5%. Typical plasma coatings have approximately one to two percent porosity. The sprayed coating develops as the spray gun traverses repeatedly over the surface and applies the coating in layers, bit by bit, with a typical layer thickness of 10 to 20 μm (400 to 800 μin). Oxides can form during the time between passes on the outer surface of the layer. This oxidation can be minimized by spraying in a vacuum or inert atmosphere. 9 Fine dust from overspray and unmelted particles can become trapped in the coating. The dust is the result of coating material that does not adhere to the workpiece during spraying. Subsequent spray passes drag these particles towards the coating surface where they become trapped in the coating layer. Figure 11 shows a photomicrograph of an arc sprayed coating of X40 CR 13. One recognizes the laminated structure and existing porosity (the black regions). The circular particles are those that did not melt completely before re-solidifying.

2.5 Struttura del riporto I rivestimenti termospruzzati presentano un certo livello di porosità che dipende dal processo. Le porosità maggiori si presentano con i processi a fiamma convenzionale e ad arco elettrico. I rivestimenti HVOF, tuttavia, producono riporti molto densi con porosità inferiori allo 0,5%. I tipici rivestimenti al plasma presentano una porosità di circa 1-2%. La spruzzatura in camera a bassa pressione e atmosfera controllata può produrre riporti con densità quasi totale. Il rivestimento termospruzzato si genera con il passaggio ripetuto della pistola di spruzzatura sulla superficie, con l’applicazione di piccoli spessori per ogni passata, tipicamente 1020 μm (400-800 μin). Nel tempo che intercorre tra i diversi passaggi possono crearsi ossidi sulla superficie esterna dello strato appena applicato. Tale ossidazione può minimizzarsi effettuando la spruzzatura in camera a bassa pressione o in presenza di un’atmosfera inerte. Il pulviscolo fine e le particelle non fuse possono rimanere intrappolate nel rivestimento. Il pulviscolo è generato da quella porzione del materiale d’apporto che non aderisce al substrato. Passaggi di spruzzatura successivi trascinano queste particelle verso la superficie del rivestimento, dove restano intrappolate all’interno. La figura 11 è una fotomicrografia di un rivestimento X40 CR 13 applicato ad arco elettrico. Si riconosce la struttura a strati laminari e la porosità (aree nere). © Oerlikon Metco

not to be forgotten, as the so-called “overspray”, i.e. the powder material that does not stick to the component surface, can be exhausted and trapped in the filtering unit. The spray dust produced by some spray materials can ignite; hence, in these situations, the entire system must be fire and explosion proof. Figure 10 shows a modern, automated, high productivity coating facility.

9

A typical coating facility. Tipico impianto di termospruzzatura.

ipcm® Protective Coatings - 2016 APRIL - N. 17

45


PROTECTIVE COATINGS | INNOVATIONS

10

A modern LPPS highvolume production system for coating gas turbine blades. Un moderno impianto LPPS (Low Pressure Plasma Spray) ad alta produzione per il rivestimento di pale di turbine a gas.

46

10

© Oerlikon Metco

The thickness of this coating can be up to several millimeters. One can produce much denser coatings with the HVOF spray process. In Figure 12, a coating of WC (CoCr) is represented. There is hardly any porosity visible. The bright regions consist of WC hard phase, which is embedded in a ductile matrix of cobalt and chrome. Here the typical coating thickness is with 0.2 to 0.3 mm (0.008 to 0.012 inches).

Le particelle circolari sono quelle che non si sono fuse completamente prima di risolidificarsi. Lo spessore di questo rivestimento può arrivare fino a diversi millimetri. Con il processo di spruzzatura HVOF è possibile produrre rivestimenti molto più densi. Nella figura 12 è illustrato un riporto di WC (CoCr). Praticamente non vi è porosità visibile. Le aree chiare costituiscono la fase dura di WC, incorporato in una matrice duttile di cobalto e cromo. Qui lo spessore tipico del rivestimento è compreso tra 0,2 e 0,3 mm (0,008-0,012 in).

Thermal sprayed coatings generally exhibit high internal stresses, which are attributable to the process of solidification and cooling. The hot particle contracts as it cools, which gives rise to the internal coating stress. If the ratio of the thermal expansion coefficients for the substrate material and the coating material are taken into account, these stresses can be compensated for by producing compressive stresses. Temperature control during the coating process, therefore, plays an important role to determine if the substrate must be cooled or warmed. Sometimes, the adhesion of a ceramic coating on

I rivestimenti termospruzzati presentano generalmente elevate tensioni interne, attribuibili al processo di solidificazione e al raffreddamento. La particella calda si contrae al raffreddamento dando luogo alla tensione interna nel riporto. Se si considera il rapporto tra i coefficienti di espansione termica del materiale di cui è fatto il substrato e quello del materiale di riporto, queste tensioni possono essere compensate generando tensioni a compressione. Il controllo della temperatura durante il processo di rivestimento svolge, pertanto, un ruolo importante per determinare se il substrato deve essere raffreddato o riscaldato. Talvolta, l’adesione di un rivestimento ceramico su un substrato non soddisfa i requisiti

N. 17 - 2016 APRIL - ipcm® Protective Coatings


Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com

a substrate does not meet the necessary requirement for bond strength. In order to increase the bond strength, a bond coat is applied, usually composed of a NiAl or NiCr alloy, which acts as an intermediate layer between the substrate and the ceramic coating. Such intermediate coatings can also perform another important function by providing additional corrosion protection.

necessari per un buon ancoraggio. Per aumentare l’adesione, viene quindi applicato uno strato ancorante, solitamente composto da una lega di NiAl o NiCr, che agisce da strato intermedio tra il substrato e il rivestimento ceramico. Tali rivestimenti intermedi possono anche svolgere un’altra importante funzione, offrendo un’ulteriore protezione anticorrosione.

2.6 Coating Characteristics As previously stated, the porosity of a thermal spray coating is process-dependent, and exhibits an anisotropic, layered structure. These basic characteristics can be modified within a wide range to suit the specific application.

2.6 Caratteristiche del rivestimento Come citato in precedenza, la porosità di un rivestimento mediante termospruzzatura (Thermal Spray) dipende dal processo e presenta una struttura anisotropica, a strati. Queste caratteristiche di base possono essere modificate entro un’ampia gamma di valori per adeguarsi all’applicazione specifica.

2.6.1 Wear Protection One of the most important uses of thermal sprayed coatings is for wear protection [4]. In these applications, ceramics, and above all, carbide materials are used. The commonly used carbide

2.6.1 Protezione antiusura Uno dei più importanti utilizzi dei rivestimenti termospruzzati è la protezione antiusura [4]. Per queste applicazioni si utilizzano la ceramica e, soprattutto, carburi. I carburi comunemente utilizzati sono WC/Co o WC/CoCr.

World Leaders

Have Responsibilities Too!

• Surface Preparation

A

• Concrete Reinforcement Protection

N

R

L

E

V

C

E

• Water Based Coatings • P RO

TECT • P

S RE

E

• Equipment Preservation

Cortec ® provides environmentally safe corrosion protection solutions.

www.CortecVCI.com D

A QU

LI TY

TE SYST EM REGIS

EN

SY ©

Cortec Corporation 2011

ST

VIRO

NMENT

AL

EM REGISTER

ED

RE

4119 White Bear Parkway St. Paul, MN 55110 651-429-1100 • 800-426-7832 info@cortecvci.com 47

ipcm® Protective Coatings - 2016 APRIL - N. 17


PROTECTIVE COATINGS | INNOVATIONS materials are WC/Co or WC/CoCr. Here, the carbide hard phases (WC) exhibit excellent resistance against abrasive and erosive wear, and are embedded in a ductile matrix of cobalt.

Arc wire spray coating of X40 CR 13. Rivestimento di acciaio X40 CR 13 mediante spruzzatura ad arco elettrico.

48

2.6.2 Corrosion Protection Low carbon, unalloyed steel and cast iron materials are susceptible to rust and therefore often need constant surface protection. This can be produced by flame sprayed coatings of aluminum or zinc. The main areas of application are offshore structures, electro welded pipes manufactured starting from galvanized sheet metal, petrochemical plants, metal structures exposed to marine and industrial environments, LPG cylinders, etc. 11 For high temperature applications, protective coatings of MCrAlY materials can be used. These are usually applied using controlled atmosphere plasma spray.

2.6.2 Protezione anticorrosione Acciaio non legato a basso tenore di carbonio e ghisa sono materiali soggetti alla ruggine e pertanto necessitano di costante protezione superficiale. Tale protezione può essere ottenuta con rivestimenti termospruzzati a fiamma o arco elettrico di alluminio, zinco o loro leghe. Le principali applicazioni sono le piattaforme offshore, i tubi elettrosaldati costruiti a partire da lamiera zincata, gli impianti petrolchimici, le carpenterie metalliche esposte ad ambiente marino e industriale, le bombole di gas GPL, ecc. Per applicazioni a temperature elevate possono utilizzarsi riporti protettivi di leghe MCrAlY (dove M individua uno o più metalli). Questi vengono normalmente applicati con spruzzatura al plasma in camera a bassa pressione ad atmosfera controllata.

2.6.3 Insulating Coatings (Thermal/Electrical) Ceramic materials are excellent thermal and electrical insulators. They also possess good oxidation and wear resistance. These characteristics are quite useful on engine and turbine components as thermal barrier coatings. The thermal barrier coating lowers the skin temperature of the substrate, thereby extending the useable service life. On the other hand, efficiency is improved as a result of reduced heat loss at the same operating temperature. These coating systems consist of a bond coat, which is usually an oxidation resistant MCrAlY material (M = Fe, Ni or Co) and a ceramic top coat. An yttrium-stabilized zirconium oxide material is often used for the top coat because of its good thermal shock characteristics.

2.6.3 Rivestimenti isolanti (termici/elettrici) I materiali ceramici sono eccellenti isolanti termici ed elettrici. Possiedono anche ottima resistenza all’ossidazione e all’usura. Queste caratteristiche sono particolarmente utili come barriera termica su componenti di motori endotermici e di turbine. I riporti che agiscono da barriera termica abbassano la temperatura superficiale del substrato, aumentando quindi la vita in servizio del pezzo. Dall’altro lato, la ridotta perdita di calore alla stessa temperatura di funzionamento migliora l’efficienza. Questi sistemi di rivestimento sono costituiti da uno strato intermedio, solitamente una lega resistente all’ossidazione MCrAlY (M = Fe, Ni o Co), e uno strato ceramico superiore. L’ossido di zirconio stabilizzato con ossido di ittrio è spesso utilizzato come strato superiore, grazie alle ottime caratteristiche di resistenza allo shock termico.

2.7 Post Processing Because many sprayed coatings have an inherently rough surface finish and porosity, it is frequently necessary to post process the surface. In addition,

2.7 Post-trattamento Poiché molti rivestimenti termospruzzati hanno una finitura superficiale intrinsecamente ruvida e porosa, spesso è necessario sottoporre la superficie a post-trattamento.

© Oerlikon Metco

11

Qui, le fasi dure del carburo (WC) presentano un’eccellente resistenza contro l’usura da abrasione ed erosione e sono integrate in una matrice duttile di cobalto.

N. 17 - 2016 APRIL - ipcm® Protective Coatings


Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com

specified procedures can call for other methods, such as post-coating diffusion, nitrating, hot isostatic pressing or shot peening, as required.

© Oerlikon Metco

2.7.1 Mechanical Post Processing Thermal sprayed coatings exhibit a rough surface that is between 5 and 20 μm (see Table A2 in the Appendix). Therefore, it will often be necessary to machine the components to get the final dimension and surface finish. Depending on the coating applied, the surface can be worked by conventional machining or can be ground and lapped to the final dimension. 2.7.2 Sealing Sealing sprayed coatings serves primarily to fill the pores and microcracks in the coating, which provides additional protection against corrosive media that 12 would otherwise penetrate to the base material. When resin or wax sealants are used, those in a liquid condition penetrate into the pores and then harden (usually with heating). If the sealant is sprayed or painted on, the procedure may have to be repeated several times to insure complete coverage. Sealants can also be used to provide surfaces with non-adhesive characteristics (PTFE based sealers). 2.7.3 Post-Coating Heat Treatment With thermal post treatments, one differentiates between diffusion to increase the bond between the base material and the coating and fusing of “selffluxing” alloys. The self-fluxing alloys form a special class of spray materials in that after the spray coating is applied, the additional step of melting the coating is employed. The spray powders of these alloys are generally blends of chrome, iron and nickel that contain a substantial amount of temperature suppressants, such as boron and silicon. During the spray process there is some partial

Le procedure prescritte possono richiedere anche altri metodi quali: diffusione post-rivestimento, nitrurazione, pressatura isostatica a caldo o pallinatura, secondo le esigenze. 2.7.1 Post-trattamento meccanico I rivestimenti termospruzzati possiedono una superficie irregolare compresa tra 5 e 20 μm (vedere la tabella A2 nell’Appendice). Pertanto, sarà spesso necessario lavorare a macchina molti componenti per ottenere una dimensione e una finitura superficiale finale. In base al rivestimento applicato, la superficie può essere lavorata mediante lavorazione convenzionale a macchina oppure rettificata e lappata alle dimensioni definitive. 2.7.2 Sigillatura I sigillanti applicati a spruzzo o a pennello, servono principalmente per riempire i pori e le microfessure del rivestimento, tale da offrire ulteriore protezione dagli agenti corrosivi che altrimenti penetrerebbero nel materiale di base. Quando si utilizzano sigillanti a base di resine o cere, quelle liquide penetrano nei pori e successivamente induriscono (in genere con il riscaldamento). Se il sigillante è spruzzato o applicato a pennello, può essere necessario ripetere più volte l’operazione per garantire una copertura completa. I sigillanti possono anche essere usati per creare superfici antiaderenti (sigillanti a base di PTFE).

12

HVOF spray coating of WC-(Co,Cr)12. Rivestimento di WC-12(CoCr) mediante spruzzatura HVOF.

2.7.3 Trattamento termico post-rivestimento I trattamenti termici post-rivestimento si differenziano tra quelli in cui il riporto è diffuso nel materiale di base per aumentare l’adesione e quelli in cui si portano a fusione le leghe “con fondente” (in inglese “self-fluxing”). Le leghe con fondente (self-fluxing) formano una classe speciale di materiali per la spruzzatura. Dopo la loro applicazione a spruzzo, si esegue una fase supplementare di fusione del rivestimento. I materiali sono generalmente leghe di cromo, ferro e nichel che contengono una quantità considerevole di soppressori di temperatura, come il boro e il silicio. Durante il processo di spruzzatura si verifica una formazione parziale

ipcm® Protective Coatings - 2016 APRIL - N. 17

49


PROTECTIVE COATINGS | INNOVATIONS

13

Self-fluxing coating. Rivestimento “self-fluxing”.

50

di fasi intermetalliche. La successiva fusione del rivestimento causa una trasformazione completa dei materiali e la formazione di fasi dure di siliciuro e boruro. Si verifica anche diffusione nel substrato, migliorando l’adesione. La porosità è pressoché eliminata e senza interconnessioni tra gli eventuali pori. Questi rivestimenti presentano un’ottima resistenza alla corrosione nonché una durezza molto elevata. Il metodo manuale più comunemente utilizzato per fondere il rivestimento prevede l’uso di una torcia ossiacetilenica. È anche possibile la fusione in forno, con laser, con fascio di elettroni o con riscaldamento a induzione. La temperatura richiesta per la diffusione è compresa tra 1000 e 1200°C (1800-2200°F). Nella figura 13 è illustrato il rivestimento di una lega NiCrBSi prima e dopo la fusione. L’omogeneizzazione della struttura del rivestimento è chiaramente riconoscibile, come pure la ridotta porosità e la natura compatta del rivestimento fuso.

2.8 Coating Characterization Apart from the coating characteristics that are important with respect to the application, there are some characteristics that can be determined with relatively little effort and can be accomplished in terms of standardized quality control measurements. These are: - Visual inspection. - Coating thickness measurement. - Surface finish measurement. If necessary, test pieces sprayed at the same time and under the same conditions as the coating can be examined to determine additional characteristics about coating quality: - Cross-sectioning for the determination of precise coating thickness, porosity and structure, as well as examination of the microstructure for unmelted particles and oxide inclusion. - Microhardness measurement. - Bond strength determination, using a special adhesive and test equipment. - Bend tests.

2.8 Caratterizzazione del rivestimento Oltre alle caratteristiche del rivestimento, importanti per l’applicazione, ci sono alcune caratteristiche che possono essere determinate alquanto facilmente e possono essere ottenute come controlli di qualità standardizzati. Tali controlli sono: - ispezione visiva; - misurazione dello spessore del rivestimento; - misurazione della finitura superficiale. Se necessario, è possibile determinare ulteriori caratteristiche del rivestimento esaminando provini sottoposti a spruzzatura contemporaneamente e nelle stesse condizioni del rivestimento: - sezionamento trasversale per la precisa determinazione degli spessori del riporto, porosità, microstruttura, presenza di eventuali particelle non fuse e inclusioni di ossido; - microdurezza e/o macrodurezza; - misura della forza di ancoraggio; - prove di piegatura.

N. 17 - 2016 APRIL - ipcm® Protective Coatings

© Oerlikon Metco

formation of intermetallic phases. Fusing the coating afterward causes a complete transformation of the materials and the formation of hard silicide and boride phases. Diffusion into the substrate also occurs, improving bonding while the porosity is nearly eliminated, with no interconnecting pores. These coatings exhibit extremely good corrosion resistance as well as very high hardness. The common manual method used to melt the coating is through the use of an acetylene torch. Fusing in a furnace, with laser, electron beam or with induction heating is also possible. The temperature required to effect diffusion is in the range of 1000 to 1200 °C (1800 to 2200 °F). In Figure 13, a coating of 13 NiCrBSi alloy is shown before and after fusing. The homogenization of the coating structure is clearly recognizable, as is the reduced porosity and dense nature of the fused coating.


Oerlikon Metco Wohlen, Switzerland info.metco@oerlikon.com

The test measurements use standardized sample geometries. Exact execution and interpretation is in accordance with various standards [6]. Beyond that, there are many other possibilities. The characterization of coatings in practice is quite complex, and there are many different procedures that are not common. In addition, the various methods for element analysis can be included, as well as scratch testing, tribological investigations, stress analysis, corrosion and abrasion behavioral investigations. Since these are all destructive examinations, they are not especially suitable for production and are rarely employed on test pieces. Many end users have developed their own specifications and test methods to characterize and judge the quality of their coatings. In particular, the aerospace and space industries have very strict guidelines.

Le misurazioni di prova utilizzano geometrie campione standardizzate. L’esecuzione e l’interpretazione esatta sono conformi a varie norme [6]. Oltre a ciò esistono molte altre possibilità di verifica. La caratterizzazione dei rivestimenti nella pratica è piuttosto complessa ed esistono molte diverse procedure poco comuni. Possono essere inoltre inclusi altri test come, ad esempio: metodi vari per l’analisi elementare, prove di scalfittura, indagini tribologiche, analisi delle sollecitazioni, caratterizzazione della corrosione e indagini di comportamento all’abrasione. Poiché si tratta di esami tutti distruttivi, non sono particolarmente utilizzabili per la produzione e vengono raramente eseguiti sui provini. Molti utilizzatori hanno sviluppato proprie specifiche e propri metodi di prova per caratterizzare e valutare la qualità dei loro rivestimenti. In particolare, l’industria aerospaziale e automobilistica ha linee guida molto rigorose.

The fourth and final part of this article will be published in the next issue (ipcm®_Protective Coatings n. 18, June 2016). ‹

La quarta e ultima parte di questo articolo sarà pubblicata sul prossimo numero della rivista (ipcm®_Protective Coatings n. 18, giugno 2016). ‹

APPENDIX

APPENDICE

Table A2 - Surface finish (approximate crossreference values)

Tabella A2 - Finitura superficiale (valori di riferimento incrociati approssimativi)

Surface Finish NO N1 N2 N3 N4 N5 N6 N7 N8 N9 N10 N11 N12

Ra [μm] 0.0125 0.025 0.05 0.1 0.2 0.4 0.8 1.6 3.2 6.3 12.5 25 50

Ra [μin] 0.5 0.1 2 4 8 16 32 64 128 250 500 1000 2000

Rz [μm] --0.29 0.55 0.91 1.74 2.6 4.65 7.87 15.6 40 63 100 160

Literature references

Riferimenti bibliografici

[1] DIN EN 657; Thermal Spray – Begriffe, Einteilung; Beuth-Verlag, Berlin (1994) [2] H.D. Steffens, J. Wilden: “Moderne Beschichtungsverfahren”, DGM-Verlag, ISBN 3-88355-223-2, (1996) [3] P. Huber: “Vakuumplasmaspritzen”, Oberfläche surface, 10 (1992), 8 [4] H. Simon, M. Thoma: “Angewandte Oberflächentechnik für metallische Werkstoffe”, Hanser-Verlag, München (1985) [5] E. Lugscheider. H. Reymann: “Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiss-und Korrosionsschutz”, Schweissen und Schneiden, 50 (1998), 44 [6] DIN 50600; Metallographische Gefügebilder, Beuth-Verlag, Berlin DIN EN 582 Ermittlung der Haftzugfestigkeit, Beuth-Verlag, Berlin (1994) DIN EN 10109 Teil 1; Härteprüfung, Beuth-Verlag, Berlin (1995) DVS 2310 Teil 2; Anleitung zur Schliffherstellung, DVS, Düsseldorf, (1989)

[1] DIN EN 657; Thermal Spray – Begriffe, Einteilung; Beuth-Verlag, Berlin (1994) [2] H.D. Steffens, J. Wilden: “Moderne Beschichtungsverfahren”, DGM-Verlag, ISBN 3-88355-223-2, (1996) [3] P. Huber: “Vakuumplasmaspritzen”, Oberfläche surface, 10 (1992), 8 [4] H. Simon, M. Thoma: “Angewandte Oberflächentechnik für metallische Werkstoffe”, Hanser-Verlag, München (1985) [5] E. Lugscheider. H. Reymann: “Hochgeschwindigkeitsflammgespritzte Chromschichten zum Verschleiss-und Korrosionsschutz”, Schweissen und Schneiden, 50 (1998), 44 [6] DIN 50600; Metallographische Gefügebilder, Beuth-Verlag, Berlin DIN EN 582 Ermittlung der Haftzugfestigkeit, Beuth-Verlag, Berlin (1994) DIN EN 10109 Teil 1; Härteprüfung, Beuth-Verlag, Berlin (1995) DVS 2310 Teil 2; Anleitung zur Schliffherstellung, DVS, Düsseldorf, (1989)

ipcm® Protective Coatings - 2016 APRIL - N. 17

51


PROTECTIVE COATINGS | INNOVATIONS

BRISTLE BLASTING SURFACE PREPARATION METHOD FOR MAINTENANCE Bristle Blasting: metodo di preparazione della superficie per la manutenzione

Key concern for end users is the question of how long remedial coating systems will last in corrosive environments. The maintenance carried out in areas which are difficult to access, especially where wet and abrasive blasting with respect to SSPC’s surface condition SP 10 or SP 5 is not possible, can be up to 20 times more expensive than the maintenance carried out in the shop.1

S

intesi del paper n. 09004: questo abstract riepiloga il contenuto dell’articolo tecnico scritto da Neil Wilds - pubblicato da NACE International (2009) - che approfondisce il processo di Bristle Blasting. Sono messi a confronto tre diversi metodi di preparazione della superficie, con un focus particolare su adesione e prove cicliche di corrosione: spazzolatura meccanica elettrica convenzionale, granigliatura e Bristle Blasting. © MONTI - Werkzeuge GmbH

A

Summary of NACE Paper no. 09004: This Abstract summarizes Neil Wilds’ work published by NACE International, 2009, addressing the Bristle Blasting process in depth. With focus on adhesion and cyclic corrosion tests, three different surface preparation methods are compared, namely conventional power wire brushing, grit blasting and Bristle Blasting.

1

Gli utilizzatori finali si preoccupano principalmente per la durata dei sistemi di rivestimento di riparazione in ambienti corrosivi. Le operazioni di manutenzione eseguite in zone difficili da raggiungere, soprattutto dove non è possibile effettuare la sabbiatura a umido e abrasiva rispettando le condizioni superficiali di SSPC come SP 10 oppure SP 5, possono costare circa 20 volte di più rispetto alle operazioni di manutenzione effettuate in officina.1

Surface preparation tools like power wire Gli strumenti di prepara1 zione della superficie, cobrushes, grinders or Bristle Blaster® belt (23 mm), with bar. needle scalers are me spazzole metalliche, Supporto (23 mm) di Bristle Blaster®, con barra. capable to realize SP 11. molatrici e scrostatori However, these surface ad aghi sono in grado di conditions ultimately lead to adhesion failure of the raggiungere il livello SP 11. Tuttavia, questi trattamenti sucoating system by generating poor anchor profiles. perficiali conducono a difettosità nell’adesione dei sistemi In contrast, the Bristle Blasting process (Fig. 1) di rivestimento a causa della creazione di profili superficiaremoves coatings and affords an anchor pattern li insufficienti per un buon aggrappaggio del rivestimento stesso. Al contrario, il processo Bristle Blasting (fig. 1) rigiving surface profiles approaching that of grit blasting. The main difference to traditional wire muove le vernici e offre un ottimo profilo di ancoraggio, 1 Wilds, N. “Bristle Blasting Surface Preparation Method for Maintenance”. In NACE Corrosion Conference 2009, Atlanta, p. 1

52

N. 17 - 2016 APRIL - ipcm® Protective Coatings


Lukas Janotta MONTI - Werkzeuge GmbH, Hennef, Germany info@monti.de

Performance tests comparing the chosen surface preparation methods were carried out on carbon steel with rust grades A and D, respectively, and starting with roughness parameters. In both rust grade cases, Rz values are much higher for Bristle Blasting than for standard power tooling techniques. Moreover, the 2 recorded values are similar to those of grit blasting.3 Cyclic corrosion tests according to ISO 20340 were made under laboratory conditions after applying different coating systems on test specimens simulating Korean shipyard conditions. Pull-off tests show an improved corrosion resistance for Bristle Blasting due to higher adhesion of coating systems to substrates. Substrates being machined by the power wire brushing method were still corroded and therefore unstable due to disbondment. That is, Bristle Blasting clearly outperforms conventional power tool techniques, is at least equivalent to and even can exceed the cleaning that is achieved by white metal blast cleaning SP 5 (Fig. 2).4,5 Key facts: Surface condition (cleanliness, roughness) and corrosion resistance at least equivalent to grit blasting. If you are interested in reading the full NACE Paper no. 09004, please contact MONTI – Werkzeuge GmbH. ‹ 2 3

Ibid., p. 2 Ibid., p. 3

attribuendo alle superfici proprietà molto simili a quelle che si ottengono con la granigliatura. La principale differenza rispetto alle tecniche convenzionali di spazzolatura meccanica risiede nelle risultanti condizioni della superficie, che non presenta segni o striature: questo è possibile grazie al comportamento delle punte delle setole, che si ritraggono immediatamente dopo aver colpito la superficie.2 © MONTI - Werkzeuge GmbH

brushing preparation techniques are surface conditions without any score markings and striations, because bristle tips retract immediately after impacting onto the target surface.2

Sono state effettuate delle prove prestazionali che hanno messo a confronto i metodi scelti di preparazione delle superfici su acciai al carbonio con, rispettivamente, livelli di ruggine A e D, partendo dai parametri di rugosità. In entrambi i casi, i valori Rz sono molto più elevati con il metodo Bristle Blasting rispetto alle tecniche meccaniche convenzionali. Inoltre, i valori registrati sono simili a quelli che si ottengono con la granigliatura.3

2

Average adhesion test values. Valori di adesione medi rilevati nelle prove.

Le prove cicliche di corrosione (secondo ISO 20340) sono state effettuate in condizioni di laboratorio con l’applicazione sui campioni di diversi sistemi di rivestimento, simulando le condizioni nei cantieri navali coreani. Le prove di trazione hanno dimostrato che il processo Bristle Blasting aumenta la resistenza alla corrosione grazie alla migliore adesione dei rivestimenti sui substrati. Le superfici lavorate con spazzole metalliche elettriche erano ancora corrose e, quindi, instabili a causa del distacco. Il metodo Bristle Blasting supera quindi abbondantemente le tecniche convenzionali con utensili elettrici, ed è in grado di eguagliare o superare il livello di pulizia white metal blast cleaning SP 5 (fig. 2).4,5 Elementi chiave: condizione delle superficie (pulizia, rugosità) e resistenza alla corrosione almeno equivalenti a quelle che si ottengono con la granigliatura. Chi fosse interessato a leggere la versione completa del paper n. 09004, è pregato di contattare MONTI – Werkzeuge GmbH. ‹ 4 5

Ibid., p. 7 Ibid., p. 6

ipcm® Protective Coatings - 2016 APRIL - N. 17

53


PROTECTIVE COATINGS | EXHIBITIONS CALENDAR

MAY 2016 OTC OFFSHORE TECHNOLOGY CONFERENCE Houston, USA May 02-05, 2016 2016.otcnet.org

COATINGS & CORROSION ASIA Kuala Lumpur, Malaysia May 17-19, 2016 www.coatcorrosionasia.com

SPE International Oilfield Corrosion Conference & Exhibition Aberdeen, UK May 09-10, 2016 www.spe.org/events/ofcs/2016

CORROSION PROTECTION St. Petersburg, Russia May 17-20, 2016 corrosion.expoforum.ru/en/

INLAND MARINE EXPO St. Louis, USA May 10-12, 2016 inlandmarineexpo.com

SANTOS OFFSHORE Anhembi, Brazil May 17-21, 2016 www.santosoffshore.com.br

EUROPEAN CONFERENCE ON HEAT TREATMENT Prague, Czech Republic May 11-13, 2016 www.htconference-prague2016.cz

NAVALIA Vigo, Spain May 24-26, 2016 www.navalia.es

HTCPM Les Embiez Island, France May 15-20, 2016 www.htcpm2016.com

NACE MILANO ITALIA SECTION - CONFERENCE & EXPO 2016 Protective Genoa, Italy Coatings May 29-31, 2016 media partner www.naceitalia.it/GENOA2016/

SINOCORR Beijing, China May 16-19, 2016 www.sinocorr.org

229th ESC Meeting San Diego, CA - USA May 29 - June 03, 2016 http://www.electrochem.org/meetings/biannual/229/

INTERCORR Búzios, Brazil May 16-20, 2016 www.abraco.org.br

THE CORROSION SUMMER SCHOOL Dubrovnik, Croatia May 29 - June 03, 2016 cssd.squarespace.com

®

IMPA Singapore May 17-18, 2016 impasingapore.com

JUNE 2016 UDT UNDERSEA DEFENCE TECHNOLOGY Oslo, Norway June 01-03, 2016 www.udt-global.com

OIL&GAS EAST AFRICA 2016 Nairobi, Kenya June 10-12, 2016 www.expogr.com/kenyaoil/

CASPIAN OIL&GAS Baku, Azerbaijan June 01-04, 2016 www.caspianoilgas.az

NOG - NIGERIA OIL&GAS CONFERENCE & EXHIBITION Abuja, Nigeria June 13-16, 2016 www.cwcnog.com

TUBE RUSSIA Moscow, Russia June 06-09, 2016 www.metallurgy-tube-russia.com

POWER-GEN EUROPE Milan, Italy June 21-23, 2016 www.powergeneurope.com

GLOBAL PETROLEUM SHOW Calgari, Canada June 07-09, 2016 globalpetroleumshow.com

54

N. 17 - 2016 APRIL - ipcm® Protective Coatings

Protective Coatings ®

media partner


JULY 2016 OIL&GAS EAST AFRICA 2016 Dar-es-Salaam, Tanzania July 07-09, 2016 www.expogr.com/tanzania/oilgas/ AFRICORR Midrand, South Africa July 25-29, 2016 http://www.africorr.org.za/AfriCORR-Congress/AfriCORR-16/

AUGUST 2016 ISE ANNUAL MEETING The Hague, The Netherlands August 21-26, 2016 annual67.ise-online.org ONS Stavanger, Norway August 29 - September 01, 2016 www.ons.no

SEPTEMBER 2016 SMM HAMBURG Hamburg, Germany September 06-09, 2016 www.smm-hamburg.com EUROCORR Protective Montpellier, France Coatings September 11-15, 2016 media partner www.eurocorr.org MARINTEC SOUTH AMERICA Rio de Janerio, Brazil September 19-21, 2016 marintecsa.com.br CORRUS Moscow, Russia September 19-22, 2016 www.corrus.ru CORROSION TECHNOLOGY WEEK Houston, TX, USA September 24-30, 2016 ctw.nace.org 3RD MEDITERRANEAN CONFERENCE ON HEAT TREATMENT AND SURFACE ENGINEERING Portoro転, Slovenia, September 26-28, 2016 www.ifhtse.org TANK STORAGE ASIA Singapore September 27-28, 2016 www.easyfairs.com/events_216/tank-storage-asia-2016_82861/tank-storage-asia-2016_82862/ INTERNATIONAL PIPELINE EXPOSITION Calgari, Canada September 27-29, 2016 internationalpipelineexposition.com WIND ENERGY Protective Hamburg, Germany Coatings September 27-30, 2016 media partner windenergyhamburg.com 速

速

ipcm速 Protective Coatings - 2016 APRIL - N. 17

55


PROTECTIVE COATINGS | ZOOM ON EVENTS

PIPELINE COATING 2016: A SUCCESSFUL EVENT Pipeline Coating 2016: un evento di successo

T

he eighth edition of AMI’s Pipeline Coating Conference took place at the Austria Trend Hotel Savoyen in Vienna, Austria from 16-18 February 2016 (Figg. 1 and 2). The conference began with a welcome evening drinks reception followed by a 2-day technical programme and buzzing exhibition area. The programme included end-user’s perspectives on how to maximise coating’s functionality and performance with papers from ExxonMobil Development Co. and N.V. Nederlandse Gasunie. Coaters and raw material manufacturers presented novel developments in materials, systems and quality assurance. Among the case studies analysed at the conference, Borouge Pte Ltd. presented the first Middle East carbon capture, utilisation and storage pipeline.

1

L’

ottava edizione della Pipeline Coating Conference, organizzata da AMI, si è tenuta presso l’Austria Trend Hotel Savoyen di Vienna dal 16 al 18 febbraio 2016 (figg. 1 e 2). La conferenza è iniziata con un ricevimento serale di benvenuto seguito da un programma tecnico di due giorni e da un’affollata area espositiva.

© Applied Market Information Ltd.

1

The eighth edition of AMI’s Pipeline Coating Conference took place in Vienna from 16-18 February 2016. L’ottava edizione della conferenza AMI di Pipeline Coating si è tenuta a Vienna dal 16 al 18 febbraio 2016.

The conference attracted hundreds of delegates from more than 30 different countries. Pipeline Coating 2016 provided a unique forum for the world’s leading pipeline contractors, operators, pipe mills and pipe coaters, engineers and specifiers, researchers, raw materials and machinery suppliers to debate the latest pipeline protection technology and worldwide industry trends. The 2017 edition of AMI’s Pipeline Coating conference will take place from the 14-16 February 2017 at the Austria Trend Hotel Savoyen in Vienna, Austria. For further information: www.amiplastics.com ‹ 56

2

© Applied Market Information Ltd.

2

The conference attracted hundreds of delegates from more than 30 different countries. La conferenza ha attratto centinaia di delegati da oltre 30 Paesi.

N. 17 - 2016 APRIL - ipcm® Protective Coatings

Il programma ha incluso le prospettive finali su come massimizzare funzionalità e prestazioni dei rivestimenti con i paper di ExxonMobil Development Co. e N.V. Nederlandse Gasunie. I verniciatori e i produttori di materie prime hanno presentato gli ultimi sviluppi nei materiali, nei sistemi e nel controllo qualità. Tra i casi analizzati durante la conferenza, Borouge Pte Ltd. ha presentato la prima pipeline per la cattura, l’utilizzo e lo stoccaggio del carbonio in Medio Oriente. La conferenza ha attirato centinaia di delegati da più di trenta Paesi diversi. Pipeline Coating 2016 è stata un’occasione unica per le aziende leader di livello mondiale, come appaltatori nel settore pipeline, operatori, costruttori e verniciatori di tubi, ingegneri e progettisti, ricercatori, fornitori di materie prime e macchinari, per discutere delle ultime tecnologia di protezione delle pipeline e delle tendenze mondiali dell’industria. L’edizione 2017 della conferenza Pipeline Coating, organizzata da AMI, si terrà a Vienna dal 14 al 16 febbraio 2017 presso l’Austria Trend Hotel Savoyen di Vienna. Per maggiori informazioni: www.amiplastics.com ‹


PROTECTIVE COATINGS | ZOOM ON EVENTS

STOCEXPO 2016 SHINES IN ANTWERP StocExpo 2016 splende ad Anversa

S

S

© Easyfairs

tocExpo 2016 (Fig. 1), the world’s leading international tocExpo 2016 (fig. 1), l’evento internazionale leader a livello monevent for the tank terminal industry, returned to Antwerp on diale nell’industria dei serbatoi per terminal, è ritornato ad Anversa 15-17 March 2016 after two years in Rotterdam. The event dal 15 al 17 marzo 2016 dopo due anni a Rotterdam. L’evento ha attracted record numbers for an Antwerp based show, achieving a attirato un numero record di visitatori per una fiera con sede a Anversa, 13% increase since 2013. con un aumento del 13% dal 2013. 150 exhibitors were packed into Antwerp Expo, bringing together 150 gli espositori riuniti all’interno di Antwerp Expo, i migliori e più brillanti the very best and brightest in the international bulk liquid sector, protagonisti nel settore internazionale dei liquidi alla rinfusa; tra i visitatoand welcoming visitors from major names including Shell, ri hanno presenziato delle aziende importanti, come Shell, Oiltanking, BP, Oiltanking, BP, ExxonMobil, Vopak e ExxonMobil, LBC Tank Terminals, Vopak and LBC per citarne alcune. Tank Terminals to Nick Powell, StocExpo name a few. & Tank Storage Portfolio Nick Powell, Event Manager, ha StocExpo & Tank commentato: “AncoStorage Portfolio ra una volta StocExpo Event Manager, ha superato tutte le commented: nostre aspettative. La “Once again qualità dei visitatori è StocExpo has stata eccezionale e siasurpassed all our mo fieri di annunciare expectations. che il 72% dei nostri The quality of espositori ha prenovisitors was tato nuovamente gli exceptional and stand per la prossima we are thrilled to edizione durante la announce that fiera, a prova di quan72 per cent of to sia importante l’eour exhibitors vento per i fornitori e 1 rebooked i compratori. Ringrazio 1 stands live on molto tutti coloro che the show floor, partecipato. StocExpo 2016 attracted record numbers for an Antwerp based show, achieving a 13% increase since 2013. hanno highlighting just Abbiamo anche avuStocExpo 2016 ha attirato un numero record di visitatori per una fiera con sede ad Anversa, con un aumento del 13% dal 2013. how important to un ottimo feedback the event is for dai delegati per il prosuppliers and buyers. A big thank you to all who attended. We also gramma della conferenza, in particolare per il suo mix di temi globali e lohad great delegate feedback on the conference programme and cali. È un peccato che il capitolo 2016 si sia già chiuso, ma questo significa its mix of global and local talks. It is a shame to have closed the che possiamo focalizzarci sull’edizione del prossimo anno affinché sia an2016 chapter, but it does mean we can focus on making next year’s cora meglio. Assicuratevi di segnare sul vostro calendario le date dal 28 al show even better. Make sure you mark the 28-30 March 2017 in 30 marzo 2017: sarà un evento da non perdere.” your calendar now, it is not one to miss.” Gil Anukov, General Manager di Gil Engineering e visitatore dell’esposizioGil Anukov, General Manager at Gil Engineering visiting the show, ne, ha commentato: “Questo non è il mio primo StocExpo, ma è la mia remarked: “This is not my first StocExpo, but it is my first in Antwerp. prima edizione ad Anversa. È stata un successo e probabilmente la miIt has been such a success and I would say perhaps the best yet.” gliore edizione finora”. 58

N. 17 - 2016 APRIL - ipcm® Protective Coatings


The sell-out StocExpo conference programme featured 28 speakers including experts from Vopak, the Port of Antwerp, Botlek Tank Terminal, VOTOB, Gulf Petrochem and the Port of Tarragona. The talks were in dual streams, one with a regional feel and one focusing more on international issues. This was a new initiative for 2016, ensuring delegates with both a local and a global remit were catered for. Among the speakers was Eduard J. Smits, Manufacturing IT, MES at Accenture, who discussed the convergence of IT and OT in terminal operations. Smits remarked: “As much as we might not like it, data is becoming more important to us every day. We need to adjust to today’s real-time processes, and create a culture where everyone within an organisation trusts each other, in order to move forward.” John McVay, Managing Director for Energy at IHS Consulting, who chaired the conference, commented: “I have been lucky enough to witness every presentation at this year’s show. The talks have been interesting, educational and highly-interactive, covering a broad and varied range of topics. It has addressed a wide audience, exceeding all of the delegate expectations. StocExpo 2016 has been the best yet.” In addition to the conference, StocExpo’s exhibition featured the newest technologies, with exhibitors using the show to launch new products to the market: Endegs launched its new range of Mobile Vapor Combustors; Chubb Ajax unveiled its E-FOAM systems; Implico previewed its new OpenTAS and Scully Systems displayed its new Intellitrol2 Overfill Prevention, Static Ground Proving and Vehicle Identification Control System. After a hugely successful show Alec Keeler, Managing Director at Loadtec Engineered Systems, said: “We have far exceeded our own expectations of how busy we would be, in terms of quality visitors expressing real and current demands for our products and services.” Euan Fisher, Business Development Manager at Fort Vale, agreed: “The launch of our new loading arm, Safeload, has attracted a large amount of visitors to our stand, which has resulted in some significant future enquiries. We have experienced an increase in visitor numbers this year compared to last year, so we are very pleased.” Other show floor activity included the “Best in Show” awards. Tom De Backer, Division Manager Process Automation at Agidens picked up the award for best stand, having been selected for originality and unique design. Jessica Ivarsson, Marketing Communications Specialist at Emerson Process Management collected the award for Best Entertainment, whilst Aart Kroneman, Director of International Sales at Verwater Group was selected for Best Hospitality. In addition, three exhibitors used StocExpo 2016 to mark significant milestones – Scully Systems celebrated its 80th anniversary, Kenbri its 30th year and Agidens reached its half century live on the showfloor. For further information: www.stocexpo.com ‹

Il programma della conferenza di StocExpo, con posti completamente esauriti, è stato caratterizzato da 28 relatori, tra i quali gli esperti di Vopak, Port of Antwerp, Botlek Tank Terminal, VOTOB, Gulf Petrochem e del Porto di Tarragona. Le discussioni hanno avuto una natura duplice: una parte incentrata sull’aspetto regionale, l’altra più focalizzata sulle questioni internazionali: una novità introdotta per l’edizione 2016, radunando delegati con competenze sia locali sia internazionali. Tra i relatori era presente Eduard J. Smits, Manufacturing IT, MES di Accenture, che ha discusso della convergenza di IT e OT nelle operazioni dei terminal. Smits ha commentato: “Per quanto potrebbe non piacerci, i dati stanno diventando ogni giorno sempre più importanti. Abbiamo bisogno di adeguarci ai processi di oggi in tempo reale, e di creare una cultura nella quale ognuno all’interno dell’organizzazione si fida dell’altro. Solo in questo modo è possibile progredire”. John McVay, Managing Director per il settore Energy di IHS Consulting, che ha presieduto la conferenza, ha affermato: “Sono stato abbastanza fortunato da aver assistito a tutte le presentazioni della conferenza di quest’anno. Le discussioni sono state interessanti, formative e altamente interattive, e hanno coperto una gamma di argomenti ampia e varia. Si sono rivolte a un pubblico ampio, superando tutte le aspettative dei delegati. StocExpo 2016 è stata la migliore edizione organizzata finora.” Oltre alla conferenza, l’esposizione di StocExpo 2016 è stata caratterizzata dalle tecnologie più innovative. Alcuni espositori si sono serviti della fiera per lanciare nuovi prodotti sul mercato: Endegs ha lanciato la sua nuova gamma di Mobile Vapor Combustors; Chubb Ajax ha svelato i suoi sistemi E-FOAM; Implico ha presentato in anteprima il suo nuovo sistema OpenTAS e Scully Systems ha esposto il suo nuovo sistema Intellitrol2 (sistema di prevenzione overfill, messa a terra e identificazione e controllo del veicolo). Dopo il grande successo dell’evento, Alec Keeler, Managing Director di Loadtec Engineered Systems, ha dichiarato: “Siamo stati molto occupati, al di sopra delle nostre aspettative; i visitatori ci hanno rivolto richieste puntuali e concrete sui nostri prodotti e servizi”. Euan Fisher, Business Development Manager di Fort Vale, concorda: “Il lancio del nostro nuovo braccio di caricamento, Safeload, ha attirato un grande numero di visitatori al nostro stand e abbiamo ricevuto molte richieste di informazioni. Abbiamo rilevato un aumento del numero dei visitatori rispetto all’anno scorso: per questo motivo siamo molto soddisfatti.” Un’altra iniziativa di questa edizione sono stati i premi “Best in Show”. Tom De Backer, Division Manager Process Automation di Agidens, ha ricevuto il premio per il miglior stand, scelto per il suo design originale e unico. Jessica Ivarsson, Marketing Communications Specialist di Emerson Process Management ha ritirato il premio “Best Entertainment”, mentre Aart Kroneman, Director of International Sales di Verwater Group, ha ricevuto il premio “Best Hospitality”. Inoltre, tre espositori si sono serviti di StocExpo per festeggiare i loro traguardi: Scully Systems ha celebrato il suo ottantesimo anniversario, Kenbri il trentesimo, mentre Agidens ha raggiunto il mezzo secolo durante la fiera. Per maggiori informazioni: www.stocexpo.com ‹

ipcm® Protective Coatings - 2016 APRIL - N. 17

59


PROTECTIVE COATINGS | ZOOM ON EVENTS

SEATEC AND COMPOTEC CLOSED THEIR 2016 EDITIONS WITH THE GENERAL SATISFACTION OF EXHIBITORS, VISITORS AND ORGANIZERS Chiudono i battenti il 14° Seatec e l’8° Compotec: soddisfazione generale di espositori, visitatori e organizzatori

S

S

© CarraraFiere

eatec and Compotec (Fig. 1), organised by eatec e Compotec (fig. 1), organizzati da CarraraFiere, hanno CarraraFiere, closed their 2016 editions confirming the chiuso i battenti delle edizioni 2016, rispettivamente la 14a positive optimistic mood for the renewed interest of the e l’8a, confermando un clima migliore all’insegna dell’ottimimarket for boats, concretely perceived since the beginning of smo per un rinnovato interesse del mercato per la nautica, già conthis year. cretamente percepito in questo primo trimestre 2016. They are two unique professional events, the sole in Italy Sono due eventi professionali unici in Italia e nel Sud Europa, deand Southern dicati rispetEurope to be tivamente alrespectively la tecnologia, dedicated to alla compotechnology, nentistica, al components design e alla and supplying subfornitura chain for applicate alla the boating nautica da diindustry and porto, e al setto composite tore dei matematerials and riali compositi their multiple e alle loro molapplications. teplici applicaStarting from zioni. this year Da quest’anCarraraFiere no è cambiachanged to il sistema the visitor di conteggio counting degli ingressystem, si, basato non 1 based on the più sul numenumber of ro totale di vi1 companies sitatori bensì Seatec and Compotec closed their 2016 editions confirming the positive optimistic mood for the renewed interest of attending the the market for boats. sul numero di shows that aziende che Seatec e Compotec hanno chiuso i battenti delle edizioni 2016 confermando un clima migliore all’insegna registered a hanno partedell’ottimismo per un rinnovato interesse del mercato per la nautica. total number cipato alla viof 1,800 companies visiting the two shows - with a total sita delle mostre. Le aziende accreditate sono state 1800, con un increase of visitors of 42% compared to the last edition. aumento totale dei visitatori del 42% rispetto alla scorsa edizione. The carried out work and the devoted commitment by Il lavoro svolto e l’impegno profuso hanno portato buoni frutti: tra Seatec staff produced good results: Among the registered le 1800 aziende accreditate per la visita alle manifestazioni, sono 1,800 companies there were the most important Italian stati registrati cantieri italiani primari che sono ritornati a visitare la yacht builders that came back to CarraraFiere after years of kermesse di CarraraFiere dopo anni di assenza. Ottima performanabsence. Compotec registered a 25% increase of exhibitors. ce di Compotec che ha registrato un aumento di espositori pari al Within the abundant show schedule of conferences, 25%.

60

N. 17 - 2016 APRIL - ipcm® Protective Coatings


workshops and seminars – a unique programme among the professional shows, usually concentrated only on the products – had a particular success, with standing audience, the Myda conference on the “Entry Level Boat”, the workshop organised by RINa and MSC Software on “Simulation Technologies in the boating industry”, the conference organised by Octima on “3D Printing and addictive technologies”, the workshop organised by Ascomac on “The Sustainable Supplying Chain for a Blue Economy”, the workshop organised by Seatec on “Diesel-Electric Propulsion for Yachting” and the conference organised by the MassaCarrara Architect Association in co-operation with Mapei on “Innovative Systems to Reduce Seismic Sensitivity of the Existent Buildings”. As much success collected the 4th edition of the CNA survey, compiled by Lorenzo Pollicardo, on “Dynamics and Market Perspectives of the Yachting Industry”, that confirmed the Italian leadership in the Industry, even though highlighting a high number of hulls in “hold”, waiting for finishing of for an owner, being built on specs. The consolidated long-termed co-operation with Ice/Ita, the Italian Trade Agency, to invite a delegation of foreign operators has been significantly increased to 80 delegates, fairly covering the totality of the nautical markets, who took part to over 1,500 B2B meetings in two days. The business meetings and their relevance with the interests of the exhibitors were organised using the Like Event software, an organising and managing match-making system, managed by Uplink agency and shared with Navigo, organizer of the 6th edition of Yare, the refit and after sales operations event that attracted 100 Captains of large yachts up to 100m and 120 Italian and foreign Companies, among which some North European yacht builders. On Thursday April 7th Yare managed 1,600 B2C meetings between the Captains and the Companies, doubling the total number of meetings compared with last year edition. The events held on the same time and the same place, the abundant show schedule of conferences and workshops, the co-operation with primary associations contributed all together to the success of these editions, closing with a more than positive balance. “We worked with determination and renewed optimism – states CarraraFiere President, Fabio Felici – to propose an event that could meet the expectations of the operators and that could give a contribution to relaunch the Italian boating industry. Seatec and Compotec represent the best technical offer of the two sectors and propose always new areas of interest and emerging opportunities”. For further information: www.sea-tec.it ‹

All’interno del ricco palinsesto di convegni, workshop formativi e seminari hanno avuto un successo di pubblico totale il convegno Myda sul “Natante Entry Level”, il convegno organizzato dal RINa e da MSC Software sulle “Tecnologie di simulazione in ambito nautico”, il convegno organizzato da Octima su “Stampa 3D e tecnologie additive”, il convegno organizzato da Ascomac “La filiera della nautica sostenibile per la blu economy”, il workshop organizzato da Seatec su “Propulsione diesel-elettrica applicata allo yachting” e la conferenza organizzata dall’Ordine degli Architetti di Massa-Carrara, in collaborazione con Mapei, “Sistemi innovativi per l’abbattimento della vulnerabilità sismica degli edifici esistenti”. Altrettanto successo di pubblico ha riscosso la quarta edizione dello studio promosso da CNA e realizzato da Lorenzo Pollicardo su “Dinamiche e prospettive di mercato della filiera nautica del diporto”, in cui è stata riconfermata la posizione di leadership assoluta dell’industria italiana del superyacht, seppur con l’evidenziazione di un certo numero di scafi in “hold”, ovvero in attesa di finitura o in attesa di un compratore, essendo stati costruiti in speculazione. La consolidata e pluriennale collaborazione con Ice/Ita, Italian Trade Agency per l’invito di operatori stranieri si è notevolmente espansa nelle edizioni 2016, che hanno allargato ulteriormente le occasioni di incontro diretto attraverso match-making B2B degli espositori di Seatec e Compotec. I business meeting e la loro pertinenza con gli interessi degli operatori sono stati organizzati con il software Like Event, un metodo di organizzazione, conduzione e gestione di match-making gestito dell’agenzia Uplink e condiviso con Navigo. Navigo è l’organizzatore della 6a edizione di Yare, svoltatasi contemporaneamente e contestualmente a Seatec e Compotec. Alla 6a edizione di Yare hanno partecipato 100 comandanti internazionali di grandi yacht fino a 100 metri e 120 imprese italiane ed estere, tra cui cantieri nordeuropei costruttori di gigayacht. Nella giornata di giovedì 7 aprile Yare ha gestito 1.600 incontri B2C tra i comandanti e le aziende, raddoppiando di fatto gli incontri rispetto alla scorsa edizione. La contemporaneità e la contestualità delle manifestazioni, il nutrito palinsesto di convegni e workshop, la collaborazione di enti di primissimo livello e importanza, hanno contribuito tutti insieme alla riuscita di queste edizioni, che chiudono quindi con un bilancio più che positivo. “Abbiamo lavorato con determinazione e rinnovato ottimismo dice Fabio Felici, presidente di CarraraFiere - per proporre un appuntamento in grado di rispondere alle attese degli operatori del settore e capace di contribuire, con la sua offerta, al rilancio dell’industria nautica italiana. Seatec e Compotec, oltre a rappresentare al meglio l’offerta tecnica dell’industria nautica e dell’industria dei compositi, vogliono proporre aree d’interesse sempre nuove, capaci di rappresentare proposte e opportunità emergenti”. Per maggiori informazioni: www.sea-tec.it ‹

ipcm® Protective Coatings - 2016 APRIL - N. 17

61


PROTECTIVE COATINGS | ZOOM ON EVENTS

EXPO FERROVIARIA 2016: AN INTERNATIONAL EDITION, WITH A COMMITMENT TO TECHNOLOGY EXPO Ferroviaria 2016: un’edizione internazionale all’insegna della tecnologia

T

L

he seventh edition of EXPO Ferroviaria (Fig. 1) is over. a settima edizione di EXPO Ferroviaria (fig. 1) si chiude con It welcomed 5,500 visitors (engineers, managers, directors 5.500 visitatori: ingegneri, manager, dirigenti, protagoniand railway industry players) who decided to meet up at the sti dell’industria ferroviaria si sono dati appuntamento al Lingotto for a three-day session dedicated to business, ideas and the Lingotto per una tre giorni di business, idee e prospettive sul fuprospects for the future of rail transport. The exhibition’s international turo della rotaia. Lo spirito internazionale dell’esposizione è stato spirit was reflected in the event’s extensive outreach: Many visitors confermato dal grande numero di visitatori stranieri, circa l’11% (approx. 11%) arrived from abroad, from 49 countries including del totale, provenienti da 49 Paesi, tra cui Cina, India, Russia, Japan, China, India, Russia and the United States. Giappone e USA. The seventh edition of EXPO Ferroviaria (5-7 April) welcomed 270 Alla settima edizione di EXPO Ferroviaria, dal 5 al 7 aprile, hanno exhibitors from 22 countries, 66 of these attended the event for the first partecipato 270 espositori, di cui 66 esordienti, provenienti da 22 time. Among visiting international rail operators we note ONCF and Paesi. Tra gli operatori ferroviari internazionali che hanno visitato Casa Tram from Morocco, West Japan Railway Company and Central l’esposizione, ONCF e Casa Tram dal Marocco, West Japan Railway Japan Railway Company, Company e Central and SRT State Railway Japan Railway comof Thailand. European pany, SRT State Railway visitors included of Thailand dal mondo, Deutsche Bahn AG, dall’Europa Deutsche French operators SNCF, Bahn AG, le francesi SNCF Réseau and RATP, SNCF, SNCF Réseau e Switzerland’s SBB and RATP, la Svizzera SBB, Britain’s Network Rail. dall’Inghilterra Network Lingotto also welcomed Rail. Al Lingotto anche i Italy’s major network principali operatori delplayers: Gruppo Ferrovie la rete nazionale: Grupdello Stato Italiane, po Ferrovie dello Stato with its main group Italiane, con le princicompanies, the private pali società del gruphigh-speed operator po, l’operatore privato NTV, and representatives dell’alta velocità NTV e 1 of regional and local i rappresentanti del tra© EXPO Ferroviaria transport operators sporto regionale e lo1 such as Trenord, Ferrovie cale come Trenord, FerNord, ATM Milano and rovie Nord, ATM Milano The eighth edition of EXPO Ferroviaria is planned to take place in Milan (Italy), at the Rho Fiera trade fair (3-5 October 2017). GTT Gruppo Torinese e GTT Gruppo Torinese L’ottava edizione di EXPO Ferroviaria è in programma dal 3 al 5 ottobre 2017 a Milano, Trasporti. Visitors on the Trasporti. Di rilievo per presso Rho Fiera. lookout for new products gli espositori i contatand partnerships greatly ti con i rappresentanti appreciated the opportunities provided to establish contacts with the delle industrie manifatturiere del settore, alla ricerca di nuovi prosector’s manufacturing and industry players. dotti e partnership. Exhibitors included the United States’ Wabtec Corporation, Tra gli espositori, dagli Stati Uniti, Wabtec Corporation, JR East-East Japan Railway Company, PESA, Matisa SpA, Plasser JR East- East Japan Railway Company, PESA, Matisa SpA, Plasser & & Theurer, Vossloh AG and Italy’s ECM, Poli Costruzione Materiali Theurer, Vossloh AG e le italiane ECM, Poli Costruzione Materiali Trazione, Vapor Europe and Hitachi Rail Italy. Trazione, Vapor Europe e Hitachi Rail Italy. 62

N. 17 - 2016 APRIL - ipcm® Protective Coatings


At the opening ceremony, the President of the Piedmont Region, Sergio Chiamparino, and the Mayor of Turin and president of the association of Italian municipalities, ANCI, Piero Fassino, underscored the vital role played by regional transport and the importance of the great logistics platform that is emerging in northwest Italy, generating opportunities on a par with the prospects emerging in northern Europe. The CEO of Rete Ferroviaria Italiana, Maurizio Gentile, the President of ANIE-ASSIFER, Maurizio Manfellotto, and the Director General of TELT, Mario Virano, provided updates on work in progress. They also pointed to the transformation of the railway industry since the 1980s, and the central role of rail routes, and not only as infrastructures since networks and projects proliferate around these routes, altering the characteristics of Piedmont and the neighbouring Regions. More than 250 b2b meetings were organised during the three-day event, thanks to the efforts of various partners such as Torino Piemonte Railway − a project managed by Ceipiemonte on behalf of Regione Piemonte, the local chambers of commerce, Unioncamere Piemonte and Camere di commercio di Piemonte e Valle d’Aosta, Easy Business in Oman (an organisation backing up and assisting Italian concerns interested in establishing trade partnerships with the business community of the Sultanate of Oman), Business France, the trade service of the French Embassy, and UKTI, the British government’s UK Trade & Investment agency. Conferences were organised by the railway engineers’ association, Collegio Italiano degli Ingegneri Ferroviari CIFI on Italy and the TEN-T corridors (“L’Italia e i Corridoi TEN-T”), and by the transport sector press agency, Ferpress, on the opening of the Gotthard Base Tunnel and prospects for north-south rail transport (“L’apertura del tunnel di base del Gottardo e le prospettive per il trasporto ferroviario merci nord-sud”), not to mention the seminar organised by Politecnico di Torino “Windblown Sand Modelling and Mitigation”. Technical site visits were a great success. Organised in collaboration with GTT – Gruppo Torinese Trasporti and TELT Tunnel Euralpin Lyon Turin, they included trips to the La Maddalena exploratory tunnel, the automated metro in Turin, the Porta Milano train workshop, Piedmont’s rail museum, Museo ferroviario piemontese, the Sassi station and the Sassi-Superga rack tram line. EXPO Ferroviaria has strong ties with the large urban area of Italy’s northwest. Indeed, the eighth edition is planned to take place in Milan, at the Rho Fiera trade fair (3-5 October 2017). High-speed rail has brought changes with it in terms of distance and time. The prospects for sector growth in Italy, and the Government’s investments, require interaction with an increasingly multinational marketplace. Thanks to links to Italy’s major airport hubs, Malpensa and Linate, to the MilanTurin (Mi-To) motorway, and to the new “metropolitana d’Italia” – Frecciarossa railway station (inaugurated during EXPO2015), the Rho Fiera Milano location is the ideal venue for the next edition of EXPO Ferroviaria. For further information: www.expoferroviaria.com ‹

Alla cerimonia di apertura il Presidente della Regione Piemonte Sergio Chiamparino e il Sindaco di Torino e presidente ANCI Piero Fassino hanno sottolineato la centralità del trasporto regionale e l’importanza della grande piattaforma logistica che si va delineando nel Nord-Ovest, che offre grandi opportunità pari a quelle del Nord Europa. L’AD di Rete Ferroviaria Italiana Maurizio Gentile, il Presidente di ANIE-ASSIFER Maurizio Manfellotto e il Direttore Generale di TELT Mario Virano, nell’aggiornare sull’avanzamento delle opere, hanno ribadito la trasformazione dell’industria ferroviaria a partire dagli anni ’80 e la centralità delle linee ferroviarie non solo come infrastrutture, perché intorno a esse si ampliano reti e progetti che modificano il profilo di un territorio. Più di 250 gli incontri b2b organizzati durante i tre giorni della manifestazione, grazie ai diversi partner: Torino Piemonte Railway, progetto che Ceipiemonte gestisce su incarico di Regione Piemonte, Unioncamere Piemonte, Camere di commercio di Piemonte e Valle d’Aosta, Easy Business in Oman, organizzazione che supporta e assiste le aziende italiane nella realizzazione di partnership commerciali con gli imprenditori del Sultanato dell’Oman, Business France, il servizio commerciale dell’Ambasciata di Francia e UKTI, l’Agenzia governativa britannica UK Trade & Investment. Di grande interesse le conferenze organizzate dal Collegio Italiano degli Ingegneri Ferroviari CIFI su “L’Italia e i Corridoi TEN-T”, da Ferpress su “L’apertura del tunnel di base del Gottardo e le prospettive per il trasporto ferroviario merci nord-sud” e il seminario del Politecnico di Torino “Windblown Sand Modelling and Mitigation”. Ottimo successo per le visite tecniche, organizzate in collaborazione con GTT – Gruppo Torinese Trasporti e TELT Tunnel Euralpin Lyon Turin, al Cunicolo esplorativo La Maddalena, la visita alla metropolitana automatica di Torino, all’officina treni Porta Milano e il Museo ferroviario piemontese, alla stazione di Sassi e il viaggio sulla tranvia a dentiera Sassi-Superga. EXPO Ferroviaria si muove nella grande area urbana del Nord Ovest: l’ottava edizione è in programma dal 3 al 5 ottobre 2017 a Milano, presso Rho Fiera. L’alta velocità ha cambiato lo spazio e la temporalità; le prospettive di crescita del settore in Italia e gli investimenti del Governo hanno la necessità di interagire con un mercato sempre più multinazionale. Rho Fiera Milano, grazie all’interconnessione con i maggiori hub aereoportuali italiani Malpensa e Linate, l’autostrada Mi-To, la nuova stazione ferroviaria della “metropolitana d’Italia” - Frecciarossa inaugurata in occasione di EXPO2015, è lo snodo ideale per le occasioni di business che costituiranno il futuro delle ferrovie e delle reti continentali e globali. Per maggiori informazioni: www.expoferroviaria.com ‹

ipcm® Protective Coatings - 2016 APRIL - N. 17

63


Protective Coatings ®

Eos Mktg&Communication srl www.myipcm.com info@ipcm.it

Questo periodico è associato all’Unione Stampa Periodica Italiana

TECHNICAL ADVISORY BOARD

Redazione - Sede Legale: Via Giacomo Matteotti, 16 20811 - Cesano Maderno (MB) - Italy

Antonio Amati:

Ing. Ilario Maconi:

Tank lining and special coatings

Materials Engineer, Nace inspector lev.2 quality inspections of coatings

Enzo Dell’Orto: Shot-blasting technologies

Loris Loschi: Protective coatings application

Vittorio Grassi: Heat treatment

EDITOR IN CHIEF / DIRETTORE RESPONSABILE ALESSIA VENTURI venturi@ipcm.it

ISSN 2282-1767

The new international magazine about corrosion control and prevention

Protective Coatings ®

www.myipcm.com 2016 5th Year Quarterly N°17-April

EDITORIAL DIRECTOR / DIRETTORE EDITORIALE M.d.L. PAOLO RAMI paolorami@hotmail.it

LUCA ANTOLINI antolini@ipcm.it

Oil & Gas Specialist

Edoardo Tevere:

Department of Chemistry, Material and Chemical Engineering, Politecnico of Milan – Chemical Engineering Section

Dr. Antonio Tolotto:

Ivano Pastorelli:

Ing. Luca Valentinelli:

Measurement and quality control

MONICA FUMAGALLI info@ipcm.it

NICOLE KRAUS kraus@ipcm.it

Massimo Cornago:

Department of Chemistry, Material and Chemical Engineering, Politecnico of Milan – Section of Applied Chemistry and Physics

Indipendent Nace inspector lev. 3 QC/QA

PAOLA GIRALDO giraldo@ipcm.it

FRANCESCO STUCCHI stucchi@ipcm.it

Prof. Massimiliano Bestetti:

Prof. Paolo Gronchi:

EDITORIAL OFFICE / REDAZIONE

MEDIA SALES

EDITORIAL BOARD

ipcm_PC digital on

Marine and industrial anticorrosive coating cycles

Materials Engineer, PhD, Nace inspector lev.3

Prof. Fabrizio Pirri: The new international magazine about corrosion control and prevention La nuova rivista internazionale sul controllo e la prevenzione della corrosione

Department of Material Sciences and Chemical Engineering, Politecnico of Turin, Micro and Nanosystems, Nanomaterials and Surfaces

Registrazione al Tribunale di Monza N° 4 del 26 Marzo 2012 Eos Mktg&Communication srl è iscritta nel Registro degli Operatori di Comunicazione con il numero 19244

POSTE ITALIANE SPA – SPED. IN A.P. 70% LO/MILANO SERVICE SUBSCRIPTION - SERVIZIO ABBONAMENTI: Sale only on subscription - Vendita solo su abbonamento E.mail info@ipcm.it Subscription Rates 2016 - Tariffe Abbonamento 2016: Annual subscription: EMEA 60,00 € (postage included) Rest of world 200,00 € (fast airmail shipping included) Abbonamento annuale: EMEA 60,00 € (spese postali incluse) Resto del mondo 200,00 € (spedizione via aerea inclusa) Subscription Rates 2016 digital version: 35,00 € Abbonamento 2016 versione digitale: 35,00 € + iva Single copy: 15,00 € EMEA (postage included) - Rest of world (postage excluded) Back issues: 30,00 € EMEA (postage included) - Rest of world (postage excluded) Fascicolo singolo: 15,00 € EMEA (spese postali incluse) - resto del mondo (spese postali escluse) Arretrati: 30,00 € EMEA (spese postali incluse) - resto del mondo (spese postali escluse)

LAYOUT/ IMPAGINAZIONE LASER GRAFICA DIGITAL srl www.lasergrafica.it

PRINT/ STAMPA A.G. PRINTING SRL www.agprinting.it

Subscriptions can be made by bank transfer to the following account: Eos Mktg&Communication Srl IBAN IT97F0844033270000000084801. SWIFT CODE CRCBIT22. The VAT on subscriptions and sale of single copies is over Gli abbonamenti possono essere sottoscritti versando il relativo importo a mezzo b/b IBAN IT97F0844033270000000084801 intestato a eos Mktg&Communication Srl. L’Iva sugli abbonamenti, nonchè sulla vendita di singole copie è assolta ai sensi dell’art.74 comma 1 lett. C DPR 633/72, DM 29/12/1989.

It is forbidden to reproduce articles and illustrations of “ipcm®” without authorization and without mentioning the source. The ideas expressed by the authors do not commit nor magazine nor eos Mktg&Communication S.r.l and responsibility for what is published is the authors themselves. È vietata la riproduzione di articoli e illustrazioni di “ipcm®” senza autorizzazione e senza citarne la fonte. Le idee espresse dagli autori non impegnano nè la rivista nè eos Mktg&Communication S.r.l e la responsabilità di quanto viene pubblicato rimane degli autori stessi.


www.turbotecnica.it


Turn static files into dynamic content formats.

Create a flipbook
ipcm® Protective Coatings n. 17, 2016 by ipcm® International Paint&Coating Magazine - Issuu