AIETEUR NEWSK Guyana’s largest selling daily & New York’s most popular Guyana’sweeklylargest weekly Online: www.kaieteurnews.com September21,2022-Vol.17 No.39 Online readership yesterday, 73,819 Wednesday Edition Price $100 Court case filed by 2 women to quash new Liza 1 Environmental Permit …we can never realise true potential of oil wealth if we don’t work together Opposition, Govt. must grow-up, set aside differences -GCCIPres. -JagdeoBerbicianstells Oil money each year only enough for two projects …asGovt.invitesbidsfordrainage&floodcontrolstructures More money to be spent on “modernising” CJIA -Dr.YogMahadeo Legal minds should provide guidance on inclusion of Stability Clause in new PSA Construction worker jailed, remandedanotherforstealing$400Mworthofgold - police arrest another suspect, recover cash, vehicles & gold bars - calls for full investigation of NPTAB Patterson flags suspicious tenders received for Gas-to-Energy project
The charge was laid indictable and Krishna pleadednotguiltywhile
They were identified as Bhaloonauth Seegobin called ‘Krishna’, a 49 year old contractor of Lot 13
Farm, East Bank Demerara (EBD) and his relative Satrohan Seegobin called ‘Richie’, a 24 year old constructionworkerlivingat thesame Krishnaaddress.andRichiemade their court appearance at the Cove and John Magistrate’s Court before Magistrate FabayoAzore to face a joint charge of simple larceny.
Construction worker jailed, another remanded for stealing $400M worth of gold police arrest another suspect, recover & gold bars
Kaieteur NewsPAGE 02 Wednesday September 21, 2022
-
A construction worker was onTuesday jailed while another was remanded for reportedly stealing some $400M in gold bars from a female gold dealer at Mahaica, East Coast Demerara (ECD), between the period December 2021 andJanuary2022.
The cars recovered by police
cash, vehicles
Some cash recovered by police
ByShervinBelgrave
Continuedonpage9
...wecanneverrealisetruepotentialofoil wealthifwedon’tworktogether-GCCIPres.
DrPresident,.IrfaanAli
Opposition Leader, Aubrey Norton
President of the Georgetown Chamber of Commerce and Industry (GCCI), Timothy Tucker believes it is high time that politicians within the OppositionandGovernment campsgrow-up,andsettheir differences aside for the greatergoodofthepeople.
said he would advise Guyana’s young politicians in particular, to make use of
ByKianaWilburg
Unlocking the true potentialoftheoilwealthhe posited,cannotberealisedif both sides are at proverbial loggerheads.Theshrewdbusinessman and leader for one of the largest business advocacy groupsinGuyanaofferedthe foregoing advice during a recent appearance on K a i e t e u r R a d i o ’s Programme, Guyana’s Oil andYou.Bluntly speaking on the needforbothsidestoworkin harmony,Tuckerwaskeento remind that every policy leader has a role to play in setting the stage for the future generation to live comfortably He said the current population size which totals approximately 700,000 persons is akin to a familyof10personswhoare in charge of managing massive amounts of wealth. His belief is that this household can no longer continue to be divided or p e r s o n s w i l l b e isPresidentoriginalpanotherthenbuildingswwe’reyounationalcomeeaputbedon’potentialcoulddivideddisenfranchised.“Weseepoliticiansforsolongbutweneverrealiseourtrueasacountryifwetworktogether;ithastotogetherandyou’vegottoyourpettydifferencessideforthegoodofveryone.You’vegottotogetherandcreateaplan.It’snotwhencomeintopower‘ohgonnachangethis;e’regonnapainttheinthiscolour’andwhenyoucomeout,partyisgoingtobeaintingitbacktothecolour,”theGCCIexpressed.Furthertothis,hesaiditimportantthatthereisa
defendits Givenpeople.themagnitude of Guyana’soilresources,Paul
It is on the foregoing premise he contended that a government and opposition working arm in arm, paves the way for every citizen to feel the benefits of the boomingoilindustry
Earlier this month, Trinidadian Energy StrategistandLocalContent Expert, Anthony Paul offered similar advice as he stated that the government and the political opposition mustaspiretoputasidetheir differences and work togetherasmuchaspossible. He too agreed that this level ofcollaborationisnecessary if Guyana is to truly maximise value from the oil and gas sector while ensuringproperoversight.
parliamentary oversight committees as much as possible to demand more information from ministers about their policies and measures of accountability thatwouldbeinplaceforthe spendingoftheoilrevenues.
Kaieteur News PAGE 03Wednesday September 21, 2022
Opposition, Govt. must grow-up, set aside differences
unified front on the fundamental issues that hinder the improvement of the nation’s standard of living He said power generationisamatteralland sundry have agreed must be fixed if the country is to transform for the better Tucker said there is also an agreement that the country needs good medical care, and a proper mass transit system.“These are matters we have to be able to find a common ground on and ensure that we keep each other in check,” the GCCI Presidentsaid.
He had said too that in manyofthecountries,which he has worked in, there are cases where politicians workingoneithersideofthe divide were able to join forces and protect the interestsoftheircountryand save millions of dollars in theprocesstoo.
In the case of Ghana, Paul said it was the robust oversight of the government
Paul said oil companies love nothing more than to see politicians more concerned with fighting amongst themselves as opposedtoworkingasoneto
GCCI President, Timothy Tucker
aswellastheoppositionthat prevented the country from being saddled with an overdesigned and inflated field development plan. The costsavingfromthislevelof oversight, he said, saved the country almost US$1B in costs.Takingtheselessonsinto consideration, Paul said his advice therefore, to Guyanese politicians would be this: “Yes, you have your party loyalty but there’s one Guyana; think about where youagreeandworkforthat. There’s nothing foreign companies love better than to see us fight amongst ourselves…”
hehastobebare-knuckledandiron-fisted inlayingeverythingonthelineforGuyanese,andnotmake such a priority of “legitimate expectation” and “decent return” of foreigners. Guyanese have been treated in an illegitimatemannerandwiththegreatestindecency,andthis muststop. Mr Jagdeoisuptothetask,orheisnot.
Regarding royalties, Mr Jagdeo must be first and foremostaboutthebusinessofGuyana,andlessaboutwhat is right for ExxonMobil. Jagdeo must stop hedging. ExxonMobil is quite capable of looking after its own interests, which it has done so most handsomely at our expense. The ExxonMobil consortium already worked out the risks, and made decisions about Guyana’s oil, with dreamsofthehighestreturns.
EDITORIAL
Mr Jagdeo, the President, and a few Ministers enjoyed greatpoliticalmileageinlashingthe2016oilcontract. Now theymustdeliver,byshowinghowgoodtheyareandcanbe, consideringthisoilcontractthattheyalldamnedtohell. If not, Guyanese will think that their leaders have done most poorly, quite treacherously, in representing them and their interests.
This distribution of the royalty (SN Article 9-18- arebeingrobbedat7to1;the (Additionally, it was oil between Guyana and 2022)1; the cost for case will become much confirmed) that no EEPGL is a constant environmentalinsuranceand worsewhentheseothercosts renegotiationwilloccuruntil reminderoftheinequitythat oil spills; the cost related to are subtracted from the 12 2036.’(KN9-19-2022). Guyana is experiencing no ring-fencing; taxes due million barrels that we Given this non These twelve lifts at one for fake receipts; the loss of receive. interference by Guyana; and million barrels each will fishermen income due to Consequently, EEPGL in light of the fact that yield 12 million barrels for smaller landed catches; and has done an excellent job of EEPGL will be accelerating the year, with the largest the loss of the price maximizing shareholder the extraction of Guyana’s sharecollectedbyEEPGLof differential between a earnings from the 83 6 oil by introducing several 81.6 million barrels of oil; medium to light sweet oil million barrels they will new floating production and being captured at a rate called Liza and an even receive, given that we will storage and offloading ofapproximately7barrelsof lighter grade called Unity struggle to reject any (FPSO) ships, it is oil for EEPGL tonne barrel Gold (KN Article, 9, 09, expenses EEPGL submits; conceivablethatcome2036, ofoilforGuyana(Table1). 2022)2. and, therefore, Guyana’s EEPGLwillbereadytoshutThis approximate seven The total cost for these sharewillbeminiscule. shop and leave, as all the to one ratio that Guyana additional expenses that Meanwhile, it was commerciallyviableoil suffers is not the final Guyanamustpaywillreduce reported that ‘… the 2016
DEAREDITOR, Natural Resources states that the We learnt from the VP that an oil
I must have been wrong because prosperityofGuyana.’ distressingisthatthePresidentandVice his statements during the debate and Even at the personal level, President have a number of Advisors recent ones were disappointing and traditionally man and woman, swear andstaffwhooughttobedoingresearch reminded me of the ‘slippery ochro,’ before Man and God to stay together: so that our political leaders don’t not able or willing to provide Glenn ‘until death do us part,’ yet neglectsuchfauxpas.
PrintedandPublishedbyNationalMedia& PublishingCompanyLtd. 24SaffonStreet, Charlestown,Georgetown,Guyana.
It is this latter condition that is beforedeath. responsible for the vital subject of the worrisome,andIsaidtomyselfthatthe This talk about the sanctity of environment say if the present Head of Governmenthierarchyseemstobelieve contracts is unworthy of serious the EPA is better qualified than Dr that the rest of us including the PPP/C politicalleaderswhomustknowofthe Vincent Adams who until 2020 headed supportersareabunchofnincompoops abovementionedcircumstances. thisvitalagencyandiftheincumbent,as
At a forum earlier, titled ‘Men of deepermeaningofourNationalPledge becomingtoGuyana.
Kaieteur News Kaieteur NewsPAGE 04 Wednesday September 21, 2022
Lallstraight,truthfulanswers. everywhere, there are divorce cases Onthisnote,couldtheHon Minister
ExxonMobil doesn’t need Mr Jagdeo’s help in measuring its risks and calculating fabulous returns, that is their business, and they are extremely good at it. It is perplexing, therefore, that Mr Jagdeo keeps harping about “legitimate expectation” and “decent return” since ExxonMobil has already taken care of those beyond the company’s wildest imagination. Like an aggressive trade union leader, or a highly skilled divorce settlement lawyer, Bharrat Jagdeo’s business and emphasis must always be on whatisgoodforGuyana,andthepeoplewhoputhimback intoThisoffice.iswhere
Wesayitagain:theoilcompaniesmustgetafairreturn for their investment. But it is not at the levels that we live with currently, and to our detriment, with too many Guyanese severely handicapped and distressed (UN 2022 Report). The oil companies combined take (profits) from Guyana’soilmustnotbethehead,theheart,thewholenessof alltheprimeparts,whileGuyaneseareleftwiththehooves. Thatcanneverbefair,andneverbeacceptedasourdue,as thebestthatwedeserve,givenpastleadershipfailures.
Jagdeo was unable or unwilling to provide Glenn Lall straight and truthful answers
Royalties, risks, returns
First, we hear that the PPP Our Ministers swear on their Holy Ibelieveisthecase,islessqualified,why government who while in opposition Book to uphold the Constitution of was the services of Dr Adams severely criticized the arrangements Guyana, yet daily we see the unceremoniouslyterminated? with the oil giants and we all look Constitution being trampled upon. So These matters ought not to be forwardtowhentheygotintoofficein whatisthisnonsenseaboutthesanctity ignored.WhenwillourGovernmentbat 2020tobeconsistentanddealwiththis ofaContract? for us and not as it seems for the other matter swiftly seeking better All that is happening, we are being folks? conditions for the people of Guyana, madethelaughingstockoftheworld. While this question is being insteadwehearthisnonsenseaboutthe In April 2019, President David answered, I bring Dear Editor to your sanctityofcontracts. Arthur Granger and ExxonMobil attention, statements made by our VP Everywhere, and I repeat Country Head, Rod Henson signed an with regard to harassment and everywhere, in every continent, in Agreementmakingcertainadjustments mistreatment of our fishermen every situation, treaties, contracts and to bring greater benefits to this and operating in theAtlantic waters off the agreements can be re examined, succeedinggenerations. Surinamese coast. The problem, the changed and adjusted in keeping with In this regard, few of us have fishermen seem to have, revolves changing circumstances and the needs congratulated David Arthur Granger aroundtheissuesoffishinglicencesby ofeitherofthecontractingparties. forhiscourage,concernanddeepsense the Surinam authorities Since Notsohere,Guyanaisdifferent. ofpatriotismforthisnoblestep. ascensiontoofficebyPresidentAliof A release from the Minister of Ipubliclyapplaudhim.
The distribution of the oil between Guyana and EEPGLis a constant reminder of the inequity this country experiencing
(Continuedonpage5)
Editor:SHARMAINGRAINGER
energies towards the happiness and Ifmyinformationiscorrect,whatis
uyana’s Vice President, Bharrat Jagdeo is back singinghisoldtuneandseekingtogetGuyanese
DEAREDITOR,
MasterBlaster
Gtojoinhisone-manchorusaboutroyalties. This waswhathedidduringthethree-hourlongconversationwith thepublisherofthisnewspaper
Once again, Mr Jagdeo was more about what the oil companyshouldget,andalmostawhimper,onwhatGuyana mustdemandandmakeExxonMobilanditspartnersdeliver Allthispussyfootingoverroyaltiesmuststop,anditiseither ExxonMobilandpartnerswantthisoilonourterms,orthey are ready to face whatever comes from agitated citizens, as advancedbyhonestleaders.
In a SN article dated 8/15/2022 and captioned, ‘Guyana set to receive 12 lifts of profit oil for 2022 –Ministry’, it is reported ‘…that the expected total production of oil in 2022 is 93 6 million barrels of distribution of oil between Guyana’ssharesignificantly PSA, shared between oil…(fromwhich)…Guyana the two parties because from 12 8% of total EEPGLand its partners will willgetanestimated12lifts Guyana has to pay from its production; and this will remain unchanged, while of one million barrels each, 12 million barrels of oil, the further penalize Guyana. In maintaining“sanctity”ofthe according to the Ministry of cost for the following items: fact, if we, the owner of the contract until the end of the NaturalResources…’. the loss of 2 the percent resource,alreadyfeelthatwe agreement’s life cycle
He cannot operate in a vacuum of ignorance about the legitimate aspirations of Guyanese. Because our oil is of such a fine quality, and so cheap to produce, ExxonMobil couldaffordtogiveGuyanamultiplesofwhatisitscurrent royaltyshareandstillmakemorethanthe“decentreturn”of whichMr Jagdeoadvocatesforsopowerfully Hispowerful energiesshouldbedevotedtowhatisgoodforGuyana,and nottosinglingoutforvilificationthefewGuyanesewhoare patrioticenoughtosaythatmoreisbetter,andbetteriswhat mustbedepositedinthebank. Wemustagetafairshare,and thatshouldbewithoutdelay,whileExxonstillmakesmoney handover ExxonMobilfist. and Hess need Guyana’s oil more than we needthem. ThisisatrumpcardforGuyana,andusedwisely, itcouldputusinastrongerfinancialposition.Mr Jagdeois smart enough to know that when his PPP/C Government goesitalone,thenthebargainsstruckwithExxonMobilwill alwayshaveasuspicioussmellaboutthem. Partofthishas todowithtrust,andhismysteriousdancestepswhenhardoil issues are tabled. It is better to partner with the political oppositionforaunitedfront,asmuchas thatis despised,if onlytogetmoreforouroil.
(Continuedonpage5)
Ilistenedtothedebateon Kaieteur Contract signed in 2016 cannot be subsidiary Esso Exploration & News between Kaieteur Publisher, renegotiateduntilfourteenyearshence. Production Guyana Limited (EEPGL) GlennLallandGuyanaVicePresident This is confounded nonsense wasregisteredinGuyana butthatisnot and former President and General MinisterVickramBharatrecognisesthe so,itwasregisteredintheBahamas,so SecretaryofthePPPBahrratJagdeo. GoldenArrowheadandappreciatesthe taxesnowgoingtotheBahamasshould
Tel:225-8465,225-8491. Fax:225-8473,226-8210
Power’ held at the Jesus Deliverance which he must have recited at some I can only assume that the Church in Kitty, I observed that VP time which says inter alia ‘To be loyal Honourable VP was mislead by some Jagdeohadstudiedandlearntfromthe to my country and dedicate my personorpersons.
Publisher:GLENNLALL-TEL:624-6456
The attention of the himprivately,amajorsource thisdispute. explanation I received order to ensure that he that apply to all other MinistryofFinancehasbeen of his dissatisfaction is a His Excellency (including on the amount of continues to enjoy the right practising accountants drawn to a number of longstanding dispute he has forwardedthemattertome.I time that had already been to practice his profession, acrossGuyana.Iamadvised statements made by Nigel with the Institute of communicated with Hinds granted to Hinds to resolve while he has been granted that those requirements Hindsrecentlyonthesubject Chartered Accountants of andexplainedtohimthatthe the matter) and having extratimetobringhimselfin resemble those applied by ofracism.Themostrecentof Guyana(ICAG). ICAG is a regulatory body considered his request for order with the ICAG. Alas, the bodies that regulate the these are an assertion The ICAG is a body tasked with responsibility additional time, I suggested his initial satisfaction with accountingprofessionacross published online that racism established by law to and vested with authority to t o t h e I C A G t h a t thisoutcomeappearstohave the Caribbean and in many in Guyana is getting worse, regulate the practice and regulate the accounting consideration be given to morphed swiftly into partsoftheworld. and a rambling letter profession of accountancy, profession, and that there is granting Hinds an extension dissatisfaction. As I have already done published in today’s inmuchthesamemanneras no basis for Government
Foraddedemphasis,itis practice and all accountants conclusion is that his newworthwhile to repeat that in public practice have to foundpostureasachampion Hinds is currently the complywiththerulessetout of ethnic rights is firmly beneficiary of a direct and bythatbodyforthatpurpose. grounded in pure self exceptional appeal by this The fact of the matter is interestandtheadvancement People’s Progressive that Hinds wants to be (Continuedonpage6)
Lall, Christopher Ram, Anand Goolsarran
The distribution of the oil between...
Kaieteur News PAGE 05Wednesday September 21, 2022
Why should our VP be groaning and andhistory grumbling? Where are our Advisors and May I take this opportunity to particularlytheMinisterofForeignAffairsin congratulate and to thank the likes of Glenn allofthis?
Whyarewediminishingourselveswitha and others for shedding light on important neighbour to the East? While agreeing with matters. the Statements on this matter of the Regards, fishermen, unless I can be corrected, this HamiltonGreen ought to be a matter that should have been Elder
Frompage4
Frompage4 willenhanceproductionand notapoliceinthearea!… would have been extracted reduce the economic life of (E)verymaninthegang and Guyana will have the Stabroek Block hadawhite-handlerazor… nothingtoget.Wehaveseen Consequently, I would Tentooneismurder! similar behaviour in the further contend that unless So wake-up Guyana, for extraction of other non action is taken to allow a hole in the ground and renewable resources when Guyana to get an equitable crumbsinthebankrepresent the impending tax payment perpetualdamagethatfutureshare of itspatrimony,one dateisimminent. generations will forevercan only think of the I would therefore bemoan the loss of our non-Mighty Sparrow’s song in contend that adding new renewable resources andwhichIhavemodifiedafew FPSOs was probably not in inter-generationalwealth.lines for context and theoriginalcontract;anditis Sincerely,alignment: on this premise that a Dr.C.KenrickHunte‘Can you imagine how renegotiation can be Professor and Formerthey planning to dig out introduced, for more FPSOs Ambassador(we)…liver’ (and)
Whatevermaybethereasons,whatuseis should be taught to respect Guyana even as this camaraderie to our fishermen? In my the issue of the Corentyne River has time, as happened elsewhere, a single remained unsettled between Holland and telephone call from our President, Vice Great Britain since the end ofWorldWar II. President, Prime Minister or Minister of Recall,inmid1969,whenSurinamesebegan ForeignAffairstoacounterpartinSuriname settling in the New River triangle, Guyana shouldbringrelieftoourfishermenandsolve didn't grumble. We growled and grabbed. thisissue.
TherestistothegloryofourDefenseForce
oftimetoresolvethematter I certainly hold no brief privately,IwouldurgeHinds newspapers. As usual with the Medical Council of interventioninthedispute. Anextensionwasgranted,as for the ICAG, and I believe once again to engage the his missives, both are high Guyana regulates the Nevertheless, based on adirectresultofwhichHinds that body is capable of ICAG meaningfully with a on rhetoric and devoid of medicalprofession. his representation that he continues to be licensed by defending itself against the view to resolving the matter fact.Inresponse,Inowwish In relation to the dispute needed additional time to the ICAG to practice as an vulgarracistassaultlaunched betweenhimandthem. to offer the following he has with the ICAG, resolve the matter, I offered accountant.
Nigel Hinds’crusade is grounded in self-interest
Jagdeo was unable or unwilling...
DEAREDITOR, interactions I have had with Government to intervene in matter In light of the Party/Civic Government in exemptedfromrequirements
resolved at the level of the Ministry of Guyana and President Chan Santokhi of ForeignAffairs. Suriname, we have shown a perceived Ifsuchinitiativesfail,Guyanashouldnot preference for winning and dining, hugging grumble but where necessary, growl loud andbackslappingwithSurinamemorethan enough to be heard across our rivers to the our traditional English-speaking territories Surinamesecapital. suchasTrinidad,Antigua,etc.
Whichever Government is in Suriname
onitrecentlybyHinds Itismostregrettableand comments. withoutanyintentiononmy t o m a k e s u c h a I communicated this to The Government’s completely disingenuous Judging from the public parttodisclosethedetailsof representation on his behalf Hinds At the time, I position is unequivocal that Hinds would take a pronouncements Nigel the dispute, Hinds to the ICAG. I took the understood him to be Untilsuchtimethat,thelegal bilateral dispute he has with Hinds has been making approached His Excellency exceptional step of satisfied with the result frameworkforregulatingthe the ICAG as the basis on recently on the subject of the President some months contacting the ICAG myself achievedasadirectresultof accounting profession is which to weave a patently racism, as well as from ago and asked for the and enquired about the a Government appeal on his changed, the ICAG is the falseandblatantlydishonest behalf and entirely at his body authorised to license narrative about racism in request. accountants in public Guyana. The unavoidable
Frompage5 Hinds Recently, the Review). of his own narrow cause, GovernmentinvitedHindsto The posture adopted by instead of that of the masses be a member of the VAT Hinds in the latter matter whose emotions he is trying Board of Review, speaks entirely for itself. toexciteforhisownpersonal considering that this might Here again, instead of benefit. be an opportunity for him to acknowledging the diversity
Kaieteur NewsPAGE 06 Wednesday September 21, 2022
DEAREDITOR, agreement of both and you want to do the right
Regardless of what the GovernmentandOpposition say about not renegotiating the current bad contract for theStabroekBlockwith11+ billions of barrels of oil, the
NigelHinds’crusadeisgrounded...
Put differently, it is my contribute to the work of an (notonlyethnically,butalso considered opinion that important tribunal Hinds in terms of professional H i n d s i s n o w declinedtheoffer,indicating backgrounds and skills) of opportunistically using the that he is not prepared to the appointments made to bully pulpit of racism to try accept appointment to any theseimportanttaxtribunals, to intimidate the ICAG to board or entity unless he is the position adopted by extend special treatment to beingappointedtochairthat Hinds is an entirely selfhim and to enable him to board or entity It is, of servingone.Itwouldappear b y p a s s s t a n d a r d course, a matter of public that,inhismind,diversityis requirements that are record that Ronald Burch- only served when he is the applicable to all persons Smithwasappointedtochair designated appointee to practising the same the VAT Board of Review whichever post he covets or professionashedoes. (and Sharon Roopchand when he is the recipient of
governance of oil, put Guyana first. It’s “Our
The VP and de facto parties–has lost the right to thing, forgiveness is President has made it very govern the nation. A good available.However,whatthe clear that his PPP Governmentlooksoutforits PNC needs to do is to move Government will not ownpeoplefirst,notlookout one step above the renegotiate the worst oil for the rapacious oil “nibbling” at poor oil contract in the world signed imperialists.AgoodMinister governance, and come clean by the PNC. The PPP has or official should be and honest and repent of fullyendorsedthePNCdeal advocates for the nation on their great iniquity against and now thinks it’s a fair, why we should get more thepeopleofGuyana. sanctified contract that income from our “non ThePNCneedstotakea guarantees a fair reward to renewable” resource, not position that they want the oil investors, while give the answers advocating renegotiation as a platform Guyana keeps getting for the oil barons, as ourVP issue.BoththePPPandPNC screwed. habituallydoes. secretly promised Exxon
It should be added that Edwards to chair the whichever reward or theremightbeanothercause Customs Tariff Tribunal and recognitionhecraves. for the dissatisfaction Emily Dodson to chair the This again reinforces the currentlybeingdisplayedby Income Tax Board of purely opportunistic nature of his recently adopted ethnic advocacy It bears striking resemblance to the posture also adopted by a few others recently, who invoketheracismbogeyman without any basis whatsoever, for the sole purpose of political opportunism, and knowing fullwellthattheythemselves failed blatantly to serve in anymeaningfulwaythevery people whose cause they nowclaimtochampion. The MinistryofFinancetakesthe opportunitytorejectoutright the unsubstantiated and baselessracistrhetoricbeing peddled by Nigel Hinds and toreaffirmtheGovernment’s strong commitment to govern in the interest of all Guyanese, in keeping with President Ali’s One Guyana vision.
If “we will not Recently, I noticed more they will not renegotiate the renegotiate” is the final and more statements and contracts during the 2020 answer from the PPP “nibbling” coming out from elections. Government’s side, then it’s thePNCsideindicatingtheir The Opposition Leader time to use the old slogan support for renegotiation, needstoanswerthequestion that served us well against including from two whether he had met with the old PNC dictatorship - Ministers who were in the Exxonofficialsinoneofhis “People’s Power, No PNC government when the visits to the USA, and if so, Dictator ” I remember contractsweresigned. should give the nation a shouting this slogan along It may be shameless report.(See“Did Opposition with others as we marched hypocrisy when your Leader Norton meet with from the East Coast toTiger government signed a bad Exxon officials in the USA?” BayonthedayofDr Walter contract and you did not KN&SN,Jun22,2022). Rodney’sfuneralin1980. object, and now when you Any Government and are out of Government, you Opposition that refuses to say the contract was bad. renegotiate the contract – But,ifyoucommittedabad, whichcanbe“reviewedand unpardonable sin, and now renegotiated” with the you want to make amends,
Regards, Hon Dr Ashni K Singh,M.P
“One Guyana” must resist, overturn Government’s refusal to renegotiate the treasonous oil contracts
Senior Minister in the OfficeofthePresident with Responsibility for Finance
people by their public They now talk about not paying enough attention actions must convince the “sanctity of contract” with to what’s going on We PPP/PNC that their position Exxon How about the shouldn’t be punishing so is simply unacceptable and “sanctity of contract” with much every day, when our untenable The Oil the Guyanese people when country is so rich but our Renegotiation Movement you told them during the politicians on both sides are will not relent, will not give election campaign you sellingusout. in. We cannot roll over and would “review and This is not a PPP issue play dead, because there is renegotiate?” Exxon don’t norPNCissue;it’sanational toomuchmoneyatstake,too vote, the Guyanese people issue. All are involved; all much to lose, while our do! The Government talks areconsumed.So,Iaskyou, people are living hand to about“investorconfidence,” let’sspeakwithonevoiceas mouth.It’sthePPP/PNCthat when it should be worrying “OneGuyana”unitedtotake mustchangetheirpostureor about our vote of “no backourcountryfromthose face the angry voters in confidence” in their that have sold us out. Let’s 2025.
The PPP lied to the t r a n s p a r e n c y a n d Wealth, Our Country,” and nation during the election accountability Nation, if we must care Wake up campaign on the most you are not outraged by the Guyana! important item in their ongoing giveaway of the Sincerely, manifesto. nation’s oil wealth, you are Dr.JerryJailall
Kaieteur News PAGE 07Wednesday September 21, 2022
ormerMinisterofPublic Infrastructure, David Patterson is requesting a full investigation into the operations of the National Procurement and Tender Administration Board (NPTAB) over a series of questionable contractPattersonawards.during an Alliance
Former Minister of Public Infrastructure, David Patterson
For Change (AFC) press conferencesaid that most recently, thepublicsawbidsbeingaccepted for the Gas to Energy (GTE) project from contractors who were notlistedasprequalifiedearlierthis yearHe explained, “In January 2022, NPTAB received 12 prequalification bids for the Gas to Energy project, at [the] tender opening, companies that did not participateintheJanuary2022prequalificationprocesshassubmitted bids–itwouldbeofinteresttosee thefinalaward.”
Power, CH4 Guyana Incorporated and Lyndsayca Incorporated, China Energy International Guyana Company Limited, Apan Energy, Wison Offshore and
It was later revealed by Vice President Bharrat Jagdeo that nine of these firms had prequalified for thelocalgasproject.Afewmonths after receiving the initial bids, the VP held a press conference where heexplained:“Youknowthatnine companies were prequalified. I think the list was in the public domain.Thisisafteralongprocess. Andtherequestsforproposalswill now go out, at the end of two weeks, to these nine companies to make the bids now for the power plantandtheNGLfacility.”
Diagram depicting the layout for the Government’s planned GTE project
It was only on September 15 that bids were opened for the construction of the Natural Gas FiredPowerPlant.Fivecompanies submittedfinancialproposalsfor
F
Patterson flags suspicious tenders received for Gas-to-Energy project investigation-callsforfullofNPTAB
Marine Limitedl, Constutora Queiroz Galvao, Tecnicas Reunidas, Power China InternationalGroupLimited.
In January this year, the Department of Public Information (DPI) reported that NPTAB received 12 prequalification bids fortheproject.Thecompanieswho
were listed include Amerapex Cooperation (USA), NGC Group (Trinidad and Tobago), China Machinery Engineering Cooperation, CEPCOII Electric
Kaieteur NewsPAGE 08 Wednesday September 21, 2022
Continued on page 24
TheformerMinisterwentonto note,“TheAFChasbeencompiling a list of all these questionable contracts awards and will be formally submitting a request for the (Public Procurement Commission) PPC to conduct further investigations into these awards.”
De fuss man reply forcibly, “Ah telling andfinish.” yuh,deAmazonWarriorswin…”
Guyanese love cricket. Da is why de He turn to de fuss man and shout back, “I govament trying fuh mek Guyana de telling yuh dat yuh lie. And Teacher Percy headquartersofT20cricketindeCaribbean. sayifyuhtellalie,yuhgoingtohellassoon
Desecondmanseh,“Ahtellingyuh,you lying!” lie!DeAmazonWarriorslose!Butgoahead
1, 2022 while Richie was As police continue their
However, given theimportance in life, they thumbs at their desks. And for the rest of their living system of salary bands has offered early retirement increase in salaries sincenever have to sit and wait when they notice that you days. become outmoded and why without loss of benefits to then and the concomitantwhile their transactions are areobservingthem,theytry Andsoeachdaytheygo many people opt for non- moveon. increase in the benefits, thebeing handled. They have to engage in some make- to work and whittle the day tenured employment within The government should pay-off package may nowothers to do the running believe work, pretending away watching the new, thepublicservice. seriously consider doing inducemanytooptforearlyaroundforthemandsothey that they are doing more educated and more
Defussmanexplain,“Allahwastelling
Dem boys seh...
Before de fuss man could finish, de yuhisdatdeAmazonWarriorswindetoss.” secondmanstartfuhgethotunderdecollar Talkhalf,leffhalf.
Kaieteur News PAGE 09Wednesday September 21, 2022
Invariably when you requiring more knowledge the motions, and enduring
CRICKET DOES CAUSE ARGUMENT AND FIGHT!
Frompage2 Investigators were able received from the sale of Richieadmittedtothecrime. to track them down because some of the gold bars – and Krishna was remanded they had reportedly gone on two cars believed to have to prison and is expected to a spending spree after the beenpurchasedwiththesaid returntocourtonNovember theft. cash.
certificates.Thereareothers waiting for the day when visit a government office, andspecialisedskills. the humiliation of the work h they are relieved of the you have to wait The These employees often day just in order that they specialised skills, and still responsibility of going to waiting is not all that bad if are only a few years away can serve their time and others who have to be paid work. you look around and from the age of retirement qualifyfortheirpensionand market rates because of the These workers want to observe what is taking but have outlived their the big pay-off that comes needfortheirskills. beretired.Theyarewaiting place. usefulness to the system. withit. For example, a normal to be retired and the thepublicservice.
who come in wit
The government in theobservations that can be efficiently at the level at theymaybeabletobuyacar be paid the same as a thembyofferingavoluntary early 1990s had once toyedmade while waiting in a which they are, and given and place it in hire, open a hydrologicalengineer Even retirement package as has with the idea of offering agovernment office. Often their age and present skills, shop, pay off their though they are both been done with great voluntary retirementtheseinsightsarelostonour itmakesnosensetore-train mortgage, or do something engineers,theskillofoneis successinothercountries. package, but backed out ofpolicymakers and them for a modern public elseusefulwithittobringin inmoredemandingthanthe There are many within the idea. At the time, it didpoliticians,andforthemain service. an income, which when other and therefore will thepublicservicewhohave not seem as if there wouldreason that is because of These employees can added to their monthly attract a higher pay This is afewmoreyearsonthejob bemanytakers.their positions and oftenbeseentwiddlingtheir pension, will tie them over why the old public service andwhowouldbewillingif
But before he could finish again, de argument.Anditwasaboutcricket,degame secondmanwasinhefacescreaming,“And dat people does claim does unite de whole Itellingyuhhay,yuhisablastedliar!” country De fuss man tell de second man, Defussmanseh,“Yuhganallowmefuh “DeAmazonWarriorswin…” finish or wat? Yuh nah allowing me to
Construction worker jailed...
There are a great many this.Itwillreducethesizeof retirement.miss out on valuable something, when in fact, talentedentrantsdomostof educated and highly t h e g o v e r n m e n t
Last weekend, two men get into wan
Waiting for the day of retirement
Within most public requiredtosign-offonsome totheonethatnowexists. outlived their usefulness peoplewhowillbringmore o p i n i o n s o f t h i sservices, you are bound to documents, they will Thepublicserviceisnot and who are simply e n e r g y a n d m o r e newspaper.)findanemployeethatstands examine it like a doctor what it used to be. Entry occupying space and enthusiasm to the work of outfornootherreasonthan examiningapatient.Butitis levelpositionsarenolonger the fact that they do not fit clear even to the casual filled by persons who may in. onlooker that they are have simply completed
But Guyanese also love to argue about asyuhdie.” cricket.And dem argument does get heated Defussmanprotest,“Ahtryingfuhtell likedeonelastweekend. yuhdatdeAmazonWarriorswin…”
Most often, this merely going through the secondary education.These employee would have ritualofpretendingthatthey positions are now being belonged to the old public arere-checkingit. filled by young, highly service and would have For most of them, they educated kids with seven found that over time, he or are simply waiting for the and eight subjects, others she had become redundant daytheywillretire.Theyare withmultipledegreesanda because of the work hanging on, going through long line of computer
(The views expressed ininsights into the workings theyhavenothingtodo. the work, just like they did talented individuals in our bureaucracy and create this article are those of thewithin government Ifbychancetheyhavea when they were young and publicservice.Butthereare some openings for some author and do notdepartments. supervisorypositionandare in a different public service also many others who have sharp, qualified young necessarily reflect the
Accordingtoreports,the detectives believe that more thestolengoldbars,acanter two construction workers individualsareinvolved. truck and another car were hired to do some Another suspect was According to reports, two repairs on the female gold arrested on Tuesday and cops were also in custody dealer’s house when they police were able to recover before the construction found the gold bars and some $6 million in cash – workers were arrested and decidedtostealthem. cash suspected to have been charged.
During the initial stages sentenced to four years investigation into the multi- of the investigation, police behindbars. million-dollar gold robbery, had also recovered some of
There are many useful Theycannolongerfunction With this big pay-off, electrical engineer cannot government should help
But before he could finish de second finish!” man, who was in a bad mood, seh, “Stop
FrederickKissoon
Guyana has left that era a long time ago. Why do Guyanese have to go to Trinidad? WhyTrinidad?IlikeBurtBacharach.Ilove his composition; “That’s what friends are for.” Listen to it and then apply for a CanadianorUKvisa.
As I wrote yesterday, the Chinese Embassy gives you the visa right here. Fifteenyearsago,GlennLall,RaviDevandI haddinnerwiththeChineseAmbassador We
WhenyouapplyforaCanadianvisa,your passportisforwardedtoTrinidad.Hereinlies the danger As I stated in my column yesterday,apassportisanextremelyprecious thing. An embassy in Guyana should never sendthatdocumentoutside.
were introduced to the consular officers. Theyallseemtobemodestpeople. Youdo not have to go by Bourda Market at VFS Globalofficetogetyourpassportbackwhen youapplyforaChinesevisa.Iamsayingwith unashamed boldness that VFS office is situated at a place where you can easily get robbed.ItisabadareawhereasIstatedinmy column yesterday, a Venezuelan youth got muggedandknifedtodeathrightneartoVFS GlobalTheoffice.CanadianHighCommissionstopped issuingvisatoGuyanesein1980becausethe mission was overwhelmed with Guyanese fleeing the insane hegemony of President Burnham.Thatwasfortyyearsago.
PresidentAli on more than one occasion expressed severe disappointment on the reality of not having access to the EU visa (known as Schengen visa). He raised it with therecentoutgoingEUambassador
TheSchengenvisacannotbeobtainedin Guyana because it has to be issued by the embassyofacountrythatbelongstotheEU. Thereisn’tanEUcountrywithadiplomatic missioninGuyana.
Ifitislost,thereisanensuingnightmare. SupposeyouapplyforaUKvisaorCanadian visaandinsideyourpassportareanAmerican andSchengenstamps.Ifyourpassportislost atanotherairportwhenitissentabroad,then youwillfaceanightmare.
shouldbeinpower
I would say things that are on my mind thatmayembarrassmygovernment.IfIwere aparliamentarianfortherulingparty,Iwould tell the British High Commission that the requirementofaTBtestforastudentvisais nonsense and the imposition of only four doctors in the entire country to do the test is nonsense.Iwouldusethatveryword.
I walked into the Bank of Guyana Building in 1978 and went straight into the Canadian High Commission housed in that complex to get my student visa. I wore a soiledpairofjeans,anoldarmyjacket,apair of rubber slippers, and a basket hat on my head.Ipresented my MacMaster University scholarship offer No one asked me any question. My passport was stamped and I neverlookedback,philosophicallyspeaking. Those days are gone. Unfortunately, the world has become a far more difficult place forThirdWorld(TW)peopletolivein.
I can imagine the millions ofTWpeople whoareturneddownforaWesternvisaeach day around the world but those very TW countriesarewarnedandadvisedeachdayto have nothing to do with the countries of China,Russia,Iran,Venezuela,etc.
Ittakesayeartogetavisaappointmentat the US Embassy You have to leave Guyana to have your Schengen stamp replaced. The question that the Guyana government must askitselfiswhyvisaservicesarenotoffered at the diplomatic missions of the UK and CanadarighthereinGeorgetown?Whytake the risk in sending applicants’ passport abroad?The answer from the UK and Canada shouldbefascinatingbecausebothcountries offer consular services in other countries where they have embassies.Why is Guyana an exception? Why do you have to go to a privatecompanynamedVFSGlobaltogeta UKWhyvisa?GuyanesehavetogotoTrinidadto getaCanadianvisa?Itookthedecisionsince Iwas18yearsoldnottogetinvolvedinparty politics because I would not be a good representativeofthepartyIbelongedtoifit
(The views expressed in this article are those of the author and do not necessarily reflecttheopinionsofthisnewspaper.)
What the President may not have known atthetimethatrighthereinGuyana,thereisa Canadianembassy(officiallyknownasHigh Commission) that does not offer visa services.TheCanadianscenarioismoreconfusing thantheSchengenvisathingbecauseCanada has an embassy here. It is a sprawling complex on Young Street in Kingston. It stopped offering consular services in 1980 whenitwithdrewvisaservices.
Kaieteur NewsPAGE 10 Wednesday September 21, 2022 THEFREDDIEKISSOONCOLUMN
The President needs to know about the Canadian visa
Wednesday September 21, 2022 Kaieteur News PAGE 11
Whilehisofficehascompleted its examination of the 2021 financial statements of the Natural Resource Fund (NRF), Auditor General Deodat Sharma has said that the audit office is still not equippedtolookintomattersofthe OilandGas SpeakingSectortomembers of the media on the sidelines of the handingoverceremonyofthe2021 audit report held at Parliament Building on Monday, Sharma noted that audit office is working currently to build capacity with regardtomattersoftheoilsector
NRF financials, Auditor General says office still not equipped to audit oil sector
On Sunday, this publication carried a report in which civil society group, Article 13, expressedgraveconcernaboutthe Continued on page 22
Despite completing examination of 2021
Accountability Foundation (CAAF).“The Audit Office has been planningforourroleintheOiland Gas Sector Apart from staff being previouslytrainedintheextractive industries, training is ongoing to build capacity in this sector
inthe“WNRFelook strictly at the part where the money went into the lift but the part where you have the money,howmuchwe’resupposed to get out there and if we are to determine are we getting the right [sum],thatpart,itwouldmeanthat I would have to employ a lot of engineers, consultants to do that aspectofit.Inmy2023budget,we are going to work towards strengthening the work to go that way…Soyes,itisanewarea;itisa newRchallenge.”esponding further, Sharma noted that while his office is responsible for audits, it is the mandate of the Guyana Revenue Authority (GRA) to indicate
Auditor General, Deodat Sharma
He said as part of efforts to build capacity, the audit office is seeking the expertise of the Canadian Auditing and
Kaieteur NewsPAGE 12 Wednesday September 21, 2022
Further members of the
Atpresent,theAuditorGeneral said that his office does not have specialists on the ground to determine issues like whether the oil is mixed with water or whether Guyana is getting the correct amount of oil per lift and at the correctprice.
“IntermsoftheGRA,thereare several people doing several different things, and if you check Newfoundland and how the auditors do the audit, they look at the entity So, they let the entity, like the Ministry of Natural Resources,thatisincharge,theydo all the checking and balancing, Guyana RevenueAuthority, GEA, etc.,andweauditthatprocess,”the AuditorGeneralsaid.
whetherthetaxesarepaidinfull.
In responding to criticisms from a civil society group over his examination of the 2021 audit of the NRF financial statements, he said the audit was merely to examinethemoneythatwasplaced
He went on to say, “I can audit that because I have engineers working with me and I can strengthen the section by getting more engineers, which I discussed with the Public Accounts Commitment.”
Performance Audit Section, with help from CAAF, are also being trained on how to conduct performance audits in the oil and gassector,”Sharmarevealed.
PresidentBharratJagdeohas argued in the past that Guyana’s profits remain larger than the oil companies’ share, he recently admitted that the money Guyana receives for its petroleum resource is in factnot“awholelot.”
bestcarethatyoucangetlike any part of the world that’s about US$170 million. That alone is one year of the oil money.”Hewent on to note that these two infrastructural projects alone could use up the funds gathered, without even considering the highways to be built on the East Bank of Demerara and other road works scheduled fortheirRegion.
While addressing an audienceinBerbicethispast weekend, he told citizens therethatthefundscollected annually are barely enough
Even though Vice
Oilmoneyeachyearonlyenoughfortwoprojects
Manifesto, we said the first prioritiesareoneworldclass health care and now you are seeing us, we have just awarded seven new hospitalsforthecountrythat will cost nearly US$400 million…”TheVice President was at the time explaining that theOpposition,forexample, has suggested solutions without any analysis underpinning same For instance, he detailed that some sections of society believe that the treasury is overflowing with revenue from the oil and gas sector,
inflation.”Eventhough the Vice President has accepted that Guyana is not receiving “a lotofmoney”foritsoil
Continuedonpage22
oil and gas sector would increase over the next few years.Hesaid,“Soit’snota whole lot of money Later from the oil and gas sector, once we stay the course, we are going to collect more money but the money that we are spending that we are receiving now and the moneythatwearecollecting because our economy is expandinggenerally-thatis taxes - we’ve made it clear how we want and where we willspendthemoneyandwe arenotgonnaswayeveryday like a leaf in the wind. We have laid this out in our
-JagdeotellsBerbicians
ByDavinaBagot
which means that all of the funds collected should be distributed However he noted,“Thesamepeoplesay oh the cost of living is too highandyouhaveahighrate ofinflation.Wellifyousend moremoneyintothemarket and you are not careful, you don’t have a solid fiscal and monetarypoliciestosupport thespendingthenyouwould simplybepromotinggreater
Vice President Bharrat Jagdeo addressing Berbice residents
tocompletetwoprojects. He explained, “When you hear a lot about the oil money and we’ve collected about US$350 million per year so far, the first two years, you think it’s a lot of money But the Demerara Harbour Bridge alone, the four-lane bridge, there is US$260 million and the hospital, the Children and Maternal Hospital that we are building which will be a World-class hospital for our children and women specialisedhospitalwiththe
Kaieteur News PAGE 13Wednesday September 21, 2022
The Vice President, nonetheless, assured that Guyana’s revenue from the
Continued on page 22
AbiolaAttorney-at-law,WongInniss
Ms. Radzik in her affidavit statedthatdeepwateroffshoreoil
pumping oil in December 2019 after hydrocarbons were found in commercialquantitiesin2015.
Guyana, who has previously applied for to the court to stop EEPGLfromflaring.
Attorney-at-law,MelindaJanki
Kaieteur NewsPAGE 14 Wednesday September 21, 2022
the EPA acted unlawfully by refusingtoprovideinformationon whether Esso had complied with the regulatory requirements for applyingforanewpermit.
Court case filed by 2 women to quash new Liza 1 Environmental Permit
Accordingtoastatementissued in relation to the case, the court action was filed in the name of applicants,Radzik–ahumanrights activist and a party to other legal proceedings challenging shore based activities, and Henry – a lecturer at the University of
Thefieldisbeingservicedbya Floating Production Storage and Offloading (FPSO) Vessel the Liza Destiny—with an installed capacity of producing 120,000 barrelsofoilperday
The Liza 1 oilfield in the Stabroek Block first began
Two citizens of Guyana, DanutaRadzikandSinikkaHenry, have applied to the High Court to quash the Liza 1 Permit which the Environmental Protection Agency (EPA) signed in favour of Esso Exploration and Production GuyanaLimited(EEPGL)onMay
31,2022.The court action follows monthsaftertheEPAissuedanew environmental permit for the Liza Phase 1 project which expired in MayThelast.initialpermit fortheLiza1 project officially expired at midnightonMay31,2022. Anew permitwas issuedforanotherfive yearsgivingEEPGL—asubsidiary o f E x x o n M o b i l Guyana—clearance to conduct oil exploratory activties in the StabroekBlock.
The applicants, two women who are being represented by two female attorneys-at-law, Melinda Janki and Mrs Abiola Wong Inniss, are alleging that the EPA waslegallyprohibitedfromissuing thepermitunlessanEnvironmental Impact Assessment (EIA) was conducted in accordance with the Environmental Protection Act and there was full compliance with public rights to take part in that EIA.Theyalsoclaim,interalia,that
We are excited to be part of this event again and look forward to great service quality out there at the stadium ”
He added that Digicel Business is currently in the process of rolling out Fibre t o b u s i n e s s e s i n Georgetown, providing fast, reliable,secureinternet
Continuedonpage19
Head of Digicel Business, Balaji Vinjimoor is flanked by CPL’s representatives Nafeeza Rodriguez and Chaitram Singh
During a short press
DigicelisdesignatedFibreinternetproviderforCPLmatchesinGuyana
Kaieteur News PAGE 15Wednesday September 21, 2022
briefing at the Kingston, Georgetown Pegasus Corporate Office, it was revealed that since Digicel was the official service provider of the home matches for over 10 years, this year, the company remainsthedesignatedFibre InternetproviderfortheCPL matchesinGuyana.
the entire fibre internet for the stadium We are providing at the entry points,weareprovidingfor the media broadcasting room, we are providing at the VIPbooths, in all about
eight locations where we would be providing fibre
Marking the launch of itsFibreinternetservicesin Georgetown, Head of Digicel Business, Balaji Vinjimoor said, “As usual as we support CPL, this yearalsowearegoingtodo
With the Guyana Amazon Warriors kick startingtheirfirstsetofHero Caribbean Premier League (CPL) home matches today, Digicel on Tuesday announced that it will be providingitsFibreXinternet service for the matches that willbeplayedhere.
Kaieteur NewsPAGE 16 Wednesday September 21, 2022
Kaieteur News PAGE 17Wednesday September 21, 2022
In a recent interview withthisnewspaper,hesaid, “No one person or party should argue the fairness of the stability clause - it is the judiciary that must so determine.”DrMahadeo believes that the legal minds should not be locked out by any
Transparency Advocate, Dr. Yog Mahadeo Dr.Yog Mahadeo
The activist explained, “Jagdeoisrightonthepoint thatinvestorsneedastability clausewhichisusuallythere to protect investors against political risk (among other things) but if the contract was a fair contract then we can accept such a stability clause. We cannot have a lopsided contract with such anonerousstabilityclause.It is unconscionable to even defendthecurrentcontract-
Legalmindsshouldprovideguidanceoninclusion ofStabilityClauseinnewPSA
contract He told this newspaper that a decision should be made by legal minds to this end, on invitation of the Attorney General,AnilNandlall,S.C.
Kaieteur NewsPAGE 18 Wednesday September 21, 2022
ByDavinaBagot
He however maintained thattoensureinvestmentsin Guyana,thefuturecontracts will include a Stability Clause “A Stabilisation Clause should be in a contract…once we have a highertake,wewillstabilise (or)ensurethatthecompany getswhat’sintheagreement whichwillbeasmallershare of profit but they have an expectationthattheywillget thatsharewhatevertheshare is It would be smaller becausethegovernmentwill getabiggertakebutwewill have to stabilise that,” the
which, thankfully, Jagdeo didnotdo.”
During airing of The Glenn Lall Show last week Tuesday on Kaieteur Radio (99 1, 99 5 FM), Vice President Jagdeo was asked toexplainwhatispreventing him from renegotiating the 2016dealwhenhepointedto theStabilityClause.
Vice President Bharrat Jagdeo has clearly indicated that future oil contracts will include a Stability Clause that currently exists in the 2016 Production Sharing Agreement (PSA) Guyana inked with US oil major, ExxonMobil.TheStability Clause is a binding agreement that seeks to ensure that the profits of the contractor is unaffected One specific term in that Clause outlines thatevenifGuyanachanges its laws, this will not affect the oil companies. Another section makes it clear that the Government shall not requirearenegotiationofthe agreement without the written consent of the contractorTothisend,transparency advocate, Dr Yog Mahadeo believes that such an “onerous stability” must not find its way into any new PSA, unless so determined bylegalminds.
Continuedonpage22
–
VPsaid.Inaprevious interview, Dr Mahadeoarguedthatthe Exxoncontractisamockery to the country’s constitution as it attempts to shackle the country into more unfair provisionsorbenefitsforthe petroleum companies operating in the Stabroek Block.At
The Stability Clause that is included in the 2016 PSAwith ExxonMobil
the time, he explained, “Of critical importance to me is the fact that we have not only allowed the Exxon contract toremoveourwealthbutare allowingthemtoeffectively remove our constitutional right to elect a government that can create and enact laws on our behalf, that is, the contract mocks and neuters our Parliament’s abilitytopass Accordinglaws.”tohim, the PSAattempts to shackle the Government into financial andotherlopsideddeals.
Frompage15
for having Digicel on board to provide quality internet service for the home matches.“We
Guyanaissettohosttheremaining CPL matches from today up until the finals which will be played on September30.
for businesses The fibre internet service is being offered as low as $9,000.Speaking at the press briefing too were two of CPL’s representatives, Nafeeza Rodriguez and Chaitram Singh, who expressed their gratitude
are glad to have Digicel on board with us; you know CPL is in its tenthyear Wewouldhavereachedout toDigicelastheywouldhavepartnered with us from the starting. We reached
Kaieteur News PAGE 19Wednesday September 21, 2022
out to them with this opportunity to provide the CPL in Guyana with fibre service and they’re readily taking up thattaskwithus,”Singhstated.
DigicelisdesignatedFibreinternetproviderfor...
DemandforGuyanesepassportincreaseby500%-Pres.Ali
Addressing an interfaith ceremony in NewYorkwhereheisonanofficialtripto attend the United Nations General Assembly,PresidentAlispokeofaspikein demandforGuyanesepassports.
Kaieteur NewsPAGE 20 Wednesday September 21, 2022
The President pointed out that the impact of the COVID-19 pandemic is profound, as he outlined the challenges in
the global supply chain that it has posed. This crisis, he noted, has impacted every sectorEmphasizingthatthepassportservices has not been spared, especially renewals, the President took note that the Guyanese Diaspora has been complaining bitterly aboutthedelays.
-globalsupplychaindelaysblamedforlongwaitfornewtraveldocuments
shortage For whatever reason, I don’t know why, there is a demand for Guyanesepassportsthathasincreasedby 500 percent So unfortunately, we are being hit with the perfect storm We are getting hit by a supply chain crisis and a rapid increase in demand for the passport ”
The long wait for the issuance of new passports is due to a delay in the global supplychain.AtleastthisiswhatPresident Irfaan Ali made clear during an engagementonDiasporaSunday
He said, “And whilst there is this
He noted, “Every day, the Consulate OfficeherewouldcalltheMinistryof Continued on page 21
Shalimar Ali Hack, SC; of the main objectives is to
The Home Affairs Minister during his remarks pointedoutthatsensitisation and awareness is important in Indigenous communities because of their culture. He noted that such culture differencemustbetakeninto consideration before new
Back in June, however, the Central Immigration and Passport Office in Georgetown issued a statement informing the public that its operation has beenaffectedbyadelayinthe shipmentofmaterialsusedto print
A Canadian funded project was on Tuesday launched at the Kingston, Georgetown, Umana Yana anditsmaingoalistoreduce severe violence against women and girls in Guyana, especially those living in Indigenouscommunities.
vicinity of the bus park, Rodrigues had an altercation with three men. During the confrontation, one of themenhadreportedlystabbedRodriguestohischestwitha knife. Reports indicated that the victim was waiting for a minibus when he was robbed of his iPhone before being stabbed to death. Rodrigues was rushed subsequently to the Georgetown Public Hospital Corporation where he succumbed.
The project seeks to deliver greater equality in access to justice for women who face gender- based violence.Empowering Indigenous womentobelessvulnerable to violence is also a key component. In order for this to accomplish its goals, JES will work along with the GuyanaPoliceForce(GPF), theofficeoftheDPPandthe judiciary by providing trainingandassistance.Asit relatestoremoteIndigenous communities, the project will run a pilot to build the capacity of Indigenous women and leaders, such as Toshaos, to deliver gender transformative and rights basedpubliclegaleducation.
Canada Tasked with executing the project is an international non governmental organisation, M a r k B e r m a n ; Home Affairs, Robesonthe Justice Education Commissioner of Police, Benn Speaking at theSociety (JES), and it is Clifton Hicken; Director of launch, Project Director,expected to span a four-year Public Prosecution, LisaThompsonsaidthatoneperiod.
WayneGilbertcalled‘Nervous’wasonMondayfreedofa 2017murderchargeafterthejudgeruledthattheallegedoral confessionhegavetopolicewasinadmissible.
The project titled: “Strengthening Justice for Women and Indigenous Peoples in Guyana”, will be funded by Global Affairs
Coming out of the COVID 19 pandemic lockdown, there was a surge inpersonsvisitingtheCentral Office for passport services, where about 200 persons werebeingattendedtodaily
Inpassports.fact,personswhowent to renew their passports were told to return after three months. Prior to the COVID19 pandemic, persons were told to return to uplift the travel document within a week after they applied.As a
OnMonday,JusticeKissoonruledthattheoralconfession by Gilbert was inadmissible since it was unsigned by the accusedandpolicehadnootherevidenceagainsthim.
Canadafundsprojecttoreduce violenceagainstwomen,girlsinGuyana
Gilbert was the third person charged for the murder He was charged jointly with Afibia Yankana, 27, of Hadfield Street,GeorgetownandAkeemHaymer.
Kaieteur News PAGE 21Wednesday September 21, 2022
Gilbert,30,ofWestLaPenitence,Georgetownhaddenied killing Rawl Rodrigues on January 20, 2017, at the route 32 minibus park. Rodrigues was reportedly killed during a robberyatCroalStreet,Georgetown.
Thompson related that consultations will be held firstinthesecommunitiesin order to identify solutions for violence against indigenouswomenandgirls.
Man freed of 2017 minibus park murder after judge rules oral confession inadmissible
Gracingthelaunchofthe Attorney General, Anil targetsome10,000to12,000project was Canadian High Nandlall,SCandMinisterof girls and women in GuyanaCommissioner to Guyana,
Earlier this month, a mixed 12-member jury was empanelled before Justice Sandil Kissoon at the Demerara HighCourtforthemurdertrial.RepresentingtheStateinthis matterwereprosecutorsMuntazAliandTaneishaSaygon.
Frompage20 result, many citizens are now being other immigration document services ForeignAffairsandsaypeoplecussing forced to reschedule travel plans and willcontinueandthatitisattemptingto [them]…Butthisisthereality Sincea cancel appointments overseas. The do so within the normal timeframe of year-and-a-half ago, we ordered, I delaysareprovingtobeamajorsetback fiveworkingdays think, 80,000 passports. We’ve been for persons awaiting passports so that While the wait in many cases is continuouslyordering.” they can travel overseas to conduct inevitable,theCentralImmigrationand
Last year, Yankana and Haymer were arraigned before Justice Kissoon for murder – the duo had denied the capital offence but opted to plead guilty to the lesser count of manslaughter.JusticeKissoonhadsentencedbothmentolife imprisonment with the possibility of parole after serving 15
WhileGarden.inthe
A section of the audience
years.According to information, on the day in question, three men had reportedly followed Rodrigues, 43, of Lot 64 LeopoldStreet,Werk-en-Rust,Georgetown,fromtheDemico Roof
Minister of Home Affairs, Robeson Benn
He explained that the materials to businessbeforesummerholidays. Passport Office had said it remains print the Guyanese passport booklet As the passport office awaits unwaveringinitscommitmenttowork areprovidedbyaleadinginternational supplies, the Guyana Police Force’s assiduously to ensure that things are company in Canada. But because of CentralImmigrationandPassportOffice back to normal in the shortest possible the supply chain issues, there are hasassuredthepublicthatpassportand time. tremendous shortages and delaysofthematerialsneeded toproducethesedocuments.
withspecialfocusonremote a n d I n d i g e n o u s communities.
Project Director, Lisa Thompson
Demand for Guyanese passport increase...
Freed: Wayne Gilbert called ‘Nervous’ Dead: Rawl Rodrigues
Driver, Sales man, Porters to work in warehouse. Must have experience, attractive salary offered. Call: 696-4444.
VEHICLE FOR SALE
LAND FOR SALE
PAGE 22 Kaieteur News Wednesday September 21, 2022
Cow for sale @ 34 Station Street, Kitty. Call: 677-6780/
The civil society body said “…It was inappropriate and incorrect for the Auditor General to issue a clean audit opinion on the financial statements of the Fund for either or both years (2020 and 2021).”Therefore, Article 13 on the foregoing grounds called on the Auditor General to withdraw his statements and re-issue his opinion on the financial statements for noncompliance with the law. “We understand that such a step, though unusual, was done by the Audit Office before and that, in any case, that it is a professional requirement where a previously issued report is subsequently found to have been inappropriately issued,” the group stated.
Drawing of Building plans and Estimate, K.Lakeram building contractor. Tel:2160671/692-8464 whatsapp 6220267.
Despite completing...
Large quantity CAT 215 excavator used parts, Paddy steel trailor 16ft/8ft/2ft, Road painting machine, Air compressor.Call: 275-0367/ 2683-7225.Excavator buckets, Dragline hammer - 1 & 1/2 tons. Call: 275-0367/ 683-7225.
Experienced Handyman, porter all below 40 years. Apply with written application @ Keyfood McDoom Village.
This newspaper has highlighted in the past that in the absence of the ringfencing provision, Guyana can lose out massively coupled with the country’s inability to monitor costs associated with production. Presently, Guyana does not authorise purchases made by the oil company; instead, the country conducts a yearly audit to verify the spending.
Room attendant, Receptionist and Deskstaff, 25-45 years old. Located @233 South Road Lacytown, Call:225U.S.A, Canada & UK; Graphics
Male& Female needed to work in factory. Apply to RP'S Enterprise Area K Le Ressouvenir E.C.D. Call: 2202818.
One female Assistant needed. Call: 656-7554.
Female to take care of an elderly male, age 25-40 in Trinidad. Accommodations provided. Call or WhatsApp 1-868-683-1528.
FOR SALE
CLERICAL ASSISTANTS LIVE-IN ACCOMMODATION AVAILABLE FOR OUT OF TOWN APPLICANTS COVID VACCINATED PERSONS ONLY. CALL: 223-7500
Court case filed by 2 women...
VACANCY
The EIA is the place to determine whether Esso can drill for oil and subject to what conditions.”Thecase was filed on August 8, last, and assigned to Justice Younge on August 10. It is fixed for hearing on October 10, 2022.
He then went on to explain the formula for calculating profits as outlined in the 2016 Production Sharing Agreement (PSA) for operations at the Stabroek Block.The Vice President told the media that in 2021, there were 42 oil lifts, which brought in US$3B as gross revenue.
One Prime Business property next to Mon Repos market. Call: 644-7088/ 624-7248.
She continued, “I am a mother and a Guyanese
Cooks needed to work at restaurant. Call: 697-8160.
Land for sale @ Bent Street, excellent for bond, warehouse or apartment building. Call: 661-2828.
One male Accountant needed, must have a valid driver's licence. Call: 6447088/624-7248.
From page 13 wealth, he has no plan to change the lopsided Exxon contract which several experts have advised Guyana to change.InitsMid-Year Report, the Ministry of Finance said the total balance in the Natural Resource Fund (NRF), inclusive of interest income, at the end of June was US$753.3 million, after a withdrawal of US$200 million in the month of May. By Kaieteur News’ calculations, Exxon’s subsi diary and operator of the Stabroek Block, Esso Exploration and Production Guyana Limited (EEPGL) is poised to walk away with US$3.9B while CNOOC will get US$2.2B this year. It therefore means that Exxon and partners will walk away with US$8.7B profit, tax-free, in 2022.Meanwhile, Guyana must pay the company’s share of income taxes for 2022 from its projected US$957.6 million revenue.Despite this, the former Head of State had rebutted Guyana’s earning being less than the oil companies share. Back in June during a press conference, he said, “I have seen in the newspaper a lot about how Exxon is drawing down hundreds of US billions more and we are getting a pittance. But people making such statements are mistaken.”
Design, etc.Tel:ElderlyWeddingAdvertisements,Decorations&Grooming:Hair,Nail626-7040.Specializedrepairs/servicerefrigerator,washingma-chine,pressurepump,stove,treadmill,dryer,filterationsystem,deepfryer.Call:694-9733.
Oil money each year...
According to him, “If you split that into two: cost oil which would be 75 percent is US$2.3B and profit oil is US$700M. The contractor group is supposed to get 50 percent of profit oil and we are supposed to get 50 percent as well. So that works out to US$360 each. Now the contractor has to pay royalty on this...”Heinsisted that the oil companies are left with 10.5 percent of gross revenue while Guyana gets 14.5 percent. In other words, the government received US$420M in profit for 2021 while the contractor group collected US$300M.
Vacancy for experience Lorry driver. Apply in person at Alabama Trading at 65 Robb Street, Bourda.Pure breed German Shepherd pups for sale. Call: 680-1828, 632-9022/ 639-4966.
One223-8205.male Pitbull/ Rottweiler, 8 months old. Call: 629-7426.
From page 14 drilling is an extremely dangerous exercise and that the danger to the environment and people of Guyana from the deepwater drilling has been increased as a result of the oil company using faulty equipment, flaring gas and operating above the design capacity of the Liza Phase 1 Project.
our right to elect a Government that will make the right decisions on our behalf.”Article 32, which lists conditions for ‘Stability of the Agreement’ states at 32.1 that “Except as may be expressly provided herein, the Government shall not amend, modify, rescind, terminate, declare invalid or unenforceable, require renegotiation of, compel replacement or substitution, or otherwise seek to avoid, alter, or limit this Agreement without the prior written consent of Contractor.”
Ms. Radzik said, “The resources of Guyana, including our marine resources, belong to each and every Guyanese, including the generations to come. We are the paramount owners and custodians and as such, we have the responsibility to be consulted, to be informed, to make decisions about our resources and to ensure the protection of all our resources.Themost important part of our responsibilities as custodians is to ensure we do not pollute, contaminate, harm, or destroy our precious resources through dangerous and irresponsible oil and gas/fossil fuel extraction and exploitation.”
0198.Visa Application:
One Honda CRV, fully loaded immaculate condition, low mileage 3.3M negotiable & 1 new super custom Hiace Bus 2.5M .Contact: 649-0956.
One Female able-bodied clerk. Call: 225-2313/658-8559.
From page 12 Government as well as Sharma’s non-compliance with the NRF legislation.
Receptionist needed @ Hick Ville Hotel. info@vgiworld.comEmail:Tel: gmail.comeliteprotectionservicesgy@tact:Inc.@sors,Security0673/227-7714/231-0951/4.640-Officers,Supervi-DispatchClerkneededEliteProtectionServices161LamahaStreet.Con-2234172or2238805or:
SERVICES
The group noted that these taxes which ought to be paid over were not, yet the Auditor General in his review, gave it a clean bill of health.
Two Cooks needed. Call: 6542433/ Counter623-8654.clerkneeded to work at restaurant. Call: 697-8160.
For International Visitors, long term contractual agreement: newly built house, 5 bedrooms, 3 bathrooms, 5 minutes from CJIA. Call: +1347-613-4987/ 613-0448.
The agreement goes on to say at 32.2 that “after the signing of this agreement and in conformance with Article 15, the Government shall not increase the economic burdens of contractor under this agreement by applying to this agreement or the operations conducted thereunder any increase of or any new petroleum related fiscal obligation, including but not limited to, any new taxes whatsoever, any new royalty, duties, fees, charges, value-added tax (VAT) or other imposts.”
Driver for Vegetarian Garden, license to drive lorry. Call: 640-0673/ 227-7714.
One Male able-bodied clerk. Tel: 231-2029, 616-5954.
From page 18 “It also attempts, in Article 32, to handcuff the Government away from contemplating changing any laws that can impact the agreement to the economic detriment of the contractor.Byattempting to shackle the Government, it therefore attempts to fetter the entire population from getting a Government in place that can pass laws as desired by and for the people. This unconstitutionality threatens
WANTED
Mason & Carpenters needed (preferably from E.B.D). Call: 661-5613/ 669-9091.
FOR RENT
Vacancy - Lorry Drivers & Porters Contact: 650-0979.
woman. W hich mother does not first and foremost look out for and protect and care for their children and family? The Environmental Protection Agency is mandated to enforce the Environmental Protection Act to ensure that Guyana’s resources, our air, soil, rivers, creeks and seas are protected. I call on the EPA to fulfill its mandate and to help us to protect our environment for not only this generation but all those generations to come.”Similarly, in a document to support the case, Ms. Henry stated, “Oil production results in greenhouse gas pollution that is killing the planet. We have a legal right to know about that pollution. We have a legal right to insist that the EPA protects the environment and puts our health and wellbeing above the profits of ExxonMobil.
‘Article 13’ said that it found that the Auditor General did not conduct his audit in a manner that is compliant with the requirements of the NRF law.‘Article 13’ pointed out too that Guyana agreed via the 2016 Stabroek Block Production Sharing Agreement (PSA) to pay income taxes for Exxon and its partners.Those taxes are to be paid from revenues earned for the sale of Guyana’s share of profit oil. Those deposits are made into the NRF account.
Legal minds should provide...
Welder, Fabricator three years experience & male cleaner. Call: 233-2745/ 645-8443.
Vacancy for 2 experienced nail Technician located at Grove, E.B.D. Call: 652-5800.
One Assistant Cook & one Kitchen Assistant needed. Call: 677-7011/ 602-8067.
The group explained that it carried out a review of the financial statements of the Natural Resource Fund for the year ended December 31, 2021 and comparative information for 2020.
ccelerated tutoring
Wednesday September 21, 2022
foundational skills; cultural learning resources were ensure that it benefits all Tertiary education will be response; technological provided.
Kaieteur News PAGE 23
W
While the bids submitted expansioncontract. were between $126 million
The airport expansion and $233 million, engineers contract was signed in 2011 attachedtotheMinistryhave under then President, pegged the works at Bharrat Jagdeo, and was $149,678,084. passed through the truncated
…commits to improving expenditure, enhancing inclusivity at UNGA’s Education Summit
17 new COVID-19 cases recorded
the absence of formal education in the ever narrowing access and The “rethink,” he said, schoolingdidnottranslateto changing landscape of attainment gaps by ensuring must include strategies to theendoflearning. Guyana, President IrfaanAli that every school-aged child reduce inequalities and As a result, remote has revealed that efforts are in all regions is entitled to a foster inclusion; curriculum learning was implemented already in place to not only s o u n d p r i m a r y a n d r e f o r m ; f o c u s o n
The Ministry’s latest dashboard shows that five persons areininstitutionalisolation,108areinhomeisolationandone isquarantinedinstitutionally
Todate,atotalof69,885personshaverecovered.
expansion government’s plan to administration took over in completed. project is completed at the continue “modernising”’ the 2015, it said that the very Notably, while the Cheddi Jagan International airport. It was Minister of defective plan needed contract cost with the Airport (CJIA), the Public Works, Juan Edghill, adjustments and changes Chinese contractor remains Government through the who announced that citizens were made. The decade-old at US$150 million, the Ministry of Public Works is should expect more of their project was awarded to Government is undertaking stillconductingworkswhich taxpayers’ dollars going CHEC for the sum of several multi million have been described as towards the ‘continued US$150 million: $138 upgradestotheairportwhich “modernisingworks”. modernisation’ of the millionfromtheChinaExim were separated into three
services, the creation of a gaps This includes citizensofthecountry provided free of cost by integration,thedevelopment To address the issue of learning platform to bring introducing more in-person A c c o r d i n g t o a 2025.” of a comprehensive and learning loss and others that students back to grade level, tutoring, reforming the government press release, The Head of State added integrated education surrounded the pandemic’s and an early warning system national curriculum, President Ali made this that as part of Guyana’s management information effect on the education to identify students at risk of extending the use of ICT in statement on Tuesday while efforts to strengthen the system; monitoring and s y s t e m , d i a g n o s t i c fallingbehind. education, increasing access deliveringremarksastheco- education system, his evaluationandfinancing. assessments in numeracy “Guyana remains to digital and non-digital chair of the Transforming Government plans to GUYANA’S PLAN andliteracywereconducted. committed to Sustainable educational resources, and Education Summit Leaders increase its expenditure by As happened in the rest The data, the President Development Goal number increasing distance Roundtable Discussion, 20percent.This,hesaid,was of the world, President Ali said, will now be used as a four, and inclusive and education.” which is a part of the 77th necessary due to the noted that the pandemic guideforremedialmeasures, quality education for all. President Ali also United Nations General implicationsofthepandemic disrupted the education among other procedures, to Presently,however,thereare pointed out that the A s s e m b l y ( U N G A ) , on the education system. He system for more than 20 help the learning loss educational gaps nationally, Government is supporting currently underway in New sourced aWorld Bank report months in Guyana. Despite recoveryprocess. which can frustrate the children’s school attendance York. which said that the COVID- this, initiatives were Among the measures are objective. We are adopting withthe‘BecauseWeCare’
and digital and non-digital enhance its delivery but to secondary education
The President said, which includes a “rethink of “Guyana commits to an education strategies” if the inclusive education system, Sustainable Development one that leaves no one Goal (SDG), four is to be
Guyana’s education system will ensure that “no one is left behind” - Pres. Ali
For this project, a total of sooner or later with oil and contractor and as such, they The $150 million that is 11 contractors have applied gas sector growing and had negotiated and got expected to be spent on to execute the works. The tourism growing and CHEC to do additional drainage and flood control companies are as follow: bringing in high profile worksattheairportatnocost structurewillbeclassifiedas Orin’s Supreme Enterprise, tourist, we will have to have toGuyana. additionalspending. Dundas Construction Inc., facilities for corporate jets, Theadditionalworksthat B e l o w a r e t h e Novus Construction and luxury lines people were done by the contractor companiesandtheirbids: Supplies Inc , K and S coming here with private General Contractors Inc , planes to go and do things, Mohamed’s Excavation w e h a v e t o k e e p Construction Inc., Manohar expanding…” Services, Superior General It wasn’t so long ago that Contracting, Engineer Chinese contractor, China Construction Co., M. Sukhai Harbour Engineering ContractingServices,Arjune C o m p a n y ( C H E C ) , Construction Inc., and JOP completed its part under the SPConstructionInc. US$150 million airport
More money to be spent on “modernising” CJIA
IrfaanPresidentAliPresidentIrfaanAli
Even as one patient is receiving intensive care treatment, theHealthMinistryonTuesdayrevealedthatthereare17new cases,bringingthetotalnumberofconfirmedcasesto71,280.
…as Govt. invites bids for drainage & flood control structures
During the opening of airport. The Minister had Bank and $12 million from parts. tenders on Tuesday, it was notedthatconstructionatthe the consolidated fund The additional spending revealed that the Ministry airportwillcontinuebecause taxpayers’money by the Government has will be undertaking another the Government has to keep W h e n t h e P P P increased the amount of roundofworks;thistimeitis m a k i n g m o r e administration took office in money spent on the airport theimprovementofdrainage accommodation He had August 2020, Minister which falls way below and flood control structures said, “We have to continue Edghill had stated that they e x p e c t a t i o n s a n d at different exit roads at the m a k i n g m o r e were not satisfied with the international airport airport. accommodation I think work that was done by the standards.
h i l e t h e As reported, all new presidency of Donald included a superstructure U S $ 1 5 0 worksbeingdoneattheCJIA Ramotar However,whenthe corridor and curtain wall. m i l l i o n will fall under the D a v i d G r a n g e r This was only recently
Construction of drainage improvement and flood control structures for exit roads at CJIA
He said that along with 19 pandemic was the implemented to ensure that a measures to narrow these (Continued ensuring that Guyanese greatest worldwide shock benefit from free primary that the education system and secondary education, suffered. effortsarealsobeingmadeto He said that Guyana provide free education at the intends to follow the tertiarylevel. suggested recommendation,
Given the importance of behind This entails achievedby2030.
on page 24)
Further, Patterson said another contract wasgranted,thistimetobuildafirestation,to acompanywhosemainbusinessactivityisin theminingsector
Director of Chinese logging
The AFC said that since August 2020, submitting a request for the PPC to conduct several contract awards have caught the furtherinvestigationsintotheseawards.The public’s attention. For instance, the party former Chairman of the Public Accounts reminded that a company with no track Committee (PAC) was keen to note that record in construction – that is in fact better special attention should be paid to the bid known for the promotion of sporting and evaluationandcontractawardsprocess. entertainingevents–receiveda$346million contracttoconstructaschoolinRegion10.
“Our teachers are the backbone of our educational system. Trained teachers are criticaltotheattainmentofoureducational objectives. As such, we’re investing in teachers’trainingwiththegoalofensuring that by the end of the decade, our schools arestaffedby100percenttrainedteachers. In-servicetrainingofteachersisalsobeing strengthened.”AfterthePresident’s address, several world leaders and government representatives presented national statements of commitment that outlined their vision and concrete actions for the transformation of education to drive progress toward the SDGs and to better preparelearnersforthefuture.
Digicel Health Ministry’s Special Needs Project
HighCourtthrowsoutBKTiwariecase
Logging Company, the property being placed But in his recent ruling transfer of the property to instrument of transfer Tiwarie, the former BaiShanLin for US$8 into receivership and as a on the matter, Justice Precious Metal Mines Inc. registered,” the judge owner of housing project million. result the land was sold by Franklyn Holder found that and not to set aside the outlined in his written Sunset Lakes which is Hesaidthatuponsigning the Registrar of Lands to Tiwarie had no permanent Certificate of Title issued decision. located at Plantation the agreement, Chu paid a PreciousMetalMines. rights to the lands that was must be understood in the He explained too that, Providence, EBD, was deposit of US$4 million. In In a lawsuit filed in solelyinthenameofSunset context of the peculiar facts “Thedeficiencyinthecaveat seeking damages in excess that agreement, he said too, December 2017, against the Lakes;acompanythathasits of the case. He said the resides on the very face of of $300 million for the were covenants which Registrar, Precious Metals, own legal personality from decisionmustnotbereadas the document In the alleged unlawful transfer of prohibit the land from being Sunset Lakes, Citizens itscreditorsorshareholders. the court giving its approval circumstances, I thought in the 100 acres of the said encumbered, or the shares Bank, Nigel Hinds and Assuch,thejudgeissued of the actions of the theinterestoftime,savingof lands valued at US$8 disposed of without his another, Tiwarie argued that orders that the Registrar of Registrar of Lands in moneyandthemaximisation million. permission. at the time of the sale and Lands remove the caveat determining that the caveat of the court’s scarce
Justice Holder explained of the Registrar of Lands. In those circumstances, in his decision in the matter “However,hadtheRegistrar the judge ordered that not to quash the decision of complied with Section Tiwarie’scasebedismissed.
BrianBusinessman:‘BK’Tiwarie
High Court Judge, 125(6) of the Land Registry Franklyn Holder has thrown Act,Iamoftheopinionthat out a case brought by the very issue amongst businessman Brian ‘BK’ others would have been Tiwarieoverthesaleoflands raised in any proceedings located at Plantation land to Chinese developer, through, and a court action operating as a statutory bar the Registrar of Lands to before the court by the Providence, East Bank Chu Hungbo of the Chinese wasmountedthatresultedin toanysuchtransfer register the instrument of parties seeking to have the Demerara(EBD).
Kaieteur NewsPAGE 24 Wednesday September 21, 2022
BaiShanLin,companyChuHungbo
The Sunset Lakes Housing project located at Providence, EBD
Notably, Guycan Consortium was not being supervised, the final product was listed as a prequalified bidder This unacceptable.” newspaper did not find any records for the He explained that the party has been companyinGuyana.Itisunclearwhetheritis compiling a list of all these questionable alocalfirmorregisteredelsewhere. contracts awards and will be formally
Frompage23 cash grant, uniform allowance grants and the expanded school feeding programme thataimstoboostclassroomattentiveness, schoolattendanceandperformance.
overclaimstoProvidencehousingprojectHighCourtthrowsoutBKTiwariecaseoverclaimstoProvidencehousingproject
Pattersonflagssuspicioustendersreceived...
Guyana’s education...
From left: Malcolm Watkins, Permanent Secretary of the Health Ministry, and Gregory Dean, CEO Digicel Guyana, at the signing of the agreement
commits $60M to
Aspartofitssupportand caregivers. This is a small testament of the Ministry of commitment, Digicel in a step in a long term Health’s comprehensive press release noted that it commitment, and it is approach to health care and made the financial envisioned that this project we intend to build and commitmentof$60Movera will continually enhance s t r e n g t h o n t h i s three year period to the qualityoflife,andempower partnership.”
Frompage8 Patterson said a recent inspection the project including Guycan Consortium – revealed that several issues relating to the US$549,088,000, China Energy Int’l Group poor construction of the Kato School still Co. Limited US$466,649,772, China exists. To this end, he told the media that Machinery Engineering Inc. MinisterPriyaManickchand’sassurancethat US$696,001,776, Power China Int’l Group an independent engineer will be supervising Limited – US$703,652,256, and Lindsayca thisproject,shouldbeoflittlecomforttothe Inc.injointventurewithCH4GuyanaInc.– public, since “an independent engineer was US$898,764,244. also assigned to the Kato School – despite
Citing another example, the former Infrastructure Minister explained, “In 2020, thecompletionofHunterStreetwasawarded to a company, whose principal’s previous experience was in the motor racing arena, once again, when queried the response was the successful bidder previously built roads intheHebackdam.”added,“The recent award for the rebuilding of the North Ruimveldt Multilateral School, is yet another example of the questionable evaluation and award process arising from NPTAB, one can recall thatthelasttimethiscontractorwasawarded a contract with the Ministry of Education, headed by the current Minister, they jointly produced the Kato Secondary School – a project so riddled with defects, that it was deem unsafe for occupation, and extensive remedialworkshadtobeundertaken.”
B a s e d o n c o u r t Chuwenttothebankfor transfer of the lands, there lodgedbyBKTiwarieasitis lodged did not disclose that resources that it would be documents seen by this the remainder of the existed, and still exists, a defective and essentially Tiwarie had a valid interest prudent and judicious to newspaper, Tiwarie sold the payment but the deal fell caveat in his favour, discloses no interest in the in the land. This, he noted, consider and rule on the land. was outside the jurisdiction issueintheseproceedings.”
Digicel Guyana, a long- Ministry to support special thepeopleofthecommunity standing partner of the needs and rehabilitation and will provide a holistic Government and other services This agreement approach to the well-being organisations for social will not only support the of families with special development across Ministry but will provide emphasis on health and communities in Guyana, on support to families living education through various Tuesdaycommitted$60Min with disabilities in e m p o w e r m e n t financial support to the communities across programmes,”notedDigicel Health Ministry’s Special Guyana. CEO, Gregory Dean, at the NeedsProject. Theproject, Across the region and in signing of the agreement on which represents the Guyana, Digicel has been Tuesday Ministry’slong-termvision, keen on developing T h e P e r m a n e n t isthecreationofworld-class sustainable programmes in Secretary of the Ministry of development facilities for areas like special needs, Health, Mr Malcolm children with special needs education and community Watkinsexpressedgratitude across the 10 regions of development that impact to Digicel for this initiative, Guyana. The initial period key social and economic statingitisimmeasurable. will see Digicel investing in developmentmarkers. “We The release added, special needs training for havemadeacommitmentto “ this partnership will i n d i v i d u a l s a n d support the Ministry of facilitate and foster longprofessionals within the Healthastheystrivetomake term enhancements to the disabilities sector in a difference in the lives of health sector This Guyana. the children and their partnership falls under the
Liza Unity crude, governmenthasbeendoingitsown marketing. At least two cargoes were already sold but little is known about the buyers and how theywereselected.
Governmentsaidthebidsmust besentnolaterthan09:00hourson October 11, 2022 at the address:
cargo.Furthermore, the EITI had flagged Guyana for not publishing descriptions of the process for selecting the buying companies, the technical and financial criteria used to make the selection, the list of selected buying companies, and any material deviations from the applicable legal and regulatory frameworkgoverningtheselection ofbuyingcompanies.
Kaieteur News previously reported that Aramco Trading Limited (ATL), the London-based trading subsidiary for the State controlled Saudi Aramco, had inked a one-year contract with the ministrytomarketGuyana’scrude
The
Kaieteur News PAGE 25Wednesday September 21, 2022
It has also pointed out that the country is yet to declare
consistently, information pertaining to the volumes of oil collected in accordance with the profit-sharing split in the Stabroek Block Production Sharing Agreement (PSA), alongside the identity of the buyer for each oil
Importantly, sales agreements forthecountry’sshareofprofitoil have not been made public The International Secretariat for the E x t r a c t i v e I n d u s t r i e s TransparencyInitiative(EITI)has since called for Guyana to do betteronthisfront
entitlement from the Liza Phase OneProject.Thatcontractcameto anendlastmonth.
The bidder shall seal the signed bid in an envelope addressed to the National Procurement and Tender AdministrationBoard(NPTAB)
Procurement and Tender Administration Board, Ministry of Finance, Main and Urquhart Streets,Georgetown,Guyana.
T
Interested bidders may obtain further information by email at jmckenzie@nre.gov.gyorfromthe following address: Permanent Secretary, Ministry of Natural resources, Duke Street, Kingston, Georgetown,Guyana.
he Ministry of Natural Resources on Monday saiditisseekingeligible bidders for the provision of marketingservicesforGuyana’soil entitlement from two Floating, Production, Storage and Offloading (FPSO) vessels, namely the Liza Destiny and the LizaBiddersUnity may bid for one or morelotsasdefinedinthebidding documents Kaieteur News understandsthatfirmsmustsubmit the original and two copies along with two electronic non-editable copiesoftheBidforeachlot.
ATL was among 15 bidders in the Brent linked tender for Guyana’s light sweet Liza grade, and “was identified as the lowest compliant evaluated bidder at the price of $0.025/bl,” the ministry hadThesaid.other bidders were: Bibi Energy Trading, Shell Western Supply and Trading, Chevron, Petraco Oil, China National Offshore Oil Corporation, Natural Gas Company of Trinidad and Tobago and Heritage Petroleum, Hess, Vitol, Mercuria Trading, Total Energies, Litasco and
The envelope shall bear the following identification: - “Ref. No. MNR/2022/ICB/MS-02 - Bid for the Provision of Marketing Services for the Cooperative Republic of Guyana’s Oil Entitlement Lot 1: For the Liza Destiny FPSO Vessel (and/or, where applicable) and Lot 2: For theLizaUnityFPSOVessel.”
Govt. seeking marketer for crude from Liza Destiny & Liza Unity vessels
Liza (FPSO)Guyana’Destiny,sfirstFloating,Production,StorageandOffloadingvessel
Trafigura. Proposed commissions ranged from US$0 02/bl to US$0.26/bl.Asforthe
The Chairman, National
PAGE 26 Kaieteur News Wednesday September 21, 2022
You may feel a bit restless and unsettled without really knowing why. Stresses on the job could churn up repressed resentment from the past that you need to let go.
out as, for now, they are no longer earning world ranking points.“We call on you to render a positive decision quickly –for the benefit of the integrity of the rankings, the game and all of us who love the sport,” the players said.
Too many people could be vying for your attention today, Aquarius. All of them want advice or help. This could be flattering, and you'll probably want to help them, but it can also be unsettling and make it hard to focus.
Former Berbice and Guyana U19 fast bowler Naresh Roopnarine, will be contributing towards the development of West Berbice cricket by sponsoring an U13 25 overs competition
There could be trouble brewing in the workplace. Your colleagues neither like nor trust each other and find it impossible to work together. Adjustments are needed if everyone is going to work to the best of their abilities.
He played first division cricket in West Berbice alongside players such as Nigel Wilson, Trevor Crawford, Eon Abel, Vibert Fraser and Hoosalram Lalsa.
ARIES (Mar. 21–Apr. 19)
Is your significant other caught up in family problems and unable to spend time with you? Don't let your insecurity get the best of you. Your partner needs to deal with family now. Relax, do what you want to do, and have confidence in yourself.
SCORPIO (Oct. 23–Nov.
If you've been having trouble reaching a romantic partner, Sagittarius, it might be a good idea to stop trying. Your friend is having a rough day and might not make the best company.
AQUARIUS(Jan.20–Feb.18)
Spiritual breakthroughs may have you feeling a little disconcerted, Cancer. Clearing away deadwood, such as past traumas, might tell you a few things about yourself you'd rather not face.
the upstart circuit feel they are “being slow played” by the OWGR.According to the OWGR website, the ranking points breakdown is derived from each tournament’s total field rating and points are awarded players who make the cut and complete an event, subject to their finishing position in the tournament.LIVGolf’s 54-hole events do not have a Organiserscut.ofgolf’s four majors have not changed their qualifying rules but players who earned exemption into the blueriband events due to past results could one day be left
LEO (July 23–Aug. 22)
(Reuters) - All 48 players who competed at LIV Golf’s event outside Chicago over the weekend sent a joint letter to Official World Golf Ranking (OWGR) Chairman Peter Dawson urging him to award ranking points to competitors on the Saudi Arabia-backed series.The letter, dated Sept. 16 and shared by LIV Golf on Tuesday, included electronic signatures of every player in the field at Rich Harvest Farms where British Open champion Cameron Smith won in his second start on the lucrative circuit.
Former Guyana cricketer Roopnarine to sponsor cricket tourney in West Berbice
The tournament is expected to commence shortly.
Roopnarinethere.indicated
CAPRI (Dec. 22–Jan. 19)
Matters involving communication seem to be fouled up. Messages may not get delivered, emails may not go through, and people might misinterpret your words.
Roopnarine is from the village of D’ Edward, West Berbice, and played his youth cricket for D’ Edward Sports club before moving to Blairmont community center.
Squabbles may come up between you and a sibling or neighbor, Aries. Your ability to compromise is definitely called for here. If you aren't careful, this could turn into a battle of wills.
PISCES (Feb. 19–Mar. 20)
VIRGO (Aug. 23–Sept. 22)
Wednesday September 21, 2022 Kaieteur News PAGE 27
LIV Golf, which launched in June and has so far held five events, applied for recognition in golf’s world rankings - which play a key role in deciding entry into golf’s four majors - in July and their file remains under review.
added that outstanding players will be receiving cricket gears.
Wednesday September 21, 2022
GEMINI (May 21–June 20)
Too much rigorous exercise over the past few days might have you feeling a little sore and tired. Your nerves may be on edge, and you could be more likely than usual to snap at those around you.
He is urging the clubs in West Berbice to register for the competition so that the players will get an opportunity to hone their Roopnarineskills.
SAGIT (Nov.22–Dec.21)
According to the letter sent by the players, every week that passes without the inclusion of LIV Golf athletes “undermines the historical value” of the world rankings.
CANCER (June 21–July 22)
LIV Golf players urge World Golf to grant ranking points
LIV Golf, which last weekend had 12 major champions in the field, has lured some of the game’s biggest names away from the PGA Tour with the promise of guaranteed, big-money paydays and a reduced schedule.Critics say LIV Golf, which is bankrolled by Saudi Arabia’s Public Investment Fund, amounts to blatant “sportswashing” by a nation trying to improve its reputation in light of its history of human rights abuses.
A virtual conference of some kind could touch upon some pretty volatile issues, Leo. People could disagree to the point that the meeting turns into a shouting match.
LIBRA (Sept. 23–Oct. 22)
Money matters might cause you a few headaches. You could be torn between the desire to put money aside for the future and the impulse to buy something that you've wanted for a long time.
that during his playing days it was difficult to obtain cricket equipment and when he was selected to represent Berbice, he had to borrow cricket equipment and this motivated him to give back to the game.
The letter was shared by LIV Golf four days after a Sports illustrated report which cited a source close to the situation saying officials from
“After all, the fans deserve rankings that are inclusive and accurate. Failure to include 48 of the world’s best golfers would mean the fans are being denied what they deserve.”
TAURUS (Apr. 20–May 20)
21) Your values could oppose those of a business or romantic partner today. One of you may be overly pragmatic and the other too idealistic. One seems callous, while the other seems to be living in a dream world.
Kimora was focused in P a u l a K a l e k e y z i thefirstsetandwaspoisedto defeated Anastasia Semple earn her first defeat over her 4-0,4-0 cousin, but Niomi settled-in Boys U-14 andralliedtotakethesecond Nathan Denobriga set. defeatedJoseRodriguez4-0,
The three human rights Amnesty’spropositionandthatworkers along with other foreigners comprise organisations said they had written to had received payments of a total $22.6 thebulkofthecountry’spopulation.
Guyana’s Paul, 24, was drafted to the Durban Super Giants along with St. Lucian wicketkeeper/batsman Johnson Charles, the leading run-scorer in the ongoing CaribbeanPremierLeague.
Guyanese All rounders Keemo Paul and Romario Shepherd were among five West Indians selected in Monday’s inaugural SA20 draftin TheSouthAfrica.league,scheduled for January-February next year,willfeaturesixteams.
Itwasaclosebattleinthe 4-0 beginning of the super tie Christian Younge break where both player’s defeated Gabriel Felix 4-0, determination was on 4-1 display Niomi eventually N a v i n d r a A r j u n e took the tie break 10/8 and defeated Elwyn Levius 5-3, withthatcementedherselfas 5-3 theGirlsU12champion. Girls U-18
Guyanese duo Paul, Shepherd among five WI players for inaugural SA20
(Reuters) - FIFA’s partners and report that thousands of migrant Energy, Qatar Airways, Vivo, Hisense, World Cup sponsors must urge world workerswerestillbeingexploited. Mengniu, Crypto and Byju’s — have soccer’s governing body and the Qatari Last week, a YouGov survey of not responded to written requests to government to compensate migrant more than 17,000 fans from 15 discuss tournament-related abuses, the workers who suffered while preparing countries 10 of them European organisationssaidinastatement. the nation for the event, Human Rights commissioned by Amnesty showed In May, Amnesty and other rights Watch, Amnesty International and 73% of respondents would support a groups had called on FIFA to earmark FairSquaresaidonTuesday proposal for FIFA to compensate $440 million to compensate migrant Qatar has faced intense criticism migrant workers, while 10% opposed workersinQatar from human rights groups over its it FIFA said then that it was assessing treatment of migrant workers, who
FIFA’s 14 corporate partners and World million as of December 2021, with an Qatari authorities did not Cup sponsors in July and that four of additional $5.7 million committed by immediately respond to a request for them — AB InBev/Budweiser, Adidas, contractors. comment from Reuters about the rights Coca Cola, and McDonald’s had It added last week that a wide range groups’report. indicated their support for ensuring of measures had been implemented in
hethirdEditionof Gabrielle Felix defeated the Rebel Tennis JaydeanKing4-0,4-0
Khalifa International Stadium
Niomi Erskine is Rebel Tennis Club Tourney Girls U-12 Champion
Other results for Sunday Norella Jordan defeated 18th ErinTucker6-4,6-3 Girls U-12 Renola Jordan defeated Kimora Erskine defeated Leshaute Berkley by GabrielleFelix4-1,-1 walkover
KeemoPaul ShepherdRomario
Top-seededErskine,who Malia Maikoo defeated was last year’s runner-up, AnastasiaSemple4-0,4-0 outlastedhercousin,Kimora Kayesha Harding Erskine 2-4, 4-0, 10- 8 to defeated Niomi Erskine 4-1, takethetitle. 4-2
Town franchise while the Paarl Royals who alsoBajans Jason Holder and Jamaica’s Odean Smith Barbadian pacer Ramon signed Obed McCoy beforeKyle Mayers, were among will turn out for the MI Cape Simmonds was drafted by thedraft.the pre-draft signees for the
Two more West Indians, SuperGiants.
TClub Annual Boys U-12 Juniortournamentcontinued Elwyn Levius defeated last Sunday, where Niomi Jonathan Jordan by Erskine defeated Kimora walkover Erskine to win the Girls Elwyn Levius defeated under 12 title at the DequanBoston4-0,4-0 DiamondCourt. Girls U-14
Kaieteur NewsPAGE 28 Wednesday September 21, 2022
The government of Qatar has said remedyforworkers. recent years to improve protection for that its labour system is still a work in Ten other sponsors Visa, workers in Qatar, which will host the progress, but denied a 2021 Amnesty Hyundai Kia, Wanda Group, Qatar WorldCupfromNov 20.
The Johannesburg Super Kings draftedAlzarri Joseph in addition to signing RomarioShepherdpre-draft.
KimoradefeatedErskine(right)hercousinErskinetowintheGirlsU-12title
Niomi
RightsgroupsasksponsorstopressFIFA, Qataronmigrantworkercompensation
President of the Berbice GroundonSundaylast. PresidentWayneFordeandI Football Association (BFA), “We should all be very must say that active S h u r w i n F o r d e , i n grateful to NAMILCO for participation in this game
Goal scorers for Orealla following their 6 – 0 win over Cougars
Sunday’s other match which is seeking to become saw Paradise Invaders FC t h e 1 0 t h R e g i o n a l blanking Rosignol United, AssociationsoftheGFF 2-0.
The BFA President, their commitment to the ways that they have been himself a former National development of the sport in supporting you over the Player who controlled the Guyana, encouraged his years. This league presents midfield also known as the playersandclubstocontinue the platform for you to engine room, urged players supportingthebrand. showcase your skills as an toaimtobethebestandthey Forde was delivering individual and a team,” will be rewarded noting that official opening remarks at Fordesaid. lots of opportunities are thekick-offoftheBFAlegof The BFA president there for their development the GFF/NAMILCO added, “this is a worthwhile i n t h e s p o r t a n d Thunderbolt Flour Power investment, engineered by academically Under-17 Intra Association the Guyana Football Meanwhile, when the League at the Scott’s School Federation (GFF) through action got going, Orealla Falcons got their quest for top honours off to a flying start when they tamed Cougars FC, 6-0, led by a hat trick of goals from Rayan Deneux, who rocked the nets from as early as the 2nd minute and again in the 20thand36thminute.
BFA President, Shurwin Forde (2nd left) takes time out for a photo with Orealla Falcons FC.
Berbice FA GFF/NAMILCO
Kaieteur News PAGE 29Wednesday September 21, 2022
Fraser who was on target in
- Thunderbolt Flour Power U-17 League kicks off Orealla Falcons, Paradise Invaders notch opening wins
The other competing
Setting the stage for the clubs are Corriverton Links win was Raphael Sampson FC, Hopetown Rangers FC, whoscoredinthe8thminute and New Amsterdam and his teammate, Kishawn United.
total control of the A total of eight clubs are proceedings and never vying for the championship allowed the counterparts trophy and the right to from Cougars to get settled. represent the BFA in the The other goal scorers were Inter-Association Playoffs Ronaldinho Felix (3’), which will feature the Lawrence France (28’) and respective champions of the Anjan Herman who closed Federations nine Regional out proceedings, in the 55th Associations and the Barima minute. Waini Football Association
The Orealla lads were in the45thminute.
Paradise Invaders scorers
c o m p l i m e n t i n g t h e their continued investment alsoallowsyoutosucceedin unflinching support of the in the development of you your academic pursuits as National Milling Company and your peers nationwide, thetwogohandinhand.” of Guyana (NAMILCO) and this is just one of the many
FC
The president’s outreach initiative is designed to optimise information exchange between the GFF Council and administration and GFF members, while enabling the President to experience first hand the unique challenges and successes of stakeholders in each of the GFF’s nine regionalassociations.
G u y a n a F o o t b a l l Federation (GFF) president Wayne Forde, concluded a successful visit to the Upper D e m e r a r a F o o t b a l l Association (UDFA) this weekend, handing out football equipment and meeting with officials and clubs as part of the federation’s official regional outreachprogramme.
“ T h i s o u t r e a c h said, according to a GFF for the future of the game,”
- President distributed football equipment to Region 10 Sub-Association
“The GFF is committed to exploring all and we have seen how trailblazers such as possibilities to help Guyanese girls and boys Natalie Nedd and Omari Glasgow have develop their talent to its full potential and excelled in the U.S. college or professional forge opportunities from football, whether footballenvironments.” that might be in education, professional sport “We are confident that, following this or other careers,” said GFF President Wayne important camp in February, many more of Forde. our players will be able to follow in their
During his visit, Forde also distributed footballs to service to the beautiful underlined how the GFF andisanessentialpartofour from our administration to met with the UDFA senior men’s teams in the game, and to assure them Club Charter Programme work to develop football for c l u b s a n d r e g i o n a l Executive Committee, the region. “There are so many that the GFF stands ready to andGFFMembersFinancial all across Guyana, while associations – and it’s vital General Council and other unsung heroes working support them with the Assistance Programme can ensuring our members have thatwedoeverythingwecan stakeholders, competed in a behind the scenes in football equipment, technical and helpthemimprovestandards the tools and resources they to maintain excellent “masters” football match, across Guyana,” Forde other support that they a n d a c c e l e r a t e t h e need to deliver on their relationships within this and kicked off the UDFAleg explained. need.” “With that in mind,” development of their clubs individual, as well as our community to continue of the GFF NAMILCO “It was, therefore, a Forde continued, “I and their on-field and offcollective, goals,” Forde building a strong foundation Thunderbolt “Flour Power” m a t t e r o f p e r s o n a l emphasised the importance fieldtalent.”
The pioneering initiative, which will also delighted to partner with ARSASSA for this exposethecreamofyoungGuyanesefootball potentially life-changing football camp,” talent to coaches and scouts from the United President Forde added. “Young players from States and Brazil, was formalised during a ournationalteamyouthstructurewillbeable meeting between the two organisations on to improve their technical skills, showcase September17. their ability to scouts and college coaches,
Five college coaches from the U.S. and andlearnmoreabouthowtonavigatetheU.S. one academy coach from a club in Brazil will collegepathway.” participate in the week-long camp at the GFF Adding his thoughts on the initiative, the National Training Centre in February, which Technical Director of the GFF said: “One of will be facilitated by ARSASSA in our core goals as a federation is to develop a collaboration with the GFF Technical clear pathway from youth football to Department,ledbyActingTechnicalDirector professional and educational opportunities BryanJoseph,aformerGoldenJaguar forourplayers.”Weknowwehavethetalent,
Kaieteur NewsPAGE 30 Wednesday September 21, 2022
The Guyana Football Federation (GFF) will partner with the US-based AR Student Athlete Soccer Scholarship Academy (ARSASSA)foraone-weekfootballcampin GuyanainFebruary2023,whichwilleducate players of the academic and professional development opportunities available in the USyouthfootballandcollegestructure.
Wayne Forde - GFF President
CAS had earlier rejected has been a key staging area In July, the Court of a request from the Russian for the Russian invasion, Arbitration for Sport (CAS) soccer federation to freeze were included in the draw dismissed appeals filed by F I FA’s s u s p e n s i o n , though UEFA said they the Russian football effectively ending its hopes cannot be placed in the same federation and four Russian of competing at the World groupasUkraine. clubs against FIFA and CupinQatarlaterthisyear Football’s global body UEFA’sdecision. (Reuters)
GFF
GFF creates pathway for trcollegeweek-longfootballyoutsinFebruary
GFF President, Wayne Forde , distribute balls to UDFA Clubs.(forth fromGFFleft)President, left),
However,Belarus,which operation”.
“As part of these ongoing efforts, we are footsteps,”concludedJoseph.
National U17 Intra importance for me to thank of strong club governance programme is part of our release.“TheGFFisaunited Fordeadded. Association League. He the club executives for their a d good governance strategy community of football
nd structures, an
drawqualificationEurofromexcludedRussiadrawqualificationEurofromexcludedRussia20242024
Forde reassures UDFA of GFF support
Russia were excluded FIFA and European UEFA confirmed Russia from the qualifying draw for Football’s governing body would not be involved in the t h e 2 0 2 4 E u r o p e a n UEFA decided in February event after its Executive Championship with the that all Russian teams, Committee met in Hvar, national team still banned whether national or club Croatia and approved the from all competition until sides, would be suspended procedure for the qualifying further notice following the from participation in FIFA draw, which will take place country’s invasion of andUEFAcompetitionsafter on Oct 9 in Frankfurt Ukraine, UEFA said on the invasion, which Moscow Germany will host Euro Tuesday calls a “special military 2024.
The pre-juniors title was Kitty and proceeded to second, Paul Chooweenam won by Nevon Wilson while Burma Road junction, third; Segan Hubbard Christian Dudley placed M a h a i c o n y b e f o r e occupied the fourth spot and second. culminating at Carifesta RobinPersaudwasfifth.
Jamaul John takes Victor Macedo Memorial Cycle Road Race title
amaulJohnturnedin by Romello Crawford, Sampsonrespectively a s p l e n d i d Christopher Griffith and Cliveca Spencer took the
were laid down to age in game who takes a brilliant Guyana,” added Samaroo, American Oak ex-bourbon catch,sinceitsinception. who spent most of adult life ith much pop casks10yearsago.
Curtis Dey took the won by Alexander Leung Christopher Griffith (1), runner-up spot while Bryton f o l l o w e d b y M a r i o Curtis Dey (1) and Jamaul John placed third, followed Washington and Sherwin John(1).
DDL, CPL celebrate 10th Anniversary partnership with commemorative rum DDL,
The race commenced in Shaw Alex Mendes was
DDL’s latest Rum was Warriors will face Jamaica
blended before the guest Tallawahs this evening atspecial El Dorado rum is a members of the Guyana Butcher and Joe Soloman. We are hugely honoured
Jamaul John (left) receiving his spoils for winning the Victor Macedo Memorial Cycle Road Race title.
According to DDL, the guests,themediaandseveral Rohan Kanhai, Basil produces.
unique blend of specially Amazon Warriors, that El He added that Roy that they have created this distinguished opportunity of and with three points fromselected marques from the Dorado Rum has been an Fredericks also came from wonderful rum to help us sampling the El Dorado sixes matches, need to winhistorical Port Mourant official partner and sponsors EstateBlairmont. celebrate a decade of the Master 10th Anniversary all four of the remainingDoubleWoodenPotStill,the the tournament’s Catch-of- “So Rum, which is made CPL.” CPLT20Rum. preliminary round games toFrench Savalle Still, and the the Match award, which with Sugar has also been The Blend Master
The Guyana Amazon qualifyforthesemi-finals.Diamond Coffey Still that goes to one player in each associated with cricket in explained in detail how the
The junior segment was taken by Bryton John (7),
w e r e o f f e r e d t h e Providence from 7:00pm
Komal Samaroo, CEO of DDL, making the presentation to Pete Russell (left), Hero CPL CEO following the unveiling of the commemorative 10-year old rum.
Jperformance to win Deeraj Garbaran in that top podium spot in the theVictorMacedoMemorial order female division and Walter cycle road race which was The Veterans Over 50 Grant-Stuart won the under contestedovertheweekend. title was taken by Tallim 50segment.
P e g a s u s S u i t e s i n forged their partnership with CPLandDDLandsaiditwas After being presented Georgetown, Guyana, the ElDoradobrand,ratedasthe about bringing people with a bottle with a bottle of Demerara Distillers Limited best Rum in the world and together the 10th Anniversary rum, (DDL) on Monday Evening since then the bond between Komal Samaroo, Chief Pete Russell, Hero CPL launched its El Dorado El Dorado and the second Executive Officer (CEO) of CEO,saidthelocalcompany Masters Blended 10th most watched T20 league in DDL highlighted the “have been a fantastic AnniversaryCPLT20Rum. the world has gotten relationshipwithCricketand partner of our tournament
- El Dorado Master Bender’s CPL Rum launched
Director of CPL James at DDL ensuring that the and splendour It was in the inaugural Stewart spoke about the 10 G u y a n e s e c o m p a n y
Wat spanking tournament in 2013 that years of magnificent continues to produce the new and lavishly designed DDL and the Hero CPL partnership between Hero finestRumintheworld.
The prime prizes were Avenue.
By Sean Devers
The specially distilled stronger the sugar estates in Guyana overthelast10years. rum is a commemorative Director of Marketing and stated that in the 1950s Wehavebeenveryproud edition in celebration of the Sharda Veeren spoke of the SirClydeWalcott,whowasa to bring the world the DDL’s involvement with wonderfulUnionofadecade part of the famous 3Ws, BiggestPartyinSportandno the Caribbean Premier and told the gathering of spent some time at Estate partyiscompletewithoutthe League. dignitaries, distinguished PortMourantanddiscovered fantastic rum that El Dorado
Kaieteur News PAGE 31Wednesday September 21, 2022
The scenarios for the losses,oneno-result).
Rahmanullahwicketkeeper/AfghanbatsmanGurbaz
There’s a love hate sports’ played loud in relationship between the Guyana.
However, Griffith starting from tonight, adding believesthatwiththecurrent “we know that if we slip, we situation, the Warriors will will slide…we all know the have to take a collective position the team is in at the approach to their remaining moment,wejusthavetostay matches, telling reporters, focus and try to execute –“everybody will have to put bat, ball and in the field as theirhandsup. well.”
NOT WORRIED matches against the Knight ABOUT THE PRESSURE Riders and the Royals and
By Rawle Toney three points from six seven wickets to hoist the points and should’ve gained wicketkeeper/batsman, finals (the most by any matches (one win, four trophy for the first time. some points and we Rahmanullah Gurbaz will franchise), Coach Griffith
Fast forward three years would’ve been in a better replace Klaasen, while wouldn’t be fazed by the AmazonWarriorstoadvance And no, he’s not later (2016), the Tallawahs position,” Griffith told the Shakib Al Hasan will take pressure of their fans’ to Hero Caribbean Premier speaking about Shai (Hope), defeated the Warriors by localmediayesterday the place of Tabraiz Shamsi, expectations. League (CPL) Playoffs are – but rather, the team’s coach nine wickets to pick-up their Griffith has gotten the after both South Africans “To be honest, so far, tosimplyput–complicated. is backing his men on secondtitle. mostfromhisbowlersinthis were called for International we’re trying to keep them
Amazon Warriors are in the must-win situation to keep their hopes alive in this year’s CPL (Photo: Getty/CPL T20)
Kaieteur NewsPAGE 32 Wednesday September 21, 2022-AlGurbaz,ShakibHasanaddedtolineupGurbaz,ShakibAlHasanaddedtolineup
Sometimes you come, Following tonight’s you might have a good game clash with theTallawahs, the or you don’t, but every Warriors will battle St Lucia player is important to Kingstomorrow(Thursday), performathisleg.” followed by back-to-back
This time around, the year’s CPL, but it’s the duties. together, they’re in good they’re in the playoffs; lose something they will Jamaican franchise will be
The Amazon Warriors SaturdayandSunday are in an unfamiliar position One thing is for certain, for the first time in the the National Stadium will franchise’s history of the see a capacity crowd, with CPL, especially at this stage everyone turning up to ofthetournament. witness the ‘biggest party in
Wa r r i o r s a n d t h e i r It will be either‘Let’s go supporters, but after playing Warriors!’ or, ‘oh No in every playoffs and five Warriors!’
Amazon Warriors begin ‘tricky’ quest for CPL Playoffs spot
Win all four matches and playing perfect cricket
team’s batting that resulted Al Hasan, in 2016, spirit. twoandthat’stheendoftheir certainlyneedtodogiventhe the first of four hurdles the intheirfailure,sofar helped guide the Tallawahs Thepressurecouldbeon, campaign; win three and fact that they also have the Warriors must climb in their “I think batting wise, to CPL glory over the side but at the end of the day, it’s they will have to wish on a lowest Net Run Rate in the quest for a place in the instead of 20’s and 30’s we he’s now suiting up for In cricket, we all work, we’ve star for the likes of the tournament (-0.540). First tournament’sPlayoffsstage. need to stretch that a bit 2019, with the Barbados beenherebeforesoyouhave Jamaica Tallawahs, St Kitts up, the Jamaica Tallawahs “We’re home. We know longer and try to get some Tridents (now Royals), the to understand how to handle and Nevis Patriots and the tonight at 7:00pm at the how important it is for these 50s and 60s and even 70s. Bangladeshi all rounder pressure and you could get Trinbago Knight Riders to GuyanaNationalStadium. last four games, we really We had one innings from picked up another CPL title, the best out of them. So, I’m not have favourable results The Jamaica Tallawahs, need these four games badly HeinrichKlaasenwhogot63 again at the expense of the stillhavingconfidenceinmy intheirremainingmatches. owned by Guyanese because we put ourselves in (unbeaten), so we know Warriors. side to go the long way,” the One might argue on businessman Kris Persaud, this position, especially wherewefallshort,”Griffith His 6 for 6 bowling usually composed Griffith which is simpler to achieve are known for raining on the when we lost games three said when asked about what figures in 2013 is still the said. based on the Warriors’ form Warriors’ parade ever since (against Patriots) and game canbedonedifferently record in the CPLand with a One thing is for certain, in this year’s tournament theinauguraledition. five (against Knight Riders) GURBAZAND total of 490 wickets, he’s Griffith isn’t naïve when it where they’re at the bottom In 2013, the Tallawahs because those are the two SHAKIB INCLUSION sitting 5th all-time in T20 comes to the tight rope that of the six-team table with defeated the Warriors by games where we lost some A f g h a n i s t a n cricket. they will have to walk
It was the first meeting between the players and ExxonMobil Guyana officials, which took place at the GuyanaMarriottHotelinKingston.
ExxonMobil Guyana’s officials and the Guyana Amazon Warriors team (Rawle Toney photos)
ExxonMobil Guyana batting with the Amazon Warriors
President of ExxonMobil GuyanaAlistair Routledge reiterated the Oil giants’ notion that their sponsorship this year is in recognition of the importance of cricket to Guyanese and the exciting opportunity to host the semifinals andfinal.Routledge spoke profoundly of ExxonMobil’s sponsorship of several key areas of sports development, especially in basketball and football with Youth Basketball Guyana (YBG) and the PetraHOrganisation.eaddedthat ExxonMobil Guyana is committed to the development of sports and their unwavering support of the Guyana AmazonWarriorsfranchise.
The value of ExxonMobil’s investment into the team owned by Dr Ranjisinghi ‘Bobby’ Ramroop wasnotannounced.
Kaieteur News PAGE 33Wednesday September 21, 2022
Havingannouncedthemselvesas the official title sponsors for the Amazon Warriors in August, the hierarchy ExxonMobil Guyana met with the players and management of the local Hero Caribbean Premier Leaguefranchiseyesterday
Printed and published by National Media & Publishing Company Ltd., 24 Saffon Street, Charlestown, Georgetown. Tel: 225-8458, 225-8465, 225-8491 or Fax: 225-8473/226-8210. Sport - Gurbaz, Shakib Al Hasan added to lineup Amazon Warriors begin ‘tricky’ quest for CPL Playoffs spot Let’s Go Warriors! One thing for sure, the Warriors’ fans will be out to support their beloved team (: Getty/CPL T20) Shakib Al Hasan will suit-up for the Warriors ShakibWarriorsAlHasanwillsuit-upfortheWarriors -ElDoradoMasterBender’sCPLRumlaunched DDL, celebrateCPL parAnniversar10thytnershippartnershipwithcommemorative rum A look at the specially distilled DDL 10-year old commemorative rum to the 10th Anniversary partnership between DDL and the Hero Caribbean Premier League. From left: Komal Samaroo , CEO of DDL, along with Director of CPL James Stewart and Pete Russell, Hero CPL CEO following the unveiling of the commemorative 10-year old rum. (Photo compliments: Terrence Thompson) ExxonMobil the AmazonExxonMobilWarriors Warriors President of ExxonMobil Guyana Alistair Routledge (L) received an autographed GAW jersey from the team’s captain, Shimron Hetmyer Guyana batting with
