AIETEUR NEWSK Guyana’s largest selling daily & New York’s most popular Guyana’sweeklylargest weekly Online: www.kaieteurnews.com August24,2022-Vol.17 No.35 Online readership yesterday, 71,915 Wednesday Edition Price $100 storSeeyonpage2 2 charges,slappedcarjackerswith13remanded Guyana's share without robust auditing, monitoring of oil companies' expenses Better contract will not increase IDB says GPHC in need of urgent Consultation begins today for US$115M EBD Road Project $334M to rehabilitate 10 roads in Belle West Housing Scheme criticaldead,HusbandwifeafterWCBcrash Jagdeo should not be involved in auction of oil blocks-Opposition wooden buildings from 19th century represent fire hazards upgrades main operating theatre currently has just 6 rooms general Intensive Care Unit (ICU) has only 7 beds Norton says... Detective Sgt. Bascom statementsubmitstoOPR 'Paper Shorts' murder…
IDB says GPHC in need of urgent upgrades
· general Intensive Care Unit (ICU) has only 7 beds
While the Georgetown PublicHospitalCorporation (GPHC)hasbeenrenovated over the years, much more needs to be done to ensure the country’s premier referral and teaching institution is able to meet g r o w i n g d e m a n d s effectivelyAccording to the Inter American Development Bank (IDB), GPHC is the main national referral hospital in the country, which functions as the Regional Hospital for Region Four – DemeraraMahaica and the District Hospital for Georgetown. The bank said several improvements to the hospital infrastructure are necessary to overcome gaps relating to capacity, quality, and growing demand for specialistservices. In this regard, the bank said inpatient bed supply is inadequate, with some wards consistently experiencing over 100 percent occupancy rates. It said the general Intensive Care Unit (ICU) has only seven beds, and specialised ICUs and high dependency units frequently have waitinglists. As a shift progresses to more sophisticated minimally invasive surgery techniquesandnon-invasive procedures,theIDBsaidthe lack of specific outpatient day recovery beds is becoming an important limitation.Furthermore, the IDB found that the main operating theatre currently has just six rooms, which is insufficient to attend to the growingquantityofelective surgeries requested by an expanded array of medical specialists.Asforthe accident and emergency department, the bank said it has a bed assignment that covers merely 50 percent of demand and no areas for p a e d i a t r i c a n d psychological examination andTheisolation.IDBinitsreportsaid additional physical deficiencies exist in laboratory, pharmacy, imaging, and support services (administration, warehousing, and staff environments).Overtheyears, in the absenceofamasterplan,the IDB said the spontaneous addition of services through improvised infrastructure and settings on the GPHC campus has created a situationofimproperpatient flows,supplyprovision,and medical waste disposal, in which transfers occur in the open environment and sometimes across public thoroughfares.Thefinancial institution said this generates risks of accidents and cross contamination. In the most extreme cases, such as the maternity ward, the IDB said wooden buildings from the 19th century at GPHC are still operational and representfirehazardsdueto f a u l t y e l e c t r i c a l installations.Importantly, it said similar situations exist at both the New Amsterdam Regional Hospital and the Linden Hospital Complex. Kaieteur News understands that the New Amsterdam Hospital is the second largesthospitalafterGPHC, and along with the Linden Hospital Complex, serve a significant catchment area, including receiving patients from other regions and the hinterland. In fact, the three institutions serve 315,000 persons,nearly40percentof theentirepopulation. The bank noted, however,thatbothhospitals possess limited capacity in their accident and emergency departments, intensive care units, high dependency units, surgical rooms, and imaging departments.Moreo v e r, N e w Amsterdamwasconstructed nearly 20 years ago and lacks sufficient installations for outpatient clinics, inpatient wards, and the pathology laboratory and has no buildings to house a central sterilisation unit, administration, and medical and paramedical staff on call As for the Linden HospitalComplex,thebank said it is unable to deliver properly the full contingent of obstetric, neonatal and child health services. It also does not have a burn unit to attendtoaccidentpatients.
T h e I D B s a i d strengtheningtheseregional hospitals to provide the full contingent of level four serviceswillalsoreducethe transfer of patients to the GPHC, thus reducing the patientloadofthathospital. To date, the bank has loanedGuyanaUS$160M,a portionofwhichisintended
wooden buildings from 19th century represent fire hazards
Kaieteur NewsPAGE 02 WednesdayAugust 24, 2022
·
Continuedonpage3
· main operating theatre currently has just 6 rooms
IDBsaysGPHCinneed...
Kaieteur News PAGE 03WednesdayAugust 24, 2022
Two carjackers were on Monday remanded after being slapped with 13 charges four at the Georgetown Magistrates’ Courts and nine at the Sparendaam Magistrate’s Court.The 13 charges include hijackingacar,kidnappinga taxi driver, shooting at police and a series of armed robberies.Policeidentified the two defendants as 18-year-old Emmanuel Hale and 32 year-old Hamza Samuels called“BadCoolie”,bothof ‘B’ Field Sophia, Georgetown They were among four men captured last Thursday by police during a shoot out on Mandela Avenue in Georgetown.Theyhad reportedly hijacked a car from a taxi driver, Joshua Singh, and locked him in the trunk before going on a robbery spreeuntiltheywerenabbed finallybypatrolranks. Theothertwomenhave been identified as Rawle Franklyn called “Mad Dog” andAndrew Newyer known as “Black Boy”. Franklyn andNewyerwerereportedly s h o t d u r i n g t h e confrontation with police. Newyer has since succumbed to his gunshot wounds while Franklyn remainshospitalised. Hale had reportedly given police a confession admitting to a number of violent crimes they had committed. Moreover, the Director of Public Prosecutions (DPP), ShalimarAli Hack, SC, had advised that police charge them.Haleandhisaccomplice, Samuels, on Monday appeared first at the Georgetown Magistrates’ Court before Magistrate Leron Daly to face the first four charges and were later taken to the Sparendaam Magistrate’s Court to face theremainingninecharges. At the Georgetown Magistrates’ Court, the duo was charged for allegedly dischargingaloadedfirearm atpoliceonAugust18laston MandelaAvenue with intent to maim, disfigure, disable or cause grievous bodily harm. The second charge allegesthatonAugust18,at Kitty, Georgetown, while beingarmedwithagun,they robbed Ershad Mohammed of a haversack and other itemstotalling$310,000. Athird charge reads that onthesamedate,atThomas Land,Georgetown,Haleand Samuels,whilebeingarmed with a gun and in the companyofothers,allegedly robbed Brindsley Thom of twocellphones,awalletand cash, totalling $253,000 They were also accused of stealing a black bag, a cell phone, local and foreign currency totalling $89,500 from JomoAngus that same daySamuels and Hale were not required to plead to the four charges read to them at t h e G e o r g e t o w n Magistrates’ Court and Magistrate Daly remanded them to prison until November14,2022. Themenwerethentaken to the Sparendaam Magistrate’s Court where they appeared before Magistrate Rushelle Liverpool to answer the remainingcharges. There the court heard that Hale and Samuels on August18,lastatOgle,East Coast Demerara (ECD), while being in the company of others, allegedly robbed Madan Ramdeo of a cell phone and cash totalling $73,000.Itwasfurtherallegedthat on that same day, at Red Road Sophia, they robbed JennyMingoof$293,000in items They were also charged for hijacking a $1 7M car from Joshua Singh, robbing him of his cellphoneandcashandthen abductinghiminhisowncar The charges did not stop there. The Magistrate went ontoreadthatonJune26,at Sophia, Georgetown, the duorobbedGeorgeGreyofa quantity of personal items totalling $895,000. Earlier that month on June 12, at Sparendaam Housing Scheme, while being armed withacutlass,theyallegedly robbed RoystonAdams of a Taurus pistol, ammunition and other items totalling $1.4M.Samuels was then charged separately for allegedly robbing Collin Robinson of $944,000 at gunpoint on July 24, last at ‘B’ Field, Sophia. He was slappedwithanothercharge, whichallegesthatherobbed Angela Delayra at gunpoint of $1.9M in items. That robbery reportedly took place on July 31, last, at Cummings Park, Sophia whilehewasinthecompany ofothers.Hale, his accomplice in the carjacking and other robberies, was also charged individually for allegedly attempting to rob Ezra RobertsonJuly31,last. Theduowasnotrequired to plead to the abduction charge at the Sparendaam Magistrate’s Court but for theremainingeightcharges, they faced there, they pleadednotguilty Magistrate Liverpool also remanded them to prisonandtheyareexpected toreturntocourtonOctober 7,2022.According to reports, while in police custody, the defendants gave police detailed confession about their alleged hijacking and kidnapping of a taxi driver before going on a robbery spree. In that confession, they named a fifth accomplice, Romario Hudson,popularlyknownas “Mario”. Police are yet to nabthatindividual.Haletold investigators that he was picked up from a location at Kitty Public Road by Samuels, Franklyn and Newyer in the car driven by Hudson.Hudsonreportedlydrove Continuedonpage9
In an article published on August 17, 2022, it was reported that the Oil and Gas Governance Network (OGGN)wasgearingtosetupaLegalDefenceFundtohelp fight cases relating to the 2016 Production Sharing Agreement (PSA) and that it will be spearheaded by the Civil Society organisation, ‘Our Wealth, Our Country’ (OWOC).Wewish to clarify that it is OWOC that will be launchingthefund,andnotOGGN.Weregrettheerrorand apologiseforanyinconvenienceitcaused.
REMANDED: Hamza Samuels (left) and Emmanuel Hale
CORRECTION Twocarjackersslappedwith13charges,remanded
Frompage2 toaddresstheissuesoutlinedabove. TheUS$160Mprojectwillsupportinterventionsthatwill increase the number of consultations and examinations provided at the primary level of care; increase referrals to districtandregionalhospitalsforconsultations,examinations and/or procedures that require a more specialised level of care; increase access to radiology and ophthalmology services; and ensure the continuous availability of key medicines,inputs,andsuppliesinhealthfacilities.
DEAR EDITOR, Please allow me this opportunity to say thank you publicly to the Minister of Education, Hon. Priya Manickchand.OnAugust 04, 2022, I penned a letter in your newspaper expressing my frustration with applying to various places and never getting a reply from them. In that letter, I made mention of the Ministry of Health and the Ministry of Education with the hopes of having someone from either of those ministries reach out to me.
A big thank you to Minister Manickchand
Yours faithfully, Tony Vieira Rohee must explain what he meant by “GECOM needs staff that reflects what Guyana looks like”
On August 05, 2022, I received an email from a representative at the Ministry of Education. I responded to that message and was told that the individual was asked by Minister Manickchand to reach out to me. I was advised to fill out a teacher’s application form and to bring it into him with my certificates and other necessary documents, which I did.I also received another email for another representative from the Ministry of Education stating that Minister Manickchand asked the individual to reach out to me also. I explained to her that I had submitted the application already and I gave her the name of the person to whom it was submitted to. She did a (Continued 5)
DEAR EDITOR, Newly appointed GECOM Commissioner, Mr. Clement Rohee’s hasty response to my letter published in both the Stabroek News and Kaieteur News editions under the captions: “Rohee’s message is crystal clear” and “Rohee the New GECOM Commissioner” respectively is an excellent example of stating much but not addressing the contention of my letter. Mr. Rohee is essentially playing word “games” in his response. This is not new. Mr. Rohee and his party (the PPP) has had a long history of transmitting “coded” and subliminal messages when it comes to race and race relations in Guyana. Mr. Rohee is within his right to resort to diversionary tactics in his response to me but it does very little in refuting my contention and interpretation of his statement that the GECOM staff needs to reflect what Guyana looks like. The issue here is a simple one. Either I interpreted his statement correctly or I did not.He wrote in one section of his response, “As far as I am aware, the PPP has never said what Ogunseye claims nor did I in my remarks.”
on page
Because of PPP’s intransigence, the sugar industry is in the state it’s in
Putting aside for the moment the accuracy of my statement that the PPP wants the composition of GECOM staff to change and bearing in mind that Rohee has insulated himself somewhat by saying, “As far as I am aware”, I will narrow down the controve rsy and request of Rohee, an unambiguous answer to the following questions: (1) Explain what you meant by “GECOM needs staff that reflects what Guyana looks like…” (2) Does the PPP accept the present racial composition of GECOM’sRohee’ssecretariat?answerto these questions will settle this polemic forthwith. Yours Tacumasincerely,Ogunseye
This is a sick country, with many very sick people in charge, as confirmed by the caption “IDB finds New Amsterdam Hospital in shocking state” - KN August 21).
PAGE 4 Kaieteur News Wednesday August 24, 2022 Printed and Published by National Media & Publishing Company Ltd. 24 Saffon Street, Charlestown, Georgetown, Guyana. Publisher: GLENN LALL-TEL: 624-6456 Editor: SHARMAIN GRAINGER Tel: 225-8465, 225-8491. Fax: 225-8473, 226-8210 EDITORIAL KAIETEUR NEWS New HospitalAmsterdam–thisisasickcountry
BUT, and I calculated it myself, if we set about to do a 100 day per year harvesting crop by machines with the hectarage we currently have, those factories don’t have the capacity to take that amount of cane to make sugar in only 100 days. The thinking behind all of this is very sound and cannot be solved by those who are currently in charge, I will not apologise for writing that they are not. But I do want to be constructive, because I do support President Ali’s hopes of salvaging the industry, and I never said that we must close down the entire sugar industry. I said that we should stop producing sugar and take the cane and make ethanol. But the PPP’s intransigence not to close the Guyana Sugar industry is today paying quite large dividends, since in the Caribbean, there are only two sugar exporting countries left, Guyana and Belize. Because of the Treaty of Chaguaramas and the other Caribbean Community agreements, if any entity in the Caribbean is producing sugar, all the others must buy it without duty impositions, if they want to go outside of the Caribbean to buy it, the Governments have to impose a 40% tariff on it. This creates a huge benefit for Guyana and Belize. Packaged and bagged sugar in this region therefore does not earn 12 cents per pound, it is almost 3 times higher if you bag and package it, and if we can produce white sugar, it will earn much more per ton, since all the territories in Caricom including Guyana needs white sugar to make soft drinks, sweets, chocolates etc. So it would be a huge asset to have, going forward. Ethanol is also very much more lucrative than using the cane to make sugar. Briefly, Guyana takes between 13 to 15 tons of cane to make one ton of sugar [tc/ ts]. Brazil and Australia are taking 7 tc/ts, this alone tells us that such a competition is unrealistic. But the sugar cane biomass from Guyana produces the same amount of ethanol per ton of cane as Brazil and Australia about 2022 gallons levelling the playing field considerably. So it’s very clear, we MUST mechanize effectively to survive and since today we are doing exactly what we did at Enmore and LBI to create machine-friendly layouts which were a complete disaster, we have to take the methods we are currently doing to create a friendly machine harvesting layout, back to the DRAWING board. I would like to state clearly that I do not want to seek any job in the sugar industry or anywhere else. At 77, I am not inclined to go to a desk daily, I am just showing what the actual situation is, since there is quite a lot of confusion about where we are, and where we must to go to prevail.
DEAR EDITOR, Guyana faces many challenges in sugar but the most important one is the weather. The second most important one is shortage of labour.At one time, the corporation employed more than 25,000 persons; today it is around 7000. I won’t start too far back, so I will start in 2010. In 2010, the industry produced 220,818 tonnes of sugar and employed 17,000 persons. I discovered that, between 2019 and the previous 20 years 2001-2019, a total of 31,004 MMs of rain fell, which is an average of 1554 MMs per annum, in the previous 20 years 1978 to 1998, a total of 32,523 MMs of rain fell, an average of 1626 MMs per annum. Incredibly, in the period 1969 to 1976, the average annual precipitation was 2116.5 MMs. In fact, the annual precipitation seems to be reducing rather than increasing. [Source: GuySuCo’s records] When we had enough manual labour, we could have a very long cropping period of over 200 days per year, and to give one example, we used to burn sometimes three grinding days of cane when the rain was limiting our ability to burn, since the limiting factor to production was mainly no cane burnt, because even whilst the rain was falling, the workers could cut and load the cane manually.Today, the sad fact is that our workforce has been dwindling since no one wants to do that very onerous task of cutting cane anymore, and we have been struggling to produce even when we are claiming that we are capable of mechanizing the HOWEVER,industry. machines can’t work more than say 75100 days per year in Guyana, our weather will not allow it, and this has affected the industry badly. There is a standard practice in the industry to replant 20% of the cultivation every year so that we won’t have to carry old ratoons. So we expected that our cultivations will comprise plant canes and 4 ratoons. We rarely achieve our planting programmes, because of the rainfall limiting our land preparation opportunity days to 75 days per year. So here is an industry which cannot plough or till its land with machines more than 75 days per year, but are planning to have mechanical harvesting going on for 220 days per year. Even though there is some leeway, the fact is that putting these heavy machines in the fields to harvest and the necessary trailers to collect the cane and take it to the punts, causes so much compaction that after harvesting, one MUST do inter-row TILLAGE to undo the compaction which can result from those operation.
National leaders and Ministers of Health are always happy to tell us about how much they are spending on healthcare, and all the great things they are doing, but the ugly state of the New Amsterdam Hospital (NAH) mocks them, pains us, and inflicts huge humiliations on every citizen, whether they live in Berbice and make use of the NAH services, or reside elsewhere in Guyana. What happened to our sense of pride that there are the terrible conditions at the NAH, and no Guyanese patient, no staff member, no visitor has registered any complaint or disgust? It should not take the foreign IDB to reveal the terribly unhealthy state of different areas at the NAH. Guyanese who go there ought to have been raising a ruckus, sounding loud alarm. We don’t expect anything from leaders and ministers, who should all hang their heads in the toilets that don’t work. Our filth-filled leaders take taxpayers’ money, and leave them existing in filth, but they are building infrastructure from loans and grants, and wherever else they can get money to put their dirty, greedy hands on. We recommend that when their PR departments and camera operators accompany them, they take snapshots of the surgical room walls, and then have the honesty to let all Guyana see the state of the walls. Any and everybody is quick to take pictures of developments on the streets, but when their own health and surroundings are involved, their phones and their minds freeze. The Guyanese people are now so beaten into docility that they take anything that is shoved at them. Local leaders do it, and the foreigners have gotten into the tricking and beating down action, with ExxonMobil’s Country Head, Alistair Routledge, being the latest, with his best ever contract, while his company bleeds Guyana blind. Our leaders, ministers, and governments are sick, but that doesn’t mean that Guyanese have to catch their nasty sicknesses also. They borrow millions upon millions in American dollars for that same hospital, yet the harsh reality is the dreadfulness with which patients go there and have to deal with it when they seek cures. Infrastructure and state of the art facilities and equipment are what Guyanese politicians love to boast about, but there is the biggest hospital in Berbice that makes all of them look like total fools, chronic liars, and the greediest of thieves. How else to explain the millions spent and the miseries that workers and patients going there have to live with? This is after 18 years of neglect, if not more. In this day and age, this is the Age of Oil in this rich country, patients are being treated in the stockroom, almost like animals being attended to by vets. We say ‘almost’ because it is likely that animals could be getting treated in more dignified surroundings than what sick and stressed human patients are now accustomed to at the New Amsterdam Hospital, and its stockroom. If there are real leaders in this country, a Minister of Health with some sense of self-respect, they all should hang their heads in shame. They should all resign from office without a second thought, a moment of hesitation. And if there are Guyanese who still have a conscience and are insulted by what exists in New Amsterdam (and other places), then they would run every man jack of them out of office. When our people, some of them patients or family and friends of patients, fail to be sufficiently enraged, deeply humiliated, by what is going on at NAH, then they are also sick, but don’t know how much. There are some sicknesses that doctors and medicines can’t cure, for we have to do that for ourselves. It is when individuals, communities and a society look deep inside, take stock, and say, we can’t live like this anymore. We refuse to contribute to our own degrading, will no longer inflict pain upon ourselves. We cease coddling the crooks we have for politicians, and we kick them into the garbage can.
ARegards,Thankful Youth
Wednesday August 24, 2022 Kaieteur News PAGE 5
DEAR EDITOR, Samuel Goolsarran should be highly commended for calling the National Assembly and Government to debate and consider the COI report which was submitted to His Excellency President David Granger in May 2016 by Professor Harold Lutchman, Chair of the Commission.Thereport was also circulated to members of the National Assembly for debate and consideration. It is hoped that the Government would not throw away the baby bath water. The nation should be told of the Government’s position on the many recommendations of the CIO in the Public Service report. The Opposition and the Guyana Public Service Union should state clearly their disposition on the many essential independentthatConstitutionaltheirimpartialhighsuitablyconstitutedCommissionadministration.effectiveServiceandandCoderelatedPublicincluding:recommendations,1.TheenactmentofaServiceLawwithRegulationsandaofConducttocreatedevelopaprofessionalpoliticallyneutralPublicwithhighintegrityformanagementand2.ThePublicService(PSC)bealwayswithqualifiedpersonsofintegritytobefairandintheexecutionofdutyinlinewiththeprescriptiontheyexercisejudgementand not be influenced by political and other external considerations and influences. Clearly, the authorities should not appoint members of the Commission who have any conflict of interest. The National Assembly and the Government would have been negligent in the appointment of some members of the current Commission.
3. The Constitution and other laws should be appropriately amended to empower the Public Service Commission (PSC) to appoint permanent secretaries and regional executive officers to remove direct political appointments to Public Service positions.
6. There should be a higher retirement age of 60 and 65 for public servants with corresponding higher Public Service pensions and NIS7.pensions.Thereshould be a highlevel representative Committee to identify, based on merit, candidates to be awarded fellowships and scholarships.8.ThePublic Service compensation system should be reviewed and redesigned within the graded salary structure with the involvement of the GPSU, but not in conflict with their collective bargaining negotiations, and considering pay for performance based on a merit system.
12. The Public Service Ministry, the Public Service Commission, and the Appellate Tribunal should be constituted with professional personnel with high integrity to rebuild trust and confidence in the Guyana Public Service with the private and public sector organisations.The above recommendations are essential for good governance and management of the Public Service, fair employment practices, and developing a professional Public Service to serve the national community fairly. These recommendations also speak to removing conflict of interest at professional and political levels, setting the procedure for finality of public negotiations, and having the National Assembly setting the remuneration of those in the governing
ofinrebuildotherImplementationauthorities.oftheseandrecommendationswillconfidenceandtrustourcountryforthegoodall.
From page 4 follow up and informed me that the application is being processed.Today,August 23, 2022, I received a call from the Teaching Service Commission and was asked if I am still interested in being a teacher to which I responded, “Yes I am.” I was then told of the school that I will be placed at and was told that a representative from the Teaching Service Commission will make contact with me in a few days time. Minister Manickchand, I must say how thankful I am that you read my letter and had your team reach out to me and assist with the entire application process. I sure hope that youths like me would read my letter and endeavour to work hard for what they want. Explore all avenues and options like I did.
Implementing the Public Service COI recommendations
4. All appointments to Public Service positions should be by open internal and external competition to obtain and select the best suitably qualified persons from the job market, based on merit and free from political influences.5.Contract employment of low-level and general staff in the Public Service should end. However, contract employment in the Public Service should be restricted to high-level, professional, scarce skills not available in the Public Service, and for project work. No public servant who retires from the Public Service before attaining 65 years should be re-employed on contract.
A big thank you to Minister...
11. The Public Service Appellate Tribunal should be appointed to adjudicate on disputes with the Public Service Commission.
9. The resumption of collective bargaining in goodfaith encounters at negotiations, forSalariesontherecommendedprocedures,keepingagreedrequireresolveFailureconciliation/mediation.andattheselevelstoissuesindispute,referencetoamutuallyArbitrationTribunalinwiththeexistingORasintheCOI,toNationalAssembly,basedtherecommendationsofaReviewCommissionfinaldetermination.10.ASalaryand Remuneration Commission be established to make recommendations to the National Assembly on remuneration for high-level political and Public Service offices, including the President, Vice-Presidents, Prime Minister, Ministers, Leader of the Opposition, Members of the National Assembly, Permanent Secretaries, CEO’s of Public Corporations, Regional Executive Officers, and Regional Chairpersons.
With thanks and regards, Joshua Singh
But Mr. Haynes apparently could not get past the framing of the conference as “emerging apartheid” - a phrase he says he completely rejects.Previous conferences by Cuffy 250, some addressed by President Granger, were titled: “African Guyanese Revitalization: Restoring the African Guyanese communities as spaces of Education, Culture and Economic Vitality (2014);” “Repositioning African Guyanese for Justice, Recognition and Sustainable Development (2017);” “Positioning African Guyanese villages and communities for the green state economy (2018);” “State of the African Guyanese Villages Forum;” “The Way Forward (2020).” With the PPP now in power, the theme is “Emerging Apartheid.” So, is Cuffy 250 saying under the 33years of the PNC when the PNC took control of the “commanding heights of the economy” under cooperative socialism, our Afro communities made no progress and now suddenly, we are into apartheid?IDPADA-G and associates involved in the Conference must consider whether it is a smart strategy to invoke racism, as that mostly favours the PPP. Anytime our Afro groups frame issues as racial issues, it sends those crossover voters who made them win in 2015 back to their base, and helps the PPP the most. To say that Guyana is an emerging apartheid state is lower than low. Shame on the Cuffy 250 and their allies for choosing such a divisive theme!
PAGE 6 Kaieteur News Wednesday August 24, 2022 I agree with AG, Cuffy 250 proposed forum on “Emerging Apartheid” is reprehensible
DEAR EDITOR, Guyana is the richest country in CARICOM and with massive oil resources, we can all live happily ever after, if we unite as a nation, and realize our motto of “One People, One Nation, One Destiny.” Regrettably, we are a perpetually nation divided, and while the major parties and their associates fight each other, the rapacious oil imperialists ship away the bulk of our wealth, and we live in never-ending persistent poverty. Every race suffers. The poorer class suffers most. The so-called leaders look out for their own aggrandisement, and use us as political fodder. Our politics which seeps into everything has been a poisoned chalice. Instead of fighting together for a bigger pie, we fight about which group seems to be getting most of the crumbs that fall from the oil masters’ tables. Invoking race and racism is self-destructive and hurts us all. Getting millions of dollars from the Government for your cause and turning around and “cussing” them out as “apartheid” is ungrateful and not very smart.
The recent letter by Attorney-General Nandlall, “Forum on ‘emerging apartheid’ is a travesty, breach of the constitution,” (SN, August 20, 2022) has roundly criticised the apparent pro-PNC Cuffy 250 group, a member organization of the International Decade for People of African a speaker at the Conference should attend and explain that he got a huge oil auditing contract (US$751,000) and a license to set up a Merchant Bank in Guyana. He could have shaped the discussion in positive ways, and move the mentality from one of perpetual victimhood to one of strategizing to take advantage of emerging opportunities, versus this nonsense of an “apartheid.”
Dr.Sincerely,JerryJailall
thing.seemsuponintoRoheeElectionplainly“emergingsupports.Day,”addTheyinsteadbadpromiseoneunpardonablecommunitiesCuffyvictimhoodPPPandrecognizedishonest,mischievous,only“emergingcommunities.fairlygrantshomes,scholarships,politicalcommunitiesdiverseensuremakesberace-focusedavailableknowingettingthatlaws.theracialwhichunfoundedApartheid“Resistingconference(IDPADA-G).Assembly-GuyanaDescentTheAGsaidtheframedastheEmergingState,’’is“racistbrew,”maybeencouraginghostilityandviolatingConstitutionandotherUntiltheVPmentionedrace-basedgroupswerehundredsofmillionsspecialgrants,wedidnotsuchgrantsweretoallGuyanesegroups.Truthtold,thePPPGovernmentavaliantefforttoitsprogrammesservepopulations.Theyhavevisitedacrossthespectrum.GOALhouselotsandthevariouscashtoall,hampers,etc.aredistributedacrossallTousethetermapartheid”isnotmalicious,vexatiousanditisoutrightandfailstoanygoodeffortsareasofprogressoftheGovernment.Thisapproachby250doesnotservetheirwell.ThePPP’sbiggest,sin–ahuge–isitsfailuretokeepitstorenegotiatethePNCoilcontracts,butisdefendingthem.havealsorefusedto“Indian”to“ArrivalwhichthePNCButtoaccusethemofapartheid”iswicked.WhennewCommissioner,Mr.saidhewantsGECOMlookliketherestofGuyanadiversity,hewaspouncedbyMr.Tacumawhotothinkthat’sabadDowenotwanttoheal Guyana? Remember GECOM had bypassed the most qualified candidate for the CEO job which was given to Lowenfield. Would you say the civil HaynescountriesPresident“s…holeCARICOM,beingmatter.nationalscorchedthemGovernment,WhenPNCthewantgoboat.boataplaybookassociatesanti-PPP.anti-nationalist,footreputationdisserviceapartheidcountrycommunities.includingbenefitstoforward.unionsAfricanSteal,”“Renegotiationtopicmeaningful,to250electedthatthe“Apartheid,”“NancyGovernment.neglectedWhimbetterannually$210totalcitedEthnic30Governmentalthoughproblemandsecurityagencies/commissions,service/stateforceslackdiversityisakindofapartheid–athePPPneverfixedbeinginfor25ofthepastyears?TheexistenceoftheRelationsCommissionbytheAGhasbeenawasteoftime,andthemilliontheygobbleupcouldbespentpavingourstreetsatthathavebeenbythisInsteadofconcoctingastory”ofthesamewayPNCtellsitssupportersthePPPisnotavalidlyGovernment,Cuffywouldhavedonebetterdiscussthereal,mosturgentinthenation-oftheOilandstrategisehowtheCommunity/PNC/canpushthisstruggleThiswouldhelpusgetabiggerpiethatallcommunities,ourAfroCreatingamyththattheismovingtodoesgreattotheinternationalofthecountry.Weshootourselvesinthewhenwedothat.ThatisnotsimplyCuffy250anditsthatusethesamemustabandonsuchlosingstrategy.AholeintheisaholeinthewholeIftheboatleaks,wealldown.DoesCuffy250Guyanatofail?WhenPPPisinGovernment,thewantsthemtofail.thePNCisinthePPPwantstofail.Bothpartiesuseearthtactics.TheinterestdoesnotThat’swhydespitetherichestcountryinweremainacountry,”asTrumpdescribedlikeours.Perhaps,Mr.Floydwhowasslatedtobe
Kaieteur News PAGE 07WednesdayAugust 24, 2022 BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT BLUNT...BLUNT...BLUNT...BLUNT BLUNT BLUNT BLUNT BLUNT Is the Creator alive? If He is, does He really care about this SouthAmerican nation? While the many machinations exposed daily by this publication would lead many to believe that the single answer to these questions is a resounding NO, this is certainly not the case. Although the Creator may act swift at times, there are other instances that He expects us to have faith, wait patiently and allow Him to make a grand show of His SUPREMACY, for His name must be glorified. Patriotic Guyanese, once you have done all that you can, it is time to be still and see PRE-EMINENCE at its best. Time To Be Still!
contract to do Lot 237 for $23,170,620, VR Construction was awarded Lot 238 for $20,049,200, Amic General Contracting Service was awarded Lot 239 to the tune of $15,276,750, MK Hanif Construction Service was contracted Lot 240 for $20,604,000, Joshi Construction & Establishment was given to execute Lot 241 for $26,505,250, Hoosein Logistics & Supplies Inc. was awarded to complete Lot 242 for $67,271,800, Expert General Contracting Service received the contract for Lot 243 for $70,461,00 and lastly, P. Hariram & Son Contracting will execute the works in Lot 244 to the tune of $26,829,000. It was reported previously that these roads, the Ministry is scheduled to fix, are in dire need of rehabilitation having been in a deplorable state for some time.As reported, these projects will form part of the $15.2 billion that was allocated in this year’s budget for the construction and rehabilitation of urban and community roads across the country.Last year, the government would have spent approximately $8.8 billion to upgrade over 300 miscellaneous roads across the country.
Continuing with this year’s miscellaneous road programme, the Ministry of Public Works is preparing to spend some $334 million to rehabilitate 10 roads in Belle West Housing Scheme, RegionFollowingThree. competitive bidding for the contract to rehabilitate the roads, 10 out of the 33 contractors who had placed bids have been selected to do the job. According to information provided on the National Procurement and Tender Administration Board (NPTAB) office website, the projects were awarded on August 16, last. The NPTAB website states that P. Hariram & Son Contracting, Expert General Contracting Service, Hoosein Logistics & Supplies Inc., Joshi Construction & Establishment, MK Hanif Construction Service, Amic General Contracting Service, VR Construction Inc., Naran Construction, $51,682,500,Lotlots;$361,822,425estimated$334,599,720.contractsSupplyWeeding,Construction,SewkumarcharranDeodatandT.MohanCleaning&GeneralwereawardedthetothetotalsumofTheprojectwhichwastocostsomeisdividedinto10(Lot235toLot244)with235estimatedatLot236estimated at $25,776,000, Lot 237 estimated at $25,776,000, Lot 238 estimated at $21,737,450, Lot 239 estimated at $16,217,575, Lot 240 estimated at $21,578,050, Lot 241 estimated at $27,812,650, Lot 242 estimated at $70,221,500, Lot 243 estimated at $73,149,500, and Lot 244 estimated at $27,871,200.Among the 10 contractors, NPTAB revealed that T. Mohan Weeding, Cleaning & General Supply was given to do Lot 235 for $43,206,000, ConstructionLotConstructionSewkumarcharranDeodatwasawarded236for$21,226,000,Naranwasgiventhe
PAGE 8 Kaieteur News Wednesday August 24, 2022
$334M to rehabilitate 10 roads in Belle West Housing Scheme
When dem boys read dat IDB report about dem hospitals in Guyana, dem boys almost drop dead. But den dem boys remember dat if dem drop dead, dem family gan gat to rush dem to one ah dem same hospital to pronounce dem boys dead. Suh dem boys raise up back from de Demdead.boys praying dat dem nat gat fuh end up in no public hospital. Dat is like a shortcut to de Maker. Dem hospitals nat up to scratch. In fact, one ah dem gat mould in de surgical room. And another one using untreated water!Dem boys does always seh if yuh nah gat money in dis country, yuh cork duck. Yuh gat to use yuh money and guh to private hospital because yuh nah certain about de quality of treatment and care at dem public hospitals.DeIDB want fix de system. But dem bin try before. Dem give money before and it nah mek no difference.
From page 3 them to Vryheid’s Lust, East Coast Demerara. Upon their arrival there, Hudson, Franklyn and Samuels, all armed with hand guns, exited, leaving him and Newyer behind. They approached a white car with its windows down that was parked in front of a taxi base and hijacked it before locking its driver in the trunk.The suspects reportedly got into the stolen car and Hudson drove it off. Hale claimed too that Newyer took over the wheel of Hudson’s car and drove behind the stolen car all the way to ‘B’ Field, Sophia, Greater Georgetown.Whenthey arrived there, Newyer handed over Two carjackers slapped with 13
Hudson’s car to an individual by the name of “Foxy” and together with Hale, he entered the stolen car still being driven by Hudson. The carjackers then proceeded to carry out a robbery spree with the stolen car while the owner was still locked in the However,trunk.their luck ran out after police spotted them and chased them all the way to Mandela Avenue where they were captured eventually in a shootout. According to reports, persons had spotted them committing an armed robbery on Lamaha Street and had tipped off police around 02:59hrs.Hale and Samuels have also reportedly admitted to participating in several other robberies in the Georgetown district and led police to a house in West Ruimveldt where they handed over a 9mm Taurus Pistol without a magazine and a single live 9mmTheammunition.twosuspects then took police to Hudson mother’s house at ‘D’ Field, Sophia where more suspected stolen items were found. Hudson is the fifth suspect still on the run. Police identified the items as four cellular phones, and an HP laptop. Police also found boxes of illegal .32 and 9mm ammunitions along with over 2000 grams of ganja. Hudson’s mom was taken in for questioning and the illegal items were seized.
Dem
charges...
About three weeks ago, the Parliamentary Sectoral Committee on Social Services lauded the state of the Region Six health system. Having paid a visit to a number of health institutions and hospitals in the Region, including the New Amsterdam Regional Hospital, the Committee said it observed improvements. This was certainly not the vote of health which the InterAmerican Development Bank pronounced following its evaluation of the New Amsterdam Regional Hospital. That report which was the subject of a Kaieteur News report of Sunday, pointed to glaring deficiencies.TheIDB assessment was contained in a report dated August 2022, a mere days after the visit by the Parliamentary Sectoral Committee on Social Services. But it was a desktop review, the findings of which are at odds with the committee’s findings. The IDB desktop review found mould on the walls of the surgical rooms and fungus on the external walls of the hospital. And the management, according to the report, claims there has been no maintenance or upgrades since the construction of the building. This could hardly be factual since in May of this year, it was reported that a new maternity unit was due to be completed within two months.TheIDB report also found inadequate space for examination rooms and that the wounds of patient are dressed in a stockroom due to limited space for outpatient care. Kaieteur News reportedly found the public waiting area consisting of wooden benches. The IDB report found a three-bed operating theatre and a two-bed ICU, both of which were deemed inadequate for the catchment which the hospital serves. The report also found that the vacuum/suction system as non-functional. The hospital, it is said, lacks the capacity to do pathology analysis which is done at the GPHC. However, it is not unusual for such services to be outsourced. There are some private hospitals, including in Georgetown, which outsource their pathology analyses.Alitany of other problems was identified including waste management and facilities management. The IDB desk study found no waste management plan. The number of toilets was found to be grossly inadequate for the traffic which flows through the hospital and some were said to be not working. The water used in the hospital was said to be untreated and the laundry inefficient. A number of other problems were identified as part of the assessment done to justify Guyana’s application for a massive loan to improve the New Amsterdam Regional Hospital, the Linden Regional Hospital and the Georgetown Public Hospital Corporation.
Wednesday August 24, 2022 Kaieteur News PAGE 9
boys seh...
The IDB
should not approve this request
The IDB report raises a number of questions concerning the management of the health sector. For one, it calls into question the value obtained in respect to the massive annual Budget appropriations. Each year, we read about the billions which are allocated to the health sector. It is damning that in light of all the hundreds of billions spent, there should be such disconcerting deficiencies uncovered in the IDB report. It is time for a detailed audit of government expenditure on the three hospitals.Second, the report raises serious concerns about the quality of management of our public hospitals and about the quality of the oversight exercised by the Ministry of Health. Why would Guyana have to depend on an IDB study to uncover all these problems? These things should have been discovered and acted upon by the health authorities. A forensic assessment of the management of our public hospitals needs to be taken immediately. Also, an assessment of the oversight exercised by the Ministry of Health needs to be placed under the microscope. But we know that this is not going to happen. The PPP/C is impervious when it comes to demands to investigate its own officials and ministries. Asking the PPP/C to investigate itself is like talking to a wall. The problems which have been identified are basic problems which could have been determined by a simple needs assessment. That it took an IDB study – and a desk one at that – to reveal the glaring deficiencies – is an indictment against our health care management. But the unkindest cut of all is the realisation that all these problems are being found in a system which each year is propped up with tens of billions of taxpayers’ dollars. Where did all the moneyNowgo?Guyana, an oil producing country, is going to have to borrow to fix this system. And the borrowing is to the tune of billions of dollars. The IDB should not be lending this money. Unless there is an overhaul of the healthcare system, it will be a waste of time injecting resources to fix problems which ought to have been fixed as part of routine hospital management. (The views expressed in this article are those of the author and do not necessarily reflect the opinions of this newspaper.)
People frighten fuh get sick in Guyana
Dem boys seh we gat to outsource we management of dem hospitals. De Cubans good at managing hospitals. We should bring dem in and ask dem fuh tek over de entire management of we hospitals. Right now de Cubans helping de Italians. In Italy, dem gat a place call Calabria. Dem short ah doctors. And de Cubans send 500 over deh fuh help dem out. Well, if de Italians can get Cubans fuh help dem out, wah wrong with we? Goat bite we? Talk half, leff half.
Brian Stelter Mr Stelter entered social activism more Ms Isabelle DeCaires, supporter of thehave such a capacity,hosted one of the most than 50 years ago. We the replied to me in this ruling party or thetherefore, they have to bef a m o u s t e l e v i s i o n people have to hold societal newspaper to say as a government. On theaccountable. programmesonCNNnamed, actors accountable The shareholder, she cannot contrary, he is a critic Any senior journalist“ReliableSources.” media and civil society are interferewiththeworkofthe of both. Mr Jonas was that has left the KaieteurHecalledaspadeaspade toopowerfulnottoholdthem editor But isn't this the a guest recently on the News, including Adamand was trenchant in his accountable. problem Mr Stelter is Gildarie Freddie He cited domesticcriticisms of President In those long decades of Harris and Leonard pointing us to? He believes KissoonShowandhewasin violence, alcohol abuse, the Trump.AnewCEOtookover presence in the media and thattheonusisonustohold full rage in his criticism ofGildarie, would tell you traffic madness. This little at CNN and felt Mr. Stelter political activism, I have the media accountable. That both.that the disagreements, statement, coming from the wastooleft-liberal.TheCEO been psychologically also is the task of the As I watched thewhich I have had with the leaderofanoppositionpartyremoved Reliable Sources. lacerated by political actors shareholders of any exchange, I wondered whypublisher of Kaieteur holds tremendous research The CEO said he prefers and media houses not being company. Mr.Jonaswasaskingforthat significance. It exposes theNews, Mr Glenn Lall,moreneutralperspectives. fair and accountable. How I am not a fan of the commitment.What was he sincerity of somehave been countless. I amIn his final appearance, then can they expect to present crop of civil society gettingat?Coulditbethat organisations in which ego-notafraidtorepeatonthislastSunday,hereiswhatMr influencestatepowerinmore organisations Three h e e x p e c t e d t h e tripping has replacedpagethatIthinkitisaboutSteltersaid,“Butit'sgoingto acceptabledirections? negative occurrences stand transparency group to do patrioticcommitment.15 years now, I have notbe on you to hold CNN I have consistently out in my mind about the The third negative iswhat its raison d'êtreaccountable You got to arguedmanymoonsago,and beengivenanincreaseasa existence of certain civil accountability If ancompelledittodo?hold your local paper I still do, that you cannot society groups in Guyana.paidcolumnist. organisation wants stateTheotherisawiseandaccountable; you got to hold accuse the government of The first one is connected toI am not a fan of the powertobeaccountablethene y e r a i s i n gyour local digital outlet being callous and biased prominent OppositionStabroek News. Since the it has to be accountable toopronouncement by Mraccountable. It's on all of us. when you are the very thing politician, Timothy Jonasdeath of its founder, Mr because it purports to speakWe are all members of the you accuse state power of fromtheorganisationnamed RalphRamkarran.David DeCaires, the SN has for the citizenry One media, all helping to make it being. The media and civil ANUG.This year is 2022.strayed millions of miles He suggested to civil organisation replied to mebetter.” society groups are not a Thatwouldbetwoyearsafterfrom what it was under Mr society organisations that and said it has a 12-person
Kaieteur NewsPAGE 10 Monday May 02, 2022 THEFREDDIEKISSOONCOLUMN
The words of Brian
Thishasbeenmysermon horse-cart driver that has no 2020. Yet in 2022, I saw aDeCaires and its journalistic therearemanyareasoflife board but refuses to publishZoom discussion in which in Guyana that need their thenames. Mr Jonasrequestedthehead (The views expressed infocus and they shouldof Transparency Institute this article are those of thelocate their focus thereGuyana Chapter, Mr a u t h o r a n d d o n o tinstead of seeking outFrederick Collins, to declare necessarily reflect thesituations that have sexwith emphasis that there opinionsofthisnewspaper.)appeal.wereattemptstorigthe2020 Stelter will never reverberate in
FrederickKissoon
I think most people since I entered the media 34 integritycanbedebated. elections.power to influence the around the world who watch years ago. But this has also I cannot believe what I Please note:dialectics of Guyana. The CNN will know the name, been my sermon since I saw when one of its owner, Mr Jonas is not amedia and civil society
WednesdayAugust 24, 2022
Guyana
Wednesday August 24, 2022 Kaieteur News PAGE 11
PAGE 12 Kaieteur News Wednesday August 24, 2022
press corps, “Senior officials contradict each other on critical matters, timelines are pushed back without explanation, the government proposes ideas and then scraps them abruptly, and the stench of corruption lingers.”
“There should be no oil block auction until Guyanese are confident the process will not be tainted.” This is the clear position of the Opposition regarding the year-end auction of the remaining oil blocks. On Tuesday, during the A Partnership for National Unity + Alliance For Change (APNU+AFC) press conference, Economist Elson Low argued that Vice President Bharrat Jagdeo should play no role in this process as the People’s Progressive Party (PPP’)s mismanagement of the oil and gas industry begins to stack up. He told members of the Economist Elson Low (left) and Opposition Leader Aubrey Norton addressing the media during Tuesday’s press conference
Low pointed out that it was not too long ago since Jagdeo’s friend and business man Su ZhiRong was heard in a Vice News documentary uttering the words “oil company” in the context of allegedly paying a bribe to the VP. To this end, the activist said, “We called for a halt to the auction of Guyana’s remaining oil blocks, unless an investigation was launched and clear mechanisms to ensure transparency and accountability put in place. We renew those calls now.” He insisted, “There should be no oil block auction until Guyanese are confident the process will not be tainted.” Low, the Economic and Youth Policy Advisor to the Leader of the Opposition, argued that the serious allegations of bribery and corruption levelled against Jagdeo is a clear indication that the official must not be especially involved in the business of oil. “His involvement sends the message that the Ali government condones corruption and is complicit in the alleged illegal activities for which the VP is accused. Only his removal from office and a credible international investigation will change that reality,” he contended. In underlining the importance of the oil and gas sector, the Economist noted that billions of US dollars are at stake, and there must not be any confusion or hiccups during the process. He explained that there were talks of a National Oil Company being setup; however, the idea was subsequently put on pause “with the flimsy excuse given that it would delay oil exploration. Was that not obvious from the beginning? How could the PPP not know that a national oil company would take time and resources to develop?”Lowsaid that if something this obvious was not clear to the administration before, it begs the question of what other basic concepts the party is struggling with. On the other hand, he said it would be prudent for an explanation to be given as to why a decision was made to postpone the auction if the ultimate objective is to speedup oil exploration.“Itis this type of contradictory thinking that permeates their policymaking,” the Economist said. To further elaborate, the Opposition member referenced the differing positions of the Vice President and Head of State, Irfaan Ali on the subject of renegotiation. “Before the 2020 election, we heard that the PPP wanted to renegotiate this PSA. We then heard the opposite, and that instead they would focus on future PSA’s for other oil blocks. Recently, we have Vice President Jagdeo say the Stabroek PSA would in future be asfromtheconfirmedengagement,confusion,”cannotdollarsindustry,President?theisinwouldwhocontradictedrenegotiated.ThiswasimmediatelybythePresident,saidthatnosuchthingbeconsidered.Whattheworldisgoingon?Whoreallyrunningthecountry,PresidentorhisViceIntheoilandgaswherebillionsofUSareatstake,GuyanaaffordsuchLowurged.OnFriday,duringamediaJagdeothatthetimelineforauctionhasbeenmovedSeptembertoyearend,thereareanumberof matters that are still under consideration.TheVicePresident said too, “We have all of the areas potentially that we are gonna put out to auction. We have 3D seismic for some areas; we have 2D seismic for some areas and we have no data for some areas. Before the end of August, we have to make a determination on whether we will pursue the strategic partnership idea or whether we will put out everything to auction or do a combination of both. Also, we have to decide on the blocks – how we want to split these potential areas and what size these blocks should be so we are going to get technical advice on Jagdeothat.”added, “We also have to make a decision on whether we will allow existing oil companies in Guyana, particularly ExxonMobil, to participate in the auction and if so, will there be a limit to the number of blocks one person could have or not. We have to also work swiftly – and this is where we may have some delay because we now need to determine the fiscal terms for the new prospecting licences and this brings me to that very, very contentious issue that we have had in the public domain, which is the fairness of the contract and what the future take for Guyana will be.”The Vice President said the government is trying to put all of this together into a framework that is fair to the investor, so that they get a decent return on their capital while also promoting accelerated exploration.Thedecision on the foregoing is expected this month.
Jagdeo should not be involved in auction of oil blocks - Opposition
Better contract will not increase Guyana’s share without robust auditing, monitoring of oil companies’ expenses
To address this deficiency, Norton explained that robust auditing and monitoring of the companies’ expenses must be instituted. The Leader of the Opposition offered this explanation in response to a question posed the Publisher of Kaieteur News , Mr. Glenn Lall, on the subject of renegotiation.Nortonsaid, “I did say that you have a situation where you have an agreement, you have cost oil and you have profit oil; the point I made was that we’re in a situation where the government hasn’t developed the human resource capability or the institutional capability to be able to monitor and audit cost oil so that expenditure that should not be there, we ensure that they aren’t there, and so I said one of the first things we need to do is to develop our capacity to audit cost oil which will ensure we have profit oil in the amounts that we should have.”
Opposition Leader, Aubrey Norton is of the firm view that a new Production Sharing Agreement (PSA) does not mean Guyana’s share of wealth from the oil and gas resources will be increased, as this will not barricade share.costsExxonMobilcorporationsmultinationalsuchasfromwithdrawingfromthecountry’s
-Norton
“Let’s assume we renegotiate and you have a better deal, but you still don’t have the capacity to audit and monitor, what stops ITEC programme, including
Officers of the Guyana Police Force (GPF), Guyana Defence Force (GDF), Coast Guards, officers and staff of the various government ministries of Guyana and members of the public/private sector. The ITEC programme comprises of offering short term fully funded courses at prestigious institutions of India by the Government (Continued on page 22)
Opposition Leader, Aubrey Norton
Wednesday August 24, 2022 Kaieteur News PAGE 13
On the other hand, he also sought to point out that while Kaieteur News sometimes operate as though oil and gas is all that matters, the Opposition will not turn a blind eye to the other areas that affect its supporters.
PAGE 14 Kaieteur News Wednesday August 24, 2022
Ms. Anuja Reyada Singh (centre) and Dr. KJ Srinivasa, the High Commissioner of India (right)
A Guyanese national, Ms. Anuja Reyada Singh, has been chosen for an ITEC Scholarship to undertake a course on Using Digital And Social Media Marketing For Organisation Growth at the Lovely Professional University, Punjab, India, which will span the period August 24 –September 6, 2022.In a release, the High Commission of India noted that Ms. Singh works with the Government of Guyana, volunteers with Art of Living and the Guyana Zoological Park.During a meeting, High Commissioner H.E. Dr. KJ Srinivasa congratulated and briefed Ms. Singh on the ITEC programme overall and the course.Since May 2022, the High Commission of India in Guyana restarted its on-site training in India, under the Indian Technical and Economic Cooperation (ITEC) programme after a twoyear hiatus due to COVID-19 pandemic.Todate, over 675 Guyanese have undergone training with the (Continued on
Better contract will not...
“While we are prepared to address oil and gas, we will not allow ourselves to be placed with blinders on one issue. We want to look at all the issues that affect the people of Guyana, including the benefits from oil and gas,” Norton said. Presently, a review of approximately US$9.5 billion in bills that were handed to Guyana by oil giant ExxonMobil is undergoing. In May of this year, a contract was signed for a four-month review of the expenses between the years 2018 to The2020.consultancy was awarded to VHE Consulting which is a registered partnership between Ramdihal & Haynes Inc; Eclisar Financial; and Vitality Accounting & Consultancy Inc. The Local Consortium is supported by International firms - SGS and Martindale Consultants, for the ‘Cost Recovery Audit and Validation of the Government of Guyana’s Profit Oil Share’. Natural Resources Minister, Vickram Bharrat at the signing explained that the audit was delayed as the government was trying to ensure local companies undertake the important task even as it pushes for the inclusion of Guyanese in the oil and gas However,sector.hepointed to the fact that the former government did not carry out the important review of the expenses it was billed, hence the belated audits are being conducted. According to him, the government should have been focusing on the 2020 to 2021 audits but must move the process forward. While qualifying the government’s decision to use foreign companies on the review committee, the Minister explained, “The technical company is needed because our local auditors might be very familiar with the auditing (of) basic expenses (such as) fuel, meals, transportation. But when we are talking about jumpers and risers and Christmas trees, FPSO (Floating Production Storage and Offloading vessel) and these technical terms, obviously, they will need that kind of technical knowledge and expertise onboard to assist them to have a thorough exercise beingHedone.”added that there will be new arrangements for future audits even as the government seeks to conduct annual and even biannual cost reviews for ExxonMobil. Previously, Vice President Bharrat Jagdeo said that the country did not have the local capacity to complete the audits.
The Opposition Leader was reluctant to share any additional ways that more wealth could be raked in from the lopsided 2016 deal, stating that “we got to keep some to campaign on.”
From page 13 a multinational corporation from adding costs that were not actually in the particular project,” he added.
page 22)
Norton pointed out that for this same reason, stakeholders have been pressing the need for ringfencing to be introduced. To this end, he explained, “So I am making the point that there are many things we can do to ensure we live by our Constitution. Our Constitution says the people of Guyana must benefit. The law says that and there are a number of things we can do. Renegotiation might be one but there are many other things we can do and like I said at some stage in the near future we will outline a clear position on this issue.”
Guyanese selected for ITEC scholarship in India
$50M well commissioned for
President says size of community irrelevant in ensuring equity of good life 3,500 Wakenaam residents
In excess of 3000 residents of the IslandofWakenaam, Region Three are now the beneficiariesofanimproved water supply, following the drilling of the Noitgedacht welltoservethecommunity According to a Guyana Water Incorporated release, the new $50M well was commissioned by President Irfaan Ali on August 22, 2022atthewellstation. Addressingthegathering during the commissioning, President Ali noted that infrastructure such as this is necessary if Guyana is to continue on the path of development.HesaidWakenaamplays an important part in Guyana’s food production and this new well must be linked to a greater initiative for the community, outside ofdomesticuse. The President stressed that it should lead to the eventual economic prosperityoffamiliesonthe island and help Guyana to tap into the $1 5B internationalfoodmarket. He observed over the past two years that Wakenaam’s agricultural and water sectors have experienced a decline in investments and the realisationofthiswellisjust the beginning of the change theycanexpect. Tothisend,healludedto a US$6.3M water treatment plant that Government has approved for the island.The c o n t r a c t f o r t h e c o m m e n c e m e n t o f construction is expected to beawardednextyear This will tackle the high iron content present in the water and it translates to an improved quality of life and the ‘One Guyana’ that his Government is on a mission to achieve countrywide According to President Ali too,thesizeofacommunity isirrelevantwhenitcomesto ensuring equity of good life forall.Minister of Housing and Water Collin Croal said since assuming office, G o v e r n m e n t h a s c o n s i s t e n t l y a n d significantly increased its capital investment to GWI; with this year’s allocation growing by some $3B from last year This year’s budget is$6.2B,whichtheMinister said caters for increased access to water across Guyana.This, he said, includes therehabilitationofthewells at Fellowship and Vergenoegen, as well as the drilling of 10 new wells in Region3. He congratulated the drilling team at GWI for a job well done, adding that the in house technical capacity will allow GWI to fast track works and deliver inatimelymanner GWI’s CEO Mr Shaik Baksh stated that Monday’s event comes on the heels of thepreviouswellscollapsing dueto Heage.explained that the wellatFreeandEasy,which was 46 years old and the Noitgedacht No.1 well (43 years old) dropped in production due to their age andAccordingneglect.toMr Baksh, the Basic Needs Trust Fund a n d t h e p r e v i o u s Administration had two failed attempts at drilling wells However, when Government took office, consultationswereheldwith the Neighbourhood Democratic Council on the mostsuitablelocationforthe newThewell.CEO boasted that the Noitgedacht No.2 well wasdrilledbyin-housestaff to the tune of G$50M, makingitthefirstwelltobe drilledbyaGWIteamonthe coastin35years. He also noted that the significant increase in level ofservicewasapplaudedby the residents, which saw GWI having to repair leaks alongthenetworkduetothe pressureofthewater Regional Democratic Council Chairman for Region3,Mr SheikAhmad thanked the President for his leadership, which led to the realisation of the new wellThis, he noted, is a significant achievement for theresidents,sincetheyhave been without a consistent w a t e r s u p p l y f o r approximately five to six years.The Noitgedacht #2 (Wakenaam)wasplacedinto operation at the end of January2022allowing3500 residents to enjoy 24 hrs water access and an improvedlevelofservice. This translates to more than 200 percent of the total daily water demand of the islands’residents.Previously, residents received water every three days.The water quality analysis from GWI’s Laboratoryconfirmsthatthe water is consistent with the ground water quality from the aquifer on the island. The design lifecycle of this well is a minimum of 30 years.
-
GWI’s CEO Mr. Shaik Baksh testing the water pressure in the presence of President Irfaan Ali
Kaieteur News PAGE 15WednesdayAugust 24, 2022
TheIDBhighlightedthat the East Bank Demerara Public Road is considered the major artery for goods coming to the coast and of suppliesbeingtransportedto theinteriorThisincludes timber from interior locations; and sand and loam from pits along the Soesdyke-Linden HighwayDueto its economic importance,theGovernment of Guyana, through the Ministry of Public Works –Work Service Group, with funding provided by the I n t e r A m e r i c a n Development Bank, believes upgrades to the EBDPRarecritical. The contractor for the project is expected to be selected in late 2022 and start final design in early 2023. Given the lack of a final design, WSG has started a preliminary assessmentofthenatureand m a g n i t u d e o f t h e displacement impacts on surroundingcommunities.
ccording to theAMinistry of Public Works, consultation will commence todayontheUS$115MEast BankDemeraraPublicRoad (EBDPR) Project Discussionswillkickstartat Golden Grove/Diamond PlaceNDC–GrovePrimary School. The second round will be held tomorrow at Caledonia, Good Success NDC – Friendship Primary while the third will be on Friday at Soesdyke /Huist’ Coverden NDC–St.Mary’s Primary All engagements willbeginat IsummaryAccording17:30hrs.totheprojectpreparedbythenterAmerican
Consultation begins today for US$115M EBD Road Project Sparta Goed Fortuin Better Hope BuxtBuxtBuxtononon Nabaclis Paradise Georgetown Tor Bagotville Canal No.Belle2 WestBelle Golden Grove TimehriSoesdykeSoesdykeSoesdyke Cheddi Jagan International AirportInternationalCheddi AirportInternational InFEugeneEugene.CorreiaternationalInternationalAirportEugeneF.CorreiaInternationalAirport EssequiboIslands West Bank DemeraraBank ConserDemeraravancy Vriesland ParikaParika VergenoegenenoegVen Stewartville Windsor Forest Project Corridor
Development Bank (IDB), Guyanese authorities will upgradea23.5kmstretchof the two lane road from Grove, near the southern outskirts of Georgetown, to Timehri, near the Cheddi Jagan International Airport (CJIA), running along the eastern bank of the DemeraraRiver This road segment traverses both open as well as residential community areasthatareconstrainedfor space on either side of the right-of-wayduetophysical barriers.The corridor, the IDB said, is essential for supporting economic activities as the East Bank Demerara Public Road is widely relied on for the transportationofgoodsfrom the coast, supporting value chains in sectors including manufacturing, food processing, construction, mining,andforestry The Grove to Timehri section specifically, provides essential access to the airport as it is the only road connecting the airport to the capital city, Georgetown.Thisspecific investment operation will be financed through an IDB loan of US$100M from the Bank’s Ordinary Capital (OC), and t h e r e m a i n i n g US$15,000,000 from the local counterpart The proposed disbursement periodforthisprogrammeis fiveTyears.heproject will be executed by the Ministry of Public Works (MPW) through the Works Services Group (WSG) and Guyana Water Incorporated (GWI). T h e W S G i s a multidisciplinary Project Executing Unit (PEU) withintheMPWthathasthe mandate to execute government and donor funded projects in the areas oftransportandseaandriver defences.Thebank was keen to notethatefficientlyworking transport systems provide economic and social opportunities and benefits that result in positive multipliers effects such as better accessibility to markets,employment,social services, enhanced cost and timesavings,lowertheprice for commodities, increased competitiveness, and additionalinvestments.
Kaieteur NewsPAGE 16 WednesdayAugust 24, 2022
Kaieteur News PAGE 17WednesdayAugust 24, 2022
The University of G u y a n a F o u n d a t i o n (UGF) in collaboration with Demerara Distillers Limited (DDL) onThursday,August 18,2022,launchedaSpecial Limited Edition Rum, blendedexclusivelybyDDL inhonourandcelebrationof the University of Guyana’s 60th anniversary at the Black Magenta, Ground Floor of the Georgetown Club.The University of Guyana (UG) was established on October 3, 1963,andthereforebecomes 60onOctober3,2023.There are 60 activities planned for the year running up to UG’s diamondanniversaryandthe year itself. The UGF was launchedinFebruary2022. The Foundation, UG noted in a press release, is intendedtoassistinfunding gaps that exist within the universityandincreatingan endowmentforthefuture. All proceeds from the sale of the world-class rum will go to the UG Foundation. The funds will then be directed towards fourspecificactivitieswhich fallwithinthemandateofthe Foundation and agreed to in collaboration with UG. The Foundation’s funding drive is slated to revolve around these four grand challenges, which have 11 specific objectives. These objectives appearaspriorityinitiatives. These are investing in human capital, creating a g r e e n u n i v e r s i t y, modernising essential systems and services, and accelerating innovation through centres of excellence and research institutes.University of Guyana’s Vice-Chancellor (VC), XI, ProfessorPalomaMohamed Martin, in her remarks, though a non drinker herself, expressed great satisfaction and joy as she uncapped the first bottle of the limited edition rum. She said: “I am accustomed to unboxing books and getting thenewscent.AsIdidsofor the rum, I was quite impressed with the packaginganddesignofthis s p e c i a l e d i t i o n commemorating UG’s 60thAnniversary.”Providinga brief historical background, the VC noted that the late Dr Yesu Persaud, former Chairman of DDL, was also thepatronoftheUGFwhich is an offshoot from one he founded 20 years ago but is now defunct. She told the gathering that Dr Persaud was very passionate about seeing the university develop and moving from strengthtostrength. Prof. Mohamed Martin told the audience that the UGFhasseveralchaptersin various countries working towards creating an Endowment Fund for the UniversityofGuyana,which willgotowardsensuringthat students are provided with the necessary facilities and servicesthatwillallowthem to become the best they can be. The VC pointed out that the funds received from subventions, fees, or gifts are not always predictable; hence the necessary action must be taken to fill the existingProf.gaps.Mohamed Martin pointed out that the Chancellor of UG, Prof. Edward Greene, has set a very ambitious target of US$60 million for the UGF, starting this October when the University will be headingintoits60thyear “TheUS$60Mwillfocus onthebuildingofastate-ofthe art sports facility, to buildanauditoriumthatcan house 700 and more people, to start a scholarship programme to increase staff development and capacity building, to assist in rebuilding the heart of the University–theUGlibraryand several other small infrastructural development projects,” the VC outlined. The VC also thanked the new Chair of DDL, Mr Komal Samaroo, and his staff, including Marketing DirectorShardaVerreenand DDL’sMasterbrewers,who developedtheproduct.
Master Distiller at DDL Group of Companies, Mr Lennox Caleb speaking on behalf of DDL’s Chairman, Mr Samaroo, said, “It was an honour for DDL to play such a significant role to kick off the institution’s UG’s 60th anniversary activities. It is portentous that DDL, through its Diamond Distillery, was able to partner with the University to specially craft this limited edition blend to celebrate the diamond anniversary of the University.”According to the Master Distiller,whenDDLandthe UG Foundation embarked on the partnership for this product, the top minds in DDL, many of whom are graduates of the University, worked diligently on framing the concept, the f o r m u l a t i o n , t h e presentation and every aspect of the special edition rum.“WeatDDLareproudof thisproductionandofferitas a fitting collector’s item for all alumni proud of their University association Indeed,alumnicantoastand sipthisfinestlimited-edition rum, knowing that all proceeds will benefit the Universitythroughdonation totheFoundation,”saidMr Caleb.In a strong marketing pitchforthespecialblended rum, Mr. Caleb urged persons not to hesitate in purchasing the product as it is likely to be sold out in a relatively short space of time. The rum which is speciallypackagedinatube for safe transporting has an outstanding taste and is considered a “must have” souvenir for all visitors and UG Alumni. Caleb gave a masterful description of the blend which was both a lesson in rum development and an insight into the significance and magic of thisspecialblendwhichwas also distilled in the rarest wooden Stihl in the world aged 300 years. For a full description of Caleb’s exposition, use this link: https://drive google com/fil e/d/1Axwfj OV9B6h3ST3
LimitedGuyanaapplaudUG’eventslaunchingSomattie(Acreatedcontributionctastefantasticbelievers…thistofdiscussionseventsthatlaunchFUGFwithtyeardevelopmentdisciplineseGuyana’developmentwGabeUGF?usp=sharingxU8g1Os86PmvSxH0/viewCoConvenerofthe(USAChapter),MrCunje,whocameupiththeideafortheoftherum,positedthathewashonouredtobegivingbacktospremieretertiaryinstitution–theinstitutionthathasproducedthousandsofleadersandsuccessfulxpertsinmultiplearoundtheglobe.Heindicatedthatthetookoverone,ayearinwhichheotallyenjoyedhisworktheFoundationandDDL.CoConvenerofthe(CanadaChapter),MridelHinds,hailedtheashistoricandnoteditisthefirstofmanytocelebratethe60thanniversaryofUG.Hesaid,“IthasbeenoneyearsincewestartedthewithDDL,someuswerenotbelievers,butodayweareallrumlooksandIcan’twaittoit.WeareproudtoelebratethegenerousthatDDLhasforus.”PresidentoftheUGlumniAssociationBerbiceChapter),MsSyrangeapplaudedUGFforsuccessfullythefirstofmanyincommemorationofs60thanniversary“ItheUniversityofFoundationforitsmanyeffortsandDDLfortheirreadiness
Continuedonpage22 UG Foundation, DDL collaborate to launch Special Limited Edition Rum Displaying a bottle of the Special Edition Rum The Special Limited Edition Rum Master Distiller at DDL Group of Companies, Mr. Lennox Caleb University of Guyana’s Vice-Chancellor, XI, Prof. Paloma Mohamed Martin
Kaieteur NewsPAGE 18 WednesdayAugust 24, 2022
Wednesday August 24, 2022 Kaieteur News PAGE 19
PAGE 20 Kaieteur News Wednesday August 24, 2022 On Tuesday, the Ministry of Health reported that within the last 24 hours, it recorded 26 new COVID-19 cases, bringing the total number of confirmed cases in the 26 new COVID-19 cases recorded country to 70,841. The Ministry via its daily dashboard stated too that two patients are still in the COVID-19 Intensive Care Unit, 10 persons are in institutional isolation, 309 are in home isolation and seven are quarantined institutionally. To date, a total of 69,242 persons have recovered from the virus. NGC declares $2.56 billion profit
(TRINIDAD EXPRESS) WHOLLY State-owned natural gas merchant and aggregator, the NGC Group of companies yesterday declared an after-tax profit of $2.56 billion for the financial year ended December 31, 2021, reversing the loss of $2.13 billion the company declared in 2020. NGC more than doubled its revenue in 2021, reporting sales of $23.60 billion compared to $11.41 billion in 2020. The amount of taxes the company paid also more than doubled , increasing to $2.29 billion in 2021 from $1.05 billion in NGC’s2020.board of directors said the group’s revenues and margins benefited from the rebound in commodity prices as the global prices of ammonia, methanol, liquified natural gas (LNG) and natural gas liquids (NGLs), increased by 190 per cent, 92 per cent, 911 per cent and 112 per cent respectively. In a news release yesterday, the group said the positive impact of energy prices on financial performance was further solidified by the continued leveraging of its people, technology and partnerships in delivery of critical operational functions, strengthening its presence along the gas value chain, while continuing the journey towards a sustainable energy future.
Ten police officers have been arrested in Colombia on suspicion of involvement in the killing of three youths. The three were shot dead while in police custody in northern Sucre province on 25 July. A police colonel, the highest-ranking officer suspected in the case, is on the run and thought to be abroad. Prosecutors say the police officers had alleged that the youths were members of the Gulf Clan criminal group that had earlier shot dead a policeman. Colombia has a dark history of “false positives” - cases in which civilians were murdered by the military and passed off as rebels to boost its kill rate. An inquiry found last year that Colombia’s military killed more than 6,400 people between 2002 and 2008 and falsely labelled them as enemy combatants. While the majority of “false positives” occurred during the height of Colombia’s armed conflict with left-wing rebels - and were carried out by the military rather than the police - the case of the three youths has caused alarm. The outgoing head of the country’s police force, General Jorge Luis Vargas, said that any officer found to be responsible would face the full weight of the law.
Wednesday August 24, 2022 Kaieteur News PAGE 21 Colombian police officers held over killing of youths (BBC NEWS)
Driver must be able to assist in workshop Car&Van license ForkliftCall.642-9823.Operator, Delivery Clerk/Sales Clerk /Delivery Clerk. Contact: 227-1511/2272486. VACANCY WANTED Maid to cook & clean for East Bank area call: 615-9132. One clerk for TSI Eccles office.English& Mathematics, Grade1or 2 yahoo.comapplication:techserigy@Emailorcall642-9823.
A fter tying the blissful wedding knot on Sunday, a new bride was on Tuesday widowed and left in a critical state after she and her husband, along with two others, were involved in a car accident at Bath Settlement, West Coast Berbice. The dead man has been identified as 23-year-old overseas Guyanese Beesham Dhoray called ‘Lako’ of Queens, New York, USA. His wife, 23-year-old Viroshni Persaud called ‘Roshni’, resides at Lot 88 Canefield Settlement, Corentyne, East Berbice, This publication understands that the dead man’s cousin, 26year-old Novashkar Sahadeo, also an overseas based Guyanese who ha ils from Susannah Village, Corentyne, Berbice, was the driver of the vehicle. A fourth person, who was in the car, has been identified as Ramona Romatalli of SusannahAccordingVillagetopolice, the accident occurred at approximately 15:30hrs on Tuesday, August 23, 2022, on the Bath Settlement Public Road, West Coast Berbice and involved hire car HC 7356 driven by William Darenne, 57, of Bath Settlement and PTT 7600, driven by Sahadeo.According to reports, HC 7356 was heading east along the northern side of the Bath Public Road and Sahadeo was heading in the same direction behind HC 7356. Sahadeo reportedly tried to overtake the hire car while it was turning south, resulting in his car hitting the hire car’s front side northernwhichthewasSahadeo,bumper.thispublicationinformed,lostcontrolofvehiclehewasdrivinghitametalpoleonthesideoftheroad
exists for Sales Woman,Counter Attendant @Dian's Deli Bar St Kitty.Tel:621-7862.
PAGE 22 Kaieteur News Wednesday August 24, 2022
Vacancy
Husband dead, wife critical after WCB crash
Male697-6015.&Female receptionist 30 years & older. Apply in person @ 12 Henry Street Werk-en-Rust. Call: 225-9211. Farm Workers In Timerhi :6172032 / Experienced617-2047.Barbers, Hair colourist & Nail Technicians.
Sales Person and Babysitter needed.
2pm-10pm).Shell gmai.com.email:Shellramsburg@ProvidenceE.B.D,Station
PROPERTY FOR SALE call: 658-4023. Call: 645-9333. at Campbellville with Staff, salary 3000-3500 per day. Call: 649-7371. Queenstown (Office or Embassy), office for over 50 persons, house with pool. Contact Ray Realty: 627-9685. Specialized fryer.Call:694-9733.filterationpump,stove,treadmill,dryer,machine,pressurerefrigerator,washingrepairs/servicesystem,deepBelAirPark,Subryanville,Peter'sHall,RepublicPark,NandyPark&Diamond.Con-tactRayRealty:627-9685.
2 storey, 4 bedrooms back lot house located in Station Street Kitty. Needs some TCL,
One Honda CRV,fully loaded immaculate condition, low mileage 3.3M negotiable & 1 new super custom Hiace Bus 2.5M .Contact:649-0956. VEHICLE FOR SALE Experienced male Cooks wanted for mining operation.
LAND FOR SALE
FORSERVICESSALEPure
Experienced cashier, cleaner, Labourer and counter person.Apply @ Shanta’s 225 Camp & New Market St. Vacancy exists for Experienced Pharmacy Technicians @ Smart Aid 24hrs Pharmacy Eccles Branch. Call: 613-6610. Farm workers, General cleaners, Maintenance workers, Time keeping/ Tool issuing Clerk needed. Call: 621-6969/ 615-7784. Taxi Drivers ( Hire Car license ) at Princess Taxi Service. Call: 265-7075/ 76 or 616-5419. Seeking Grades 2 & 5 Teachers at The Jos-el Educational Institute. Call: 226-7868/ 6780652.Skilled Masoner, Carpenter, Painters& Labourers to work in Linden. Call: 615-7526, 6029469, 660-6385, 625-7642. Visa Application: U.S.A, Canada & UK; etc.Tel:626-7040.ElderlyWeddingdesign,Advertisements,Graphicsdecorations&grooming:Hair,Nail breed German shepherd pups for sale. Call: 680-1828, 632-9022/ 639-4966. For one washing machine and refrigerator technical Trainee. Whatsapp: 660-8905. Female Cleaner for office. Call: 642-9823/ 645-8443. Experience Serving staff & Kitchen staff needed to work in a Restaurant. Whatsapp : Kitchen609-9893.assistant/ Call: 659-5559. Call: 676-5144. Call: Call: (6am-2pm &
Guyanese selected... From page 13 of India to select partner countries across the world. The High Commission of India urges all Guyanese to seize the opportunity to get themselves trained at some of the most
From page 18 and urgency to collaborate with the University of Guyana to make this achievement a reality,” Ms. Syrange said. The uncapping of the special edition of UG’s 60th anniversary rum was ably chaired by Trustee of the Foundation Mr. George Edwards. It was held at Mia Rahaman’s beautiful Black Magenta Club on Camp Street, Georgetown, and graciously attended by the United States of America Ambassador to Guyana, Ms. Sarah-Ann Lynch, British High Commissioner to Guyana, Dr. Jane Miller, European Union Representative to Guyana, Dr. Fernando Ponz Cantó, and other members of the Diplomatic Corps, UGF Trustees, members of the business community, UG officials, Members of Parliament, well-wishers and staff.The UGF Special Limited Edition for UG’s 60th anniversary can be purchased by order through UG’s Campus Store – call (592) 672-0922, DSL stores around the country and at duty-free shops at the airports at a cost of US$100 dollars or G$22,000 per Forbottle.more information on the UGF, please visit their website at: ugfoundationinc.comhttps:// UG Foundation... before crashing into a concrete fence then coming to aDhoray,halt. his wife, Sahadeo and the fourth person were taken to the Fort Wellington Public Hospital where Dhoray was pronounced dead on arrival. The others have since been transferred to the New Amsterdam Hospital. On Sunday, August 21, 2022, Dhoray and Persaud got married in a Hindu religious ceremony. Dhoray reportedly returned from the USA to tie the knot after months of planning the auspicious day. (Continued on page 24)
649-5005. FOR RENT Bachelors self contained rooms to rent @ 12 Henry Street Werk-en-Rust. Call:Counter225-9211.Clerk living around Ogle, must be honest and responsible. Salary $25-30,000 weekly, informationchanicMustMachinecall:610-3974.Mechanicneeded.haveelectrical&me-knowledge,formorecall:227-8042. Person to manage Hardware store. Call: 264-2524 between 8am- 4:30pm from Mon- Fri. Experienced Counter Servers, Handy Boys, Kitchen Assistant, Roti/Puri cook & Waiters. Apply @ Hack's Halaal. Apartments & Office space for rent, 6 Bedrooms top floor located @ 25 Princess Street Georgetown. Call: 623-1562/Driver612-5296.needed, for more information call: 227-8042. Pump Attendant Cashier,shifts
prestigious universities in India in various sectors. For more information, persons wwworedu.georcontactcangetown@mea.gov.inaccesswebsite.HCIgeorgetown.gov.in
Lathe Operator
The couple on their wedding day
Carmicheal street, Friendship, Garden of Eden, Coldingen, Parfaite Harmony. Contact Ray Realty: 627-9685. Experience Cashier, Cooks, Counter Staff, Office Assistant, Bakers & Cleaners. Apply @ Hot& Spicy Albertown. Call: 225-6255/ Female226-9000.to take care of an elderly male,age 25-40 in Trinidad. 623-2900.Masoners,Skilled18686831528.provided.CallAccommodationsorWhatsAppCarpentersand$8000perday.Call:
Security needed for Interior location with reputable mining company.
Sales Persons & Porters, apply
written Experiencedapplication.Wash Bay
Best Buy Food Supplies
GHKSincerely,Lall Wednesday August 24, 2022 Kaieteur News PAGE 23
DEAR EDITOR, I take stock of our national leadership regime, and come up with a spectacular. One in an Olympic style pole vaulter; the other, a confirmed pole dancer. It is what represents leadership at its best in Guyana, governance in action.The leader that is a pole vaulter is all of that, with hops, skips, and jumps. Into the thin air of truth, accuracy, and the physics of facts, which all bring crashing down to earth. Though some training and conditioning are evident, it is still a hard and heavy fall. Things crumble. Take this utterly lovely business of our new national motto called ‘One Guyana.’ It is really a PPP motto, but because its people say it, push it, are all for it, that automatically makes it the national motto, slogan and all. I like the sound of ‘One Guyana’, but if it is exclusively a Freedom House envisioned and driven ‘One Guyana’ that tells me only one kind of people under that umbrella. I look hard, probe deeply, but there is no place in that oneness for people like me. Yes, I am an outsider in the considerations of those under the tribal tent, but as much as I may be a renegade Indian, a hostile (to use Howard Hawks’ language), they can’t take that away from me. That is, the last part of renegade Indian. So, when there is that last word that holds for those outcasts like me, then the prospects don’t look too good for those beyond the brown circle. The pole vaulter we have for a leader may try to brush that aside, but he can’t hop and skip over this one. Not when his policies and practices leave so many of the electorate out. Not when his beauties about goodies represent who is included, who excluded. These are the high stubborn hurdles that he can’t verbally leap over when he soars with those rhetorical songs of his that he relishes. Point the pole vaulter to the prospects of transparency and accountability, and he is all for investigations. This is the dope that he plants on Guyana, just like the Russians and Chinese do in real competition: conduct sham investigations, unleash kangaroo courts. When some Guyanese speak against those, they are branded as the plots of misfits, deviationists, and seditionists, as imagined by the pole vaulter leader who gets better at such things daily. In his book, centrists, patriots, and independents are regarded as freaks; in the same way that missionaries and vegetarians once were. I recall that the true test of character is to give a man some power, then watch what he becomes. In sum, I see a leader beating his breast in self-congratulation and selfaggrandizement, while beating down those who point to the holes in his trousers, the missing zippers, the threads that come apart. Then, there is the other exemplary Guyanese leader, a skilled pole dancer. He goes around and around, sometimes upside down, while he holds on for dear life. It is of a very clever leader at work, with his efforts to pull the wool over the eyes of Guyanese. He performs these extended ‘talkathons’ to simpletons and skeletons, as he tries to make automatons of them. His stories never have a conclusion, only create more confusion. This is what pole dancing does: it causes chaos in the minds of listeners and watchers. Ask the leader about oil spill insurance and he has no reassurance to give. Push him on renegotiation and he keeps going in circles. The pole on which he holds on to is a greasy one; some of the stuff smears his face, his sweat. Oh, the leader must be given credit for trying very hard, working tirelessly. But it couldn’t be for Guyana; not with Exxon so happy, and Mr. Alistair extolling his Texas Gospel of Guyana’s best contract ever. Dare to squeeze the leader on where he stands on the Chinese, and suddenly he is for the Taiwanese. It took a moment, then I caught on: the accuser is Fukienese or Fujianese, maybe even Cantonese. When questioned about production reports, there is shock, head spinning. It is a symptom of too much pole dancing, sliding on the greasy. Here is the bottomline: pole vaulting and pole dancing are not striptease dancing, but they might as well be, given what these two have done to openness and straightness in this country.
Pole vaulter and pole dancer: a tale of two leaders
Detective Sgt. Dion Bascom
On Monday, Police Sergeant Dion Bascom made his way down to the Guyana Police Force (GPF’)s headquarters at Eve Leary, Georgetown to submit his statement to the Office of Professional Responsibility (OPR) regarding recent allegations he made about a high-profile investigation. The request for his statement came after his lawyer, Nigel Hughes made it known that his client was never asked to be a part of any investigation that has since been launched against him by the BascomOPR.had made accusations against his bosses at the Force’s Criminal Investigation Department (CID), claiming that they were bribed to cover-up the March 2021 murder of Ricardo Fagundes, popularly known as ‘PaperActingShorts’.Commissioner of Police, Clifton Hicken had called Bascom’s allegations unfounded and malicious in nature.He also accused Bascom of breaching the Force’s code of conduct and claimed that Bascom never provided evidence to back-up his
National Communication Network Inc. Supply of studio lighting system - 2022 Ministry of Education Supply and delivery of steel pans and accessories - Unit of Allied Arts, Lot 1- steel pans, Lot 2 - musical instruments.
Husbanddead,wife....
Bascom added that he learnt that Caesar and another investigator had collected a $30M bribe to cover-up the case.Mohamed, Richmond and Caesar have since denied Bascom’s allegations and have threatened to sue him for millions for defamation of character.TheGPF has also joined in to refute Bascom’s claims of an alleged cover-up, calling him a Meanwhile,liar.
PAGE 24 Kaieteur News Wednesday August 24, 2022
During the reading of tenders on Tuesday, it was revealed that six companies have applied for the contract to procure books for the Ministry of Education. It was reported that out of the $74.4 billion that was allocated from this year’s budget towards the education sector, some $1.2 billion was earmarked to procure books. The companies that bid for the contract are A1 Print Shop, E & M Essential
The cars that were involved in the accident
Vice President Dr. Bharrat Jagdeo, while speaking on the matter at a recent press conference, made it clear that although he does not know if Bascom is credible, three businessmen –Ricardo Fagundes aka ‘Paper Shorts’ Roger Khan, Tamesh Jagmohan and Azruddin Mohamed – who have also been linked to the matter will not be allowed to tarnish the reputation of the People’s Progressive Party. If they are found guilty of being a part of any “illegal activities,” he said they will have to face the consequences.President Mohamed Irfaan Ali in weighing in on the matter too said that he is not against Bascom receiving protection as a result of his public allegations and has since asked the Barbadosheadquartered Regional Security System (RSS) to review the ‘Paper Shorts’ probe.Ali’s request comes amidst growing calls for an independent investigation into the murder case and allegations made by Bascom of a massive cover-up.
From page 22
Business Services, Kap Copy Centre, Beyond 2000 Printing Inc., F & H Printing Establishment Inc., and Matts Printing EstabAlsolishment.opened at the National Procurement and Tender Administration Board (NPTAB) office, five firms are vying to supply and deliver agricultural equipment to the Guyana Sugar Corporation. Below are the companies and their bids:
Audit Office of Guyana Supply and delivery of laptops and backup system
(To be continued in next edition) Procurement of books
Sgt. Bascom submits statement to OPR ‘Paper Shorts’ murder… allegations and also failed to submit himself for an investigation.Hickenalso related that the OPR had conducted an investigation against Bascom and submitted a case file with recommendations to the Director of Public Prosecution (DPP) Shalimar Ali Hack, SC, for legal Hughesadvice.had, however, refuted the claim that his client failed to cooperate with the OPR since he was never invited by the OPR to do so. However, on Monday, Hughes told members of the media that the OPR subsequently requested Bascom’s presence and he complied. According to Hughes, they wanted a statement from him and that wasThesubmitted.ongoing back and forth between Bascom and the Force started after he made a Facebook live accusing them of coveringup the findings unearthed in the ‘Paper Shorts’ murder investigation.‘PaperShorts’ was gunned down on March 21, 2021, moments after stepping out of a popular bar on Main Street, Georgetown by two men emerging from the back seat of a white tinted Toyota FielderBascomWagon.had said that, with the use of technology, investigators were able to place Mark Richmond, a security guard with Mohamed’s Enterprise located at Lombard Street, Georgetown, at the crime scene on the night of his murder.Hesaid too that they were also able to establish that Richmond was in contact with prominent businessman, Azruddin Mohamed, when the crime Whenoccurred.thisinformation, along with the corresponding evidence, was presented to his superior – a police superintendant by the name of Mitchell Caesar, no followups were done and no suspect was arrested.
6 companies vying to procure books for Education Ministry
Detective
Wednesday August 24, 2022 Kaieteur News PAGE 25
TGA completes IATA Standard Safety Assessment
In August 2022, Trans Guyana Airways (TGA) completed all required audits and improvements to achieve the IATA Standard Safety Assessment (ISSA) certification. ISSA is the International Air Transport Association (IATA)’s global safety assessment for operators of smaller aircraft. In a release, TGA revealed that Director of Operations, Capt. Andre Farinha, has said that, “Trans Guyana Airways is always endeavouring to raise our safety and operations standards in keeping with the changing landscape of our country.” TGA is one of the two airlines from CARICOM countries on the ISSA registry. ISSA builds on IATA’s internationally recognised IOSA programme. Assessment standards are derived directly from IOSA Standards and Recommended Practices, including elements of the ICAO Safety Management System (SMS). Trans Guyana Airways continuously monitors all safety and operations systems through its Safety/ Quality Assurance Department.TheISSA accreditation was initiated by the former Director of Safety & Quality, Capt. Jonathan Fitt, and was completed by the collective efforts and dedication of the safetyBookingsteam. and inquiries can be taken by TGA’s Commercial Department orcommercial1@transguyana.net592-222-2525,atWhatsApp5926082118.
PAGE 26 Kaieteur News Wednesday August 24, 2022
The eight-time Olympic goldmedallistretiredfrom athletics at the 2017 World Championships inLondon.Hecould only manage bronze in his penultimate race - the men's 100m - before pulling u p injured just as hebeganto hittopspeedathis finalevent,the4x100mrelay When asked if he would consider a return to racing, he replied:"I'veseentoomanypeople retireandcomebackjusttomakeit worse or to shame themselves. I won'tbeoneofthosepeople."
Usain Bolt
Frompage32 honoured to be part of this group establishing everything thatisnecessaryforthegrowth ofsportinGuyanaandfootball taking the front page this time around makes it even better, becausewehavealotofyoung people getting involved in the programme. The Ministry of Educationisalwaysreadyand willing to collaborate with other organisation when it comes to the development of young“It'speople.”fromthese kinds of tournaments that we see our young people moving on to represent Guyana What people fail to realise is that manyoftimestheopportunity isnotalwaysaffordedtous,so thisisactuallywhatweneedto seethosedreamsrealised.” When Joseph made his brief remarks, he commended the organisers for their work whichhashadapositiveeffect on the youths and football fraternity He also mentioned that the choice of format for the tournament is very important in the development ofyouths.Alight word from the representative of the sponsor wasalsosignificant.Thisyear, GuyOil/Tradewind Tankers haspumpedanapproximation of GYD$4.8m into the tournamentwiththeassurance of supporting Petra's cause through this event, which has had two editions before the worldcrisisstruck.
AND TRADEMARK OFFICE
PISCES(Feb.19–Mar.20)
The Assistant Director of Sport disclosed that this tournament adds to the consistency of competitions that are needed to help youths andteamsdevelop.Shefurther commended Petra for making an addition of such in the schoolsystemwhichwillonly auger well for both the youths andsport.
rdPetra launches 3 ... BBC News - Athletics icon Usain Bolt has moved to trademark a logo showing his signaturevictorycelebrationpose. The retired Jamaican sprinter submittedanapplicationintheUS lastHeweek.isknown globally for the move-inwhichheleansbackand gesturestothesky-asheroutinely strucktheposeafterwinninggold medalsandsettingworldrecords.
CANCER(June21–July22)
SCORPIO(Oct.23–Nov.21)
"Given that Bolt is now retired from racing, it m a k e s s e n s e that he would l o o k t o
UsainBoltmovestotrademarksignaturevictorypose
Jeexpandhisbusinessmpire,"oshGerben,a Wa shington DC based trademark lawyer, told the BBC.
TAURUS(Apr.20–May20)
AQUARIUS(Jan.20–Feb.18)
LIBRA(Sept.23–Oct.22) Unfinished job tasks might have you wanting to pitch in and get them done no matter what it takes, Libra. This is likely to earn you a few brownie points with your colleagues but take care that youdon'tstressyourselfout Today you're apt to feel very sensual and passionate, Scorpio. Sexy clothes, racy novels, and romantic movies couldbemoreappealingthan usual.
Mr Bolt still holds the world records for the 100m and 200m, making him the fastest man in historyAccordingtotheUSPatentand Trademark Office, Mr Bolt filed his application for the trademark on17August.Itdepicts"The silhouette of a maninadistinctivepose,withone armbentandpointingtothehead, and the other arm raised and pointingupward". Heintendstousetheimageon itemsincludingclothing,jewellery and shoes, as well as restaurants andsportsbars,thefilingshows.
(Getty (GettyUsainImages)BoltImages)
USAIN
"Th e silhouet te of his victory pose is recognised around the world This trademark registration would enable him to offer the items listed in the a pplication himself, or license the right to use the trademark to third parties," Mr Gerben said. Mr Bolt applied to register a similar trademark 12 years ago, butthishassincelapsedunderUS law
The Usain Bolt logo - BOLT/US PATENT
SAGIT(Nov.22–Dec.21) A powerful desire for a current or potential romantic partnermightcomeoveryou today,Sagittarius.
LEO(July23–Aug.22) A friend you may not have seen for a while could awaken strange new feelings forwhichyou'reunprepared, Leo.Youmayseethisperson as a potential romantic partner
Kaieteur News PAGE 27WednesdayAugust 24, 2022 Wednesday August 24, 2022
Money matters could prove obsessive today, Aquarius, as you might be trying to make an important purchase and need to revise yourbudgetinordertodoso. Todayyoushouldbelooking especially good and feeling particularly passionate and sensual,Pisces.Thisisagreat day to buy new clothes online,asyourfashionsense isprobablyrightontarget.
GEMINI(May21–June20)
CAPRI(Dec.22–Jan.19) A powerful need to reach someone either for business or personal reasons could have you spending a lot of time on the phone that may cometonothing,Capricorn.
VIRGO (Aug. 23–Sept. 22) The formation of a new business partnership might transform your working life, Virgo. The benefits may not appear for a while, so don't quityourdayjob.
ARIES(Mar.21–Apr.19 Your imagination should be flying high today, Aries Words, images, melodies, or whatever your artistic media are probably popping into yourheadfasterthanyoucan keeptrackofthem. Your financial goals are probably on the verge of becomingreality,Taurus,but it might seem as if the few tasks remaining are too monumental to face right nowConversations with a friend whose good sense you trust could open your eyes to new career possibilities, Gemini. You might think about transforming your working life.Strange dreams, insights, or visions could upend your spiritualorientation,Cancer
Kaieteur NewsPAGE 28 WednesdayAugust 24, 2022 Wh e n t h e Essequibo C o a s t Pomeroon Football Association (ECPFA) held its Annual General Meeting (AGM) on Saturday last at the Arabian Atlantic Hotel, located at Henrietta on the Essequibo Coast, Marvin Pearson was elected as the new President, replacing Magzene Stewart who was elected, Secretary The full Executive Committee is as follows: President (Marvin Pearson), First Vice President (Albert Tucker), Second Vice President (Andrew Carter), Third Vice President (Royquinn Fredericks), Secretary (Magzene Stewart), Treasurer (Kofi Bascom), Assistant Secretary/Treasurer (Brandon Allicock) Ordinary Members: Marlon Conway, Devon Hardy, Lerawle Halls, and Benedict W i l l i a m s Six of the seven eligible clubs attended the AGM, namely, Henrietta United, Wa k a p o a U n i t e d , Queenstown FC, Mainstay GoldstarFC,GoodHopeFC, and Tapakuma FC The ECPFA Audited
Marvin Pearson is the new President of the Essequibo Coast Pomeroon FANew Essequibo Coast Pomeroon FA President Mr. Marvin Pearson addresses members following his ascension to the leadership of the Association on Saturday last. last.
r
Frompage31 about winning or losing it's about developing the talent we have and staging tournamentslikethistoshowuswhereweare insportasaCaribbean,”opinedNinvalle. Ninvalle,whostatedthatsomeCountries cannot find two U-16 Boxers, thanked the Ministry of Health for getting the juveniles into the Country.The three teams were expectedinGuyanabytodayandweigh-inis setfortomorrowattheSportsHall. NinvallesaidthatverysoontheGBAwill be sending their five-year plan to the GOA and the Government “With the rules constantlychangingwehadasessionbyatop IABA Referee/ Judge and within a year we should have some 3-star Referee/ Judges,” saidAlsoNinvalle.speaking at 'presser' at La 'France RestaurantandSportsBarinCharlotteStreet between Alexander and Camp Streets, were TechnicalDirectorandHeadCoachTerrence Poole, Assistant Coach Lennox Daniels, Cuban Coach Francisco Hernandez Roldan, Coach Samuel Gittens from the USA and Manger of the 18-member Guyana team, SeonCoachBristol.Daniels said that despite over two years of inactivity due to the Pandemic, the Boxers were 95 percent fit and ready to go, while he reminded that Guyana was the only CountryinRegionthathasaSchoolboysand SchoolGirlsprogrammewhichisbenefitting the Caribbean.Gittens, speaking directly to youngBoxers,whowereallpresent,toldthat theywerearetooyoungtosaytheyaretiredor stressed and urged them to talk less and do more.Bristol said it was an honour to have been appointed Manager of the team which comprisesfightersfromages13to16.
n
Members of the Essequibo Coast Pomeroon FA during Saturday's Annual General Meeting held at the Arabian Atlantic Hotel, Henrietta.
r e
Financial Report was presentedandadoptedbythe members apart from the President's Report which was presented by former President,MagzeneStewart. New President Pearson in taking over the mantle, thankedtheclubsforthehigh levelofconfidencetheyhave reposed in him to lead the ECPFA to bigger and better things.Pearson stated that his tenure would be based on t a s p a n c y a n d strengtheningthestructureof the Association, by extension, the clubs Inpositingthatfootballmust always be the winner, Pearson also noted that he would be working assiduously to improve the technical development of players throughout the A s s o c i a t i o n All clubs present, extended congratulations to the new body whilst pledging that they are committed to working collectively to positiontheECPFAasoneof the best in Guyana Guyana Football Federation (GFF) Member Services Officer,Mr FranklinWilson supervisedSaturday'sAGM.
“It's like having 18 pit bulls in a pen and understanding how to deal with them,” said Bristol who thanked the Media for their support while stressing the importance of Marketing.“IamlookingforwardtoafullSportsHall and I must say thanks to the GBA and its President and all of the Coaches involved in the training camp of 30 before the final 18 wereselected,”addedBristolwhothankedLa 'France Restaurant and Sports Bar for providing high quality meals for the teenagers and Exclusive Barber Shop for the hair-cutsoftheBoxers.TheCubanCoachsaid that in 2015 when he first came here he had said that Guyana has the talent just as Cuba, butforittobedevelopedmanythingshasto bedone.“This (tournament) is another step in the right direction and I thank the GBA and Guyana for making my stay here comfortable,” said Coach Roldan, in much betterEnglishthanwhenhefirstcametothese shoresbutstillwithdistinctSpanishaccent. It was disclosed that only Trinidad is sending a female and while Guyana has female fighters, none are in theTrinidadian's weight category In the interest of giving her some 'Ring Time' an exhibition bout will be arranged.
GBA Head wants more participation from...
Kaieteur News PAGE 29WednesdayAugust 24, 2022
Namilco making positive difference in RHTYSC Cricket - Set to sponsor massive BCB Secondary Schools Coaching Programme
Mr. Bert Sukhai
Guyana Tourism Authority Director Baksh... Frompage33 poisedtobecomeagolfdestinationintheverynearfutureand hostmajortournaments. Formoreinformationonhowyoucanlearnthegameor sharpen your skills, contact the Nexgen Golf Academy via Facebook, Instagram, WhatsApp 645-0944 or visit them at theScoutsAssociationGroundonWoolfordAvenue.
RHTYSC Namilco Thunderbolt First Division Team.
Wh e n t h e N a t i o n a l M i l l i n g Company (Namilco) of Guyana assumed the role of the official sponsor for the Rose Hall Town Youth and Sports Club's (RHTYSC) Men's First Division team in November 2019, it was the company's first major investment in cricket at the locallevel.Overtheyearsthe company was known primarily for making major investments in football and cycling under the leadership of Bert Sukhai, a passionate b e l i e v e r i n t h e transformational power of sports.Namilco was a part sponsoroftheRHTYSCfora while, having sponsored the annual awards ceremony, annual youth magazine, Christmas Village and Say Yes to Education campaign, among other programmes. TheRHTYSCanditscricket teams also successfully hostedaDayofSportsatthe AlbionCommunityCentreas apartofthecompany's50tha n n i v e r s a r y celebrations in May 2019. The club and company formally cemented the officialrelationshiplaterthat year and in November, Namilco replaced Gizmos andGadgetsasthesponsorof the RHTYSC Under21 and First Division teams. Over thelastthreeyears,theteams have won all tournaments organised by the Berbice Cricket Board, including the Busta Champion of Champions, Ivan Madray 20/20, Pepsi 40 overs, Carib Beer 50 Overs and Elizabeth S t y l e s u n d e r 2 1
The team has also produced Kevin Sinclair, who was named to the West Indies 20/20 team and recently to theregionalteamfortheoneday international series versusNewZealand.Kevlon Anderson also successfully representedtheWestIndiesat the Under19 World Cup in Australia where he was one of the leading batsmen Clinton Pestano and Kevin Sinclair also represented the Amazon Warriors in the past while the exciting Junior Sinclair would do so in the 2022edition,beingthefourth RHTYSC member to do so. At the senior level, Pestano andKevinSinclairplayedfor Guyana in the recently concluded Four Day tournament. Anderson, who is rated among the most promising young batsmen in the Caribbean, was selected byCricketWestIndiestobea part of the historic West I n d i e s E m e r g i n g Players Academy Female p l a y e r s S h e m a i n e Campbelle, Shakiba Gajnabi and Sheneeta Grimmond have all played for the West Indies at the international levelwithCampbellescoring twofiftiesinthe2022Female W o r l d C u p AtotalofnineteenRHTYSC members have represented the country at the different levelsin2022aloneorgained selection to regional teams. Jonathan Rampersaud, JermeySandiaandMahendra Gopilall were with the national under19 team in St Vincent, while Sohail Mohamed and Ramzan Koobir are in the national under15team.Abrokenhand prevented Matthew Pottaya from being in the national under17team. With the support of Namilco and several other sponsors, the two teams also hostedthelargestevercricket academyinGuyana.Arecord one hundred and forty-five young people were in attendanceandtheyhavealso established the first ever Kiddies Cricket Academy with dozens of kids between the ages of eight and twelve years.The two Namilco teams under the sponsorship have beeninvolvedinhundredsof personal VpprogrammesAcchealth,headingsunderthreeprogrammesdevelopmentaloverthelastyears.Theseprogrammeshavebeenheldawiderangeofsub-includingcharity,youthdevelopment,education,publicsecurity,oaching,awardsandommunitydevelopmentmongthenumeroushostedweretheopularannualChristmasillage,ChristmasCharity
Programme, Covid Hampers Project, Medical Outreach, Youth Information Booklet, Covid posters and leaflets, senior citizens breakfast programme, Tribute To Teachers, Tribute to Medical Workers, Tribute to Law Enforcement Officers, installment of solar lights across the township, upgrading of the Area Ground, Republic Bank Grade Six Summer Camp and the hosting of the Basil Butcher Trust Fund The Namilco teams spearheadedtheconstruction of three homes for families overthelasttwelvemonthsin their biggest project ever Club Secretary/CEO Hilbert Foster hailed the positive effect that Namilco has had on the two teams and described the company as a truefriendoftheclub,which happenstobetheonlyyouth and sports club in Guyana to haveeverreceivedanational awardfromtheGovernment. Hestatedthatthecompanyis a prime example of how the private sector can make a positive difference in the lives of youths by being a good corporate citizen, their commitment to c o r p o r a t e s o c i a l responsibility and their customerbase. He disclosed that the companywouldberenewing its sponsorship for 2022/2023 very shortly and wouldalsobehandingovera total of thirty-two new pairs of first division coloured uniforms for the upcoming s e a s o n Namilco's Managing Director Bert Sukhai expressed satisfaction with the company's return on its investment over the years. Mr Sukhai noted that the Namilco Thunderbolt under21 first division teams have represented his company's brand with pride, honour, discipline and passionandhiscompanywas very proud to be associated with them He urged membersoftheprivatesector tosupportventureslikethese across the country as they serve to make a positive difference in the lives of our youngpeople.
Betram Ivan Narain
Get ready to vote for the Skyexch 6ixty Fan Ball
The process by viewers can vote for Mystery Fan Ball at the SKYEXCH 6IXTY has been announced.Fanswill be able to choose between four randomly chosen deliveries in the Hero CPL and SKYEXCH 6IXT ChatApp.Theresultofthisvotewill be kept secret until the umpire signals that the Mystery Fan Ballwilltakeplace. The runs scored off this ball will be added to the team's totalasextrasandasaresultwillnotbecreditedtothebatter's score,anditwillnotbeaddedtothebowler'sfigures. YoucandownloadtheHeroCPLandSKYEXCH6IXTY ChatAppbysearchingforCPL6TYChatonyourappstore. ThistechnologyispoweredbySAYTV ChrisWatson,HeroCPL'sHeadofMarketing,said:“No crickettournamenthasbroughtfansclosertotheactionthan theSKYEXCH6IXTYandthisexcitinginnovationwillgive fansrealcontroloverhowthegameunfolds.”le:6ixtylogo
Canada-based Guyanese Betram Ivan Narain has expressed excitement torepresentCanadaattheforthcoming International limited over Over-60 World Cup to be held from September 2-15TinAustralia.heallrounder stated that he would like to make an impression on theworldstage. “I[am]excitedtobeselectedinthe Canadianteamforthisworldcup;Iam really looking forward to it but more importantly I want to help Canada coming out victorious,” Narain, who hails from Essequibo Coast, mentioned.ApartfromNarain,GarvinBudhoo, is the other Guyanese-born in the 17membertravellingsquad. “We have to go out there and play goodcricket;allteamswouldnodoubt embrace the tournament to win; it is obviously a huge tournament and to play there is massive,” the leg-spinner and left handed batsman Narain commented.Theother participating countries are: the hosts, India, South Africa, USA, Sri Lanka, New Zealand, PakistanandaRestoftheWorldXI. Quizzed on how the preparations for this mega event are, Narain responded: “We had a nation-wide tournament to select the national team andbaseonperformancesthesidewas selected; I can say everyone is thrilled to represent this country and I am confident we coming back as the winning unit,” Narain related. He addedthattheyhavebeendoinglotsof netsessionsoverthepastseveralweeks and that has boasted their confidence tremendously All matches will be streamedlive. The teamis set to depart for Down Under Friday Notably, the over-60 CanadaCricketisgovernedbyCricket CanadaMastersCouncil. Canada team reads: Mukesh Narula, Farouk Kirmani (Vice Captain), Rohan Jayasekera, Stephen Williams, Philip Navaratne, Daniel Seiwdass, Shameen Baksh, Betram Narain, Eugene Soanes, Garvin Budhoo, Kariti Patel, Ian Justin, Horace Giles, Krishna Ramnarace, Kenneth Robertson, Wilson Seenathsingh,MohammedRameez. Akshay Pandya (Manager), Parmeet Risum (Physiotherapist) and NazeemBacchus(Scorer).
Narin “excited” with Canada selection for upcoming Over-60 World Cup in Australia
Kaieteur NewsPAGE 30 WednesdayAugust 24, 2022
The youths watch boxing yesterday. (Sean Devers photo)
Kaieteur News PAGE 31WednesdayAugust 24, 2022
GBA Head wants more participation from other Nations
BySeanDevers
The Boxers screams their team motto yesterday. (Sean Devers Photo)
Winfield Braithwaite C'bean Schoolboys
“I want to see more participationfrommoreoftheother Islandssincethistournamentisthe Nursery of Boxing in the Caribbean. If we don't produce more U-16 Boxers then it will be harder to find Boxers who could win medals at International Events,” lamented Ninvalle, who alsoGuyana'sDirectorofSports. NinvalleurgedmorePresidents to try and cultivate a good crop of under-16 pugilists for the future of Caribbean Boxing to remain strong “Too many times, Administrators take up positions and don't do any work. Some Administrators needs to do much more for the sport to progress throughouttheRegion. Guyana have a strong Boxing structure because of the hard work we (GBA) do while only a few otherPresidentsworkhardenough to find U-16 Boxers to come here and for that we must (GBA) must giveourselvesapatontheback. AsIsaidbeforethisisnotonly (Continuedonpage28)
C/Ships Aug 26-28
The three-night Winfield Braithwaite Caribbean Schoolboys and Juniors Boxing Championships will commence at the Cliff Anderson SportsHallonFridayandPresident of the GBA Steve Ninvalle wants more participation from the other Islands.Trinidad & Tobago, Bahamas andStLuciaalonghostGuyanaare the Countries participating in the fifth such event which began in Guyanain2016. This is the only tournament for U-16 Boxers in the Caribbean and the bouts are scheduled to commenceat6PMeachevening.
e
mely the victor
h e P e t r a organization
t u r e t h e e i g h t
hristianburg
“So it is only fitting to express our gratitude to the Executives at GuyOil and their partner for such an investment in our human capitalandevenmoretothe development of football, especially at the school level,”Mendoncaadded. Braithwaitestated,“I'm (Continuedon
Tcontinuestopress theimportanceoftheir2022 programme with the official rdlaunch of the 3 edition of the GuyOil/Trandewind Tankers sponsored Schools Under-18 Football League, onTuesdayThistournament will f a quarterfinalists of the recently concluded Petra organised, Milo Schools U18 Football Tournament, na C / Secondary, Cummings Lodge, Dolphin, North Ruimveldt, President's College, West Ruimveldt, G
Wismar
Petra launches edition of GuyOil/Tradewind Tankers U-18 Football League
Kaieteur NewsPAGE 32 WednesdayAugust 24, 2022
3
olden Grove and
Friendship.Thechampion of this tournament along with the runnerupwillautomatically qualify for Petra's KFC Goodwill Football Tournament which will compriseofsixteams.Those two top finishers will compete against a field of 2 Hinterland teams and 2 foreignAdditionallyteams., the spoils f o r t h e 2 0 2 2 GuyOil/Tradewind Tankers are in kind to the tune of $500,000 for the winner, $300,000 for the runner up, $200,000 for the third place finisher and $100,000 for fourth. Individual prizes includeHighestGoalScorer, Most Valuable Player, Best Goalkeeper and Most DisciplinedTeam. Meanwhile, GuyOil's Green Office was the location which hosted the simple event that was attended by Directors of Petra, Troy Mendonca and Marlan Cole, Berkeley McCalman GuyOil Representative, Melissa Dow-Richardson–Assistant Director of Sport and Kurt Braithwaite Head of Physical Education Department in the Ministry of Education.In Mendonca's briefremarks,heannounced thattheeventisscheduledto commenceonSeptember18 andwillrununtilNovember 6, with all matches being played at the Ministry of Education Ground on CarifestaAvenue.Mendoncasaid, “We are proud and happy that even after two years, GuyOil and its partner, Tradewind Tankers, have delivered to the football fraternity a sponsorship that will only enhance the sport The League format of the tournament is most important and critical competition in any football calendaranditformspartof a complete structure that we at Petra and hopefully in collaboration with the Ministry of Education and the Ministry of Sport and GuyanaFootballFederation, hope to deliver a solid schools football programme inthenearfeature.”
GuyOil's GuyOil'sMcCalmanBerkeleymakesapointduringthelaunchofthetournamentatGreenOffice.GuyOil'sGreenOffice.GuyOil'sBerkeleyMcCalmanmakesapointduringthelaunchofthetournamentatGuyOil'sGreenOffice.
page27) rd
The Petra organised
Participants of the camp going through their paces.
ExxonMobil Boys U-14 Schools Football Tournament…
Guyana Tourism Authority Director Baksh commits support for Nexgen Golf and GGA
Round-of-16 kicks off today
Part of the action on Saturday in the Boys Division of the ExxonMobil and Pepsi sponsored U-14 Football Tournament at the Ministry of Education Ground. the Director of the Guyana Tourism Authority (GTA) Mr Kamrul Baksh and several members of his team took time out on Monday to visit the Nexgen GolFun Camp being hosted by the Guyana Golf Association at Scout Association Ground on Woolford Avenue. In addition to speaking with the youths, parents and coaches, Mr Baksh and staff were given their first golf lesson by Head Coach Aleem Hussain and they proved to possessnaturaltalentforthegame. Director Baksh told the audience, "This is a fantastic opportunity for everyone to be involvedwithandtheGTApledges its support for ongoing programmessuchasthisbecauseit fits our development plans for sportsandtourisminGuyana.What theGGAandNexgenGolfhasdone to bring awareness to the game of golf is amazing, considering the short time in which it has been accomplished and we will be here tosupporttheirlong-termefforts."
ExxonMobil Boys Under 14 Football Tournament enters its round-of-16 stage today at the MinistryofEducationGroundwith eightmatchesonthecard. Action gets underway at 14:00 hrsforthetournamentwhichisalso sponsoredbyPepsi.Inthefirsttwo matches that will be run simultaneously, Dolphin Secondary will meet St. Winefride Secondary, while Lodge Secondary will tackle East Ruimveldt.Onehour later, the battles continue with another two matches as New Central High takeonPatentiaSecondarywhile St.John'sBoscoBoysOrphanage goheadtoheadwithAnn'sGrove SecondaryAt16:00 hrs, West Ruimveldt Secondary lock horns with Westminster Secondary while Cummings Lodge Secondary engage battle with Tucville SecondaryThefinal two matches of the daykickofffrom17:00hrsandwill see Charlestown Secondary and Freeburg play on pitch one while NewCampbellvilleSecondaryand Ruimveldt occupy the other pitch, all with hopes of advancing to the nextNoround.matchesfromtheGirlsU-14 edition of the tournament will be contestedtoday
(Continued on page 29)
Mr Baksh went on to speak about the benefits that golf can bring to Guyana since it's a sport thatattractsmillionsofplayerswho arewillingtospendtopdollarfora great golf experience, "With all of the world's attention focused on us and dozens of hotels under construction, I am happy that Mr Hussainandhisteamisfocusingon the development of facilities that will host worldclass golf events. This will provide our current expats, re-migrants and tourists with courses to play, thereby creatingjobsandrevenuesforlocal partners."Healso commented on the talent he had seen in Guyana, "FromtheshorttimeI'vebeenable to observe the players, I'm amazed at the potential I've seen from persons who have never touched a club before. This is an untapped source of talent that will make an impactinthegolfworld,especially with our support and training from these talented Nexgen Golf coaches."President of the GGA Aleem Hussain thanked the GTADirector whilst stating that without the massive support from numerous sponsorsandthecoachingteamfor Golf, Archery, Table Tennis, Physical Fitness and Self Defence, Drone Training and massages for the parents whilst the children learnt,theGolFunCampcouldnot havebeenassuccessfulinthethird yearOver the past 18 months, Golf has gained national attention in Guyana through the sole efforts of the Guyana Golf Association and Nexgen Golf Academy in partnership with the Ministry of Education Allied Arts Unit Thousands of learners and their families are now involved in the sport with over 100 students making history this year as they choose Golf as a PE elective at CSEC.The Guyana government has emphasized its commitment to physical education and allocated enormous resources in the 2022 budget for the Development of sport and facilities. With record breaking numbers taking part in Golf,itisanticipatedthatanational team, and quite possibly an Olympicteamisinthecardsforthe countryintheverynearfuture. Also, with new emphasis on constructionofgolfcoursessuchas MaraikoBayResorts,NexgenWest Side Golf Club, along with other facilities around the country, it is expected that with the influx of expatsandtourism,Guyanais
Kaieteur News PAGE 33WednesdayAugust 24, 2022
PrintedandpublishedbyNationalMedia&PublishingCompanyLtd.,24SaffonStreet,Charlestown,Georgetown.Tel:225-8458,225-8465,225-8491orFax:225-8473/226-8210. rdPetra launches 3 edition of GuyOil/Tradewind Tankers U-18 Football League Petra Director, Troy Mendonca (left) receives the sponsorship cheque from GuyOil/Tradewind Tankers' representative, Berkeley McCalman (right) in the presence of members from the GFF, National Sports Commission and Ministry of Education. WinfieldBraithwaite C'bean SchoolboysC/ShipsAug26-28WinfieldBraithwaiteC'beanSchoolboysC/ShipsAug26-28 Officials and Boxers at yesterday's Press briefing at the La' France Restaurant & Bar. (Sean Devers photo) Sports GBA Head wants more participation from other Nations
