Issuu on Google+


CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 3


BEAT MAGAZINE PAGE 4

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 5


G O L D E N GI NLCOL UBD EI N速G N O M I N A T I O N S MUU S IC M I C A L OR O R C OOM M E DY

Frequent coarse language and mature themes

BEAT MAGAZINE PAGE 6

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


THE TEELLEEG TH GR RAP A H

EMPI EM MPPIIRE R

TH TH HEE SU UND NDAAYY TIMES NDAY IM MES E

PPet Pe eter e Tra Traver veerrs, s, Ro Ro lin Rol lin ing Ston Sttonne

Pet Pet eter e Tra er Traavver Tr veeerrs, s, Rol Rolllin Ro iinng Stonne

Inside In Ins ide delle de elle lleewyn wyyn w yndavism dav dav avism ismovi s ov sm oviee.c ovi e..ccom. coom. om m au au

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 7


SATURDAY THE 18TH OF JANUARY 9PM

FOXT X ROT LAURA PALMER L THE SHADOW LEAGUE JOSH MANN (PAPER ARMS)

X

QV

RW

%U

HO

4PM - IN THE BEER GARDEN

ZLFN+

WEDNESDAY THE 15TH OF JANUARY 8PM

THE BRUNSWICK HOTEL’S OPEN MIC WITH YOUR HOST BRODIE REGISTER R FROM 7PM ONWARDS TIMESLOT RAFFLE IS DRAWN R OUT AT 7:30PM! GET IN EARLY TO ENSURE YOU GET A SPOT!

$10 JUGS OF BOAGS DRAUGHT ALL NIGHT (FOR THOSE NEEDING LIQUID COURAGE...) THURSDAY THE 16TH OF JANUARY 8PM TILL 1AM $3 SCHOONERS OF BOAGS DRAUGHT R $5 BASIC SPIRITS

TERRIBLE LIZARD GUESTS EMPRESS CHILD THE CREEPING BAM FRIDAY THE 17TH OF JANUARY 9PM

TOMCAT A LUCA BLISS 3 MILE FIELD POSITIVE ENERGY

Brunswick Hotel

BEAT MAGAZINE PAGE 8

THE BRUNNY BUNCH! FEATURING: GROM FA FAWKNER AMISTAT HUDSON AND TROOP JAMES MACKEY BROOKE TAYLOR T RICHY MCKAY K JAMES DOBSON LEAIGH BACCHETTI SUNDAY THE 19TH OF JANUARY 8PM

DIGITAL T ORDER (WA ( A) LEEZ LIDO BOMBAY B SCARLETT MONDAY THE 20TH OF JANUARY 8PM

“LET’S GET T FUNNY AT THE BRUNNY” FREE COMEDY WITH FEATURE PERFORMERS EVERY R WEEK!

$10 JUGS OF BOAGS DRAUGHT ALL NIGHT TUESDAY THE 21ST OF JANUARY 8PM

THE BRUNSWICK HOTEL DISCOVERY NIGHT GIVING CHANCES TO UP P AND COMING LOCAL TALENT! THIS WEEK: C CANARY FLYING SAUCER S TERROR

140 SYDNEY RD, BRUNSWICK

6$785'$<-$18$5<30

7+(%/$&.(<(' 686$1675,2

%$/0<6800(51,*+767+(75($&/( 721(62)52%61$56.,7+(0$-(67< 2)7+(686$16u&28175,),('$/7 52&.6281'$1'621*67+$7(0%(' 7+(06(/9(6,1<285628/)520 602.,1u-2+11<&$6+72722 +2772029(722+27727+,1. &20()257+()285*,*5,'($1' 6(77/(,1)256800(5$5926:,7+ 7+(/(*(1'$5<%/$&.(<('686$16

30

75$&<0&1(,/

&$1$',$16,1*(5621*:5,7(5 75$&<0&1(,/'(/,9(5652&.,1u $/7&28175<25,*,1$/6,1&/8',1* 1(:6,1*/(7227+72$675,1*y /86+$1'/28'$1'+($9,/<67((3(' ,13236(16,%,/,7<

681'$<-$18$5<30

&,6&2&$(6$5

&,6&2&$(6$5,6:+$7+$33(16 :+(1/29(562)%/8(6628/ 9,17$*(52&.$1'$/7&28175<*(7 72*(7+(5y6/<$1'7+()$0,/< 6721(0((77+(52//,1*6721(6

www.brunswickhotel.net

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


Become a Graphic Designer A world class design education needn’t take forever… At Shillington it takes just 3 months full-time or 1 year part-time. The Shillington Graphic Design Course is well planned, continually adapted to the times and taught by passionate industry professionals in an inspirational studio environment. Starting with no prior experience our students graduate with an outstanding portfolio of work and an exceptional knowledge of design theory and industry software, making the transition to working in a real life studio as streamlined as possible. FIND OUT MORE AT OUR INFO SESSION ON THURSDAY 16TH JANUARY AT 6PM. SHILLINGTONCOLLEGE.COM.AU

College of graphic design shillingtoncollege.com.au F shillington.fb T @shillington_ SYDNEY • MELBOURNE • BRISBANE LONDON • MANCHESTER • NEW YORK

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 9


G RIN

MIE PRE RY

RUA FEB 4TH BEAT MAGAZINE PAGE 10

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


IN CELEBRATION OF 125 YEARS OF WINEMAKING

PRESENTS

LOON LAKE OWL EYES TOM KLINE

BEC & SEBASTIAN

MAYFIELD

YOUR MUSIC RADAR (DJ)

BROWN BROTHERS MILAWA WINERY FEBRUARY 15 2014

GATES OPEN 11.30AM. TICKETS: $85 (INCL. SOUVENIR WINE GLASS). TICKETS AVAILABLE FROM THE EVENTBRITE WEBSITE www.eventbrite.com.au/e/ямБrst-crush-festival-at-brown-brothers-tickets-9451195781 WINE, BEER AND OTHER BEVERAGES AVAILABLE THROUGHOUT THE DAY. NO BYO ALCOHOL. COMPLIMENTARY SHUTTLE SERVICE TO AND FROM WANGARATTA. PLEASE SEE BROWNBROTHERS.COM.AU/FIRSTCRUSHFESTIVAL FOR TRANSPORT OPTIONS AND FESTIVAL INFORMATION OR CALL BROWN BROTHERS: +61 (3) 5720 5500

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 11


IN THIS ISSUE

14

HOT TALK

18

TOURING

20

THE ORB

22

WHAT’S ON, BATTLE OF THE SEXES

23

ART OF THE CITY, THE COMIC STRIP

24

CHRIS THILE, CHRIS WILSON, ROTTING CHRIST

29

UNKNOWN MORTAL ORCHESTRA, WARPAINT

THE DILLINGER ESCAPE PLAN page 42

UNKNOWN MORTAL ORCHESTRA page 29

30

INDUSTRIAL STRENGTH

39

THE HIVES

40

BEADY EYE, COSMIC PSYCHOS

42

THE DILLINGER ESCAPE PLAN, MAYDAY PARADE, CLUTCH

43

CORE/CRUNCH!

44

MUSIC NEWS

50

ALBUM OF THE WEEK, SINGLES, CHARTS

CHRIS WILSON page 24 3 NEWTON STREET RICHMOND, VICTORIA 3121 Phone: (03) 9428 3600 Fax: (03) 9428 3611 email: info@beat.com.au www.beat.com.au BEAT MAGAZINE EMAIL ADDRESSES: (no large attachments please): Gig Guide: online at beat.com.au email gigguide@beat.com.au - it’s free! Club Listings: online at beat.com.au email clubguide@beat.com.au - it’s free! Music News Items: music@beat.com.au Artwork: art@beat.com.au Beat Classifieds 33c a word: classifieds@beat.com.au

BEADY EYE page 40 PUBLISHER: Furst Media Pty Ltd. MUSIC EDITOR: Ali Hawken ARTS EDITOR / ASSOCIATE MUSIC EDITOR: Tyson Wray INTERNS: Dina Amin, Mimi Velevska, James Nicoli MANAGING DIRECTOR, FURST MEDIA: Patrick Carr BEAT PRODUCTION MANAGER: Gill Tucker GRAPHIC DESIGNERS: Gill Tucker, Patrick O’Brien, Ruby Furst COVER ART: Gill Tucker ADVERTISING: Ali Hawken (Music: Bands/Tours/Record Labels) ali@beat.com.au Ash Bartlett (Beats/Beat/Arts/Education/Ad Agency) ash@beat.com.au Aleksei Plinte (Backstage/ Musical Equipment) mixdown@beat.com.au Thom Parry (Hospitality/Bars) thom@beat.com.au Kris Furst (beat.com.au) kris@furstmedia.com.au Dan Watt (Indie Bands/Special Features) dan@beat.com.au CLASSIFIEDS: classifieds@beat.com.au GIG GUIDE SUBMISSIONS: now online at www.beat.com.au or bands email gigguide@beat.com.au ELECTRONIC EDITOR - BEAT ONLINE: Tyson Wray: tyson@beat.com.au

BEAT MAGAZINE PAGE 12

51

ALBUMS

52

GIG GUIDE

56

BACKSTAGE / THE LOCAL

58

LIVE

CHRIS THILE page 24 ACCOUNTANT: accountant@furstmedia.com.au ADMINISTRATION CO-ORDINATOR: Lizzie Dynon: reception@furstmedia.com.au ACCOUNTS RECEIVABLE: Luke Forester: accounts@furstmedia.com.au RECEPTION: reception@furstmedia.com.au DISTRIBUTION: distribution@beat.com.au Free Every Wednesday to over 1,850 places including convenience stores, newsagents, ticket outlets, shopping centres, community youth & welfare outlets, clubs, hotels, venues, record, music and video shops, boutiques, retailers, bars, restaurants, cafes, bookstores, hairdressers, recording studios, cinemas, theatres, galleries, universities and colleges. Wanna get BEAT? Email distribution@beat.com.au DEADLINES Editorial Copy accepted no later than 5pm Thursday before publication for Club listings, Arts, Gig Guide etc. Advertising Copy accepted no later than 12pm Monday before publication. Print ready art by 2pm Monday. Deadlines are strictly adhered to. CONTRIBUTING PHOTOGRAPHERS: Mary Boukouvalas, Ben Clement, Ben Gunzburg, Rebecca Houlden, Nick Irving, Anna Kanci, Cassandra Kiely, Charles Newbury, Richard Sharman, Tony Proudfoot. SPECIAL PROJECTS EDITOR: Christie Eliezer

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV

SENIOR CONTRIBUTORS: Patrick Emery COLUMNISTS: Emily Kelly, Peter Hodgson, Lachlan Kanoniuk CONTRIBUTORS: Mitch Alexander, Siobhan Argent, Bella ArnottHoare, Thomas Bailey, Graham Blackley, Chris Bright, Joanne Brookfield, Avrille Bylock-Collard, Rose Callaghan, Kim Croxford, Dave Dawson, John Donaldson, Alexandra Duguid, Alasdair Duncan, Cam Ewart, Callum Fitzpatrick, Jack Franklin, Chris Girdler, Megan Hanson, Chris Harms, Andrew Hickey, Nick Hilton, Peter Hodgson, Lachlan Kanoniuk, Cassandra Kiely, Joshua Kloke, Nick Mason, Krystal Maynard, Miki McLay, Jeremy Millar, James Nicoli, Oliver Pelling, Matt Panag, Jack Parsons, Sasha Petrova, Liam Pieper, Steve Phillips, Zoe Radas, Adam Robertshaw, Joanna Robin, Leigh Salter, Side Man, Jeremy Sheaffe, Sisqo Taras, Kelly Theobald, Tamara Vogl, Dan Watt, Katie Weiss, Krissi Weiss, Rod Whitfield, Jen Wilson, Tyson Wray, Simone Ziada, Bronius Zumeris. © 2013 Furst Media Pty Ltd. No part may be reproduced without the consent of the copyright holder.


CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 13


HOT TALK

THE BIGGEST IN INTERNATIONAL & NATIONAL NEWS

For all the latest news check out beat.com.au

THE HOLIDAYS Sydney indie-pop outfit The Holidays have announced that they will embark on a tour in support of their forthcoming sophomore LP Real Feel, due out in February. Created over the course of two years and countless locations, the album is described by lead singer Simon Jones as “a travelogue of the last few years.” Real Feel is the follow up to The Holidays’ debut Post Paradise, which won the Red Bull Award for Best Debut as part of 2011’s Australian Music Prize. The Holidays will hit the Corner Hotel on Thursday March 20. Tickets go on sale at 9am on Wednesday January 15 from the venue’s website.

GANG OF FOUR In celebration of the 35th anniversary of their album Entertainment!, post-punk outfit Gang of Four have revealed that they will tour Australia, performing the influential LP in full. An enthralling combination of punk, funk and rock, Entertainment! played a radical role in ushering the post-punk era, an era that Gang of Four have been credited with pioneering. Catch Gang of Four at the Corner Hotel on Wednesday March 19.

THE DEAD DAISIES

AWME 2014

Australia will have the chance to welcome back one of their hottest musical exports in years when The Dead Daisies kick off a series of shows supporting the February 7 release of their anticipated debut self-titled album. The line-up for the Australian dates will feature Jon Stevens (INXS/Noiseworks), David Lowy (Red Phoenix/ Mink), Richard Fortus (Guns N’ Roses/Psychedelic Furs), Dizzy Reed (Guns N’ Roses/Hookers & Blow), Marco Mendoza (Thin Lizzy/Whitesnake) and newcomer to the band, John Tempesta (The Cult/Rob Zombie). Off the back of a whirlwind year which saw the group tour with Aerosmith, headline a stage across North America on the 25 date Rockstar Energy UPROAR Festival alongside Alice in Chains and Jane’s Addiction, and play sell out shows throughout the UK & Israel, The Dead Daisies are set to play a series of dates across the country. Don’t miss them when they stop in at the Yarra Valley to perform at Day On The Green on Saturday February 15 and then follow it up with a show at the Espy on Sunday February 16. Tickets and info available from the venue’s website.      

Missed out on applications to the Australian World Music Expo last year? You need not worry, applications for the 7th edition have just opened and are looking for roots artists like you. Hosted over four days, AWME helps new and old artists pioneer new relationships with music industry representations, including informative workshops and insightful seminars. This year, the AWME are expecting over approximately 500 local and international high-profile music agents, including representatives from music festivals, record labels, booking agencies and arts organisations. Previous artists who’ve performed at AWME include Melbourne Ska Orchestra, Ngaiire, The Twin Beats, The Bombay Royale, Graveyard Train and Barefoot Divas. To apply, interested artists must meet the AWME criteria and be fully available from Thursday November 20 – Sunday November 23. If this sounds like you, why not head over to AWME and apply today. Full terms and conditions of applications can be found through awme.com.au.

LIOR On Friday March 7 acclaimed Australian singer-songwriter Lior will release his fourth studio album  Scattered Reflections; a collection of songs written during and inspired by recent travels.  Ahead of the album release, Lior will further explore the art of travel with his extensive Scattered Reflections Tour 2014. See Lior take the stage when he plays the Corner Hotel on Friday March 28. Tickets on sale now and available from cornerhotel.com.

PIGEON Brisbane electro-pop outfit Pigeon have unveiled a string of shows in support of their forthcoming sophomore EP Settle In. Due out later this month, the EP’s first two singles, Curtain Call and Two Moon Love exhibit the five piece’s penchant for brass, raw piano, electric bass and anthemic vocals. Pigeon will play Boney on Thursday February 27. Tickets are available from the venue’s website.

WWW.THEPUBLICBAR.COM.AU

238 VICTORIA ST, NORTH MELBOURNE OPEN TIL 7AM FRI/SAT

WEDNESDAY 15TH JANUARY

PUBLIC BAR COMEDY 7:30PM $6

THURSDAY 16TH JAUARY

SWAMP MOTH SIREN BLACK, REAL SANG 8:30PM $6 FRIDAY 17TH JANUARY

CTRIX, PACKAGE HOLIDAY NIGHTWORKS, FRIENDSHIPS BOOMA, SURVEY GENRE CULT LIVE 8:30PM $10 SATURDAY 18TH JANUARY

REING OF PARANTHROPUS ZOND, RATSAK COMPLETE 8:30PM $10 DJ LEOPARD HEAD SUNDAY 19TH JANUARY

COOPERS PRESENTS SUNDAY SCHOOL: EAST BRUNSWICK ALL GIRLS CHOIR SLEEP DECADE 4PM FREE

MS MURPHY You probably know Ms Murphy from the second season of The Voice, where her story captured viewers hearts and Ricky Martin’s support. After joining Ricky as his special guest on his sold out October tour and selling out a string of headline shows, Ms Murphy returns for her second tour with a brand new EP. After months of writing and recording with Melbourne soul band, The Bamboos, Ms Murphy has put together a brand new five track EP, White Dress And The Spirit to be released on Friday January 24. The first single to be lifted from the EP is Ritual Union, a cathartic and passionate cover of the 2011 hit from Little Dragon. Come join her at The Toff on Thursday January 30. Tickets are on sale from The Toff.

SETH LAKEMAN The fiddler of the North will be returning to Australia this April in promotion of his seventh album Word of Mouth, ahead of his Bluesfest appearance that month. Hailing from Devon (you know, that English county), Seth Lakeman is virtuoso of the fiddle and folk. Both skills, alongside his vocals and songwriting, earned Lakeman a Mercury-nomination back in ‘05 and the chance to perform with the lauded BBC Concert Orchestra; as well as a devoted audience. Known for his ethereal performances imbued with whimsicality and heart, Seth Lakeman is a must-see for all folk lovers. Seth Lakeman will be performing at the Thornbury Theatre on Saturday April 19. Tickets are available through Thornbury Theatre.

MONDAY 20TH JANUARY

CLOSED

TUESDAY 21ST JANUARY

FACT HUNT TRIVIA 7:30PM FREE

KITCHEN OPEN:

TUES - FRI 5PM - 9PM SAT - SUN 12PM - 9PM

WWW.MISSKATIESCRABSHACK.COM

BEAT MAGAZINE PAGE 14

OZOMATLI Ozomatli, the ultimate LA party boys return after four years. Having blown the roof off Bluesfest heaps of times, they are back to partify the East Coast in three ‘dance yer arse off ’ sideshows. Starting off as hometown heroes playing in the street of Los Angeles, these culture-mashers went on to become U.S. State Department Cultural Ambassadors, the first western band to play in Nepal (to 14,000 people) and Mongolia (to 25,000 people), headlining the Hollywood Bowl three times and even having their own day named after them by the city of LA. Catch em at The Corner Hotel alongside fellow Americans Chali 2NA on Saturday April 26. Tickets are $66 + bf and are available from cornerhotel.com

NAME THAT POINT IN THE NIGHT WHEN JOKES TURN INTO JOKER IMPERSONATIONS. VISIT NAMETHATPOINT.COM TO WIN $5,000


HOT TALK

THE BIGGEST IN INTERNATIONAL & NATIONAL NEWS

SECRET SOUNDS PRESENTS

For all the latest news check out beat.com.au

FLYYING COLOURS Flyying Colours and The Evelyn Hotel are hosting a huge Australia Day party on Sunday January 26 featuring Melbourne’s best and brightest psyche and shoe-gaze bands. Flyying Colours had a huge 2013, releasing their first single Wavygravy, their first self-titled EP through Universal Music, playing their first east coast tour and recovering from their heavily debauched recording sessions. See Flyying Colours, Atolls and ESC deliver all the fuzz, reverb and good-times that one needs to celebrate this great country of ours. Tickets available from oztix.com or on the door.

WITH SPECIAL GUESTS TRIXIE WHITLEY Following her appearance at Bluesfest this April, vocal anomaly Trixie Whitley will be performing at the Northcote Social Club in promotion of her debut album Fourth Corner. Trixie Whitley is the daughter of renowned singer/songwriter Christ Whitley. From a young age, three-years-old to be exact, Trixie was involved in her father’s nomadic lifestyle, spending her youth growing up in Belgium, New York, France, Texas and Mexico, where her father played and worked. By the time she was 26, Trixie had caught the attention of producers with her highly evocative voice — this voice was explored through her Fourth Corner, where her tones ranging between love, rage, crippling loneliness and utter bliss. Trixie Whitley will hit up the Northcote Social Club on Sunday April 20.

GUDRUN GUT Legendary Berlin artist Gudrun Gut, of influential  experimental art-rock band Malaria!  will play two exclusive solo shows in Australia, presented by Krass Happening. Gut first came to prominence in the early '80s as a member of Mania D (with Bettina Koester and Beate Bartel) and an early incarnation of Einstürzende Neubauten, eventually going on to form Malaria! who’s infamous track Kaltes Klares Wasser was later made into a hit a second time around by Chicks on Speed.  A key cultural figure in Berlin, Gut works throughout Europe as a  musician, performance artist, record label owner, audio engineer, programmer and record producer. Gudrun Gut will play the John Curtin Band Room on Sunday February 2, supported by White Hex and Kate Fox (Requiem). Tickets available through johncurtainhotel.com. 

PUBLIC ENEMY In response to the rapidly selling 2014 Australian tour and the announcement of Melbourne’s sold out Corner show, Public Enemy announce a second and final Melbourne show.  In order to accommodate the additional Melbourne concert, the Australian-based promoters have decided to cancel the Newcastle show previously scheduled for March 6. If there is only one gig you attend this year, make sure it is Public Enemy. See the legendary group at the Corner Hotel on Monday March 3. Go to cornerhotel.com for ticket info.

THE CREASES & THE GROWL (ACOUSTIC)

THURSDAY 17 APRIL PALACE THEATRE TICKETS ON SALE NOW TICKETEK.COM.AU, 13 28 49 / PALACE.COM.AU

BETH HART In addition to her appearance at Bluesfest, singer-songwriter Beth Hart has unveiled that she will play a Melbourne sideshow when she makes her way to Australia for the first time this April. Hart’s new album Boom Boom Bang Bang is due out in March, with her single of the same name already receiving mountains of praise for its blues, R&B and swing influences. With her voice likened to greats such as Janis Joplin and Stevie Nicks, the Los Angeles native has lent her talents to everyone from Jeff Beck to Slash. Catch Beth Hart at the Corner on Tuesday April 15. Tickets go on sale now via the Corner Box Office.

WE ARE SCIENTISTS Fans waiting for New York indie rock outfit We Are Scientists to make their first return to Aussie shores since 2008 will have to wait a little bit longer, as the band has postponed their upcoming tour until May. Citing the need to put finishing touches on their forthcoming album, We Are Scientists have assured fans that tickets currently held will be valid for the new dates. Those in Adelaide aren’t quite as lucky, with the new schedule nixing the city’s date. We Are Scientists will now play the Corner Hotel on Wednesday May 28. Tickets are available from the venue’s website.

THE WAILERS The Wailers will bring their feel good sounds to Melbourne when they play a Bluesfest sideshow this April. With classics like Jammin’, Is This Love, One Love and People Get Ready to their name, the iconic Bob Marley backing band’s catalogue of hits runs deep. Joining the Wailers will be Sly & Robbie and the TAXI Gang with Bitty McLean. The Wailers will play 170 Russell on Wednesday April 23. For ticket information visit bluesfesttouring.com.

SHANGRI LA OUT NOW

THE CRIMSON PROJECKT The Crimson ProjeCKt have announced that their January Australian tour will be postponed to June. Tickets held for the three hour show of all things King Crimson will be valid for the June show and full refunds are available for those who are unable to attend the new date. The Crimson ProjeCKt will now play The Hi-Fi on Thursday June 26.

SECRET-SOUNDS.COM.AU | JAKEBUGG.COM

NAME THAT POINT IN THE NIGHT WHEN DINNER PLANS TURN INTO FOOD VANS. VISIT NAMETHATPOINT.COM TO WIN $5,000

BEAT MAGAZINE PAGE 15


HOT TALK

THE BIGGEST IN INTERNATIONAL & NATIONAL NEWS

$

THE PRICE IS RIGHT

$

For all the latest news check out beat.com.au Vance Joy

SOUTH BY SOUTHWEST 15 Melbourne acts have been confirmed to showcase at South by Southwest Music in Austin, Texas in March. These are out of 41 acts from around the country. The names heading to Texas from Melbourne are Vance Joy, Oh Mercy, Owl Eyes, Miami Horror, Mia Dyson, Gossling, Money For Rope, Dub Fx, King Parrot, High Tension, Strange Talk, The Delta Riggs, Indian Summer, People Of Letters and Reptiles. They join Angus and Julia Stone, Boy and Bear, The Preatures, Gang of Youths, Sheppard, DZ Deathrays, The Swiss, Dune Rats, The Griswolds, The Growl, Kid Mac, Kirin J Callinan, Josef Salvat, The John Steel Singers, Wave Racer, The Kite String Tangle, Panama and Seekae among others. In its 28th year, SXSW will have over 2000 bands from more than 50 countries playing 100+ venues. More info at sxsw.com.

THE GREAT AUSTRALIAN BEER FEST The Great Australian Beer Fest is on Saturday February 1 at Geelong Racecourse, bringing you the chance to sip or slurp your way through over 150 craft beers and ciders, paired with live music by some hot Australian talent including Owl Eyes, Tigertown, Kylie Auldist and more. And if great beer and great music aren’t enough (are you crazy?!) then think amazing regional gourmet food to keep you going. Now the even better bit: we have two double passes to the festival to give away! But wait, there’s more: Each winner will receive a $100 voucher from the Odyssey Tavern & Brewery, a Surf Coast Highway brewery who’ll be showcasing their wares on the day. Everyone’s a winner baby!

BROODS Youth Lagoon have just announced that New Zealand brother sister duo Broods will be joining them on their Laneway Festival sideshows. Positioned as one of the fastest rising acts of 2013, they have just released their debut single, Bridges, produced by the man behind fellow kiwi Lorde. We’re giving away a few double passes plus an album for their Ding Dong show on Wednesday February 5.

JEFF MARTIN AND SARAH MCLEOD

THE HIVES The Hives have locked in a Big Day Out sideshow. The Swedes will be spinning around and dancing along while they play notes from their latest round music disc Lex Hives. Catch ‘em at 170 Russell on Tuesday January 21.

CHICKS ON SPEED

THE ESPY HOTTEST 100 PARTY If on Australia Day you're left with little to do and you want to hear triple j's Hottest 100 and head to a party afterwards, the good news is that you can do both at the same venue this year. The Espy will be playing the countdown over their PA throughout the day and changing things up with an exciting lineup to take you into the night. Featuring World's End Press, Asta, Willow Beats, Client Liaison, Papa vs. Pretty, Drunk Mums, Bad/Dreams, and with a DJ set from Gold Fields and more to be announced, the night is set to be full of music to keep you happy. Make sure to clear your calendar on Sunday January 26 and head down to The Espy. Entry is free.

GROUNDATION Groundation will be hitting Aussie shores this February with their eclectic mix of funk, jazz and dub. It’s been two years since the Californian eight-piece performed here, wowing audiences at WOMADelaide, and their 2010 Australian tour saw the band captivate and play to packed houses, including a show-stopping performance at the Australian World Music Expo. Considered an organic fusion of classic roots, reggae, heavy jazz and funk, and transcendental dub, Groundation will be taking pro-surfer and reggae master Tom Frager (France) along for the ride as well. Groundation, supported by Tom Frager, will perform at The Hi-Fi on Thursday February 6. Tickets are through The Hi-Fi.

Chicks on Speed are back with a new daring style of MediaArt-Pop-Music. Utopia, the Chicks latest studio album, is scheduled for release in March 2014, accompanied by six interactive iPad apps. To mark the occasion Chicks on Speed’s founding members Melissa Logan (USA) and Alex Murray-Leslie (Australia) will perform a series of live shows in Australia, accompanied by electro-drummer Erica Lewis.  The album launch performances will see the unveiling of tracks from the new album, as well as inviting audience members to participate in the creative process on stage with the chicks, by live-composing and mixing audio-visual scenes via the Chicks on Speed Apps. Utopia features 14 new tracks, including collaborations with Yoko Ono and Julian Assange.  Chicks On Speed play Howler on Friday March  21. Tickets go on sale through h-w-l-r.com on Monday January 20.  

Joss Stone and India.Arie will be bringing the soul party to Melbourne this April, ahead of their Bluesfest appearance later that month. Both women are known for their lustrous voices that have earned them both Grammys — Stone receiving a Grammy Award and two BRITs and India.Arie 21 Grammy nominations and four wins — and a worldwide fan base. This sideshow will see the songstresses perform their hits and numbers from their new albums, The Soul Sessions Vol II by Joss Stone and SongVersation by India.Arie. Known for their stellar live shows, this duo are a must-see for soul lovers. India.Arie and Joss Stone will perform at The Palais on Thursday April 17. Tickets on sale now via Ticketmaster. BEAT MAGAZINE PAGE 16

CHERRYWOOD Sold out shows, exhausted riders, small towns with even smaller stages, festivals, thousands of kilometres and one new album, Cherrywood are putting on one final show for some time, and we’re giving away some double passes to their Friday January 17 gig at the John Curtain. Head to beat.com.au/freeshit to win.

ROCK THE BAY Rock The Bay Festival is turning six this year. To celebrate, the one-day-only festival has expanded to include 40 local, interstate and international bands across four rooms at The Espy this February. Featuring a special (and secret) guest act from Austria, Rock The Bay is chockablock full of local and interstate Aussie talent, including triple j favourites The Love Junkies, Like Thieves (featuring former The Butterfly Effect lead vocalist Clint Boge), Engine (formerly Engine Three Seven), Dallas Frasca, Mother’s Cake, Head Filled Attraction, Battle Axe Howlers, Born Lion, Tim McMillan Band, Toehider, Helm, The Dead Elected and many, many more. Rock The Bay Festival will be held at The Espy on Saturday February 15. Tickets through Oztix.

JEN CLOHER & DIALECTRIX INDIA.ARIE & JOSS STONE

A musical coupling of tremendous proportions, The Tea Party’s Jeff Martin, and Sarah McLeod will perform separate sets as well as take the stage together, and we have some tickets to give away to their Man The Life Boats tour at the Northcote Social Club on Wednesday January 29.

This January will see blues singer/songwriter Jen Cloher and Dialectrix perform at Shortlisted, an event that celebrates the nine shortlisted artists for the 2014 Coopers Australian Music Prize Awards. Shortlisted will see Jen Cloher (who was shortlisted for her third LP In Blood Memory) and hip-hop MC Dialectrix (who was shortlisted for his current LP The Cold Light of Day) perform alongside six other shortlisted Coopers AMP artists and 2013 AMP winners Hermitude at the Sidney Myer Music Bowl. The 9th winner of the Coopers AMP will be announced in March and be awarded $30,000 courtesy of PPCA. Jen Cloher, Dialectrix and Hermitude will perform at the Sidney Myer Music Bowl on Sunday January 26 from 6pm – 8pm. Admission is free.

PORT ROYAL STREET PARTY The Port Royal Street Party has added on more tasty eats and drinks, a chance to get inked as well as one more band to complete its inaugural program. For those looking to chow down, look no further than Huxtaburger and Vietnamese street food specialists Uncle. Sailor Jerry will also be on board for the day to serve up signature cocktails in addition to tatting up festival goers in their Airstream Tattoo trailer. Raucous outfit Drunk Mums are set to round out the music lineup. It all goes down on Saturday January 18 from 11am to 11pm at 1 Fennel Street in Port Melbourne. Tickets are available via Oztix.

GHOST Ghost have locked in a sideshow to coincide with their appearance on the Big Day Out lineup. On the tour, Ghost  will be performing hits from their sophomore record Infestissumam and their most recent If You Have Ghost. Catch ‘em at The Hi-Fi on Wednesday January 22.

NAME THAT POINT IN THE NIGHT WHEN CLEAR THINKING TURNS INTO MORE DRINKING. VISIT NAMETHATPOINT.COM TO WIN $5,000


Wednesday 15th January

Simply Acoustic 7:00pm Wesley Anne Band Room $free Thursday 16th January

Woodward & Rough 6:00pm Free in the front bar Thursday 16th January

Thursday

Suzanne Kinsella Gus Rigby and Kanvas Grey

Free Pool

8:00pm Wesley Anne Band Room $10 Singer Songwriter

Friday

Friday 17th January

The Boys 6:00pm Jazz

The Fuzz

Friday 17th January

6pm

Charlie Lane & Ree Nay Tim ischia & July days 8:00pm Wesley Anne Band Room $10 Pop

King Lucho 8pm

Saturday 18th January

midsumma folk, country, rock.

Saturday

5:30pm Wesley Anne Band Room $30/20 Sunday 19th January

Big Seal and the Slippery Few

The Boy Who Spoke Clouds & special guests

9.30pm

3:00pm Wesley Anne Band Room $donation Expermintal folk Sunday 19th January

Sunday

The Stopouts 6:00pm Free in the front bar Blues

DJ Tech-No Shit

Monday 20th January

5pm

Mohamed Camara and Jarabi 7:00pm $12/10 World Music Wednesday 22nd January

Tuesday

Simply Acoustic

Beyond the Bathroom Choir

7:00pm Wesley Anne Band Room $free

7.30pm

$14 jugs. And 2 for 1 selected mains, weekdays before 6pm. wesleyanne.com.au CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 17


TOURING

WHO'S ON TOUR, WHERE AND WHEN

PROUDLY PRESENTS

For all the latest tour dates check out beat.com.au

INTERNATIONAL THE JULIE RUIN Corner Hotel January 15 MONA FOMA FESTIVAL TBA January 15-19 EDWYN COLLINS The Kelvin Club January 17 JOHN GRANT Corner Hotel January 18 JOHN MURRY Meeniyan Town Hall January 18, Northcote Social Club January 21 MATMOS Howler January 19 HALF MOON RUN Corner Hotel January 19 MAJOR LAZER AND FLOSSTRADAMUS The Palace January 21 THE HIVES 170 Russell January 21 THE 1975 Northcote Social Club January 22 MUDHONEY Corner Hotel January 22 SNOOP DOGG The Palace January 22 ARCADE FIRE Sidney Myer Music Bowl January 22 GHOST The Hi-Fi January 22 TORO Y MOI/PORTUGAL. THE MAN The Hi-Fi January 23 THE LUMINEERS The Palace Thursday January 23 GROUPLOVE AND CSS The Hi-Fi January 23 BIG DAY OUT Flemington Racecourse January 24 GEORGIA ANNE MULDROW, DUDLEY PERKINS Prince Bandroom January 24 MELBOURNE ZOO TWILIGHTS Melbourne Zoo January 24 - March 8 KING KRULE Corner Hotel January 28 PARQUET COURTS Corner Hotel January 29 CHVRCHES The Forum January 29 MOUNT KIMBIE Corner Hotel January 30 CASS MCCOMBS Northcote Social Club January 30 SAVAGES The Hi-Fi January 30 CAT POWER Thornbury Theatre January 31, February 1 ST JEROME’S LANEWAY FESTIVAL Footscray Community Arts Centre February 1 PERIPHERY, ANIMALS AS LEADERS Billboard February 2 GUDRUN GUT John Curtin Bandroom February 2 AUTRE NE VEUT Northcote Social Club February 4 DRENGE The Tote February 5 FRIGHTENED RABBIT The Palace February 5

YOUTH LAGOON Ding Dong Lounge February 5 KURT VILE & THE VIOLATORS Corner Hotel, February 5, 6 GROUNDATION The Hi-Fi February 6 THE NATIONAL Sidney Myer Music Bowl February 9 DAUGHTER St Michael’s Uniting Church February 10 LYNYRD SKYNYRD The Plenary February 11 DOLLY PARTON Rod Laver Arena February 11, 12 JULIA HOLTER Northcote Social Club February 14 AUSTRA Corner Hotel February 15 BRUCE SPRINGSTEEN AAMI Park February 15 EDDIE VEDDER Palais Theatre February 16, 18, 19 EMINEM, KENDRICK LAMAR, J. COLE Etihad Stadium February 19 OKKERVIL RIVER Corner Hotel February 22 MANGO GROOVE Forum Theatre February 23 CLUTCH Prince Bandroom February 27 SOUNDWAVE Flemington Racecourse February 28 SIX60 The Hi-Fi March 1 NEKO CASE Corner Hotel March 2 PUBLIC ENEMY Corner Hotel March 3, 4 BRIAN MCKNIGHT Palais Theatre March 5 CHARLES BRADLEY Corner Hotel March 6 JON CLEARY AND THE ABSOLUTE MONSTER GENTLEMEN Northcote Social Club March 6 PHOENIX Festival Hall March 6 MIKHAEL PASKALEV Howler March 7 PORT FAIRY FOLK FESTIVAL Port Fairy March 7 – 10 FAT FREDDY’S DROP Melbourne Zoo Twilights March 8 PANAMA FESTIVAL March 8, 9 FUTURE MUSIC FESTIVAL Flemington Racecourse March 9 YO LA TENGO Corner Hotel March 9 POKEY LAFARGE Corner Hotel March 12 NEIL FINN Hamer Hall March 12 BILLY BRAGG Palais Theatre March 13 BRUNSWICK MUSIC FESTIVAL Various Venues March 13 - 24 QUEENS OF THE STONE AGE, NINE INCH NAILS Rod Laver Arena March 14, 15 BILL MEDLEY Palais Theatre March 15 LIONEL RICHIE AND JOHN FARNHAM Rod Laver Arena March 16 GANG OF FOUR Corner Hotel March 19 JURASSIC 5 Palace Theatre March 20 SEBADOH Corner Hotel March 21 CHICKS ON SPEED Howler March 21 THIRTY SECONDS TO MARS Hisense Arena March 28 THE ROLLING STONES Rod Laver Arena March 28, Hanging Rock March 30 ALLEN STONE Corner Hotel April 12 ERYKAH BADU Palais April 15 EDWARD SHARPE AND THE MAGNETIC ZEROS Palace Theatre April 15 BETH HART Corner Hotel April 15 JASON ISBEL Northcote Social Club April 16, 17 BLUESFEST Byron Bay April 17 – 21 JIMMIE VAUGHAN Corner Hotel April 17 DEVENDRA BANHART Prince Bandroom April 17 INDIA.ARIE & JOSS STONE Palais Theatre April 17 JAKE BUGG Palace Theatre April 17 KC & THE SUNSHINE BAND Palace Theatre April 18 SETH LAKEMAN Thornbury Theatre April 19 TRIXIE WHITLEY Northcote Social Club April 20 IRON AND WINE Forum Theatre April 22 THE WAILERS 170 Russell April 23 GREGG ALLMAN, GOV’T MULE Forum Theatre April 23 STEVE EARLE Forum Theatre April 24 SKID ROW, UGLY KID JOE Palace Theatre April 25 OZOMATLI Corner Hotel April 26 ARCTIC MONKEYS Rod Laver Arena May 9 WE ARE SCIENTISTS Corner Hotel May 28 ELLIE GOULDING Festival Hall May 31 JAMES BLUNT The Plenary June 8 BASTILLE Festival Hall June 15 THE CRIMSON PROJECKT The Hi-Fi June 26

MIAMI HORROR Corner Hotel February 14 RIVERBOATS FESTIVAL Echuca February 14 - 16 JIMMY BARNES Rochford Winery Yarra Valley February 15 MAJOR LEAGUES The Workers Club February 15 THE KITE STRING TANGLE Northcote Social Club February 15 ROCK THE BAY FESTIVAL The Espy February 15 THE DEAD DAISIES Day On The Green February 15, The Espy February 16 FEEDTIME The Tote February 15, 16 NGAIIRE Northcote Social Club February 27 PIGEON Boney February 27 WORLDS END PRESS NGV February 28 JOSH PYKE Melbourne Zoo February 28 THE JOHN STEEL SINGERS Northcote Social Club February 28, March 1 DAN SULTAN Corner Hotel March 1 ILLY The Hi-Fi March 7 PORT FAIRY FOLK FESTIVAL March 7 -10 PANAMA FESTIVAL March 8, 9 ROCK IN THE VINES FESTIVAL Big Hill Vineyard March 9 PUSH OVER Sidney Myer Music Bowl March 10 NEIL FINN Hamer Hall March 12, 13 PETE MURRAY Forum Theatre March 15 THE HOLIDAYS Corner Hotel March 20 SUNNYBOYS Forum Theatre March 21, 22 LIOR Corner Hotel March 28 JOHN BUTLER TRIO Palais Theatre April 1 HUNTERS AND COLLECTORS Palais Theatre April 11 MICHAEL FRANTI & SPEARHEAD Prince Bandroom April 16 KEITH URBAN Rod Laver Arena June 25

BEAT MAGAZINE PAGE 18

31

Corner Hotel FEB

05 FEB

09 MAR

06 APR

RUMOURS LITTLE DRAGON, MILEY CYRUS, Q-TIP, MEAT PUPPETS

01

APR

16

YOUTH LAGOON Ding Dong Lounge

THE NATIONAL Sidney Myer Music Bowl

PHOENIX Festival Hall

JOHN BUTLER TRIO Palais Theatre

MICHAEL FRANTI Prince Bandroom

= NEW ANNOUNCEMENTS

PROUDLY PRESENTS

FEB

09

THE NATIONAL Sidney Myer Music Bowl

PROUDLY PRESENTS

NATIONAL JAGWAR MA The Hi-Fi January 16 LITTLE BASTARDS The Workers Club January 17 SUN CITY The Espy January 18 SARAH BLASKO St. Michael Uniting Church January 22 PETE MURRAY Trak Live Lounge January 22 SNAKADAKTAL Howler January 25 COLORWHEEL Workers Club January 26 DALLAS CRANE Corner Hotel January 26 FLYYING COLOURS Evelyn Hotel January 26 JEFF MARTIN AND SARAH MCLEOD Northcote Social Club January 29 MS MURPHY The Toff January 30 LED ZEPPELIN TRIBUTE Corner Hotel January 31 KIM CHURCHILL Workers Club January 31 NINA FERRO Caravan Club February 1 ST KILDA FESTIVAL St Kilda February 1 – 9 THE BENNIES Reverence Hotel February 7

LED ZEPPELIN 1972 KOOYONG CELEBRATION CONCERT JAN

FEB

05

YOUTH LAGOON Ding Dong Lounge

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


.COM.AU LBOURNE E M G IN H T Y R E V E E ONLINE & MOBIL

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 19


THE ORB By Augustus Welby

The fortunes of the English cricket team might be a touchy subject for any proud Briton at present. However, Alex Paterson, the founder/leader of London electronic legends The Orb, is not particularly fazed. “I suppose it is if you’re English. Things like this I go with my Dad – he’s Scottish anyway, so I don’t give a hoot about cricket.” Rather, Paterson takes aim at an aberrant feature of Australian sport. “What about football? You guys call it soccer, you knobs. Americanised twats – come on, sort your life out,” he wryly suggests. Thankfully, sporting divides will be irrelevant when Paterson’s electronic ambient masters The Orb perform a 25th Anniversary set at the Rainbow Serpent festival later this month. That’s right – 2013 was The Orb’s 25th year in action and to celebrate a retrospective boxset entitled The History of the Future was released. The compilation is a startling document of the group’s decorated history and Paterson reveals there’s more coming this year. “What we basically did was we cut this whole project into two, so [this] year you get part two of the history of The Orb, which is the non-Island years [Island Records, the label they were signed to from 19922001] and all the stuff from after and before then.” Last year was also Paterson’s 25th year living in his London home. Yet, unlike The Orb this relationship has reached its conclusion. He reveals that while preparing to move he’s uncovered some lost artefacts. “I’ve just been under the stairs and, my God, I found fifteen boxes of records I didn’t even know I had.” The move means that he’ll have to part ways with some of this vinyl, but he definitely hasn’t been converted into a digital listener. “I’m not going to be like everyone else and sell my record collection. That would be, to me, suicidal because there’s some gems in there. I’ve got some that are worth… well you couldn’t put a price on them.” Indeed, Paterson’s affection for his favourite piece of wax transcends currency evaluation. “My Life in the Bush Of Ghosts acetate - by Eno & Byrne. If anybody’s never heard of that then I don’t know why they’re bothering to talk to me because that to me is my kind of bible. Just the way it was put together is very similar to what an Orb record is about.” Of course back in 1988 when The Orb started releasing music, vinyl was the standard format. Since then Paterson has witnessed the rise and apparent fall of the CD and he sceptically observes the contemporary digital saturation. “Vinyl is something that will be a big, big, big resurgence. My grandchildren will certainly make sure of that. This digital age is going to fall flat on its face.” This dismissal might seem a little hasty, but Paterson’s confidence in the virtues of vinyl is surely augmented by the fact that The Orb’s fans are increasingly vinyl-hungry. BEAT MAGAZINE PAGE 20

“When we do gigs, we sell a lot of vinyl,” he says. “We sell a lot of music from our store, in fact we sold out of everything that we took on the road in the last three months and there’s a big demand for more vinyl. The vinyl of the Lee ‘Scratch’ Perry album sold out immediately and we had to get it re-pressed.” Now, this brings us to the topic of The Orb’s two most recent releases. Both 2013’s More Tales From The Orbservatory and its predecessor The Orbserver in the Starhouse are collaborations with dub/ reggae supernova Lee ‘Scratch’ Perry. Understandably, Paterson was honoured to work with Perry, “He’s a legend beyond legends. He’s out there with the Bob Marley’s of the world that man.” Bob Marley is actually one of the many acts Perry himself produced – others include The Clash and the recently deceased Junior Murvin. Meanwhile, Perry’s formidable solo discography exceeds fifty album releases and Paterson explains how The Orb’s fruitful partnership with him developed. “[We] became friends DJing with him on gigs in England, Mexico and Finland, of all places. Then we went into sending tapes over [to him] and it took nine or ten months before we got a reply. The whole thing took about 18 months and we eventually got him into the studio for a week and we recorded enough material to make two albums.” Going into the recording sessions, Paterson and The Orb’s co-commander Thomas Fehlmann had some specific ambitions for what they wanted to achieve with the dub pioneer. However, the highly-charged sessions surpassed their expectations. “We thought ‘OK, we’ve got five new tracks, that’s easily enough for the week’. He got there Monday night, his working schedule was from 6pm to 6am. That was his way of working, which was a bit odd for us. Anyway, [he] turns up at 4 o’clock in the morning on Monday and we start recording Tuesday night. We’ve done five tracks by Wednesday [and] we’ve got him until Sunday.” Paterson says incredulously. “Knowing that he’s not going to get up until really late we then start writing a load of tracks on the Thursday. He gets up Thursday night and as a DJ I start playing him loads of stuff and he’s just singing along to it [while we’re] recording his vocal. We ended up with 17 new tracks. How do you like us now?” he laughs. “We had vocals done

DISCUSS WHAT? BEAT.COM.AU/DISCUSSION

by Sunday and we had Sunday off.” Not only do the two records expand upon The Orb’s previous dub/reggae explorations, but Perry’s vocals apply a melodic root to The Orb’s ambient atmospheres. The simple fact that the albums comprise songs with verse-chorus structures makes them unique. “Completely different ball game. By having songs you have to have verses and choruses and bridges, which is something else that was quite alien for The Orb,” Paterson explains. “Normally it’s just dubs with a few bits of vocals. There are normally timely sarcastic comments, a bit of humour or a bit of enlightenment, but this time it was vocals all the way through.” The addition of Perry’s vocals inevitably made the songs assume a more conventional form than The Orb’s characteristic meandering. “Instead of something like ten minutes of a doodle it became a four minute pop song. The most we got was six and half minutes. That was on Soulman, which we edited down as a single anyway.” Metallic Spheres, the album that came before the two with Lee ‘Scratch’ Perry, featured Pink Floyd guitarist David Gilmour. Paterson notes that The Orb will continue to involve outside musicians on their next LP. “We’re looking at working with some other people on the next album, but not so much as a whole. Different people coming in working on different tracks. We’re looking at Peter Hook, ex-New Order, [to] come in and do some bass lines. The other one is [techno progenitor] Juan Atkins who will come in and give us some atmospheric Detroit sounds.” The Orb competently achieved commercial success long before embracing pop-song structure or enlisting the help of revered associates. Their second LP, 1992’s U.F.Orb, could be one of the most unlikely records to ever top the UK charts and the group’s whimsical electronic music continues to hold the attention of a legion of fans. Paterson says that he’s never felt inclined to pander to standard record company criterion. “The record label was our own record label at the very beginning, so we didn’t have any problem releasing stuff. Then within two years it snowballed because, from putting out A Huge Ever Growing Pulsating Brain in February ’89, it became a sought after tune.” Paterson reminds us how improbable it was for this song to become a hit. “That was a 19 minute ambient piece, a doodling, and yet it came up as the most noticeable tune we’d ever written at that point. By Christmas ’89 we were doing a John Peel session. The rest, as they say, is history.” The group’s illustrious history certainly hasn’t reached an impasse. Paterson describes how working with Perry indicated there’s plenty of productive years ahead. “I used to look up at one of my mates who’s 65 now and think ‘When I get to that age I want to be like him.’ Lee ‘Scratch’ Perry is 78 so I’ve got someone else even higher to go ‘When I get older I want to be like him.’”

THE ORB will perform at this month’s Rainbow Serpent Festival, which takes place from Friday January 24 – Monday January 27. More Tales From the Orbservatory is available now.


CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 21


THIS WEEK: ON SCREEN Featuring unrivalled access to archival footage, in The Stone Roses: Made Of Stone Shane Meadows (This is England) brings together the story of the band to the big screen in a film that will convert you to the music of The Stone Roses. Meet Mani, Reni, John and Ian, four musicians who had the world at their feet. Hear the music that shaped a generation through a thumping 20,000 watt Shadow Electric sound system. It happens at the Abbottsford Convent this Friday January 17.

With Tyson Wray. Got thoughts, news, gossip, complaints or cat photos? Email tyson@beat.com.au or send by carrier pigeon before Friday 12pm.

ON STAGE This summer will mark a quarter of a century of Shakespeare in Melbourne’s Royal Botanic Gardens. To celebrate the 25th Anniversary, the Australian Shakespeare Company will remount A Midsummer Night’s Dream, the first play performed in 1988, that over the decades has proven to be Melbourne’s favourite Shakespeare under the stars. Since the very first performance, an amazing array of talented actors have traipsed the boards under the trees in Glenn Elston’s Shakespeare adaptations. Guy Pearce played Lysander in 1993, Tim Minchin performed in Twelfth Night, one of Australian television’s most loved personalities Kate Kendall played Beatrice in Much Ado About Nothing, and Nadine Garner playing the very first Juliet at the age of 20 in 1995. It opens on Friday January 17.

ON DISPLAY It’s time for the annual Chapter House Lane Fundraiser and Exhibition, and this time it’s an event for everyone, including art connoisseurs. Opening on Sunday January 18, Chapter House will host a gala fundraising event full of cake stalls, activities and drinks. Of course, an array of photography, paintings and ceramics will be available for purchase, including work by: André Piguet, Andrew Gordan, Jackson Eaton, Brad Haylock, Justin Lee Williams, Benjamin Lichtenstein, Kez Hughes, Emily Ferretti, Charles O’Loughlin, Grant Nimmo, Kenny Pittock, Matlok Griffiths, Helen Johnson, Pia Murphy, Ronnie van Hout, Nicole Breedon and Riley Payne. Chapter House Lane is a not-for-profit volunteer-run art space that exhibits independent and contemporary local artists, helping them garner attention they may not get elsewhere. Chapter House are hoping to raise $15,000 for cover operational costs for the next year. Chapter House Lane Gala Fundraiser will be held at Chapter House, entry via Flinders Lane, on Sunday January 18 from 3pm – 6pm, and the Chapter House Lane Fundraiser Exhibition will be on exhibition from Sunday January 18 – Sunday February 2. Admission is free.

PICK OF THE WEEK One of the most original and distinctive stars on television, radio and the stage in the UK, Jimmy Carr is set to tour Australia for the first time with his hit solo show, Gagging Order. Over the past 10 years, Jimmy Carr has deservedly earned his place amongst the very best of British comics. His stand-up achievements to date include a British Comedy Award for Best Live Stand Up Tour, a Loaded LAFTA Award for Best StandUp and a Perrier Award nomination. Having now played to over 1.5 million people on his live tours, Jimmy knows a thing or two about making people laugh. Gagging Order is the chance for Australian fans to catch this award-winning comedian at his near-the-knuckle best. Catch him at Hamer Hall on Wednesday January 15–Friday January 17.

BEAT MAGAZINE PAGE 22

BATTLE OF THE SEXES By Patrick Emery

When top-ranked American tennis player Billie Jean King stepped on the court to play former Grand Slam champion Bobby Riggs at the Astrodome in Houston, Texas, King was playing for more than the handsome $100,000 prize money: she was playing for the reputation of women’s tennis. Riggs, the self-proclaimed chauvinist and legendary hustler, had recently defeated champion Australian tennis player Margaret Court, giving superficial credibility to Riggs’ public taunts at the quality of women’s tennis. But by the time King overcame Riggs in straight sets, King had struck a compelling blow for both women’s tennis, and the feminist agenda generally. Battle of the Sexes tells the story of King’s game against Riggs, and the surrounding sporting, political and sociological context. Made by English film makers James Erskine and Zara Hayes, the film punctuates historical footage of the match with interviews with King, Riggs’ son Larry (Riggs died in 1996) and King’s contemporaries on the court including Rosie Casals, Chris Evert and Margaret Court. It wasn’t a love of or fascination with tennis that compelled Erskine and Hayes to research and document on film the match and its surrounding sociological context – neither of the film makers were born when the match took place, and Hayes confesses that she wasn’t even sure how the scoring system operated in tennis before she embarked on the project. “We wanted to make a film about sport, and women’s sport especially,” Erskine explains. “We had this vague idea of the Battle of the Sexes game, and that while some people thought of it as comic, it had seismic consequences – it was a really major event in the history of women’s sport.” Critical to the film is the era’s context: women’s tennis was gratuitously under-rewarded, with top players including King, Court and Virginia Wade taking home a sliver of the prize money offered to male contemporaries. In 1970, a small group of female players – the so-called ‘Group of Nine’, which included King, and Australians Judy Dalton and Kerry Melville (later Kerry Reid) – had broken away from the male-dominated International Tennis Federation to form the Virginia Slims Circuit.

Despite strong opposition from the tennis establishment, this renegade tour would become the basis for the Women’s Tennis Association in 1973 and eventual – albeit slow – move toward parity in prize money and promotion for women’s tennis. Billie Jean King was originally approached by Riggs to take part in a ‘battle of the sexes’ game in early 1973; King, perhaps surprisingly given her outspoken views on women’s tennis, demurred. Margaret Court, at that time the world’s leading female tennis player – but with political and social views in sharp contrast to King – accepted Riggs’ challenge, only to lose convincingly. “Billie Jean only played the match because she realised she had to after Margaret lost,” Erskine says. Hayes notes that Court’s defeat raised the stakes – politically, if not necessarily financially – for King’s involvement. “Before

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV

Margaret lost to Bobby Riggs, Billie Jean didn’t see what there was to gain from playing him, but after Margaret lost, she knew the reputation of women’s tennis was on the line,” Hayes says. Despite the pressure on her to rehabilitate the reputation of women’s tennis, King seemed remarkably calm. Erskine puts this down to King’s legendary determination to win. “I don’t think Billie Jean was nervous about losing,” he says. “On a sporting level, she was determined to win. But I’m sure she was nervous that something might go wrong.” Riggs was a colourful character, with a reputation for gambling and provocative public statements. While he portrayed himself as an unreconstructed male chauvinist, Erskine agrees that Riggs was more interested in making money from the match than putting women’s tennis back in its place. Erskine and Hayes looked into recent allegations that Riggs had deliberately thrown the match as a means of paying off mob debts, but found no substance to the claims. “We spoke to a lot of people about that, and no-one believes the story, especially Riggs’ coach, though for some people it’s an easy story to believe.” In making the film, Erskine and Hayes were delighted to track down lost footage of Court’s original encounter with Riggs (the so-called ‘Mother’s Day Massacre’), which was eventually discovered in a vault in New York. Hayes was also perversely amused to watch footage of the King-Riggs match, with its illustrative commentary on the social attitudes of the day. “What was surprising was the level of casual sexism that was just accepted,” Hayes says. “It was really shocking – even on the night of the game, you had the commentators saying that if Billie Jean could just cut her hair and get rid of her glasses, she’d actually be quite attractive!” Billie Jean King remains an iconic figure in the world of women’s sport, and a champion of gay and lesbian rights – late last year, King was included in the official US delegation to the Winter Olympics in Sochi, Russia as a public slight to the Russian Government’s recent ‘anti-gay’ legislative activities – and her legacy is both understood and appreciated in the contemporary women’s tennis scene. King, for her part, has claimed that she has always been a reluctant political figure; Erskine and Hayes aren’t so sure. “Billie Jean will say that she’s reluctant, but she’s a natural – she really wears her heart on her sleeve,” Erskine says. “I honestly believe that she hadn’t been a sports player, then in whatever industry she’d been involved in, she’d have transcended it to make a difference,” Hayes says. Battle of the Sexes is currently screening at ACMI until Thursday February 13.


For more arts news, reviews and interviews visit beat.com.au

THE COMIC STRIP PUBLIC BAR COMEDY Dave O’Neil

JUST AN OLD FASHIONED GRRRL!

ANATOMY OF THE PIANO

It looks like another huge show tonight at Public Bar Comedy as Dave O’Neil hosts a loaded lineup including a special guest from your TV that is too big to name, but trust us, they’re very good. Joining Dave and their mystery guest are the likes of Bart Freebairn, Jonathan Schuster, Steele Saunders and Kelly Fustuca all for just $5. The air conditioning is cranking and the drinks be frosty. Come down and  join one  of the most appreciative audiences in Australia as  Melbourne’s finest comedians let loose in the intimate Public Bar back room.

CRAB LAB Crab Lab is back for 2014 with a huge lineup tonight featuring Celia Pacquola, Tommy Dassalo, Daniel Connell, RAW winner Demi Lardner, Brendan Maloney and a bunch more for a measly five bucks. Doors at 7.30pm.

COMMEDIA DELL PARTE Commedia Dell Parte returns for 2014 at the George Lane Bar in St Kilda this week. Hosted by Sean Ryan the night will also be featuring Xander Allan, David Boyle, Angus Brown, Anthony Jeannot, Brendan Maloney and Travis Nash. The room still runs on a ‘pay as you like’ basis, so come along and have a great laugh, then pay what you believe the show is worth on the way out. Commedia Dell Parte runs every Thursday from 8.30pm.

Pianos are inanimate beings of immense emotion and musicality; and this February Will Pickvance will show you why in the Anatomy of the Piano. Originating from the UK, Will Pickvance is a mastermind of horse-play and piano. Anatomy of the Piano will see Pickvance armed with only his temperamental piano and his wit as he explores the anatomical history of the piano, including its copulating Neanderthal ancestors. Endearing, comical and disarmingly charming, Pickvance is that “music teacher whose marriage has fallen apart, causing him to retreat into a childlike obsession with his piano” (FestMag). If that’s not enough to make you want to see him, Will Pickvance has been endorsed by Black Books legend Dylan Moran. Anatomy of the Piano will be performed at The Butterfly Club from Wednesday February 12 – Sunday February 23.

Authentic tease Danielle Asciak will be returning to The Butterfly Club with her newest show, Just an Old Fashioned Grrrl! It’s undeniable that cabaret performer Danielle Asciak is talented, she was the first person to awarded the Australian Council Artstart Grant for cabaret; and with an burgeoning fanbase, as exhibited by her history sold-out shows, Asciak will honour her idol Eartha Kitt. Directed by Maude Davey, Just an Old Fashioned Grrl! will see Asciak performance Kitt’s hits, including C’est si bon, I Wanna be Evil! and Just an Old Fashioned Girl. Danielle Asciak will perform at The Butterfly Club on Tuesday January 21 and Wednesday January 22 at 9.30pm.

HOMOPHONIC

LOOK AT THE FUNNY LADY

Black Apple Theatre will be returning to Midsumma Festival this year with their newest production, Look at the Funny Lady. Despite the acerbic title, Look at the Funny Lady will be an act of feminist defiance, blending sassiness and satire to illustrate the gender inequality that pervades comedy theatre. “Men seem to be getting all the best jokes,” said director Cheyney Caddy, “and I’m never happy with being the Robin when I could be Batman.” To combat this discrimination, Look at the Funny Lady will use an all-female cast of young and emerging actors, elevating them from a object of comical patronization to a teller of jokes (the good kind). Look at the Funny Lady will be performed at Wesley Anne from Thursday January 23 – Saturday January 25 and from January Thursday 30 – Saturday February 1.

VA VA BOOMBAH

The dancing fat ladies return, bigger and better than ever, spreading body love in their wake. Melbourne’s very own fat burlesque troupe, Va Va Boombah, return to Midsumma for their annual gala event on Saturday January 18, 2014. Va Va Boombah combines the dazzling with the dirty, the sultry with the silly, the personal with the political, the fat-tastic with the funny and the sexy with the even more sexy. It goes down on at The Substation on Saturday January 18.

As part of Midsumma Festival this month, La Mama Theatre are dedicating two nights to homosexual classical composers in Homophonic. Joining the LGBT friendly theatre will be 3 Shades Black, who will perform classic compositions from Tchaikovsky, Poulence, Copland and Cage; as well as compositions from some of Australia’s most-sort-after composers, including David Chisholm, Naima Fine, Luke Paulding and Wally Gunn. So head along to La Mama on Friday January 24 and Saturday January 25 at 7.30pm to get down and boogie at Homophonic. Tickets are available through La Mama.

FIVE BOROUGHS COMEDY Denise Scott

PRIVATE LIVES

Denise Scott makes her Five Boroughs Comedy debut this Thursday. You’ve seen her on Winners and Losers, and now you can see her live. Plus there’s an almighty lineup including Mike Goldstein, Harley Breen, Ryan Coffey and some special guests. It’s all happening this Thursday January 16 at 8.30pm, at 68 Hardware Lane, CBD, all for only $12.

COMEDY AT SPLEEN Mondays at Spleen are more packed than ever (and that’s pretty damned packed). This Monday, Spleen Comic Of The Year Nick Cody hosts, plus there’s Luke McGregor, Anne Edmonds, Karl Chandler, Michael Chamberlin, Xander Allan, Shayne Hunter and heaps more. It’s this Monday January 20, 41 Bourke St, in the city, at 8.30pm. It may be free, but they appreciate a good gold coin donation at the door. 

The Melbourne Theatre Company will be re-imagining one of playwright Sir Noël Coward’s classic plays Private Lives, an effervescent comedy about marriage and infatuation, this month. Directed by MTC Associate Director Sam Strong (The Crucible, Madagascar, Other Desert Cities) and starring award winning Lucy Durack (Legally Blonde, Wicked) as Sibyl, Leon Ford (Constellations) as Elyot, Nadine Garner (City Homicide) as Amanda, and John Leary as Victor, Private Lives illustrates the tale of two newly-married divorcees who honeymoon in the same French hotel. Reunited since their divorce, Amanda and Elyot re-ignite their love and abscond to Paris, leaving their partners behind. Private Lives will run at Southbank Theatre from Saturday January 25 – Saturday March 8.

STANDING ON CEREMONY

Chapel Off Chapel, in conjunction with Ellis Productions, will be premiering the internationally lauded play Standing On Ceremony — The Gay Marriage Plays as part of Midsumma Festival. Consisting of nine short plays focused on the moments before and after ‘I do’, Standing On Ceremony features contributions from acclaimed playwrights Jordan Harrison, Wendy MacLeod, Paul Rudnick, Doug Wright, Neil LaBute, Mo Gaffney, Moisés Kaufman and José Rivera. The production will also include a live wedding band to complement the stories of Facebook arguments, lesbianism in Iowa and gay marriage. Standing On Ceremony — The Gay Marriage Plays is currently being performed at Chapel Off Chapel until Sunday February 2. WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV

BEAT MAGAZINE PAGE 23


CHRIS THILE By Krissi Weiss ‘Genius’ gets tossed around a lot lately (so does that introduction) but seriously, Chris Thile is, by definition, a genius of his craft – and as a 2012 MacArthur Fellow recipient he has the grant to prove it. With the mandolin as his tool of choice, Thile somehow brings together the worlds of American folk and bluegrass with many a classical opus to stretch, bend and break the boundaries of both his instrument and music in general. “I’m bringing a boatload of excitement,” Thile says when asked what he’s bringing to Australia. “I’ve only [been over] to play in Australia once before and I had such a great time and, yeah, I know this comes at the risk of sounding like I’m brown-nosing. I really did though. It’s always fun for me, at this point in my career, I mean I know I’m not that old but I have been doing this for a long time and you start to get a sense that you’ve seen a lot of things, and so the experience there is truly different.” His set is sure to be as jarringly eclectic as ever and for Thile, performing is as much about a re-education of audience assumptions as it is about just having fun. “I feel like we need to be reminded that great musicians like Bach should not be listened to with our superior ear on,” he says. “I feel too often when people go to the concert hall to hear Bach I’m surrounded by peo-

ple who are prepared for a night of improvement. It’s like they’re sitting down to read an improving book and they think they’re gonna be better people. I feel Bach or any great musician, the reason why they stood the test of time is that their music was always meant to get your feet tapping as quickly as it was meant to get your brain moving. I’ve constructed the program so that people are ready to listen to Bach with their fun-loving ears as well as to listen to music that they only approach with fun-loving ears with a more serious perspective. We often approach the hallowed halls of great musicians with such reverence that we deprive ourselves of a real, human, red-blooded experience.” From American late night talk show spots to country fairs and orchestral compositions, Thile is constantly reinventing what he does and who his audience is. There must be a fair degree of pressure for him to

maintain the high standard he has set alongside his furiously diverse projects? “I’ve always put a lot of pressure on myself,” he laughs. “It’s like I’m never comfortable unless I’m a little uncomfortable but the one thing I’ve learned is that these potentially uncomfortable dinner parties end up being the most comfortable thing in the world. In cooking, there is such an importance in balance opposite flavours when handled by an expert chef and the same thing goes for music. When you start to combine these seemingly disparate pieces of work though, the more you start to realise all the things they actually have in common. But hell, if it were easy I’d be bored.”

Still riding the financial freedom afforded by the 2012 MacArthur Fellowship, Thile admits that with such a great honour comes even greater expectation. “I tell you what, that award certainly didn’t help things,” he laughs. “They make a lot of the fact that it’s no strings attached but I’ve felt the fire that I lit under myself get a lot hotter. I was so honoured and several heroes of mine are fellows and when I found out about it I actually had difficulty breathing. I mean, I don’t want them to take it back but, yeah, it’s created an intense path.”

way that it interacted with its community. If you go up there for any length of time it gets under your skin a little bit, the way you see Australia and the way people live here. It was more community and culturally based.” For a man with one of the most powerful voices in Australian music, Wilson is soft spoken, though his passion and appreciation for each opportunity in his career is apparent. He gets a little more vocal when talking about a backstage meeting with Bob Dylan at the Palais theatre years ago, when Dylan made an effort to meet the band personally. “That was an extraordinary experience really, we supported him a couple times in St Kilda, did it once and the second time we were all just sitting there waiting for the gig and he walked in,

shook our hands and he said he liked our band. I was blown away; I could play anywhere now, I don’t care what anyone says, you can heckle the hell out of me, but as long as Bob Dylan liked it I don’t care!” Thankfully more people than just Dylan like the music that Wilson covers and creates, and his new live album Live at Cherry (as in Cherry Bar) will be his third live recording of his solo career. “I don’t mind a live recording,” he tells me, and if Bob Dylan likes it, everyone else should probably give it a shot too.

favourites. “I don’t want to mention names because I know I will forget someone important. But actually the Greek metal scene has some very interesting bands. The last five years there has been kind of an explosion, you know – bands are creating very good music and touring constantly.” Perhaps this surge of dark music has something to do with the political situation in Greece, where the environment is currently marred by the rise of neo-fascists. Tolis is less reluctant to discuss his influences, citing Bathory and Kreator as bands he grew up listening to. “I do follow the scene and there are some great bands out there right now, but again I don’t want to mention any names. Touring is a great experience because the bands that we respect the most have attitude. Because for me it is not only music, it is attitude [that matters]. People claim we are too black metal, and we are, much more than mainstream. But we respect the bands that are keeping the spirit alive, that old school category of bands. And that is what we want to be a part of; we want to be in the category of ‘old school’.” Rotting Christ have worked with several renowned producers over the years, including Fredrik Nordström and Waldemar Sorychta of Lacuna Coil fame, but To-

lis remains the driving force behind most of the writing and production. “The last five albums I produced by myself,” he says. “Like I said, I’m an old-school person; I like old-school ways of working, which is do it yourself, you know? The last album I mixed in Sweden, but I’m the guy who produces everything. I even play most of the instruments, except the drums of course, which are performed by my brother. Maybe I would like to work with a famous producer, but I don’t have money for this so I must do everything myself. But also I want to make the music that I am 100 per cent satisfied with.” And while Rotting Christ may sing about the corruption of modern religion, Tolis has not completely turned his back on spirituality. “Spirituality is always needed. Humanity needs to search and find new directions in the future. We’ve got to live on this planet and maybe we can live forever. And maybe we won’t see that, maybe we’ll be dead by then, but I think that is the intention of humanity.”

CHRIS THILE will be performing an exclusive show at Fairfax Studio, Melbourne Arts Centre on

CHRIS WILSON

By Garry Westmore

Looks like it’s going to be a big year for Australia’s premier Blues performer Chris Wilson; he’s got a live album to launch this week and he’s back performing with one of his first bands, Crown of Thorns for the first time in 20 odd years. It’s just another highlight in a blessed career that has seen Wilson record with Paul Kelly and the Coloured Girls, X, Diesel, Hunters and Collectors, and perform with a host of others. “I’m not nostalgic about it,” says Wilson, talking about the late 1980’s, early 90’s when he recorded and performed with many of Australia’s most popular groups. “But I do appreciate how lucky I was.” His vocal, harmonica, guitar and saxophone abilities have led to many guest positions on records, as well as the occasional overseas tour. “I went overseas with Paul Kelly’s band, it was extraordinary, I still think about it. I think; ‘how the hell did that happen?’ It was just amazing.” As was his experience recording with X, whom Wilson loved dearly. “I was always caught in a quandary because I was such a fan that I didn’t want to change what they were doing but I also didn’t want to not be on the stage with them too you know? That was always a dilemma.” Wilson went on to form his own band around the time, Crown of Thorns, but also dabbled with other groups, namely Sole Twisters and neo blues outfit Harem Skar-

em. Chart success beckoned and came through a collaboration with Diesel in the mid ’90s called Short Cool Ones, the success of which surprised Wilson somewhat given the ad-hoc approach the two took. “We were just winging it, we were just going for takes, we weren’t worried; we just played the songs. It was just great fun and then we toured it. Usually it’s the other way round, a band plays live then records, we recorded than went and played live. That was a full on exercise.” In a career of some 30 years in which Wilson has released solo records as well as collaborations; it’s been the most unlikeliest of experiences that have had the greatest impact on him; namely spending a chunk of time in the Northern Territory with little known The Yugal Band. “It just changed my perception of so many things,” he says somewhat wistfully. “Just the way the music was made, the way that band operated, and they

CHRIS WILSON will launch his new album Live at Cherry this Sunday January 19 at Cherry Bar.

ROTTING CHRIST By Jesse Hayward Riding on the wave of their latest album, Rotting Christ are heading to Melbourne to headline Heavy magazine’s HeavyFest alongside a host of local metal bands. They’re legends of the international metal scene – one of the first metal groups to emerge from the Mediterranean region, and who thus defined much of the local sound. Their new album, Kata Ton Daimona Eaytoy (translation: ‘Do what thou wilt’) was released in March this year – the 11th full-length album in the band’s 26-year history. The title phrase refers to the law of Thelema: “Do what thou wilt shall be the whole of the law. Love is the law, love under will.” It’s not an unfamiliar concept in modern music, with mystic, magician and Aleister Crowley immortalised by bands obsessed with dark spirituality; Black Sabbath and Iron Maiden among them. It was Crowley who claimed a supernatural being named Aiwass dictated to him The Book of the Law, wherein the principles of Thelema were defined. But while Rotting Christ draw much from a rich history of mysticism, lead singer Sakis Tolis is quick to distance himself from groups like the Church of Satan. “The album is not about Crowley; we didn’t set out to write about Crowley,” he says. Instead, Kata Ton Daimona Eaytoy explores the ancient history upon which Crowley based his philosophy. Elements of various cultures and myths make their way into the lyrics; for instance, on the first track, In Yumen/Xibalba – Xibalba is the Mayan underworld or hell, ruled by the gods of death. Spooky. Despite these mystical trappings, the band is not proselytising for its own brand of dark spirituality. In response to moralistic outrage from Christian politicians BEAT MAGAZINE PAGE 24

in America during the late ’90s, Tolis said in a statement: “We are not a ‘satanic-crusader’ type of band but rather one of the many bands that represent the dark side in nowadays’ metal music.” Rotting Christ’s music and lyrics explore the dark side without necessarily subscribing to the referenced philosophies. As he explains during our interview: “We have believed from the beginning that all religions are rotten. We don’t believe that there is a God but we don’t have any problem with people believing. As a band I can say we are more agnostic.” Besides, while defining spiritual philosophies is one thing, defining Rotting Christ by genre is another task completely. It’s a common pursuit amongst metalheads – is this or that band brutal death or tech death? Drone or doom? Over the years, Rotting Christ have moved through grindcore to gothic metal and beyond, and as such are fertile subjects for these bitter semantic feuds. Tolis himself is ambivalent. “[We are] metal. You can call it as you want, but metal. We create atmospheric, dark music, black music. You can add any word that you want, but for us it is just metal, because we are metalheads and we love metal music.” Rotting Christ inspired a generation of Greek metal – their success paved the way for many others such as Nightfall and Necromantia. But asked about the current metal scene in Greece, Tolis is reluctant to choose

DISCUSS WHAT? BEAT.COM.AU/DISCUSSION

ROTTING CHRIST will headline this weekend’s HeavyFest at The Hi-Fi on Saturday January 18. Tickets available via the venue website.


MAC MILLER words / augustus welby

2013 was a big year for Pittsburgh native Mac Miller. In addition to turning 21, the rapper released his second album Watching Movies With The Sound Off. The record brought Miller a lot of new fans, notably gaining the favour of many critics who panned his 2011 debut Blue Slide Park. What’s more, Miller switched coasts and recently bought a home in Los Angeles. “I’m going to sign with a notary right now to own a house, so things are good,” he reveals over the phone just before Christmas. The majority of the new album was actually recorded in Miller’s home studio setup. Having the ability to make music so freely has evidently boosted his skills as both a rapper and producer. “I’m constantly making music. It’s disturbing. It seems like all people that make music really work hard and blah blah blah, but it’s actually like a disturbing obsession,” he admits. No matter how disturbing it may be, his obsession is generating positive results. There’s a quite obvious shift from Blue Slide Park to Watching Movies. The first record was rather frivolous and adolescent, whereas the latest record sounds paranoid, dangerous and includes substantial self-reflective lyrics. “I think the more you work and the older you get, and the more you’re committed to what you’re doing, you just learn more about what it means to write a song,” Miller says about his artistic progression. Watching Movies With The Sound Off also features a number of

big name collaborators, including guest vocalists Earl Sweatshirt on I’m Not Real (Earl produces a couple of songs too) and Schoolboy Q on Gees. Miller handled a large proportion of production himself but understandably he made room for Flying Lotus to work on SDS, Diplo on Goosebumpz, and Pharrell leant his unmistakeable touch to Objects In The Mirror. Despite working closely with these talented artists, Miller says he wasn’t tempted to imitate anyone. “As far as approaching a song, it’s something I kind of had to figure out all myself.” Right now the hip hop scene is dominated by rappers of a similar age to Mac Miller. For example, the Odd Future collective, Chance the Rapper and Kendrick Lamar are all in their early-mid 20s. Hip hop has always been youth culture and this generation of MCs are adding something particularly novel to the format. “I think right now’s just a special time. This generation I think is going to do something very special,” Miller agrees. Interestingly, rap music’s reputation for inciting testosteronefuelled feuds has been largely avoided by the current crop of trendsetters. Indeed, Miller doesn’t perceive a negative competitive dynamic. “It’s awesome that everyone’s doing well. It makes you want to be better, but I tend to just compete with myself,” he muses. Something hip hop is also somewhat unfortunately renowned for is mixed success in the live arena. Miller is coming to Australia

for the Big Day Out this month (as well as sideshows supporting Snoop Dogg) and he recognises the issues rappers face in front of large audiences. “There’s people that go out and just feel a lot of energy, which is great. If you listen to the audio back, yeah it might not be the best listenable thing, but in the moment it’s awesome. So there’s time for that but then there’s also a place to perform and instead of people jumping around and going crazy [they’re] just kind of taking it all in. It’s all about the balance of both. You can’t only have people stand there and take it all in because that’s boring but you can’t only have people jump around because, what do they leave with?” Speaking of leaving, the trip down under will force Miller to depart from the domain of his studio, which he says has been a rare occasion of late. “Currently I have a bedroom and a studio separate and I haven’t slept in my bedroom for a couple of weeks. I’ve just been sleeping in the studio.” Given that he’s literally living in the studio, 2014 is set to be another highly productive year for Miller. However, his studio addiction doesn’t always prove healthy. “There’s times when I’m obsessing over trying to finish something but I’m obviously out of juice and everyone in the room – if there’s anyone still in there –doesn’t know what to do because it’s obvious if I’d just gotten sleep I could’ve fixed it,” he reveals.

electronic - urban - club life

Seemingly Miller is not exaggerating and is in fact addicted in the true sense of the word. Thankfully his unwavering persistence does eventually lead him on the right track. “Sometimes, like last night for instance, I worked on a song for like ten hours and then at seven in the morning I decided I’d make another one. The first one was so hard to get down but the second one came right out and it ended up being better than the first.” Miller is only 21 and still has plenty of room to expand his artistry, so such voluminous experimentation should ultimately be to his benefit. However, he should probably gain some life experience outside of the studio, in order to inform his next release. “I think the next step for me is taking some time to step away and collect my thoughts, do some living and then come back and see what I’ve got.”

Catch Mac Miller at the Big Day Out on Friday January 24 at Flemington Racecourse or at the Palace Theatre alongside Snoop Dogg on Wednesday January 22.

facebook.com/macmillerfans

1


UPCOMING

JANUARY

on tour BEN UFO [UK], PEARSON SOUND [UK] Friday January 17, Brown Alley MARCUS WORGULL [GER] Friday January 17, The Liberty Social PETE TONG [UK] Friday January 17, Fabrique DANNY HOWELLS [UK] Friday January 17, Victoria Star JUAN ATKINS [USA] Saturday January 18, The Liberty Social MEDLAR [UK] Saturday January 18, New Guernica KOLOMBO [BEL] Sunday January 19, Revolver Upstairs MATMOS [USA] Sunday January 19, Howler MAJOR LAZER [USA], FLOSSTRADAMUS [USA] Tuesday January 21, The Palace SNOOP DOGG [USA], MAC MILLER [USA] Wednesday January 22, The Palace BIG DAY OUT: SNOOP DOGG [USA], MAJOR LAZER [USA] + MORE Friday January 24, Flemington Racecourse RAINBOW SERPENT: DONATO DOZZY [ITA], MICHAEL MAYER [GER] + MORE Friday January 24 - Monday January 27, Lexton HENRIK SCHWARZ [GER], DANNY DAZE [USA] Friday January 24, Brown Alley ANDREW WEATHERALL [UK] Friday January 24, New Guernica AVICII [SWE] Sunday January 26, Melbourne Showgrounds MOUNT KIMBIE [UK] Thursday January 30, Corner Hotel LAIDBACK LUKE [NED] Friday January 31, 170 Russell JACQUES RENAULT [USA] Friday January 31, Mercat Basement ST JEROME’S LANEWAY FESTIVAL: XXYYXX [USA], MOUNT KIMBIE [UK] + MORE Saturday February 1, Footscray Community Arts Centre XXYYXX [USA] Tuesday February 4, Corner Hotel. YOUTH LAGOON [USA] Wednesday February 5, Prince Bandroom EARL SWEATSHIRT [USA], DANNY BROWN [USA] Thursday February 6, The Palace DVS1 [USA] Friday February 7, The Liberty Social BEN PEARCE [UK] Friday February 7, New Guernica MK [USA] Sunday February 9, Revolver Upstairs DJ SHADOW [UK] Thursday February 13, Prince Bandroom EMINEM [USA], KENDRICK LAMAR [USA] + MORE Wednesday February 19, Etihad Stadium MARCELL DETTMANN [GER] Friday February 21, Brown Alley MARIO BASANOV [LIT], CASSY [UK] Sunday February 23, TBA FLYING LOTUS [USA] Friday February 28, The Forum BRUNO MARS [USA], MIGUEL [USA] Tuesday March 4 & Wednesday March 5, Rod Laver Arena GOLD PANDA [UK] Friday March 7, Corner Hotel GOOD LIFE: DEADMAU5 [UK], KNIFE PARTY [UK] + MORE Friday March 7, Flemington Racecourse MAITREYA: DICK TREVOR [UK], YAHEL [ISR] Friday March 7 - Monday March 10, Sealake GOLDEN PLAINS: PUBLIC ENEMY [USA], FLYING LOTUS [USA] + MORE Saturday March 8 - Monday March 10, Meredith Supernatural Ampitheatre FUTURE MUSIC FESTIVAL: DEADMAU5 [UK], KNIFE PARTY [UK] + MORE Sunday March 9, Flemington Racecourse BATHS [USA] Saturday March 22, Corner Hotel DARKSIDE [USA] Friday April 4, The Palace

banco de gaia wo rd s / rk

Toby Marks hails from Leamington Spa in the UK and without doubt, is one of the electronic world’s most experienced and wellrounded musicians. Initially, Banco De Gaia began as the solo project of Marks himself, who as far back as 1992 produced a multitude of down tempo, tribal and chill-out albums on the World Bank and Planet Dog imprints. Later, in 1997 he expanded to set up the Disco Gecko label that has been home ever since. Fast forward though and he says that 2013 has been full on. “It’s been a pretty hectic year, actually,” chimes the man. “I’ve been broadening my horizons and have started working on a PhD in Electroacousitc Composition which I’m very excited about. I’m also doing a bit of part-time lecturing on top of all the usual Banco and label stuff, so I haven’t had much free time lately. As for Banco, we have some exciting news coming for next year and of course a load of shows shaping up including the trip to Australia, which I am really looking forward to.” Originally, the Banco outfit was a collaboration between Marks and Andy Guthrie – a close friend from university. “I was living in Scotland trying to be a jazz guitarist around 1988/89,” he says. “Andy was playing keyboards in a reggae band and doing a little bit of programming and sequencing for Island Records at the time. I was going back for a visit to Leamington Spa, where Andy and I met and where he still lived and he had a gig lined up. I turned up with a guitar synth and a drum machine and Andy had this really basic sequencer and a couple of synths and we knocked together something resembling acid-house, or

news

the crowd is responding to. I also like to use video whenever I can and have a variety of material to choose from depending on my mood as well.” Summing up, he tell us that this is his third trip to Australia. “I was last there for the Eclipse Festival in Queensland last year, which was amazing. This time around I’ll be playing at Rainbow Serpent and I’ll be doing an uptempo, party kind of set as well as a chill-out set; expect everything from my most banging remix territory to some really mellow, gentle textures. I’m also playing at the Northcote Social Club in Melbourne and I am thinking of doing a more mid-tempo set there, danceable but a bit dubbier and melodic. But who knows? I make it up as I go along each time!”

Banco De Gaia will play at Rainbow Serpent 2014 alongside James Zabiela, Donato Dozzy, The Orb and more which takes place in Lexton from Friday January 24 - Monday January 27. He’ll also perform on Thursday January 23 at the Northcote Social Club. soundcloud.com/bancodegaia

- head to beat.com.au for more

the kite string tangle

off the record w i t h

how we understood it at the time!” Indeed, Banco was always about combining music from all over the world with what he considered contemporary western electronic music – a key part of the concept and the heart of what Banco is about. “What exactly I use musically, tends to depend on what is to hand though,” he claims. “If I’ve been traveling and recording somewhere interesting, or come across a new and exciting sample library perhaps, the kind of material I incorporate is pretty random and not part of some master plan. I’m always looking for new sounds though and one reason I like using ‘ethnic’ sources is that to my western ears, they can sound very unfamiliar, which sparks all sorts of creative ideas I wouldn’t have otherwise. I guess that’s why I got drawn to electroacoustic music and sound art in general, it’s a whole new alien language for me to explore.” Describing his sound then, is something that isn’t going to happen without some difficulty. “I‘ve always used so many varied elements in my music, that after 25 years I still can’t sum it up in one or two words. How about global-ambient-techno-dub-jazz-folk-fusion?” he says in jest. “Basically, it’s a mix of post-acid house electronic dance music in various forms, a bit of techno, a bit of breaks, a bit of dub, a bit of house, mixed with other music and sounds from all over the globe and the occasional jazz, rock or classical twist. I think of myself as a human jukebox these days. I have over 20 years of Banco tunes to choose from too, so I tailor the sets on the fly depending on the vibe, where and when I’m playing and what

t yson

w ray

LinkedIn emailed to notify me that someone got a job at Subway.

Off the back of a stellar 2013, producer on the rise The Kite String Tangle (aka Danny Harley) is darting around the country once more this February. Breakout single Given The Chance gained massive traction online (almost 750k Soundcloud plays to date) and on radio. That single helped secure TKST a place in triple j’s 2014 Next Crop and win the triple j unearthed spot at the inaugural Falls Festival in Byron Bay as well as a completely sold-out national tour last November. These will be TKST’s last shows before leaving to the U.S. (where he has just picked up booking representation by The Windish Agency) to play several showcases at SXSW this March. He’ll be hitting the Northcote Social Club on Saturday February 15.

tour rumours Terrence Parker, Move D, Lexx, San Soda, Len Faki, Legowelt, Redshape, Kito, Reija Lee, Roman Flügel

pete tong

Pete Tong is heading back down to our shores, playing club shows and at the Australian Open. Tong is an institution in electronic music, it would be bordering on blasphemous if you didn’t know who he was. The man behind BBC Radio 1’s Essential Selection, the muse behind spreading awareness about tinnitus in It’s All Gone Pete Tong and the most accessible face of dance music, Tong’s reach is undeniable. Make sure to see the living legend at Fabrique on Friday January 17, with tickets on the door. Otherwise, catch him at Australian Open’s Heineken Live stage on Saturday January 18.

kerser

contact Editor: Tyson Wray / tyson@beat.com.au Production/Cover Design: Gill Tucker / art@beat.com.au Typesetting: Rebecca Houlden Advertising: Ash Bartlett - (03) 8414 9710 / ash@beat.com.au Thom Parry - (03) 8414 8719 / thom@beat.com.au Ali Hawken - (03) 8414 9711 / ali@beat.com.au Kris Furst - (03) 8414 9703 / kris@furstmedia.com.au Patrick Carr - (03) 8414 9751 / patrick@furstmedia.com.au Dan Watt - (03) 8414 9712 / dan@furstmedia.com.au Photographer: Callum Linsell Contributors: Alasdair Duncan, Andrew Hickey, Annabel Maclean, Chloe Papas, Dan Watt, Jo Campbell, Kish Lal, Lachlan Kanonuik, Leigh Salter, Miki McLay, Morgan Richards, Nick Taras, Nina Bertok, Richie Meldrum, RK, Rose Callaghan, Ryan Butler, Simon Hampson, Tamara Vogl Deadlines: Editorial: Friday 2pm Advertising: Monday 12pm Publisher: Furst Media - 3 Newton Street, Richmond (03) 9428 3600 | beat.com.au

2

Kerser has returned with his third album S.C.O.T. Proving to be his most popular release yet, chart results shocked critics nationally during the day of release. S.C.O.T maintained a strong position at #2 on the overall iTunes charts, second only to international pop superstar Katy Perry. A week later it was announced that S.C.O.T had secured #5 on the main ARIA Charts and #1 on the ARIA Urban Charts. With a national tour ahead of him across four states including a revised date for Newcastle, Kerser will be flanked by some of the freshest Australian hip hop talent including Jay UF, DJ Victor Lopez, Dazastah, Fortay, Willis, Tycotic, Flu AKA Fluent Form, MDMA, Omac, Dwizofoz (feat Flowz), Bitter Belief, Complete, Edukate, Lariken, Classic Example and The Kid. Catch him at The Hi-Fi on Saturday February 15.

titty twister laidback luke

Laidback Luke is returning to Australia. One of the most important figures in Dutch house, Laidback Luke is an innovator and a DJ in a league of his own. Injecting his fans with unadulterated excitement at every set he plays, he has managed to keep things fresh for over 15 years. Now as he heads back to Australia off the back of his new single, Blow which he collaborated on with Martin Solveig, fans can look forward to an amazing show. Make sure to head to 170RUSSEL on Friday January 31.

Melbourne’s one and only den of depravity and fast times returns with a 2014 stamp of certified insanity and more fucked up fun times then you can shake a snake at. The event they tried to censor is ready to take Melbourne city by the horns like so many did on the mechanical bull, twisting another titty on the fresh stomping ground that is Brown Alley. It’s going down on Saturday February 8. This is the Titty Twister; the most outlandish honky-tonk ever to hit Melbourne. Inspired by Robert Rodriguez’s mid ‘90s grind house cult classic From Dusk Till Dawn, it is live music, entertainment and all night carnage rolled into one.

citizen kay

jonathan toubin

For the first time ever, New York Night Train’s Jonathan Toubin will be bringing his show to Australia and New Zealand. After conceiving Soul Clap and Dance-Off in 2007, Toubin has gone from underground New York venues to some of the world’s most prestigious festivals, only spinning unique and rare 1960s soul 45”s along the way. The New York DJ is now taking his show to Australia and New Zealand for a six-stop tour. Jonathan Toubin will be playing the Copa Cabana on Monday January 20.

pigeon

Brisbane electro-pop outfit Pigeon have unveiled a string of shows in support of their forthcoming sophomore EP Settle In. Due out later this month, the EP’s first two singles, Curtain Call and Two Moon Love exhibit the five piece’s penchant for brass, raw piano, electric bass and anthemic vocals. Pigeon will play Boney on Thursday February 27.

electronic - urban - club life

Kicking off the Australia Day Long Weekend, Citizen Kay will be playing a show at Melbourne’s Ding Dong Lounge. After performances at Falls Festival and The Plot, capping off six months that saw him take over stages and airwaves around Australia following the release of his debut EP YES!, Kay has welcomed 2014 with his sophmore single Raise A Glass. In support of the single, Kay is playing a show in Melbourne and bringing Dylan Joel with him. Citizen Kay will be playing Ding Dong Lounge on Friday January 24.


       !" !      "!  ! "#  " "           "  "  " " "      #     ! " "  !   # MIKE  $   !! "!  AND MORE ...

4 DAY INTERNATIONAL MUSIC, ARTS AND LIFESTYLE FESTIVAL   

TICKETS ON SALE NOW

MUSIC

ARTS

LIFESTYLE

www.rainbowserpent.net

MUSIC / ART / LIFESTYLE / PERFORMANCE / MARKET VILLAGE / WORKSHOPS / HEALING / CAMPING G

electronic - urban - club life

3


club guide wednesday jan 15

snaps bimbos

DJ FLIPSIDE KARL Fitzroy Pinnacle, Fitzroy North. 4:30pm. MIDNIGHT SOUL ENSEMBLE - FEAT: MZRISK Lounge, Melbourne Cbd. 10:00pm. THE DINNER SET - FEAT: BACON BOOTY DISCO Revolver Upstairs, Prahran. 8:00pm.

thursday jan 16 ... - FEAT: LA POCOCK + MUGEN Lounge, Melbourne Cbd. 10:00pm. 3181 THURSDAYS - FEAT: HANS DC + JESSE YOUNG + JOHN DOE + MATTHEW BUTTERS + SAM GUDGE Revolver Upstairs, Prahran. 6:00pm. SPARE GROOVE - FEAT: DANNY HOTEP + LA POCOCK + SALMON BARREL Ferdydurke, Melbourne Cbd. 8:00pm. TIGER FUNK LIVE - FEAT: DJ MOONSHINE Bimbo Deluxe, Fitzroy. 9:00pm.

first floor

lucky coq

friday jan 17 BEAT THE BUSH - FEAT: COOCHIE HUGGINS + JIMMY CAUTION Ferdydurke, Melbourne Cbd. 8:00pm. BEN UFO + PEARSON SOUND Brown Alley, Melbourne Cbd. 8:00pm. $23. CQ FRIDAYS - FEAT: VARIOUS DJS Cq, Melbourne Cbd. 9:00pm. EPIC - FEAT: CODE BLACK + AHMET + ARCHITECT + HEATH RENATA + HOLLY J + JOEL FLETCHER + SOUND CHECK + STEVE STRANGIS + TENSAI + THE ORIENTALS + ZAC DEPTRO Trak Lounge Bar, Toorak. 9:00pm. GET LIT - FEAT: D’FRO + HANS DC Lounge, Melbourne Cbd. 10:00pm. LA DANSE MACABRE - FEAT: DJ MACHETE BROTHERS Rainbow Hotel,

Fitzroy. 10:00pm. PULL UP SELECTOR - FEAT: DJ PIT + ANDY ITES + CHANT DOWN SOUND + DJ AGENT 86 + KID MILITAN + SISTA ITATIONS Red Violin, Melbourne Cbd. 10:00pm. REVOLVER FRIDAYS - FEAT: DJ LEWIE DAY + DJ MIKE CALLANDER + DJ KATIE DROVER Revolver Upstairs, Prahran. 7:00pm. RUBIX FRIDAYS - FEAT: WORDSMITHS Rubix Warehouse, Brunswick. 8:00pm. TOMORROW NEVER COMES - FEAT: PLEASUREKRAFT + DOORLY Brown Alley, Melbourne Cbd. 8:00pm. $30. TUNES BY DAVE GRAY Gem Bar, Collingwood. 8:00pm.

saturday jan 18 BABA X + 2XXXX + BUBBLE TOWN BABE CREW + DJ JAMES TOM + FREEJACK + LUCY DITTY Ferdydurke, Melbourne Cbd. 8:00pm. CLUB FICTION - FEAT: KITTY ROCK & THE BAD LADIES Red Bennies, South Yarra. 11:00pm. DJ SOUL LOCO Retreat Hotel, Brunswick. 3:00pm. MELBOURNE FREESTYLE CRUSADER Revolver Upstairs, Prahran. 8:00pm. MIAMI HORROR DJS + TOUCH SENSITIVE DJS Brown Alley, Melbourne Cbd. 8:00pm. $29. SUPER GRANDE - FEAT: CC:DISCO + DIGITAL PRIMATE Lounge, Melbourne Cbd. 10:00pm. TRENDY FRIENDS - FEAT: DJ TRANTER + J.D.MAR + VOTEFORSCOOTER Boney, Melbourne Cbd. 10:00pm. TUNES BY PAT BOURKE Gem Bar, Collingwood. 8:00pm.

7”S & 12”S VINYL SALON - FEAT: VARIOUS DJS Retreat Hotel, Brunswick. 3:30pm. CARIBBEAN COOKOUT - FEAT: JESSE I + BAHDOESA + BUMAYE + DD + LOTEK + MONDO LOCO + MR FISH + RAS CRUCIAL + SISTA SARA + SISTA ZAI Ferdydurke, Melbourne Cbd. 8:00pm. COCOA JACKSON LANE - FEAT: PINA TUTERI + DARK FAIR + DJ ANT1 Bendigo Hotel, Collingwood. 6:00pm. $12. DJ TECH-NO SHIT Edinburgh Castle, Brunswick. 6:00pm. MATMOS + ALWAYS + ANDREW TUTTLE + DJ SIMON WINKLER Howler, Brunswick. 8:00pm. $31. MATMOS + ALWAYS + ANDREW TUTTLE + DJ SIMON WINKLER Howler, Brunswick. 8:00pm. $39. PANDORA SUMMER SESSIONS ON THE SAND - FEAT: VARIOUS DJS 5:30pm. PLEASURE PLANET - FEAT: BEENAK + DREW JUGUM + HAROLD + REECE WALKER + SOT & PWD Lounge, Melbourne Cbd. 2:00am. $10.

snaps khokolat koated

monday jan 20 MIXTAPE MONDAYS - FEAT: VARIOUS DJS Rubix Warehouse, Brunswick. 8:00pm.

tuesday jan 21 MAJOR LAZER + FLOSSTRADAMUS Palace Theatre, Melbourne Cbd. 9:00pm. $72. TASTEMAKERS - FEAT: DURBAN POISON + ABLE8 + CUT N PASTE Lounge, Melbourne Cbd. 10:00pm.

be. at co.

urban club guide friday jan 17

HIP HOP &AMP; R&AMP;B CREW LOVE - FEAT: DJ TONY SUNSHINE Sub Lounge, Melbourne Cbd. 11:00pm. $15. FAKTORY - FEAT: DJ DAMION DE SILVA + DJ DURMY + DJ K DEE + DJ YATHS Khokolat Bar, Melbourne. 9:30pm. LIKE FRIDAYS - FEAT: BROZ + DIR-X + S DINESH + NYD + SEF + SHAGGZ + SHAUN D La Di Da,

Melbourne. 8:00pm. SWEET NOTHING FRIDAYS - FEAT: DJ MARCUS KNIGHT + DJ XANDER JAMES Temperance Hotel, South Yarra. 9:00pm.

saturday jan 18

HIP HOP &AMP; R&AMP;B SATURDAY NIGHTS - FEAT: DJ DAMION DE SILVA + DJ JAY SIN + DJ K DEE Khokolat Bar, Melbourne. 9:30pm.

workshop

4

sunday jan 19

sunday jan 19

HIP HOP &AMP; R&AMP;B OPEN DECKS Thornbury Local, Thornbury. 7:30pm.

monday jan 20

HIP HOP &AMP; R&AMP;B FREEDOM PASS - FEAT: PHIL ROSS + B-BOOGIE + CHRIS MAC + DOZZA Co., Southbank. 10:30pm.

faktory

electronic - urban - club life


UNKNOWN MORTAL ORCHESTRA

By Daniel Prior

Humble beginnings are a rare thing in bands, especially ones where they know they’re onto a unique and powerful sound. The restraint and patience involved are often beyond band members; it is simply too strong a temptation to throw your hands up and yell to the world, “It’s us! We’re the one’s you should be adoring! Give us your love and praise!” Unknown Mortal Orchestra managed to maintain their composure when the single Ffunny Ffrends appeared on the internet with no information or credits listing who created it. The song’s popularity took off and roaming packs of bloggers began an internet manhunt to discover who made this wonderful single. Ruban Neilson, formerly of New Zealand experimental rock-pop band The Mint Chicks and founding member of Unknown Mortal Orchestra, eventually raised his hand and took credit for the track. “When I first started, I thought it would be more basic: Someone would like the song, they’d listen to it and that would be that. When it started taking off, it was funny because no one knew who made the music, and I didn’t want anyone to know it was me, I mean, even my family didn’t know I had started making music again. It wasn’t me trying to hide or anything, I just didn’t think the knowledge of my involvement was a necessary factor for the song’s popularity. And I was right.” A beginning as humble as that only made Unknown Mortal Orchestra’s success that much more impressive. After finally

being ‘outed’, the band went all out, releasing their debut selftitled record in 2011 via Possum Records. The album won the Taite Music Award, as well as being nominated for Best Alternative Album at the New Zealand Music Awards (with Ruban himself winning Best Male Artist). More recently, the band has won several awards for their second album II. “It’s a bit weird to go from our quiet beginnings to winning awards and having such notice and reception. I’ve been working so hard for so many years now that it doesn’t seem as weird as it used to. When we first started getting noticed, there was a bidding war between my favourite labels to sign us. That was weird. To have such amazing labels fighting over each other to get us, it was pretty surreal. It doesn’t feel that weird now because it just feels like my job.” No matter what beginnings the band may have had, the band’s success was never in question, thanks to the incredible sound and atmosphere their music possesses. Driven by an intoxicating groove, the band’s simple and psychedelic sounds are underlined by the expansive tones and atmosphere evident in all their songs.

“Our music usually starts out with a sound. I’ll mix with a pedal and a mood and an ambient noise; some pretty weird sounding stuff basically and then I’ll start working to get the atmosphere and mood right before we begin to turn it into a more understood song.” On top of their musical signature, the band have also gained quite the reputation for non-stop touring and partying. After the release of their Blue Record EP, the band went on tour for almost a year straight. II was also conceived and written while on tour. Ruban finds that both touring and studio time have their equal but very separate effects on the band. “I like them both the same, even though they’re opposites. I’ll do one and then want to do the other. I definitely need to do both of these things. It’s like I’ll want to be alone and write and record music, and I enjoy doing that, but if I do it too long it starts to feel as if I’m unemployed and I begin to wonder what’s going on in the world outside my door. So we go touring and it feels great again, very freeing while having that sense of work and accomplishment. The downside is that we can get strung out and narky with each other and need some alone time, which is difficult to do when you have to work with the same people day in day out for such a long time.” The high physical and emotional strain that touring takes on a band and its members is well documented. “We party a lot. It’s one way to deal with the stress. It’s prob-

ably the best way. But, I mean, we think about it a lot and we always worry about moral. Like, if everyone has been working too hard, I’ll send everyone to a spa, tell them to get a massage. Everyone can get a bit touchy, and it’s a weird thing to be stuck with the same people all the time, you have to be careful not to annoy anyone. “I mean, I bought everyone a present for Christmas recently so right now, everyone is still in high spirits!” Booked for a performance at the St Jerome’s Laneway festival this year, as well as other tour dates across Asia, Australia and New Zealand, Unknown Mortal Orchestra is lining up for another big year. “I’m looking forward to going to China, I’ve never been there before and I’m quite excited. Also coming back to NZ and Aus and hanging out with some friends there. The St Jerome’s Festival will be great, the band will still be touring and it’ll be awesome, but we won’t be touring as much, instead we’ll be getting some studio time to get the next album ready. It’s going to be a good year.”

The casual manner in which Wayman details the evolution in the band’s sound is at first incredibly off-putting, as if the band stumbled upon a new direction. The hazy, wandering spirit of The Fool is still present on the new record, sure. And Wayman’s refusal to give definitive answers insists that the band’s evolution is simply underway, or even just beginning and they’ve still got a long way to go in terms of understanding exactly who they are as a band. The process may now be taking longer than one might expect for Warpaint. There’s glimpses of a more relaxed band that is enjoying the process throughout Warpaint, particularly during the build in the first single, Love Is To Die. Perhaps this is the new Warpaint: a fun band that doesn’t demand as much from listeners. But again, as Wayman illustrates, it may be too early to tell. “There’s so many tried and true ways of constructing a song and we’re just trying to figure out the best way for us to construct a Warpaint song,” she says in relative earnest.

“We all like a bit of the avant-garde and we all like a bit of the straightforward stuff. We’re all on the same page. We didn’t want to be cluttering the stage so much and we wanted to be in constant conversation with each other.” For Theresa Wayman and Warpaint, conversation seems to be important. Whether those conversations do indeed lead to a more focused band still remains to be seen. “I really appreciate the ability to hone in on an amazing bassline or an amazing drumbeat or a killer melody,” she says pointedly. “I don’t think it should be much more complicated than that. You should be able to hear what we’re doing without trying too hard.”

UNKNOWN MORTAL ORCHESTRA will grace the St Jerome’s Laneway Festival on Saturday February 1 in Footscray, alongside priceless acts Mount Kimbie, Danny Brown, Earl Sweatshirt, Jamie XX and many many more.

WARPAINT By Joshua Kloke It took well over three years since the release of their critically acclaimed debut The Fool for Warpaint to release their self-titled sophomore full-length. Waiting that long to capitalize on a successful debut isn’t usually a safe plan for most acts, however for the Los Angeles-based four-piece, the three-year gap and the sense of patience they had to employ ultimately ended up being beneficial to the band’s sound. “We were forced to be patient,” admits guitarist Theresa Wayman. “I didn’t want to be patient at all, I wanted to start recording as soon as possible. When we recorded The Fool we hadn’t really left Los Angeles and there was a whole world out there that we hadn’t seen and didn’t end up seeing until we finished with The Fool. We changed a lot when we played every night.” Wayman hums and haws throughout our twenty-minute conversation, often getting distracted by others in her Los Angeles home and only perking up when the topic of Toronto’s embattled mayor Rob Ford comes up. She details the changes the band underwent in the lead-up to their new record slowly and somewhat abstractly but insists they were necessary changes. “We were eager to express all the things we’d realized about music,” she says of Warpaint. What Wayman and the band learned is reflected in a leaner, more focused record. Many of the band’s critics noted that

The Fool stretched itself too thin at times and lacked a cohesive thrust. So when pressed further upon what exactly Wayman and Warpaint realized about their music, she does eventually deliver a succinct answer. “We wanted to simplify things on this record, if only to stop jerking people around,” says Wayman amidst a constant loud voice in the background. “I’d see the audience generally getting into certain parts of the song and they were the parts that I liked best. And I’d get excited, but then I realized that as much as our fans were getting into the song we were going to throw them a left turn in about ten seconds. Our fans weren’t always sure where the song was going because that was our M.O. at that point. We never wanted to stay in one spot for too long because that’s what pleased us.” Wayman concedes that the lean, at times parsed sound of Warpaint “might not be what people were expecting from us,” and that “it feels very different to play these songs.”

WARPAINT will be performing at this year’s Laneway Festival on Saturday February 1, alongside Mount Kimbie, Jamie XX, Earl Sweatshirt, Danny Brown and many others. Warpaint is available this Friday January 17 via Rough Trade/Remote Control.

60 SECONDS with MARK from FRACTURES Define your genre in five words or less: Dark, atmospheric, sombre, sadness-inducing. What can a punter expect from your live show? A more lively (sorry) approach and sound – a lot less restrained than the recorded versions. When’s the gig and with who? The gigs are Saturday January 25 at The Toff with Yeo and Saturday February 1 at Brighton Up Bar with Goldsmith.

Why should everyone come and see your band? Because our ticket pricing is very competitive, especially in this economic climate and we’re very good and tight. So, come. What makes you happiest about what you’re doing? The fact that people outside of my friends, acquaintances, family, etc, are taking the time to listen to it, and invest in it. Makes it all seem a bit more worthwhile and attainable.

If someone made a movie about your life, who would play you? Cuba Gooding Jr. and Sandra Bullock. One as a young Mark and one as the more mature Mark. I won’t tell you which is which.

What makes a good musician? Never being satisfied with mediocrity – always trying to improve in every aspect.

Banco De Gaia 100% live "The master of Worldtronica" Thursday January 23rd Northcote Social Club Support from Deep Fried Dub, Sunsaria and DJ Dom Hogan. Decor by Kundalini Enquiries: baz.bardoe@hotmail.com

Tickets $17 (+$3 BF) on sale via www.northcotesocialclub.com Phone bookings on 1300 724 867 or in person from 10am-8pm Monday to Saturday via Corner Box Office 57 Swan Street, Richmond

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES..... WWW.BEAT.COM.AU/TV

BEAT MAGAZINE PAGE 29


INDUSTRIAL STRENGTH

MUSIC INDUSTRY NEWS & GOSSIP

With Christie Eliezer * Stuff for this column to be emailed to <celiezer@netspace.net.au> by Friday 5pm

MELBOURNE VENUES AUSTRALIA’S MOST SUCCESSFUL

DJ MAG LAUNCHES IN AUSTRALIA

Melbourne venues proved to be Australia’s most successful according to global live music bible Pollstar. In its Top 200 roundup for 2013 for biggest global ticket sellers, the magazine listed The Corner Hotel at #13 in the world after selling 136,357 tickets through the year. At #91 was the Northcote Social Club with total sales of 40, 158. No clubs in any other Australian city made it to the category. The Rod Laver Arena was the most successful Australian arena, ranked globally at #6 after shifting 894,629 through the year. Three other Australian venues made it into the Top 200 Arenas list. Sydney’s Allphones Arena ranked at #11 with 640,328 customers. Brisbane Entertainment Centre was at #20 with 493.601. At #55 was the Sydney Entertainment Centre with 267,730. The Myer Music Bowl made it to #43 in the Amphitheatre section (131,582) with Brisbane’s Riverstage at #97 with 23,960. Palais Theatre was #37 with 152,497 paying customers in the last 12 months in its category, with Brisbane’s Convention and Exhibition Centre with 79,999. A Melbourne venue headed Australian entries in Festivals/ Outdoor Sites. Etihad Stadium was at #30 with 151,244 tickets. Bluesfest and Tyagard Tea Tree Farm in Byron Bay was #44 with 104,244; Brisbane’s Suncorp Stadium at #63 with 81,223; and Sydney’s ANZ Stadium at #89 with 60,150. Frontier Touring sold the most tickets of all Australian promoters, ranked #20 globally with 972,062. Chugg Entertainment (480,328 tickets), Nine Live (471,553), Dainty Group (325,301) and Adrian Bohm Presents (260,104). Live Nation Australasia’s sales were included with its American parent but it would have rated high from just Pink (500,000) and Beyonce (348,406) alone.

After a soft bow on New Year’s Eve, international dance music magazine DJ Mag will launch an online Australian version next month. Its office is in Sydney, with 10 journos working under editor Victor de la Serna who set up the title in Spain in 2010. The Australian version will feature international and local content, and de la Serna reckons it will get 60,000 unique viewers in its first month.

MEASLES OUTBREAK FROM RAP COMP CONTINUES The measles outbreak at the Asia-Pacific finale of the World Supremacy Battleground hip hop competition – at Sydney’s Olympic Park on December 7 attended by 2,000 people – continues to create grief. A contestant from the Phillipines infected 14 others from other cities in Australia and New Zealand including Melbourne. The four NZ contestants returned home and infected six others. Last week, an attendee brought it to Canberra, with ACT Health forced to issue a health warning. It was the first case of measles in Canberra since 2011.

RAINBOW SERPENT CONFIRMED The 17-year old Rainbow Serpent electronic music and arts festival returns to Lexton, in the Ballarat area, January 24-27 after Pyrenees Shire Council granted it a permit. But it is still under strict safety security after the 2012 death of 34-yearold Epping man Daniel Buccianti from bad acid. The event almost got the chop last year when its permit failed to satisfy extra security demands. This year the application went smoothly. It draws 10,000 a year.

BILLBOARD RENAMED 170 RUSSELL After 40 years, the 900-capacity venue Billboard has changed its name to 170 Russell, after its street address in Chinatown. It has also outsourced its booking to Corner Booking which handles the Corner Hotel and the Northcote Social Club. Bookings are through info@cornerboxoffice.com.au or 1300 724 867. Venue contacts are Eric at eric@170russell.com or (03) 9639 4000 and Cat at cat@170russell.com or (03) 9639 4000.

PETE TONG AWARDED MBE UK club DJ and radio presenter Pete Tong was awarded an MBE (Member of the British Empire) in the UK’s 2014 New Year’s Honours. Tong, in Australia this week, was the first DJ to be lauded, and the only contemporary name on this year’s list. Said Tong: “I’m proud that it acknowledges a profession that I care about a great deal, and one that’s made a huge impact around the world.”

RED TAPE SNIPPED FOR MUSIC VENUES Music venues were among recipients of 36 red tape reforms announced by the Victorian Coalition Government to boost productivity and reduce costs for Victorian businesses. These included Building and construction, mining, farming and fishing as well as easy ways for veterans to gain travel passes and allowing under-18s to finally be able to buy plastic knives. The ones governing the music industry include making it easier for small venues to get permits and approvals if they decide to host live music. Established venues no longer need to get approval to hold alcohol-free underages and mix-aged live music events on licensed premises. Venues that want to change their liquor licence will have to apply only to the Victorian Commission for Gambling and Liquor Regulation for approval, and not to the local council. One-off events needing a temporary liquor licence now merely have to advice authorities eight weeks out of their plan to get one. See Music Victoria and the Premier Dept’s websites for full list. These changes came as a result of consultation with the local music industry, spearheaded by the state’s peak music association Music Victoria. The removal of red tape still does not cover the all-important Agent of Change which declares that anyone who moves into an area that already has a live music venue cannot complain about its noise. But Planning Minister Matthew Guy has indicated that it is still on the agenda to be introduced at a later date. Music Victoria’s Patrick Donovan said, “We welcome the Government’s initiative to remove onerous requirements in the building code which discriminate against live music, as well as the statement of the Minister for Planning to implement the Agent of Change principle and give it statutory weight. Collectively, these reforms will ensure a more vibrant future for artists, venues, and the music loving public.”

MERCURY WHITE WIN EMERGENZA COMP Melbourne band Mercury White won the Emergenza Competition For Unsigned Bands national (with over 300 bands competing) at the grand finale in Sydney. They now represent Australia at the world final at the Taubertal Festival in Germany in August before 20,000 people. Mercury White fuse the styles of space rock, progressive rock, alternative rock, symphonic rock and electronica.

AWME ARTIST SHOWCASE APPLICATIONS OPEN Artist showcase applications for the 7th Australian World Music Expo (AWME) have opened until Friday May 2 at awme.com. au. Over 500 international and local music industry heavies are expected to attend. Past acts to showcase have landed overseas festival slots and management/booking deals.

THINGS WE HEAR • Vampire Weekend told triple j that they faced a dangerous situation onstage on New Years Eve at the Falls Festival in Lorne as the clock struck midnight. Someone threw a flare and almost hit bassist Chris Baio on the head. Video footage showed that the man who threw the flare had himself been hit on the head by the flare half a minute before thrown by another audience member. • The January 26 Grammys are shaping up with exciting live performances. Daft Punk’s second appearance on the awards show (their first was in 2008) sees them joined by Get Lucky collaborators, Pharrell and Nile Rodgers and a cameo by Stevie Wonder. The Eurythmics are reuniting to do a Beatles song. • Sevendust pulled out of Soundwave in a “pissweak” move after promoter AJ Maddah turned down their request for more money. • The 26th Midsumma Festival, Melbourne’s annual celebration of queer culture, drew an estimated 90,000 people to Alexandra Gardens on Sunday. Premier Denis Napthine who launched the event, announced Victoria would become the first Australian state to erase the criminal records of men previously convicted of having gay sex. “We are proud of our diversity in this great state,” he said. • Lorde might have signed a multi-million dollar publishing deal and Royals might have sold 5 million in the US, but she still walks around Auckland with her boyfriend James in a $3 dress from a thrift shop. • This year’s Coachella festival in California features the most amount of Aussies to be on the bill: Flume, Jagwar Ma, Empire Of The Sun, The Preatures, Flight Facilities and Anna Lunoe. • In a Twitter Q&A, Paul Stanley responded “No way” when asked if Kiss would play with original members Ace Frehley and Peter Criss at their Rock and Roll Hall of Fame induction. • Noel and Liam Gallagher might be feuding but they met at a family wedding in Ireland and talked about opening a bar together with their mum. • A 68 year old from Staffordshire, UK, who had his CD player and electrical gear confiscated from his home for playing Frosty The Snowman, Motown hits and Martin Luther King Jr’s iconic ‘I Have A Dream’ speech at full volume will now be evicted after he threatened two neighbours who complained.

$10,000 GRANT FROM HILLTOP HOODS An emerging Australian hip hop/soul act is in line to win a $10,000 grant from the Hilltop Hoods to help record and promote their debut album. Applications opened this week for the 2014 Hilltop Hoods Initiative and close on February 28. The winner will be announced on March 27. The prize also includes legal advice courtesy of David Vodicka and Media Arts Lawyers, Zoo York and Shure Microphone packs. See www.apra-amcos.com.au.

27 AUSSIE ALBUMS MAKE IT TO 2013 BEST SELLERS LIST As far as Australian acts were concerned, Flume and Vance Joy were the biggest Australian sellers through 2013. Overall, Pink’s The Truth About Love was the largest selling album, and Katy Perry’s Roar the biggest single. Joy’s Riptide was at #12 while Flume’s self-titled debut was #11 in the album section. Australian artists represented strongly with 13 of the top 100 singles and 27 of the top 100 albums. Names included Birds of Tokyo, Matt Corby, The 12th Man, Russell Morris, Bliss N Eso, Troy Cassar-Daley & Adam Harvey, Human Nature and X-Factor’s Dami Im and Taylor Henderson.

LIFELINES Married: former EMI Chairman Mark Poston and stylist & creative David Bonney tied the knot in Sydney with Paul Mac as musical director. Injured: Lukasz Chomentowski, owner of Warrnambool music venue The Last Coach was king-hit from behind while walking home. Bruising to his back suggest the attackers might even have kicked him when he was down. He says he has no enemies, and the attack was not a robbery. Hospitalised: John McVie of Fleetwood Mac is set for surgery for his cancer. Injured: a Texas man selling Jay Z concert tickets via Craigslist was contacted by two women who asked to meet him at a parking lot of a Starbucks shop. When the man leaned into the car to show the tickets, they grabbed them and drove off, dragging the man along. He ended up with broken legs and arms and needs plastic surgery. Police turned up at the concert and found the women seated at the assigned seats and arrested them. In Court: 50 Cent lost a bid to throw out a lawsuit by his rival Rick Ross’ ex-girlfriend, Lastonia Leviston. He got his hand on a sex tape in 2010 that a man made with Leviston and put himself on the tape as a character named Pimpin’ Curly, a dig at Ross. She sued. He tried to argue that he was not responsible for the tape leaking onto the internet, and that it was “legally fair to use the images.” The judge didn’t buy it, saying the woman had felt suicidal as a result of the tape. In Court: Gold Coast IT student David Matthew O’Brien, 22, who sold fake tickets to Pink’s sold-out Brisbane show and the Soundwave festival through Gumtree was ordered to repay his victims $4185 within six months. He pleaded guilty to 13 counts of fraud in the Southport Magistrates Court. He was also sentenced to two years’ probation and 200 hours community service. Suing: Insane Clown Posse and four of their fans took legal action against the FBI and the U.S. Department of Justice after they labeled the act’s fans, the Juggalos, as “a loosely affiliated hybrid gang.” Died: Ricky “Lord Infamous” Dunigan, 40, founder of Three 6 Mafia, was found dead in his mother’s home in Memphis, of a heart attack. They were the first rap band to win an Oscar in 2006 for It’s Hard Out Here For A Pimp. Died: US drummer Ricky Lawson, from a brain aneurysm suffered after a nightclub gig. A founding member of The Yellowjackets and co-writer of their Grammy Award-winning And You Know That. He also worked with Michael Jackson, Whitney Houston, Steely Dan, Eric Clapton and Lionel Richie.

Perform. Record. Manage. Animate. Design. Capture. What will your creative future look like? Degrees and Diplomas in Music, Audio, Entertainment Management, 3D Animation, Game Design and Film and Television. Open Day 17th January 2014. Register online today.

Your creative future starts today. Visit jmcacademy.edu.au or call on 1300 410 311.

BEAT MAGAZINE PAGE 30

FEE-HELP available. facebook.com/jmcacademy

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


education SPECIAL BEATâ&#x20AC;&#x2122;S EDUCATION SUPPLEMENT ALLANS BILLY HYDE ACADEMY ADDRESS: 152 Bourke Street, Melbourne CBD. PHONE: (03) 9510 4455 EMAIL: bourke.academy@allansbillyhyde.com.au WEBSITE: www.allansbillyhyde.com.au/Academy/Melbourne

Some people believe you are just born with a musical talent. The truth as Allans Billy Hyde Academy teaches, is that anyone can develop music skills with the right guidance! Located in the heart of Melbourneâ&#x20AC;&#x2122;s CBD the Academy teaches guitar, violin, piano, drums and vocals. Ideally suited for people who work in the city or are joining the increasing number of permanent residents, who want to incorporate music into their working week, the academy offer private air-conditioned teaching rooms on the first floor of their iconic city retail store. The rooms are fitted with all the best gear from world famous brands and they provide their students with exclusive discounts when purchasing in store. Lesson times can be flexible to cater for your needs, whether a lunch time suits, or lessons on the weekend work better. They operate lessons at the Academy during store opening hours and cater for all ages and levels of experience. For a limited time only, they are offering a no obligation FREE trial lesson so prospective students can view the updated rooms, the fantastic new performance stage and meet one of the Academyâ&#x20AC;&#x2122;s teachers to discuss their musical objectives and their individual tuition options. ABH Academy also run The SoundLab Music School in Prahran. Contact ABH co-ordinators now to book a FREE trial lesson on (03) 9510 4455 or email your name and contact number to: bourke.academy@allansbillyhyde. com.au and check out their website for staff bioâ&#x20AC;&#x2122;s and all the finer tuition options.

COLLARTS

OPEN DAY: Saturday January 18, 10am to 3pm. ADDRESS: 55 Brady St, South Melbourne, VIC 3205. TELEPHONE: (03) 9281 8888 EMAIL: info@collarts.edu.au WEBSITE: www.collarts.edu.au

Collarts are all about creative, exciting events and their Open Day on Saturday the 18th of January will be no different. The day will feature live music performances, DJ lessons, course presentations from industry leaders, the chance to check out the collegeâ&#x20AC;&#x2122;s state-of-the-art facilities, the opportunity to talk with current and graduate students, goodie bags, tasty treats and a general festival vibe, which will last from 10am to 3pm. You will also gain insight into what a degree at Collarts involves â&#x20AC;&#x201C; whether you are looking to study Audio Production, Entertainment Management, or Music Performance â&#x20AC;&#x201C; Collarts are Victoriaâ&#x20AC;&#x2122;s leading music-industry educators. The collegeâ&#x20AC;&#x2122;s courses will connect you with industry professionals, will allow you to gain hands-on practical experience and skills, and you will be surrounded by a great network of peers. All degrees are accelerated, which means that they are completed within two years â&#x20AC;&#x201C; so students are out in the field doing what they love as soon as possible. If you dream of a career in the music industry, the Collarts Open Day is the first step to starting a career you love. For more information or to register your attendance visit www.collarts.edu.au or phone (03) 9281 8888.

6RPHSHRSOHEHOLHYH\RXDUHERUQZLWKPXVLFDOWDOHQW 7KHWUXWKLVHYHU\RQHFDQGHYHORSPXVLFVNLOOVZLWKWKHULJKWJXLGDQFH

"   *8,7$5_9,2/,1_3,$12_'5806_92&$/6

)5((7ULDO0XVLF/HVVRQ

"!;% ;" ;# *8,7$56_.(<6_'5806_92&$/6_(9(176 7KH6RXQG/DELVDQHSLFHYHQWVSDFHDQGVWDWHRI !-* 271)&'.56-*2++.(.&/67.6.21567).2+246-*&//.15 WKHDUWPXVLFWXWRULDOVWXGLRRIIHULQJXQLTXHLQWHUDFWLYH  //&15.//::)*(-&.12+4*6&./5624*5$*&4*&/52 VHVVLRQVIRUDOODJHV7KH6RXQG/DELVWKHRIILFLDO 3427)/:&++./.&6*)9.6-6-*025634*56.,.275.156470*16 WXLWLRQVWXGLRRIWKH*DOOLQ V*XLWDUJURXSDQGSURXGO\ '4&1)5&1)6&/*16*)075.(6*&(-*45.1*/'2741* DIILOLDWHGZLWKWKHPRVWSUHVWLJLRXVLQVWUXPHQWEUDQGV

  

*8*/  /.+621 64**64&-4&1#.(624.& 9996-*5271)/&'(20&7

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

.1+26-*5271)/&'(20&7

BEAT MAGAZINE PAGE 31


education SPECIAL BEAT’S EDUCATION SUPPLEMENT MELBOURNE POLYTECHNIC

THE SOUNDLAB

ADDRESS: 142-144 High Street, Prahran, VIC 3181 PHONE: Course Enquiry Centre on (03) 9269 1900 EMAIL: courses@nmit.edu.au WEBSITE: melbournepolytechnic.edu.au

ADDRESS: Level 1/48 Clifton St, Prahran VIC 3181 TELEPHONE: (03) 9510 4455 EMAIL: info@thesoundlab.com.au WEBSITE: www.thesoundlab.com.au

Are you interested in a career in music? Let your passion for music shine at Melbourne Polytechnic. Located on the site of the former Swinburne University Prahran Campus, Melbourne Polytechnic is set to become a vibrant hub for creative industries training. Build your musicianship skills and knowledge with a Certificate or an Advanced Diploma in Music; learn to produce your own music and sound designs with a Diploma of Sound Production; or manage and market the band with a Diploma of Music Business under your belt. We are really excited about introducing Music Performance programs to Prahran and have fast-tracked plans to build new facilities at the campus. Students of Music Performance and Sound Production will enjoy working and creating in the four large band rooms, eight individual practice/tuition rooms, and centrally located sound recording control room, all of which provide users with a state-of-the-art facility designed for music rehearsal, recording and playback. Alongside our qualifications in music, we are also offering training in Writing and Publishing, Theatre Arts, Visual Arts, Photography, and Screen and Media. Melbourne Polytechnic might be a brand new name in the south east, but we’re part of NMIT – one of Melbourne’s biggest TAFE providers, with a history and reputation for delivering high quality training for more than 100 years. To find out more about facilities and programs at Melbourne Polytechnic, go to www.melbournepolytechnic.edu.au.

Founded by Leah Gallin, Marketing Manager for Australian Musical Imports, the distributors of the Gibson family of brands and the Gallin’s Guitar & Musician’s Pro Shop chain of retail outlets across Australia. The SoundLab is a welcome extension as the official tuition studio of the Gallin’s Guitar Group for Melbourne. The SoundLab located in the heart of Prahran, offer guitar, piano, drum and vocal tuition from beginners through to experienced musicians. Their epic warehouse space and state of the art musical tutorial studios are designed to deliver sessions that markedly develop your proficiency with your chosen instrument. Individual sessions are a personalised and focused approach to music tuition, tailored to suit your specific objectives. The group sessions are both practical and observational, offering a great opportunity to have a jam with other players; perfect for friends, partners or siblings. With a selection of amazing teachers that are highly qualifies and relaxed, their tailored lessons make learning music fun! All the gear is supplied and the studio is decked out in the best high-end equipment, so there is no hassle if don’t have access to an instrument. Open by appointment only, during the day through to late at night, the SoundLab are offering a FREE Introductory Lesson to all prospective students. Contact their coordinators to reserve your free lesson and see the state of the art studios and ask all the important questions by calling (03) 9510 4455 or email your name and contact number to info@thesoundlab.com. au All further info can be found by visiting www.thesoundlab.com.au.

BEAT MAGAZINE PAGE 32

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 33


education SPECIAL BEAT’S EDUCATION SUPPLEMENT NCAT (NORTHERN COLLEGE OF THE ARTS)

JMC ACADEMY

ADDRESS: 62 Murray Rd, Preston, VIC 3072. TELEPHONE: (03) 9478 1333 EMAIL: ncat@edumail.vic.gov.au WEBSITE: www.ncat.vic.edu.au

OPEN DAY: Friday January 17, 3pm to 7pm ADDRESS: 171 Bank Street, South Melbourne, VIC 3205. PHONE: (03) 9624 2929 EMAIL: melbourne@jmc.edu.au WEBSITE: www.jmcacademy.edu.au

NCAT (Northern College Of The Arts) specialises in a range of practical hands on music, business and arts courses to help you take that next step in your chosen career. Their Music and Sound Production course for example, utilises practical learning methods, with regular industry professional guest speakers, in-class work experience and touring opportunities. This course has students create a folio throughout the year to present to universities and potential employers along with their qualification. Thriving on staying up to date with industry standards NCAT comprises of a professional recording studio, 10 fully equipped rehearsal rooms, Mac labs and digital audio workstations for all learning and practice needs. Private and group instrument tuition is also available. Another extremely popular course NCAT provides is their Musical Instrument Making & Repair course which offer the only qualification of its kind in Australia. The course covers both traditional and emerging digital technologies and offer graduating students opportunities in the guitar building and repair industry. Many graduating students go on to work with companies such as Maton Guitars and set up their own repair business or workshop. To learn more about the range of NCAT courses visit their website and keep up to date with upcoming 2014 Open Days at www.ncat.vic.edu.au.

There are few things more exciting than performing on a stage to hundreds, if not thousands, of people. Being a contemporary performer requires an understanding of not only performance skills but also knowledge of arranging and composing, music technology, business skills, and an understanding of how it all fits together. Whether it’s about learning different genres from experienced (and often famous) musicians, using sound mixing skills to enhance a performance or being better at playing your instrument, JMC Academy’s Contemporary Music Performance course prepares students for the challenges of life as a performer and prepares them for postgraduate study at Master’s level. If you’re still undecided about how you want to spend the next one to two years of your study time or want a preview of what your years after school might hold, head along to the JMC Academy Campus Open Day! Undertake a campus tour, a focused overview on your course of interest, speak first-hand with current students, scholarship winners and the Heads of JMC Academy’s Music, Audio, Animation, Game Design, Film and Television, and Entertainment Business Management departments. You’ll also be able to view student work, listen to bands, view student films and even see live audio and film production in action. Register now at www.jmcacademy.edu.au.

SAE INSTITUTE

HOLMESGLEN

INFORMATION EVENING: Tuesday January 28, 5pm to 9pm ADDRESS: 235 Normanby Road, South Melbourne, 3205 TELEPHONE: (03) 8632 3400 EMAIL: melbourne@sae.edu WEBSITE: www.sae.edu.au

OPEN DAY: Wednesday January 22 ADDRESS: Chadstone, City, Moorabbin PHONE: (03) 9564 1602 EMAIL: arts@holmesglen.edu.au WEBSITE: www.holmesglen.edu.au

SAE Melbourne hosts their first information evening for 2014 on Tuesday the 28th of January. Here you will learn about SAE’s 37 year history in providing new and emerging education in the creative industries. Originally offering courses in Audio Production, SAE has branched out into the fields of Film, Games, Animation and Games Design. Tuesday the 28th will be the perfect opportunity to check out the campus and learn everything there is to know about Certificates, Diplomas and Degrees in Creative Media. SAE Melbourne now offers a Degree in all these creative media areas as well as offering a Diploma in Studio Production and a Diploma in Live Sound in collaboration with the HiFi Bar. SAE’s Diplomas can be completed in just two trimesters, which is just over 6 months and they also offer a Certificate III in Music and an introduction to Ableton Live. So weather you just completed VCE or if you have always wanted a career in the Creative Media Industries, SAE has the course to get you there. They are also looking to introduce a Bachelor in Web Design and App Development later this year, so keep your eyes out. All Bachelor and Diploma courses commence on Monday February 10 and applications are still open. So come see why completing an SAE degree will put you leagues above the rest when it comes to securing a job in the creative industries both locally and overseas.

Holmesglen is renowned as a centre of excellence for the design and delivery of education and training services. Established in 1982, Holmesglen is now one of the largest providers of vocational and higher education in Victoria. Our teaching staff are trained professionals working in the industry, giving students access to relevant industry skills and contacts and preparing them for work or further study. Our fashion students know the industry, so they can engage with it, our graphic design students work with the industry, and our screen and photo imaging students work on real projects. Holmesglen boasts purpose built studio environments across three campuses, offering students a range of art and design courses from certificate through to degree level in partnership with the University of Canberra. Students are regularly given access to a variety of experiences, including practical placement, industry events, competitions, speakers and excursions, as well as annual graduate events such as exhibitions and screenings. Find out more at the Open Day on Wednesday January 22. Visit www.holmesglen.edu.au for more information and to register for a session of your choice.

SHILLINGTON COLLEGE

INFO SESSION: Thursday January 16 at 6pm ADDRESS: L9 55 Swanston Street Melbourne PHONE: (03) 9663 8444 EMAIL: info@shillingtoncollege.com.au WEBSITE: www.shillingtoncollege.com.au

Craving a career change? A world class design education needn’t take forever. The Shillington Graphic Design Course takes just three months full-time or one year part-time. Most Shillington students have no previous experience and come from various professional backgrounds - finance, hospitality, construction, nursing you name it! With passion, determination and some friendly guidance from our talented teachers, students graduate with everything they need to begin their exciting and rewarding new career in graphic design. If you’d like to find out more about the Graphic Design Course, come along to the Info Session on Thursday January 16 at 6pm. The presentation lasts for just half an hour with a chance to chat to our teachers and past students afterwards. There’s no need to book, just come along.

BEAT MAGAZINE PAGE 34

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV


CREATIVE COURSES DESIGNED FOR GRAPHIC DESIGN, FASHION, INTERIOR DESIGN, SCREEN PRODUCTION, PHOTOIMAGING Our certiďŹ cate and diploma programs offer direct pathways and credit to University of Canberra degrees delivered at Holmesglen campuses. Commonwealth Supported Places for degrees are also available.

Melbourne, Victoria T: 03 9564 1602 E: arts@holmesglen.edu.au W: www.holmesglen.edu.au/arts

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 35


A guide to eating out in Melbourne

The Penny Black Attention Brunswick residents: Your prayers have been answered The Penny Black now has awesome cheap pizzas. From the visionaries that brought you Bimbo Deluxe and The Lucky Coq, The Penny Black now has a kick-ass pizza menu that includes the Lo Zenzero Prawn ($8.50). This tasty seafood pizza is seasoned with ginger, garlic, chilli, coriander, Caesar dressing, lemon and bean sprouts that masterfully coaslese around the star of the dish – the prawns. The ‘tang’ of this dish is offset beautifully by a pint of Carlton lager, this combination is what the Beat Eats’ team was treated to as we enjoyed the expansive beer garden on a balmy Sunday evening as we watched Australia humiliate the English (again) in the first One Day International by 7 wickets. The other pizza ordered was the Mexiwick that is loaded with chicken mince marinated in taco spices, iceberg lettuce salsa and mozzarella. The taco spice gives one hell of kick to this tasty dish. One particularly hungry member of the Beat Eats team insisted on trying the dessert pizza ‘Banana Pizza’ that involves mascarpone, maple syrup and errr... bananas. Suffice to say it was delicious. The soundtrack for this perfect meal and tasty beverage was an indie DJ playing 90s big beat bangers and indie classics such as The Strokes Is This It. The Penny Black is located at 420 Sydney Road, Brunswick and is open Monday to Saturday 12pm to 1am and Sundays 12pm to 11pm. For more information call 9380 8667, email info@thepennyblack.com.au or visit thepennyblack.com.au

Beat Eats Page 36

The Post

Trumpeters Ice Tea

Reality TV likes to make a big deal of makeovers, whether they are of a house, home cooks, or bookish Korean karaoke singers. However, the reality (pun intended) is that motivated people continually reinvent the proverbial wheel in far bolder ways than any of the aforementioned fame addicted tosspots. St Kilda’s 125-year-old pub The Post’s redo was helmed by new business owners Leon Handel & Mike Ramensky, who have fully redesigned the premises, including raising the ceiling and converting the bottle shop into a cafe. Remensky opened renowned Asian restaurant Wood Spoon Kitchen on Smith st that he has since sold. However, he retained the services of the head chef Kazuko Goto whose vision for the menu at The Post is a gastro pub experience that includes a trip around the world with dishes that include baked tandoori barramundi and roast vegetable tagine. Beat Eats was invited down to the eatery on Sunday to experience ‘Sliders & Ciders’ that includes $4 pulled pork and soft shell crab sliders and $15 jugs of Napoleone Apple cider. Served in a delectable brioche bun the pulled pork is accented with sweet coleslaw and the soft shell crab includes that familiar tang of tartar sauce – both are excellently offset on the palate with a hearty gulp of cider.

Move over cider, it be all about the ice tea for 2014. Leading the alcoholic ice tea movement is new kid on the block, Trumpeters Alcoholic Ice Tea. Created by Melbourne husband and wife duo, Hayden and Anna Newton, the inspiration for the locally brewed tipple lies in 1920’s New Orleans. In the midst of prohibition, jazz bands playing in speakeasies would cool their lips with ice tea and a cheeky splash of vodka. Fast-forward over 90 years and this recipe has motivated the birth of Trumpeters - a refreshing blend of Ceylon tea and pure super premium vodka. When served over ice and with a slice of lime it’s the perfect antidote to a day in the summer sunshine. Trumpeters source only the most premium and organically grown tealeaves grown deep in the Sri Lankan mountains. To capture their distinctive flavour, the tea is put through a unique cold infusion method to produce a subtle and refreshing taste. Combined with top-shelf triple distilled vodka, Trumpeters Alcoholic Ice Tea truly embodies the taste of summer. Trumpeters Ice Tea is exclusively available in Melbourne across selected venues including Belle’s Diner in Fitzroy, Electric Ladyland on Chapel Street and The B.East in Brunswick. You will also find Trumpeters in selected liquor stores including Smith Street Cellars in Collingwood.

The Post Office Club is open Tuesday through to Sunday from 10am to 1am. The cafe is open for coffee and breakfast at 7am each day (8am on Sundays) and at the end of this month boutique accommodation will be available upstairs. It is located at 306 St. Kilda Road (corner of Inkerman Street), St. Kilda. Ph. 03 9534 7678.

BEAT’S GUIDE TO EATING OUT IN MELBOURNE

To find your nearest stockist, please visit: www.trumpetersicetea.com


THE FITZROY BEER GARDEN BY FAT PRESTON

The Fitzroy Beer Garden is a place for locals. On Sunday Beat Eats was treated to a superb late lunch on the sun-speckled beer garden that boasts an array of large tables placed with casual elegance around the tree and fern drenched garden. Head chef Chris ‘Sparkles’ Marchant is quiet softly spoken man with a very friendly face and when he talks about the food that comes from his kitchen you can’t help but share his enthusiasm. “I really struggle to put a specific label on our menu. It’s about good food at reasonable price that lends itself to sharing and drinking. I don’t want to call ‘it pub grub’ and I don’t want to call it ‘bar food’ because it is more than that.” On our visit Beat Eats ate from the A Bit Hungry section of the menu: Warm Pretzel with Mustard ($4), Frank’s Hot Wings & Blue Cheese Sauce ($8) and Walnut Artichoke Salad ($6). And off the Hungry section we ate the Mussels & Fries cooked with chilli, garlic & white wine ($12) and The Famous Fat Eddy burger with a double patty, cheese, bacon, house made ‘slaw’ and pickles ($14). The Famous Fat Eddy (pictured far right) is a supreme sized meal but despite its two patties and generous slaw the taste is so morish that one member of the Beat Eats team considered ordering another one! Marchant explains what how he achieves such a delicious meal, “The pattie itself, like all our components are made on site with fresh mince and even some cheese worked into the pattie just to make it a bit richer and to keep that moistness. The homemade coleslaw is red cabbage, white cabbage, carrot, red onion and we do our own dressing. It is really important to me that everything is made from the bottom up in the kitchen – all our own dressings and sauces,” explains Marchant. The bun that the burger comes in is good old fashioned white bread roll not brioche as seems to be the formula at many eateries that offer burgers. “I think not using a brioche bun for The Fat Eddy is almost a point of difference!” Chuckles Marchant

before adding, “Everywhere there’s brioche buns but I actually like a nice white bread roll so that’s what we use.” The other main-sized dish that we sampled, Mussels & Fries cooked with chilli, garlic & white wine, was the perfect match to The Fitzroy Beer Garden’s cool and leafy courtyard. The broth created by the mussel’s juices and the white wine is perfect to have a wad of crinkle cut fat chips dipped into it. “My favourite dish is the mussels and chips it’s one of those dishes that when I serve it I get tingles – most chefs have a dish that they love and this is the one that makes me feel like a chef and when I see the bowels come back with all of the sauce mopped up it is a good feeling!” The dish from the A Bit Hungry menu that really blew our minds was the Frank’s Hot Wings & Blue Cheese Sauce. The hottish chilli marinade of the wings is mellowed perfectly by the blue cheese sauce – a

flavoursome melange that cuts through to even the most beer soaked tastebuds. Blue cheese sauce is a staple of French cuisine but Marchant never trained in Paris – he is in fact a veteran of Fitzroy dining – more specifically, Gertrude st! “I have actually worked on Gertrude st. for about 7 years having worked at the now defunct Dante’s, I worked at The Gertrude Hotel and I have been here for almost three years!” Finally, Marchant explains why he and front of house manager Dawn McKinley believe you should drop in

BEAT’S GUIDE TO EATING OUT IN MELBOURNE

for a beer and a The Famous Fat Eddy burger next time you’re in Fitzroy. “We’re trying to do good food at a reasonable price – that’s the key goal.” The Fitzroy Beer Garden is located at 243-245 Gertrude St, Fitzroy and is open Wednesday Thursday: 4pm – 1am Friday - Saturday: 11:30am to 1am and Sunday: 11:30am – 6pm. For further details please contact the team on Phone: (03) 9416 2689 Email: cheers@thefitzroybeergarden.com

Beat Eats Page 37


HAMMER & TONG BY FAT PRESTON

Any keen observer of the music industry would be aware that classic musicality has come to the fore of popular music over the past six years with acts like Britainâ&#x20AC;&#x2122;s Florence & The Machine and Adele as well as the U.Sâ&#x20AC;&#x2122;s Beirut and Dirty Projectors all imbuing the disciplines of classical music into their music. This reflects an audience who are more informed, via the hyper information depot known as the internet, than any other generation. Brunswick Streetâ&#x20AC;&#x2122;s Hammer & Tong has taken on this classical erudition of the populace with via its food. Owners, chef Simon Ward and sommelier Dennis Ferreira (pictured right), like the aforementioned musicians, take the knowledge of classical training and imbue it into what is a celebration of fresh and affordable food. The pairâ&#x20AC;&#x2122;s resumes read like road map of Melbourneâ&#x20AC;&#x2122;s finest restaurant with names like Vue de Monde (where Ward and Ferreira worked together), Jacque Raymond and France Soir. As well as running the busy Brunswick street restaurant, that is open for breakfast, lunch and dinner, Hammer & Tong also features at The Queen Victoria Marketâ&#x20AC;&#x2122;s weekly night markets with their crab burger a huge hit having sold 250 of them last week! Other highlights from the Hammer & Tong menu include the tomato fondue bruschetta, basil, buffalo bococini (pictured, $16), grilled octopus, kimchi, apple & fennel ($17), buttermilk lamb, goats cheese, onion rings, fennel & lettuce ($22) and lavender yoghurt custard, raspberry & mango gel, summer berries, lychee  w basil cress ($14). Ward has this to say about Hammer & Tong, â&#x20AC;&#x153;Our menu is designed to be shared with family and friends sitting around the table. The meals are based on the concept of creating action around the table and talking points among guests.â&#x20AC;? Wardâ&#x20AC;&#x2122;s vision can be seen in the menu in such dishes as the grilled octopus, kimchi, apple and fennel â&#x20AC;&#x201C;   kimchi is a traditional fermented  Korean  side dish made of vegetables with a variety of seasonings. It is often described as spicy and sour. To better understand the integrity of Wardâ&#x20AC;&#x2122;s vision for the food at Hammer & Tong it is important to know his background. â&#x20AC;&#x153;I worked at Vue de Monde for two years but then I

decided to get out of fine dining and became head chef at Dukeâ&#x20AC;&#x2122;s Coffee Roasters which is cafe in Windsor and I have maintained a relationship with them with us using their beans here. With Hammer & Tong I have tried to combine the best of both experiences. â&#x20AC;&#x153;A lot of chefs are getting out of the fine dining scene and pushing the boundaries of what food is â&#x20AC;&#x201C; people are eating more breakfast and lunch so I think people want to be satisfied and challenged with every meal they have, not just special dinners at expensive restaurants,â&#x20AC;? contends Ward. After a well earned break over Christmas and New Years Hammer & Tong reopened this month and launched their new Summer menu. â&#x20AC;&#x153;We have a lavender labneh custard with freeze dried summer fruits like lycees and mangos, with blueberries and black berries all over it â&#x20AC;&#x201C; you can have it during the day as a light meal or as a desert at night. Also, I am really proud of the buttermilk pressed lamb shoulder that with goats custard and a lettuce puree,â&#x20AC;? explains Ward. The lettuce puree is a refreshing dollop of gastronomy

that Ward admits harks back to his days at Vue de Monde, â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s a lot of French techniques involved that I learned through Vue and also I worked at The Point for a little bit.â&#x20AC;? To truly accentuate the flavours of each meal Ferreira takes wine matching very seriously. With this in mind he recommends the Garganega from Soave in Italy that is produced by winemaker Gini to go with Hammer & Tongs famous crab burger. While lamenting the pretension sometimes associated with wines Ferreira is desperately passionate about enhancing a diners experience through a wine

complimentary to their dish. â&#x20AC;&#x153;Being a sommelier is about matching the finding the best wine to go with a dish. This month we are lucky enough to be able to offer Gini Soave at $8 a glass because of a good buy. It is similar to a chardonnay and tastes great with the crab burger,â&#x20AC;? states Ferreira. Hammer & Tong is open Tuesday to Saturday 7am to late and Sunday 8am to 5pm. Call 03 9041 6033 or email admin@hammerandtong.com.au for more information or to make bookings. The restaurant is located at the rear of 412 Brunswick st. Fitzroy.

presents

er

y dd

g ur

B

E t a sF

u

mo a eF

Th

$YDLODEOH:HGQHVGD\WR6XQGD\ DW0HOERXUQH VPRVWFRPIRUWDEOHSODFHWRKDQJRXWZLWKIULHQGV *HUWUXGH6W)LW]UR\ QHDUWKHFRUQHURI6PLWKVW

Beat Eats Page 38

BEATâ&#x20AC;&#x2122;S GUIDE TO EATING OUT IN MELBOURNE


THE HIVES By Bob Gordon Chris Dangerous, drummer of The Hives, is no doubt dressed to the nines and sipping on a Heineken somewhere as he waits for the operator to hook up this interview call. “I’m pretty fucking good,” he affirms, with bandmates chatting up a storm backstage, as the line is connected. “I just played a show in a huge arena in Newark, New Jersey.” It’s fitting, really, that The Hives would already be out there on the road at a time when they have come to save the day (along with Deftones and Beady Eye), filling in for UK icons, Blur, who backed out of their forthcoming Big Day Out appearances. “Actually that fill-in spot has worked out perfectly because we were just gonna be at home,” Dangerous says. “We were going to try to rehearse some new stuff, but then the question was asked and we looked at our calendar and it just fit perfectly.” After playing in Australia back in January, The Hives have been busy touring in support of 2012’s Lex Hives album, mainly in the US. “We’ve toured so much in the US this year,” he explains, “more than ever before. I don’t know why it happened that way. It’s always great to anyway, but we were offered some fun tours to be part of, pretty much just like the Blur thing. They just happened; the fun stuff that just comes up.” Part of that fun stuff was the opportunity to support Pink on numerous stops of her The Truth About Love US tour. It’s a different experience for The Hives, playing shortened sets to mainstream pop audiences. “It’s quite interesting,” Dangerous ponders.” We were quite scared in the beginning but we’ve always been really good in the face of difficult competition. We love to walk into these arenas and try to explain to people what we’re doing and why they should love us. Pretty much every night we’ve gained some 15,000 new fans who would never have heard us before. “It’s challenging, it sure is, because you’ve really got to win them over. It’s a huge crowd and no one’s heard of you but by the end of the set people are just cheering and really loving what we do – and at least then they promise to come back too,” he laughs. “It’s fun for both of us.” As perfect as it seems, it also gets unpredictable at times, and it certainly did a fortnight ago when vocalist, Pelle Almqvist, dedicated a song to the people of Boston during a show in that city. Unfortunately that song happened to be Tick Tick Boom and was deemed by some to be too soon/too much after the Boston Marathon bombing last year. The Hives apologised via Facebook and it seems the slip-up was accidental rather then ill-considered. “When we’re up on stage – and we do this a lot – we always want to dedicate a song to people who came to the show,” Dangerous says. “It was really unfortunate that it happened to be that song. When we’re onstage we don’t really think about anything but trying to make the best show possible. It’s unfortunate, but we’ve had so many comments coming back just saying, ‘you don’t have to apologise; you’re a rock band who just like to dedicate their songs.’”

“WE’VE ALWAYS BEEN REALLY GOOD IN THE FACE OF DIFFICULT COMPETITION. WE LOVE TO WALK INTO THESE ARENAS AND TRY TO EXPLAIN TO PEOPLE WHAT WE’RE DOING AND WHY THEY SHOULD LOVE US.” “You could probably interpret a lot from the lyrics into whatever you want, but it’s still just a song. The title of the song is Tick Tick Boom but it doesn’t have to do with bombs. It’s not about that. It’s just very unfortunate and unlucky.” Another tour, another raft of experiences it would seem. Earlier this year, when LA skatepunkers FIDLAR, hit our shores they sang the praises of The Hives, who took them on their first tour of Europe and gave them a little advice along the way. “That first tour we did was with The Hives,” FIDLAR vocalist/guitarist, Zac Carper, recalled. “And after the tour Nick (Arson) the guitar player came up to me and said, ‘This is the first tour you’ve ever done. What did you learn?’ I said straight away, ‘not to bring my skateboard ever again’ (laughs) because we’d play then just get wasted and go skating all night and wake up the next morning and go, ‘oh my god what the fuck did we do?’ “That’s what The Hives guys had found too; after their first tour they never brought along their skateboards again.” When reminded of this, Dangerous laughs and explains simply that when your business is showbusiness you simply can’t be letting the show down. “For us it’s all about every show being as good as the other one,” he says. “I’ve played the same night that I was robbed with pepper spray; or when my body’s been in such bad shape that I couldn’t even stand up but somehow I’ve pulled through and played a show. “The main thing is if you’re in a band and you go out on a six-week-long tour you might not want to do everything you can to destroy yourself on the first night. It’s gonna bite you back and it’s gonna hurt. There’s not really much advice you can give; it’s really just being able to play the show every night. Whatever situation you face, somehow you gotta pull through.”

THE HIVES play the Big Day Out Festival on Friday January 24 at Flemington Racecourse. Tickets available via bigdayout.com. They will also be playing a BDO sideshow at 170 Russell on Tuesday January 21. WATCH INTERVIEWS, CHATS & AWKWARD SILENCES..... WWW.BEAT.COM.AU/TV

BEAT MAGAZINE PAGE 39


BEADY EYE

By Peter Hodgson

It’s probably the greatest example of stunt-casting since Keith Richards was drafted to play Johnny Depp’s dad in one of the Pirates of the Caribbean movies. When Blur unexpectedly pulled out of the Big Day Out, the fans were clear to the festival organisers: “We’re in a Britpop mood now, so what are you gonna do about it?” The logical – nay, perfect – choice would be Beady Eye, the band formed from the remnants of Oasis following the departure of Noel Gallagher. And so it was. One of the key slots on the Big Day Out is now occupied by misters Liam Gallagher, Gem Archer, Andy Bell and Chris Sharrock – all former members of Oasis – along with former Kasabian guitarist Jay Mehler. Sharrock’s mellifluous voice booms down the line from the other side of the world and under the shadow of the polar vortex to tell Melbourne he’s looking forward to the Big Day Out – his first time playing the festival. “I’ve heard a lot about it and it’s another one to cross off the list, I suppose,” he says. “I can’t wait to get out there to a bit of warm weather. That’s the main thing! It’s the coldest of the cold here!” The band is, of course, aware of the swell of calls for them to be added to the line-up in place of Blur, and the poetic justice thereof. “Yeah! The response was amazing. It’ll be great to bring it to the Aussies because we didn’t get out there last time. It’ll be nice to see everyone.” Beady Eye’s latest album, BE, is a finely crafted mix of

true band vibe and studio experimentation. In amongst the organic instruments and band chemistry you’ll hear samples, answering machine messages, music apps - the whole shebang. In a live setting the band tries to capture a little of the technicolour washes of the recording without losing sight of their roots as a true band. “It’s a bit of both, really. We try to make it sound like the album a bit but there are a few things. We don’t even call it experimental, to tell you the truth. It’s just music. But I think our poor keyboard player’s probably a bit overworked. But it kinda rocks more live, as most things do. CD players don’t really make you jump up and down like a live band will!” While Sharrock is primarily known as a drummer, he’s an avid guitar fan – especially of AC/DC’s Angus Young. “I saw AC/DC with Bon Scott on vocals at the Liverpool Empire and it blew me away,” he says. “That was cool. I think it was a few weeks before he died. It was at the height of the mod

revival here and I was a mod who happened to like AC/DC, y’know! It’s not like now where everyone can like pretty much everything. I had to keep it quiet! There was a big chant of ‘We hate the mods! We hate the mods!’ just before they came on!” Sharrock is also considering a bit of a secondhand-store scrounge on the look-out for cheap vintage guitars – not the nice, $250,000 Gibson Les Paul kind of vintage guitars but the junked-up, quirky, probably-made-from-kitchencountertop-material guitars that were pedalled to students back in the ’50s and early ’60s. “Just sort of cheap West German, European ’60s things that are covered in dust, really. I’m not really into your Gretsch or Les Paul brigade – mainly because I can’t afford it but I don’t really like those guitars either. Give me a Futurama or a Framus!” This obsession with slightly off-beat early electrics goes back to when he was 14. “I got a Hofner violin and that sort of started me off. They’re all funny, quirky guitars. Hey, I’m not bad for a drummer,

y’know what I mean? Drums don’t turn me on as much. I mean, I’ve got some nice kits that I love but guitars are easier to bring home from Europe or Australia. Do you think I’ll get any bargains in Australia?” Well, that’ll be tricky because all the secondhand stores have smartphones now but there are still bargains to be had. Britpop fans are in for a monster set of Beady Eye tracks (and a few choice Oasis cuts, if recent set lists are any indication of what to expect); Melbourne’s famed AC/DC landmarks (like Swanston Street and AC/DC Lane) might just be host to a famous tourist, and the secondhand guitar dealers of our fine city might want to dust off those busted-ass old pawnshop prizes.

calls the sheer amount of beers consumed (a studio record of fifty-something slabs) and the Psychos haphazard approach to recording. It seems too that not much has changed. “Everything’s pretty much spur of the moment; have a few beers, get the creative juices flowing and just have a sit round and a shit and giggle,” says Knight summing up a typical Cosmic Psychos recording session. The topic of beer ends up being a big one, despite the fact that we have a thirty-year music career to discuss. The Cosmic Psychos are famed for their ability to consume the amber ale, their best of was even called 15 Years, A Million Beers, not a bad estimate according to Knight. And though the calculations to find the exact figure would probably be too difficult, he does estimate the Psychos have at least consumed a million

dollars worth of free beer over the years. Despite being a hard nut, he doesn’t mind the Pure Blondes either. “If anything you can drink more of ’em, light on the fizz, they don’t fill me up. I don’t mind ’em, simple as that. I drink a lot of different beers, but if I’ve got work to do, I’ll drink a Pure Blonde. How’s that for an ad? “If I wanna leave room for a bloody Souvlaki at three thirty in the morning from the Souvlaki King, well I can fit one in if I drink Pure Blondes.”

BEADY EYE will play the Big Day Out Fest on Friday January 24 at Flemington Racecourse. You can still secure tickets via bigdayout.com. BE is available now via Columbia Records.

COSMIC PSYCHOS

By Garrath Westmore

For thirty years Ross Knight has stumbled through a music career with Aussie punk rock’s most debauched outfit, the Cosmic Psychos. These days, the Victorian farmer made good seems unchanged by three decades of touring, partying and generally just being a menace. Buoyed by renewed interest thanks to the Matt Weston doco Cosmic Psychos: Blokes You Can Trust, he and the Psychos are back to belt it out at this year’s Big Day Out. Speaking about the documentary, Knight is as typically laconic and humorous as the doco and live performances would lead you to believe. “I told him not to waste his time and money,” says Knight when asked about his reaction to Weston’s desire to make a Cosmic Psychos film. “But Matty did a fine job. I thought if he wants to do it, that’s his business. He did a great job of documenting what a bloody car crash the band has been the whole time.” And as far as bands’ ‘history of ’ stories go, there’s probably none more amusing, more loose and more surprising than that of the Cosmic Psychos. Knight, a country boy and farmer from Kyneton teamed up with guys just as rag tag as he was, and ended up finding fans not just in Australia, but over the world. It’s well publicised but worth mentioning nonetheless that guys like Nirvana, Pearl Jam and the Melvins were fans of the rough and tumble trio; their antics and attitude helping endear them to audiences worldwide; unpretentious

songs about farming, road kill, and hitting the pub a breath of fresh air for many. “I don’t think people had seen a band that really wasn’t serious,” Knight reflects. “We were basically three drunken clowns, and I think it appealed to a lot of people that we didn’t take the music too seriously. A lot of people who did take it seriously, especially locally, they didn’t like us at all. They thought we were taking the piss out of them… which we were.” Other people took them seriously though, after impressing in the States they were signed to Amphetamine Reptile Records and sent into the studio to record Blokes You Can Trust (1991) with none other than Nevermind producer Butch Vig. “He is just such a good bloke,” Knight says of Vig. “When he heard me fire up the bass for the first time, he came running in saying ‘what’s that fucking noise?!’ And from there we just got along so well.” Vig in Cosmic Psychos: Blokes You Can Trust re-

The debauched COSMIC PSYCHOS will hit up Big Day Out later this month on Friday January 24 at Flemington Racecourse. Tickets are still available via bigdayout.com

THE COUNT with THE SPINNING ROOMS Name/Band: Pete Dickinson from The Spinning Rooms. Ten bands everyone should know about: Batpiss, Bodies, Damn Terran, Peep Tempel, Sheriff, Harmony, Brat Farrar, Bad Vision, Sun God Replica and Look At The Owl. Nine food items that you need to make a kickarse dinner party: Vodka, tomato juice, Worcestershire sauce, Tabasco sauce, celery, black pepper, lemon juice, celery salt and recreational pharmaceuticals. Eight possessions that define you: Astro turf, solenoid in a Datsun 120Y, Musicman 112RP, Gold Street, misguided ambition, hangovers, Mum and HFC.

BEAT MAGAZINE PAGE 40

Seven favourite movies/TV shows that go on your mix-tape: Twin Peaks, The Sopranos, Rage, Naked, Bad Boy Bubby, Jaws and Wake In Fright. Six bad habits you can’t escape: Smoking, Dad’s beer, swearing at Callum Routledge, A major, Collingwood and drunk crying. Five people who inspire you: Noah Wilson, Ianto Kelly, Joe Greenway, Cyril Rioli and The Screamer. Four things that turn you on: Sadness, bravery, idiocy and gakk. Three goals for your music: Female vocals, hand claps and Baker Street.

Two live gigs you’ll never forget and why: All Good In The Wood parts 1 & 2 – the police were nice to us. One day left before the apocalypse and you… Drink with my wife.

DISCUSS WHAT? BEAT.COM.AU/DISCUSSION

When’s the gig / release? The inaugural Port Royal Street Party, Saturday January 18 at 1 Fennell Street Port Melbourne with Cosmic Psychos, The Meanies, The Murlocs, Harmony, Straight Arrows, Batpiss, Bits Of Shit, Ausmuteants, Yo Gritto DJs and us!

BEAT MAGAZINE PAGE 40


THE WORLD’S FESTIVAL LINE UP INCLUDES

Billy Bragg

Mikhael Paskalev Arrested Development

Muro

Washington

Femi Kuti

SEE WEBSITE FOR FULL L I N E -U P

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 41


THE DILLINGER ESCAPE PLAN

By Augustus Welby

The Dillinger Escape Plan’s fifth record, last year’s One Of Us Is The Killer, again melded technically elaborate arrangements with furious hardcore energy. Ever since their 1999 debut Calculating Inf inity, the group have masterfully executed this concoction while displaying an understanding of accessible songcraft. Consequently, they continue to prove themselves as one of the most innovative and memorable bands in contemporary heavy music. The only original member from the lineup – guitarist and key songwriter Ben Weinman – formed the band in the small borough of Morris Plains, New Jersey back in 1997, an obscure suburb that he still calls home. “I just always felt like I needed to stay close to where I came from, in order to maintain the ethic of the reasons why I’m doing this to begin with – not get cluttered by outside influences,” Weinman explains. Indeed, living outside of a city enables Weinman to have a basement studio, which gives him plenty of freedom to craft and refine the band’s experimental precision. Although none of the other members live close by, he’s more than content with keeping a low profile. “All the guys in the band live in different cities. Our singer lives in Los Angeles. I don’t want to even be around all that. I don’t want to know what the hottest band is doing right now and what they look like. I want to just keep going and doing what I’m doing and just live a normal life.”

Of course, The Dillinger Escape Plan are a globetrotting rock & roll band so Weinman is by no means a complete hermit. The band will make another visit to Australia next month for the Soundwave festival and Weinman clarifies that he does appreciate the perks of being a touring musician. “We tour a lot so I’m always in amazing places all over the world. I’m in places like Australia or London – I’m in Los Angeles a couple of times a year. When I’m at these places there’s always somewhere to go, some party, some person in some big band hanging out. It’s great and I love the fact that I’ve had a lifestyle where I’m able to be around some of these amazing people, but at the same time that stuff doesn’t last, that’s not what’s important. I try to keep what’s

important around me and maintain that level head.” The band’s fourth LP Option Paralysis (2009) thematically addressed how the overwhelming presence of digital stimuli in modern life dampens the purity of individual experiences. Living in a wholesome small town might suggest that Weinman lives a life of arcane pleasures. Yet, that’s not quite the case. “The fact that I’m not going out every night to parties or shows means that I really have to force myself to get out and experience the world sometimes,” he says. “I’m so closed in to my house, working on music, working on things around my computer and my phone, so I have to really discipline myself even more sometimes. I have dogs simply for the reason [that] I have to take them for walks. It makes me leave my computer, whatever I’m working on; it actually gets me up and gets me out into the world.” Given the meticulous technical nature of The Dillinger

Escape Plan’s music, you can understand why Weinman might seek some digital distractions. Meanwhile, he does believe there’s been a general improvement in the utilisation of media resources recently. “I think people are starting to use technology a little more efficiently. The things that matter and the things that are useful are starting to rise to the top, so it’s not just a sea of information. People are starting to go to the sources that they really trust and just getting info from there. It’s still a mess but it seems like there’s a little more focus on quality instead of quantity. I would hope, anyway.”

a lot of time thinking about our music too much. We simply try to satisfy ourselves by writing music that we like and we want to listen to, we try and push ourselves with each album by trying to make what we do at least better and that’s about it. We really try not to worry about it too much other than that. We try to be genuine because we believe that is the thing that people can really notice.” For a band like Mayday Parade, the band bucket list is pretty well complete. That’s not to say they’re close to giving up this game of melodies, just that there’s less mountains left to climb. Or maybe the mountains have just gotten bigger? “At this point we have accomplished so much that we set out to do – and even more – we’re all just happy to maintain,” he says. “If we can

keep things going like this then we’ll be so happy with that. Musically we just want to keep gradually changing things up and growing our sound and ourselves. I wanna be a band like Brand New who’ve been around long enough to have such a hard core fan base that they’re able to creatively do whatever they want and their audience will just go along for the ride. We don’t want to alienate people who like us for what we’ve done, so for us it’s just a gradual process at this stage.”

“Basically, you’re getting two different versions of the album – how we recorded it, and how we’re playing it live. It looks really cool, too – our art director, Nick Lakiotes, really knows how to capture the aesthetics of what we do.” Australian audiences will get their chance to hear Earth Rocker for themselves when the band returns in February for the Soundwave Festival. It was the same festival where Aussies last saw them back in 2010 – and Sult enthuses that the whole group is raring to return. “It’s always been absolutely amazing coming over there – I don’t think we’ve ever had a bad show over there,” he says. “This will be our sixth time, and every time we’ve

gone over it’s been an amazing experience. Even the days off are fun!” Before he can go any further, Sult is cut off by his young son asking an indecipherable question. Excusing himself, Sult offers a solution to whatever the problem was – “Just flush it!” he says – and then returns to wrap up. Clutch: Overlords of riffs, interviews and parenting. What more could you want?

THE DILLINGER ESCAPE PLAN will perform at this year’s Soundwave festival on Friday February 28 at Flemington Racecourse, alongside Greenday, Placebo, A Day To Remember and many more.

MAYDAY PARADE

By Krissi Weiss

The pretty boys of punk from sunny Tallahassee have well and truly earned their stripes in the hardcore scene. Mayday Parade completed their musical apprenticeship alongside punk rock luminaries Fall Out Boy and You Me At Six while honing their live skills around the world (including the most educating festival of all – Vans Warped Tour). With album number four – Monsters In The Closet – released to the world last year, the five-piece are in an enviable place in the music scene but as many people know, comfort can be a dangerous thing. With the album released in October, Mayday Parade enjoyed a Christmas break in the middle of what would have been at any other time of the year, the height of the album touring cycle. “This is the third album in a row that we’ve put out around the first week of October so we’re used to this kind of routine,” front man Derek Sanders says. “For each album we do the massive Fall tour to support it and then we take off for the holidays and then we hit it hard again early in the next year.” Do they notice a change between the initial tour and the audience’s response to the album after the holidays? Has the audience become more familiar with the new material by then? “I think you’ve nailed it,” he says. “When we do the first tour it’s very cool and exciting and a lot of the new stuff that we play gets a good response, but

because it’s so new it just isn’t as familiar to the audience. It feels great to come back after the break and see how the response has changed to the new songs as people have had time to really get to know the music.” The genre that Mayday Parade exists within, by its very nature, means that by album number three critics are howling disdainfully that their new material is merely a rearrangement of their back catalogue while their audience salivates at the very same thought. What music critics claim is hardcore’s ultimate creative failing is, to the genre’s audience, its greatest asset – reliability. So how does a band stay creatively fulfilled while adhering to the expectations of your audience? “It can be tough,” he says. “You can spend a tonne of time analysing it and thinking about it but really, we try to not spend

MAYDAY PARADE will perform at Soundwave festival on Friday February 28 at Flemington Racecourse with Green Day, Placebo, Trivium and many, many more. Monsters In The Closet is out now through Fearless.

CLUTCH By David James Young Music aficionados will see plenty of bands coming and going in their time, so whenever an artist reaches double digits in any regard it’s a commendable and respectable effort. Heavy Maryland four-piece Clutch spent their 23rd year as a band in 2013 releasing and touring their tenth studio album, Earth Rocker. Their first studio release in four years, the album was a welcome return for Clutch to their cult-like fanbase – high on blazing guitar licks and hellhound vocals, low on filler. “The fact that we were able to release our tenth album this year was such a highlight for us,” says Tim Sult, the band’s lead guitarist and one of its founding members. “People seem to be really into it. We can go out and play shows where we play all 11 of the new songs that we’ve written. The fact that we can keep going out and doing what we do after all these years – I’d say it’s the highlight of my career. It’s not like we’re a band who people only like the first few albums of, you know? We’re lucky to be able to continue to write songs that people react to and take to heart.” The album picks up where its predecessor, 2009’s Strange Cousins From The West, left off. This isn’t a coincidence, either – despite the lengthy gap between albums (the longest they’ve ever had in their discography), Sult traces the writing of Earth Rocker right back to the months after Strange Cousins was released. It was BEAT MAGAZINE PAGE 42

more or less a matter of life getting in the way – extensive touring lead to extensive breaks so the band members could spend time with their families. “For us, it didn’t feel like this huge gap between releasing new albums. We just kind of lost track of the time. There’s definitely a lot of fresh stuff on Earth Rocker, though. We’re constantly writing new material, we’re always throwing out new ideas. We might dump it, we might keep it. You never know what’s going to happen.” In the spirit of keeping things fresh, Clutch released a special edition of Earth Rocker last month as a doubleLP picture disc set. Entitled Earth Rocker Live, the set consists of the album itself and a recreation of its track listing using recordings from live shows. “Our drummer JP [ Jean-Paul Gaster] cherry picked the best live versions of each of the songs on the album,” says Sult.

DISCUSS WHAT? BEAT.COM.AU/DISCUSSION

CLUTCH will play the annual Soundwave festival on Friday February 28 at Flemington Racecourse. They will also rock the Prince Bandroom on Thursday February 27. Tickets available via Oztix.


CRUNCH

CORE

METAL, HEAVY ROCK. CLASSIC ROCK LOCAL AND INTERNATIONAL GOOD SHIT

With Peter Hodgson: crunchcolumn@gmail.com

By Emily Kelly: ek1984@gmail.com

STAR-STUDDED LED ZEPPELIN TRIBUTE

THE CANING ALBUM ON THE WAY I’ve been checking out the forthcoming album by Melbourne rockers The Caning, recorded in September at Sing Sing with producer Tim Gilles. The first track (Burn Out, Fade Away) is already available to check out on their website. If you’re into riff-driven hard rock, classic rock and 70s metal you’ll love this! Their next gig is at the St. Kilda Festival on Thursday February 6 at the Elephant & Wheelbarrow with Riot In Toytown and Transience as part of the Live ‘N’ Local contingent. You can find The Caning on all the usual social media channels.

PUNK, SKA, HARDCORE NEWS, REVIEWS & GOSSIP

For one night only, a group of talented Australian artists are uniting at The Corner Hotel in Richmond to recreate the sounds of Jimmy Page, John Bonham, John Paul Jones and Robert Plant – Led Zeppelin, of course – played at Kooyong back in 1972. The team of musicians coming together to perform the set list of the legendary rock group includes Ash Naylor (Even), Danny Leo (King of the North), Stephen Hadley (Tex Perkins), Bruce Haymes (Renee Geyer), Dave Larkin (Dallas Crane), Vika Bull (Vika & Linda), Pat Carmody (My Dynamite) and Talei & Eliza Wolfgramm. It is sure to be a rockin’ celebration of the first and only time Led Zeppelin graced Melbourne with their presence. Ramble on down (ha!) on Friday January 31.

Ask anyone and they’ll tell you that one of the highlights of last year’s Soundwave Festival was Swedish metal band Ghost. I remember at one point seeing punters bolting across an oval in order to catch a band’s set before its conclusion. When I asked what they were so eager to see, a young man informed me that a rumour had been spreading about Ghost’s special live show. If you’re not heading to Big Day Out this year, you can now catch Papa Emeritus and his crew of nameless ghouls at The Hi-Fi Bar on Wednesday January 22. Alexisonfire are still getting fans hot under the collar, even a year after their demise. The band released an online documentary series last week that features an episode for every one of their albums. It really is a fantastic insight into the band’s dynamic and history. And damn, hearing those songs again, I can’t help but think the guys have left really massive shoes to fill in the melodic hardcore field. It may be sometime until someone can create a catalogue as flawless as those dudes.

Hadal Maw Adelaide’s Crisis Alert have announced a mega tour this February, to support their recently released full-length Urban Decay. They’ll perform at Melbourne’s Reverence Hotel on Friday February 14, followed up with an all ages spot at Phoenix Youth Club on Sunday February 16. Stay tuned for supports because they’re bound to be pretty decent. Tickets are available at the door. Tom Morello has said something rather outlandish in an interview with Billboard Magazine and subsequently revealed a rather massive ego. Not to say it’s totally unwarranted; the man is a genius. Morello spoke of his upcoming album (his “first solo big rock record”) saying that “the idea is that this is the Hendrix of now”.

NEW INSANITV The first edition of InsaniTV for 2014 is the best one yet, featuring Hadal Maw, Cube, Ravenous, Eye Of The Enemy, Brighter Than A Thousand Suns, Paradigm and The Advent Equation. Check it out at youtube/HMV8Fn9mP4Y

THE DEAD DAISIES HIT THE ROAD The Dead Daisies – the supergroup combining members of Guns N’ Roses, Noiseworks, Whitesnake, The Cult and more, will kick off a series of shows next month to support the February 7 release of their selftitled debut album. The line-up for the Australian dates will feature Jon Stevens (INXS/Noiseworks), David Lowy (Red Phoenix/Mink), Richard Fortus (Guns N’ Roses/Psychedelic Furs), Dizzy Reed (Guns N’ Roses/Hookers & Blow), Marco Mendoza (Thin Lizzy/Whitesnake) and newcomer to the band, John Tempesta (The Cult/Rob Zombie). “I’m really excited about the release of The Dead Daisies debut album in Australia,” Stevens says. “We’ve been on tour in the US and UK over the last six months and can’t wait to play shows at home all through February.” Those overseas dates included a tour with Aerosmith, a headlining slot on the Rockstar Energy UPROAR Festival alongside Alice in Chains and Jane’s Addiction, and sell out shows throughout the UK & Israel. The Dead Daisies are also set to play a series of dates across the country. They’ll be at Rochford Wines Day On The Green on Saturday February 15 and The Espy on Sunday the 16th.

Perth’s Saviour have followed in the footsteps of label mates House Vs Hurricane and called it quits, despite showing bucket loads of promise. Whereas House Vs Hurricane had been kicking about for a while, Saviour had just released their debut album via popular hardcore label UNFD before they announced that they’d be “calling it a day”. They’ll honour commitments to Breath Of Life Festival and Pushover Festival, but will then part ways. No reason for the split has been offered, despite their insistence that “it is going to be the hardest thing letting it go”.

CORE GIG GUIDE WEDNESDAY JANUARY 15: Blessthefall, Prepared Like A Bride, The Colour Morale, Glorified, Storm The Sky at Arrow On Swanston THURSDAY JANUARY 16: Erica Freas at Dane Certificates Magic Shop Blessthefall, Prepared Like A Bride, The Colour Morale, Trainwreck at Corner Hotel Bellusira, Jack The Stripper, Ire, Copia at Next Watchtower, The High Drifters, Turqminus, The Sweaters at The Bendigo Hotel FRIDAY JANUARY 17: Erica Freas at The Reverence Misfits, Graveyard Rockstars, The Mercy Kills at Corner Hotel Young Lions at Wrangler Studios The Bluebottles, The Villenettes, The Kave In at The Luwow Outlines, Oh Pacific, Singles, Break The Wall at The Bendigo SATURDAY JANUARY 18: Lucy Wilson, Force Fieldz at The Old Bar Rotting Christ, The Amenta, Terra Australis, Denouncement Pyre, Rise Of Avernus at The HiFi Bar Built On Secrets, Young Lions, Just Like Clockwork, Sidelines at Ding Dong Lounge Cosmic Psychos, The Meanies, The Murlocs, Harmony, Straight Arrows, Batpiss, Bits Of Shit, The Spinning Rooms at Port Royal Street Party, Port Melbourne King Parrot, I Declare War, Graves, Bury The Truth at Bang The Feel Goods, Evil Twin, Uptown Ace, Willow Darling at The Bendigo SUNDAY JANUARY 19: Eyehategod at The HiFi Bar Wil Wagner, Jamie Hay, Spencer Scott, Georgia Maq at The Reverence

PALACE OF THE KING EP LAUNCH Rock lives! And you can see it come to life when Palace Of The King launch their new EP Moon & Mountain at Cherry Bar on February 1. The band has an interesting story. At the end of 2012 they approached Tim Henwood (The Androids, The Superjesus) after seeing him sing with former KISS guitarist Bruce Kulick. The band needed a singer but Tim had no intention of joining any other bands and so he offered to help them find a frontman. Then he heard the instrumental versions of the songs that ended up on the first EP. Tim liked them so much that he felt compelled to get involved with the band. “When I heard the tunes, I thought, ‘I’m not gonna help anyone else get this gig!’” Tim added his vocals and returned the songs with a simple message: “I’m in.”

DOOMY STONE PSYCHE AT THE BENDIGO The Bendigo Hotel in Collingwood is offering up a slab of awesome upcoming local stoner-doom-psyche riffery this Thursday January 16 with Watchtower, The Highdrifters, The Sweaters and Turqminus.

IF YOU’RE SUBMITTING NEWS.. GIG ALERT: TV COLOURS Canberra band TV Colours are buzzing from the positive reaction to their album Purple Skies, Toxic River and their recent European tour, and they’ll kick off 2014 with a show at The Bridge Hotel Castlemaine on January 25 with The Stevens – who released their own amazing album in 2013 – and Castlemaine/ Melbourne band Beat Disease. Doors at 8:30, entry is $10.

This week I’m flying out to Los Angeles for a couple of weeks – yes mum, I’ll send a postcard – so if you have news to submit please try to get it in a little earlier than the usual Sunday night cut-off. By Saturday afternoon would be utterly awesome.

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 43


MUSIC NEWS

YOUR COMPREHENSIVE LOCAL GUIDE

For all the latest news check out beat.com.au

WEDNESDAY JANUARY 15

BOOKER T AND THE MGS TRIBUTE SHOW

This Wednesday Ding Dong Lounge plays host to Matt Dwyer’s Booker T and the MGs Tribute Show, an all-star cast of seasoned players coming together to pay homage to the works of one of the greats. With members like Matt Dwyer (ex-Bondi Cigars), Steve Hadley (Paul Kelly, Tex Perkins, Black Sorrows), Dustin Maclean (ex-Bamboos) and the inimitable Steve Morrison, the sheer talent and chops on stage is astounding.  They’ll be joined by very special guest Rita Satch, who having supported the likes of Renee Geyer and Kate Ceberano, and with an excellent debut EP under her belt, not to mention a stellar effort in the works, has shown herself to be a stalwart of Australian Soul. Free entry with Mr Vince Peach (PBS) spinning tunes before, in between and after the bands.

VAN WALKER

After a hardcore 2013 touring Australia and Europe while also finding time to release an album with the Livingstone Daisies and write the first draft of a novel, Van Walker returns to The Retreat Hotel for a balmy summer evening residency with new songs, Shane Reiley on lap steel and a bunch of his favorite Melbourne acts, including  Duncan Graham & Rex Watts,  Small Town Romance,  Leena,  Jemma Rowlands & Sean McMahon. From 8.30pm every Wednesday in January.

ROD FRITZ AND ROCHELLE BRUCE

TENDER BONES

Soon to release their debut 10” vinyl, Tender Bones are set to hit the Boney stage this Wednesday night alongside The In The Out and The New Pollution. Their debut was recorded and mixed with Jake Phillips and mastered by Greg Wadley (Beaches, Kim Salmon) If you’re lucky, they might just have a few copies of their soon-to-be-released release for some lucky punters.

FULL CODE

THE STRANGE

Part gypsy caravan and part psychedelic meltdown, The Strange are a collection of garage beat mystics. After supporting The Preatures on the Melbourne dates of their recent Is This How You Feel tour and a successful tour in support of debut single Sugar Boy/Cherry Pop, The Strange have quickly evolved into a hypnotic fixture of the Melbourne scene. The lo-fi scuzz at the core of their sound threads together a patchwork of influences from The Velvet Underground and The Rolling Stones to French symbolist poet Arthur Rimbaud and English occultist Aleister Crowley. Thursdays in January 2014 will see The Strange take centre stage for a residency at legendary Melbourne club Yah Yah’s with a colourful cast of supports including Sooky La La, The Naked Bodies, Going Swimming, Darts and the Hondas. See them on January 9, 16 and 23 and experience their strange and psychedelic world first hand. Debut single Sugar Boy/Cherry Pop available now on iTunes, Spotify, Google Play and Amazon.

Originally from NZ, are the tribal, warm, and spacious sounds of Full Code. Bliss to dance to. Ziah Ziam will be the beans between the bread, getting as rowdy and loudly as possible with stoner punk rock. The boys from Belgrave Shut Up Jackson doing their uplifting, enchanted, swampy, hardcore grooves. Come check out some live music this January Wednesday 15 at The Bendigo! Doors at 8pm and its $8 to get in.

SARA RETALLICK

Melbourne based singer and songwriter Sara Retallick takes time out from her band Jimmy Tait to play a rare solo show Wednesday January 15. Retallick takes listeners on a journey of heartache and hope. With the silence and space of her country past to the bedlam and noise of the city she now resides delivering a distinctive twist of Australian Gothic. She’ll be playing songs from the band’s latest offering, Golden. Special guest is Palm Springs playing solo. Head down to The Spotted Mallard for this free entry mid-week pick up.

The freshest offering to the Revolver Bandroom and Colonel Tan’s is the new ‘The Acoustic Sessions’ dining experience! You can pull up a seat at a table in the front room or a couch if you prefer and enjoy some relaxed tunes from an array of Melbourne and Australia’s finest acoustic artist’s week in, week out. All whilst enjoying the large number of choices from the Colonel Tan’s Thai Restaurant menu. This week to serenade you they have the well traveled and very charismatic Rod Fritz, who has racked up numerous independent music awards throughout his career with his brand of folk/rock. Alongside him will be new girl to the scene Rochelle Bruce, who will be playing a mellowed out set of popular songs to keep you entertained throughout your meal.  Doors at 6.30pm. Entertainment starts at 7pm.

THE BRUNSWICK HOTEL OPEN MIC

Whether you play a comedian, poet, musician or dancer, you are welcome here at the Brunny this Wednesday January 15. Register from 7pm onwards with the time slot raffle drawn out at 7.30pm. Get in early to ensure you get a spot! $10 Jugs of Boags Draught all night (perfect for those needing a bit of liquid courage).

CHILD

PASSERINE

A  little bit dub, a little bit trip hop and a LOT of disco. That pretty much sums up dynamic, seven-piece band Passerine who will be headlining the Espy front bar on Thursday January 16. Passerine first  appeared in July 2013 with the debut single Ready To Begin, an infectious, band-driven disco number that dragged listeners out of the depths of winter and onto the dance floor. They returned with Paris Morning  featuring a remix by Sydney producer GLOVES which caught the attention of The Aston Shuffle (“This is a Gem”), and the original version being  named as one of the “Top 25 Genre Benders of 2013” by influential  Canadian blog, Hilly Dilly. With the launch of their self-titled, debut EP in February imminent, Passerine will bring some disco deliciousness to the Espy with a free show in the front bar, with some very special guests in tow.

Psychedelic blues rock trio Child continue their Wednesdays in January residency at Cherry Bar and this week, support comes from Don Fernando and Arctic Dune. Doors at 6pm and music from 9pm. Cherry DJs till 3am and the best part is that it’s all free entry!

PRIMATE 

To finish off their Australian tour, Primate (featuring Bill Kelliher of Mastodon and Kevin Sharp of Brutal Truth) will be ripping it up with a set of Black Flag covers this Wednesday January 15 at Whole Lotta Love Bar! Show starts at 8pm and its $25 entry, but be warned, capacity is limited.

THURSDAY JANUARY 16 Darling James

L ARISSA TANDY

Here is a unique voice: Her unrestrained performances and muscular songwriting are fast becoming Larissa Tandy’s hallmarks. While her band, Strine Singers goes from strength to strength, she has been quietly toiling away between shows: writing compulsively, studio engineering, and staking a claim on foreign red carpets as a film composer for hire. She emerges as a solo artist for the first time with a five part residency with a stellar lineup of handpicked supports, including Tracy McNeil, Rich Davies, Saint Jude’s Brooke Penrose, Al Parkinson, Amarillo, Brooke Russell, and more. Every Thursday in January at Some Velvet Morning, Clifton Hill. Free Entry. 8pm start.

SMITH STREET SOUL TRAIN

NORTHCOTE TOWN HALL SUMMER JAMBOREE

Need a cool tune to quench the heat? Head to the Northcote Town Hall Summer Jamboree! Darebin City Council presents three glorious extra-long summer weekends of free music, games, sunsets and summer refreshments to keep you cool as the temperature soars. Pull up a deckchair, grab some chilled watermelon and soak up some of the coolest grooves in town. It’s all free at the Summer Jamboree. Highlights include: Hairy Soul Man and Guests at the Sunday Soul Sessions on January 19. Darling James (Duo), Nicolette Forte and Domini Foster on Australia Day Eve Mikelangelo and Guests at the Australia Day Bonanza The Darjeelings, The Rims and Miss Eileen &amp; King Lear presented by Decibels Youth Music Centre on Saturday February 2 and Carus Thompson and The Furbelows at the Jamboree Finale on Sunday February 2. BEAT MAGAZINE PAGE 44

All you soul lovers should head on down to the infamous Soul in the Basement at Cherry Bar this Thursday as the Smith Street Soul Train play one huge set of classic and current soul tunes from 10pm. Original DJs Vincent Peach and Pierre Baroni spin classic funk and soul 45s until the AM. Doors 9pm, $10 entry.

TRACY MCNEIL

From the wilds of Ontario, now firmly planted in Melbourne, Tracy McNeil fluently blends authentic alt-country with timeless rock and searing pop in songs that have been described as ‘mini masterpieces’. She can pull you in, break your heart and leave you wanting more. With third record Nobody Ever Leaves due to be released in the near future, 2014 shapes up as a big year. Tracy will be hitting up the Drunken Poet this Thursday from 4pm with a swag full of songs both old and new.

NAME THAT POINT IN THE NIGHT WHEN JOKES TURN INTO JOKER IMPERSONATIONS. VISIT NAMETHATPOINT.COM TO WIN $5,000


MUSIC NEWS

YOUR COMPREHENSIVE LOCAL GUIDE

For all the latest news check out beat.com.au

LOW SPEED BUS CHASE

GOING SWIMMING

After the ‘annus gargantuous’ that was 2013, a year that saw them release their debut EP to a sold-out Grace Darling, as well as two new singles and 3 interstate tours, the lairy lads from Going Swimming are set to welcome the new year at The Tote with some new tunes, a bunch of rad bands and too many tinnies. Joined by a bunch of their musical mates, Going Swimming’s Summer Lovin’ mini Slow Club residency will see the boys defile The Tote’s upstairs area for the last three  Thursday nights in January, so come along and blast your back-to-work blues away with some short, sharp, surf-punk jams. $5 entry, 8.30pm every Thursday in January.

Come along for some Thursday Night drinks and some great live music, sweet atmosphere at the Reverence hotel on Thursday January 16. Kicking off proceedings will be Billy Jean Simmons of the Melbourne three piece rock act Kashmere Club. Performing an acoustic set showcasing his talent of bringing a new flavour to well known covers, as well as some great original songs. Melbourne three-piece The Ugly Kings also join the bill with only one guitar, drums and vocals the sound they produce is truly awesome and is a must see up and coming local act. Headliners Low Speed Bus Chase are a five-piece funk-rock act with elements of reggae and blues thrown in for good measure with their energetic live performance set to make it a great early-weekend treat. All this for a donation entry.

ARTHUR PENN & THE FUNKY TEN

With ‘Funktoberfest’ now a somewhat delicious and distant memory, it’s time for Arthur Penn to come back with a whole new party–this time happening at the John Curtin Hotel. Uncle Arthur has more tunes, more dance moves and more reasons for you to question why you came in the first place. Soul Safari and Maeflower will kick the night off so make sure you don’t miss a minute. It all goes down this Thursday January 16, kicking off at 8:30pm and its only $5.00 on the door!

FRIDAY JANUARY 17

GHOST TOWNS OF THE MIDWEST

CAT CANTERI

Stepping out from behind the drum kit to the front of stage, singer-songwriter, and multi-instrumentalist Cat Canteri (The Stillsons) is launching her new electric band at The Retreat Hotel, this Thursday January 16. Canteri has been busy putting the finishing touches to her debut solo album, which has been produced by Aria award winning Craig Pilkington (Archie Roach, Gurrumul, Killjoys). Canteri says she wasn’t in a hurry to finish her new recording, as The Stillsons’ constant work ethic kept her extremely busy over 2013. She selected some of Melbourne’s finest musicians to perform in her group, including: Megan Bernard (guitar/ keys), Justin Bernasconi (The Stillsons), Daniel Hobson (The Stillsons), and Scott Zimmer (The Bastard Children). She plays The Retreat from 9.30pm.

MI-SEX

During 2013, MI-SEX  tested the chemistry between the band, the songs and the crowds and its success had them make a pack to come together and perform a few times each year. What better way to kick off 2014 than to follow the sun, creating and doing something the band all love, “performing our music live”, at the same time venturing into areas that have not seen the band perform since they were at the top in the ’80s. The iconic new wave  rockers will be  delivering the same powerful MI-SEX show in the Espy Gershwin Room on Friday January 17, so lets see you rock-out like you did back then! Tickets are $31 + bf via OzTix.

HALCYON DRIVE

Melbourne duo Halcyon Drive bring their mix of garage indie pop goodness with a combination of upbeat tunes and irritatingly irresistible hooks to Revolver this Thursday night. Following them will be the guys from Foreign/National who just recently filled the Boney venue for the launch of their single Paris and are ready to do the same again. Topping off the night is Digital Order who hail all the way from Perth, and are bringing along with them what they claim to not only be a musical act but an experience with a unique mix of electronic/hard rock. Entry is $5 at the door. Doors 8.30pm.

ERICA FREAS

This Friday January 17, Erica Freas (Olympia, USA), from RVIVR will be gracing our shores for the first time with her solo/acoustic/folk project. This is an exciting prelude to RVIVR’s first Australian tour in April. In conjunction with the tour, Melbourne indie label One Brick Today will be releasing Erica’s full length LP Belly on cassette, a tour 7”, and some other RVIVR related goodies! This show is set to be sweet one, with the line-up boasting locals Circular Keys, Masses and Lucy Wilson. Only $12 on the door, music from 8pm.

Local Alt-Country Raconteurs Ghost Towns of the Midwest, will take the stage at The Cornish Arms in Brunswick every Friday in January, previewing songs from their recently recorded debut EP. A different special guest opens each week, including Anne of the Wolves, Rob Harrow (Immigrant Union) and Liam Gerner...and best part–it’s free!

MR BL ACK AND BLUES

Having recently been honored with Rhythms magazines Australian ‘Album of the Year’, Mr. Black and Blues is in top form. It has been said that the sound is like Eric Bibb getting drunk with Tom Waits and being told to straighten up by the ghost of Howlin Wolf in a Clarksdale back alley. This cannot be a bad thing. Weaving the voodoo this Friday at the Drunken Poet from 8.30pm.

NAME THAT POINT IN THE NIGHT WHEN DINNER PLANS TURN INTO FOOD VANS. VISIT NAMETHATPOINT.COM TO WIN $5,000

BEAT MAGAZINE PAGE 45


THE MIGHT Y KINGS

The Mighty Kings hit Whole Lotta Love Bar this Friday January 17 with a set of rock n’, pop’n n’ rockabilly covers. Come on down for a great night of dance and drinks. It all kicks off at 8:00pm and the best thing is, is its free entry!

MUSIC NEWS For all the latest news check out beat.com.au

THE VILLENETTES

The Villenettes will be in town for a one-night stand at The Luwow, Fitzroy, to give their Melbourne fans another dose of their psychobilly rock’n’roll. On their first trip to Melbourne in 2013, The Villenettes launched their debut EP, V for Villendetta, to a full house at The Old Bar in Brunswick. The Villenettes will smash it out with ’60s surf boys The Bluebottles and rockers The Kave In for a night of garage mayhem. Hosts DJ Sye Saxon and Jemma Reprobette will be along for the ride, as well as The LuWow’s go-go goddesses. Doors 8pm. Entry $7.

SATURDAY JANUARY 18

THE DRUNKEN POACHERS

With their wily ways and wooden instruments, The Drunken Poachers have snuck boot-clad and boozed onto Melbourne’s live music stages. A dubious septet not to be trusted, they poach the tunes of others and after a white-wash of their brand of Irish-blue-grasscountry, they declare what never belonged to them, their own. Dishonest and dirty and ...wearing flannelette better than you do, they’re leaving heavy heads and dented floors in their very catchy wake. With the aid of banjo, gee-tah, ukulele and mandolin, backed by Irish fiddle, uke bass and propped up with lager phone and a trifle of trumpet, their hearty harmonic throat is unlike any other. They take the stage at the Reverence Hotel on Saturday January 18. Entry $2.

HAYLEY COUPER

This Friday January 17, Hayley Couper will be showcasing both new material from her forthcoming EP Love. Addix. Anon, along with previously released tracks at North Fitzroy’s intimate Some Velvet Morning. This stripped back performance is a perfect start to anyone’s weekend. With special guest Adam Cousens, it’s one not to be missed. 8pm, free entry.

OUTLINES

CHERRYWOOD

Sold out shows, exhausted riders, small towns with even smaller stages, festivals, thousands of kilometers and one new album. Cherrywood’s highly acclaimed debut Book of Matches sent the four blokes and their Country/Punk tunes to the far reaches of the country in 2013. But now Rob, the lovable double bass player and founding member is heading back to his homeland of Ireland. To celebrate his service, Cherrywood are throwing him a massive farewell at The John Curtin Hotel with a stunning line-up including Saint Jude, Suicide Swans (QLD), Sara Retallick ( Jimmy Tait) and Graveyard Train DJs. It’ll also be the last Melbourne show for Cherrywood for a while as they head into the studio to record a new album with whoever is silly enough to come along and play bass. So come along to The Curtin on Friday January 17 and say “G’bye” to Rob.

SKYSCRAPER STAN

Skyscraper Stan and the Commission Flats play troubadour rock ‘n’ roll, a flavour of music birthed in the musical mecca of Melbourne, Australia and unique to the group. Sensibilities gleaned from years of playing early American music collide with the big band sound of New Orleans and the verbose, cynical and often whimsical lyrics of frontman Stan Woodhouse. Supported by Perth songstress Ruby Boots at The Spotted Mallard this Friday from 9pm. Free entry.

It’s been almost a year since  Outlines  put out their debut EP, Idle Times & Clouded Minds. In that year they have matured as a band and truly developed their own unique sound. Friday January 17 marks the launch of their new EP Talking Walls, a release beyond their years which looks to illustrate their progression. Joining them to help launch Talking Walls, will be Oh Pacific,  Singles  and  Break The Wall  to complete an exciting and diverse line up. It all happens this Friday at The Bendigo. Showtime is 8pm.

BUILT ON SECRETS

After five years, hundreds of shows, multiple tours on the back of two successful releases and many adventures along the way, Melbourne’s Built On Secrets are calling it a day. This will be the final performance for the band, highlighting a large back catalog of songs from their humble beginnings to their stunning debut album The Disconnect at the iconic Ding Dong Lounge. Joining them on their final show will be Brisbane favourites Young Lions, Adelaide’s Just Like Clockwork and Melbourne’s best new pop punk outfit Sidelines. Head to the Ding Dong Lounge on Saturday January 18 for one last special show.

THE LOVE BOMBS

The Love Bombs are an up and coming four piece that comprises of members Hamish McLean and Derek Anderson from The Council and Jamie McLean from Bunny Monroe. Combining forces with singer Pierina O’Brien they have created a sound that can only be described as a rock beat with a punk heart … They are just at the end of a wildly successful Wednesday night residency at the Cherry Bar in AC/DC Lane. With The Love Bombs taking the stage, Friday January 17 is going to be one hell of a sweet night of rawk. Doors at 7pm with bands hitting the stage from 9pm. Free entry.

THE GLORIOUS NORTH

The Glorious North play music that aficionados of shoe-gaze yodeling call “slacker country”–think Jay Mascis smashing it at the bar with Dwight Yoakam while Ben Kweller noodles around in the background. They do this for no personal gain; merely to provide the soundtrack for you to drink copiously and bootscoot your way into the whiskey-stained heart of that someone special. They play The Retreat Hotel Front bar at 8pm on Saturday January 18 followed by an epic DJ set from Adalita!

GRAND WAZOO

After a short break, Grand WaZoo are resuming public gigs in 2014, kicking off  at The Flying Saucer Club, Elsternwick on Saturday January 18 at 8.30pm. Bookings are online and dining is available from 6.30pm, prior to the show. Catch up with stellar singers, Wylie Miller, May Johnston and Samantha Morley with this fantastic band of six horns and four rhythm for another outstanding Soul Spectacular.

THE FEEL GOODS

The Feel goods were established in 2007 as a hard rockin’ blues duo from Melbourne’s hills. They have since worked their knuckles to the bone playing all over Melbourne and interstate.  Evil Twin,  Uptown Ace  and  Willow Darling  will be in the supporting roles. So, this Saturday January 18 come see four amazing rock bands share the stage for one night at The Bendigo. Show starts at 8pm and it’s $10 on the door.

SPENCER P JONES

If you’re looking to kick-start your weekend, head down to Cherry Bar to catch Spencer P Jones continuing his Friday residency playing two solo sets from 5.30pm til 7.40pm. It’s all free entry to catch The Keef of Melbourne. Do it!

JC & THE PO’BOYS

JC & the Po’Boys are breaking all the rules as most bands are scaling back and touring with skeleton band members where as Joe is getting bigger an louder with this nine piece outfit. This nine piece band delivers a banquet of New Orleans second line funk, soul and R&B from artists such as The Meters, Dr John, Professor Longhair, Sly & the Family Stone and the Commodores along with Mavis Staples, The Temptations, The Staple Singers, Ann Peebles and Etta James. The Po’Boys horn section is led by the legendary Jimmy Sloggett who has played with Johnny O’Keefe, Max Merritt and Digger Revel. Add two drummers on stage and you create a recipe for some real high energy scorching funk. They launch their funky new show at The Caravan Club on Friday night January 17. Doors 8pm. BEAT MAGAZINE PAGE 46

MELODY MOON

EL MOTH

Spawned from the remnants of an empty longneck of Melbourne Bitter, El Moth dusted its wings and flapped its way around the underground party scene in 2008. The boys quickly became known as one of the hottest party bands in town, providing the soundtrack to many a memorable night. After playing in alleyways, parks, warehouses, lounge rooms and backyards with jam sets of anywhere up to 5 hours, the boys decided to see what would happen if they tried to write some actual songs. Their efforts have not gone unrecognised, and in the last few years they have played a bunch of festivals around Victoria (Folk Rhythm and Life, Apollo Bay, The Hills Are Alive, Cool Summer...). El Moth return to Bar Open for a sweltering sweatfest this Friday January 17. It’s going to be quite the funked up rockin’ reggae extravaganza! Doors at 10pm and free entry.

Melody Moon’s unique sound of sweet vocals, cello, double bass and three-part harmonies has been earning quite a reputation around town in 2013. The success of her latest single Bridges has lead to a string of festival gigs and widespread radio airplay. With her debut album well on the way, and a new single coming out this week, it’s set to be a ripper year for Melody. She will be playing with her trio at the Northcote Town Hall Summer Jamboree on Saturday Jan 18 at 3.45pm. See melodymoon.com.au for more details. 

FOXTROT

Get ready for some punk rock party times at The Brunswick Hotel! Fresh off success on The Short Fast Loud top albums of 2013, these hard working gruff punk Melbourne legends will provide you with all the rowdy sing a long good times you can shake a fist (or beer) at. Rounding off the lineup will be Laura Palmer, The Shadow League and Josh Mann (Paper Arms). This Saturday January 18–free entry, summery weather and punk rock–what more could you ask for?

NAME THAT POINT IN THE NIGHT WHEN CLEAR THINKING TURNS INTO MORE DRINKING. VISIT NAMETHATPOINT.COM TO WIN $5,000


MUSIC NEWS For all the latest news check out beat.com.au

CHAD MASON

Singer/songwriter Chad Mason is a true urban cowboy with a heart of gold and steel, wielding a hefty gift for song rather than a weather-beaten Winchester. After an extended run with Australian outlaw-country rockers Wagons, including a win for Album of the Year at The Age EG Awards (2011) and the AIR Award for Best Country Album (2011), Chad has settled in Nashville to focus on his songwriting roots. A well respected songwriter, as well as guitarist, Chad returns with a songbook of new melodies ready to offer up raw, open and reflective truths. Chad performs at The Spotted Mallard this Saturday with support from Dan Waters band. 9pm, free entry.

PABLO NARANJO

Mixing the sounds of â&#x20AC;&#x2DC;90s rock, jazzy harmonies and intricate guitar arrangements, Pablo Naranjo released his debut album as a solo artist Here in the Distance last year. After playing around Melbourne for only a few months, his album has already received very positive reviews from newspapers, radio and popular music blog sites in Australia, the UK and South America. Pablo will be playing acoustic versions of his songs on Saturday January 18 at The Thornbury Local accompanied by Eyal Chipkiewicz on percussion and Emiliano Beltzer on bass. The show starts at 9pm and entry is free. 

MATMOS

Performing with joy and humour, Matmos bring their live sonic experimentation to Howler on Sunday January 19 for an evening of boundary-pushing sonic invention on their first ever Australian tour. Avantgarde electronic duo Matmos experiment with noise to push the boundaries of pop music. Mining nonconventional sound sources and exploring bold ideas, Baltimore-based Drew Daniel and MC Schmidt have been producing music together since the mid-90s, delivering nine albums to date. Their latest release The Marriage of True Minds, based on experiments in telepathy, is an art object, a scientific report, a practical joke and a daring pop record. Tickets are $38.50+bf and available from www.h-w-l-r.com.

HALF MOON RUN

Canadaâ&#x20AC;&#x2122;s Half Moon Run are returning to Australia, 12 months after appearances at Woodford and Peats Ridge last Summer gained them an instant and solid following. Turning into a successful national tour as news of their stunning show ignited social media, the spreading reputation ultimately led to the play listing of their debut single Full Circle on triple j. They play The Corner this Sunday with support from locals Tigertown. Tickets via OzTix.

JR REYNE

Australian singer-songwriter JR Reyne will be performing a free show at Brunswickâ&#x20AC;&#x2122;s Victoria Hotel on Sunday January 19. Reyne has lived and played all over Australia, America, Asia and the UK, as both a solo artist and in bands. Releasing his debut EP Tex Sessions, whom Rolling Stone called a â&#x20AC;&#x2DC;new artist you should know aboutâ&#x20AC;&#x2122; at the age of 20, then wasting no time releasing the critically acclaimed album Fallen Flower (â&#x20AC;&#x2DC;Album of The Weekâ&#x20AC;&#x2122;â&#x20AC;&#x201C;Kathy McCabe, Daily Telegraph) the following year, Reyne has been on a musical path right from the beginning. JR Reyne will also playing a residency at Cherry Bar on Tuesdays in January, two sets from 9pm.

SUN CIT Y

Perth band  Sun City, are returning to the Espy during their Summer National tour. This year saw the release of two new singles All We See and Colour Blind alongside a string of remixes including an official remix for The  Crystal Fightersâ&#x20AC;&#x2122; single LA Calling released on Atlantic Records.  Support comes from Yeo, Jack Stirling and Suicide Swans at the Front Bar. Free entry.

RIZKYâ&#x20AC;&#x2122;S BLOCK PART Y

Friends, Hip Hop community and those that donâ&#x20AC;&#x2122;t have any idea about positive Hip Hop cultureâ&#x20AC;Ś here is the best way to find out! Some of the most talented musoâ&#x20AC;&#x2122;s are jumping on the microphone and the 1s & 2s to take you through an awesome journey of quality music, vibes and food. Cookin on 3 Burners will be bringing their funky steez live to our block party featuring some of the most talented musosâ&#x20AC;ŚBoom! Plus DJâ&#x20AC;&#x2122;s MzRizk, DJ Jumps (Cat Empire), Sensible J (Remi/House Of Beige) Butters, DJ Peril and MCâ&#x20AC;&#x2122;s Cazeaux O.S.L.O L- Fresh the Lion, Dâ&#x20AC;&#x2122;Fro & Guests plus Paris (c2F DMA) will be painting live on the day! There will also be traditional Soul Food from Trinidad & Tobago from the Ferdydurke Kitchen, a Bball shoot out , a 1 on 1 Dance dance battle and a Get Yo Hair Did Stall with Kween Kwacha from 4pm! It all goes down at Section 8 and its free from 3pm!

SUNDAY JANUARY 19

SWEET JEAN

Sweet Jean  will be kicking off an exciting year in 2014 with a hometown show at the Northcote Social Club on Sunday January  19 with special guest Hello Satellites (solo). Sweet Jean will be playing songs from their acclaimed debut album  Dear Departure,  and previewing music from their forthcoming acoustic EP. Co-produced by John Castle (Washington, The Bamboos), Dear Departure has  been included in several end of year â&#x20AC;&#x2DC;best of â&#x20AC;&#x2122; lists, and continues to receive glowing reviews in Australia and overseas. Their matinee show is from 1.30pm. Tickets $15 via northcotesocialclub.com.

RAVENSWOOD

United in celebrating women of country music, Ravenswood present four of Melbourneâ&#x20AC;&#x2122;s country/folk leading ladies, joined together in lyric, melody and song. Elizabeth Barker, Alison Ferrier, Ruth Lindsey and Alysia Manceau seamlessly blend their original material and shared influences to create a unique, smoky-sweet sound. Crowned by the haunting clarity of three and four part harmonies, Ravenswoodâ&#x20AC;&#x2122;s balance of elegant songwriting and careful instrumentation has silenced even the rowdiest of Melbourne venues.  Ravenswood are currently co-writing original material in preparation for their debut release in 2014. They play the retreat hotel front bar from 5pm on Sunday January 19. Entry is free.

MONDAY

$2 POTS $2 TACOS $5 TEQUILA $10 PARMA & POT DJS TILL LATE FREE ENTRY

TUESDAY

HAHAHA AT THE ROCHY FREE COMEDY FROM 8PM

WEDNESDAY MONDAY JANUARY 20

LETâ&#x20AC;&#x2122;S GET FUNNY AT THE BRUNNY

â&#x20AC;&#x153;We lost an Ash but gained a Mo, poor old AT had to go. Caruana joined the crew, great comedians kept coming too. All of a sudden weâ&#x20AC;&#x2122;ve turned one. the BRUNNY is the house of Fun.â&#x20AC;? Come down to the Brunswick Hotel this Monday January 20 for an evening of free comedy with feature performers every week! $10 Jugs of Boags Draught all night. 8pm. Free Entry.

TUESDAY JANUARY 21

ROCHY TRIVIA FITZROYâ&#x20AC;&#x2122;S BEST GAMESHOW PUB QUIZ WITH NED & DOUG DOUGLAS & THE DULCET TONES $60 1ST PRIZE 8PM

THURSDAY

CLIVE PARMA CHALLENGE OUR FAMOUS PARMA EATING CHALLENGE BOOKINGS ESSENTIAL HAPPY HOUR ALL NIGHT DJS TILL LATE

FRIDAY

THE TROTSKIES

Taking their cues from post punk bands of yesteryear like Ride and Joy Division, The Trotskies are a bunch of very close friends who share a passion for music whom Dave Ruby Howe from triple j Unearthed describes their sound as â&#x20AC;&#x153;getting good brooding vibes off this oneâ&#x20AC;?. Essentially the live sound they create involves moody transfigured guitars, atmospheric electronics and a robust rhythm section. So make sure you are part of the party as The Trotskies launch their third single Running from their self-titled EP at The Workers Club on Saturday January 18 with Oscar Galt and Magic America supporting. Entry is $10, doors at 8.30pm.

38% %((5*$5'(1 -2+1672167),7=52< 3+

THE ROCHY SELLS OUT LAUNCH PARTY 17TH JAN COME DOWN NEXT WEEK FOR OUR BRAND NEW FRIDAY NIGHT

COCOA JACKSON L ANE

Cocoa Jackson Lane combine Psychedelic Soul with just the right amount of grit to make your ears stick and take your mind on a tropical journey. This freshly squeezed duo is made up of Jess Harlen and Camilla Charlesworth, catching a vibe with sailing melodies and deep grooves. Theyâ&#x20AC;&#x2122;ll be pumping up the  The Bendigo this Sunday January 19 for an arvo sesh starting at 5pm and there will be plenty of other acts including Pina Tuteri,Dark Fair and DJ Ant 1, so come early. Tickets only on the door, $12. Thereâ&#x20AC;&#x2122;s a sweet beer garden usually flooded with sunshine in summer and itâ&#x20AC;&#x2122;s always a time warp at the Bendy.

THE LET YOUR HAIR DOWN GIRLS

Come get your fill of Boogaloo Soul and ShingA-Ling this Sunday for FREE in The Curtin front bar.  Featuring members of Melbourne soul band Saskwatch, The Let Your Hair Down Girls are a cool six-piece, that have awed crowds at numerous backyard get-downs and a primary school fete, but are now ready to take it next levelâ&#x20AC;&#x201C;The front bar at the John Curtain. It doesnâ&#x20AC;&#x2122;t get more next level than that! Guest DJâ&#x20AC;&#x2122;s, guests musicians,cocktail jugs and cheap beerâ&#x20AC;&#x201C;what more could you want huh? The party begins at 5pm.

SMALL TOWN ROMANCE

Freshly minted Melbourne country band Small Town Romance are looking to get you dancing, or at least drunkenly swaying, to a swag of country classics and honky tonk heart-stoppers. With a line up consisting of tex-mex button accordion, telecaster, lap steel and watertight harmonies, they make their way from the country music of South Texas to South Australia, peppering their set with originals that youâ&#x20AC;&#x2122;ll swear youâ&#x20AC;&#x2122;ve heard somewhere else before. Come catch them this Sunday January 19 as they warm up the Bar Open beer garden with a special Sunday arvo session of two sets, cold drinks and free entry. Support comes from Peter Dickybird, Wonderboy, The Furrows and Vision Street. Show kicks off at 3pm.

SATURDAY

SHANE Oâ&#x20AC;&#x2122;MARA AND DAN LETHBRIDGE

Melbourne singer/songwriter Dan Lethbridge teams up with renowned guitarist Shane Oâ&#x20AC;&#x2122;Mara for a duo residency at The Retreat Hotel. Lethbridgeâ&#x20AC;&#x2122;s second album Oh Hawke (mixed by Oâ&#x20AC;&#x2122;Mara) drew resounding praise from the Australian music community with Rhythms Magazine editor Martin Jones describing the album as â&#x20AC;&#x2DC;delivering in both style and substanceâ&#x20AC;&#x2122;. Dan and Shane will be playing songs from Oh Hawke as well as a selection of their favourite covers. Front bar. 7.30pm Tuesdays. Free.

LETâ&#x20AC;&#x2122;S GET TRIVICAL

Come and be fascinated by the wonderful world of music. Win booze. Win meals. You might win music too. But everyone will win one thing. You know what that prize is? Knowledge. You will win music knowledge. It will serve you well. Itâ&#x20AC;&#x2122;s not â&#x20AC;&#x153;Letâ&#x20AC;&#x2122;s Get Quizzicalâ&#x20AC;?. Itâ&#x20AC;&#x2122;s not â&#x20AC;&#x153;Letâ&#x20AC;&#x2122;s Get Trivialâ&#x20AC;?. They would be obvious choices. Itâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Letâ&#x20AC;&#x2122;s Get Trivicalâ&#x20AC;? which is infinitely better than both. Hosted by Laura Imbruglia every Tuesday night from 7:30pm, free entry at The Spotted Mallard.

LOOKING FORWARD

JANUARY CASS MCCOMBS

Brilliant songsmith Cass McCombs returns to Melbourne for a one-night-only intimate evening of magical songs from his richly rewarding 22-song opus, Big Wheel And Others, on Thursday January 30 at The Northcote Social Club with full band and special guest, Ross McLennan. Tickets on sale now via Corner Box Office.

BE PART OF HISTORY. VISIT NAMETHATPOINT.COM TO WIN $5,000

BLACK NIGHT CRASH MELBOURNEâ&#x20AC;&#x2122;S LONGEST RUNNING INDIE NIGHT FEATURING MINIATURES HIDEOUS TOWNS, BREVE 9PM $5

SUNDAY

PARMA Oâ&#x20AC;&#x2122;CLOCK $6 PARMAS AT 6PM, $7 PARMAS @ 7PM, $8 PARMAS @ 8PM

HAPPY HOUR 9PM - 11PM , TUESDAY - SUNDAY $6 ROCHY DRAUGHT PINTS $6 CIDER PINTS $6 VODKA

OPENING HOURS Mon 7pm - 1am Tues - Thurs 4pm - 1am Fri - Sat 4pm - 3am Sun 1pm - 11pm PH: 9415 7555 BAND BOOKINGS: info@blacknightcrashcom www.facebook.com/rochestercastlehotel BEAT MAGAZINE PAGE 47


MUSIC NEWS

YOUR COMPREHENSIVE LOCAL GUIDE

For all the latest news check out beat.com.au

L A BASTARD

T V COLOURS

Picture Nancy Sinatra singing out front of the Gun Club with Dick Diver playing lead guitar at the best party of the year. If you can imagine such an exciting and eclectic mix of 50’s rock n roll, 60’s surf tunes and 80’s punk attitude, you’re getting close to the sound of four piece La Bastard. La Bastard’s mix of sultry vocals, searing licks and unwavering energy will get you dancing even if they have to come down there and join you! With a stellar line up of superb musicians Rich Davies and The Devils Union will be joining La Bastard for one hell of a rockin’ night! Rich captivates the crowd with his soulful voice and the entire band delivers an incredible high energy show not to be missed! Be sure to be at the LuWow on Friday January 24.

2013 was a massive year for TV Colours. The Canberra band released their Purple Skies, Toxic River album, toured Europe and towards the end of the year topped (or came close to topping) many ‘Best of 2013’ lists. They kick off 2014 with two big shows over the Australia Day weekend. First up at the Bridge Hotel in regional Castlemaine with The Stevens who released their own amazing album in 2013 and Castlemaine/ Melbourne band Beat Disease. Then Boney on Australia Day with Sydney duo Unity Floors (who released another amazing album in 2013) Beat Disease and local poppers Chook Race.

BEACHES

Sprawling psych-rock quintet Beaches will be headlining at Ding Dong Lounge on Saturday 25 January, Australia Day Eve, with support from Unity Floors, Terrible Truths and Pearls. The allgirl Melbourne band Beaches formed in 2007, comprising of members from Panel of Judges, Love of Diagrams and Spider Vomit. Beaches have toured extensively around Australia and the US and have played festivals such as All Tomorrows Parties, Big Day Out, Flip Out, Melbourne International Arts Festival, and the Laneway and Meredith music festivals. The band has done support slots for the likes of Mogwai, Deerhunter and The Black Angels, and toured the US twice performing at SXSW and the Austin Psych Fest.

FRACTURES

In early 2013, multi-instrumentalist, singer and producer Mark Zito was involved in a near fatal fall which left him with a fractured (ironically) vertebrae in his neck and confined to a neck-brace bolted to his skull for three months. After a long a challenging road Melbourne’s Fractures  finally debuted his much anticipated live show to a completely Sold Out and jammed packed Worker’s Club. After the quick sell out of his first Melbourne show he will return to play at The Toff on Saturday January 25. Support comes from Yeo. Tickets via The Toff ’s website.

THE NARROW ROAD

Back this summer to bring you their eagerly awaited sophomore EP Released From The Time, The Narrow Road reaches into all the corners of life, with their familiar blend of warm vocals and ultra-catchy, indiepop hooks. In the end, their EP has the simple aim to make your dancing-legs groove and your soul hum. They play Ding Dong Lounge on Thursday January 30 supported by The Karmens, Vela and My Piranha. Tickets are $5 on the door. Doors 8pm.

SUNBEAM SOUND MACHINE

THE SPOILS

In anticipation of their show with Mick Harvey (ex-Nick Cave & the Bad Seeds) at The HiFi Bar, The Spoils play their first Melbourne headline show for 2014 at The Old Bar on Australia Day as part of the finale for Ron Peno & the Superstitions’ curated Sundays in January. 2013 marked a welcome return to the stage for The Spoils with their first shows locally and interstate for some time. In 2014, the band promise to only play a handful of shows at the start of the year before retreating to the studio to begin writing and recording their fourth album.

HOLY LOTUS

Holy Lotus headline the Grace Darling Basement on Thursday January 23 with a line up of post-punk, experimental delights.   The three piece, synth-postpunkers play one last show before they head to Perth for their single launch tour. The band bring forth minimal drum beats, repetitive layers and experimental tones. Joining them in the basement are Tangrams, Map Ends and O Littleblood. $5 entry, doors at 9pm.

BEAT MAGAZINE PAGE 48

Their sound has been described as “wild blues and slick swingin’ country rock n’ roll… with horns”   and that’s exactly what this Sydney-based, band-of-seven Papa Pilko and The Binrats deliver on their third EP release, Third Time Lucky.  To celebrate, they’ll take their notoriously raucous live show to The Workers Club on Friday January 24 for a stint of launch parties like no other. The opening track and first single Poor Boy conjures up the energy of their stage show, most notably, in the ‘caged-animal’ vocal outro, a result of keeping the band’s frontman, Cyrus Pilko holed up in a windowless studio for three days! Visit their Facebook page for more info.

LED ZEPPELIN 1972 KOOYONG CELEBRATION CONCERT

Melbourne’s newest dream-pop purveyors Sunbeam Sound Machine released their debut double EP One/ Sunbeam Sound Machine worldwide digitally on Friday. After completing a month long residency at The Tote in Melbourne throughout November the five-piece live outfit has well and truly cut their teeth within the Melbourne live music scene. The crew are excited to announce that they will support Castlemaine folkfusion wiz kid D.D Dumbo at The Workers Club on Saturday January 25.

The Corner Hotel is playing host to a unique celebration of Led Zeppelin on Friday January 31 celebrating the great Led Zeppelin with an exclusive show from an all-star one-off local band re-living the 1972 Kooyong show track-for-track. 20 February 1972 and Led Zeppelin from London, just four years into their fabled existence are the global epicentre of hard rock, fusing metal, blues and folk to Hammer of the Gods. And for the first and only time, they play live in Melbourne at the Kooyong Tennis Centre. Need more convincing? Here’s the set list: Immigrant Song, Heartbreaker, Black Dog, Since I’ve Been Loving You, Stairway To Heaven, Going to California, That’s The Way, Tangerine, Bron-Y-Aur Stomp, Dazed and Confused, Rock and Roll, and the finale Whole Lotta Love. You’d be crazy to miss this. Tickets via Corner Box Office from $30.

CARAVAN BURLESQUE

Moira Finucane and her wild artistes fly in from Buenos Aires, Paris and London to unleash seductive spectacle, swinging circus, disco and dirty dancing, as part of The Substation’s Sizzling Summer Program! Globally acclaimed in 12 languages, winner of 8 awards including Scotland on Sunday’s Hottest Temptation of the Festival, this promises to be the wildest night in the West this summer. So get ready for a balloonpopping, show-stopping, jaw dropping, disco fever! For 2 weekends only - 24 & 25 Jan, and 31 Jan & 1 Feb - Finucane & Smith’s legendary, genre-busting, globally-acclaimed seductive and subversive cult-hit Salon storms into Newport, with suitcases bulging  with awards & five star reviews, sequined gowns & sparkling hoops, six inch heels and two-foot nails, light sabres (and not much else), milk bottles, cutaway wetsuits, mirror balls and a single trapeze. Drinks at the bar, cabaret tables & catwalk seats (the hottest seats in town), all grand, intriguing and velvet draped at The Substation.

PAPA PILKO AND THE BINRATS

CITIZEN KAY

Following performances at Falls Festival and The Plot, Citizen Kay ascends on Ding Dong Lounge on Friday January 24 to raise a glass and kick off the Australia Day Long Weekend. After popping the cork with his climactic arrival in early 2013, smashing the airwaves and musical palates around the country with the sonic and lyrical experience of his debut EP YES!, Citizen Kay has spent the last six months spitting rhymes and dropping beats on stages all across the country in his prodigious live show. Joining him on the night is Dylan Joel, Melbourne’s freshest addition in the ever growing sub-culture of Oz Hip Hop. Doors at 8pm, tickets are $12+bf via dingdonglounge.com.au.

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV

UNKNOWN L ANDSCAPES

Venturing out to see what the New Year holds in store, Melbourne’s D.A.Calf (The Book of Ships) and Matt Wicking (The General Assembly) hit the open road this January for a series of co-headline shows. They begin in the concrete wasteland, then traverse The Cumberlands, The Pacifics and The Warregos.  In between lies a landscape of as-of-yet uncharted collaborative territory between the two solo artists, who will join each other on stage for collaboration and accompaniment. They finish their tour across the country at The Grace Darling basement on Friday January 31 with Boatfriends. Tickets are $10 on the door.


MUSIC NEWS

YOUR COMPREHENSIVE LOCAL GUIDE

For all the latest news check out beat.com.au

THE AUSTRALIA DAY WEEKEND FUNDRAISER

BONJAH

After your BBQs and the triple j Hottest 100 are over, head on down to Ding Dong Lounge to keep your Aussie Day celebrations rolling with Bonjah! Like all good things out of New Zealand, we try to claim them as our own and it seems fitting to have them headline for an Australia Day party. Earlier this year they covered Lordes Royals for Like A Version broadening their fan base with over 400k YouTube views. Support comes from Tanya Batt and Sweets. Tix are $20+bf via OzTix or $25 at the door. Extra Bonus: all attendees will receive an exclusive free recording of the full show emailed to them after the event – good one Bonjah!

Hosted for the second time at Melbourne’s mighty Reverence Hotel, the 2014 instalment boasts the event’s most diverse line up yet and will completely take over the much loved Footscray pub for the weekend. Two mega stages will be rammed with the best of Australian live music on Saturday January 25 and Sunday January 26 with all proceeds donated to Oxfam and The Refugee Council Of Australia. With every band making the trek on their own time and money, these shows are a concoction of the most seasoned road warriors and promising new talent. From the exuberant, melodic punk of Luca Brasi on Saturday to the intelligent, dynamic song writing of Lincoln Le Fevre on Sunday, wedge in local garage legends Batpiss, scuzzy punkers Damn Terran, the posi-hardcore tunes of Outright and Anchors, emo-rock from Ceres, alt-country courtesy of Ribbons Patterns, and moving guitar-driven punk rock from prized acts like The Sinking Teeth, Grenadiers, Initials and The Union Pacific. There’ll be Mexican food all night and a raffle of rad prizes donated by kind folks of Poison City Records, Blunt Magazine, Apollo Collective, Deathproof PR, The Reverence Hotel and heaps more. Tickets on sale now. Get your pass, book your flight, pick up a raffle ticket. Come do something good and have a ripper time amongst good humans while you’re doing it.

BANCO DE GAIA

THE PUBLIC OPINION AFRO ORCHESTRA 

This Australia Day, take a trip to the tropics with The Public Opinion Afro Orchestra.  The 17 piece afrobeat powerhouse takes the stage for the first time in 2014 for a huge summertime jam at Melbourne’s newest venue Howler.  The band will be your guide taking you at breakneck speed through the backstreets of West African funk, detouring via the hip-hop and beat driven sounds from the blocks of Brunswick. The Orchestra have just been added to the 2014 Byron Bay Blues and Roots line-up. Seun Kuti was announced last year also, meaning that this year’s 25th anniversary festival is one of the only festivals in Australia to host two huge afro-beat ensembles on the same bill! Bringing the heavy funk vibes will be instrumental soul behemoth The Cactus Channel. These guys are firing on all cylinders on the back of causing serious waves with their sophomore release Wooden Boy and completing their first solo national tour. With sweet neo-soul and lush vocal harmonies The Do Yo Thangs are a band to keep you eyes on.  Featuring members of Saskwatch and Sex On Toast, they will be making a lot of noise in 2014.The Public Opinion’s own  DJ Manchild  will also be inviting his favourite funk, afro and tropical DJs to join him in the beer garden all day alongside live percussion and MCs. This will be one serious percussion-driven, dancefloor-burning party you do not want to miss! Tickets are $16 + bf via Ticketscout or $20 on the door.

Banco De Gaia will perform only one solo show in Melbourne on Thursday January 23 at the Northcote Social Club, aside from his appearance at the Rainbow Serpent Festival. Support comes from Deep Fried Dub, Sunsaria and DJ Dom Hogan. Playing in support of his new album Apollo, which has received the kind of lavish critical praise fans of his work have come to expect. In a world dominated by generic, and formulaic dance music Banco De Gaia is a breath of fresh air. A genuine icon of electronic music he has been fusing world sounds with electronica for two decades. Tickets on sale via northcotesocialclub.com.

60 SECONDS with

MIGHTY BOYS SNAKADAKTAL

Snakadaktal are kicking off 2014 in style, with an EP release and headline shows in Melbourne and Sydney. The recently released The Sun II EP features six tracks including a radio mix of the current single of the same name, new track East of Here and remixes of album singles from an array of talented producers and artists including Sydney favourite Hayden James and UK outfit Just Kiddin. Snakadaktal will launch The Sun II EP at Howler on Saturday January 25. Appearing alongside Snakadaktal will be beat maker Kilter and local artists Rat & Co and CHIEFS. Sleep In The Water will be released in Austria, Germany, Switzerland, The Netherlands, Japan and South Korea in January. The Sun II EP is out now.

FEBRUARY LEMURIA

Hailing from Buffalo, NY, indie-pop trio Lemuria will be hitting our shores this coming January / February for their first Australian tour, It wouldn’t be wrong to believe that melodic, sugary, indie-pop anthems would be out of place at a punk rock show. In fact, they would obviously stand out like a sore thumb. However, having seamlessly managed to blur the lines between the soft and melodic and the fast and tough by mixing all the right ingredients, catchy hooks, sweetheart vocals, odd time signatures and discordant notes; are all cleverly beated together leaving the listener asking politely for more. Along for the ride will be Melbourne’s own Kissing Booth.  They hit the Reverence Hotel on Saturday February 8. Tickets on sale now through Oztix.

I, A MAN

FLYYING COLOURS

Flyying Colours and The Evelyn Hotel are hosting a huge Australia Day party on Sunday January 26 featuring Melbourne’s best and brightest psyche and shoe-gaze bands. Flyying Colours had a huge 2013, releasing their first single Wavygravy, their first selftitled EP through Universal Music, playing their first east coast tour and recovering from their heavily debauched recording sessions. See Flyying Colours, Atolls and ESC deliver all the fuzz, reverb and goodtimes that one needs to celebrate this great country of ours. Doors 8pm. Entry $10 with tickets on the door or at www.oztix.com.au.

I, a Man spent most of 2013 locked away in The Alamo Studio working with long-time production team Tim O’Halloran and David Williamson crafting their debut LP.  Gravity Wins Again, was mixed by Tim Whitten (The Go Betweens, Augie March, Art of Fighting), and mastered in the US by Roger Siebel at SAE mastering and is due for release in March 2014. The Melbourne four-piece will be back on the live scene in early 2014, showcasing cuts from their debut record. They play the Luscombe Street Community Gardens on Saturday February 8. Doors from 5pm and tickets $8 +bf via OzTix.

ALBARE

ABC Music jazz recording artist, Albare has just announced his first two concerts for 2014, performing for the first time in Hobart at MONA, as part of the Jazz at MONA series of free afternoon concerts ( JAM) on Sunday February 2, and in his home town at the Melbourne Recital Centre on Sunday February 9. Tickets to the Melbourne Recital Centre concert are $55 each, available now through  www.melbournerecital.com.au and Ticketmaster.

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

Define your genre in five words or less: Garage / punk / ridiculous cunts. If you could travel back in time and show one of your musical heroes your stuff, who would it be and why? Daryl Braithwaite – He’s selling out midsized RSLs up and down the east coast as good as any pop star, past or present. What inspires or has influenced your music the most? We just look at all the problems in our neighbourhood and also the rest of the world and we get quite upset and sad and we write beautiful songs about it for everyone. What do you think a band has to do these days to succeed? Eat dairy. Do you have any record releases to date? What are they? We have no releases. Our first record will come out this year. It’s called Dole Cheque and Cabana. You can’t buy it now, but you might be able to one day. Describe the best gig you have ever played. Jack’s mum’s 53rd birthday. Jack is of the Italian persuasion and his family put together a fantastic spread with lots of dips and cured meats. What’s your favourite song, and why? Boys of Summer by Don Henley – it’s a good song. How do you stop your pre-gig jitters? Bulk tins. When are you playing live? We’re playing our first show of the year at Prince Bandroom on Friday January 17 with Jimmy Junk Heart for his EP launch. We’ve been pretty restless for the past few months and are looking forward to playing again.

BEAT MAGAZINE PAGE 49


ALBUM OF THE WEEK BEYONCĂ&#x2030;

BeyoncĂŠ (Columbia) %$5Â&#x2021;%$1'5220Â&#x2021;%277/(6+23

:('1(6'$<-$18$5< 5(6,'(1&<

:22/<%(()

,03266,%/(12*22'6 *$/$;<)2/. ),*85(+($' 7+856'$<-$18$5<

0&%$,1

*256+$ $&+((.<*5,1 )5,'$<-$18$5<

63(&,$/*8(676 6$785'$<-$18$5< (3/$81&+

0$1*(/:85=(/

3(7(%,%%< 7+(%277/(62) &21),'(1&( 7+(6+$%%$% %8))$/275$&(< 681'$<-$18$5<

This is the body of work by which Queen Bey should be remembered. Everything BeyoncĂŠ Knowles, Sasha Fierce, Mrs. Carter, whatever you want to call her, has represented and spoken about in the past â&#x20AC;&#x201C; female empowerment, self-empowerment, sexiness, class, groove â&#x20AC;&#x201C; all coalesce righteously on BeyoncĂŠ. Without the visual accompaniments, I think the minimalist grandeur, brazenly honest lyricism and hush-hush leak-proof global release has to be commended. But couple that with the fact that every minute of this album has been synchronised with its own filmic depiction, and we have a behemoth of modern commercial music, full stop. We now live in a post-BeyoncĂŠ world. If you think Iâ&#x20AC;&#x2122;m being overzealous, you havenâ&#x20AC;&#x2122;t listened to this album. And if you have: you havenâ&#x20AC;&#x2122;t WATCHED this album. From the opening track Pretty Hurts, with its sampling of BeyoncĂŠ herself (playing a mock beauty pageant contestant, Miss 3rd Ward) stating her aspiration in life is simply â&#x20AC;&#x2DC;to be happyâ&#x20AC;&#x2122;, weâ&#x20AC;&#x2122;re given the warning that we might be along for the ride, but this is a body of work made for one person. Locals will be happy to see her much-publicised shoot in Brunswick serve as a background for the No Angel video. Speaking of cameos, look out for a stellar appearence from both husband Jay-Z in the epic Drunk In Love (spitting gems like â&#x20AC;&#x2DC;We sex again in the morning / Your breasts is my breakfastâ&#x20AC;&#x2122;) and young daughter Ivy Blue in the aptly-titled Blue, closing out the album proper with a cute-as pie refrain. The distance between BeyoncĂŠâ&#x20AC;&#x2122;s last release, 4, and this eponymous beacon is brain-melting. Where the production on 4, even at its most horn-laden and ballbustingly raucous, sounded shiny, synthetic and thin, BeyoncĂŠ is robust and ferocious. Whatâ&#x20AC;&#x2122;s more, all this power is pulled off with a seriously raw production. The bass hits the spot, synths

/,77/(+286(*2'= 75,803+29(5/2*,& 7(;$6-(', (9(1,1*6+2:

&(/,$&

/25'5$5 .2.$7681$21$1, &,&$'( +256(

021'$<-$18$5< 5(6,'(1&<

.$5$7(%22*$/22 7+('2<27+$1*6 8383$:$< 78(6'$<-$18$5< 5(6,'(1&<

6381.0$&+,1( &522.6 48((16 78/$/$+

&20,1*83

7L[DYDLODEOHWKUX0RVKWL[ ,PPLJUDQW8QLRQ -DQ

6H[2Q7RDVW²5RRIWRS6KRZ -DQ

$WROOV(VF7HHQDJH0RWKHUV -DQ

.RR\HK=LRQ7UDLQ²8. -DQ

(FKR'UDPD²(3/DXQFK -DQ

$/RQHO\&URZG²$OEXP/DXQFK )HE

/XQJ²(3/DXQFK )HE

7KH*URYHV²(3/DXQFK )HE

%DQH2I:LQWHUVWRUP²$OEXP/DXQFK )HE

,QFKHV2I%ORRG²&$1 $SU

6TXDUH6RXQGV)HVWLYDO 0DU

)LQQWUROO²),1 -XQH

%5816:,&.675((7 ),7=52<Â&#x2021;0(/%2851(Â&#x2021;  ZZZHYHO\QKRWHOFRPDX

BEAT MAGAZINE PAGE 50

RECORD PARADISE TOP 10 1. A Sea Of Split Peas COURTNEY BARNETT 2. Donâ&#x20AC;&#x2122;t Tell The Driver MICK TURNER 3. Anywhere And Everything Is Bright RON S PENO AND THE SUPERSTITIONS 4. Lust For Life IGGY POP 5. Treace CAVE 6. Wakin On A Pretty Daze KURT VILE 7. Wise Up Ghost And Other Songs ELVIS COSTELLO AND THE ROOTS 8. Vanishing Point MUDHONEY

and samples freckle the tracks, but the star of the show is that voice. With Knowles having overseen and assisted production on every track, every video, every word, thereâ&#x20AC;&#x2122;s absolutely no question whoâ&#x20AC;&#x2122;s pulling the strings. If you thought she was a powerful force before, prepare to shut up, bow down and be humbled yet again. MATT PANAG

9. Head In The Dirt HANNI EL KHATIB 10. The Stickmen THE STICKMEN

HEARTLAND TOP 10 1. In Utero  DELUXE CD/DVD BOX NIRVANA 2. Eponymous To Anonymous BOX SET TOMAHAWK 3. Self Titled ORIGINAL PIC DISC LP MR BUNGLE

BEST TRACK: Pretty Hurts IF YOU LIKE THESE, YOUâ&#x20AC;&#x2122;LL LIKE THIS: PHARRELL, JT, TIMBALAND, THE BIG PINK IN A WORD: Triumphant

4. Freedom Run BOOK VISTA CHINO/KYUSS 5. Neverland 2LP SET MANGOO 6. From Beer To Eternity COFFIN BOX SET MINISTRY

0$7,1((²<($5$11,9(56$5<

755(66

TOP TENS:

7. Academy Of Music CD/DVD BOX SET THE BAND

SINGLES

BY LACHLAN

8. Live At The Cellar Door 2LP NEIL YOUNG 9. Electric AUTOGRAPHED LP THE CULT 10. Self Titled LP BACKGROUND NOISE

For all the latest singles check out beat.com.au This piece of shit Melbourne weather blew the kiddie pool off my roof last week leaving me high and dry for the #heatwave this week. Eff em ell.

NICKI MINAJ & PTAF

Boss Ass Bitch (Remix) (Self-Released) After laying relatively low in terms of studio output in 2013, Nicki Minaj jumped in on PTAFâ&#x20AC;&#x2122;s viral anthem Boss Ass Bitch to spit a freestyle just before New Yearâ&#x20AC;&#x2122;s Eve. Not to say the Eurodance-inflected pop bangers from Roman Reloaded arenâ&#x20AC;&#x2122;t great, but Boss Ass Bitch is a welcome reminder that Nicki is jaw-dropping when it comes to going in hard on a hard beat. Pretty sure no-one else could get away with spitting a dorky line like â&#x20AC;&#x153;But I never iPhone / Android these n***asâ&#x20AC;? into â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a holiday / play wit my pussy dayâ&#x20AC;?. Fingers crossed 2014 will bring a new Nicki Minaj full-length.

ST. VINCENT

Digital Witness (Loma Vista) The second tease from the upcoming self-titled St. Vincent album leans heavily towards the horn-adorned Love This Giant David Byrne collaboration, the brass blasting what sounds like an approximation of Death From Above 1979â&#x20AC;&#x2122;s Black History Month riff. Annieâ&#x20AC;&#x2122;s gnarly guitar mastery is relegated into the background, which is a bit of a shame, but thereâ&#x20AC;&#x2122;s still plenty to hold onto â&#x20AC;&#x201C; especially the sardonic progression from â&#x20AC;&#x153;People turn the TV on it looks just like a windowâ&#x20AC;? into â&#x20AC;&#x153;People turn the TV on and throw it out the windowâ&#x20AC;?. Even when playing it relatively straight, Annie is still a goddamn superhero.

BANOFFEE

Reign Down (Two Bright Lakes) Vocalist-producer Banoffee treads a tightrope between an uncanny polarity of distance and intimacy, simultaneously coming across as sentimental as Drizzy while robotic as a Laurie Anderson vocal experimentation. The pitcheddown vocals thing is almoooost played out, all the elements here arenâ&#x20AC;&#x2122;t so much ahead of the curve but rather bang on the crest, most evident in the trap-happy final verse. Those of-the-now factors are more of a garnish than a crutch, with a richness of character riding high throughout. Definitely an act to watch in 2014.

SUPPRESSION

ANGEL OLSEN

Hi-Five ( Jagjagwuar) With a big tip of the ten-gallon hat to the late great Hank Williams, Angel Olsen pulls together classic country acumen with some blown-out Neutral Milk Hotel acoustic fuzz with a delightfully uninhibited helping of oscillating tones. Taken from the upcoming LP Burn Your Fire For No Witness, out mid-Feb.

WARPAINT

Biggy (Rough Trade/Remote Control) A rigid vintage synth melody sublimates into a deep bassline at the mid-point of Biggy, a dynamic that should be jarring, instead melding together with impeccable ambient guidance. Warpaintâ&#x20AC;&#x2122;s rhythm section is their ace in the hole, and they manage to ease it into the spotlight and back again on a sedative whim. An intoxicating meditation on melody.

ROMI

How 2 Make U Cum (Independent) Romi lays down the titular single-entendre quandary of â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve forgotten how to make you cumâ&#x20AC;? over cute little synth lines, dropping in a dialogue sample of Samanthaisms from Sex And The City midway through. Equal parts endearing and raw. The finale is a blink and youâ&#x20AC;&#x2122;ll miss it hi-fidelity â&#x20AC;&#x153;comeâ&#x20AC;? that Iâ&#x20AC;&#x2122;m pretty sure is a millisecond snippet from Frankie Goes To Hollywood.

RECORD COLLECTORS CORNER MISSING LINK 1. Teenage Suicide TAPE IDLE MINDS 2. Demo CD PREGNANCY 3. A Sea Of Split Peas 2LP COURTNEY BARNETT 4. Nuclear Reich LP KROMOSOM 5. King For A Da y 2LP FAITH NO MORE 6. Threace LP/CD CAVE 7. Whales And Leeches LP/CD RED FANG 8. Smashed On A Knee LP POWDER MONKEYS 9. Resolution LP HAILGUN 10. History Of Hygiene LP/CD THE STEVENS

BEATâ&#x20AC;&#x2122;S TOP TEN SONGS ABOUT THE COSMOS 1. Across the Universe THE BEATLES 2. Intergalactic BEASTIE BOYS

SINGLE OF THE WEEK

ELIZABETH ROSE

Sensibility (Inertia Access) Flicking a swizzle stick amongst industrial-tinged post-dubstep and a reggae groove, Sydneyâ&#x20AC;&#x2122;s Elizabeth Rose invokes the spirit of late-â&#x20AC;&#x2122;90s R&B with a dreamy vocal take thatâ&#x20AC;&#x2122;s all Aaliyah in the verses and a little bit Amber Coffman in the hook. Deft electronica production with a finely honed pop sensibility (wow, thatâ&#x20AC;&#x2122;s the name of the song!).

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV

3. Rocket Man ELTON JOHN 4. Interstellar Overdrive PINK FLOYD 5. Space Oddity DAVID BOWIE 6. Spaceman BABYLON ZOO 7. Space is The Place SUN RA 8. Supersonic Rocket Ship THE KINKS 9. Subterranean Homesick Alien RADIOHEAD 10. Cosmic Girl JAMIROQUAI


ALBUMS

NEW MUSIC IN REVIEW THIS WEEK

For more reviews go to beat.com.au/reviews

THE BEEGLES

SKINDRED

Daytime (Independent)

Kill The Power (Cooking Vinyl)

Locals The Beegles have taken what was honestly a choppy eponymous debut EP, and extrapolated by an infinite magnitude with the follow-up release of Daytime. The band has expanded to a seven-or-so piece, incorporating synths, horns and wigged-out production, and the repertoire extends from bombastic all-out jaunts in intricate times to temperate finger-picked freak-folk musings. In half an hour The Beegles manage to tread more ground than most; the experimentalism still feels like it is yet to jell into a truly representative score, but you have to laud the bravery. Opener My Head Exploded opens with an all-out horn driven riff into something like 9/4 before meandering into a groovy little lull pondering the benefits of... well, getting loaded. By the time the title track emerges later on, you’ve acclimatised to the all-encompassing sound and solid song craft. With production values which give even the most BEST TRACK: Daytime exacerbated tracks an insular, intimate, old-worldly IF YOU LIKE THESE, YOU’LL LIKE THIS: BRIAN feel, this one is best heard through headphones. Stay JONESTOWN MASSACRE, MGMT, THE tuned for an inevitable adventurous future. BEATLES IN A WORD: Dense

MATT PANAG

Skindred take an extra large pot and stir metal and reggae together. Purists from either camp would usually cross arms, close their eyes and refuse to talk to one another. The same purists would briefly plug their ears with fingers whilst being told that metal gods Judas Priest wrote the first ever reggae-metal song, The Rage, back in 1980. History is on the side of Wales’ own “raggametallers,” like it or not. What’s served up is low-slung metal swaggering straight from stony Welsh streets. Fist-shaking Kill the Power picks up Rage Against The Machine’s agitprop n’ punk gauntlet, punching toward metal’s gleam and crunch. Ninja gets raucous with rap and sweet with soaring choruses, a late-90s nu-metal kicker swept of cobwebs and lovingly refurbished for the modern era. Autobiographical The Kids are Right Now marches along to one beat and one riff before the floaty and smoky We Live preaches peace, love and taking green. It grows and grows with an unforgettable chorus the size of a small world, a BEST TRACK: We Live world where everyone’s holding hands and grinning IF YOU LIKE THESE, YOU’LL LIKE THIS: SOULFLY, like a rabble of red-eyed Rastas. We hope. P.O.D, ILL NINO IN A WORD: Babbled-on TOM VALCANIS

MOGWAI

T54

Rave Tapes (Spunk)

In Brush Park (Flying Nun/Remote Control)

The haunting, bell-like keys that open the eighth Mogwai album suggest a continuation of their superlative soundtrack work on creepy French TV series, The Returned. As opener Heard About You Last Night develops in their textbook quiet-to-loud manner, all the familiar Mogwai elements slot into place to assure you that this will be a classic run of Mogwai in the vein of Rock Action and The Hawk Is Howling. After 2001’s Hardcore Will Never Die, But You Will, the Scottish quintet pull out another cheeky album title, one which suggests that this could be an assortment of experimental dance numbers uncovered from the archives. Although the band further their dabbling in electronica, it’s all very well contained within their sturdy postrock fortress; it’s an album that’s tighter in length and structure, but looser in sound and sonics. Vocals remain an almost superfluous addition to the ensemble, at times even a little distracting. A ramble about subliminal messages in Repelish feels like it was slotted in to boost a middling composition, while the hushed vocal on Blues Hour only serves to strip away the song’s mystique. The well-worn vocoder is used to great effect on the excellent closing track, The Lord Is Out Of Control. It’s a striking end to a mixed bag, but there’s enough classic material here to make this another must-have BEST TRACK: Remurdered Mogwai album. IF YOU LIKE THESE, YOU’LL LIKE THIS: Rock Action MOGWAI, Red Line TRANS AM, Halloween CHRIS GIRDLER (Soundtrack) JOHN CARPENTER IN A WORD: Brooding

In geographical terms, there aren’t too many places further apart than Christchurch and New York; neither would you naturally align the confident, brazen social demeanour of the average New Yorker with the almost institutionally affable Christchurch resident. Musically, however, it’s a different matter. T54 hail from Christchurch, yet in the band’s music you can hear the art-punk rock of the lofts of 80s and 90s New York. The opening track, Nails Painted, is dark, brooding and mesmerising and Life Is Swell is pop with attitude. Kill Red cuts a swathe through a host of forgotten antecedents and cheap impostors; if you can’t see the spirit of Teenage Riot shining here, you’re not trying. But that’s not to say T54 is in any way predictable: O Nina is to In Brush Park what Ann was to The Stooges – which is to say surprising, and necessary because of that. Return of the Worm is thick with guitar sludge and freakish melodies and SW Chops is replete with indulgent noise. AC Parade finds comfort in the indie guitar rock of Pavement et al, Return to Action Movies is slacker rock on a diet of pizza and Jolt Cola and Jennifer Hands is tender and melodic, until it breaks with a violent wall of noise. Finally, there’s the seven-minute opus of Biscuit City Sisters: a collage of noise, rhythms and melody, a squall of sonic intensity and an extended moment of psychedelic BEST TRACK: Biscuit City Sisters force. In the end, it simply stops, and silence fills the IF YOU LIKE THESE, YOU’LL LIKE THIS: 80s art-punk void. This is some very good shit. like SONIC YOUTH and GLENN BRANCA IN A WORD: Art-punk

STEPHEN MALKMUS AND THE JICKS

JAMES VINCENT MCMORROW

Wig Out At Jagbags (Spunk)

Post Tropical (Dew Process)

The second album from James Vincent McMorrow sees the Irish music-maker dramatically broaden his musical horizons. The folk pop of his 2010 debut Early In The Morning has magically converted into something that more accurately represents McMorrow’s own musical tastes, involving fewer guitars, RnB inklings and many, many more layers. McMorrow is clearly a fan of the full-bodied chorus. The Lakes builds up a massive swell towards the end of the song and fades out with tropical twangs evocative of the oddly paradoxical album art (because every tropical setting should include a polar bear lurching from an iceberg in the background, obviously). You could find anything in Post Tropical if you listen closely enough; tapping raindrops intercepting with foot thudding in All Points, broad, thunderous brass and glittering syncopation in Gold, and atmospheric RnB in almost every song, but especially in the single and album highlight Cavalier. Hand-clapping and gospel-like coos feature in the more vocally-driven Glacier, to wondrous effect. Something must be said about McMorrow’s vocals – a constant falsetto reminiscent of Justin Vernon – that reaches seemingly unnatural heights in pitch, yet does so without sounding lofty. McMorrow has put his everything into this album and it shows, no more so than in his emotion-drenched vocals and lyrics. Red Dust closes with McMorrow repeating: ‘Sometimes my hands, they don’t feel like my own/I need someone to love, I need someone to hold’ and his heartfelt cries at the end of Outside, Digging tug at something deep. James Vincent McMorrow wanted to make the most BEST TRACK: Outside, Digging beautiful thing he could imagine with Post Tropical – suffice IF YOU LIKE THESE, YOU’LL LIKE THIS: JAMES it to say, what he thinks is beautiful is hard to argue with. BLAKE IN A WORD: Heartfelt KATIE DAVERN

After the energised pop of 2011’s Mirror Traffic, Wig Out At Jagbags sees Malkmus and his Jicks take another left turn. As with every new Malkmus album, casual listeners will think it sounds like every other one of his albums, while Malkmus’ devotees will think it’s nothing like what’s come before. There’s no precursor in Malky’s oeuvre for this album. All his trademarks are here (rambling, brilliant guitar solos matched with rambling, brilliant lyrics), but they’re assembled in a very relaxed way, even for him. He sounds adult and content on this album, making it hard to compare to his other albums. Pig Lib with more focus? Real Emotional Trash’s flashy guitar without the wank? His self-titled album’s professionalism with better songs? All are partially true, leaving it easier just to describe it as a batch of quintessential Malkmus. And what a batch it is. Lariat and its refrain “we grew up listening to the music from / the best decade ever” will make it nostalgic for anyone who listens, regardless of age. Chartjunk and J Smoov utilise Malkmus’ most extensive use of horns yet, and are both highlights. The former is a Mccartney-esque raveup, while the latter is a slice of soul food. And Surreal Teenagers, with its build and release structure is his best solo album closer yet (depending on how much you like Pig Libs’ Us). With no disrespect to The Jicks, Wig Out sounds like what a Stephen Malkmus solo album should. BEST TRACK: Chartjunk IF YOU LIKE THESE, YOU’LL LIKE THIS: PAVEMENT, HARRY NILSSON IN A WORD: Xanadu-shuffle

THIS WEEK

WEEK AFTER

ARTHUR PEN & THE FUNKY TEN

MITCH POWER & THE SOUL ASSASSINS

THURS 16TH

W MAEFLOWER + SOUL SAFARI FRI 17TH

CHERRYWOOD

KITCHEN HOURS

PATRICK EMERY

WED 22ND

W DRU CHEN + THE TARANTINO EXPERIENCE FRI 24TH

PEAK TWINS LP LAUNCH

W SAINT JUDE, SUICIDE SWANS + SARA RETLLICK (JIMMY TAIT)

W LAKES + SCHOOL OF RADIANT LIVING

SUN 19TH

TWIN BEASTS (FORMALLY THE TOOT TOOT TOOTS)

THE LET YOUR HAIR DOWN GIRLS FREE IN THE FRONT BAR 4:30PM

***AUSTRALIA DAY***

W PONY FACE + OHMS TIX FROM WWW.JOHNCURTINHOTEL.COM

LEONARDO SILVESTRINI

COMING SOON

31/1 WARMTH CRASHES IN 2/2 GUDRUN GUT (MALARIA!/BERLIN) W WHITE HEX + KATE FOX (REQUIEM) 8/2 ‘HOW YA GARN? YEAH NOT BAD!’ MUSIC FEST, FEAT…SHERIFF, THE PEEP TEMPEL, SUN GOD REPLICA, JAPANESE BLUES COWBOYS, LEGENDS OF MOTORSPORT PLUS HEAP HEAPS MORE ALL TIX FROM WWW.JOHNCURTINHOTEL.COM

FRONT BAR FREE EVERY MONDAY

DO YOU KNOW WHAT I MEAN? POP CULTURE TRIVIA

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 51


GIG GUIDE

WHAT'S ON AROUND MELBOURNE THIS WEEK

For all the latest gigs check out beat.com.au

WEDNESDAY JAN 15 JAZZ/SOUL/FUNK/LATIN/ WORLD MUSIC BOHJASS + DAMIEN ELLIS BAND + KEWTI 303, Northcote. 9:00pm. BOPSTRETCH Uptown Jazz Cafe, Fitzroy. 9:00pm. HAMMOND JAZZ CLUB + MR ANDREW SWANN Claypots, St Kilda. 10:00pm. JOE O’CONNOR PROJECT Bennetts Lane Jazz Club, Melbourne Cbd. 9:30pm. LYN GILLETT & THE ADAM RUDEGEAIR TRIO + ADAM RUDEGEAIR Paris Cat Jazz Club, Melbourne Cbd. 10:00pm. $20. NINA & HERMES Open Studio, Northcote. 9:30pm. VIVE LA DIFFERENCE Claypots Evening Star, South Melbourne. 8:30pm.

INDIE/ROCK/POP/METAL/ PUNK/COVERS BOYS OF SUMMER TOUR - FEAT: BLESS THE FALL + PREPARED LIKE A BRIDE + THE COLOR MORALE Arrow On Swanston, Carlton. 8:00pm. CHILD + TTTDC Cherry Bar, Melbourne Cbd. 7:00pm. COLLAGE - FEAT: MATT KATSIS & THE INDIA BLACK + JEHAN + MISSION BROWN + PABLO NARANJO Espy, St Kilda. 8:30pm. PRIMATE Whole Lotta Love, Brunswick East. 8:00pm. $25. REMZELK + JANANA BEAT + SKIPPYS BRAIN Bar Open, Fitzroy. 9:30pm. SHUT UP JACKSON + FULL CODE + ZIAH ZIAM Bendigo Hotel, Collingwood. 9:00pm. $8. SNAKADAKTAL Melbourne Park, Melbourne. 6:00pm. SUICIDE SWANS + EATEN BY DOGS Old Bar, Fitzroy. 9:30pm. $7. THE IN THE OUT + TENDER BONES + THE NEW POLLUTION Boney, Melbourne Cbd. 8:00pm. THE JULIE RUIN Corner Hotel, Richmond. 8:30pm. $44. VOWEL MOVEMENT + HIDEOUS TOWNS + THE DEAD HEIR + ZONE OUT Tote Hotel, Collingwood. 9:00pm.

ACOUSTIC/COUNTRY/BLUES/FOLK BOOKER T & THE M.G’S + RITA SATCH Ding Dong Lounge, Melbourne Cbd. 9:00pm. KIM SALMON Standard Hotel, Fitzroy. 9:30pm. OPEN MIC Ontop Bar, Ormond. 8:30pm. SARA RETALLICK + PALM SPRINGS Spotted Mallard, Brunswick. 8:00pm. SIMPLY ACOUSTIC Wesley Anne, Northcote. 9:00pm. THE ACOUSTIC SESSIONS - FEAT: ROD FRITZ + ROCHELLE BRUCE Revolver Upstairs, Prahran. 8:00pm. VAN WALKER + SMALL TOWN ROMANCE Retreat Hotel, Brunswick. 8:30pm. WINE WHISKEY WOMEN - FEAT: LISA CARUSO + SUZANNE KINSELLA Drunken Poet, West Melbourne. 9:00pm.

THURSDAY JAN 16 INDIE/ROCK/POP/METAL/ PUNK/COVERS SIMON MARKS Bridge Hotel, Castlemaine. 8:30pm. $10. ARTHUR PEN & THE FUNKY TEN John Curtin Hotel, Carlton. 9:00pm. BEN LAGUDA & NAT ALLISON Whole Lotta Love, Brunswick East. 8:00pm. BLOOD RED BIRD Post Office Hotel, Coburg. 9:30pm. BOYS OF SUMMER TOUR 2014 - FEAT: BLESSTHEFALL + PREPARED LIKE A BRIDE + THE COLOR MORALE + TRAINWRECK Corner Hotel, Richmond. 8:30pm. $42.

CAT CANTERI + ISAAC DE HEER Retreat Hotel, Brunswick. 9:30pm. ICM LABEL NIGHT - FEAT: ANGUS TARNAWSKY + A DEAD FOREST INDEX + ALEXANDER GARSDEN + WORNG Old Bar, Fitzroy. 9:00pm. $8. JAGWAR MA (LET HER GO TOUR) + JONTI The Hi-fi, Melbourne Cbd. 9:00pm. $36. LOW SPEED BUS CHASE + BILLY JEAN SIMMONS + THE UGLY KINGS Reverence Hotel, Footscray. 9:00pm. MAHALIA BARNES Melbourne Park, Melbourne. 6:00pm. NEXT - FEAT: BELLUSIRA + COPIA + IRE + JACK THE STRIPPER Colonial Hotel, Melbourne Cbd. 10:00pm. PASSERINE + BIG CREATURE + DEAR PLASTIC + DR. DOCTOR Espy, St Kilda. 9:30pm. PLUGGED IN THURSDAYS - FEAT: DIGITAL ORDER + FOREIGN/NATION + HALYCON DRIVE Revolver Upstairs, Prahran. 9:30pm. RABBLE ROUSER + NATIVE + RIDERS OF SIN + SUNBEAM SOUND MACHINE Bar Open, Fitzroy. 9:00pm. SKYSCRAPER STAN & THE COMMISSION FLATS Yarra Hotel, Abbotsford. 9:00pm. SWAMP MOTH + REAL SANG + SIREN BLACK Public Bar, North Melbourne. 8:30pm. $6. TERRIBLE LIZARD + EMPRESS CHILD + GUESTS + THE CREEPING BAM Brunswick Hotel, Brunswick. 9:00pm. THE HOODANGERS Fitzroy Pinnacle, Fitzroy North. 8:00pm. THE OCEAN PARTY + ELECTRIC SEA SPIDER + SCOTDRAKULA Boney, Melbourne Cbd. 7:00pm. THE STRANGE + BIG SMOKE + DARTS Yah Yah’s, Fitzroy. 8:00pm. WATCHTOWER + HIGH DRIFTER + THE SWEATERS + TURQMINU Bendigo Hotel, Collingwood. 9:00pm.

JAZZ/SOUL/FUNK/LATIN/ WORLD MUSIC AARON CHOULAI TRIO Uptown Jazz Cafe, Fitzroy. 9:00pm. ALWAN Claypots, St Kilda. 10:00pm. CRAIG SMITH QUINTET Dizzy’s Jazz Club, Richmond. 9:00pm. JACK PANTAZIS GROUP Paris Cat Jazz Club, Melbourne Cbd. 10:00pm. $15. MOTHER JACK + TYTO TYTO Open Studio, Northcote. 9:00pm. ORQUESTA TIPICA FERNANDEZ FIERRO Forum Theatre, Melbourne Cbd. 9:00pm. RAPT Farouk’s Olive, Thornbury. 6:00pm. SMITH STREET SOUL BAND Cherry Bar, Melbourne Cbd. 9:00pm. $10. THE JOE CHINDAMO TRIO Bennetts Lane Jazz Club, Melbourne Cbd. 9:30pm. THE OVEREASYS Claypots Evening Star, South Melbourne. 7:30pm.

ACOUSTIC/COUNTRY/BLUES/FOLK GOING SWIMMING + BRAT FARRAR + WHIPPED CREAM CHARGERS Tote Hotel, Collingwood. 9:30pm. HELLHOUND BROWN Labour In Vain, Fitzroy. 9:30pm. INTERNATIONAL MUSICIAN’S CHALLENGE - FEAT: SPARROW DALEY + ANNA SCIONTI + EVIL TEIN + GALLIE + JARROD SHAW + LIV CARTLEDGE + SARAH WILKINSON 303, Northcote. 9:00pm. $10. LA MAUVAISE REPUTATION + SULTAN Northcote Social Club, Northcote. 9:00pm. $20. LARISSA TANDY + AL PARKINSON + TRACY MCNEIL Some Velvet Morning, Clifton Hill. 8:00pm. LES THOMAS + AL CARR Drunken Poet, West Melbourne. 9:00pm. NOVA HEART + ALTITUDE + SONS ET AL Ding Dong Lounge, Melbourne Cbd. 9:00pm. OPEN MIC Balaclava Hotel, St Kilda East. 8:00pm. SOPHIE OFFICER Bar 291, Brunswick. 8:00pm. SUMMER JAMBOREE - FEAT: WES SNELLING + SUSY BLUE Northcote Town Hall, Northcote. 5:30pm. SUZANNE KINSELLA + GUS RIGBY & KANVAS GREY

GIG OF THE WEEK!

THE HIVES Rumoured to be the best live band in the world, Swedish rockers The Vines will be playing a sideshow this week in support of their upcoming Big Day Out performance. They will be hitting up 170 Russell (formerly Billboard The Venue) this coming Tuesday January 21. Tickets available via Oztix.

Wesley Anne, Northcote. 9:00pm. $10. THE TRAINWRECK SUMMERS BALL - FEAT: TRAINWRECK TRIO + THE SIMONTOLOGISTS Spotted Mallard, Brunswick. 8:00pm. WOODWARD & ROUGH Wesley Anne, Northcote. 7:00pm.

FRIDAY JAN 17 JAZZ/SOUL/FUNK/LATIN/ WORLD MUSIC BIRCHALL & WOOLHOUSE Ruby’s Music Room, Melbourne Cbd. 8:30pm. $15. DEAN’S MARTINI & SHAKERS Claypots Evening Star, South Melbourne. 8:30pm. JC & THE PO BOYS Caravan Music Club, Oakleigh. 9:00pm. $35. KUNJANI Dizzy’s Jazz Club, Richmond. 9:00pm. MARGIE LOU’S PIANO HOUR + ALYCE PLATT Claypots, St Kilda. 10:00pm. MASINA MILLER & DAVID DOWER Paris Cat Jazz Club, Melbourne Cbd. 8:30pm. $20. RALEIGH WILLIAMS Paris Cat Jazz Club, Melbourne Cbd. 10:30pm. $20. STEVE MAGNUSSON TRIO Uptown Jazz Cafe, Fitzroy. 9:00pm. THE BOYS Wesley Anne, Northcote. 7:00pm. THE RITA SATCH BAND Bennetts Lane Jazz Club, Melbourne Cbd. 9:30pm. $25.

INDIE/ROCK/POP/METAL/ PUNK/COVERS BROOKLYN’S FINEST Bridge Hotel, Castlemaine. 8:30pm. $8. CHARLIE LANE & REE NAY + TIM ISCHIA & JULY DAYS Wesley Anne, Northcote. 9:02pm. $10. CHERRYWOOD + SAINT JUDE + SARA RETLLICK + SUICIDE SWANS John Curtin Hotel, Carlton. 9:00pm. CINEMA 6 + THE GENERAL + THRASHER JYNX + VADGEDAGGAR Espy, St Kilda. 10:00pm. CTRIX + BOOMA + FRIENDSHIPS + GENRE CULT LIVE + NIGHTWORKS + PACKAGE HOLIDAY + SURVEY Public Bar, North Melbourne. 8:30pm. $10. DAS MOTH + AWESOME WALES + BAYU & KANZO + MISTY NIGHTS + SUPERCHANG Boney, Melbourne

Cbd. 10:00pm. DAUGHTERS Evelyn Hotel, Fitzroy. 9:30pm. $39. DIE! DIE! DIE! + LOVE OF DIAGRAMS Ding Dong Lounge, Melbourne Cbd. 9:00pm. DRUNK MUMS + BITS OF SHIT + DJ MAX CRAWDADDY + THE LIVING EYES Cherry Bar, Melbourne Cbd. 9:00pm. EDWYN COLLINS Kelvin Club, Melbourne Cbd. 8:00pm. EINSTEINS TOYBOYS + BRONNIE GORDON & BELLATRIX Musicland, Fawkner. 8:30pm. $10. EL MOTH Bar Open, Fitzroy. 11:00pm. ERICA FREAS + CIRCULAR KEYS + LUCY WILSON + MASSES Reverence Hotel, Footscray. 9:00pm. $12. GARAGE A GOGO - FEAT: THE BLUEBOTTLES + THE KAVE-INN + THE VILLENETTES The Luwow, Fitzroy. 9:00pm. $8. I AM THE RIOT + JAYNE’S FIGHTING SHIPS + MARICOPA WELLS + SPENCER SCOTT + TIM HAMPSHIRE 303, Northcote. 9:30pm. $5. JON STEVENS + JAIME ROBBIE REYNE Flying Saucer Club, Elsternwick. 7:30pm. $33. KING OF THE NORTH + DJ SHAMIKAZI + THE FEELGOODS Retreat Hotel, Brunswick. 11:00pm. LITTLE BASTARD + GRIZZLY JIM LAWRIE + NAKED BODIES Workers Club, Fitzroy. 10:00pm. LOVEBOMBS Yah Yah’s, Fitzroy. 8:00pm. LUKE BRENNAN & THE STICKY VALENTINES + BEN MASON + DJ LINK MEANIE + EMMA RUSSACK + NEW ARCHER Old Bar, Fitzroy. 9:30pm. $10. MI-SEX + THE MICK PEELING BAND Espy, St Kilda. 9:00pm. $31. MISFITS + GRAVEYARD ROCKSTARS + THE MERCY KILLS Corner Hotel, Richmond. 9:30pm. $59. OUTLINES + BREAK THE WALL + OH PACIFIC + SINGLES Bendigo Hotel, Collingwood. 9:00pm. $10. PANAMA Northcote Social Club, Northcote. 9:30pm. $12. SIDE FLAPS ACROSS THE PACIFIC - FEAT: EEVIE LA VOLPE + 40ACREFOREHEAD + CELESTIALMILK + FOX + LUNASEA + LYCRA & LACE + MADAME BUTTONS + MIMI VELEVSKA + MO ICHI + SEXCAKEMONSTER + THE ASS LIBERATION Bar 291, Brunswick. 9:00pm. $15. SPENCER P JONES & KIM SALMON + BRIAN HOOPER + DIMI DERO + PENNY IKINGER + TEX NAPALM Tote Hotel, Collingwood. 9:00pm. STONEFIELD Melbourne Park, Melbourne. 6:00pm. THE HARLOTS + ATOLLS + MAGIC BONES + SUN GOD REPLICA Espy, St Kilda. 10:00pm.

NorthcoteTown Hall

Summer Jamboree

Free Entry

16 Jan –2 Feb 2014 Thursday–Sunday Darebinarts.com.au/jamboree

live l emusic,bar,food, games&sunsets

BEAT MAGAZINE PAGE 52

NAME THAT POINT IN THE NIGHT WHEN DINNER PLANS TURN INTO FOOD VANS. VISIT NAMETHATPOINT.COM TO WIN $5,000


GIG GUIDE

WHAT'S ON AROUND MELBOURNE THIS WEEK

For all the latest gigs check out beat.com.au

MATMOS Since their conception in 1997, Matmos have made a vast contribution to the electronica scene with their unique ability to marry unpredictable sounds and concrete noises to create a delectable rhythm matrix. They will be bringing their audiovisual show to Howler this Sunday January 19.

THE MIGHTY KINGS Whole Lotta Love, Brunswick East. 8:00pm. THE SURF THANG Yarra Hotel, Abbotsford. 9:00pm.

ACOUSTIC/COUNTRY/BLUES/FOLK CENTRE & THE SOUTH + BUDDHA IN A CHOCOLATE BOX + VISION STREET Bar 291, Brunswick. 8:00pm. KING LUCHO + THE FUZZ Edinburgh Castle, Brunswick. 7:00pm. LAUREN Elsternwick Hotel, Elwood. 8:00pm. LET YOUR HAIR DOWN GIRLS + LUCAS POHLING Open Studio, Northcote. 9:00pm. MAJOR TOM & THE ATOMS Post Office Hotel, Coburg. 10:30pm. MR BLACK & BLUES Drunken Poet, West Melbourne. 9:30pm. MUSTANG Pascoe Vale Rsl, Pascoe Vale. 9:00pm. $8. SKYSCRAPER STAN & THE COMMISSION FLATS + RUBY BOOTS Spotted Mallard, Brunswick. 9:00pm. SPENCER P JONES Cherry Bar, Melbourne Cbd. 6:30pm. SUMMER JAMBOREE - FEAT: WES SNELLING + DJ SIZZLE Northcote Town Hall, Northcote. 5:30pm. THE TWOKS Penny Black, Brunswick. 10:30pm. TRADITIONAL IRISH MUSIC SESSION - FEAT: DAN BOURKE Drunken Poet, West Melbourne. 7:00pm. ZYDECO JUMP Lomond Hotel, Brunswick East. 10:30pm.

SATURDAY JAN 18 JAZZ/SOUL/FUNK/LATIN/ WORLD MUSIC ALINTA & THE JAZZ EMPERORS Paris Cat Jazz Club, Melbourne Cbd. 10:30pm. $25. CLASSICAL PIANO Claypots Evening Star, South Melbourne. 3:00pm. GOYIM + ELVIS IN THE HOUSE Claypots, St Kilda. 4:30pm. GRAND WAZOO Flying Saucer Club, Elsternwick. 7:30pm. $32. JAMES SHERLOCK TRIO Uptown Jazz Cafe, Fitzroy. 9:00pm. JOE CHINDAMO Dizzyâ&#x20AC;&#x2122;s Jazz Club, Richmond. 9:00pm. MORELAND CITY SOUL REVIEW + DJ SATURDAY KNIGHTZ Fitzroy Pinnacle, Fitzroy North. 4:00pm. THE RETURN OF THE BEAST Paris Cat Jazz Club, Melbourne Cbd. 8:30pm. $20. TRACY MCNEIL Union Hotel, Brunswick. 10:00pm.

INDIE/ROCK/POP/METAL/ PUNK/COVERS AARON JAMES + MICHAEL KERSS Whole Lotta Love, Brunswick East. 8:00pm. BANG - FEAT: KING PARROT + BURY THE TRUTH + GRAVES Royal Melbourne Hotel, Melbourne Cbd. 10:00pm. BLACK NIGHT CRASH - FEAT: MINIATURES + BREVE + HIDEOUS TOWNS Rochester Castle Hotel, Fitzroy. 9:00pm. $5. BLACKEYED SUSANS Union Hotel, Brunswick. 6:00pm. BOURBON STREET PARTY BAND Bennetts Lane Jazz Club, Melbourne Cbd. 9:30pm. BRIGHTSIDE BATTLE OF THE BANDS - FEAT: JACK PELLOW + CATCHER KITE + MANTIC NOTION + THE SPINSET + TRANSIT GLORIA Espy, St Kilda. 8:00pm. BUILT ON SECRETS + JUST LIKE CLOCKWORK + SIDELINES + YOUNG LIONS Ding Dong Lounge, Melbourne Cbd. 9:00pm. CUNTZ + HYPERBOREA Tote Hotel, Collingwood. 5:00pm. FOXTROT + JOSH MANN + LAURA PALMER + THE SHADOW LEAGUE Brunswick Hotel, Brunswick. 10:00pm. HAWAIIAN PARTY - FEAT: PRETTY CITY + CHOP SQUAD + DEAR THIEVES + KOOLTRON + THE DEAD ELECTED Bar 291, Brunswick. 8:00pm. $5. HEAVYFEST - FEAT: ROTTING CHRIST + TERRA AUSTRALIS + THE AMENTA The Hi-ďŹ , Melbourne Cbd. 9:00pm. $53. I AM DUCKEYE + SPIDER GOAT CANYON + THE BALLS Tote Hotel, Collingwood. 9:30pm. JACKY JACKY & THE BLACKIES + BRETT LEE + JNR BOY + MERIKI + ROBBIE BUNDLE Reverence Hotel, Footscray. 9:00pm. $10.

JOHN GRANT Corner Hotel, Richmond. 9:30pm. $45. JUDGE PINO & THE RULING MOTIONS Bar Open, Fitzroy. 11:00pm. LEGENDS OF MOTORSPORT + TTTTDC Bridge Hotel, Castlemaine. 8:30pm. $8. LUCY WILSON + FORCE FIELDZ Old Bar, Fitzroy. 3:00pm. MANGELWURZEL + BUFFALO TRACY + PETE BIBBY & THE BOTTLES OF CONFIDENCE + THE SHABBAB Evelyn Hotel, Fitzroy. 9:00pm. $10. MICHAEL ROHOTAS 60TH - FEAT: EINSTEIN TOYBOYS + JOEY AMENTE BAND + MICKâ&#x20AC;&#x2122;S MIX JAMMERS Musicland, Fawkner. 9:00pm. PETE TONG Melbourne Park, Melbourne. 6:00pm. PORT ROYAL AFTER PARTY - FEAT: BONE + BODIES + SPACE JUNK + YO GRITO DJS Old Bar, Fitzroy. 9:30pm. $10. PORT ROYAL STREET PARTY - FEAT: COSMIC PSYCHOS + AUSMUTEANTS + BATPISS + BITS OF SHIT + DRUNK MUMS + HARMONY + THE MEANIES + THE MURLOCS + THE SPINNING ROOMS Port Royal Street Party, Port Melbourne. 12:00pm. REING OF PARANTHROPUS + COMPLETE + DJ LEOPARD HEAD + RATSAK + ZOND Public Bar, North Melbourne. 8:30pm. $10. SIERRA LEONE + DAVE OH + KAT ANTOINETTE & THE RENAISSANCE LOVER + SLACQUER Espy, St Kilda. 10:00pm. SOL NATION + GOGO GODDESSES The Luwow, Fitzroy. 11:00pm. $5. SUN CITY Espy, St Kilda. 9:00pm. THE ATTICS + THE MAGIC BONES + THE STRANGE Toff In Town, Melbourne Cbd. 8:30pm. $8. THE BRUNNY BUNCH! - FEAT: GROM FAWKNER + AMISTAT + BROOKE TAYLOR + HUDSON & TROOP + JAMES DOBSON + JAMES MACKEY + LEAIGH BACCHETTI + RICHY MCKAY Brunswick Hotel, Brunswick. 5:00pm. THE BUFFALO CLUB + BARRY SAVAGE + THE MAU MAUS Town Hall Hotel, South Melbourne. 6:00pm. THE DRUNKEN POACHERS Reverence Hotel, Footscray. 9:30pm. $2. THE EARS NOT + FRAUDBAND + MIDNIGHT SCAVANGERS + MOTH BODY Yah Yahâ&#x20AC;&#x2122;s, Fitzroy. 8:00pm. THE FEEL GOODS + EVIL TWIN + UPTOWN ACE + WILLOW DARLING Bendigo Hotel, Collingwood. 9:00pm. $10. THE TROTSKIES + MAGIC AMERICA + OSCAR GALT Workers Club, Fitzroy. 9:30pm. $10. VOODOOCAIN + DARCEE FOX + RIOT IN TOY TOWN Cherry Bar, Melbourne Cbd. 9:00pm.

ACOUSTIC/COUNTRY/BLUES/FOLK ROD DAVITT Hidden Garden, Ascot Vale. 7:00pm. BIG SEAL & THE SLIPPERY FEW Edinburgh Castle, Brunswick. 10:30pm. BLACKWOOD JACK + THE BROKEN HILLS BAND Penny Black, Brunswick. 10:30pm. BLUE EYES CRY Drunken Poet, West Melbourne. 10:00pm. CHAD MASON + DAN WATERS BAND Spotted Mallard, Brunswick. 9:00pm. GORDI Lomond Hotel, Brunswick East. 10:30pm. HOLY MOSES HEARTACHE 303, Northcote. 9:30pm. KING WOLF + RICH DAVIES Labour In Vain, Fitzroy. 8:00pm. MIDSUMMA Wesley Anne, Northcote. 6:30pm. $20. RIPPINLIFE - FEAT: THE BLACK ALLEYS Elsternwick Hotel, Elwood. 8:00pm. STEPHEN CUMMINGS Post Office Hotel, Coburg. 10:30pm. SUMMER JAMBOREE - FEAT: MELODY MOON + DJ T-NA + NICOLETTE FORTE Northcote Town Hall, Northcote. 2:00pm. THE GLORIOUS NORTH + DJ ADALITA + MOONEE VALLEY DRIFTERS Retreat Hotel, Brunswick. 6:00pm. THE SHANNON BOURNE BAND Rainbow Hotel, Fitzroy. 10:00pm. THE SURF THANG Victoria Hotel, Brunswick. 9:00pm.

Fitzroy. 4:00pm. $10. BEERSOAKED SUNDAYS - FEAT: HUGO RACE DUO + DJ STEVE TOOTS + MIDNIGHT SCAVENGERS + RON S. PENO & THE SUPERSTITIONS Old Bar, Fitzroy. 9:30pm. $10. BITTER SWEET KICKS + BRIAN HOOPER + DIMI DERO + SUZIE STAPLETON + TEX NAPALM Cherry Bar, Melbourne Cbd. 8:30pm. BUCK JR + DEMI LOUISE Brunswick Hotel, Brunswick. 9:00pm. CELIAC + CICADA + KOKATSUNA ONANI + LORD RAR Evelyn Hotel, Fitzroy. 9:00pm. COMMUNION MELBOURNE - FEAT: THE HELLO MORNING + AINSLIE WILLS + JIMMY TAIT + LITTLE DREAMER + THE PHONCURVES Toff In Town, Melbourne Cbd. 8:00pm. $15. DIGITAL ORDER + BOMBAY SCARLETT + LEEZ LIDO Brunswick Hotel, Brunswick. 9:00pm. EYEHATEGOD The Hi-ďŹ , Melbourne Cbd. 9:00pm. $46. HALF MOON RUN + TIGERTOWN Corner Hotel, Richmond. 8:30pm. $22. JON STEVENS Melbourne Park, Melbourne. 6:00pm. LIJ GILMOUR Wrangler Studios, Footscray. 8:00pm. LONESOME + MERRI CREEK PICKERS + SIB Workers Club, Fitzroy. 3:00pm. $10. MAT VIRGATO + DJ AGO Whole Lotta Love, Brunswick East. 8:00pm. PETER DICKYBIRD + THE FURROWS + VISION STREET + WONDERBOY Bar Open, Fitzroy. 8:30pm. SUNDAY SCHOOL - FEAT: EAST BRUNSWICK ALL GIRLS CHOIR + SLEEP DECADE Public Bar, North Melbourne. 4:00pm. $10. THE BELLWETHER BAND Bridge Hotel, Castlemaine. 4:00pm. $8. THE FOUR SCOOPS Fitzroy Pinnacle, Fitzroy North. 4:00pm. THOM LION + AL PARKINSON + DAVE GILLAN + GRIM FAWKNER Grace Darling Hotel, Collingwood. 7:30pm. $10. WIL WAGNER + GEORGIA MAQ + JAMIE HAY +

-2+1672167),7=52<

ZZZWKHROGEDUFRPDX 23(1(9(5<'$<30$0 )5((:,),

:('1(6'$<7+-$18$5<

68,&,'(6:$16

($7(1%<'2*6*8(676 7+856'$<7+-$18$5<

,&0/$%(/1,*+7

:251*$1*867$51$.2:6.< 1<&

$'($')25(67,1'(; -2(7$/,$$/(;$1'(5*$56'(1

INDIE/ROCK/POP/METAL/ PUNK/COVERS 4TRESS + LACE & WHISKY + LITTLE HOUSE GODZ + TRIUMPH OVER LOGIC Evelyn Hotel, Fitzroy. 9:00pm. 80â&#x20AC;&#x2122;S ON THE EDGE Sloaney Pony, Port Melbourne. 9:30pm. BACKWOOD CREATURES Labour In Vain, Fitzroy. 6:00pm. BECFEST - FEAT: LOVE LIKE HATE + AWOMADAH FIG + BEC NEWMAN + DANA + GARETH BENNETT + GHOST GANG + JAX JACKI BROWN + JOANNA LEIGH + OZI + REVERSE BUTCHER + SPENSER + STEVE SMART + SUBMARINES + THE JILLS + VESPASIAN QUICK + ZOMBIE SCOOTER CLUB Yah Yahâ&#x20AC;&#x2122;s,

30

)5,'$<7+-$18$5<

/8.(%5(11$1 7+( 67,&.<9$/(17,1(6/$81&+ %(10$621(00$5866$&. 1(:$5&+(5 '-/,1.0($1,(

30

6$785'$<7+-$18$5<

325752<$/$)7(53$57< %21(%2',(6 63$&(-81. <2*5,72'-¡6

30)5((:,7+:5,67%$1'

6$7$592

/8&<:,/621 )25&(),(/'=

SUNDAY JAN 19

30

30)5((

681'$<7+-$18$5<

07*2$7%((562$.('681'$<6 +8*25$&('82 52163(12 7+(683(567,7,216 0,'1,*+76&$9(1*(56 '-67(9(72276

30

021'$<7+-$18$5<

813$9('6(66,216

30

78(6'$<67-$18$5<

*(25*,1$0$7+(5621  -2(/0255,621 œ,17(17,216$5()25,',276¡ (;+,%,7,2123(1,1*

30

EDQGERRNLQJVEDQGERRNLQJV#WKHROGEDUFRPDX

NAME THAT POINT IN THE NIGHT WHEN CLEAR THINKING TURNS INTO MORE DRINKING. VISIT NAMETHATPOINT.COM TO WIN $5,000

BEAT MAGAZINE PAGE 53


THE PUSH

+ BEAT PRESENT... whatson@thepush.com.au

GIG GUIDE

WHAT'S ON AROUND MELBOURNE THIS WEEK

Major Lazer are bringing the party down under this week with a little help from their friends Flosstradamus. They will both tear down the Palace stage this coming Tuesday January 21. Tickets available via Oztix. SPENCER SCOTT Reverence Hotel, Footscray. 4:00pm.

JAZZ/SOUL/FUNK/LATIN/ WORLD MUSIC BURNT LETTERS + TRACY MCNEIL DUO Drunken Poet, West Melbourne. 5:00pm. CHEAP FRILLS Farouk’s Olive, Thornbury. 5:00pm. CISCO CAESAR Union Hotel, Brunswick. 6:00pm. ELVIS IN THE HOUSE + DUO SEVERINI Claypots Evening Star, South Melbourne. 2:00pm. MIKE NOCK & JULIEN WILSON & STEVE MAGNUSSON Bennetts Lane Jazz Club, Melbourne Cbd. 9:30pm. SUN RA ARKESTRA Forum Theatre, Melbourne Cbd. 9:00pm. SUNDAY SUMMER SOUL SESSIONS - FEAT: HAIRY SOUL MAN Northcote Town Hall, Northcote. 2:00pm. YARRA BANKS 303, Northcote. 5:00pm.

ACOUSTIC/COUNTRY/BLUES/FOLK ALL DAY FRITZ + KEN MAHER & TONY HARGREAVES Lomond Hotel, Brunswick East. 6:30pm. BEN SALTER Retreat Hotel, Brunswick. 3:30pm. CHRIS WILSON + DJ MAX CRAWDADDY + SHANNON BOURNE Cherry Bar, Melbourne Cbd. 3:02pm. $5. DAN KROCHMAL + EMMA BROADY + FATAI V + FONTAINE + JACKIE SANNIA + SANTANNA NAWALANY 303, Northcote. 8:00pm. FLAP! + DJ CRISPI Spotted Mallard, Brunswick. 4:30pm.

JAGWAR MA In the last 12 months Jagwar Ma have delivered on the considerable hype that surrounded the release of their accomplished debut Howlin. In support of their Laneway appearance next month, the boys will play a sideshow at The Hi-Fi this Thursday January 16. Tickets available via the venue website. JAM SUNDAYS Musicland, Fawkner. 6:00pm. JULES BOULT & THE REDEEMERS Rainbow Hotel, Fitzroy. 5:00pm. MATT WALKER & THE LOST RAGAS + RAVENSWOOD Retreat Hotel, Brunswick. 6:00pm. NINA & HERMES + THE IRVINES Open Studio, Northcote. 6:30pm. PETER BAYLOR & THE ROADHOUSE ROMEOS Gem Bar, Collingwood. 8:00pm. SMALL TOWN ROMANCE Bar Open, Fitzroy. 5:00pm. SUSY BLUE Penny Black, Brunswick. 6:00pm. SWEET JEAN + HELLO SATELLITES Northcote Social Club, Northcote. 2:30pm. $15. THE BOY WHO SPOKE CLOUDS Wesley Anne, Northcote. 4:00pm. THE DAMES Post Office Hotel, Coburg. 5:30pm. THE LET YOUR HAIR DOWN GIRLS John Curtin Hotel, Carlton. 5:30pm. THE MARGIE LOU TRIO + GIL ASKEY Claypots, St Kilda. 4:30pm. THE STETSON FAMILY Standard Hotel, Fitzroy. 8:30pm. THE STOPOUTS Wesley Anne, Northcote. 7:00pm.

MONDAY JAN 20 JAZZ/SOUL/FUNK/LATIN/ WORLD MUSIC ALLAN BROWNE’S NEW RASCALS Bennetts Lane Jazz Club, Melbourne Cbd. 9:30pm. $15. AN EVENING WITH ERIN CORNELL Bennetts Lane Jazz Club, Melbourne Cbd. 8:05pm. $30. MOHAMED CAMARA & JARABI Wesley Anne, Northcote. 8:00pm. $12.

INDIE/ROCK/POP/METAL/ PUNK/COVERS

MUSICIANS WANTED SOLO MUSICIANS, DUO’S, BANDS WANTED to play at Acoustics Anonymous Thursday Nights at The 86. Starting with open mic from 7pm and live band sets from 9pm. Open Mic - just rock up from 6pm, gig spots email drink@the86.com.au with bio, pics and sound demo. BATTLE OF THE BANDS. Registration now, starts Wednesday the 28th Dec and every Wednesday after for 8 week. First prize: recording time in a studio. Call Jesse 0411 803 579 DRUMMER WANTED for contemporary blues band age 30-45 Prahran/St Kilda. Contact Peter: 0407 680 527 GUITARIST WANTED. For pop/rock originals band. Contact Phil: 0421 901 530. zeffamusic.com SERVICES FREE VENUE HIRE - Fully stocked bar - Huge capacity, whole venue or partial. Call Jesse 0411 803 579 EMPLOYMENT FLAUNT IT. Internationally acclaimed producer of profeminist erotica looking for confident, adult women to smash the stereotypes and earn good money ($400 and up). Don’t overlook this til you’ve found out more about it. Jessica 9495 6555 or feck.com. WE WANT EVERYONE Promoters, Bands, DJs Revitalised bar, The Barley Corn, has reopened its doors 7 days a week and we want YOU. Call Jesse 0411 803 579

BEAT MAGAZINE PAGE 54

Wednesday January 15 With Claire Barley

Festival preparation is about to commence as Big Day Out is fast approaching! Tickets are still on sale for the one day event, which will be taking place at Flemington Racecourse on January 24. In case you’ve missed seeing every poster, billboard and social media post thus far, artist names include Pearl Jam, Arcade Fire, Major Lazer, Flume, Tame Impala and Bliss n Eso. If you’re heading to the festival, don’t forget to be sunsmart and drink plenty of water, and don’t forget to pack that tiny bottle of sunscreen that always seems to run out halfway through the day.

For all the latest gigs check out beat.com.au

MAJOR LAZER AND FLOSSTRADAMUS

ACCESS ALL AGES

CHERRY JAM Cherry Bar, Melbourne Cbd. 7:00pm. DALE RYDER BAND + DJ ROC LANDERS + GARY EASTWOOD EXPRESS Espy, St Kilda. 8:00pm. EYEHATEGOD - FEAT: THE RUINER Bendigo Hotel, Collingwood. 9:30pm. $40. MONDAYS COVERED - FEAT: SECRET TSUNAMI + HIGH SIDE DRIVER + KEVIN BROKEN SCAR + TRENT HAMILTON Espy, St Kilda. 8:00pm. THE PREATURES Melbourne Park, Melbourne. 6:00pm.

ACOUSTIC/COUNTRY/BLUES/FOLK DEAR MONDAY - FEAT: WHO ARE YOU LUTRA LUTRA + RACHEL CLARK + SLEEPY DREAMERS + TASH SULTANA Retreat Hotel, Brunswick. 8:00pm. PORT PHILLIP GILGAMESH READINGS Claypots Evening Star, South Melbourne. 8:30pm. SONGWRITERS COLLECTIVE 303, Northcote. 9:00pm. UNPAVED SESSIONS Old Bar, Fitzroy. 9:30pm. $5.

TUESDAY JAN 21 JAZZ/SOUL/FUNK/LATIN/ WORLD MUSIC FREQUANCY Dizzy’s Jazz Club, Richmond. 9:00pm. HI-FI LOUNGE LIZARDS Claypots, St Kilda. 10:00pm. MIKE NOCK & ALLAN BROWNE Bennetts Lane Jazz Club, Melbourne Cbd. 9:30pm. $18. PETER BAYLOR’S ULTRAFOX Claypots Evening Star, South Melbourne. 8:30pm.

BE PART OF HISTORY. VISIT NAMETHATPOINT.COM TO WIN $5,000

Big Day Out too expensive for you? Outraged by Snoop Dogg’s ridiculous attempt to reinvent himself as Snoop Lion? (You chose your stage name long ago, Snoop, the time for revising it has certainly passed.) Why not nab yourself a ticket to Pushover festival instead? The line-up includes the likes of All Day, Chance Waters, Cub Sport, Dream On Dreamer, In Heart’s Wake, Pez, The Smith Street Band and many others. If you’d like to have a look at the full lineup, head to www.thepush.com.au. All this sweet musical goodness for only $45. Tickets are available at ticketmaster.com.au. Starting this week, the Darebin City Council is putting on a fabulous Summer Jamboree of free live music, food, games and, according to the poster, sunsets. (This probably means the events will take place around sunset and attendees will be able to enjoy a beautiful view, but I’d like to think it means they’ve concocted some sort of complex light show – a sort of elaborate virtual sunset, if you will. Darebin Council, if you’re reading this, perhaps take that suggestion on board for next time.) Sunday Feb 2 will see local faves The Rims, The Darjeelings and the ever beautiful Miss Eileen & King Lear all perform. Festivities will begin at 4pm. For full program details, head to www.darebinarts.com.au. In case you haven’t heard, applications for the next round of Push Songs are closing in the next couple of weeks. Push Songs is a fabulous song writing/ mentoring program open to songwriters of all ages. What does the program involve, I hear you ask? Well I’m about to explain, so stop being so damn impatient. The program involves 3 one-on-one song writing workshops with The Push’s very own Charles Jenkins and this round’s batch of freshly baked mentors, including Mark Seymour, Adalita, Liz Stringer and Darren Middleton. People from all over Victoria are invited to apply. The workshops will take place at the Push HQ (Brunswick Town Hall) on Sydney Road. Just head to thepush.com.au and complete the application before January 30.

ALL AGES TIMETABLE THURSDAY JANUARY 16 - SUNDAY FEBRUARY 2 Northcote Town Hall Summer Jamboree w/ live music, food games and more, Northcote Town Hall, 189 High street Northcote, various times, free, darebinarts.com.au, AA.

INDIE/ROCK/POP/METAL/ PUNK/COVERS BRIGHTSIDE Espy, St Kilda. 8:30pm. BRUNSWICK HOTEL DISCOVERY NIGHT - FEAT: CANARY + FLYING SAUCER TERROR Brunswick Hotel, Brunswick. 9:00pm. CITY CALM DOWN Melbourne Park, Melbourne. 6:00pm. JAIME ROBBIE REYNE Cherry Bar, Melbourne Cbd. 7:00pm. MELBOURNE FRESH INDUSTRY SHOWCASES Revolver Upstairs, Prahran. 8:00pm. $15. THE HIVES 170 Russell, Melbourne Cbd. 7:30pm. TORO Y MOI + PORTUGAL THE MAN The Hi-fi, Melbourne Cbd. 9:00pm. $55.

ACOUSTIC/COUNTRY/BLUES/FOLK BEYOND THE BATHROOM CHOIR Edinburgh Castle, Brunswick. 8:30pm. JOHN MURRY Northcote Social Club, Northcote. 9:00pm. $35. JOHN MURRY Basement Discs, Melbourne Cbd. 1:45pm. MAKE IT UP CLUB Bar Open, Fitzroy. 9:30pm. SHANE O’MARA & DAN LETHBRIDGE Retreat Hotel, Brunswick. 8:30pm.


KITCHEN SPECIALS 7+87+ HELLHOUND BROWN PATCH BROWN (HELLHOUNDS) SOLO ACOUSTIC 8.30PM

6$77+ KING WOLF FEATURING RICH DAVIES (DEVILS UNION) TWO SETS 5 TO 7 PM

6817+ BACKWOOD CREATURES JEB CARDWELL, GRANT CUMMERFORD, TIM BURNHAM TWO SETS FROM 5 TO 7 PM

+8*($8675$/,$'$<:((.(1' CHAD MASON BAND HELLHOUNDS SAINT JUDE

;IHXL.ER ·;MRI;LMWOI];SQIR¸

MONDAY - $12 BURGER AND $12 PARMA + OPEN MIC NIGHT TUESDAY - $12 MEXICAN FOOD WEDNESDAY - $14 PORTERHOUSE STEAK THURSDAY - TRIVIA NIGHT

TQ7Y^ERRI/MRWIPPE TQ0MWE'EVYWS

FRI 17 JAN

TQ%P'EVV TQ0IW8LSQEW

FULL VEGAN MENU

CAM EWART & THE GHOST TOWNS OF THE MIDWEST ANNE OF THE WOLVES

SAT 18 JAN THE POLLYDEVLINS ALL SHOWS ARE FREE! FUNCTION ROOM AVAILABLE. KITCHEN OPEN EVERY EVENING 163A SYDNEY ROAD, BRUNSWICK 3056 WWW.CORNISHARMS.COM.AU 9380 8383 BOOKINGS/ENQUIRIES: CORNISHARMSBANDBOOKER@GMAIL.COM

8LYXL.ER *VMXL.ER

TQ8VEHMXMSREP-VMWL1YWMG7IWWMSR [MXL(ER&SYVOI *VMIRHW TQ1V&PEGO &PYIW 7EXXL.ER

TQ&PYI)]IW'V] 7YRXL.ER

TQ8VEG]1G2IMP(YS TQ&YVRX0IXXIVW 8YIWWX.ER

TQ;IIOP]8VMZME 8LI(VYROIR4SIX4IIP7XVIIX

HMVIGXP]STTSWMXI5YIIR:MG1EVOIX  4LSRI[[[XLIHVYROIRTSIXGSQEY

:+2Í6&87(5" 68%0,73+2726 927($7%($7&20$8',6&866,21

7+,6:((. ZKDWDPHVV

ERRWV\

>JA<9Q)/L@B9F /$85(1*/(=(5$1' *8(676 K9LMJ<9Q)0L@B9F 5,33,1/,)( 35(6(1767+( %/$&.$//(<6: 68332576

&20,1*83 B9F*,L@9F<+)KL

-$&.621),5(%,5' B9F*-L@

UXSS\SRZHUV

%$77/(2)7+(%$1'6 +,*+1,*+760,*+7< .,1*6-$0(6$9(17 +$33<*2(6%/8(6 78540,1860$77+(: /(1(+$1

VTXLGJ\

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 55


THE LOCAL

A PLACE TO CALL HOME

For more information or ad bookings call Thom on 9428 3600

VENUE PROFILE

BRUNSWICK HOTEL

History?  Was the first pub on the Street to get a liquor license back in the 1850s when Sydney Rd was the main thoroughfare for gold diggers going up the Hume Hwy. There is also mention of it used to be a Brothel for those lonely travelers as well. How long have you been operating as The Brunswick Hotel? Almost five years. What do you feel is your major attraction? Live music, giant beer garden and friendly staff. What was your favorite show in the last six months and why? 3/4 Beast last November. It was the lead singers Birthday and they always put on a great live show, with giant mascots and wild antics!  Could you nominate a bartender of the month? Probably not - they are all loved equally! How many nights of live music & entertainment are running at your venue? Every night we are open, there is something going on. Ways to get there? There is a tram stop right out the front. Cabs work too. Don’t drive, enjoy the freedom to drink. Available for functions?  Yes. Crowd?  Young, old, hipsters, bogans, it really depends on the night or band who is playing.

Opening hours? 4pm - 3am Monday - Thursday  4pm - 5am Friday 12pm - 5am Saturday 12pm - 1am Sunday Cover charge? Only for fundraisers. Food specials? $9 pizza and a pot every day from 4pm - 8pm. $3 schooners and $5 basics every Thursday from 8pm untill 1am. $10 Jugs of Boags Mondays and Wednesdays. What are you known for?  Being the last place open on Sydney Rd.

ADDRESS: 140 Sydney Rd, Brunswick VIC 3056 WEBSITE: www.brunswickhotel.net PHONE: 9387 6637 BANDS CONTACT: brunnygigs@gmail.com

BACKSTAGE

THE PLACE FOR MUSICIANS

For more information or ad bookings call Aleksei on 9428 3600

HIRE PROFILE

B S SOUND PA HIRE

Established: 1987 What exactly do you provide for hire? We provide hire and operation of sound and lighting equipment for live music events. We also have AV equipment including projectors and screens for corporate functions or any event that needs that little bit extra. What events can you cater for? We have a variety of systems to cater for large or small events with live or recorded/playback sound. We cater for wedding ceremonies and receptions, bahmitzahs and birthday parties. Celebrants hire portable PA systems for outdoor ceremonies like weddings and funerals. These are battery powered and totally wireless. We often do a full band sound and lighting system for wedding receptions. We also can cater for a variety of school events such as speech nights, musicals (with multiple wireless mics), Christmas Carols (choir mics) and fundraiser / trivia nights. What sets you apart from other hire companies? After many years of working with musicians we know what works and what doesn’t. We ensure that you get the most appropriate gear to suit your gig and offer a service extending beyond normal business hours, seven days a week. Favorite sound or lighting packages: iPod Party Speaker Systems: Why hire a DJ if you’ve already got great playlists? Prices range from $80 - $310 for speaker systems ranging from 400 - 2000 watts, complete with all necessary stands and leads. Just plug in your iPod.

car, easy to set up and comprehensive enough to suit a live band. Complete with microphones and effects. $110 - $220. Digital 24 channel PA systems: Delivered, setup and operated; 1000 - 4000 watts FoH, 4 to 8 monitors on 2 to 6 fold-back sends, multiple on-board effects and processors. Quality namebrand equipment. Prices start at $770 including crew. LED lighting systems: Complete with rigging, trees and DMX controllers. Flexible colour mixing options, low power consumption, low heat output, environmentally friendly. Prices start at $70 for 4 LED lights, stand and controller. PAR 56 Lights: Not so ‘green’ but simple and bulletproof. $10 each including leads and gells. Artists and companies you have worked with: Recently we’ve worked with Gasoline Inc, The Funkadelic Side, Underdog, The Pearly Shells, Deb Conway, Georgia Fields, Bob Sedergreen, Coco’s Lunch, Absolute 80’s, Take it Greasy, Lady Luck, Melbourne Hit Parade and many others. Pick up and or delivery of equipment available? Apart from pick-up we can do the transport at an additional cost if required. Insurance available when hiring equipment? Insurance available when we deliver, set-up and operate. For driveway hire the onus is on the hirer.

name brand equipment and free advice to anyone, including people not familiar with technical terms.

Extras: We provide reliable, well maintained, Vocal PA systems: Compact enough to fit in a BEAT MAGAZINE PAGE 56

WATCH INTERVIEWS, CHATS & AWKWARD SILENCES... BEAT.COM.AU/TV

PHONE: (03) 9889 1999 MOBILE: 0419 993 966 WEBSITE: www.bssound.com.au E-MAIL: bssound@bigpond.com LOCATION: 25 Cromwell St, Glen Iris, 3146


$%%276)25' 0,187(6)5200(/%2851(&%' '$< 1,*+75(+($56$/)520 678',26:,7+67$7(2)7+($57 3$u6$1'92&$/&2035(66,21 6,=(6)52060$//726783,'/</$5*(:,7+ ',5(&752//,1*$&&(66 VWRUDJHDQGEDFNOLQHDYDLODEOH 3K LQIR#ODQHZD\VWXGLRVFRP 5HDURI%ORRPEXUJ6W$EERWVIRUG

PA HIRE Comprehensive PA systems delivered, set up and operated with crew. Compact, easy, sound systems you can pickup and assemble yourself.Components such as microphones, speakers and effects are also available separately. Lights also available. For details phone Mark Barry on 03 9889 1999 or 0419 993 966

www.bssound.com.au

5(+($56$/678',26,1&5$1%2851( v s

&+ & +5,670$ +5,670$6+2/,'$< 0$6 $6+ +2/,'$ +2 '$<63(&,$/ $< <6 6 63 3(& 3 (&,$/ (&

a

s

667 67$ 77$7 7$$$7 $7(2)7 77(( 22))777+( 7+($57522063/( +( $57 $57 52206 52  3/(1 3/( /(11777<<<2)3$ <22)33$ 33$5.,1* $55.,1* .,,11*

Vintage, New & Second Hand Amps, Effects Pedals & Rigs

%22.12:$7:::%5,&1(7$8  

Huge Selection â&#x20AC;&#x201C; All major Brands

bssound@bigpond.com

Brand new 2000 watt HK Audio powered speakers, ProFX12 Mackie desks and XBUU:BNBIBQPXFSFEGPMECBDLTJOFWFSZSPPN .BSDI tJEFOUJDBMN2SPPNTt "JSDPOBOEWFOUJMBUJPOJOFW 4UPSBHFGBDJMJUJFT "DPVTUJD "JSDPOBOEWFOUJMBUJPOJOFWFSZSPPNt"NQBOEESVNLJUIJSFt4UPSBHFGBDJMJUJFTt"DPVTUJD FOHJOFFSEFT )JSFBWBJMBCMF FOHJOFFSEFTJHOFETPVOEQSPPÃ¥OHt&YUFSOBM1")JSFBWBJMBCMF

18 Duffy St Burwood PH: (03) 903 88101, M: 0417 000 397 Email: hydrastudios@bigpond.com www.hydrastudios.com.au

Guitars and Amps wanted Top CA$H Paid

Expert Guitar & Amp Repairs Mods & Restoration Fast Turnaround Affordable Rates Technicians on site 1131 Burke Rd KEW 3101 Phone: 03 9817 7000 www.eastgatemusic.com.au

M A D E

THIS SPACE COULD BE YOURS!

CONTACT ALEKSEI ON 9428 3600 OR MIXDOWN@BEAT.COM.AU

AUSTRALIAâ&#x20AC;&#x2122;S ONLY NATIONAL MUSIC STREET PRESS WITH A COMPREHENSIVE AND FREE DISTRIBUTION. DESIGNED, WRITTEN AND CREATED FOR MUSICIANS AND LOVERS OF MUSIC.

B Y

M U S I C I A N S

F O R

M U S I C I A N S

ISSUE 236

DEC 2013

FREE MIXDOWNMAG.COM.AU INTERVIEWED: ZEBRAHEAD LETLIVE NILE RODGERS KURT VILE THE GROWL FRIGHTENED RABBIT AUTRE NE VEUT INSANE CLOWN POSSE PEZ

GIVEAWAY NEW MATON NE N SRS70 SSR R SEMIACOUSTIC GUITAR

MEGADETH

THE CRIMSON PROJEKCT

PERIPHERY

SALE ON NOW!

VIEW FULL CATALOGUE AND PARTICIAPTING DEALERS AT YAMAHABACKSTAGE.COM.AU A MASSIVE SUMMER MUSIC PACK VALUED AT OVER $1,300 RRP, YOU CHOOSE YOUR SOUND FOR SUMMER

LIKE US ON FACEBOOK TO ENTER

facebook.com/yamahabackstagepass

â&#x20AC;¢ INTERVIEWS WITH THE WORLDâ&#x20AC;&#x2122;S BIGGEST ARTISTS AND HOME GROWN HEROES. â&#x20AC;¢ FEATURES ON THE MUSIC INDUSTRY â&#x20AC;¢ PRODUCT NEWS AND GEAR REVIEWS â&#x20AC;¢ STUDIO Q&Aâ&#x20AC;&#x2122;S â&#x20AC;¢ AWESOME MONTHLY GIVEAWAYS

FEBRUARY 2014 ISSUE DEADLINE AND STREET DATES STREET AND ONLINE DATE: FEBRUARY 5 AD BOOKING DEADLINE: JANUARY 24 EDITORIAL DEADLINE: JANUARY 27 ARTWORK DEADLINE: JANUARY 29 For more information on Mixdown Magazine contact: Aleksei on (03) 9428 3600 or email Mixdown@beat.com.au

CHECK OUT ALL THE LATEST NEWS, REVIEWS AND FREE SHIT AT BEAT.COM.AU

BEAT MAGAZINE PAGE 57


LIVE

REPORTS FROM THE FRONT ROW

For more reviews go to beat.com.au/reviews Photo by Anna Kanci

BOMBINO Corner Hotel, Sunday January 12 It’s one of those things that triggers mental tics, trying to rationalise the seemingly spontaneous, gentle fingerpicking of Bombino’s right hand while absorbing the masterful licks projected through the PA. The dynamic didn’t waiver throughout the entire set, kicking into overdrive at times and locking into watertight grooves in an instant. It was the final stop in the Taurag singer-guitarist’s maiden Australian visit, garnering acclaim at Falls and Sydney Festival in the weeks prior. Bombino’s three-piece backing band were unified as a rhythm section, often acting as a pedestal for the perpetual guitar soloing happening front and centre. The guitar was above and beyond in the mix, dwarfing even Bombino’s vocals, sung in Tamasheq. Bassist Kildjate Moussa Albade translated interstitial French banter as Bombino tapped his heart in appreciation. The comparisons to Hendrix are kinda justified, yet there is more common ground with the melodic wander of Knopfler, or something like the paradox of danger and restraint exercised by Nels Cline at his most unhinged. Desert rock of the Saharan variety was the order of the night, imbuing with bluesy jam elements, ramping up the tempo with uncanny ease, even dropping into dance-ready reggae at points. The sway of Azamane Tiliade, taken from last year’s Dan Auberch-produced Nomad, was a joyous LOVED: The moments of pure highpoint. The deceptively calm melodic noodling was compounded synchronicity between band members. by Corey Wilhelm’s frenetic yet controlled drum work. HATED: Missing out on his outdoor festival appearances over New Years. LACHLAN KANONIUK DRANK: One Sunday night cap.

Photo by Anna Kanci

DEAFHEAVEN Corner Hotel, Friday January 10

VAMPIRE WEEKEND Festival Hall, Monday January 6 A blast of rap heralded the oncoming of Brooklyn’s Vampire Weekend, a reminder that it was only Kanye West’s Yeezus that provided competition for Modern Vampires Of The City as international critic’s Album of the Year for 2013. Ezra Koenig marched onto the Festival Hall stage clad in a boiler suit with both sleeves and trousers rolled up, ready to get down to business. The gloves are off, the wisdom teeth are out. The no-nonsense anthems of local band Gang of Youths amply warmed up the squealing crowd and Vampire Weekend didn’t waste a second, hammering through the many highlights of their latest album and the heady, hyper singles from their two earlier ones. With a new album that’s their best yet and which rounds off a trilogy that moves from fresh-faced college dramas to a darker, more mature (but still catchy as hell) sound, this was the perfect time to catch the band in the live setting. While all three albums were amply represented, their enduring self-titled debut got as much of an airing as their newest release. There’s no simmering summer’s night to match the tropical pop of Contra highlight Horchata, but the fervent VM fans were in full force and it was eagerly lapped up with passionate screams and excitable girls on shoulders pointing at the ceiling. Ezra was gifted with a towel quoting his ‘Bad bitch with a power switch’ tweet, which he gladly donned for the remainder of the show. The frenetic pace of the set finally subsided for more pensive tracks from their new album, Obvious Bicycle and Hannah Hunt, after which we were sent packing with early cuts One LOVED: Highlights A-punk, and Walcott. It was a jubilant, A-grade performance of escapist fun Unbelievers, Cousins and Hannah Hunt. that momentarily snuffed out the reality of back-to-work week. HATED: The floral backdrop. DRANK: Beer in a cup. CHRIS GIRDLER

A Google search for  Thrall, tonight’s opening act, yields a number of entries relating to a World of Warcraft character – which I’m sure has probably been drawn to the band’s attention many times in the past, but what’s one more? The four piece onstage certainly don’t trade in that slightly whimsical prog metal that name checks imps and warlocks and mana. It’s an exciting yet all too short set of punishing drums and battling guitars, punctuated by Tom Void’s impressive growl. Whitehorse are chomping to get started barely before Thrall are offstage. On another night I would have had a lot more time for the sextet’s doom metal offerings, but bringing the pace down in between the warp speed bands on either side feels like whiplash. You can waste an afternoon either searching for the most convoluted description of  Deafheaven  from 2013 or coming up with your own. Seriously, what is shoegaze metal? I can only picture Kevin Shields in an Iron Maiden t-shirt, and it’s pretty hilarious. But the attempts to lock this band down go some way to indicate just what a peculiar force they are, why they’ve had such a big 2013 and why the audience loses their mind within minutes.  Dream House  from last year’s  Sunbather album acts as the opening shot, its few note recurring guitar hook drawing the song back from the brink many times. It, like many LOVED: The oddly of the songs in the hour performance, stay fairly close to the original fitting Smiths songs playing on the with only a handful of live embellishments. A set this intense runs the overheads between sets. risk of losing the smaller emotional moments, but the band is easily HATED: What seemed like the first capable of piercing the clouds before plunging back to earth. hot night of Melbourne Summer. DRANK: Gin. Ice. Keep it coming.  MITCHELL ALEXANDER

SO FRENCHY SO CHIC IN THE PARK Werribee Mansion, Sunday January 12 As a festival, So Frenchy So Chic it is sensible but classy, like the luxury, European station wagons that filled the car park. The whole thing exudes a self-satisfied air and your attendance will mark you as first against the wall when the rock ‘n’ roll revolution comes. It really isn’t a music festival and there can’t really be anyone in attendance that really cares who the bands are – it’s a day out in the sun where music happens to be. Opener Edward Deer (accompanied by backing guitar/singer) provided a lovely introduction to the day. Stripped bare classic covers such as La Vie en Rose were given a good going over, and while his Je t’aime had a great country reverb it really does need a lady for the true sleazy sex vibe. Lily Wood and the Prick are some kind of more enjoyable Euro Sneaky Sound System, with heavy kick drum and bass, overlaid with jangly guitar and piano. They got the dancing area full, which was no easy conquest considering the lazy, boozy picnic ambiance. Féfé performed a solid, almost endless set, mostly because the crowd was so into his hip hop heavy rap reggae. As long as people were dancing, he kept going. Headlining the afternoon was Babylon Circus, another reggae LOVED: The Wes Anderson music inspired sound with three-piece horns; a true party outfit. So Frenchy festival vibe. So Chic In The Park really is a lovely day in the sun. HATED: Myself. DRANK: Plastic cups of beer. JACK FRANKLIN

BONOBO The Palace, Tuesday January 7 The Bonobo performance was an eclectic and surprising show that is difficult to explain in mere words. The act began with a bold opener by mastermind Simon Green, introducing himself and profound drummer Jack Baker to the audience, and encouraging them to immediately move their bodies with his latest dance track Cirrus. As a long time listener of Bonobo records, I was intrigued to discover how this one man-electronic producer would showcase his delicate, sample heavy music in band formation. I was presently surprised to walk into the theatre and see spaces for a string quartet, many windwood and horn instruments, two synth sections, a drummer, a guitarist and vocalists, as well as Green’s podium of electro toys and bass. This foundation seamlessly steered the show through the collection of ambient, world, trance and dance tracks which all hold the unique Bonobo flavour. The night was predominantly instrumental and electronic, however I must not discount the two guest vocalists – Andreya Triana and Melbourne’s own, Chet Faker. From where I was standing, Triana’s vocals were hard to hear and seemed to get lost in the conglomeration of samples, intricate bass lines and detailed drums. I personally feel that this had something to do with her microphone technique and not her vocal ability or the sound at the venue on the night. The spontaneous appearance of Chet Faker on the stage singing a new song off the recently released album The North Borders, caused huge applause and delight in the audience. Overall, the gig showed the incredible talent, devotion, and musical integrity of Green, aka Bonobo and I struggle to comprehend how much time and effort was dedicated to recreating his beautifully recorded and produced tracks into a 12 piece band with such seamless manoeuvres between tempos, styles and samples. MIKHALA ANDREA

BEAT MAGAZINE PAGE 58

WATCH ATCH INTERVIEWS INTERVIEWS, CHATS & AWKWARD SILENCES SILENCES... BEAT.COM.AU/TV B AT C BE

LOVED: The drummer. HATED: The annoying group of guys in front of me. DRANK: Nothing. I was sober and loving it!



Beat Magazine #1405