Issuu on Google+

I: BRITISH COLUMBIAS COMPUTER [INFORMATION SOURCE

-

I: V01

1.N0. 4May 1988

Plus: NEWSB YTES Pagemaker 3.0 LANs Computer E vents Calendar

-


4®tru ANNIVERSTSLE '

fiäißinb"913535515651361zffj ‘LVTth AT Ftlrchnsb I‘

System

g;

4

"

20 MB S325 40 MB 5495

S119

.-

NEWVIEW ACCOUNTINC S950

.

=IIXFSSYSTEM 0 1515s“?

--

I

' I

(U10MHZ)

640K RAM m20“) 80286 CPU (IT board)

Clock 3nd calendar ' Enhanced keyboard „'36 High Res TTL monitor with swivel base r Metal czse mmLED light, Reset/Tube „w“ r 3: 3 cxposable halfhght 51mg I

NEC Multispeed LAPTOP 934MHz Backlit 640K 2 Floppies S2675 640K 20 MB 55795

0

(R33 51595)

v. u

T‘

.-.-.-. um’

n.

GROU]:PIIRCHASE PLAN: .» .. Please call for wholesale pncmg an m“ 31°“? Puma“: Ph“ ‘zu 0‘ m 0 " )

NCL AT hard disk G:floppy Controller M°“°/5""Phi° 937d Wifl‘ Pfime’ P0” 200 W CSA powcr supply Clock 8a: calendar

_

*

-

1200 Baud internal Modem with soflware 5119

Logitedl Maus:

- -

DELUXE AT SYSTEM (8/12 MHZ) 4 layexs mutherboard rnacle in USA 0 Nonon S! 183 Orte Megaßyte RAM (70ns) o CPU 80286-12 0 12 MB floppy drive NCL ATharcl disk 6c floppy Controller 0 Mono/graphic (zu-d with printer port 0 200 W CSA power supply 0

' Enhanccd keyboarw; v wxth swwel base High Res. ' Maulw- Wh momtof LEDMW

CONIPACT TTJRBO XT ( H A R D DISK) SYSTEM

:

o

RAM

äigeKsöoK floppy One 20 MBhard disk (auto parld

n C1051; 3nd

.. 0

COMPU I ‚ER RENTALS XT System s59/week AT System sgg/week

l

Set-ä}, parallel 2nd game 90:15 15g c 5 ; Pcwmx, gupply

-. o

(Ask for monuuy discount rate)

91mm;

AT 531,3 kgirboafd High RC5. 157L monimr with swivel basc

Compaq C353 MSDOM: GW-Basic with manuals

FTRFIK SYSTEMSIM. ACCPACG’

NoveH®

Add-ons

Sales

Customizations Data Base Repairs Consulting

Installation Certification Support

Computer Associates’ 1987 ADS Consultant of the year

Registered Netware Affiliata

#303-1661 West 8th AVenue, Vancouver, B.C. V6.1 1V1 Fax (604) 736-6431 Telephone (604) 736-3741 ’ AGCPAC und Novell m

-

2 The Computer Pnpu Mafiäss

regismrad tradanurks o! Gonpulor Mandate: Immaalioral Im; und Nova! im

‘in:

51555) ’

A?


__;I

"(qmm

Ei im": LNoAMaf 1933

BRIHSHCÜLUHIBIASCÜMPUTERINFORLMTIONSOURCE

1

m2nur "1""

LEITER FROM m5 EDI'I‘0R

12::

Wsmuphunnne

PUBLISHERIEDUOR Kinn Singhlfluln

pagesinsimdfismmw-immnhm aupportivedvafisus. Thecmcmsuneamtobcflmwc providhngamnchxudui vehickfiormcounpumoomnmfltyldhfly.

EDITORIAL

‘Ufismonmwelooknhxyirvgmmfiafinuwiflamemaptfian

CONTRIBUTING EDHORS Wendy Woods. Km Mlizß. Dann Blankenhain. Masayuki Mlyuzwr. Kairo Ynmnnomo, Guru Bankier, Slzve Gold und Peter Vekinis.

IhcIBMATCloncBuyerfsGuideand kbyEdwhRunch. Heisdnsnmorofarinfilarhookontnyfirgxdmnuflphns amrhnonßöiaflsceomingmcmhhgrwbookwiflnmeasy

-

rudingstyk.

COÄTRIBLWING WEITERE: Min: Wolf. Nclson Rucst.

Mikgwolfi sbiflkwithhismundafl finufltficsmlaflis.

Edwin Rutsch, Ren Haidcngcr

Hegensimprhgvcionnrypologigscurjmflytvtflablglnuasfixmg urPCs.

readingifyouunplumingm

DESIGN

x

a

n

u

ART DIRECTOR: Rosunxzy Anders. Desmond Phillips

ART CONSULTANT: John Hass-es. Moonliglu Studio TYPESEITING: Glacia’ Pkw

TheSharewlreshclfwctakeachangeoffocwwilhalooksfim Macintoshsidn offlfings. Neumannwi will b: blck l0 (h4: PCauf!’ withm miclecm File Etprcsx.

Alduscoxporationgaveus acallinfnerotxMachßeshop PubtishingismewlthlhcpevicwofctanfingfcwzesforQnazkand Pagcunbxffheysaidwfitfilyonseehgunlkalfl. Wahren-e imjnssedltisanicdyevolufimurypodxuwhfidzafldsinmmy newfaxxnsndimprovcs makcadygoodimafncaNebonRue-‚sx

COVER DESIGN & ARTWORK:Rosemxry Anks. Computer 3»D IlIusu-nion: are fxom IBM AT Clone Buyeräs Guido and Hundbook bry Edwixx Rutsch. pubushed by Modula- Infommion Systems (415) 552-8648 Thuy wen: ofiginully «euer! b3Joseph Gramm 01' Enabling Tochnologies Im.(312)523-1113.

wmmtuinlacswdredfls.

ADVERTISING

Checkoutonrnnwadvqfisingsacfihmflxismommihcservfioe Secua-hisamwformnwhichgivcxärafismnlinkmorespa:

Photognph by Kinn Sind: Khnln.

fromkesolutionsgivesmmeinsidestafyonafimlookumgnew Pzgamker.

DISTRIBUTION IHANAGER: Syad Yalmm

"

n d: du: spccüliznd qmm‘:mvioc. 10* I! diese listingyoumny flndjuuwhuyoungd. Asprmünedwehnvecrwfim ' Drop m a n ) :

unlineudletushnwwhatyou anyqlnsdonsyoufdlikcnuweeduve

SUBSCRNHONS:

PuhüshingoansaAs

193a

Thc Connputcr Papcr. Brifish Cohnmbiafs Counpum Infiommion

Sowaaisplablishedbyncmdaconnpuaurhperhrmflmlfighn

OSR-PSB .....„..................„..............9

Thc Stock Marke:.........................„. 10 Teleoommlmcaiiorls .......................l0 Computer Calcndar .............................„20 Classified Ads .....................................„Z3

Features

IBM AT Clone Buyefs Guido ............12

Columns

Pagamka 3.0..........................l4 Lookfixmmunnxtkanrhmwefinflhnchdmmzfimen Local Anea Networks inmgmhixulenu. i (Znd of 3 axticles) ...........................17 Inmstendfllislcuernowasmepfixmiswaifingflnjoymeisme, lilruaxuime. 5| The Shareware Shelf

AlookatMacPßäcsharcwaremmlö

CounputerPspamniledümalybyourhmmplasesmdtehqlu für S14 t0 3205 Was! 13m Amme. Vmeauver B.C. v“ 2V‘ Teupamaunm-smmwmmamfligmdlxnfliqh

m: 1sVohxme 1.No.4. my

Desktop Publishing .........................6 General Computing..........................6 Macintosh.......................................‚.7 PC News ........................................8

vandwukininulsm‘ Desktop Publishing

hucompuu Prperispublixhadmonlhly. Ifyou wouldlihaThe

IZIsaIesEnCmada. Amuicmsuhsaipdonsplenesamdsfl.

Commodore ....................................‚.6

'

smusp-csnunumeummfimubynmmmmmp

nsnndanfmmhldflsy hstimte‘: partdüirrainlngsflxlflnp PRINTBlhVmeyWebGIphla

CD-ROM .................................„ . 6 Canadian Newsbytcs.........................6 Chips

.

Ou:calcaxdar scctionkeqas growing a;maninstimrions discover dubemfinofbeinglisledinnpapq LhaLgcßrendbySQOOO

mcarphirxlhcixexpeuiseirxvnriorxsanfinslfyvoomlootingfm

ADVEKTISING MANAGER: Kinn Singt Klub:

NEWSBYTES

Ä%«.'»a+;„4„‚< a

Kimm Singh Klub:

Ecfinrlfilblirltu

EM».

Advertising Features

The Service Secwr A new advertising feature ...............19 New Products ............. ................18 The Bookscllers‘ Bestseller: .................23

mrveiRcpoducfianhlwholeurhtputwilhotnülcpauxiuimof lhcPubliahcrissuictly prohbitd. Unsolicitedmuuialisgmdhfly

aocqnnbcnwecnüberuspaumhfummfiugilmkuüh

Imawuücdbyusmqndsdf-adüwedeavelope. CIRCULATION: 30,000

Serum! Chur Poutag: Rnghtntbn Numbcr 7718

Comlng Up In The Computer Paper: „Inne Database 8: Hypercard CqyäMnnndlbcl-laym

Jul: Vertical Marke! Software WeMovdLatMonLLIn mcyoutrfirsedthsdtmcemfitxnploan notofmyowdanbassarxdlonddnahnonmnuofApru 15th.w: u: II:

Candn Computer Papa’ Inc. 3205 Wut 13th Arena: Vneonvar B12. VGIC 2V‘ San: PhoeNunhm (600733-596

capyamnzuhclnzo

AugustNctworts cnpyamoaamcluryzz September Eduution 8c Training copytadbandhmmuguazz

OGIOIMNOIÜQWRJ-GWÖ ‘ftaupnnnriaptbhylofl n3


F Ü R PERFECT DATAmDA TAPERFFCT PRESENTS The Super Turbo 286/16 Byte System F

_ ”

.

—80286proce9sorl6Mlz.0waitstabe

- clodr/mlendxr/cmoa battary hackup oonfig. —l.2Mb.diskettedrive - Hitek tactile keybonrd (RT-IOI type} - 180 Watt power supply (CSA appmved) “1Mb-(Ö40/384Jmemory

!

f

—2aerial/2para.|ldpom

—AwardorPhoen.i:BICB

- mondgmphiu/colour emulafinm video card

— —

—Microsofthß-DOS3.3/GWBaaic monochronne amher monilnr 40 M]; disk drin

............ 53195.00 DPS Turbo 286/12 System (as above)................................................ 52695.00 SUGGFSTED RETAIL PBICE-

"13?

IIIIIIIIIlllllllllllllllllllllllHlll

‘Norton SI Ratings (Dealer Inqujres Weloome}

DPS DISTRIBUTION ING

l6 Mhz.—l8.7 I8 Nfl1z.-23.0

Cnnoenüic Technologies Inc. 5094211 Kingway Burnaby. RC. 432-1392

For the Dealer Nearest You

Tri Tech Computers 9459 12m1. Street Delta, 3.0. 589-1333

(Jompatible Computers Inc. 5437 Kingsway Butnaby, 11c

4355460

N0 other portable Computers can say

this much for themselves I n t e r n a ] Modemformost

.-

u-

max-l2 MHz m 0 Wail Sum: (Advmced Nmon SI 15.6)

Another lapmp might solve youx ptoblezns now. Hut whn lbout hier. vzhcn yau may neod to udd a modem?0r oormnunicuc with nuinfnmes? Or expmd into other ateas? Omninet Computcrs prucm: Ihc DATAVUE Iina of pomble computers: For ptice muitivc buyerx, there i: the 9 1b Spuk“. [t dolivqrs all the featutes mdpowetoflhcoflnlcadhg lmtnps Itzgraatprice. For

-

OMNINET

COMPUTER LTD.

4 The Compum Paßck M3; 1988

S1599. you gut a super —readnb|e 80 churamu X 2S line displzy, dual rpeed procasm (437954MHZ). dual 720 K xmaodrive (intuface fol- exmmxl 5.2.5" driva). 640K RAM. ACndapux und

wchlrgcr.

The Sup 1+1mby Dmvu: has nbuilx-m axpmsion 510|du: lets you add 0oyout capnbüiüa half card. V0300. fnx. VGA-

-

time. Wim my IBM compaxibla

A. mtworkilm theyä": all nvlil-

Opon Seven Days a week

mmIhis vetsncfle Iaplop. I: cvm lexsycvu uk: ndvmuge cf teclanobgy Ihn’: not yet ofi’ die drxwing boncLTizfiall-feanrecßnnp lflopczflcsu l0 MHz. It's fully IBM wmpafiblc. And it's cxpmdnblc up t0 LfiMBfThc Slip 1+1 Hut: uS2250. The choioeisyomxcallomxfinetmdaysoynncmmfu yoursalf which portable bes: suim yorur meds. ab]: xoydu

3728 Main St.. Vanoouver (604) 872-1136


LE..TTFE.S7:‘.Ifi(:)

IR"e 211D1%

Files Exprcsi Fan Den: TCP, I enjoyed nending thc April inuc cf ymn- pzblicadon whichl racaivad this mommg. Ragudmg shmewure und spodfically dmbse pnchgcs. 1 urge you In oonuc: Expesswue. n Reimund Wlxobuzd m a n / m xoftvmdzvdopuflm asuwpodnctcaflcdfiküpeß. W: hzveuedixfuruva-alycnfonflaxmuflhxgxchnliflxem und mciti-n minuodzmmy Ieveldmbasemmqmxmlchn

bocnmcncwumxcmnmdanunditinaveryshoflfimc. I15: well woxth invenigning ifnn: in inwmsted in a Imw 008l. high quallty dntnbue plckagc. Exprcsrwnre am b0 machen! n:206> 788-0932orl7y Innil uPOBox ZBORHImotIL WA98U73.

Ilookfmwudnokeepim upwilh Ihccnmgnlurindustlyhtßß.

via The Cotnptmu Papa.

Sinccnly. BiIJ Hy. Computer Training Savica. sank. WA.

Gerda-I Sinvnand: nur shauwarc conrribusar Lrairmdy worling an a wril: upfor our man ixsue an daxabm-u. Fü: [in-nagt i: an rkc Ein‘.

Thanksfar du xuppm und du tip.

Hnw gnnd I5 Olivetti? Dur TCP My husband mdI have juxt rcad you: Papa: f0: m:first üme. am! 351cc "u. wonki b: wcrnäwhile rcuaeiving! I Iavmfl man

amtlnpzxblicummnmfomsvurms wIc-oupuuprodnas m6 501956435 availablc apuciixcnlly in ü: Lower Mainlmd a u ; so I'm nur: yon will fiI1 a void succanxftmy. l umseriously minking nbuul rcplacixzg my (Jlivcxti ETV 300 wotd-procusor with a compum. Whar. i: Lbc man um effxtive So w-ny u:g c l my ü ] :rmsfened nvet 1o 11:: MS-DOS forma‘! fux I huvc rcccivm a price fiom Olivetti und I wuuld likc some nthnrs w sec which i: Lhc bes: wny In ga. Also m: yuu or nur u! your rtadcrs fnmilin: wizh 111c Olivcm ETV 260? II: E snid L0bc IBM compatibleburitisrxxxc apcnsivcdza-noflmcloneslsec

uhmiadlwanldmmmmropiniomimquunmnudoes ASCII man? Youu Ixuly Mxs. Linda Gxonm While Rock

ßCHsmMsfor sotnerhbug o: aber. bat baicalfy i: rcfzrs ma

szaidardfüfcrvnnvhichnuwwwdprocaxwxmnranilrüa fairfylowlcvtlflaadarmwflckdoanxcoflaindlthcformfi-

WW°""“’““‘*.“‘F“""°“E‘F*F’"

Try/liunmfucüefiadonpagclflforyourcfidconvgrsfian mqmagoaaprscumfarmyqpaqflrmwmtaqm Wmöplactälamüflwablwof. Inlnozi-‚uximbaw

wayloxofltdtpanfinwudoyousayrmdas?

m

' m u t n V fl h ä 0

Ä V Ü Ä I W G U

o

Pnoadnosuon

o izll-Izl-Ipaliuhnfiuannräun

o F u ä fl o a w ü b

o

O

wachsam

amlnunnoum

OUUMIHI

'

Mach Sendet! Publicnflon To all irwolvedll 000d luckon your publjcafinrx. n 10ml" pcpc: i: much nudnd hure in Vmcwva

000!!!

o Hndfiarufllhnrwafiusflm o nun-umnunanauu

o Bananen: o M fi fl j w g m fi b g Dünn

S. Wahn

äfrfpf"°"""““"‘°"'”

lncnasoyouoffleolirodunctlvltynlfln tInOOIITEX cA-r ramny.

Cunyou ullmwhmlearxfmdbooksuxdmggnfinesonhnd

wir’

m „um m.m übrarias a: Capilmw Collage, BCIT und UBC-

Chaut man umvariom’ libvaric: bdbn you 3o a: t0 zhcir poücifl w: (Midas.TIM Verona PuNic Lcäary hat sonne maß: bul i: km58!) w a m m m - ‚ _ . ‚ „ „ ‚ o b ‚ m m m m ‚ „ pniodüab. n: man oompüll mpplicr: Ofbooh m: mga. ztm an Ran! a m ”an dufolh m: bring you m; Hochaltar! Smsutm L55: anpagc 23 o] Im’: nimm. ie UBC Reaktion. Sifmannzcrmny. Grunviilc Bwkr. Cady‘; am’ Supu’Sofiwara. Abo dann: nur Prxlvna Tcch a: 3900 E Hacrmg: in Bunxaby. We Ar: Rcudahh Den: TCP.

Ipummflnitoxwyvnpxpcruflscptxbfichhnymblnmfin 5L Dur "msrirute i5in Ihc orgamuumnal singe: und I am mw lcuning ahnm computm’ neu-d: und capnbilixies [w buxincxs ‚und man-auch. I found ytmr pape: bulh imuesting and Lnfommivc, und Lbe auticlc: vcry rudable. I applecinlc your effons andI wish you peu succcu!

igi‘.ffs°.‘äx‚

Directur of Thc Bau h-Lxtimw. Wherc an: u; BBS Ilstlngx? Dur TCP Saw yuu pmpcr an arecmt visx to Vuwouvcx. A fine {im effuai. I immtdintely Iooked f0: u 11x1ul’ Ion]B135‘: und Xclmnxcl in thc buuk of The Coanptxlcr Papm. I hopc you print auch Iistingu in lhe rumm. Good Iuck.

Dm’M“ "W W: an working m

“ M m it. Thanbfor IM kann

-— 000i!“I GOITEX m Solution coInuItantlouostYou...

Norm Van

T‘.

v_„

I

'

‘—

——.:= — ü ___

MICRO SYSTEM INC TEL: 004-321-2229

1 28 8.5. H u h n Dünn,Vnnoouvor. 8.0.,V 6 ! 483


syslzur. Unix systemVfromATäzTJtrlocoroln. WiflrSZZbEIISonh

Maar. 1987fixnarr—peymeuof:vya1ries.Thepodraeu‚whi-:h

sysnem will require nne 88100 RlSCchip‚ M5495. Incl two 882m

andCarrm-lmt. Usenwmnotifiedoflhechmge. Denehneentixrues

theüofllthesmflfirkqarudnewxlsccbipsfimilflsand

Imtila

l987xevmnagheeomesthelergegchiiamatnmamrflnklsc TlrgelafludMaiiglnlfilptmmimr-WebsuxflnsnmuxVcflk Chip business. Pricing is eonsidered “aggressive” by analym a: mdMemerufinmhavebemre-isrmdbyDmelnunM-wneshke 52.100 for ach S-chip setneeded-in a total ocmpuu: sysrcm. (A CanvagTheCoachMuxinnbwclskzllaesnrlmspellhgCmch.

diSkCaChingdIipmIlWHeach-lflßenleisshafinguphaeaxnmg mmppm1mumaudhinhleaauiczsayxthenxirrmiairxsineffxr

Tand

pedfionisfildßmnopexifianbashuarfiledn

Aß/Iflhuliffliefrcallnnnrfiigfllefeameoprarhgsystunlhebig Menendez‘ lcnowledge. “Seoop.” he adda. was ein-irren by

Larnee

wirmerswillbeusmflierealbanhmeulfimamebanlefordie lewigwholivvasirlSomhunCalifuniafLulwehearcLhewash lflßaisshafingupbetweenhfinfialaarldhflwlxasedfipsm theaamepnsizimwzamflewasmfiingflamenlkafleoulfln‘:

nnounces Erasable CD

PORT ORTH. TX(NB) -—Rumm50faTnIflyCDmzchinewue

givmmnresubsmlcclhmdmamedpossible in mApril 21 pren usedmrheIBMlhemdPCelonenMotorolasaysizsnumpmdin gethmghllewasoonuctingmcuxys.” Mennxicgwükeqx confercnse. Tmdy eed a reusable optical diak lechnology theRlSCclxipwmislhe88200dühcachhgdaipJtdaimsrhisdfip inmmhmoughmlacumugrwpgxapevmmshfishemwfl Willi abou! 50D u: megabymes nf capncity rhat umbe und will: doesrhejobofäochipeonollmflßcseinhelndingsmrgusing Tugeteanployeesallfiwxmdnewjohs. will licerlse its {schmol- aainglepieccoffiotnl. existing CDund CD-ROM playava. DESKTOPPUBIJSHINGUBMUtime-emnmfilgfiarrbeufim . ogy. calledfl-IOR-CD. andCluh-mmTandy John Rasch expeers products InteI/Micron Alliance: More DRAMs Of-SO-JEMWSIHHIMIIIBNGÜDBIIEÖHJBINiWHIHfSodety using i: will eome out ovet the nealt 18-24 mmmis. Counbined with SANTA CIARA. CI- (N3) Inne!Corporafion. which gol outof —Bu:in5s (NEWS BminesfinToroum. Aflnplblishhlglcvera] reporls lhaldlgilal audio mp1: (DAnplayers wculdalso beeoming rheDltAMmarketinwßiisbackinitbywayotbeoomings issueswiflaaflnayflemfineneurslelmhasgonebuckloairxrfier man: Ufitmtrlnel. Ihissetoffaflunyolwneanirlmemusic resellef of DRAM Chips runde Tedmology of Boise. melhodmtnddaeedironsmrrolsmnotesinllxlaeeniscxthal bminm.whieh fears max consumerswilluseflwmw Lechnologym Idahalnnelwillsellhllicrun’: Zfifikdfipeunduüielnlellabel. whilelhcfiniahedprudrudoesrfllookasshnmlhenewslemzis lhci: dclrimenr. _ themby insming Micron a steady rnarket fur- its ciynamicrandom lahingmuchlcssfimemgmdnce. : WP Software for'7 Languages aecessmmmrydfipaflwedealisqexrgned‘ mboostprodnetxon‘ cf

=

Eisel.Tokyo. has mleaaed ward proeessing software CD-WORDS for NEC PC-930Ü9CÜCS. CD-WORDG i: multi-lmgxiageCD-ROM

DllAMswhicharehheavydemafdworldnfideax-ldmmflydme andMicr-nn are rhe

“Buy American" spirit. Texas hvo Anniean DRAM marmfa

software lha: includes 5 nüllion Word: {er zerren languagee. Il: hns a u-anslaüan feamm for sevenlaxrguages. but it trau-reine: only «ward for ward. II i: priced et l48.000yen o1’ 51,203.

-‚1-:; :-‚-

ä

.

..

‘A’

t.

3222-». 4» ; _;_

a

«g.»

'.-

i m v h

quicldyduminaEdd-iewnddwide

Option I10 buy smclc.

....‚...

5.

last

WASHINGTON

ATARI Head T0 Tcll “The Real Story” SUNNYVALE. Ca. (NB)

While Micron Teclmobgy claims Ihr: worldwideDRAMshonagcisdrwmhueseddanmndand changes in mmufacnxring, aformcr customei- ai-lclnow adversaryis Calling these argnmenrs “a seam“ und “lhereal sei-y" rorhe vowaLto bring public. Atari CEO Jaek TrmieLhspcaksng in Harmaver. Was: Germany. eommds the U.S. tzacle smctiow irupoaed agains:Japan

forallcgeddunpingofDRAMclfifsbelowooslinlheUsnvae “stupid und ill-caonoeived” und iruligaredby MietenTedmology w mmtofLheCmadimneelmologymdlstyTDaniel Idmsax.Qnebee‘: "intprovetlnepnsifienofmicroninrljewcrldmahet." TnunieLnot Münster ot‘ Induslry andßcmmeree. welcomed Apple es e“new lmownformincingwmdasayshewpcheanedomofaemmetfor majorparmexirlthedevelopmemolaworldelass infionnaflon DltAMdxipsbyMicrmwhurüregpemimnduemrfiimsuddmly secmr.“ teelmology demandedlfigherpriees afiwttclqflunedealazalawapfimhed

BCE Bugs MDI

M O N ' l ' R E . A L ( 1 ‘ l B ) — B C E M o b i l e lheeellxrlar nelephorle andpagersisler eumpany ofBellCanada andNorthezn Teleeonnisplazntingashueoffiaürgwlnelppayfmanorbm’ aequisition. The arge! is MDI Mobile Data Inlprualjmial Ine. of Vancouver, whiehmakesradins forpolieecars und taJlis. Theplm Est0 offer filme millionof BCE Mobile‘: conunon shares. which would raisepixblicholdirlgsin lheeompunymabomsjpereexir. BCEIi-lmtheholding eompany foralltheßellopenlionnwmldbe left with just over 80 per cum. wir]: die rest belongixrg l0 National Telesyslem Ltd. IBM Cannda. Markharn, 0111.. says i1will invest C370 million in upgradirlg its plant in Brument. Que. this year. Sinne the fourth quarter oflnslyear lhc eumpmyhasaearedabm lsonewjobs a1 die feetomwhichnmkesemnponmlafiomazmgeoflfllrlpmdtiers finm (h6 Personal Systemfz w3090 mainframes. Computer Asmchtes Canada um. Vaneouver. is mw shipping SupcrProject Expertfz.the 0812 verrion cf its project nmnngemenl Software. Suggcsled relnil price i: 3995.

_

Motorola a

-—

_ in the U.S.A. ‘(II

‚g '.

'

.

Motorola RISC Chip Runs at 17 MIPS

CHICAGO. II. (N3) By concmiraüng an the man: eommon commands through Reduced Inslruction Scl Compuling (RISC) rhe 3rechniques. Momroln has crealed u ncw oompulcr ehip so: 88000 Serien. whiehcan r u n u l up u: 17million inne-dm: per aoeond (MIPS). (‘that's a sp-ad simllnr in Ihr: most modern mainfi-ame. now adaptable w adeshop or evcnulaptop.) RISC chip zeta like Lhe lllltlol). along with ihn Sun SPARE or lnuergraph CLIPPER cliip. will tun man courplex modeling and rimulation programsthaneverbeforepoasibleltll um: Iheauneerpaarhg

G ‘m: Computer Papa May 198B

halfoflhe lllhmdershewrlurdiemainmleofaeanpmer

programisfiotcllfliecompurzrwhamdofonlywpereemoflllh gradersmulddcfna: “algerirhm.”

flnxepmtbytheßdrmfiuualTeaüngservieeoflamumTown-

alügNJ„concludesthmxmesstoounpuznismolimind.sdnol cuniarladnnkirxegrazeorxnmtetconeqamnadlfldflxaremt wellu-ainedOf837sclnolooanprlercocrdhnmnaIrveL32

percauoflhirdgndereaehaszlpercemofsevenlhgradeeducaIommd lflpucmloflllhgldeoouflirlamrsfehrbeywmna well xnpared t0 teach eompuler scienee. Ganges: uablished

Nflrflwyennagoleeondnamfionalsanveysotvaxbuefim-

Xanadu ProJect to “Change the World”

sayingmymingmrlupressontheqdviceofüsanome

80386

ucwwzyofviewhguademrparhigdmwiflnnzheresuicfiomof currenlfilesyslems. Evunnallymepmjectisdnsipuadroamma

68020 On Th

Smsalimczxamduisaprojeaflelsonhnslunwlnednocxealea

'

NEWYORKlNIU-lrvingmuläehairmmmd

dorelnxcmannnalmsayssales‘ lspexeeaitinflwquana endedMzehSLInminneI-VieWinmEWALLSFREEUOURNAL Gould added Ihm. thc 80386-based maehine thal

Commodcrehubemsdlinginlimnpewillheeammgtorheus. mmtetlnthefflHcflsosaidthnmupyadedAmigLusingme Motorola 68020 prooessot. will bc avnilable in both rhe U.S. and EuropeabourlnsameümeBmallisnoloominpmrosesforüae onee-fi-ailconunodoramostofrlneeompmykstrmgthisbuedon Euopean sales. while U.S. sales an aoeomiring f0: cnly about a

qumnorlessoftheeompanykrevemm. .‚_

e

Motorola aloppcd produei-ng memmy ehips h11985. "That's 300d news for personal cumpulcr mlltn’! in Lllc U.S.. sinee there's a serious shormge ol’ mcmory Chips lhcre. As was already reporled. Mowrolaaelup ajoinlverlan-e inNorlheln Japan, in eooperazion with Toslniba. inMuy 1987. Thcir joim fix-m Tohnku Semlcmductar willmmufactureTosliibrfs 1MDRAM und Motorola‘; 68000 CPUs in May.

'

mandaläedsnadybyiheNaümalxcssanuatofEduafimalPrognass (INAEP). The smdy The First "Cmiptnu NafianalAssessznenf-tawdtbecerrqxmflciflsoflfißflüflxizfi. mammdznhgradezsmihcspsingonmmmayromm mnstflfirdgradasmuldreoogrfizeafloppydishakeyhomdmda joystichNeai-ly allsevenllxgxafidsrecognizcdthcbasicpauofthe otxupuzenBmorflyafliirdofdfirdufisevurlhgrfiasmdlesihm

Lib” SANFRANCISCOQIB-Terlllelsenanfim andinvenxozofthelermiypmaxflbaekh 1960. sayshehas relehedfliefirstfiewstxgeinfljrursaflfifäbysfigningan agreeaimzmsellsofl: ofhisxamrhumpnymamdekof

o;

TORONTO (NB)

TOKYO (NB) Motorola (U.S.A.) willrcsmne lhe prnduetion of im 1 megabi: dynnmir: RAM in lhe U.S.. setting rechnologinl assistance fror-n Japan's Toslliba. 1MDRAMwill be mmufucuned at Molorola‘: Phnenlx. Arlmrla faetnry hy 111e md of rhe ycax.

-

hemmade. Tranielissuingthcflahoouefuhuchof ourunn. bad faith. and violanon‘ anfitrust lnwx. Mann" isn't

-

..‘

oompuhaillimanenlharsrheeonclusionofewngressirmally-

reoomfliatiun ov:Ihereeem US-Jfimlese und: dispute. Ilpnese eleetronicsgimul-lilachihas agreeilmbuyneulyszmillbnh mieroprocessors from Intel and Teagas Insmnnmrs Japan. Hitadii plansto use the IG-bitmflS-bilcustbmmadedaips in aireondirioners and Video cassette reoorders.

MONTREAL (.NB)—The lalestin aseries ofeompanies announcing üwuuueztts in die largely Freneh-speaking provinee is Apple Canada Inc..which suys il will imiesr C556 million in the provinee over rhe nexr rl-ree yeaxs. The invesrmenr sn-aregy includes buyingprinlcdeireuim {mm Circa Craft of Montreal for use in Macintosh und Lucxwriler lI printers. Most of lhe cireuiis will be exported mApple plants in Lhe U.S. and Ireland. Apple also naaned Serum Disq 1110.. Munneal. Lhe sole supplicr of Apple Canada’: Macintosh [anfing Series. softwze training packages for Ihr: Macintosh. David Raqipresidcru cf Apple Canada, saidin aprepared Statement rha: the Quebec invcsunenls a major step in Apple Canada's invemnent strategy in Cmada and support lllc growfli unddevelop-

Q.„.131

clmo Eneffecfrve

Dnrgile Lhe "elassroom mmpururevolu600m0 ahnte. er lßmillionmrthofhrficrvn im.“few nchools(NB)— use oomptuas cfiecziveiy mdmosxsnadenls are

SANTACLARACLmB)—lnwhalappea:stobeagsurreof

4

m:'cae.-.s‚.'-"-f-.Ä

;

Hitatchi Buys From Intel

e C mmits S56 Million in Quebec

'

"

"9

rhroughhypercaxttechnolog. InrheswpriseammmememAumdakhaabeeennlheNhyeuold project‘: fixst “angel.” Calvimedflelsm‘: ich: I n : fimlly

wmeofagefikuodeskisfilmfingthefxojedmadißscvm

prvgranunmfurmmidiacloaedfer. ‘metrcbpptmisestohaveiß

firslmodwlbumoftlseallianeevitlfinjtlstlßmonflls-mslnafl featconsiduingtheymloralljxtfialpm-poeesxfiflvorfingfiom sexuell.

mmunccdThe Offiee

Pnhlishei’ Version 1.1. The new vcrjim of Lhe deaklnp publishing paclmge feaumes 22 added oompletc ducumml. dcaigru fcrr a 1mal of 45 templau. an international! churncter set. hyphmalion in l4 languagu Incl inlproved docummtalion. Prima and Word {aroccssor suppwl luu also bem upgraded. adding suppon for ncw versiom ol’ XyWriu: III. WcrdPcrfcei Ind Microsoft Word, 31mg will: additional printcr dxivers. . Laser‘ Friendly hus inoorporated OEM 3.0. which il xays allows fcrr lauer rerponse rime und point-ahmdnbilily. Autoradio font- scale enrreexinn und neuen Font represenülion lmve beun nddcd Io improve die aocuracy of lhe display. CONTACI‘: LASER FRIENDLY lNC.56Shorüng Rdßcarbomugh, Dm.M15 356. (416291-5736

Target Software Quits: Scoop in Limbo

—— Tmgcl Software. publiahcx" of the deskmp

publishing packuge “Scoop” und 001er producu {er im: Apple Maclmosh.has nnned Off ils 300 nuxlbcr. lcl59 i1: employees. and shmm-ed im dem. Presidmt Salvanore Papalnno i: lworlcdly

working u aeonsulunt 1o Bomu Coup. a Sumyvnle. CAschwere dislribuwr. But Tage: Im: not hemmt-y. Iceording u: Manny Menendez o! Deneba Schwere. anothez Miuni mfiwm hause. Manny bes a reuorl In hnow lheac min. He501d publiahing rights on four prodocn Denebe wrote. no‘ärger. laut llaen aued Tage: in

Com uter Press Association Awartls

.

O0 (N3) The Computer Press Associafion has releuedaliatofliae lhirdarmralCnuIpnerPrwsAvu-ardswirmas. ThereWeremorethanTOOcnHiereanQ-Jexfirlgül l5 diffumzalegoriesanltßoftbunreeeivafldlhcrfimplaeeornnmuup. 1h: evem’. Sponsoren!b)‘ Cilitu:Amcrica. drew asizneable a b w d m New York"; historic l-lelmslcy Pelze: Hotel. Hexe are 1h: best: COMPUTER NEWSLETl-ER: Pitricil Scybold’: üfiiccComptllSAN

.v

The I rce Publisher -— Laser Friendly lnc. has

MIANII. FL (N3)

“globallibraryüooessiblebyalltypesofeourpumsandaeflthahle

ing Report FEATUREJCOMPUTER PUBLICKHON: Wim RoechLPC MAGAZINE. " m : Copyright Law m rm1" RADIOPROGRAM: Ncrlhwen Computing NEWS SIURYMONCOLIPIITER FUBLlCrKlTON: Arm Held urith Robert Neff. Pfanne: Scgber: ä. Kalhleen Devcny. BUSINESS WEEK. "Big Blutbahn. May BeCleenThan l'on Thaughl" OPINION 0K EDTTORIALÄIUMPIJ'TER PUBUCAUON: Bill Mlcluvne. PC MAGAZINE, "Coming toTerms Willi 05H" NEWS STORYICOLIPUTEI PIIBUCACHON: ‘lvillie Schau, DATKLLATION,"Supu-cunxpuluDmrping Allcged al US Univer-

sxues"

COMPUTER MAGAZINE: PC‚MAGAZINE HOW-TO BOCK: Joan Lfinchdl.THE NEW WEITER. MSParis


COMPUTER NEWSPAPER: COMPUTERWORLD ONLINE PUBLICATION: Microbylu. Byn:

386 Performance

LASER PRINTER PCCOPIERS MICRO GRAPHICS

PublicaLions

PRODUCT-SPECIFIC BOCK: Damm:Goodmm THECOMPLETE HYPERCARD HANDBCOK TELEVISION PfloüRANlzcmnpumrs in Can-

ai a

IEXL

NÜNFICTIÜN CONIPIHER BOCK: Thzodor: DREAM MANclson, COMPUTER IIB!

TOHER (ARTRIDGES

CHDQES

FEATURE IN NON-COMPUTER PUBUCATION: Michael Rogers. NEWSWEEIQÜdim" icking flv: HumanNhnd" COMPUTER MANUAL: Thcm Hogmandlohn Zussmaxl. “Guide t0 Ehe Paradox Personal Progranunar" EXPERIENCEIN SOFTWARE. Bukelcy, C1. has dcmatcd 50 copies cf its Idaa Garant-nur softwun: tu lhu Amcrican Fonmdation fort AIDS R:search. Thc Idca Gmcmmr i: uscd für problcm schritt; undplaumirxjgThc fnn wann: u:dann: its producl L0 oflle: 300d causcs EIS parL cf iu ncw “Ivlcüce a Differealcc Wien: NVI; Cm" campaign. Contact Craig Settlcs at415I644-0694. ELECTRONIC 'I‘EXT CORPORATlON. Pmvo. Utah. has rclcpd four uns of diskctrns packed with the collectod wovrks of “Fillimn Shakespeare. AI S99 per set o: S299 for flze pocfs Iifefi: work. rhe smies mns an IBM PCs with WordCrmmhe: for text reu-icval. COMPUTER APPLICAIIONS. Ralcigh. NC. mtrodusccd II ‘ma PC.a S150 produsl {hat lcts IBM PS/z oomputcrs run Apple Jle scftwme. It ships Lhe end nf April.

CEX 286 IBM AT COMPATIBLE

Apple and

" 0nd 1.2 MBFloppy Disk Drive.

"HIER-II!!! mmpnfibla grnphiosCardWfpfinmport.

New —5159-’?

Multi-User Mac On The Way?

CUPERTINO. Ca. (NB) —Is-MCWEEK mugazina rcpons rhal Apple is prcparixtg t0 introducu u Motorola GSOSD-bascd. flocrr-smnding. multiuser Nlacinmsh in Octoher or November. but Apple Es denying L11: rqwort. Rafarrcd to as the Apple 11x. il rcpcmodly has connocrinrut for 51x tcminals. will includc ROM-band Ethernet Mappen, an intcnud 500 mcgabytc WORM cirive und an optional CD-ROM dtive. Apple Computu‘: CEO John Sculley has repeamdly sLulod (hat m: ncw compum inxroductions will occm in 1983. astalcman: being echoed agah b}; an Apple Computer spokeswomm. —WIm i; clenr ‘u: du: a 68030-133594 sysrcm will rcquixc a rcwxilc of lhc Macintosh operatmg syslem l0 uwtzmmodutc Ihc addidcnal mnmary 1nd proucssixlg puwcr uf Manuell’: high-md chip. m: facthas 1nd man}! Iaospeculntz: Ihm weindcud will nol so: um IIx berate 1989.

Lncense Microsoft/Ap le Show In whnl Lumcul

oould CUPERTINCÄLCIL. )— to beone oflhe most intriguingsofiwnre oopyright

c u u in compuxnrdom hinory. fetuling Apple Counputcr 1nd hfiuowft hxve joimly nleucd a

_-=-—

‘ATVEnhaJmedKeyboariCKayh-onimmol) ‘Realiimeclockwiflahatwryhackup.

Recharged —

_ „ _

Ä

_:

. .

;

-

Ä

n - _ — - - 1 . . + . . — ' — ' — — _ ‘lfißitshardffloppydiskcunlrollercxrd. ‘Blflipnntian 51cm (2-8bitaI6-16bits) t 200 Watts CSA/IJI. appmvad poweu‘ aupply. Datahain (AMDEKJ V242A Mcnitm‘ Wlfilt 8: swivel base. 40 Megabyte hnrd disk drive. (SEAGAIEAOmB). M

‘ ’ INCUJDES: i HIGHEST OUNJTY TONER

32,350

OPTIONS: Add fip to 10241;memory ( a m 30m) ......................„3199 3.5" Microfloppy disk drive 720K .............................„S149 0M Year Serial/ Parallel Port Card ...........................................‚.395 PWT‘ “"4 30237.10 Math Co-processor ....................................... s459 labow‘

t PFCKUP 8 DEINER t IENEVIIMG YOLIR WIPEII i

_

'

‘Alfiaaewithkgybuardlockpowurltxxrboldisclight.

‘69-95’

N0DRILL I. FILL

IT

J Pßfiifmg

MSDOS

s:GW BASIC v3.03

Warrunty

@ _ i _

wosssAnsrAcnou

-

’64OK.RAMMemory.

AsLowAs

rosoft Profits Soar

CUPERTINO. Ca. (NB) Apple Computer n:ports camings f0: die 1988fisculycu Loppcd S201 million, the highest ever recorded for tha computcr makcr, und a figure 118% higher Ihm this timc las!ycux. Thc ncws marks I11: wird comcculive qunrtcr Chat Apple ha: also recordod rcvmue increases of over 50?». Put anorher wny. Apple is making twiceasmmhmoxmeyasitdid Ihistinxelm year. Dcl Yocml. Apple’: chief openfing ofiicer. athibulcs Ihc stcllxr rcsults l0 nur. only an ovawhchrfing dcmmd Ior Macintoshes, which by somcestimatesisgrowing a1 anno oI40% aycar. bm t0 irs new credibility in Ihr: oorpomln nrem. "Appleissuoceeding inrhebtmhassmarkeß. Our cuslomcr bucis broadening minclude corporrg, technical. und 121x34: syslclns u m . " Microsoft. meanwhile. enmed 537.3 million. up nearry 1 c m ove: the same period last year whcm it amed just 519.1 million, ‘fhis doubling of carnings is armband to 11489€. increasein international rcvcnuc. "notably suong du: In increscd producl shipncnu und favcnhl: exchmge uns." according t0 uslalcxmmtfroznMicrosoftPresidaxt John Shirley. One (hing zhe fiscal results provc bolh fimu claarly hava more man cuough nwncy t0 puy um lawyers in their currem "Incl: am‘! feel" barfle ( w a r Ihc Macintosh screen display.

A—'

‘SOÄS-Iflclnlflflnninflatgormügflurlwfitflafl. * AWABD ROM BIOS Ver. 3.03 W/bifilt-in Setup.

m: ‘DWONMSED ENGINEY"

16041681-2981 '

286 Price!

GUARANTEED ß h v C u d 1

-

‚um

Vanoouvcr Office 1041West Brondway, Van, B.C. VBH IE2 4604)733-1535

Richmond Omen: — 310-4200 N0. 3 Rand, Richmond, B.C. V60 H2

° (604R76-9588

-rx

„-

RSI äThe "MIND LINK

„m:

n.

Fast 'n Affordable Laser Printing!

MINÜÄINK

‘h:

533-2312 O1‘ 278-5543

flnehmdshnkeiuundiünnnlsmxmnbaxsinessrelaxiotßhip. Ilbmexprusionofußtuxda xymbolofmumnlonnfiduxce. Fmmmemommtweshakahmdawfflbalfineanfideacedul comu fiorn our nppmach In sales.

Western Canada's largcst BBS

Asdbegirmingweiislmwyoumorcmmyounfightcxpon

MÖDEM SPECIAL SUPRA 2400 Baud

Just

QZSKLOO

RSI WE MULTI-TASK! (604) 278-6694

\

q u e r

300/1200/2400 Baud 8 lines/ lO0Mb+ online stomge

i

hadditimbmcn-adifiam]

equipmmlmdmfiwuesalmwecmieavwwhaommyowwulngplhfwzuvbguppofl. trnining. consulrmg und pmject oo-ordimüon patlicululy i1" you plln In inlcgm: dilfenm mdmlogies o:- cantputu fnmilies in fac: averydxhxg fromnanvozk phnnin; b suppüu.

SpocinIiänginMacinmsh“ Campus’; wncmfuldmefiglusolufionfuyou. WIHhuyoU

mcdumgkstmd-nbncnmmlmnnetworkofcomwugmuflslMmhlfix“malvrillsava you timeamd nnoncy.

_. ..

‘T

.

E‘,

O O @[H fiJlgifiTüCüfi-äfl VANFOIIVI‘!

M: 11:4

°

u

ancmnn

zum:

hnnqpmunmmaaua

VIWYIM MJNCAN NANAIX üüflUlAf KILUNNA man: J a p a n „ u m : man 1mm:

cn-rm

A m a u n a u n n u p h p p n g n - u u n - n a a y n r fi

Brlngln thls Hund rccEIQeÜÄWÜETÜwnpumbook nonMlaudtlnnwhcvm-y ._

_|’E."L"°L.°‘..'LV'LSH°JE ‘imflfiußnflh”

"

‘ g ’

n.

‘ITECoTpuTaEp-cx’ flifiäfl’7}


ytviaulycalfidulhlngmmunvhfichisazh: xoolohheirdispute. Thcwßapcunmxaflows hfiaosofilouxouxfinMadnmsb-Ekcdbphys

FORGET THE PROGRAMMERS

infinsaxtuxifumesofiwmrepuogxamsflntlfis

psarticulncusqilwuthenseofwmdows und ioons in Midosofi Windows version 1.0. However, Windows Version 2.0 i: the Center cf Ihn dzspute-Applcclainu Ihc visual inwfacaexcocd: the boundaxies sei up in thc oxiginal 13m2.menn; Microsoft dmies (bis. Th: einem-neu: was und: pause m: both sides

'

wuivcdüwconfidmfialiryclaxscundtcleuedicm

thcprcn. sayirgdnrelnsewouldhlvebem

madc darin; cum proceedixxgs any-way.

Meanwlnilc vixtnally c-veryone ‘u: saying Apple’: lnwsuir is really u sho: uIBM whose Presentaflon Mannger. when it's finally completed. inexpecrnd In b: msman Mac-lflce of all clonc inuuiacu. Apple Computer i5pxobably uying u:oonfuse m: nmtctformeprodnmatxickwhich wcrkedin olhct faunou: corpornm suits.

imcgmdnccammgpchgnlngrxnsnflvn

LudJt-fllbccfiwibtfixwglhepxrkagcsmmmelhm lüflüdaalasuzossCmdgw-iflaspcinluflpiusis an szlling Burda-lauge pacluges m Ihn Quebec matten. Thc mnolnmunen: follows 1h: signingofsoflselasadisflibutflrinlawfiivfllny. BedfmdunsocxmvmgorvuamviwinmFOWORID o! im neu: Maximal: accouaüng sofmrarc Shnply Accxxmriug. INFOWORLD‘: min-a: callad Ehe pachge “simply maguifioeat" und a g u t u m : 535mm for Marines]: ususfflxptahlicninngnesinqfiyAcommfirga rafingoUBuva-flscnrmgixexeaflaxindowmematim. ein-ohne an!um-of-laxming.

——

“Reporvs” for Hypercard Buggle?

MOUNTAThVIE-IW. Ca. (NB) HypcrCßt applicarions dcvclupa lndccmsuhmx Dm Shnfer was reemfly sbodwd l0 5nd. bis Madrlbah toll wulßed ovamdcfiewhenaocrlain vrhilc nun-fing Activisioxfs usw HypcrCzd umhcaäun REPORTSF. Shafe: EH FEWSBTIES v-‘hvmhznuuparepottinscnchnndcnfi sclectpdlstnctwimalcxrfiddinanycafldhis systemuvddcmh. Hesuysheinfoxmcdflxc

poopIeatAn-üvinmofufishagwrthnydacidtdw shipmeplodoctmxgrwvay.

Shafcrnyssomeßüfioopicsoftfisbuggyvusionhzvepmandleduoorufinfiivfisionafigu:

Microsoft Claims Lawsuit Hurts

When fhe soft becomes too hard

Swifch f0 MULTILOG Build Ihe mooi odvancod appncafions..... n 45 files per Database o UnIimifed links/Indexes o Screen/Grophics Manager o EvenT-Driven 4Ih Generation Language

o

CompiIer

o

ConsoIe/Prhter Driver

Interocfive Query

Configurafion ufilities Aufomcfic Documenfaflon ...Or buy Ihom reqdy Io run for S64 o! your dealor... ...And communicoie wlrh any existing standard: o dBcse III Interface o Lotus. Cobol. ASCII o

o

o

NOVELL/NETBIOS LANs

OS/2 or UNIX Upgrade " Vwndow Generofion ' Videotex und Telefax? ....v-.ar-

4.-.-‚.„.1

_

13***

. '

-

o

-"

,-. 2h .'r‘r':_r-hä5m

But tpokenranm Melinda Mangelluzmdocsoonfnndzgefisaxoeofflxisaxdoflxa Ing und ad}: rhcy hxv: becn mnecud. Nur

mdpeopIes-hohavepmchnsodkepcu! ndhave

smtinchmngisuaüoncadufllroufivcnfxcc replacuncnndiskinthemafl. Activisionhnnlso madcizshxg-pudn nailableonGmic. Campus» etveblacacgladirsownbtxflefinboafisystem.

New Hypermrd Version Coming

Ca. (N3) Apple Compua h pIanningnncn-gammmflypezczdrelascfi: Micxoson hab: dcnics Amis‘: chargs du Angmxotthis yea‘. n a c h ;soBin Adcinson. Winbw: 2.03 viohtcs Apple‘: 00mm}!!! G! ü: Hypercrddwnbpa. Allinsmmporldlyfly! Nisunl kaufte. ‘Visual disfinys. including finhnodncfimofl-lypuczdlüisbfilnslatcd imllminwhichApplehaschilnadwpy- forxhc-Bosunflncworldfixp. Whntwiflbcin 11'311!pzocactionuemtofiginal m Apph: am! Ihn: fixencwvufion? All Ifreloldisdaalixwfll m not copywizhublc." szyz {h6 compkirxx. includemmyfiaxxinulyawzimdenhatxcunaw.’ ' hthemaminxqvcrxionllaffly-pufirdwfllbe Mac Word Wars SAN FRANCISCO (NBJ-Thmcpaar: in Lhe onxinMay. ThisvcrsiaxvillagpottCD-ROM andiuimodznincohcidaw-fimthcrdnxcf wmdpuoccssmgumamnnviminfiuufisurs Awle'sCDROMdtiVc-.Il:ll.nü@SC towaxd m:Machland: wund {massig naht. WordPafecL m sonne: Ihm i: nunmal Ihn CanadianMaclanguageisGmphic WardPcxfoa for u»: M: was shipgzingfhnd m HAuI-‘Ax (NB)— Pnßuphzslprvfluxnm man lfllbpogranrsdxlclomnnaoul bugs. The languagetlulcu youwrizeMxänmsh pmpun: problcms remlrnd fioxu a “bai matte?‘ noccrdhig bydrawhxz picuzu while numhing thapoivuof

CERRUYJRCA (I\'B)—AcoxIsvmumofn: Fr Eurem Computer manufaduxm dann; human in Ihc U.S. Im: a Macmmsh-commtible culnpula in Ihr: whgx. NEWSBYTES has Ieamai. und i5 awuiting acum by Lhg U.S. patent offiee (und putsumably Apple nusmacys) bcfort ruching Ihe U.S. and intemafionnlmnrkct. "Da: promrype was

recemy shom inWest Germmy waselccl Eew n thc Hannover Fair trade show. UCM. Incozpomgd‘; spoknsmm Normen Dai 10H NEMISBYTES Ihn bis fixm i5 applyixu for | patent un IJu: hhcinlosh-compzxflale BIOS right now. Thc BIOS. hc sxys. wu designad by an Australim wflwlic firm In: h: declinod l0 name Ihe compnny. "I11cy'vc xigncd n coopgntive conmc: wich m. Wcwill beIheofishotc manch:m21: of meh- product." he uid.

Good Reviews for Redford

VANCOUVER (N3) Redford Schwan Ins dgnadunmamjxxdisuibumfamlmof

s-nibCoxrxpuzn PnpeMIy 198B

ActivisimwaMnotcafimnoNEWSBYTES.

kamen.

Mac Clones Waii in Tawain

FRADEL INFORMATION SYSTEMS INC. excILIsIve USA and BmIsh Columbia dIsIrIuJTor 505-1281 West Georglo Street Vancouver. B.C.. Conodo vbE 3J7 Cartoon: (604) 681-8100 U S A : 1

losscsfiona thesuil. N0dolhxamounlofdanxagas

orlouu wuestued bmMicrosofI.accuses Apple ofslmde:ofiutiflenoWmdows 2.03 und ixuzrfucnoc wixh relarionship wilh in cm-

1o a WordPufu: spokesmm.

PC/DOS - MS/DOS

Microsoft seeksunspecifieddxmagesuaresulzof

Then flnxc‘: Ihc Macinmsh ward proccssor coming fxonxlwiaofiu, code-mmed Challmga. "I'm: pmductisbeinzbctntcstedmw inhopesofa promisodlunerelcasc. Thwardptncassorreporxcdly Im sevunl Imiqtx Kanus, m: m:Least ofwmchnmabihrybbixfiwnwnmw. And fmnfly. Punsch-Taxis FuIIWxiIc i: lahm; im limc in (h:finn‘: hbs.....dxere's the mull man: of numcrous bug: m: are cnusing lange: man expected dclays. AST RESEARCH. lrdine. C8... will dalay shipnmlofiu Macsö PC cnprocessing board for the Macintosh SEmül du: um qumzr of this year. The reason f0: fihcdchy "uumA51‘ cominucz In make funkt: impmvcmcnu L0 m: bqrd. accnrding t0 David Tmup. AST product mukcwr.

...And be compafible with everything o o o o

'

REDMOND. Wa. (N3) —Mitzooofthuganzen 'lhcofiaxsivengnirwstA;pleCounpxxlcrbennsc,i sayaofmmmfing lnsensdixncfiy anxihnuublc n thelawsuilAnigfiledagairlstit. flüsinformationeomes inncomplainx Microsoftfiledix: U.S. Diario: Court. San Josc (4/7) which states zhaz

Ixovnrmnins Imsmscs. aoeordiflß w PhillipConapmncxixxthcootl-tpmydutdevcl-

powlar

opcdil. Gumkarasm SystunsLdwiIlbrim

ProGnphmmnrkelinlalcImzcwIuly—possibly mdermothumnnesincelhezunproblqmwixh rcgislaing (h:ProGrayrhnanxehdzeUß. Tobe seid fwabou 5150 U.S.. Ihe änixialversiou will conuin n cdiu- und an intapruu. A seaund vasion. addin; ncompün. isplnmedfonm m1, Co: said. CONTACI’: GUNAKARA SUN SYSTEMS LTD.. Suite 19. H27 Blrringlon SL Halifu.N.S. 83H 2P8. 0013435642

Run Mac Disks on PC PORTLAJND, (hegen (NR)

—‘wen: a chcap way

m um M u m m } : da11 disks an .1 DOS machkze?

Central Pbuu Software bar. juti zzumtmced 31m: Opium Bund." a half-saß czd. am: unWan:which mahlt: {PS/IBinde; 2.5 m30.an K.‘ o1- AT aanpalible I0 tun xMlcixaosh dauduk In in: own 720K 3.5‘ disk drive. Thc 51x11mm! bus vaiwn I: zmppmg mit‘: a micro chnnnel vcrsiun is capccwdm AugusLTheprleeofthe boardis

S159.

p:-<«.<;=.-.:37JI

..

. ..

_

_. :.‚.-„-, _._‚_

Computerland Chief vs. Wordstar

SAN RAFAEL. C: (NB)—AIotofpeopleua wonüerin; "II Comwlcrlmd fmmda- William

Mifladandhilnßomcyxhzvcgoneofimadecp

end an mehr Saum Pavific islmd rclrnl. Mnuzd

h1! um his uwmey Tetry Gilt: padung for scvcnlplrtiu innrdutwßamcracordmtjflu." 1110s: sucd mclude MicmPm lmanainnnl. u weil u an ecly invcxw: u: Compuwlun Gnu pledgu 1o spand du: au: die: o: {nur ycm

‘rasch-in man uns.“


4

1

-

2 x

:

4

1 7

{

;

x

; }

Atdlhetiggastissneiswhdixhüuohoswlewolfisu.flz woddämost-usaduompucusingpankngghunuflhfiänvwddmmmnIpmylnBIiMmnfmmhrgCupu|fiuLMmndbo—

IievesfimumupuwäfiuundaSeymourRuhantfimuMfionnn

'"

l""""""""""""""" FREE SUBSCRIPTION T0 THE COMPUTER PAPER

Mieroh-opopmnnarlolmßmilmdfldixflwdusedmmmofm

ulyImsaipodnctcnIladNEDinMdßimfiorWordSu-mflin pdecusorWord-Mßflu’. MunwhihMümProc-llhthzdnrg:

“lfiuflcfafilfBxmlfiveLamVfifliinssflshsä‘nan-

oemed uhom umu ahnt I n . bahnt; häufig In: Goldcn Gute hüdgc.” CHRDNOS SOFTWARE. San Fnnciaeo. Ca. hu innudazcad Whofwhnlwhmsuftwucforprojactundfincmnagommforu IBMPC. SchodzaledmshiphApn-lflnilfißsofivmi: chipcdfctflnhsymmxggyrbnefishflpmphgnckui

”mää*rääu°ää"äifigfi

Just filinthisquestionaiuardaanda

Here is where The Computer Paper Is dlstributed and a few of tue companies which reeeive the papet each month.

ljwlicharfldsdldyuruflrnndhuwdo rnhllmnl-IO. ofAl-ticlcüoisguottlisbulfllahg

inouwowlmaiampydflnpqaub

youmdyouwomruvltotrisxmissw.

peoplcmdptvjeas.

8-in-l Software: SUS 59.95

Garni-xi

a n ”

CAMBRIDGEMus. (NR)-——5phm|ka-sofiwarcCoxp. hasanew. hmgnmdpogunforPCsuflqMCaflodBcuerWorfing

nunmal‘

f‘

‚O1-

Eight-iua-Onqixoffusmouflmanwordpoocsorwithspcflmg checkingarprudshcuadarabasflmflmmficafiamgrlphicsnnd adnskrop orgmizcnCoznmands amccnsixtmr. acmss applicafions.

'

Sjlh l

\< u-wm-a-Jxw...

MICH-pi

Thcpmgrmisgcflhuggoodreviewsmdthepficcisrijhtfifläfi.

ltnkesßöKofkAmwrodfivesagnplüacnümdnmodemto gumsmosloutcfit. cüNfACTzspvhmuhuSofiwaroCamüu Kundin Squuc. Cambfifige MA 02139.

M nun?‘ rlnbtupfiepapu-dur Uyu Ü2)no

tun-Im: nun-u

qWhth

pofinnhlhecommfl D a ) ? “ du O3 SeniuMmagar Clnuuidagmugu

Ü 1 g Baumann:

h 3 ! .‚

New Version of Wordsmr Due

S a n y o : 00Min ÜDF-uule

A FEW COIWANIES AND LOCATIONS WHICH REGENE

SANRAFAEL Ca. (Nm-Lookfor nnewvezsionofworflsurh MwfromMimoPnv hucrnationfl. Thi: Version. Wotdsw Profesxional releaseiwillhzvfiooncwfounxesmdoonfmmwlßws Syatan Amlicaxim M a h n u n g : Amorng Ihn improvunmn m:

Gbwhlbestdescrflsesyuroflla? Dßnmh Üfllncal ÜSJHnd

THE COMPUTER PAPEFI EVEFIY °N>lonTod1nlay

man-A fi d Gnom 011b

simulnnmnsmnlgiplc-pagcviewhggzzppanofmmefmß. und:

vatiuy ofmilifiqmdxxfixßatextreflüvflpoglmufibwkpomfl {cm3 pries i5 extehcounnnnicamm funcfltms. TIM

fähig}!!!

pocwdbbeflte samsuthecmmutdusc4.—5495. Low-eost uppndcs t0 thismw version will b: lvailable to current ownu:cf WoudSuIt pmfessional schwarz.

-

man

nnoyonhflnmceyonrenmpanrsdcd» ahnt: orreaüngany dito .Clnt:kdl flntqply: Dlnmamigsuvnß’ O n b u h q x ä

mann-

' uns‘

1

Puma ramm-

nnrqnnfh

-

nunmn

Üäanpurunmiig Ddljoqmahanfiuue Dflouapunscfiwm: Dfifindfimecpipncn ' Dmcanpanianay Dfluhcanneqfpnfltülmmlnncqxmpfin‘

Dmnoaonbeabm Omaha L

in LotusLand

V2

awucayqhuduna-msthcuuuy yuunrth.

Mm.a*IB)—lnmDevebpmmCoup.isfadng asecxzilicslndfixcbxxgecarunfitfioninvesfigafimmdnnnsc

Onwholcsalemde O

diveixtthepaiceofimxtoclnflutmnoilfoflowsflnnwhfimthal

laomswmrtgczkzlencSOEI-Zßhbumxhmdamfilflwuflof Ihflycmthzrcfianlüonofaheylßußuecufivnifiheflysfles ofummcxbyoumpcnyimfidaxmfluflingflnimnnlnhflaxfi.

(‘lhoooarepsttluo

E

gaac‘;

amnmnedctlayofßehmilßflßdflfieslfinlhcmbfi myflfiqbcbwiihficdfltyurgfliuthnflndefisfinwbflh newsofiwarcofldaezmhatwsmnflszfiunhcamufivasoflmcä smchfliesflookwmbledmoretbanlopaeaxfoflowhgm

O l) 16 D 4) 26-50

O2 D 6) ML250 O 51-100 D7)25l-5m D8)SOLIGX) O9) l ! ! ! ) | um sizae by tolal lfl) Wim I:

unmmcemcm.

EIl) Und:SIWJIIO O 95250-5119!!!

Ingaflzproymduvn-mkdnfifidmflysoünflwuflbfleiß ianllud hat: bchind. In Hannemann. immun-y umhin: upea BedmdEQnIIoQdMiat-usnft’: Exahneatla-fflmdzmfil nuzw vasiou i: avdhhlaxMmzipufuau Iobc"oomfmahls"wim

OSSI-Smiflion Dflolha

lnHowddu-eyou?

cmentsüesofl-Z-S. PCSIG. SmmyvIhCLhaspublishodflJpufi Ruminginlfi

WERE ALL COMPUTER PEOPLE HERE!

MiamafnguiflotousingsoldumazpopuhuhnwuempmPCl-‘nlohPCCdoo-‚Eonflrnxwfiazhocomm GalnxywordproomouzAmmanauxiPbwummn. ‘nuhookdn oflmdiscunmnofupmssomnhuewun. S1195mmPCSlG.

cm4os-73o-9291.

-

_.„

De" Announces ts PSIZ Clones AUSTDI. TX (NB)

beat Tandy t9 the pumhbyafnwdays withinPsfiMcadclöüandßfleoznpatible -——

De]! Computer quidly

mmmdomdazxmdfot'PsflclowlwlthlhnMicruChlndhn tigmnomChainnnnhfichndDeflwßqnomdunybg.

0

Chipn+TeclmologiesmakesmclonachipactmodmthenewDall linc. Plncnix Technologien malte; Ihn BIOS. Wahn: Digital und Miaoaoft abo adotsed the nur mithin: u buinu n legitim:

0

clmgmueopy. VIhfleDellwasmfumnzmamnsPSReompatibhitvmnm bcthefustnoship. Tandy‘: loshipits PS1’! elomsfim. CONTAC1’: John Ehen. DEM... (51153384400

MOUNTAlNVlEW.Ca.(NB)—IBMhuvirmaflygurmend „Cf

IÜWIIB

x

Hawlcnhckudovalluviflllwolx Ihmknondnflitlmjlm

struck wilh Mc-Iaphor Compum- Synuml. Mctnphox. stmadhym forme: Xarox ancutiva aodiud wilh inventixxg Ihl symboßc inlarfnudmlnnappoandcnwpleßhhcfiufishhubonmnfiu

L

j:

o

s

e

D33544

0255-64 ü6)uvex65 l fl fl bu Ioftütfliü?

0gSonaeloomplendpxm-seonnflxy

Ü

Dßmfiveßitydegxu fillnvthntarudnyonlu? PostIICoIde: l 4 ) Wink h pur hnxbold hemmt? 0 l) C h ’530.!!!) E12) 90.000.39.999

,

u 3) 90.000.49.999

__—

D 5) 56031069999

a 4) 55030059999

u 6) 0m

870.000

lflwheredldyuuplctupyoureopyoflhc

nur?

l fl W ä w o ü y l i l fl i m n c m o n d h nennt? l 7 ) T)? o! Cuipuhr «I Opa-nun; 5mm: Wort:

H a n g

CALL TODAY FOR MORE INFORMATION

Tinlc: Bus-ihn: Addrul:

VANCOUVER SOFTWARE CENTER

P u l l i C06: Mail T0: The- Conpulu’ Paper

Floor.119O Melvme su-eec Am Vanoouver. B.C.‚ V6E 3W1

Ä

mmuwnauuouawmeofntpplfisdugflmwuaoftmd

noltwccünmeaavafionolfinaflghflxcoxflh‘)

06045-54

Training Room Rental Packaged Offioe Space

v

IBM Buys Insurance

2) Slm-ZSODN U4)SSm-LGILOOO Objifimiflian Ü

Ü l l u fl k ß ü fl ß fi

Desktop Publislting, Accounting, Database Courses

mnchims. the Sysam-im mdSyIIcInSwfifltyquialflcampmy oflicinlshadrrxfigwtdapinnndqpumflyhadftflgmdmM‘: lagalorthmcialmhubtowctdilsmndfirmWndoftnpoua

omfimedumushmopuufinmiflawifllwhflowsnflhmgm

Rituals?“

nnnnnl

üoworkinbosJfllütingOöllManzisaidLomisnowwmtixu

n.

8

«nun;

ThaproblernurimRclauelaucwdingmMmzListhnltixmolngc

m;

oonstrucfion

IiyouwomdIkotomowmqqulHß-Sß)

onwhyManzLSdarVinehvuiahIMiclnslKohwkLMD clddEdwndBdavgnxlPalnmTruafieepruidmtormmfiwurhgtmloudedlnxeblochofoompmymcknmmxhbefiotcth

u...

Datensatz-u

ÜTJSdu-bdfinflvpcüflüfiu

Telephone: 669-9800

Telephone 669-9800 . n . . . — — . . . — o . . . . _

_.__

. - _

— — >

I

3205 W. I 13th Ave. Vmcouver. 31.‘. VGK 2V6

I k

‘Ibcanwficflffl?!


inu-facaandsellsitwiflxwuwksmionsmdxe paekagegoodsinxiuslryJBMhupuIchuedHHä ofhdeuplnr, a: a aus: ofSlO Inillim. and will johfly dcvelop softwarc Wifll Magnet-forme in

{We

mhüfflülinnmfirnglmceitlmhnsiffln

cowlnflfnrmnrummlilmaybedifficultfor

Vancouvefs best choice for busmess Computers. Software and accessories

half the salns tax

J

AT COMPATIBLES- with enhanced keyboards. DOS. 1.2 Mb floppy. serial and parallel, monochrome dlsplay: LASER 286 640K. 40MbI40ms‚ fuII size ............ S2934 SAMSUNG S500 512K. 20Mb/32ms‚ 8 Slots...... 82634 TELECAT 1Mb RAM. 40MbI40ms. hi-res........... 83495

-

|_

„_„_.

E213

--

mm

E‘! _|

4477W

COMPUTER IIARDWARZ

I

Specialistsin

8c

sales and constllling

r

l

1

i G.I 143er’:Edge m 750 West Puder Street, Suite 804,

VancouuerRC

V6C 2TB

Phone 662 3774

WTMCOmwtaFnpRMqIMS

„ '

.

APOLLO RISING Apollo Compuur Inc. of Chelmsforcl. Man. lud solid first qmm: umingl OfSIOA mühen (Eomnpushtrc). H15: quilcxoflntymuweuningsofßAnfilfion (lsoumpcralzlxc). Apolloäalesfotlhequflu

mse l0 8168.9 million. vasus 8123.4 nimm im Iheptioryearkfirstquana. Apollouysalaof its Series 10000 supexeompulu. Which

ünotvping IaserPrinting

Hardware Software

1mm.

äßfinlfäut-Jnflts-

Desktop Publishers.

IBM“ supported

Unanxtahtßnmdmuhtfmddtntfihcanpau’: nrajrmgahammgsuilfBMüfiäofconrsc. flngitisfunycbrhndhthecxsmmaryhhnflmn21.‘ ‘This is n0! whahar you're tnyhg Shell o: TuumorwhulmyoxrvzgotMFPormxhme toolüpulcfny: Big Blue‘: PC-meinu Wflfim

f

high resolufion output for

Macintosh" and

ils frontpnge andcencludeddaaxthcmswetmzy bcnlolofbhlcanokcmdmirmxlmcnlfingifone ofmhfsmostnadnols’mnknfingganxbitseva." reponer Michael Mine: mm: umumMiete ChfinnelisflBMämystm/mgrodx’'ml.“l’xlshxt sayp MiJJer. the Micro Ganze] i: Big Blut‘: aqnivalmt of the MFP inside Colgale tooflapaste orm“Ch1orinol"inComacleanser.It'sasnnI:h duigned In diffcrcafim lt:1106m:{ m m 0mm:

eyafiaElecxroni Mail

ALLENTOWN Pa. (NIB)—TbcEoclxuzic Nutwodcirlg Asaociation will hosl a oomferenm in PhilxhlplfiaMzylz-ldaimedaflxeonmfludu

ofcanpm-«otimmdeamnmfinfiaxsflopiswin imludc kann axh u ‘global bounmy buhing." “nßtwating fix social chmgefüxildhg aflin: oounmuxilics." ‘clecuvnic dculocrty." ‘online htuactivepublislülgfandthclitnENAestxblishad in 1985. explores oosnputq ocuunnnilmfions and puticnhdy oouxputer eonfexeming. Registration i: S275 for ENA manhus. S300 for nun-nahen. CONTACT: Nan Hanalme. Exowtivc Tadmnlogis Inc... 2744 Allenmwn PA

18104. 215321-777?

Crosstalk Issues NewRemote

ROSWELLGAMBjQ-Xlfsübssnlkcfivisich. Iszxpeczdhardauedllunotczamw vuxionofilsoldlicnntepuugmnmedloopuae nPCremotdyuThcideaisaoluyonuseyour

hlheavwdodconstmwxxnnkcluitkloaneunpliälatechliclllashhflhquouüfiivxflßflan offiogPcfiuuhomgorra-‚cletfinguywbo‘: albßlnsnevebpmmlthnlhchfiaoünnnlis‘: lxmdlingyouofieäsooumtuxnfiwucgclhw nfnrupdmoraoletyomsalsmmnpdamethci: lotofFUDfwhichislfizbwchuIkforTar. ownracardsfimnfllsmadimduvasitxlsoflbis

“WARE,405530km?

“4/

YORK(NB)——-Iustwhntisfiae“Micw.-o

stimmt JOURNAL has posad the: quesfion on

2273 Kingsway (a! Nanaimo) Vanoouver 8.0. VSN 2T6 OutoiTowm1-8no-a63-4oa8 Locnl: 430-1256

Your Desktop Pubiishiug Centre

voullyomofzl-nwoodsClear?

Channel Architeaxxre‘ anyhow? Thc WALL

Owntltlos

IN CANADÄ FÜR

mffiäofhisclmemeauqagldsfillwouldmtbe

NEW

MICRO softwar ComputersCENTEE

Ä

nyxodxxcfspricafmmamaximwnoffläJiulafl PSfl pmcms n: xvaihbl: for ljnmse. Howevca‘ (flfll-hi5i51h0B5CkYPm).w'PYfi8hß.dliPm8ks. lmflemarlüandexlctiordcsigxuucmtlvlihbk forlicansefitxanyßflclonemahemtoavcfidm Ißltllzgalchallwgmwuldbepayhsßigßlucup

IBM: 1s the Emperor Clothed?

7017:5541?;d—ßT1F%—adTfHTon—eIl—cl-l;oEITt;1I;r;e—u;

Ridmmd.

IBM Clarifies PS/Z Fees C5551!!!) ayemearlict. Revmuns wen: 051.8 IBMclarified n:„ u m a umin a relaase April millionupfimnßfiflfio. Guninimakcrssmi8. An IBM fikumm mld NEWSBYTES Ihn: cumdncaorcluäys. IBMisraismg imm u i m u m license fees In 5%of

FFcrEseE EnEuErErEEaTaE E? cTuEoTay-a E.?x"sIGEÄZ ElTam-gl | im: on any other items bought a:the same lime, provldod you pay by msh or conifhd | mmpany dnqua, pay only. L._______________________ _ _

GEW/UNI ‘TECHNOLOGIE

ING. Awlempruveownflmipoffllewirldoflsarld B.C..rcpmwdpufir.ofCS88.000i:-lxhcquzu:r @ o fi uMacinmsh inlzfma. uxiod Lind: 31. cunpned vrilh a l o s of

MAY TAX BREAK

omer speclafly lfllfiffld clearance mm3.

s47nlfllimmrcvunlaofs439farlhcfinl 01d reoords. lhc quaztez M1988 dann. oompmxy unnmcodAp-HZI. LOVE THAT LOTUS Loms Devalopnzenx

the Selection. .

wo

FATTER: COLIPAQ. NCR. EDS.CRAYHOUS'I'ON(N‘B)—Con1paqcm-ned

clcalisixucspmucloAmläslxw-mithxuffidfls fiqnlbofilfixmscllim ifsnot-Muaphornad IBM hxvl: bcu: lxlkixxg Ihm:I. man effortsinca 19€}.thcptess was hold. IBM’: pmial buy-omof Cmnmlleduparenardfcrfirflqlflrflrlvmmof Mäaphcot has yompwd { Wo ü; qucsfions in Slflßmiflhnwmparedmßflßlniflionfcxlb: everyone‘; mind. How will lhis allixux cHccl. filslquuncxaflntyeal-‚Enningswuzslü hljbmsonwhichhsbeexxdmonlydsignerof miflionflüäpcnfimflverxmfwßflmiflbnh lBIaPs grsphic inmfaoe (humanen Managen elmingsßlomßpushmflßrlhc 1987515: forü-‘iflmacrlinetnandhowwfllitafiectApplds quarneanwhnfnekdaccxmfimfinggrowflxoflomit? Ami: is m: uking IBM nur Metapher In n15? Goodold 1-2-3. says the wmpmy.

Have

choque. For Visa. Mastercard or

TEE FAT GUT

hadSlümillioninixfifialordaxwinmnkenbig am-mhufion m im sacom quaxur sales. INTELOORPORATIONsaysitseaminphsped 262% inils lastquanet. huofibydetnandfiwirs 80386 Chips. This lowering figure 1ms lud some mllysrx to suggut lhis wfll be I rncord-brukirlg y e l t fm- Intel.

Yes!

MICROSOFT. Redmond. Wm. has shipped the laut: update of 05/2 Sohn-m Davalopnmu Kit. I: mtanly conmins a prarelease version 0105/2 version 1.1‚ bm develapmmt mols for 05HPrescmltion Manage: lpplicaxioru. umsYs SIZZLES llnisysCorpmfBlneßen.

_

Canada

Portable Computer 3620-244 street Langleg. B.C. V311 4P6 Telephone: 1-800-668-1061 Vancouzaermea: 834-6441

Phon» er wrlte today b: Iren Inhalation m.

Pawrepornndfimqumwemfings wer: up35 pfltmt, m S1493 million (72 cants per sham). complrad In a m: of 3110.2 mfllinn (57 cmrspu ahne) {er lhe finl quulcr of 1987. Revamu was S237 billion. down im 32.42 bmam lutyca’. Which mcans du! Unisys wu Iblc to pmducc

progrnnvuurtqnimagoodsdvafisedae-

ponadlybacamecmssmnbouglnfighßmsaneomclscäpuymluficfimkhaveißaxkpoymnningmEkdhyJeEGm-burgntflahfiun

sanüflvpduflyllfixpachglapfioedarmh’ Swfhorälwifyuujuslnoudfincllmlprvfliß vüldnfilatick.

TeIetextBoardForaPC AsmlllMorgmflinCdifonliafimcaüedAfl orAmczicuTdaauhnmaü-inbotdfwnPC whichaliowsyounoteadmlemlhrmflcusßfivm cablmsamllimmbtondmtsignkcnyoupa30ml Äflmdoyoonhwouldcnewml ndnthiflwellstafionsfinouglnutmeaotmy mexpa-irlmfingwimhoadeußofuhßxtin which a n t u n find im: wcflher. smck qmm, ncwnevcnnficxqxarminflzvnficalhlmfilg

inlavlLwmnncdporfionoflhgh-nficnlbllficunuulyavnilablafllchgcstdwlfichmflw-

uaufiTeqnfiomSnpustxiouWFBS. The

onlyomerwaystoreccivefimetelcsmtmadcuuneviangecinlTV-wpdmodzrocwhha

nzwä-lifllbigiulsysmfllfxfisflwlfidlhasa buih-in dncodu. 11|: PC band man: lass Ihm

“Cflbulwmpmyofficuxlchnhflzmflkclfw suchnbomdiajlntiniuhafmcyfilhcmnjwhudk

isgectingbothmoxcTVslafiomuxdudvatismto mppoxtnaletextuxnsznissions. By the way. the mieten btoadclst is und: a: Sßfiflflbitspnsmxndorifilflacni Thelighmming fast speed aublns Ihn rrarlsmission o! hun-

dmclsofpngasofdnupersecond. Consaqlmmy illakuonly-xmomemmtävcapmficular “pugcfyousclccurinhyom-mnupumnhcsystcm mitflhnfiacfimoflmouaditukzsmmccivcil. then"gnbs"i1fvryou vicwixg. CONTACT: Bob

In}:ptofil marginal 5o: the petiod.

DEC D U L L s v n u ;—DigitalEquipmauCnIp. ofMaynard. Mannnmgnplacklunnrmxhfor its qumenmooxding uxetoISBOSJ millinn (52.13 a shnn) «aus 5307.6 mfllion €52.29 a ApolloCutsPrices Apollo Cum man) fiormccoalparabloperiodlmyannkcva- CHELMSPORD. Mass. (N5) punufnahsbnehdmorommaufixfioffün du: wu 82.82 van: 82.41 nach: qmm-u: billion. billbn nymearlia. Butdmeisuilvalifing in wie: for in Satin 4000 vorhanden. Theo mndlhaueApolltfsncc-bw-aulooaunas.

um

_ _ _ _ ‚


withawpadupikppbhladfinmshfls und80386

flmahilitymnmgraphics-ofimmdmwmnfion PCdmuJPIumn-ylevclpricaftnflnläpoflois 01MG Wrxbwx-likfluuhmfnccs. mw Säwflnvhilcthnpiceoffilecalxxvafimof ATSLT Promisfs Friendly Unix lhcsmtalfineeringwutsnfimflamnfllwfl. NEW YORK (NB) —Amaicm Telephone k Co. is Tclegraph mnoumcing a graphical invariant: m bunixxcss daigned m mit: Unix NEXT Rauch

ers

Computers

Develop-

was. AT&T officials Inkl NEWSBYTES rhey expect die mw imnfm: will spart m: long-

PALO M-TQCn. (NB)—SmIctcn;xomby'pe modeisoflhßNexfwiotknnfimhavcbumxlfippud awfiwdbooIninUnixforpmmnloompumxBm m dcvelnpux. anaoiding m insidc sources. und IhenewpzogrammayalsolcadlolcgaldiffinflflmifalixigimzsApplemkesmuaIluAT&Tuix ' mmaaremxhnway. Assunbledbyhmdalthe ' hasMiaosofimfil-lewleu-Packndflxncwünix firm‘: Frunom. C-I. heilig’. the wcnhnlimstenidbbcflmß-basedmitliunl frommdisajoimpodtmofATJ-‘rlandsm vcrsionofflifixurimapnpinmygaphkimu- Microsystamaooorrdisigwhidsuyofiidalzsm I m ; Rqmsmdinansmntmpoductsmhaded hasracemlyrolledoutaseriesoülfßsömadiiu urilhnSmyciigitalmdioclfipfmklmck-mllsmnfl; whichmxybamefirstplntfonnsforlhcncw. Unix. Thc ioon-based interface im’ Unix thcsucenmutinnsmfltmwifinfidobeSystuns' fi-iaidly alsnisexpactadtoworkwixhtlacunifiadUnixtlmt Display PostScript. Nohody is sayixig when von AT&T und Sun amexpeczad to tmveil in 1989.11 shouldcxpoclloscelhnwmitsufionofficially willbeupxomcmajormflwmapplicmions mmmnodbyNcfifliflawevn-xthebastgunssis thatwdflsucilummmcedwithinxhenenfew dcvelopu-ssudx as mm5. Microsoft. and Ashlmmonlhsintitncfmthcfallacadmficbnryhgsu- Tatntocrummftwarathuwfllnmonüix. although Ihac am 1 1 m m ‘ : ( h : Sun is aboul the 5cm. 51511 oft’ an outside softwue firm xha! will wxita Unix Box Due in April Fron:Zenith Unix applicanbns. AT&T says i1 im: ullczd m Doefmmzexxilhisuncwüfixmanhhienxppon- Loms and Ashmn-Tane about Ihn-i: pIojccL ing up to 64 mnninals flxough mnlfipl: 80386 ' someonehassemthcncw Lotus Developing Unix 1-2-3 pmossnm A1211‘ mnapmzr ad whexe Lhe sancümonimis NEW YORK (NB)— [unsDevelogmmt Coxp. ATEPadvocamalahmyoucanhangäta-minnls i5 wvrking an a Unix-based Version of ins 1-2-3 oifmneaTäzT PC.) Irfitinllyflienewzexfithbox speadshccx. which will nm with the nsew ATäT willnmxmix. hmMia-nsoft hasmummcedifls gzaphic interfacc. callcd Oper: 100k. ATäT said IncxgingXuxixwiIhATitTkUnixSysmnVsoiI Open Look. qcatod by Sun Microsystmis md wiIlnm“slnndard"UniJL.'Th:machin:willgoinm based anXerox?» work a1 rhe Pnlo Aho Rcscaxch meoldZ-Mliboxaxflwiflmzuliflfscnuyhia Cents, will beout by Ihr: Ihirdquaner ofthis ycax. bignewoonmctnowbeingbidbyflwAüFmw Lomsmnomoednomnemble for ils Unix vexsion 1ndNavy. wcordhig mWaynsRash of"Microby- cf 1-2-3. “Lohn h8: 5061 dcvelopirag for some u: Daily.“ Zanith wonld eanfirm nzitlaa’ hat. IiInenUniJL vasionoflhe best-selling sofmrare, ‘ICONTACI‘: Glcn Nelsm. ZENITPL 312-699- 2-3." 10m: chicf Jim Maxzi mld rcponnrs a! AT&T's miveilinx of Opa: Lack. Offidals frcm 4800) Sun’s New 386 is No Ordinary PC Ashron-Tare Corp. wen: also a1 Ihr: cvmt. ATatTsaiditcxpects tooffuOpenlookthis MOLTIWFANVIEW‚CL(NB)—Wa1uUnixuId summa’ a: a windnw manage for im 6386 WorkDOSaIhCamcIiIne? Noproblun. SunMiImachinebasedonthelnml 80386d1ip. swiun. cxosysanmhasjmthhodndiufimüüxmd buedmhlcl‘: ATacTsaysuser inmfaocnoolkiu neplamedtn so386nucroploeanor‘flheßfiisents.’ranging"in buvaflablninsouzcecodeeaxlynaxtyeuxxopa: Lack’; graphiccomvenfions inchdepushpinsno pricefrmnsßpoflloildaflofljsyumfliucmot m]:man: in thc seinen for manrchenoe und Smisofferhzgnohnsinessesmhnethunixxmfixe m des-nur du: man: or down in man. The up Unix mnku. Th: nur: also signals a sudden innerfane i: immune-band mdlas man poim am! boldnessmthepunofsmmia-osymnsmraha dick kann: dm resemblc man an honmhold unBigBluiudfwhnsePSnliIeishasedmmd appiimwcs. Thc inluuling pm of Ihis mit i: thnt I n t d ' s ATckTbypusscdAppk uxlwentdirecflytothc IBM Givs Details on AIX originaler oftheioonmdwindow-baiedopua‚ W E S T ( N B ) — I B M ins ‘Wim.Xemnpethaps inanmmnpttokccp annoumed 1 mit: cf nur podnczs u n s ; in: im nimm-a from ligitation-lznppy Apple. Still enlire poduct rang: giving full stimmt to die thereisfl-seqnestionmriIlApplesue? ADLUNDK-liknopuntingsystumhodiwurmgc Unisys Keeps Growing. Adds Unix fimnfluAHßflJaofinADCfiorIhePSß. (N8)' Whcn Michael Bhmealhal. IBMmrmmmdthsADCßTOis IbeUNDI-likc DETROII‘ Ihe cigar chainnm of Unisys, was opultingsysunfnrflnsysmlfifllaxidsysmn man Jimmy Cum. h: um Traum-y Secreury Swflsfflzqnflingsyxlemwfllalsofmmfionon romdly villified forhis ofrhc eoonomy. lhcßmsyxbfllflfhnmodnlsmppoxfldfltfran And when, u chzirmmhmdling of Bin-roughs Ccrp.. h: uacßmmdelzonhmghunsooosotmmsom Innountaed Kb: aus:will: Spury whirh would daccueofücPSüsyxtmmtheAIXwillbe creameUnisys Coip..folk.ilaixghed:ndsaidhcwas snppolmil an flw P319 mndcl 80, u" my modzls headed f0: mmhur (all. thntusaflnsmlfipooessotchipufilhcfl/PC. Who's lwghingnow? Weil.Blummlhal i; nllthc

-—

‘Ibmxlxoparatingsystunwhichwillbcuquivnlenttorhe UNIXVralensePawillalsoszzpport IBM‘s SAA, Ihr.Synnms Applimrimxs Archimenn-c, which amnngxtofllu‘ mings. proposas n uni-

fioduscrimflficafnrmhwwsrmfllfilgmnfilxln

nddilimlBMllxoummmpcdmeAflfiflbe fullycompanHewithPOSDLdicUNDhmdnd poposed byIEEE ntadfivarodby Ihr: Emopcm Commmiryasflwoperuizigsysmn ofthc fuunc.

Allofthascpnnaxmwillbenblewbcwmwcmd woughmoEdmmLoalArenNetwork which follows Ihr. IEEE 802 standand. This n i m m {hat

thcAflfßflhlheADUPQmdmeAlxfflTwiflbe ab]: In exdunga infomxafion easily und eflec-

LivclyAmßmnIiflflsobeahletonmtmdnrme

VMISP. VMlSPHPOm-id VMIXA S ) ’ opmfing supuvümwgellnwimomuapermfiigsyfluns. SincethePSIZcmomxnccLoIlncrPCxmiLudocs lhcRTiPilfltismeaiulhalIßMhu mmmicod: oompletely Mangan: opczning cnvimmnn fort all o! ins sysusms («von the Systemßfifä i:

supposadtogotfifliiixflnnoufutwvfiffbckl‘!

waytodiebaxml-letoldamecüngisiTokyom April 11rhatUnisyseanfingsfiottluequmtcrcxidingMarch 31 w-illbenlusflücmtspershmaflnd mvcnuegowth shouldaoelaratninrlnsecond half of all: yelr. Blumenflul spalte n! Ihn oponing ofNihon Unix)’: LuL.which fmlly min-geil Ernm the shalls of furmu’ Bimouh: Im! Univu: subsidiaries April l. uflcrprowctndncgofinfiuns. Thc new oompmyhasrevennesofSll billimmd 8.000 unployoes. making itthefifdz-lxgesumnputzt outfir in Japan. M u m m } ; Unisys armmmcad i: would buy Convergmfs Inncl-tnsad Unix producl 1in0; giVing Camergml a hoost. und endorsed AT&T's “Opcnlnokfixscrinlflfxe forUrfinLThose moves. cunbixlcd wilh olhcr Unisy: mnvu in Ihr. Unix ms. indicalc Ihc comptny will evmnully standaniize m AT&T's Unix Systan V u thc opaning systems of its old Spetry andßurmuglu mninfrmes menge.

Dldyou knowthatwe a l s o g whalwesorvicfl...

_IHEGUYS WHOKNOWmEDlFt-‘REJVCE.

MIYFROM

“The Opercflve Solufion”

(A division of Modified PC Computer Chic Ltd.) Suite 320 1675W. 8th Ave. Vancouver, BC. V6J 1V2

Scles: (604) 732-6527 Service: (604) 732-4415

iamvensenimoizpufe" ENJOY THE BENIFITS WITHOUT THE RISK Business Picmres & Words Ü

„mmmzmm.

A: Business Picxures 8. Word: wo hava the perlect solution. a unlquo oozrabination ‘deslcbp pubishhg‘ and Cobur. OurMacSEsandMac IIprovidotho ammrk, und au Gaston Laser Golou’ Oopior finishns tho jub wilh colour. Or. btingusymrfbppydislßmacorlfis0%).bladc and whito o: cobur orldnals and we'll takn il 1mm lharo. Finally a way t0 add oolour 1o your postors. handouts. and ovorEndung: dal3.

To an for yourscl! call Bruee Wrlght or Mnvis Pmctcr a! 683-5468 and we'll visll you. You can visit us at 552 Beatty. Vancouvar er (h:nur home of our Cobur GopiIf. Bchmon Graphit: Supplias, 1ms Richards. vanoouver.

Q y v

DAILY

gnrgfigity OR EI

LONGER

ABILITY COMPUTER RENTALS

681-7032 SIaSOI-nsolldviest, VarnouvenBILVEESWI (Adviumdsuhccmfinoupln)

PCcanalnohzvemalghtponldapmlhltst-Iabe

comwcmdloeighlPCswlcnnixtlls ablcwucw:

thzflwfiminavimnlcimuit. In Maiden. IBM nko said umihn X-Windows pnphicsopcxingawhormmz willalaobchn-

lhCompunPnpnrMuylflTll


ATComputer Buyefs Guid@

Thefollawingmiclsixm aurptfiovnanew bootb} Edwinkuxh callsd IBM AT Clone Bayer’: Guide mit Handbuch ‘I1 i: pubIis-hsd b; ModularIqformafionSystem; 431MhburySmd San Franrirco, CA94H? (41355230706 IMSEQEdWÜIRHJQILUÄS will artictc ixpublivhcd with

40386 Computers haveaäz-bitdatapufl: 621mm)

Thcmjority of software now „mp1;11a:bom wrimmfa 16-

nmlrhasa-appficafinnxhwmhowcvcmevcnmaflyopmfludnmm

newq-pesofn-fificialmcfligcmcpzogrammuofiufnbcna biLSinoemeSIJBSmpUwrsHxvemIypnS-bfitdanpuüfiueflowof hurra-Unreine: chandocspresexusofiwaxmmapogxmm dataisteüwedbyabomhflfiWhmfl-bhsoflwucbwmnes opumurithmhfimuncflurlfiumlhcuseflspoirxtofviemiimcds available for 386 enmpmm, dlzpmwaiing speed wifl manni- toaooesslzgcunounxsotdamrapixflymumrplcnfighnbcnvoioe Habach": verywefhvrilmn. cdlyheiruumdfromtvmmfomfixfiadepmdingonfintypeof reoopifionpugrmnwhichmeflhmunfluflmflmmyspokmfloflh sufromlheportiwucomainadhgrc, comprdsmsiveanddcmaüyfimraraailtshoufldkintflesrorcs softwaxtflfisunspeodisxmdcpofisiblebyflxemgfldlnpafln. hawidcvaictyofcuunnstunes." . Mlllflusercnpahfiflu vary man, gfyoucwftwafinyoümnordcrü bymaildiracflyfiom Emdency otneslzn Multinsersimplymcmsxhtyuuhavetwommmenmnpunus thepublisher. Adcgrecofspeedisgainedmuchmwgmnufionofoouapums muelydvnmimpmvedefficimcyofficfimufiuyuflovaafldcsigzn. cumectcd logclhcr whid: ahnte infimnafion flflffll‘ pcxifluals. Evalunflng m:zsfi-Bascd Computer ßecauselhßlayorulofthecicuinymlhcCmisnwreeficiamüle Ganerallymcvcnlwunpcxrastreoonneaadnuncenn-flcmnptxu m m d m m l e s i z i m n - „ F m fi s m m m (canednfilc suvcflwhichhsalmgaaxdfmhnddfivaflne Computer: dmxousingflwüfimicxopuocassoruebeamning oompumrcm incrusinglypopulnandsalcsofflteseoompuusmgxowingn: chipis 2.5 timesfasta-thmünesossmcxclydrxemahetmdsign. infamafioncomainvdinxbefibsawfismmshzradmmgoflfln rnpidrate. Theta: axcmany goodreasonswhyflmsecomputm m: Ufismemsmataä MHz286ismmqafica1Iy25fimcsfastermm orhammputcrswtcrminahspecizlsoftwmmdhzdwxeaxe graduatly becoming lhc puxcdominam type of computeron Ihm-nat- aSMI-IZSOBS chip. Howevennocfiffccnecheficiencyofdcsigxz reqxzüedmccxmmclwmputcrsbgethu.Asofioday‚howcvu.flnm Im. exisrs between rhe speed of l6 MHz 286 und n 16 MHz 386 mip, isnoindzshy standardfozconnacfingooatynugruzflfingätnmch canfusionforpoleafialusets. of tht 286 provided rhey areusing Lhe u m : 16bit Software. Advantages HcSOSS-basedoompxznexisfllfl-eascwimmlfiplcusasmfl will 00x16mm: 286 Ihe. (hat It i: impwlmt t0 remember cumpuu: . Wzit Staates l0 gmw in capabälitim. With th: OS/‘Z opcxating system. it will be Wai: 3 m :arcpluccd betwaenrhßCPQ arldRAMinmeffonm 510W foraflpuauicalpuxposeacmmotaauzfilemvulbäfimadflöbnsedäflzuromfirnxpzfimdcsipxmapfinxeeboicefm allowforflxeuse ublc mus-elargeanmtmts ofmrmuxy, whichwill ofmorapowerfixl und euier-lo-mc Software.111e average 286 cum-

puternpcraqnsuleutwotofiußetimfis fasmrmmaafliß-buod compurm-Jfhis man: thax tasks canbe donesig-nificnufly faslcx.

Prioes u-ealso dxopping rapidly.thereby rnaldng üznuncvcrmorc atn-aczivc aption for the compum- user.

down 1h: transmission of das. "Iheyiäfimcfion simfluly In p ä g

useasfiIesu-verx.

liglusimrafledbaforeabridgeorfmcway-Ihcäghxstmxonandoff Themmbcroflczmhxxbvhichcanbaommecmdnazßöcnßsfi inaneffonnomgulmthgflowoflnfimflfisxxocesshelpsredxm nompnerdcpczndsonflaesimandwtnplexiryoffinesoftwxebehg uafficcangestionjustuthcwaitstfieredtnesoongestionmfln usadwhilcflzemmberamvarygrnflygenmflyspakfilgapcompumr‘: munory. Wait sfates wen;davised In allow slnwcr (md pmximateiylotexmhnlscanbewmectndmazss-buedoompuz Ihembylessexpcnsivdmcmorychipfcinobeusedwhflxflaatism md uptofiütamhxalsto fiseäö-basedccmxpcxlcx.

Thcrc mmanysofiwmpogxnsaxduskswlnfichreqtxfimax waixmn. d-nzadvanmgeisrhaxdam wsdireczlynndfxvmthc least. a 236 computet moperal: cffectively. ‘These include: 06/2; rncmoxywifixormwaifinglfhelackofdwxilmn: mdflncuseoffaster Modu fast and compficated graphics (auch as Deshop Publishing. Com- mcnxoryctüpscmincreasetheoomptufsspocdbyaboußäIhc Eachgmzrafionofomzpzxxahasfiseupabifity ofsqpntfingdifpunemkidedßesimmdconxpuxcxfidedfinglneefingxlarge followirgg mblecomparas rhe speed 05286 omnputas. bothwimam‘! fermflmodcfofopaadmTnuemcdesaxciefmadmufied modc". Pmtccted mode”. am! “vimnl 8086 rode". daxabasos; camplu spreadsbncis; multitaskilag: and multi-usarsim- withoux waix sums min; Lh: Landmgrk Speed Testprogramm. atimu.Th:286 i; Ihaefore suitable {er a widevaricty ofapplicalions andwittx ityou wilbcpreparedfmnvost fimreoompufingnecds you RcdMode oWal: sme CPU Clock Rate 1 Weit UnSOBS/flö-buedoomputacmopuflehjustonemodgthfisi: (mm-h) mzy hlvc. (in tun-h) (nmiz) 8 xafeu-edmarealmodalnralmdelheeunpumnmuazsflo 6 . 6 Disudvantagesoflhnzsfi 1o s KofphyskalmmxnnMS-DOSexpIoilsnaalmkndlb 8 Vnxilerhezsöoompxtershavcmuwadvmugmmssccompxms 13 1o _ ava-wlnclmixgmajwityofappficafimsofiwmiswfinmfordfis 1o aremlongenhgcuningodgaüisgenerafionofoompmawmin 16 mode. 12 12 which m: 386 succssor tim: slowly b: eclipsed by its compuwr. 20 l6 1G 3 PrllxhdMode offen Ihn: pmmise ofnmchgumfeannc: axflclpabüities.

E: i

AgaimflmeismneedxowmryaboutbcingleftbehimtecmmThezßs-hasedoompzmaranopqminrulmndcuwälafihm 11mearaacmallysevenlscalufogmcastxfingflzc@ofcmn- nükdmodeofopaafiancafladäßfipnmcudnnaäpotflcfld Iogicallywithaflöwmpumrbeanxseitisposfibletoupgradcitw menutgmuafionofampnuveryusfilgnmmsmnmosßsfi- pnemflmmostnoalrmmeasmuhpwmanyMmhnsofhm-Iac- nndeallowsfilrflicacousoflühlaphylsdflxysfimlmflmryufl bacdcomwmaromA-HyATchHfimSSGmomexboards üansanbeproqcnedPcrSooondJhisisrefmadtouhflPSJhis lgigabyteofvümalmmflyhflsolfloflsfinabifitybdo imtallaififlputsiltlrnATuemlblcwithtlzetypical386 mammmamisusadmallwnwtqsfinmmfinfianasdownw oomputezsomupgrademmnmlyreplachzonepan-m träumen-ganzen. Howcva. 1b: um;denn-neun speed xxing: you vidmltasksucpzowandfmmemhothusoflmifonzbüsmit moflmboualflhaveinnncfimfordufingtheupgraflairxm IurthooJningSEGCOlvIPUTERBUYEIPS GUJJJEANDHANDBOCK.

willseeixxadvafiseamnsarethamfinnslmdfiuchndmark

du: not effuct the otha poguns. hat: Ihn u m : “getestet!”

(RAMNndvhmnJmeanm-y. Randall-Atem McmoryGlAhI) 2 RAM comp-ises theounpnnlaäminmemayandknsedfianhc unponry nonge ofclau ‘mmenmry chips.

386 usw-und runde which alles-x 1h: neues d4 giglhyß

speedTmTheInndmnrkmstBopmusedbecuncüdisplay-sn modaflimdofixgmxxhfliskiflghlefllnnfiefifazptiplnhch nie:yqixic xqcsunmionofqaeed in-Mcgahuuxclazive l0 ItneAT. upmzcufncoompnezwouldloctmuzzsfingyouwbseanymx CPheLndnm-kvasionflwisapphlficdomahpmpmaxfiis wvdqfiesmflythnpmbhmwilhprotecwdnndaisflmfll comiamngmerechnical capahmuuumsomzaqandass xvailablebysuwngmmeqpopiqccouponmnishdmhnckof cxisimgsoftwmmtmherewrmmntflzuflvmngeofmlfiiauufi‘: thisbook). Speed Capabluflcs Oslzhasbemdesipedwukcadvmngeoflhepouctadnnde. Afaswrcompuxter canreducc lhetimcyou waiuwhflesmneuskis Memory Capabillfies howevet. few xpplicltiuu progrcns nreye: svaihblc. informabedngpnformecflfiumafcwminutesm afractionofammulz. foms cf stming Thctmnflänemorgffliesaibesdifiamx VirtualfiWMode Essentially. um: m: l'on: Eacum which Gummi-n: a cumputcr‘: Iionflnetwofomascomparslhcrqxenndouuaooessmetnmy ‘Thewfioompunercmoperseinnflmodcaxdinunenhlwed a5 follows: These finden an: overall speed. O5

-"clock n2"

-“width” cf dulapafll

--

.

ovenll cfficitmcy ofthe ': numbc: cf“Wa.it m m "

duign

Bcfore diqalayixugngrsphicoounpufisouofflwspaedazwhfim differentgmemtiotuofomnpmmmtoperame. eachofthescfncnrs will be bfiefly exnmined.

physicalmennoryndnuuabymofvixmnlmanotyflnmfln Urin (bis Supports 4ms Idded m06: calbd virmal

8086 u n d ;

WimmweRAMtvniIabb. lflrgfitlidhaeusinglycounplexwfl- mndni-nefonyoummoumputmlnoflmuuflsyvucansetup a sqxnn vixtual (o: inuginuy) compuusx auch wutin; wimin

wuemnbemedAnexampleofhowhqunuityofRAMcmaflna youru-‚txzaloompufingmuldbe m cpmidcrCPM-btsedeompuerswhichmzaocessonlyMKofRAMIIfisjIxstbmlyanamd: useofawurdyocemingprogrumllowevauödKofkAMism sufficienno allowmenseofnzpellingcheckeroraflresaumflh: öwKmmmryinflflßfl-buedcompuersopmedfludna-fudncsc

diffumtwindowonthesameoompnnu-‚Yoncnthmbdmmxy oIpogxunswriumEoIIheDDBSmmpnm-imondwümflmfifim

mdwinchfiomonepungrmrofluoünnflnndvmngeofvimfl

Sämodeisfitatallprevioussofiwmcmbcopumdandyauun alsodoefliciuumulfimkizmWindonsäfibylfllu-uoflisa ukns advmngcofvirmfltmfinmdlflowxdm finm-saving prognmn. I: 11m allowdd the developmmx cf duhop ptogramlfltich

Clock Rate

Insidc um oompum. a clock “ach” u n eonsmnt um. I: is in mllogou: ameuonomapcchgdactnnpnofspince ofmusic. In the compulcrüa eine, fixaclock a m :In plcc (h:flow of dm und thercby wsistsinke-apixxgmdarmmngmflrecüctfitrynfllefasm thc clock. lhe fnsner dann cm b: proaxssod. Thc clock rata is meuuxcd in megahmz (MHz) m-“millicm of cycles pe: second“. lhchighcrfllenumborofmqgflum. Ihcfustcl’thespeed. Eachhighcr guxcmüon ot‘ compumr cm suppun a fester cloclc ran: du: m imptoved rnclumlogy. Thcxc m: also variations in Ihe clocl: m4: within nach genzrution 01' CPU. Data Puth dumme Thedatapathinaomnputucunbelikmedw afiaewny; Innen, thc man um:dulcmb: canied. Tha widar m:du:puh. the morc infcrmutiuu um: can b: mnnipxxlucd. 8088 computus hwe a E-bit du:pmh (8 lnnas) 8086 comnptmrs hnve n 16bit dal1path (16 Itnes) 80286 compuzct: haue n 16-bit du: pltll (16 Imu)

--

l2 oTha CompuwrRpaMay 1988

publislüngsnfxwamwltcrlflrcmw Osüoperlfingsyxmnnmaka Avnilable du full 16 Megabyles of RAM far 1h: 286. i1will h: pnnible n: mcrgc dcskzop publislfing pmgnm: with upeciflly whidl powcrfulwordproccssixzg programsLAcmal cm: be rapidly accnssnd. will IJso h: inoorporamd inm memoryresidmt dictimny undlhguurus propnms.Whauhed gigabytu cf

cxeaüon ofnmlfipl: viruul mxhina.

Ihm will b: u m : wild ufificinl Lunlligmae progruns which direcfly n i m m : humm thouzlfls imo pflfecl. informative. und immsfing mnnucouldbcofmmnaususempourlabwiuz Milan.

chapmisnbcgmmfixugwtthcdifierenlzsfikwlfichmwflabk.

Atmispafiitycuhavcpuububhvdefidedthumnnfthcnöhsed

coutputnrs ‘u lhc uppwpziale muchine fot yaur nach. 11mm 1th nailable du!m: hnwevcr. so nun): cf Ihese pmicular

buycrofnenfeelsabirconfnsadnndovcxvhdmedbyaflfluchfina.

Eva-ydaymomucompmyoflmnncwwmpnmonthzmxifl.

meSSG-basedcompuza-wülbcuaodfurismybodykymfuhm Whnfsfiudifimncflmthnyafldihflmpmpmcoilhb

Vlrtuul hvIemory

A: prcviously mcntioned. a saftware program is dcpmdmr an rhe amoumofRAM nvnilnbln.Grcatnr amoums ofRAM allow forlzrger und more sophisricated pmgrlzm n: bc opumled. Vimnl memury (simplislicafly speakmg) i: u Icdmique in Whidi thc Computer aocesses othcr memory. auch u Ihnnpn a hard drive md t r a u e : i1n: RAM.Lage Mumm: u: Ihcrcforenot limited t0 m; svailnülity o! random woess mcanory.‘II-n’: mchniquc i: nnw (o: microoompumfs. ulthougla i: 1msboan erraployad for yem in lnrge mninfruna comput-

m.

hmially, virluul manoty will notljeof significnme lo 1h:anfange

uxcflflxc fintuseswill bcforlnrgcixadoounplcx multiuskingund

Fzrsaitshmfldbcmufimcdmatnflflneflß-huedeunpsflusm

flxesmmmdaccxncmthnlhcyaflhavelßhlsofiwmmuxpmfility. Onemajorncghowcvcx. Irhuelheydififlisinfixdtphysicfl dasignnebesLwaywnmmctefomisman-mgethcunqmms aooordmgtoflxcirrimilxrfiusiczldmmxisfiaflshlgflxfisßdn critzrix ISS-band oompunes c-an b: divided inin seren gehen] gruups wcaxcgoxicsffkxese ssvmmmgnriuucu foßows: mMATnisisumoriginaliüemnpmerwlfichbeamtha industry stmdud fcriuguaurüon.

lßMxTzsfiflxiscomptnuhsmsmadmminusmmM xtsvcxypmofmxflßflcxcuptlhckgyfioufinshmxchmge» able with m KT und vice vmn.

IBM Personal Span/Z Modulssoudfifihaemv IBMZBG-

boedoomptztersdopmfianmepcvfioutufludmbyflßmbi


Timeline of the Personal „I12...

W6

a2

W l fl y v s y m t a r

‚Computers Developmäent a:

s:

a5

a:

a7

86

"es

9:

auf

'

m:

260

cvmaoanvrs»:

_-::_ z.“ 55m

8502

‘L

nur

898a

dilflfllli!‘

{was}

m

‘”

„ 5 ,

‘m’

‚ H a a g

v--==

man:

um

Aunuom

faihreandneedsmbeukcnhankmthcdulerotmflmfaflmufnr

repaimflmvniablemndezummrswhuhcraamupunisnfisbl: ormzisflreqnznlityofflmüadivichnlpuu EvmlhnIßMATlndlfmflöhzveludxfishntofpobhmmd formaxrusomnmthcnmcssclmumdmmpsfiblu.bly mnduflsmxybeslinlshrshhzflfisrupecghnlhxvesesnfzxmo mmyp-oblcmsurithllllypuofmqnflx. mmcummcpsrzsascshumpummmummmm w h i c h w u e d e s i g n n d usingakeadyuvaflableoompoteschipadwPSBsauissisanl— pletelydesignedandoonnofledbyIBMAflmechipsmcnsmm designodmwoxkmgafiienfledesignrequirsnomhlesßfima

soumeofpcoblezmlandnodbswitdwasmbeseflagainaocmmm Im:(h:1mmtfimology and have s bwu" pmhlzm muyThe

1723715

powuconsmnpdanrsxflfinghlesslnaxßazxcanwaxroutmnyo-

5025s

‚ m ‘

ATG.QH

m a n : _' X R W E Ü

00366

Rellsbllity _ Genzraflyspsakingrcliahiliryhsrqalacadomnpanhilauyaflac primaxyissxle. Rnlishilityhastodo wirhbow Iroublafi-aayac: compumtisloumntwmumptrchmacoanpmflmnispmum

um

m a n

M7386 I

nmlslsizxcctherchnsnolbomczwughofünscmnzpuwrsixtüw field. i: 1sstill too eafly mvezify IBM‘: dahnofgxcaxa reliability. flereliabfliryforcnnxpanflesarflclomesvafiesagzeatdealfiom

verypoormfainbecmsemmaresommynfifimnmarmfxmus andpsnssvsilzblafigwidsvafietyofavsflabhpmsmumma; of oourse. du’:a’:3 0 m :low-gadg compumpsns on Ihemrka. Thisglfideiscspeciaflydcsiguodm ssiayouingetlixxgtbcbat valucmdparßforyommoney. Availnbilltyolsupport Ooodstrpponmcms

"595

B0485

avaflablchorlzcrwoxfis. whmyounendhckpw-ilhmcompnm’. W

theteshoxfldbeareadysotuceforthchclpfhctypcofsnumonyuu mayneedwomdixmhdehowtosetoonfiglnaxfionswltxoomnc;

aprixxtcnemparfl theoomptxtcr. fonnattbeharddrive. emflflhm buying a eompumt symm. i! mustbe mnembexed t h t hudwm

AT. Annas: m parts of Ihr. P512 Modzl 50 am60 m. physically ‘ compatible Wilh my cf the. previmxsly designed oompumfs. AT Compaublesflzis group deserves t0 bedividedimo two furtha’ subcamgorias:

‘Thcfirstyoupwnsismofconrpulzß whichusecunmndnfigned nmthnboxds, powu’slqaplics, Chassis, etc. und In, thflsfora. m: wilhfla: IBM AT. tolslly hardwuc flleseomfifloupisrcfmedmaspassfivebaskplflwursmnefimes as ‘ünothcrboardlcsf oomputexs. ‘Ihcse oompafibln um: n mndulaxoonocptandplxxflwchipflwhicharcwpicaflymlhc modmboardhuuoanexpansimcardfimphlgsiatouseficsoi cxpansion slots. IBM AT Clones Thue computfls a’: hndwre ls with theIBM AT. Incffoct.cvcly pmof I11: IBM ATclonscaibe insmlled into a IBM ATund vicc vctsa. Baby ATmThasc-‚compumrs arehmlwm inunhmgeable wixhIhn IBMXZTZSG. Every pmofmglBMXT286cmbe installedmma Baby ATund vic: van. Laptops (or portable) ‘Ihm oonlpulcu hlvc a smll cuslnm

c

'

desigmallowixlglhemmbepormblaflfiszroupisnvastwpicfix

itselfandisasaresultmtooveredünthisbook. EvaluxtlngthcCahgorlsa Inmskingyowdecisionaboutwhlchcamgorylsbostfotyom

givcnmrmmoffimgfiflüsispfimsfilydamfinedbyfllespeedof Lheoomputzr.

Tosurvivedheclonemdwmpafiblemmufiacmremasngexaeral mlghavchndmotfubampxformamemqafl-wshasbemnfim

IBMmmpummAsarmlLclonemdoompafiblemahushxve

typinnnybempuzmfrmwinmewtedmologtnwhmdxemMAT wasmmingnsmimhaclanesandmeeompafibleswmrmnhg

__

anSmdeVmIOlIII-ILWhmIhcIBM ATmaredupto8MHLme oanpfifimmovedupmllandmfiflm

Ifyouuccmxgurplaingflupcbaseofaüfi-hasadomflplam‘.

youucpobablydobgübecauseyonwmtsfistrmdmfirflnx

vcndonosnlppoctwhsnlusclls. Ponntlal fa- Interchnnglng Parts hisizuponmttopznthzsescompmrfmwhichmplscfinnxpflt

arereadflyavailahlefflfisavaflabifilyafiecßlbsbflüymsnwmfuflycanyunalchtasbßexpmfiiflnllpgslflfiguflrqfisofib oompmazAhigsdvxnmgaofmeATclocnesisflxatnllpaßm ewi|h|hßIBMAIThisth8pxBarexeadily avaflableandlrilloonfinuembeavafiabledneblhehngeinsnfled

bascofflaeseomnpam-s.

rcasmuildoanotmakssmselopnchaseasbwfiootnpnflnm Theeanpmaficldisdxmgingvayrgidlmlfcwfcaflncsase Ihispoünixllimqmorflhfllzoompmaswiflwwfixsnumflm ' bes: moe286's:vai1nb1c.l’orxnos1.peoplci1docsn’t behgdevelopedallthetimeßoxfixisrunonyoucompmaslnuld haveamplexuomforexpmsionsodmkcaninmrponmnev feanncsastheybcomenaihbkmmhgismomfinsflafirgthm

makulotofsaasetooonsifiamythhzgslowtr.

Prloc

.

Formnstbtxyaxlhckcyiaucispriccfwfineindividualwhois

ushghisorhexolmmoncxdfisissprfixmywnounfaixxdividu-

alswhomusixagacontpmfsorüxsfimfioflsmonexitisofimnot asralsvanahcwr. Agahxirxordernsuxvivqevetyoflzetwmputermamfmm rrmnhsve alowcrpriceandgrearercapawitiesrhmflneIBM oommpmmeourpafihlsmsgmsraflypfioethfirwmpum just umde- IBM's whilett: ATcloflfis typically eoms mal in pries. T111: Baby ATdann: n: thelowast-piced 286now avnihhlc. itisnotsdvm‘ Compunsdzprocislcqtuckbv' ablctobtxy Ehe nmtcxpnmsivcwxlupubcuvsilsble. Compmsrmch-

Mcdmitislalpfixltoconsidatheissuuhsvingtodowiflim nnchascofsoompuhz. Campaflblllty nologyischmgingsofmflminacoupleofyeamyourwanßund Compstlbfliry rafers l0 the abiliry of 9 0 m m und hardware m proanssixxgneadswilllihalyoutgrowyourpresmxoomwnmno function mgether in aharmomoue fashian Mmoutmy awlcwardness or problems. There am sevasl types of oompsrihility, mey sre as mannwhichoneyauhxyflmhighpafonnameeonqxxtaofmday will b: "old Im“ klmnrmw und m:male valus will likely bavery follows: low. You don't wmt. 2o invest sizsble amounu: of moncy für a mschinc which msy becoms obsolet: sfm" afaw sltm yurx 1xis Software Compntibillty The IBM AT is the benchznark agaixust which compaübilily is bei!“ l0 shup f0: somcthirlg incxpcxuivc. laking ldvanugc of 1h: maastired. 111a IBM AT Wß (a5 has already been stand) desigxxed 10W prioe. whilc mecüng your putsaxl upplicifiion nocds. using pans which are readily availuble fmm man}: souzces. An elecrrical enginsar cm plus-bang thmapam and dnsign a mmpnmr likethe IBM ATJFhaunnpmlBM hasaoopytigtonisasetofmro Chips called um"m05"(Basic InpurJDutpm Syslzm). 111a oods wrxiltm in thc BIOS i: Ihn esssnce of oompadbility. In ordn fair Software In finwtiun pupcxly. i! 2ms In find.cmsin insmlctionin th: BIOS. iI Ihm: i: scunflicl. Lhc softwm: will m: cpcrlte correcllgn.

wunhgtncxpuxofllsoomplmonlymfilfirhnithasrudndin

uppcxcatpuuncnlnmu.

UpgradePaihPounflal "Hmeupgzadepathrefessmaoompflmfsclpflätybbeupgtfled fiommegmnafimofcomptltertomnexrgamafimgforax-

mpmansossnonzsaornzsfizoaäoflsoompmenoravmanmfl

ton3ßöJ-ltvinglhisopfionisomoffilebßtsohfiombnoflhsg oanputuohsolesoenoclthfuexmsphposfibhnupgndemXT culxpwxlolßsbyATbychmginglhcmodzboniflisopdm whichuearuclnndvruc isonlyxeadilyzvsihblch clonesoffixeIBMXTJherusonfcttlfisisüaIüchmnIledbue ofthaxfmditsclonesissolargerhatitiswononfinflyamaaive for manufacnnrs m dnsign zsö-based molhexbosrds Ihat will fit ‘nnomXTchsssi;

Potential ofCustom Ddgnlng Your Compuhr Manypeoplewmluocmpuleflhalalilsaspwificlpplfiuüflnot

neecLTTIey wam thcmtal flcxibility nospwifyeaclzhdividualpaxt

whichmakesuprlwcomputemlnotherwordsdhey u-anxamtal unsrem fit. Avnllabfllty o! Coupons" Rcpalr

.9‘

Compvutnrcpizis fuuomcpooplcsfcufulhpinfiasnhninus

orsprofcssimflscqmpuuxfsilmtcmbcslfighmntbomnc impunmldslsundüsnccmbclontflncnfircbusfinuswxfld uctually oomemnhnhltiathucfomimwflmtlohwwbweafily. quickly. und inexpexxsively rhe mmpumex cm be repaixad.

Summary Wille each cazegcry 0Ecompulcr hIJ in mczits. i1 sppcm: Ihm Ihc ATClone und 1h:Baby AT Clone an: uboul Eh: bes:

Hardware Compatlbillty Hardwara compazibiliryr refea-s m the ahility of add-on pms m work with Lhe oomputer. Same espmsion cards, cspecially EGA 3nd memory czrds, cnnflic: with ihr. BIOS of m m : computcrs. Whcn this occurs. m:best solution is to try a different 5er cf B105 m" usa s diffcmn m6.. Hardware msnufacurars gmenlly mmm sell thciptoducuw u mwpeoplc upoulblc. theylhcefonuyto

dcsign

mppomsdxffiaxuxtfiomsoftwmsxapponflsofiwmispmchased separsrelyfibmmehfldwmnitisflaflwpoxrsibifilyoffllesofivm

--

'

-_

buy: nvailwbl: when priw.

pafounsnomupgrudability. ..

producls to function wilh Ihn broadcat rm3:ofcompm-

an um a e. Performance Performanz: assentially menns how much work cm1bc dann in a

„-. “1'=‘.‘ im

.1!’ ‚FAL‘

_

‘judixfiufiäflfiiflaüfiafilfiwfi

‘Hdy buddy. how rnuch dld you ply Iot youroompntor?‘

k».

111e Computer Papa: Mny 1988 -l3

a

#2;


A First Look by Nelson Ruest

-

An additional new fcamre allows ym In rcphcc Icn

Dialogue Boxeäl DialogueboxeshavcalsoclnngedJhctypcspedfnflim box seems mach man logical and oomnehulsiva Bach

I've been deskmp publishhg for years. My fimt efibns began withReadySerGo! LOin 198Swith some neursleners. _I 191er moved an mPageMaker 1.0. Basically. I've had the opponmüty mseethesemmomerpogmms l-‚volveoverflze past few years. ReadySetGo! 4.0 i5 considaably man powcrful Ioday than wps its precurmr. But PageMaku- 2.0. rennained though i: hnd San: necessary much the samc a3 1.2. aucstingto Ihesotznd desiglnofnlne original pmgmm. Wich new programs auch as Quark’; XPress cntczing Ihr.market. PageMaker was Starting lo lag behind. Manyusmfieltthaxmmhadmdxastficaflyimprove their pmgram. Thus. it was with trepidation that I imtalled m:hrand new shrink mappedpagenaaker Version 3.00:: my S1320, visiops of styie sheetsand amo umflow dancing through my mind.

Program Installation

The total file siz: of um 3.0 mogram is 890k. making i: l0 Eton disk. T0 solvc the problem. Aids: onc impossible distributes th_e pmgmm on two dish. A_ new program cupucs bolh pans 1o your harfl dxslc and oombuncs Lbem imo one. I: also automatically installs Tutarials, Getting Started, Templales, and ADP files (21 in total-PM docs notallow you lo selbe: which ADPfilcs youmqnixc. Mostusersauyneed3or4ontheirsystematoncfimc.) When all wtionsaxeselccted. lheprogramrequiresßfluflöß

imminflncboxisgivmthesannehasicloukmzuhoecxmfusionandspeedaocess.

l

Hoechst-Latinum ront:

snze:

cnse:

nolnls

Typs stylo: E Normal E] Italic D um [j nulllne

-

den Dialoguc Box las you

"'23: amanrnutornucnnlunnuc

r-pnnu u nach. « z ulhlhnll

rann- u b fi l aEroomxwälbllnllulnlul „uns:I

I

wbflyguwm‘ wl-Mmu o” w” „ m “

.

Genug S,

und

l

Ü“?

a"

all optional.

Landing:

Ilwisltlon: Manual] :

Ü finden!“ C] smkuthru

Perhaps Pagx-‚Makcr‘: biggest change is its new loot.

Lionalmenusmordettosuramoreinformatioowimoutcmt-

Iuingthcmcnubarwixhselectionanflmypnovideßau

accesstoflwmostfiequmflyusadiwuxsandincreaseusm’

wpacity für pruductinn. Thc two menus which have changedthe mostaxc Typz und Oprians. ‘Type now has ll selectiolas. 6 of which Call hicrarchical mmus. ‚Landing control is availablc dimcfly from the menmkeverse is now where itshouldbe wilh Type Sryies and Define Styfes calls Ihr; Slylc conlml dialogue box.

äSS-‘zäävlrgia lmhfcglfguäff 19H‘ Bang

tions. many ofllmm new.

captign

Snapmkuierfmallygives PagcMaker a grid lock. Style und Cafar Paletwld you Call new tool box menus für easy access.

Headüna

Additional palene:

-

14

m Coupon-Elan May 193a

E! Sudan!

I3 I n v e r s e

The Type Dialogue Bogakes selecfions easigr. und

fairer. Clicking an an izenp produces Ihr: [ist cfopnbns.

Newdialogue boxes includeText Wrapßefine Colors and Image Central. Text Wrap ooptrols the type of image runaromrd selected. Images can be’ ovemm (Lext ovex graphics), givenasquarewrapmomflintageinagivendistanoe scning) and usct-sgxccifxcd wrap (uscm define wrap intuactvely). When Text Wrap is seloctod, a socond so: of scleclion points appcars ammid thc imagc. {Iscrs can movc thwcpointsastheywisnNgwpomtscanbeaeatedby simply clicking on thc ncw Inarqucc linc (for odd" ----„_ spaped images). This optlon may prove cmfinsmg

"‘--—f..__

axfixmsinoeitseems diffimhtomsignzmz

DefineColmsletsmersseleaspotcolomsfatheh-layout. (Unfcrumaclymsingahlackü whiwSEmkwthismouc

diffimlmcolomscanbeassigpaduowxtandfinagesmough

lheCohPalamfilisspoloolpufeanneaflowsyoutoprült

dixecflytoaprinnerwhich sqpomcolomormaummafi-

cally crcalc oolour separatioqs for oouvenlioual prinling

methodscolaoxxrscanbedefinedbyususmaeatetheirown

mtousePMS colour coding.

lmageconnolisanewfeamewhichanowsfmscreaxing

youdefulcthchrightncssmdcoturastlcvclsofanimagc.

Memns amlass cumbusonne and includc scvctal additional feann-eaPageMaherlomesmeteoenflyintroducedhiamchical mcnu syslem. Hicrarclical memxs call upon addi-

St las

p poms

ofpaintmdlfläümagcsdireäflywiflfinmlultlasolets

New Men us

E}

um

T)” [M-mfla.

Pqidfinrll a n n i m -

E

I

|ramnno|

bytesofalmfldisk. . . . n . Usersshould unaknromnforinbafore l

‚„„„

K

givc wuquick gontrol ovcr tcnformaumg und

colour selecrton.

infevwrgreytmesfmnlorcodauastxaummücrevasalof gnyloncsannninnagchackgroumdfimnwhimtoblacloand 0mm: und um Oscreeaed 051.04; am

n

Z I Z Z I Q F‘

| uns! l

Mwgäv

U"'"""E

fi m:

7

tontlau

'

ugnmus:

Cm

grey mapping eqmlization . The imagc wmml tool allows fm dmmnfic cffects even when ming only paim images. The scannod imagc uscd für Lhc. titlc of this articlc was manipu-

lnxed wixh Ihe ‘umge control feamres. l

Auto Text Flow“ PMmexslmvt-‚longdeairedlyeltenennmmgemexu aools '

featurcis now avnilwiminthcprozlamflxis lang‘ ablc by cilhcr Inming it onin ' e Option: menu e": simply pressingtheoonunandhey

_

cmsmiotm changesfimn lhe

[E

flowingmxniheloadcd

monlylcmwn tcxticon m

'

amxmapimmdixfilnyingmefnctthaxyourwxt wmnowflowaamoolmnnsandacrosspaecsif

sodesimltwillalsocmnnowpazesmsedonthe

mnterpageforunflasmquüullufinlhcmzoutloflcxluaed.

‘Ihisaumtutflowcanbcncppedaturyünuebyclidfirlg oncc with Ihe Inouae. i. l

alreadylaidmnwimnewwn Newshunsmapaxcxeportsmndbooksueatedwiflnolzhvusimsothgelflaku canbcupdamdbyselecfingallflmmtbbclsafadnammt

anewselecfimcalledfieplaceselectedaxflwfiichwhcn chosemwillamonmficallylayounhencwlcxtwilhinyour documemmplazhgthoddetvcxsisonwfihmenew.

Style Sheet Support Addifionalwppu-tforlongdoctxmentscomesmlhefiumof StyleSheetsupportPMlflwiflautmmticallysuppmtßficraso}? Wordstyle shwsllsuscanalsocrmrszylesheflsof theirowndfixecflyvwimfinkgehiasansrylesheetscanoonmin formauing ‘mfomaafim fcr a varizzzy c4’ uscä. F0! cxample, a cmporawrcponn-ufichvfi-mesconsfistmcyoffumaningfm hmdsandmbhcadsgainsgxtzaflyhntfimumolsiylfissiuxmfis consistcxzcycanbeacaedattbeashäafewkzysmnd mainxainod througlmul lhc dnmmcnL Should this fmnat needchangejtcanbedoueshnplyhychangingflusqwleaxd

noihingclsc. Afl-pagcnmmncxmallylakingnpmfom

homsnoformauookcnlymohours withthcuseofastyle

Sheet.

Gmphimcanalsobereplxedmsfizebynewimagnlü

example, a box can be used in preliminary layours forpcxsifioningacompmxylogoandmplaoedmsizebyflxexflnllogo when the final layout is produoed.

Enhanced Interface Plvßßisamaeoonrplaxpogralnthanithasbwnlodalc. Interfacenovelfieshrclndemeabilhytosetdifiummeasmeinem: for da: hudzomal und venical mler mits and optiomlsrmkinstfrxfnflpaeedisphyuwwtxomdm lüsnioestnewfieanncsissnapzorutzrsfinfismflyhelps whmtyinglolineupilansixßideagflltbfign.

Built-in Templates 8: Guidance PrcviousversimnsofPManmwimtmmialfilesfmnainhg

purposes. Usus wen enoounged tobuy PageMaku tem-

platcstooomplesnmtthehlayommoLThisvasionpesam stcpbeymxdmltoomescocnpleewimmdafigntanphm includingpopomhsfideanewsleuuxasflbusinesummunicafionawhiletbesewnplaesmaynotbeexacflywhat

auserwmlswdupliwxmheigxaamwfllaflowunm savetimewbmamfingnewfixmmfinihzceäalsovay refimlflewusetscmuseürtbrgswtedtoleamtheiprogramwithveryliulercfauleebflnennnuls.

Conclusion sadlycnonxgmPagcMakalodoesmximhxlcnewty/jn-

graphic oonlrols such ß Ihose which hat: madeXPns famouaWhilcthc

pmposeremainslhcsanmoomolovaspaocvndthswnhm

lineaflnismwspacingoplkmnowworkswimanytype aligneuteutmdmsuggeststolnefrceflanäwaeacmn

efiectsarulimportlhemßguwhicswiflxinhgshfiakunflxis lwo-program combimtion can pmve 1ms:effectivc. Page-

Malceraoisonthesltelfnowfifltexvusimisslamdfor rclwsc lau: this ycar. Omersadlymissedfeannrßixcludeafindcommmmdor

Xpres: sryle Search and Rcplatzczpahilides. (xawaymhavc

boxesplaoedwilhinlnnflowwixhlbewxflevensnppfltfor Wordkabilitytodothiswmldnuknthingseasfiuz) Fmummlynwlmindomdofitdnesvelywelljagehfiüu

Sflnotonlyloohgoodfitfeelsgoodtomhfioaofthis fcclingcomesfmmthemwmmnmmmnzflxmghllikelo usewhicheverlayoutprogmnbestsuitsthejobathzflßtl {flink I'm going t0 Stiel: wizh PagcMakcr 3.0 fora whilc. It's goingmbchardmfindajobthisprogmmcafithaiädle.


COMPUTER W7

NEWVIEWS

ACCOUNTING SEMINARS M WWM nuvnunnpp-mnzmm"

7

'

The highest ranking AT from the uec Computing Centre Hardware Evaluation Group was the Kaypro 286i. Call us to find out more about this detailed study and save S 150.00 while quantities last.

.

jggcaggma

Mgcnoson wenn

u

Vatootwors mwul. um? oqononlc G Lp-Io-ddo eorrpmorhcflwig loely.

-'Award winnlng aonounting

“mm” °°"""°""..„..„„‚.'°°°"°“

' ‘ääfiflä;ä?‘äääu‘fäfll‚'ßty°°“ä'fi im _ u m “"”“”°"'""L .

the Kaypro 286|

ms/Pcoos mZP-Eus

7

.

_

lugumug

Accounting

"

UBC Computer of Chance:

-

The Visual Approach to

Ä

_

COURSES

Redeem this coupon for S 150.00 ofl the purchase of a 4o m:Hard Disk —based Kaypro 286i.

.

_

umocplppod.

688-2992

'

um COMpUTER pLAcE

OOMSUL TM13

n

Coast Computers

860 Burord str

908 West 77h Avenue. Vanoouver, B.C. V52 103

1

voz 1x9 A

I

MANAGEMENT SYSTEMS 207. 111 W. Broadway vanoouver B.C.. 876-7117

"""""""“"

mc

k

— o‘ Macslggogslgofintals Lease t0

_ ‘

5xpj:la.ble ar nves MASS o‘MICRO the Mac, ä5 for .

Own

F rammm

from

S106/Mo. OR Trade-up to Mac // from

SZISIMO.

‘g

Afraid of buying a hard drive that mjght

betoosmallforfuturercquiruncxtts? Start with what you can afford and add mmestongewhenyvdnrmdy. Muss 20c 51095 P2520 S795 MISS 30:11 S1395 P2530 5895 Maas dflefi S1495 P2340 S1095 Maus 50d! 51695 P2850 51195 Miss 65d! 51395 P2E65 51395 Muslime/i Apr'88 PZEIG) Apn88

DeskTop Publishing and O Fufl 1 Year Warranty CAD/CAM systems

our specialty!

O 3o Day Monay Bock G u m m i » I 12ml: o7 FREE soFrwAnE

momv DESKI

|'I'IflCnnnäfi Laser Printing by QMS - 375/ Page

-

13520 78th Anm, Surrey, B.C. V3W 816

(e04:5915550 MacStation Rentals from 515/ h1".

Complete Productlon Services Design, Layout, Printing, Typosottlng, copylng, Foldlng, Binding, und Distribution."" " " "' ‘(Fßifüäääfiäsuuon Rernal wlth uns advemsme"n2? iäüääääfi

''

availabnfly. (Allemateiy 10 froe lauer copios.) 0m per Gustomer Pleaso.

New Headache for Canada's Chartered Banks Spells Relief for Canadian Business fllcAcoounling MasnerPayxollProgx-ammay spellrheetnd oftheclmncred banks domination oflhe payoll ptocessing market for many small and medium sind businesses. Now business owmrs can oomplcu: Ihcir own payroll in

houstaandsaveabnmdleonbankchaxgesandimcm

‘Ib makemamembeucuorworsc forthcbaxaksxless woxkisinvolveclin Muster t0 complae a payroll. than in filling out fonns for

äinälffiooomlfing

The company's money can eam intcrest for the company n0: the bank. Again, providing big savings for the small to mcdium sized business parlicularly if a 121g: overflraft is involvcd. Accounting Mastcr lnc.. of Suite 163-2619 Alma St. Vancouver has introduced the definitive payroll program for the IBM and compafible Computers. This easy t0 use prognm does i: all for you. T4's‚ employee Separation repons, joumals, cheques, pay adviocs. und dctailed job costing am it handles. It even exports dircctly t0 ACCPAC" just some of the but savcs the complcx so: up timc often associatcd with genernl ledger, ACCPACs own payroll program. Umil now payroll softwam for personal oomputers has been either too simple t0 handle more man the most straight forward simations, or too big und expansive t0 set up. Accounting Muster promises In bc the bcst solution possiblefitiseasytoleamarmdinexpcnsivetobuyandmainlain. The manual documcntation does an excellcut job of bnnging the nser quicklyuptospocdonevexything rweded torunapayml]. Ycmpiobahlywfll ncverneed iLbutitis nioetoknow matfiree Support is alwaysjnstaplnnecall away.


Kaypro Computers

Over the ps5! few year's I've uied several thousmd P.D. filfl. smmquirc good and othets pure was Ihn U.F.O.s Inxh, im th: man (Unidmfificd File Objects) which I ooulcl naiver

Announces the

KAYPRO XL-30

xcllonm nisovcwiewofMacinlnshPDis

-

With an Extra Ten

oflnew fik. Manning applimtionofadow-

Million Bytes

man! und

vnious filns. Oflcn docmncnts which u: obmined d-u-cmgh

PDlibraricswiflbcrcpresu-Ltedhynblmkm gmericieon Whcnafilcisloadzdcnmyam Dcskwp. iümtificn known u the "Type" 1nd "C:eator".m'ed1cckodmdlhchiwm mstwcdin an invisibla file (called the Desktop 51c} Files

Free.

c —

ten mi ’on s Kaypmmmäqed

er

which dormhasaresidenr 5cm and cannot fmd mncmrecticmlinflleDesto/pfilearepxuvided w-inh I. galeric icom.

“n%' A

*

-

to Not? KAYPRO XL but not 011e penny t0 tha pries. That means you get IBM compatibility, North Amefican müde dumbility, and the oonvenianoe ofa 30-megabyto hard dfive. All at a Knypro price that's easy to hab. Get two-speed processing 01377/1110 MHz) koyboard, und free sofirware that includes Easy Word Wordprocessing .

=

Westcoast Computers _—_—_= _—__—_—_=—_——_ O 1915 Lonsdalc Avanue, .-=-.-_-= = . - _ _--: _ - : North Vanoouver E =":-E':....= " "

=

vmzxa

988-7080

rho

KdYE-‘fü . w m u w m d h“

F? 3.7 .17;

Fnnure‘: Bunlr

i

In

T n ü n I t k C m H . 6 T . h W m Ü ü fl n u fl n m H ß N n % I n & ; W w d S h r P r d - ’ j l & k n L m n | H l h l u m fl u n L

HYPERCARD i

HypefTaJkScript Writing -Design youx own bunonsrDofine

customised functions, v Secrets of setting und finding. -Tips on heuer rcpon gcncralionnUsing cxlanal rcsoumcs Cost 5130 Inne 18 9 Lm.—-4 p.m.

Hypexcard Workshop -How to modify your stacks-hnporfing data into HyporCard. -Form leuers and

mailinglabelsucreafingpop-upwindows vaddbunommyourhomecard Coot S130 Maya 9a.1n.—4 pm.

f‘;

inIeaduilohdpyoumdwcLhennmbuofUFDg byptofidixxg answas In Ihcmonoomxmnlynsked queslimsfroulncwuxdscalonzdPDmu-s. ICONS Icansptwida npiaorialmpasmtatbnofa docmncm m" applicnfim und ofrzn pu-ovide a ctue oflhcmanarpnpos: ofthe 51c. These small chic: cm be vuy valuable in detcrminirlg muss

EXCEL

Tips and Shortcuts

-Date und time functions. ‘Creafing macros. -CeIl fotmaning uicks, oLmlcing worin sheets. -Printing docmncnm f0: impacl ‚Coat 5150 Inne 4 9 a.m.—4 p.m Includes disk of Great Stacks/Demo Wortmann. vTaughr. by ambu- of ‘Concise Guidz t0 Hypdfalk‘, und prima

SPECIAL Servlce Contracts From

S355 per

Day

Ouamdy o: Yoarly

8.0.3.3. Electromcs 526-2871 Compleie Conputer Care

Top Quality Professional Work

a «a»

Malmenanoa Coniracls

lndustrial Applicaflons

ü- Top Quality Up-grades 8.Add-ons ü lndividualized Services and Security

ü Professional Corrputer Service and Repalr 1 " " \

winning Macrowmetglndividual Macinmshes supplied, vMomy bmk guaranlee, -Localiom The Byte Shw, Burrard and Sixth

SoftShell ß

I6 o Tho Campum 51px May 1988

readyconstxuaodtodcalw-iflugivmuskcm saveyoumuly houn ofwork und oftzn pravide you wixh a acuivc appmlch bcyond 3mm curreru abciliry. Terrxplaxes am also avaflable f0!’ many othu qxudsheetxgdaubnsß andformlaters. ‘Iheyare blankoudixuwhichmlyrequireüunwdanm b: inpm. SUPPORTING APPLICATIONS somefilaploviicdixxxPDükxy willmwirt thalyouhaveaoopyofmqplicafinnmopazmd tun thcdounncnl. Wlxmym u)‘ In laumhtbc filc youucgivmunalatmassage advisingyw Ihn

Somchbraziß

will pnwide yon with infonnation about which applicafiom are reqnired md expuimced users cmoftmdflamixtewhutheappücnions u: by Lhedoumlenfsiom mdJor iI.'s"Typc"zI:l"Crc:tot". Ifthis infounnüon i3 not provided und you can not determimc what supponing appücalions am requirai afnex uying the file in oonjuncfim urirh your vaxicms applicafiom. call an expa-i-

24 Hour sorvloo Wach b!

Rand! Momhly Splcidl

duxuzinhxyzucnoaraoflhcbiunaptypgi-nIendod für use pinmüy an I d0: nuniJr. prinxcx Iikeflmlmagcwxilczorhnlgcwfilcrfl. Fonlfilesoonmhftmlsofvnitxmsizxßuxdyow

achitionalsizaesatldstylcs. Inoxdafvr your dot matrixpintermprodnocmafloqzmcqmlityprhl

phyoumustinsxafllheapproprimfmtsius. Formediumqualitypintyoumustlnveflnfonl point s i n instand. in yonrsystun filc. Chat yon hxvefonmnndyourtextin. Toptintinxbchighes: qualjxyyoummthaveafontsizcdoulflethc formarmdsize instafled.

INIT Initszzexcsmrzccpzngrimswhichflcauwzxzaüv cafly immlled o: "ßTTializod" whcn your Mac i5 smmdup. flfisgogrmfomntisofiznxmuifm smal! pro-grau: which you'll want loa®i auch

dmeynumeyom-mmpum-‚scmhasmmxsxvcs. print spoolcxx. ein. ToimlaflmmTlÄplaccithtlzSyxtanFoldu ofycuszaflxpdisk. Ilwillloaduncnlatitaflytbc next time you mmyour mmpula’ an with that

startupcfisk. Rexnovalisaseasyasdraggmgiraut ofthesysscnx FoldumfirestarfingyourMac.

CDEV

Cdevs am “Central Dßvioes‘ f0: System e

version 4.! er 121er 321d ca) b: salec-‘nz! { m m m: control puad‘: scroläng m a n ; To i r s n j l , plane Ihcminyctz Sysxzm Foidcnndresrm your Mac. "Ibcy can bc xtmovod by rcvcxxing Ihis proccs.

Cdevsaxtbooumingqtfilcgflxasawayof pzoviding opcrnfiooalmflily filcs which theusa will wmtavailableaxflltinnesaxflarepmficululy usefulwhenmed vrith thelarge avaflable spaczof ahad diskdrive. Theixusesoovexavastspecmm from Ihr: Apple suppliod Cdcv "Monat". für wuuvflmgyotnMouscpltfucnccnloonulikc "Da: üuardDoz".for comxolling uns:unclmovaxxqxt ot’ files und tbeir locafinn gn your disk.

FKEY

FKzy-s. or fnncdon keys, am pmgrams which cmbeaddedbyonrsyaflnfilcwiflinaglkadonsuchasFKcy-Movcrffhsefilßutstmcdh: yousyaanfibmdculbecalhdrpanhyhoflhg dnwnaspocifiodsaicsofktyx Sumcoflhese oomc prc-imtallui in d1 Maß. 'u:. (oomnnndshift-Dwmejectmediskfiomyonrinranalßk dfive.

DA DAsordaskaocessodesaemapn-ogmxsnajl-

abIeImdcryunAppIemuIu ‘Ihenemehxmdxed: ofuscftfl DA; xvailable oovuingahaouevuy snbject area. Iruulladm is genaxlly arom-

anedPDuTxaxianforassisunoeorukeaeopyof püshedbymhxgütFml/DAMovcrqplicaüm thefiletoyomnexxusergonpmaermg. suppHodbyApplcCmuptüahc. DOCUMEITTATION Hyouhuvufllcuxmdlwwloimullandremove Docummmrionor Docs.Ihecommon abbrevir deskwoessoriesyou areduxyingyomselfomof tiomnrewmetimeeprovidedinthefoxmof: thetrulygreat p o w e ß oftheMacintosh. sqaarmwurflpocming documuuormaybe StartupScItcn found an-screm, whil: opuning 1h: lpplicalicxt. An: you tiered ofseeing lhesmndard “Weleomn Thcorflyüxixgmorcfxustxaixxg dxanuyizlgto mMacinlüslfopmhgscreetLeachfimayouslm opaau: aoomplicuod ncw filc wiümul docuznm- your Mac? ‘Thema am a lzrgc number of Sanufionisuyhgwnmüw filc withdocummtnüon lhcPuhlic lmnzinwhich thal cmflbe read by any of youx Word pcrooessing upscreemavailahleh cmbeusndmaddpersonalitywywomxmmp npplicmions. sequenca. Allyouhxvemdominsullmunis Mmxy mdms pnmride documexxmtion in the rnxke 51x: i h n they 1:: nzrncd. “Surmpscxum” fonn of a text file. vrhich cm b: read h)’ any ward or mxx procassor. When graphirs am raq-uired in nxdplnoeflacfibemflwsynmalioldaofyou slntupdisk. the domtnenmian n ward Focessor. such u MacWrilcor MSWtxd. iswnuncmly mal. 8cm: B-ettcrsak Than Sorry libnriuwillcunvmnmxtofüwdocmnauzfion Lu lreoommmdmnymzdmmopuazmypublic lcxlurMxWriLc fomuu u lhcsc In:lhc two mosl domfinoruhzcwxcfilcsonyomhzfldisküivc Lmlilyouhlvcuodflncmonfloppicsforwmctinlc widcly acocssiblc. Duomnmlaüon files which will m: Iaunch di- und In am: Ihn lhcy an: sccum. ructly fioxu the deshop. withyour ward processor. Register Thnsc Shareware Programs canofiaxbewnvmadifopuxedwith traepmgrmfis Enjoythevutarrayofmftwzrt.avrilabk inlhc FilelOpmcommand. Opcrxing your vmrd prrocua- PDUhu)’o! 3mm’ dwicc. bu: rcmuulr: In ( e g mr 3nd try ucing the “Opern” commmd. undgr (h: istc: CWÜS ufsiumr-vm: which yvu 16minG‘. U53. "File"mcnu. w opcn thc documcxu. Anothu Uick

iswuxlpgchyoulqplicubnlorcadfilcs

4692 Quote: 5L, Vnconvcr. B.C. VSV 3M!

(604)876-5790

uhlishedso a1] meuserhadiodo was Zxiput their paniaalar finmcial dan. Finding a Iemplale. al-

——

—-— MAY

S1992:

TEMPLATES Tanplnu bemme quize popular fonoufing the das: of rhe Microsoft spretd-thoer, Exczl. Spwcadshcctanmorx zum:series efspu-eadshecx for doing aowuntiazg. managing stock poxtiolios 3nd oomplefing incomc m rcums. These docummts was zvailable wich all Lhc fcrmulzs cmesnud. nucros w fi u m und xrmlfipk shec!

Umcimtwugauallypsoffmas, lilmgped afilascrfnnlx. Mostfmnavailablchmcpxbfic

creucdbyawotdptoccxxmanpphcxzion which you du nol hure. FONT Fonts amthe various Ions: fmxilies whid: w: be mulled in your system file with Appk‘: Font! DAMovet.


LAÜVS -What isavailable? H01»! d0 they Werk? Huw In Charme? In Lbc last auch. w: briefly rcviewed Lh: hismry cf mitmcumputcr basod LAN’; 1nd Lhc izxupcmivc “Zaun-Slot” mange-

prevcm netwm-k opcrafion. Bach workslvafian or "wir: cum-x“ anachecl In 1 goup of loca] smlicms re-uafmnit: the rohen/packe: will vary fmm allowing very lang cable Imgrhs. Cable rypu ' to Lhc distmccs expansive. spccinl cablcs. In twixled p1ir. and NIÜS involvcd.EM‘: Toten Ringpmlocoluns Lhis lopolog. HYBRID TOPOLOGIES By comhizfirlg the slrmg poinßoflhe majnr mpologieu, netvrarks wiLh improved pafmmuxce undlm fault d a n n :Ire ponibl-e. Arcnej. i5 1 “Dixn-ibuled 8 m " mpology. und the man pqmlar cf Ihc "hybrids". I1looks somcwhat likc 1. group of uns in du;ach stutimluns asinglc co-uxialcablclo fhuhflwlunhhas asinglccablc m anothe: hub o: a server. Hubs au: be passive (m;au: TV splitten) or aetive (the signals an re-trmmxiued). By linking man!acthre hubs wgethex. mm1cable lengths in the 1000'soffener am possible. A Irak in a aable out of an sztive hub will geuerally affcct only thos: stalions 1nd hubs fizmerom. Inopaaliorx.Arcneucß likeflinearbtisjinthn allsmions “see” alllhepacketnlfilmlmlpasing schmeismamuxsweequal acocss u: 111c mtwmk by 11lcomlecu-‚d stzficms. Acfive and pgssive hubs allow casy cxpansion over Iang disunces. Arena i5 a mongnized Standard tqmologylbwtowl available fmm 1 widl: vn-icg of

mm1. Will: lhulbuckpcundixlmind. 1st: cxmfinchnw aLäNin 1988 mightluuk. zmd hab: apcck "under 111611006"1oso: how lhcy Werk.

-

CABLLWG the primary llnk. Each andcvcry wrkslalion on Ihc LANxnmLbc connccmd L0 Ihc SLTVCI. Each workstation and 3 4 3 W :mustlwve a cormnmlicafiuns card, cnlled a"Network IrllerfaocCaxd" (“N103 whicl: i5cumxwtud to the cabling System. and all NIC's on rhe Same cable must use the Same language (called a “ptotocaolfl t0 um; w each ortet. All of the protocnln use snme methnd nf trammiuzing dann in relaflvely small

„mahnt

Tha-e are vm-lous merhods nf cabling, called "mpolngies". of which Lhc most cmmnon an: Linux Bus. Star. md

LINEAR BUS I n : Linear Bus topolomnasingle cable (the "LYLISÜ i: oormrxwd w auch Workstation 1nd rhe sarverts). Each und of thu Cablc musl b: terminatnd Ivirh the. CORRECT rype of resistor 1o pmperly complete Ehe elecrricnl cixcuit. Co-uial cable (Iike cableTV wie)is typically uscd. but.different types of co-xxial c1ble 1nd lcnnixxating resistent 1terequlred for different typcs cf NIC cuds. Since all stulions on Ihc nur. shan Lhc samc cable, they 11l packen. but only receivc packen addzßscd to Lhmru. Somc mcthod of preventing two 01' more stations talking simulmneously (causing 1 "oollisionÜ i5 reqnired. Collision Avoidmce (CA) invoives first Listening 1o see if aramher mfion 5:. currently n-ansmiumg an the cablc. Ifso, Ihen the NIC simply waits xmfll Ehe cahle i5fror. Oncc uNIC bcgins uaxumilring apaekct. ilalsorlny lismnoseeifatlomer NIC bcgmtrmszruuixlg althesmlc um:-c1lledCollisionDeteefim (CD). II so. Ihm BOTHNICS 310p umsmiuing {er 1tmdom um: lntetvul. fixen stan the entize pzoocsg ngain. All this nctiviw Kaltes place m.electronic specds. Lande: oonucl cf the NIC's. On a VERY BUSY net it is possiblc that a SLEÜOII may ncvcrgct ncccss u) thecable fcur 1pedodofüme. inwhichcaseitwill infurm Ihc Station opczatur 1nd nwail 1 RcrylCmccJ oommand. If Ihishappmud oflcn. Lhe thc nelwork cm bc s-plit inlo Lwo scgrnenn. euch wich irs own “bus” cable. Novell can acoonxodatc up l0 {our NIC cards in the satne seerveu’. A fiuulramrwheze in the üble will prevau networkopcxafion. Individuell cable lengths are gmcrally limited to 1000 to 3000 feet dspmdügonthelxowodbutflepeamxflmaybeusedloretrmemit packen nver langer distmces. Installationcosts for theeo1x111cable can be quire high for Iargermm, whzre anexisfing building musl b4.- rc-wirod. Ethernet. G-Net, PC-net potoools 11l um: the Linear Bus Tcpology. STAR

‚Q;9.‘;.%‚

g

Eachworksmionixtaslar tupolugyhasil: own individuul «zahle connectirlg il w Lhn: server. Sinne the cable is dedicated to rhe wartenden, no enllisinns ocem. Maximum transnaission speed requirements cmany one cablc an: much lower ihm wlth 1 slured 8 I'M’! cablc. so lwisLcdpai: (like Leleplwne wird) i: gmurally usud. Wlthno oollisions. responseis always cxcellcnt. Afaullinamblc affecrs only the Station urtachesd L0lt. Lhe runuining smüons an still

active, and Lhe problem is eusier to diugnosc. NIC cards in Ihr:SUD’!!! aus: more since they typdcally manage several stations. Mthough rwismd pan- i5 less expensive man oo-axlal cable. you need more of ir sinne each station musr have irs own cable all Lhe way Pmck I0 the server. llowever, ynu may be ahln m115c. exisring telephone wifing in newer buildings, in which case innnllaüon cnsts wonld he reduccd. Maximum cables lengths 1te usually in the 100’: nffect. RING A5 (h:namc implies, n Iling Tbpolngy is cabled in a circlc. An electmnic "tolce11"is passe-d [ m m sLaLiun u: Station in soqucncc. Euch suuiun camxmcs Lhe wkcn. und ü’llmy rcccivc pcnnissiurl. muy tun: il 1.0 scnd a parket. Thlnk of the ioken n5 an elecuonlc envelope which arrives empry n: your Station. Your packe: i: placed in the envelnpe, the addrus of Ehe receiving sution applicd. and m:cnvelopc passed an to the nur. sutiononxhe ring. Each subsequent Station "sccs" thc cnvclopc. bm m13: not um: il 3in0: il wnluhu u puckcl. T111: xccuivhtg suslivn "opcns" lhc unvclope. tctrieves 11m: puckct. pluccs an whwwledgcmcnt l0 you insidc.utuxches your uddmss. andpasscs iton. Aguin olher stations see the nnvelope. but may n0:usc il. You reeeive Ihn ackmawledge packst. then pnss nnan EMPTY mvelope to thc next suüon (man ifyou have man packen mund). ullnwing ynurneighhor 1ndotherx on Ihn xing ncccss lt) the cuble. Collisions never oecur und every smion i5guaranteed 1 fair dann cf um: an m:cnhle. A: Will! Linear Bux. 1 faul: in the- clble will

.

mmufacnrers ; Iämeoni: apupuIm-rnghpexformmme. fault molexamhybrräusixzg 1 “Sm- Wired Ring” mpologjr. Worksufimas an oomlacted t0 wie ccxucrs in astufnshion. exoeptthuspeeial qableisusedso thanhere is an ingoing 1nd ouxgoing FAIR Io each fsmion. Similzly wir: ccnwu am connecwd will: donblepnir nfle. T11: zopology physically resembles a discribuled stur. bul cleckonically 1er: a: 1 fing. Ware cenrers cm1 also have tepeatezs nrmched. allowing vcxy lang cable mns. Acable break causes the nearesfwire Center maromatically disable xhe fmlly cable, isolafing Lhe gffecredpmlnn lcecping lhc rcst of Ihe nework up xndmfuajng. _ Inopcxalion. Protomacm like1Token Ring. exeeptthnxme “euvelopc” i: largc cnough lo cury scvual packen. ach individually addressed. Inompass aroundthcrixxg. lhctokcnmunculally sqvioe sevezal workstatiom. providing jmpmvod pafommcc. Fibre optic. infm-red. and mlcrowave transmission is available. allowing Imique solutiorxs t0 special site requiremmts. Proteon is a 91991701317 13101-0601Other hybrid: axe availablc. nach will: spucial auracücns in lhl: prioelpetformnnoc axetL In addition. the dcsizc u; usc cxisling buildingwixinghasspturedtlnedeveloptnmtofhighaspwd.

rage

ge

o!

ms

New Puäfisfnngxfechnqlogyatflre

115021051310. s1‘. vmcouvnn vsnms

in VENTURA PUBLISHER Junior ä Senior Levels: Leam the secrets of Desktop Publishing with professional book designers. Or anend one of our Design Clinics _for Ventura Users: we will Salve your deslgn and forrnatllng problems on the spot. WORKSTATION RENTALS: Usa our lau-Gast Desktop woncstafiotts to complete you’own puallshlng

projeds. Professlorfl Advlsors an hand.

A EQLL PUBLISHIHG SERMCE: Let our Publishing Professionals taloe YOUI’ Dock. magazine. mwsletter or report from concept to fitflshed product pairiessly and Inezcpenslvely.

-

_

lwismdpanbased solutionsinüleläxheanet. Armen andTokaenRhg “P0108555l CABLE SPEEDS

StandardproloeolssuchuEthcxmAimcLTohmRhghavc s p u r t o f All too ofien. thisrawdnraraxeis hxcurrectly viewed es rhe only oomparinen measuranmr. Acmal data rhmughpanranee m raw cable transmissionspeeds specifxed a

affocwclbypncket ovchud (exndu:Ihgmustbesenx witheach pnckcl). u m : ooncclion ovaheld. oollisinn eounn. packe: sizc. network Ioad and oLhcx Knotens.

_

ALL NIC’: NOT ALIKE InaddilionL0lhc lopology, thc NIC‘: rtlnion Io in hoslcounpuwr will nffect Lhc duta Iramibr spood. 111cm am thrcc bagic wlys in whlch a NIC muy uansfer dann t0 und [vom phc hast. namcly shzzed memofy. U0 pnrrs. and DMA channels. An explazwtion of these is beyond the scope of this anicle. sorelax. Marmfacnrrers may choose whichever xhey wish, hased an cost, mrnplexity, and petfommce cxilcria thc protocol standuds dcfinc how thcy must 111k l0 Ihc cablc. n04. lhl: hosr. Computer.

-

HOW T0 CHOOSE? Choonitag a mpnlogy PRDPERLY invnlvzs calmlaling rhe amicipaxed 101d m1 the nefvmrlc Im‘ nach 51215011, and cnmpming rhis m zahle: genau-neu by benehmen: Lech: an differmt zopolagics and Servers. A pcrformmcc reference (such 1s. 1 stand 1km:IBM AT will: 1 hard disk) i: choscn. 1nd 11l mpoloylprotocol choiccs wir]: amuquzxl u: bcucr pcrfurmmcc für du: loud an: uvuillblc. Cablhg disrancas and pfice now enm lhe picnue. A topology may handle (h: lnad, hur may cos: .1 bundle 7o wire ynur nffice. Higherperfmmancc NIC‘: also can-y a higherpriec tag. 1km‘:fm-ge: (h:Futur: nemorlcs, likn kids. get bigger nvcr ( i m : For 1 smnll nct of 4 or fcwcr srntions. doing mm: icoommtg. word proocssixlg. 1nd sprcadxhecl work ihm: would b: ncgligiblc differcnue belwcm Anmut. Elhcrm-L. u: G-hcl. Mostitnpoflmxl- chousc u vcxzdor bnsudonkrwwlcxigc undability. n01 prioe - you get whal you puy for. In xhe next isme, l will explnre Ihn Novcllbasod sever. {mm m: inside our. We'll also loolc a! how In hmk severnl LAN ‘s xogether,

WCBuy, Seil, Rcnt, Consign ä Lease New 8: Used Computers, FAX, Printers and Accessories

-

1nd how m cmmcct m Ehe Computer vmrldzoumide (h:DOS band

LAN.

Comc inandchzckouroauconaantly ehanging inve-nrory and our Iow priees.

l

VN a l 522-4641 FAX 524-5744 7350 Edmond:

m coaigiszälfnp: Mxy 19c: n7


_

OOMMUNITY OOLLEGE

conflnulng Edueaflon Division

R

PSION Organizer II j

-

Hands on instrucilons. State of the anIBM PC-XT

interacfive pockct sind CDIIIPIIIH‘ PSIONcorphasixmodtiwdflzePSlClN

Organizaflffliisuniqu:Englishprofl-

üüprovides up m256Kinaoon|pqFL hundhcldfcnnal. Builtinsysmnftgnp-

tionshmhfledalabasefilemuugflnfln.

Ware

oompatible.

A range of times and dates 2o fit your busy schedule. A curriwlum featuring every-

-

thing from general oomputer skms. to dasktop publishing._

diuy appnimnun plamm. scieatific calculuor und cva: m intnmal grmnming languagc for anfing ca;Iom applicafimts. Praqxrograxmnod so}

on solid statt Dmpaks

oxpmd 111e fimctions of the ‘Theabilitjto download 1401115123 daga imo Lhc Oxgmizer speadsheex, ro pqForma mnrtgage amortizations undhigh Icvcl fmmcizl flmctinns, 3nd t0 gaxhar invemmy dm flmough Bnrxxadc ning an: just 5 0 m : of (h: available programs. Commtmications i: the key m

tive venture between Vanoouver Communfly Collage and Precem Computer Skills Leaming Centre.

AdaptAcoounts

Preoept Computer skllls Learning Centro Inc. 735 Clarke Drlve Vancouver, B.c. For Further Information Call:

abilizy In nmmit 1nd received dar:

a deskbound PC via fixe With the addition of thciPsinm 240)band modcm. Lhe Rsßzpom Psionflprovides remote imcractivcdfitarrmsfc: roÜ}:0mm!office host PCfiom a portable unilsmall mough L0carry in your packe: mpursc. Roman: Order man‘. dm hast: nach, und totes; In eiecxmnic nczworks und messaging an all available t0 ihis Psion portable '

oocmputer.

.

The Pxion Organiur is distfibutod through AJ Maxkcüng in Vnrlcouvcr a:(604) 736-7924. wolcome.

255-3198 CÜMPUFER

SEK WEGE

Aumorizod Service Cemre

fion 3nd darabasaixitegriqzaixiammplctcauxfizuafl. Allmodulcs

amfuflmmgalcdtothcGL Formofciizfomiafionmflfismw

Pmfiifl.COTIEEI: Adapta Software.30 LnngwuuChasc Unionviflc 0N L33 AM5 (416) 479-399

Video Worx Poinlofsolesafiwcnforlrückemalstorm

Computer ‘fforld in Smrcy. i5 plcsod b s u m m a umLhzy hxve been awnded axlusive. righls 1o Viöw Wann. lhe ultima: ‘Süden rennt! sturc Pol-m of Salz sofrwm package.

VideoWonistl-nofirstofasuiesofpoinxofsdopackaztstobe

roleased by WCE Compmet Workl soflwnn: puhlishing division.

Videoworxisduigiuedmrephcomocashregismandgive oomputctfiexibflitytnflxcvidooshapvideowcrxisloafledvfim esy m use rovonue enhancing featmes 1nd 12:11:55 n'a: syszan beoomesnprofitoermefonhcopcruor. Videoworxoomeswimovadoflfltiflesimluflodhtbcpochge

-

aflevialingthenoodmmluflfisixlfonnafion. Videowonrmuon

-

alllßMotIßMConxpufibbeunptnasfiixhaMaänmshvasion projacudroberudyiizhlyflidnowaxmaflsfiorißiDulux

ConmusaWorHanbuerhodnl3-483

-

'

Afmlflyofadvmmodrelafiomlbtßincslppficafimufm-Borlnfi‘:

WP-rat: Paradox 2.0 dnahue mamgemem systcm. was releasod T0613)’ b}! Aditptn Sofiwm: Im. ‘This lzyernd. modular mftwm approachredimu rhe costmdeffcns furbolh VAR‘; mdusus in edapihig systmis u: handle sgaecific Haines; raquiremenm‘ says _ Petzr Wolfs. Adaptäs PresidmL 1b:fully rchtionn]dgsign of AdzpfrzAcoounß provides uazxsac.

m-

powarmdadapcabflityofünePsionocpiputcr. Thc Organiserhasmc

._'»'

Accounting Schwan halb an stumm: qnnrdox DBMS

4

Tha courses otfered are a oo-opera-

.;‚—p...._..__-_„,«

cumpmyreocnflynuflmmdapsmnlomnpttmsofiwuepogranuhaoooxflhzaics wizhnheirpoplalacrfimeflmoomqatfifhe Software thacgnpcrsgrslcm. ‘hhelptpuxplehmfile 5761131‘ 11110111175 Ofiflfoflnafiofl. andbeconxcmorecxgmizpd lhus man cfifoctivc." says Prim-ixy Hangman: Systems Pgesidmz Dan SHHQIFOImMUhfiJImHEUnwIDIHCNeJwpyOfÜEPCTunm Ton Software Connor: Roher Mackmod.ConmnxporuyC/tsmmu-

krumm»:HandHoldConnpuwr Ä Rcspmding mmndzmmd for atmiy

Continuing Computer Education '

-

.1-

ATARI

King George Haut, Smsy V31‘ IE8 (604) 583-16110 Connor

COMMODORE

WallaAlliolL

AMSTRAD

Atari ST Memory Upgradw Cnbles 8LAcoessories

{Fast FMFW-F

mrsnna riouu Lro.

gfmwmd m‘? 4733 E Hastings s2, Bumaby B.C. 291-2251

Autofax Imager

VCR Top: Backup Symmfornur PC

Hereisa vCRbackupsystemforlßMcompaxilyleocmxwtasthat

'

Ton: Gans

XEROX

Trick flaompsm

xEnox SERVICE GENTRE

.

cnfwmw mmamnm Y

93a Wust amAvenuo Vanoouvar. B.c. V52 1E5 (G04) 736-8931

desrves more Ihm one look. Anlnfu Corpornion IEIOBIDES Ihe irmoduction of 110 meg Tape Backup Sysnem for under S400 Cmndcim. Based an an ndd-in band, softwre 1nd myhom:VCR (Benz o: VCR). Ihc syslcm has u aus:p: mcgubytc of about 6.2 c versus othcx systems eosting up to 63c peimegabym. Aumfu supplies the Idd-in board. softwlre. cxbles mdmmual ihn cwnplctcs lhc Image: puciusgc. 111c uscr supplics die VCR. 111c Warm-n Canadian lfisrriimnor ‘fnr Amofu Corponfim is compu-cm: 2255 Gcorgil St. Richnmd BC-V7E 2R5 Tckphonc: 275.414}.

Attention: Hetailers, User Groups, Libraries, Government Agencies, Associations, Large Companles WANTED

-

18 Tho Computer Papa May 1988

-

Axiswtlr: will b: dcznuxzsuafizlg {heil Pkw Hupuc""‘20 a: du Spring Comdcx. h wiil rezafl f0.- STBS US wir}: an additional dann’ kil. availablc II. 595. Formate informafion m1 fludrivgcal]m m u m m u - i g n o o . 697S 18th Avc Bmuby 5.02‘. u: Call (604) 522-9850

C©PUR Call 733-5596

Aristotlclxldmficsi: Innenring Ihcinnodlactionoflhuflmw productmthecomputermxkuplaczzhismmnmflxoe yearsofhnd workgduignmdnfmnnmnhavcruuhodinflmaufixmafwbl i: prolnbly thc fxzstownpktcly porlablohaxd diikdxivc f0: IBM and compafible compumr thc Plato HudpacmQ0. Thc unix i: a solicmuixlizxg swngc ccrurc housing 20 mcgnbylc: cf munory. ‘nie unit requires no special snftware for use. traute: m 5:01:34: cf imporunrdan. Simply plug Iheunix mtoahostadtplnhayawmiuv compuurr und infozmaüun bcwmc-s truly portable amleasilyamessible. The Plam IiardpacT" 20i: abou: Ihe simoüpockamvcluxl is üuxcfor smnll enoughto fitinmyhriefaxs-eotoouriaenvelflpe. l t i s i d n l für Lmxsfmingdlumnflüumlheofliaguwhmdfla sccurity is nie-immune inhexface aflows forquickhook-uplobofl! home and 0mm PCs. The Hxrdpac"2Di: also availabk: for Ihl: Mlcinlnsh warum: wilh a SCSI imctfccc Pricing 0 : 1 bozh Mx und PCunirs nillbcfllc 53mg.

DISTHIBUTQHS Of

Ifyou oen cistribum 25 er man copios cm1: Computer Papur. plonso au." ua und wo wll und you a bunolo.

Plato Hardpacm20

Portable HanfDfivaxjbr P C ’ :

Time:Text Tin:Malngcnmuf System {Mann's 101d: PC Priorlty Muugmentsyuqnn. nludhgodgs managunuuunhüng


x

Brldgqaofi Graphit: Llmltod is an esmbliüed busincss offeting a pnsporamry servioe f0!’ lhe primjng imhmry. ‘The l4 year old eompony. locamdinRichmmdconnenmlupximm-ilyanpam upmdlllaspocuofcunfliwoxkinchadfixgflfl‘;

hxlftmcsmdspecialcnnnawnrlizAflthewmkis

cmindoutbyqualifindkldeflnmrldncloserehtiomhipwithcuslomcr: cnsmuahighdegruof

Horizon Systems Computer Suflwa-w

Consultants

Karbon Systems wu bmn fiom u: i d n tiut ecmpumoonafimion Indsugmn ncednotmquhebuxkfinancingtoooquire. Ummajorobstach facing BobChisholmin 1984while computefizingifisownbtnsimsswasthehighoostof cmmltmtsaflfhnrextmsive lninii1g. snlfirsmmtionmdexperlscBobisxcadywsharclhchmwlodgchchusaoquixod. Aroyounewto LhePC lincofcomputcrs? Amyou havirxg poblenns leamirlg 1h: in: 1nd 011B cf MS orEC-DOS? Befomyougo mnandspcxxdawupl: of hundnd dollars an a nahm; murse. check Gut LImSI-IAREWAREpogmmsavailablefxomSIMCOM Scrvloes. W: hure severa] nxorial disks t0 help you beoomc morc proficimt on your PC. COMPUTER TUTOR (SCS#1l}is an hroduc-

FirstTha-ewas Loms I23 andthentlterewas dBASE 111+. If you have triod them both 0osehe yuur dalahas: problems 1nd you amstill n0:getring whax you wem... uy Lh: nzw ADVANCED REVEIAUONL0handle all ofyom da:bis:requixetnonts.

VANCED REVELATION i: a full function

‚Areluional dala

base and applioafions dcvclop-

Boas your Job Invom the cost effective managcment o! poople, money am! tlme?

wbflflgw

A: Harhinger Services we spocializc in pmjecl plamfingandschefinlm savioes. Wehelpcliallsexploitmpowerofmicxooompmmstopim ‘"4 m “ ? M‘ P‘°5°°'5 “ W 9 5 9 Ccmuflhgnadflliüusnimbrcomctnflaamlmflry “Plmfl

Sarviccäs OH-SITE BACKUP

OFF-SITE

STORAGE

ALWAYS SECURE

cemptfilüö‘ 77;:- lbrbmsxfd Crnxprirp: ,4 dnscm ‘a

Applcßflznzmmdfinzisnmuflywiflxinlwofiingdqumdiflhcmtdnhuüiscanbe speododuptomoetpfimingdcodliuos.

thepublicforldyoamForrhepastöyemJho

compnnyhasfoaxsoudonprocessingmstemu

Fromoriginnfionmdnfinislndpinfingplmu have moexpeufisonpoümaflymrfiniflnd offeringlinouonicwflßisnagesemerouqaaflei- mworkatafair prioeandourserviceisgraan thnonhsupuperorfilnflfinmfllofflacmajor" summa-mm Rand, Rlcilmond, dcskmp pngzims bmh IBMO l u d nnvcxznreupmetanns-nm

forgnnmg“ andiscaumxfly

Hurhuisydemazimistomakgavuikhlgmiu climlxnnflordahlesylfiunofsuwoxtfiumflle iütialsigcofdoudng" moumptncrme’ lhxough' sofiwueiselecüon. selw und lraining ofslafi’. Hormon Systems 1ms been insmflhg. washing andsuppunixxgßodforfl Accounting sofcware for

ovalyelaxmßobhullsodzvelopodnxysnnnof

cusmmimdmznuswhichallowsciiumtosldplhc

noryIsveimIortoDOSwnunamPCcmnpmn-s,

mficomptuerjargomlraoommaldthisdiskwaxxy

bcgimeronthePC.

D%DW*TABOOK(SCS#82&83)isaDOSm1m

thalnsfisifirfiificialhtdfigcnccwhflpyaugazup m speed; PC-DOS HELP (PC-SIG 8754) is on-

sueplgmnmgalrveofmfinfismahßrmlfiug bactups virmally

plagt-um 1nd qudxing dm

unnmnticJ-lorimnSyxunscmllmnuinyuw man busixlam wilh n u n m a l : a b : pugams

imludingbtatmlücßscmfluufisevetfll woxdpzmessingpukagas. Horiznn Systzms uns-m Avenun. Denn, B-C. ‘F4C 215 (604) 591-2245 DOS. Wo carry over 1100 SHAREWARE disks Im’ Ihn: bzginwuadvarmdnserofPC computexs. SI-IAREWAREdiskpriou 3.11351001:: '

disk. Contau

SIM-COM Services 14150 10l Ave. Same}, B.C. VBT 4Y1 (606) 585-2326

lincßüsjxelpäbamhfflenxtomDosl-{ELPGCSIG #686) is a HELP System with Dictionaxy of

WANTED: Auxhm: wamod

mentsymncthnaflomdesiglammdeveiopso-

addresslislstofullmanufaxnrhgmbcmsfot man marmfacmers. ADVANCED REVHA-

Systems l0 dclivcr 1h: “goods”, ye: simple ehough l0 allow non-toclmical usets L0 roqust ond ernste their own repons und dcfixrc

new

fields.

Porno: Systoms spocialius in developing dnta

bis: syxtnms in thenew ADVANCED REVELA» TION. Sysumsnngefinmsimplenmneaxld

In disfibue xhdr pmgrmu IlnoughSHAREWAREaII 615-2326

flONx-ursonstzxflalonIBMXTIATsasvu-ellß

onnclworks. Forasolmionnyomdanbm: pmobleruslclusdo du: wottkmdyvumxsfiflcrunencwrepurumd fieldsuyotmoedthuxzonyowownCallTed ArchihaldatPusecsystcnsßß-IMIG

fidly. Oinlotalapproachwplmninghelpsyon ningsaviceatrahlingsunamt anioonstxlfing. achieve (h:rcsnnhs you nocd. W: offcr lrlining

madmpportfordnnaostpowerfialmfiwmavafl-

R0!!!)tonnen-

ablc

5|1|12 N, 2500

uflmoeymallorminnfionxplcxcpmjoaplm-

Service. Wärcmbiuuhocuucwcdmflscllthc

Leo H. Grinblats B.Sc.‚ M.B.A, LL.B‚ R.I.A,

Stroet

Port Cbqlllall, ILC. V3C 3W4 phm:9067M FAX 94168!!

Forinfmpxaxiuulonbwwccmhdpyousavefim:

Didyoulnow Ihaxyomcomputcrdanis wonluq: back-upindslmagcmoü‘. INFOSAVE" prom25 ümas maoriginalcostofyomhaxdware? ‘Um videsawony-froqquitimoflndofbackjngup back-up mdoff-sim smragoofyomoomptmerdan tho haxddrivds) inyour Personal Compmfls) on i: missu: Ihn MUST b: addressed-wimil: your nreguxlarly schednied basis. mittirnizing d: timß. orgunizafion if your an: to survivc m mnforsucu cffurtmdcqnlrnqtniodbyycu Iopcrfoxmthis disasner. Doyou kmw whensuchadisastcr will bdiousyplcssmlialtxsk. strike? Doingaproperjobofbcking-upyompczsouzai NFOSAVET" addresses your personal oornpute: compnmtisusuallyanexpaxsiveuxdtizneoorx“man your business noeds a compner schaden. systansouservieeswcreeommmd. wlm you don't need i5 ono-sidod advice. You Wo leadihe wny 2o nmkey soluüons. quality noed informod, cunem andcompleu mfmnnfion. systemsgmldfllespecialistsinanyarea. Wealso You neod 1h:facu. pwovide Systems anniysis and plmnixxg sexvioes. Wedelivormeadviceymneeiwithdxefactsm CompuFlnd i: THE unbiuod compula’ advioc backitup.

Services

sumingjob. ALINIOSAVE“ Service m1.. w: careabwllhcimogxityudsocuixyofymzvnhableoompailcrdaulflflilthlcyoudidtoo. beforoitismolanfiCaIlmfotaFREEmaJysisof yourcorqntuback-upmdnongeneeds.

INFOSAVE" l2l-8l0W

Vancouver V52 409 (604) 815-1552

Wohavetixorasourumdoflneresatchmldcoor-

dirxamrho sohJfion.'I'hissavesyouü:neandaggra— vnfiomandyonlaanmooghw defendyourdocisiominanyanwdflu salufionissimple.

Call CompuFhd tuhy.6596588

d'en End Finnen! Statements

Jteuomblc Raus

«man-ans omearara sormn

Phon: 1-368-3030

am:5:|0 pan.

-Ma.cinmsh Accounting Spezialist

.3„‚j„„„pur,“

7

. _ _ . . . . — . . — . . — — . . — . — _ _ _ . . . — _ _ .

31s Prmcess Ave. ‚Vancnuver VGA SP5 Phnno: 255-8077

I’ I

‚Tn 131mm“ Sonne 300d rnmns why you should chouue ArtBase Services ConunuclaJGn-aphics-Cmpcnutc Logo andPmducl Design v Anixnutixm und Pruduct Simulation Technjcal und Sciemific Illustration Cotnputu"

-

Aided Dmfiing (tomputer Cnnsulting-lndividualorGaoupTmhning Assusmont of your company's oompuror

COMPUTER SOLUTIONS Phone me NOW and I'II_teII you HOW. For a FREE 1/2 hour consultation:

Call 667-2345 Reasonable rates. Satisfaction Guaranteed. Fleferences Available Clear Thought Software Company

404-850 W. Hastings 81., Vanoouver V60 1E1 rÄ-IC—-CIÄIZ

CUI { H 6 GITAMJIEEP ITDY ?UU.‘R

- -

Jodmical Wdfing

requirurmrs Desktop iPublhlüng 0 Ada, Mmunis. Reports,

-

Flycrs. Raumes, Brochncs. Newsicnns LascrWrJter Services Bring in ormodcm yuur disks 8cwewill 1 m m high-quality Last: print: buck wyou- Cunvcxüm Houn Ciosc wDowntown Vimcouver Accounting üpmadshact Design Manual m

-

-

Micm

-

cmomsmo-onsfimfimm‘g

Software Development

o

“-

Program Aocurscries.

gaphics have agpearul in Ncwswcck und Tun: Imgxxinu zum;olhcn. Axzinwiion Clips hlve lppezud m: mit-m] T.V. und griphics supponhu bocnpvvidod {u doctronics. mginccrixlg. urdfilccunul und Inediml fixms. Let AnBase hnndle ynnr nur pmject. Clip-Art.

Anfänge.

‘I

I IIIIIIIIIIII_—

LTERTEX CDNVEHSIDNS |NC.

weortet servioes designod |0 n1ee1

— —

a varioiy ci convarsion roquirensenis:

— — — —

Üflk 1o Disk

Disk to Laut iypo Disk f0 Hlgh Oualiry Typ-O Hard Cooy to Disk Hort: (‘Jopv f0 m m 1 Typo Hara 000V f0 Hiah Oualiiv Type

Porthwnte O

.

.

Jim Reich Praddsnr

Software manuals written und produced using: 0 Ventura Publisher

‚ sunu «um

v 0

V“ ‘v’

Toioohono.

[004] 732-1416

PageMaker

Microsoft Word

Mac and IBM Iommls, loser printod. 3026 Wut Znddaawc, Vmmuw,8.C. 731-6787 ‘Ph: Comww Papst May 1988 v i9


ACCOUNTING ACCESS CENTRE 290-145 Chadwick. North Van 984-4671 Redford Acmuntlng May 4.5.6. 9 1111-12 5180 BARKEL 211 -3030 Lincoln Ave. Coquiflam 464-8717 ACCPAC. Bedrurd Computer-lau! accolmtlng phone for dual: COMPUTER HdPlRE 4162 Main 879-4162 Newvlem Acctng Call fo: datcs C 0 L A N D Van. Bmnaby. 533-6152 ACCPÄC GL nur May 12 V 5180 DOPPLER TRAINING CENTRE I01 W. 51h. Van 875-0261 Redford Accounting full da34. PvIay 3 8c24 517S MCKAY TECH. INST. 2151 Bm-rard. St. Van. 735-7221 Call fnr dates Computerized Bookkeeping l2 ‘Neuss PBSC TRAINING CTRE 1350-1140 W. Pendnr S: 689-7272 ACCPAC General Ledger, May 10 S195 ACCPAC A111, ‚w, May 5 5195 Redford Accounting. Ms)’ 30 S195 PCTI 200-247 Abbot s: Van. 682-5448 12 hourtoumes ACCPAC May 7.Max 23.124 3150 Redford Accounting May 28 S150 PRECEPT COMPUTER ‘CENTRE 735 Cladt Dr.155-3198 111m) t0 Eeqford May 16.117. 26127 2 sess. S130 Intro h) ACCPAC M13: 18719. 30731 2 sexs S130 TXLÄM ANAGEMENT Hotel Gaorgia. 876-7117. 9-12 AM NewViews Accounting May l8, Im:I5 PH: VANCOUVER COMMLTNHY COLLEGE 875-8200 ACCPAC lntro May 18/19 7-10 pm S130 ACCPAC Intro Mny 30/31 9-12 neun S130 Redford lntm May 16/17 7-10 pm 5130 '

.

Redford Inlro Mty 26/27 9-12 noch S130 Redford Aoctng May 14 94:30 1:11 S115 ACCPAC-Easy M8)’ 27 8c11m 3 9-5 pm S150 VANCOUVER SCHOOL BOARD 736-7241 ACCPAC CL5 wk: Mny l7 840px: 330 ACCPAC All’ 5 wks May 18550-7230 W1 380 ACCPAC Am 5 wks May 188-10 prn S80 ACCPAC Inv. 5 wb Mag 198-10 ptn S80 Badfard 5 wlts May 17 5:30-72:50 er 8-10pm 530 VAN. SOFTWARE CENTRE 300-1190 Mclvillc 669-9800 Redford Acwunflng Msy 12 9-5 pm

COMING EVENTS Paciflc llln Computer &Conmunicatlon Show VancouvuTrade Centre Nov. 1.2.3. 433-5121 Helen

Database

-

-

PBSC-ISSD-IMO W.Pendcr St 689-7272 20 v Thc Computer Pnpa Muy 1988

hflC-ROAGE 3509 Was: 15th Alte. Van: 222-1010 S175 Autolisp Mag 30. 31 SIMON FRASER UNIVERSE? Elginouing Schau: Seminar Raum-IDEE SFU 291-3844 BH Erpm Systems 8: Shell: Mzy 30-31 9-5

GENERAL INTEREST Mothcr’s Das

FLALA. BONNER 810-1112 w Pcnda: 5L van, 584-1022 ParenrJChfld Day LrIay 7. Pticc fut 3: S150 52Uhr Drop In Tinte Mny 14. 28 Publlc Iggal Eduadon Sociexy 688-2565 Kam: Iohnscnor kann: Taylcr 150-900 Hcwc St (Snxithc St aurmce) Topic: COMPUTER LAW, May 2 a:19 ‚ NIC Vancouvet’ Enterprise Forum Discova-yheane. HCPO Sind 430-3533 Tuns May 10 512.00 per person Robotic Systcms Laumann-m! Ltd Bnffa 5:30 -7:00 psn. in ‘Theatrc Alczuxfinc. Fonnn 7:60 Vancuuver Scheel Board 735-724} Computers in the Legal Offict 580 SwksMay l3 S-IOpm Sales 8: Marketing wir]: Computers S80 May 19 5 M3 550-7550 pm Making Money from Mailing Lists so Mny 19 5 wks 8-10 pm UBC 222-5222 PERSONAL CONIPUTER WEEK M83! 9-13 91m -4 pm Lab. 01d Boqkstorv: 8375

DESKTOP PUBLISHING (See also NEW IJACIMQWHSECTION below) BCIT Bumaby. Full Time:432-8419. Part Tzme: 434-1610

.

S300

BENNDORF VERSTER 380 W 2nd A1‘: Van. 872-88821711’: Cannon Express May 4/18 l-4pm 325 DESKTOP PUBUSHING TTAINING CENTRE 400 1190

Melville SL. 681-2535 Call for May =Schcdulc Venurn. Paggmaker _ DOPPLER 101 W.5th. Vmcuuva’ 975-0261 "' Ventun Mty l9 n}. 20 975 S350 PagemnkerMay 26 ä 27 j SLVIII. 6844m FIALA.BONNERBIO-IIIZ W Ventnra 1 dayoomse May 6.1433" 31 S750 NHCROAGE 3609 W 16th AVC, Vnnouvc: 222-1010 tun-o mAntocad May 16. 18 j‘ S175 " S175 AnincadMayiil +11mc2.4 PBSC 1350-1140W.Fand: St 689-7272 (cdl für statt) PC Pagemahr S195

Vcntura

.

PRECEFI‘ 735 Cluk Dr. Vannouvu. 255-3198 DTP Ventura May 16/17 8 houxs. Intro to DTP 6 honrs Mzy 24075/26. 30I3l

8

INTEGRATED SOFTWARE DRAKE Suite 100 -1111Mdvi11c 5L. Vn669-8789 S175 Symphony 8S ü Graph May 9.30 27 5.175 Msy Symphuu

S195

S190 S13 S190

Pagcmaker May 19.008 hours PRIMA 207-3900 E Bumflay. 2944567 Ventnr: Introducfiun Mny ll. l8 1 day 31W Venwra Adv. May 25.111116 1 1 dpy S180

687-4255

Computers und Publlshlng: Speclallzed er Stngle Tlfle -Technohgy Mly 6 & 7 Publishing Using the New

S195

Dcettop Pnblishlng Tools: AlterltltlveApproaches Mly 13

S160.

SIMON FRASER UNIVERSITY

Enggineering Science Seminar Room-IOIÜB SFU 291-3844 S160 Desktop Prcscntaüons May 27 9-5pm VANCOUVER E L E C T R Ü N I C PUBLISHING ASSUC. BC Club. 750 Pacific Blvd S.. Vmcouvai’. 731-5887 Microsoft a:Knowledge Navlgator Video May 2 Mac SIG Nelson Rcust 683-2341 Wcd May 11 VANCOUVER C0 COLLEGE 875-8200 vmun Mny 15/17 830-1230 pin S190 S190 Pngemaker Mny 19/20 8:30-12:30 pm 4 wks 7-10 19 5190 pm Ushlg Pagamnltnr May VANCOUVER DESKTÜP PUBLISHING CENTRE Ltd 1150 Homer St 681-9161 Call für Start Tinas Ventura J unlor Level full day S159 S159 Ventura Senior Level 2 eveningq ' S69 Dutktop Dnlgn Cllnlm I4 pm Vcntura Publisher — Cun for Dants VAN ‚SOFTWARE CENTRE 300-1190 Mclvillc 669-9300 S300 Intro to Venrnra May 9 G:10 2 da)’ oourse Advancod Ventun May 3 S180 ‚ Intro mPngemaltcr May 24 Ja 2.9 2 da37: S300 S180 Advanccd Pnaemnker May l2. 30 1 day VANCOUVER SCHOOL BOARD 736-7241 S120 Ventura May 18 5 wks 5230-7011:): 8-10 pm

_

Mxy 8 M3)‘ 23

Victor}; Da)!

VAN. SOFTWARE CENTRE 300-1190 Mclvfllc 669-9800 Intro dBASE 111+ 9-5 PM May 5/18/30 S180 S180 IqtendBASE 111+ 9-5 Muy 12 5

DTP PC Pagemaker Mny 28 5 wks

51X1

EXPERT SYSTEMS

3.......

SIMON FRASER UNIVERSITY

ACCESS CENTRE. Louüdale Quay Nonh Van 984-4671 dBase III + Start mytime. Computer band training-sclf pwcd mtarials (average 20 hr5. n0 max.) 5140 BARKEL 211 3030 Lincoln Ava. Coquitlnm 464-8717113832 111+ phmc fur dctails CÜMPUTERLAND Vanc. Burnaby. Richmtmd 683-6152 Intro t0 1:13:53 1U +‚ Mxy l3 V, Mny 26 R 5180 dBase 111+ Intermedlate May 18V 5130 CÜBIIPUTER FLACH 360 Burrartl 51. 688 €992 I N T R Ü CIBASF. 111+, M1)’ 3 S179 INTERNE-D. dBASE 111+. May 24 S179 COMPUTER STATION 213-0 Bmlrd St. Vm. 732-3621 111110 1o dBase III +. 1 Day 71m5. May l9 5175 Intlrmldht: dBuc 111+. Mny 5 "S175 DRAKE Suiu: 1W 111l Melville SL. Van. 669-8789 dBase 111+ Intru May 4, 27 5175 dBase III-I- Interna. Mly 2S. 30 S175 DOPPLER‘S TRAINING CENTRE 101 W. 5th. Vanomnrer 875-0261 dBase III + Intro 1 Day course. Muy 5 S175 FIALA. BONNER 810-1112 W Puder St. Via-L. 684-1022 dBASE 111+ 1 Daycomsc May 24 5175 MICROAGE 3609 W 16th Avn, Vancouvu 222-1010’ dBase H1+ Part I Muy 10 S175 5175 umso I11+ Part I1 Mly 19 PCTI 200-247 Abbot S: Van. 682-5448 12 hour counnu dBnsc 111+ Muy 11112 5150 5150 Rom): Plus Jung 25

Ventnra I1 MA)’ 155230-750 ot 8-10 pm

S195 dBaseAlJI+.1N1ay2 G:24 dBuIIlI-I- level 2.May5 S195 S195 dBaseflI-o-levellhflxyz‘? PRIMA man 207-3900 E Bumnby. 294-4557 Database Using Clipper l-5 PM.- 3 wks S150 Rehtionnl Bauhaus 7-10 PM. 2 w e h S75 dßaseflhlntro, May 17.24 lday Slfl dBasem+ Advanoed. May 31/1911:": 5m VANCOUVER COMMUNUY CÜLLEGE 875-8200 5140 lnhntodBulfll-i-Mxylhmajrw ' Intenn. dBnse 111+ May 5 9-5 ‘prn S140 Designlng Relaflonal Databnses May 158105 VANCOUVER SCHOOL BOARD 736-7241 dBasc 111+ .May 5-6 all day S125 dBase III-o- May 18 5 ‘x114 550-750 S80 dBase 111+ Adv. Iviay 1s 5 wks 3-310 m; S80 1182s: IIU-I-PmgMay 165 WksB-‘IOpm S80

-

PBSC 1350-1140W. Funde: St 689-72726211 für Star!) S195 Symphtmy Ievel L Mny 13 6 5195 km13. Mzy Symphuny VANXUVER SCHOOL BOARD 736-7241 S120 FramcworltlIMay 175wb ß-lOpm VANBOFTWARE cmms 300-1190 Mdvflle 669-9800 1mm FRAMEWORK n may Mxy 12. 155m 5181 mmsmwonx L 113-5 PM May 10.27

n

LOCAL AREA NETWORKS DRAIG Suite 100 -1111Me1vi11e SL. Van 669-8789 Novell System Managerl dxysMay 5&6 S415

MACINTOSH ADWLNTAGE COMPUTERS ÖSS-MACS Suite 1760. 1 34:11:11 Ccntrc 505 Bann‘! SL Tims: 44...11. 8:30 - 12:00 3.31.‘. P.M. 1:00 - 450 p.m. Intro 1o Mm: May 3 AM- 19A31. 27 AM. S30 530 Internet! 1513€ 51a)’ 6 AJIL 16 AM.. 30 AM. 530 lntro t0 PageMflter May 12 PM.E A...“ S150 Intcrmed PageMnker Mny 5.23 8230-130 530 lntro in Microsoft Wo r t : May l6 PM. Intro mMs.Word May 3 PM..May 12 AM. 530 Mny 19 P.M„ M1312"? PM. Inlcrmrd MS.Word 113348.2‘3:30-41:30 5150 Inuwotohlicrosonßxcelhlaymlxjn. 080 Intrn to Hyparcard Im:1 ALM. S30 BCIT Full Tinte: 432-3419. Part Txme: 434-1610 MS Word (PC & MAC) 6 ‘V16 M8}! 23 395 Richmond 683-6152 COMPUTERLAÄD Vamp. lntro Word (MAC)Mly 5 V. 16 V.31 V 5180 slao Intern: Word (MAC) May 11 v, 36v S180 Macintosh Basic Sldlla Mxy 3 V.2AV 5180 Intro Macintosh Pagcmakcr Mcy 6 V S180 Macintosh Pngemaltcr Intennßäay’ 19 V Fotkmm Design. 986-8060. Dovnuown Vmc. S175 Aldus PngeMaker. Mny 16


ü

.

I l g '

Ü.’

-

>

1 ‚:

— -=

(‚wir mawxüasaffigc‘‘f:».‘-‘"T*'F:°f=‚-‘‚-’"-“.«1‘"-"=

‘E

<

-

'

::.J"1"Ä"

-'.

Excel Intro (MAC) May 17 V, May 27 V ExmllntormfMAC) MIyQV

5180 S180

Microsoft Wordlongdoammhlayzfi S175 McKAY 2151 Hurra-d St. Vom. 736-7221 C311 for details Desktop Pubmamgronphicmuxz wach SOFTSHELL 4692 Quebec Street, Vanc. 876-5790 Hypnczrd Prodocflvlty Workshop S130 May 21 9:00 4:00 Byte Shop Barren-d S: 6th Exoel Tlps und Shoflnlts June4 ‚ 9:00 4:00 Byte Shop. Blzrard S: 6th S150

-

OS/2

„Au..-

2;"-

.

'

-n‘;-»;.—_t‚L-= i5:

A:

“z, .;-

-

.

THE COMPUTER PLACE 860 Btn-md St. 638-2992 INTRO osrz May 31

S179

OUT OF TOWN Canadian H! Technology Show 0111W: May 3-4 (6131131-9850 CIPS Congress 88 Information Power Term-m M3}! 18-19 124165934040 CITEX ’88 Tolowmmurficutions Exhibifiorl. Toronto May 13-19 (416)274-5S05 Comocx Spring Adam: May 9-12 (617) 449-650 Intn'l Symposium on Medlcal Informatics 8: Education Vicmri: May 15-19 (604) 721-8475 Montreal International Computer Show Jun 8-10 Monfidfl 1416-5505 Unlx 88/211‘. Man-oToromn Convermon Cemre. Mty 17-19 Call Fawn Lobmm o: Ion: Annan (416)239-3043 ‚

l

PROGRAMMING & DEVELOPMENT

am

Lotoslßlnuodocfloughiay 18.751day Lotos Advmced 11m9 l. 8 1 day VANCOUVER COMMUNTTY COLLEGE 875-8200 Intro to Lotus 123 1 day Mny 14.26 Intermedian Lotos 1 day May 27 Advanced Lotos 4 wks May 4 7-10 pm VANCOUVER SCHOOL BOARD 736-7241 Lotos 123. May 26-27 n11dny Lotos 5 wks Msy 17 5230-750 m’ 8-10 pcrn Lotos 5 wir: May 19530-730 or 8-10 LotosLlI SWILSMay 18530-730 Lotos Accounting 5 wks Mny 19 8-10 pm:

.

S180 S130

S140 S140 S160 S125 S80

90

S80 S80 90

VPPhnnerLcvJI Mq141-3m1 . Excel 5 wk Mny 17 8-10pm 9| MSWort: 5 wh May 16530-750 pm S80 880 Power User's Lotos May 19 590-730 pm‘ VADLSOFTWARE CENTRE 300-1190 Mdvjne 59-93% IntIoUoLntnsIBIDayMIy-torw

InhermedhhIAmlDayMzyßorfi

S189 31H

1

PullThnß: 432-8419, PmTüne: 434-1610 Computer Systems Intro May 28 6 wks

S139 Inlmbfilochonla M-Fmaylsswlu 8299 COMPUCOLIEGE Vanoonxver 682-6600. Bormby 435-2424. Richmond 273-0373 Confinooo: intakt: Call [er statt.

Computer Programming & Systems Analysis 480 110m: Foll Tim: Diploma Counc Micro Computer Electronic Technology 480 honrs Fall Tim: Diploma Coursc DOPPLER 101 W 5th Ave. 875-0212 dBase III + Programming Mny 6 VANCDUVER SCHOOL BOARD 736-7241 BASIGMay May 175 wks 8-10 pm CLevalH Mly 165wks S-lflpm

S175

530 330

SPREADSHEETS ACCESS CENTRE Lnndsdzle Quxy N011}: Van 934-4671 Lotos 123 Sun myfimc. compota basod oaitxixtg-selfpaced S140 mtorinls (M20hr5. no max.) COMPUCOLLEGE Vmcuuvcr 682-66113. Bmnuby 435-2424. Richmond 273-0373 Conülmorus intakt: call fot sxan. Micro Compooner Business Appllcauons Cmmc 480 hmns Full Tim: COMPUTER PLACE 360 Donald. 588-2992 S179 Intro Lotos x-z-s Mly 4, 108c 13 Im. Lotos 1-2-3. Mly 5.11& 19 5179 C0 Van. Bomaby, Richmmld 683-6152 5130 Lotos 113 Intro Mly SR. 9V. 18326193011 S180 Lotos 123Intern: May 13 B. May 27 V 3130 um m AdwnMxy 2o v COMPUTER STATION 2130 Burrard St. Van. 732-8621 5325 F851Trank lahm Mly 111m2, 261k?) Intm u:Lotos 123. May 11. 26 5175 S175 Intermedlnte [ u n s123. May 12.27 DOPPLER 101 W. 5th. Via-wovor 875-0261. um: 123Inne.Mly 17 3175 5175 Lotos 123 Advmood. Mny 31 DRAKE Suitn 100 1111 Malvills 5L. Vmc.669-8789 5175 1mm Lotos 123 1 day Mny 11. 20.31 FIALA. BONNER 810-1112 W Pmdct Sl..Vm.. 684-1022

-

TELECOMMUNICATIONS

PBSC 1350-1140 W. Pendel’ S! 689-7272 (cfll for stxt) . S195 Crumnlk 31-3844 . SIMON FRASER Semincondnctocr Lasers 8: LEDs for Telntounmunluthm ' S105 Mxy 4 9 4 m VANCOUVER DESKTOP PUBLISHING CENFRE ua 1150 Homer St 681-9161. Slqahcn Osbomc. Roody Gnom S129 Managing a Modem 1 dzy Call im‘ domes

USING YOUR PC

S65 CompodngforrheT1m1d4WksMay9 Wks 6 DOS 24. Coquillun Bmuby: Mgy Understanding 535 Mny 30 COMPUTERLAND Vanr... Blonnby, Richrmnd 683-6152 Intro mMlcrm Mly l0 V 51H) 51H) 1211. 17V‚30R DOSMqyIIV. THE COMPUTER PLACE 860 Bin-lud St. 2993003 5179 MS-DOS M1)‘ 2 ä 13 COMPUTER 51'ATIÜN 2130 Bonn-d St, Von. 732-3521 Intro DOS 1/2 day S95. Muy 4. 13. 2.5 5160 DRAKE Suite 100 111l Melville 51., Von. 669-8739 S125 All Da] DOS Mny 12. 2A 5125 Advanccd DOS Mny 13 DOPPLER 101 W. 5th, Vmnuuvcr 875-0261 5175 Intro DOS 1 Dny Evezy Man May - Sept 684-1022 FIALABONNER 810-1 112W Penda- SL S175 lutroductlou 0o Coupons Mag 17.21

-

.

DOS Level l Mqy 9. 25

9

14.»???

15

16

3 10 ‘I?

22

z;

24

icf-Yfi-Jßirl

29

an

31

-

'

‘.

4

5

s

7

11 1B

12 ‘l9

13 20 27

‘I4

z

25

21 29

PBSC 1350-1140 W. Puder S: 689-723 lllhnlnMlcrns Mxy 1B DOS. Mzy 4. 16. 26 Advuced DOS. Mny 19 Das Level 1 a:2, Mzy 21

S15 S195 5195

ms

PCH200-247AbbolSlVm. 682-544812hoorooors6 IntrolBM-PC&PopuhrSonnr-e Mxyfllhhylfll? S150 dlys und Moy 2613m: 219/16 PRECEPT 735 Cluk Dr. Vanowver. 35-3198 lnifrobcumpuflngflßhfl2scdmnslurmx Mxy 16/17. 26/27. 4 Session: May 30.Joac 2 Hnrnessing DOS May 19/20 8 @

S110 S140 PRIMA 207-3900 E.Hastings Van. 294-4567 Call for stmDOS Introdoctitiu. Mny 9.16 1 dsy S180 DOS Aclvanud. May 30.11111: 6 1 dxy

5180

VANCOUVER COMMUNTIT (IJLLEGE 875-8200 Intro Computers Stur: Mxy 7512104121 S130 Intro IBM PC a:CompatiblesMay 16117 S120 Intro to Personal Compoting M13 l0 560 S105 XnowYourPCHar-dwareblayllday S140 Harnesfing DOS May 19/20 1-5 pn 2 saß. Intro 0oMS-DOS May 7 1 da)’ 9-4230 pm S115 PC 815mm Software Mzy 10 Swks. m m 1 S150 S150 Using PC DOS May 21:28 930-1230 2 scss Boten File Prag Islzy 14 950450 1 du S105 Bord Disk Management May 15 1 da)’ S115 VANCOUVER SCHOOL BOARD 736-7141

HIrGDiSILMmMLyISSWkSBO-fiflifll IBM PC 1|1|11). Mny 19-20 IBM PC Intim. M1}? 16 5 W1: 530-750 PM

IBMPChuvMay165wks340pIn IBMPCIRUmhhyISSWKSÜO-ESOPL! IBMPCInuo May185 wks 8401111

S80 511S Ü

580 S” 58|

X IBMPCLEMQIGSUESBOJÜOPLI S” IBMPCLII MxyloSvksß-lopn S” Undushndhg MS-DOS M13 183-10 m: VAN. SOFIWARECENTTEWO-IINMÜVHEGG9-9UN -DOSOr1mIIIbI9-SPM Mzy2or17 OE VANCOUVER DESKTOPPUBLISHINGCHWFRELM

1l501-1onmSt681-9161‚Sqinm()shan:.RodyChom S119 Intmducflon MSDOS ean for smdnes 869 rang Command ofMSDOS Superman-ging the omee PC

sm

S129

‘Prouhlashooflng 1mm:

WORD PROCESSING ACCESS GENRE. Landsdale Qoxy Ncrlh Van 984-4671 Word Pefloct,MS Word, Dhphylflußhlthlah S111

myrimqoonxpowbasadu-airmrg-setfipmednmxiahuvaqcm

ACCESS CBWTRE landsdale Quay Nord: Van984-4671 based Basic Operafing Stils Smn any-time. eomp. S125 Iraixlhlg-self pncod mnominl: ( “ . 1 2 hr3. no m m ) BARKEL 21l - 3030 Lincoln Avo. Coquidun 464-8717 MS DOS Tnmrhl phon: f0!‘ douils BCIT Foll Tim:432-8419. Port Timc: 434-1610

.

z

8

-

Lotos 113 Incl l 1 Day May 4.20.30 817S Lotos 123 Level 2 1 Day May 12 5175 Folksrmme Design. 986-8060, Duwmown Vmc. Microsoft Enel, Mny 14 S175 4010 MCROAGE 3609 W 16th Avo. Vanoouver ‘ S175 IAÜIISIZJPIHIMJYÖJ?! v Lotos I23 Port I1Max 24 S175 u PBSC 1350-1140 W. Puder S! 689-7272 Lotos 12.3Mxy 17 519S Lotm 123 level 2.Mny 24 519S Lahm 123 Advancul Min-m Mxy 11 S195 " um For nxecuuws. May 14 5195 5195 Supercnlc 4 May 16 PCI‘! 200-247 Abbot S: Van. 682-5448 12 hoor courses Lotos 123n Mny 4 1 1 m g 9/10 mähyzaßwmwu 55 515|) ovenings Lotos 123 Macros Mly 21 S150 1.‘ PRIMA 207-3900 E Hsfings. 2944557 m11(o: um dates

„jfzff 1

*"

S175

S175 DOS Live! 2 Mcy 9.25 MICROAGE 3609 W 16th Avc. Vnnoouver 222-1010 S175 Intro 0o PCs/DOS May 3. 26 S175 Advmcod DOS Mny 27

51l) hr5. m max.) BARICEL2l1-303O Lincoln AvaCoqtxiflm 464-8717

Wnng, Word Pcrfect, Wordshrfiuac fwdcufls BCIT Foll Tone: 432-3419. Part Time: 434- 1610

595 MSWMflCPC&MAC)GWbMIyTZ3 CONIPUTERIAND Vanc. Domain. Richmond 683-6152 51m DisphyWriteMay 3 B.May 2o RMay 31 a Intern. 24 V S!” Mzy DhphyWrIn MS Word Inlro Max 5&6 V, May 164117 R S375 5325 MS Word Interm Mny 10m1 11:26:12‘!!! MS Word Advancod MQQOB 51m S1!) Molümate Intro May 10 B. May 25 V S187 Molflmatn Intnrm Mny l9 V 51m Minimale Adnncod Mzy 6 B S325 Wordrerfect lnrro May m m 1 9:274 ‚I95 R Wu-dfefed Intern: Mty 2 V.Mty 19B 51W 513 WordPerfect Advancad Mly 11 B THE COMPUTER PLACE 360 Bomni St. 638-2992 5179 UVTRO M5. WORD May 5.29.30 INTRO WORDPERFECT MIJ‘ 9 6c16 5179 5179 INTERMED WORDPERFECI" May 1317 5179 INTRO WORDPERFECT 5 Mly 26 S179 BNTEIIMED WORDPERFECI’ 5 Mly 27 INIPUTER STATION 2130 Bin-ad St. VmJSZ-ÜGIIWIIG Proanlng. WmdPdGCt. bis-Word. Mobiliar: Displlywfiß AJntroorMvu-aod. ldayeome. Rcpeanlulny l0. 19.31

S175

‘fiüxunpomiopu Maar Im.-21


10l W.5Lh. Vmwuvu. 875-0251 WordPerfett introdncüooMay 18 S175 Mluuann Word lntrodncrbu-May 11517s Multimnl: Advmced. May l3 S175 S175 DkphyWflte IV lau-o May 4 DlsphyWrlte IV Advanced. May 2S S175 DRAKE #100 1111 Mclvilk 51.669878? MultiMnte-Inuudnction May 4.20 S175 MniflMate-Inmrmadhte May 1D S175 WordPerfect-Inuo Mxy 2. 10. 26 S175 WordPerfect-Intelmedhte May 6. E5175 DisplayWrite Llnboduction May l8 S175 DisplayWrlte tt-Intermediate May 193175 MS-Word-Intrnducfion May 5,24 S175 MS-Word-Intermcdiate Mxy 16 S175 S175 Symphony Word Phon. May 31 ‘FIALA. BONNER 810-1112 W Pcrxdcr SL

-

SPHING

&SUMMER

SPECIALS

Refilled To n e r Cartridges

Canon. HP. QMS. Apple and others

Serles!

Canon. HP. QMS. Apple and others

Series II

-

37995

New Toner Cartridges

Canon. HP. QMS. App1e Serlesl

Canon. HP. QMS. Apple and others

Mulflmzi: Advmtnge L1 Word Level 1 Mxy 5 1 Day S175 Ward Level 2 May 23 1 Day 5175 WadPu-fect L.1May 2. 18. 26 1 1321318175 WmflPufect L2 May 101 Da}; 5175 Disphywrln 4 L1 May 13. 16 1 Day S175 MICROAGE 3609 W 16th Ave. Van 222-1010 MS Word Part I Mzy 12 S175 MS Word Part II May 20 S175 Word Perfett Part I May 9 S175 Word Perfect Part II May 17 S175 PBSC 1350-1 140 W. Pender St 659-7272 S195 DisplayWrite 4. May 6 4 level 20 2. 5195 Displaywrlte May Micromft Word. May 9 & l9 S195 Microsoft Word ievel 2. May 12& 245195 Microsoft Word level 3, May 31 S195

36995

86995

Canon PC Copier

and others

‘Van. 684-1022

Senes I1

S1480°

S1580°

Multlmate Advantage I1.May 6 S195 Multlmate Advanhg l1 L. 2. May 135195 Mammon Advanmge I1 L3, May 26S195 Sauna Word IV. May 4 SamnaWordIVlevel1Mxyl8

Lateral File Cabinets 2-DR Recessed Front 3-DR Reoessed Front 4-DR Recessed Front

REGULAR

SALE

S486“ S660“ S809“

8369”

Computer Chair E124

Gas L111. Swlvel. Fully Adjustable. Comfort-Formed

Aufl-Statut F100! Mute

Surge Protector Bars G-OUTLET

3' X 4' 4' X 5' #50165 #50170

S469”

S599“

REGULAR

SALE

S279“

8199W

S189°°

S149“

8250“’

349°‘ 569°‘

3194” 539°‘

359°’

wrrH NOISE PHOTEGTION

Computer Labels 31/,

*

x m1.;

bax of 5.000 bax o1’ 15.000

Royal Beta 3000 C automatlc comection

REGULAH

SALE

S59“ 3177“

839"

O daisywheel prmter O nlce touch O medlum duty

SALE

0 auto-underscore

2.2 -TheCompulcr PnperMIgI1588

S

S699“

WordPerfect level 2. Mxy 17 & 27 WafiPaiccl km13. May 25 S195 fpcn 2011247 Abbau s: Van. 682-5448 12 m. I Mum-zshuMxyfi/zsmuy 30/31 5150 MS Word 4.0 Mty l4 5150 S150 18119 wordrurectuuay ‘PrmAN 1490w.Broadwxy. Vm. 733-7343. Word Procaing Concepts 8LTheories;

-

Appßaflons; Prndncßm: Advanced

PRIMA 207-3900 E Hastings. Bum. 294-4567 S180 Using WordPerfect 7-10 PM WordPerfect lntmMay 128: 19 51W WordPafcct Advnccd. May 26 S180 SIMON FRASER UNIVERSITY 291-3844 3 MS W011i (Beginnen) Mxy 14 1111 day5l25 MS Word (Intermediate) May 28 S125 VANCOUVER COMMUNTPY COLLEGE

875-8200 Intru in WordPerfcct May 6.28.31 5130 Intermedixle WvrdPerfect May 9 5130 Intro to Multimm May 12 5130 31511/0111 Sims May2ar94wks S150 VANCOUVER SCHOOL BOARD 736-7241 Word Perfett . May 12-13 all day 5m 1411111111111: Mxy l8 5 wlu 8-10 pm S80 WordStar May 16 5 wks 8-10 pm 530 WoliPerfect Mly 16 5 wb 5:30-7:30 S30 Wohdhrfect Muy 165 11b 3-10 11x1 S80 wordrerrect LIMay 19 5 wks x-m prHSBO MS-Word L2 May 165 wb 530-750 S30 VANSOFTWARE CENTRE 500-1190 MelviIk 51669-9800 Intro 9-5 PM May 2 or 20 5180 Mulflmat: InIIr..9-5 PM Mry 9 er 145180 Intro WorüPetftct Mny 4 o1 17 S180 Wm-dPu-fect-Interlned Mxy 11 or 2143180 1111m MS Word 4 May 6.19.31 51W MSWord 4 Im. 9-5 PMMay 13/25 81m V

REGULAR

Electronic Typewriter

WmdPeIfed. May 5 ü 20

3119”

5195 5195 519S 5195

USER GROUPS Anligl [herGroup Same: Cmmnmisy Centref-‘lfld E. 5151 a: Frau’) Dave Allen 270m64.

GenualMeedngMxy 117:30PM Beginnen & Progr. Mag 25 BCIT Rm 129A 7 PM AppIe II User Group Bumnhy Rugby Club 437-9935 Apple III SIG Momhly Kiyo Mnsuch 437-9935 Apph B.(‘. Cmnpnta‘ Sucht; Kiyn 437-9935 Beaver Valley Commodore Club F115: Tucs Manaus: School htiraryJohn Vink 367-6426 Clipper Developer's Asociation Maus fix: Monday of month a: SFU David 873-0747 Commodore Computer Club First T115. SLmsaCouun. Cuc. 7318-3311338 271-1032

DPMA Mcmber Bmeflt 331-5511 Video ‘The Skfs 1h: Limit (Pan I) Ptofessiomzl DevMxy 17. 5:45 13.111.

Kaypro Users GroupNnncouvcr Portable Compumr Club 3rd Monday of 111e momh. KaypIoCmadahRidmmndßBCP/Musas weloome) 278-5776 Mac Um Group Meeting BC Apple See-Lot)‘. WCB Buflding. 6951 Wesuninsta- Hvry (Kiyo Masuda) 437-9%5. Mac SIG Macmillm Plzulclariun: Archie Reid

985-5530 Mainhnd was: Meeting 7:30 PM 2nd Wednesday Rm 115 Kwanflen Collage. Sumey. Las Roberta: 437-9935 Maple Rüge Computer User Group 4672647 Rm2012 Maple Ridge Sr. Secondary

56211001750 PMJndTues. ofIhemonIiLI-‘ree NEC APC Users Grell]! Bi-monmly 1.3980-

5825 North Anna-Ion Anna-ad User's Group. Fnr ncmlelm’. munbcrship 9515m send SASE.m: 65-13880 -74th An. Sorte)‘ V3W 7155 Nord]Neunte Users PtuWhiclzw 6698789 saqxporu LANs, rneers monmly. Port Coqniflam Computer U913 Grocp MoeB1st&3rclTuaPo-coRccCa1ut2lW Wilson Ave 942-4286 T1 Computer Club moets 2nd week 0fach monflt in Caxtml Richmond Phon: Keim a: 261-2739 fcr deuils The Nur Apple Alliance May Chow 435-7609 Last Satmflay o!’ the month in Kisilmo

Neighbomhood Hause. Vnnoonver Neunte Usefs Group 1.108 Lebbrant 275-2829 fisxMondxyofmenunm Vanoouvcr PC Users Gmup, MacMillan Planeuriutn 438-6009. SZINye-Immtberxhip. 7:30 PMT1111 May 12 Vantaxi 3096 EJ-lastixlgs (Hastings Communixy Cmtrc) Lmhy Wong 751-4901 7:30-10:30 PM (2114:! Wod) May 11 wang System User Assochflnn 736-8841 ext 227 I-P Doim 99UsersCo-op {fl-99)2ad&41h1'hurs7pm a1 Cnneron Ru: Genua. Bmnaby 526-3389.

830km:


v

A.

‚. '

_

m”

um‘

391m?” mlmäfläg” c

'

'

15a,"

„‘

.

‚"

(r

Title

34,3.‘- .-.- ‘v. r_r:'-*-.-'C— ‚r 15mm

dBasI: III-O- Hmdbook 2nd Edition dBase III+ Made Easy ABCs of dBase 111+

rnimd

man.“ m.‘VPPlumuußedfiotdwordPer-

unsrem:- runusamc

fest 6c. ACCPAC GLAGUVGIMDHI Wage subsidies available für m thejob trainins

EMPLOYMENT WANTED

Insid: Karo: Vennn Fahl-Han-

Vcnnm Tips und Tricks Tcx Bank

cmplnymczu omumnxiües. Call Shirlsy MacDonald Pausen Compnmr Cent:327-31225 MANUAL WRITER. Software 6kHaufiwm. lookjng for pmjeacs. Also on-screm jxototyping. mlnrixls mdpruenufiom will: Bricklin Darm) ptogxnm. Ren Kirkby PhD. 684-4711

EXPERIDTC SECRETARY. WJ’. 000.396. 8OWPM typrmg. Dicu. edith-ng. will min an

Desktop Publishing o: any machlne. Prefu‘ gxuwing cmnpute: company downmwn. Tel 736-0623 INDEPENDENT CÜNSULTANI‘availahle for 00x11mm job. More man I2 years softwm: expefimce. Spccinlizhlg in IBM PC and Clipprx. Mr. Hhhan Wnflg 373-4373

D03

ms

GRADUATE. VW. permanent full time ukc pm (im:t0 zum. Call arrxplnylnexit. May Don 38-6957

Amdcm Anbau! Umbau: Bock Imidl:

SOFTWARE ‘ RATE!) Fznncwuk II symptnuyauaßüum MACIQTOSH Cognplelze hmdcMach-Imsh V015 Miaoiofl Word M fl :Easy (MacVßß)

oomputm’ system.

1e:us d0 the shopping for yon. COMPUFIND The tmbiased compmer advisors. 669-5588 Four Bmlall Cmuc. 1724 405S Dunsmuir St Vancouvcr V7X 1B

n1

Im.1 Mag. 800 K am 2o Mag HD. keyboa-d. programs, 5475:1 m. mm463-5233 MACINTOSH 5E 20 HDS4500 also 20 Mao 14x93mm I-Imu:Dann SCSI von m: Mac CALL HARIAT 731-7499 MACIIWTOSH SE 1 Mag RAM orte amK imemal dflvemmngfiD. stillundawurtufly S4000 MACINTOSH 512k ulhmcad l mag RAM.an: 800k inlcmalüivc SISWPROGRAMS: Quaxkxptess. Macsarvc 2.3. m as a 51000. will sell

MISCELLANEOUS snaremeßook ApPhiorks Mndr.Eßy

SOFTWARE CROSSWORD MAGIC softwazc man: your

T All you dzsknup pqxblishcß. hcreisyomchmcc Iowin51m. Enrertha E35: Riclunond Commmity Asmciafion Logo Design Conmr. Onc er ( w o color lcgo. submll onalmarsimshecv. Deadlirm Mendel Inne 17/1988. Sand enuies l0 ERCA 12360 Cmbie Rd. Rlchmond V6V 164 Call 273-3394 f0: man: demfls.

Syhex

Bcxsl.

Knufl:

Ncw Ridczs Pmß Peach Pi: Press Addism Waley

313.95 324.95 544.95

Rnbbinx

Sybe:

579.95

Name

“blvcnnn Samsa

H

534.95

Goodman

537.95

Bauzaun

Apple Holfxnm

Addison McGrxw-Hfll

834.95 537.95 524.95

Rock

MaGraw-Hill

321.95 527.95 514.95

Microsoft P188 Oshan:

Osbome

529.95 33.95 S3750

Mdhaw-Hfll Preußen I-hll Prmrioe Hall

833.95 537.35 331.95

Banxm

53.95

Jans: Iawbuoci

C05)

Manning 1E 123‘I'ma, Tricks ä Tnps I23 Tlp Packer Referent» WORD PROCESING UsingiwordPufea 3rd Edition Mastaing WomdPcrfec: Word' Ptocssixxg Powe: Wnh Mrgosoh Word

langarm

PCvarsion Graham 522-1588

1':

Sybex Sybcx

Douglps Cobb’; 123 Hantbook

s m c m m m ‚ANALYST by MBA IBM-

I

Hagen Cobb

lau-in

Guid: In Urin; [uns1B

5%

Ü-

05/33512 Insidcflsfl

IBM PC 5600m! Edition

5.5‘

S5335 S4550

Schild: Kanighm Nonon

F“

MeGmw-Hfll

533.95 535.95

Flym; Flighl Sinmlanx

Advmbed Tntbo C

DI

IvfimusoftPmss

I,

89.95

C Programming Lagune

m m 3 IBM x1‘ 0x AT only um 7333733 9-5

MoGraw-Hill

Jena: Vcnum RnkerIRicc New Ridus Onmxa Sybcx

COMPUTER BOOKS IBM 370 Assembly language with Assist. 1mm 1o Logic, Radioshack Pucnl. 85-15 euch 322-5924

„W

MISCELLANEOUS

Cowm

53.95 527.95 823.95

PROGRAMÄMING

1040 STATARI Momchxonle i-Macsac +

CIFOH LIPS IDPlus Lawhinururim additionxl 8 x l4" t n y. Brand ncw still in box. 4200 HPfDinblo/Epsom Emulator Dwight ssmwno

Que

Glm 876-5960

package. Call Lnri 388-1224

LASER ‘IUNER CARTRIIJGE Cordam lrmd new unopened. paid S140 scll für 575 Alari Parallel Printa- Inrnfacc. Um: ycu: Atari with IBM Compaliblc Hinter. Paid 5100. seall 550 030511511 876-5960 EPROM Programms. Shcrrex Systmns Model SPR 28W Stand alcme nr interfacc will: Schal Port. 31m1: all cunumn EPROMS Complete Documentaxion. Paid 5860, Scll 5550 Dm 433-3001

Q1011 ljnkin

McGraw-Hill Miaosofi.

OSIZ Hopunmds Ouide

-

.

Publisher

Malhcws Gulick

UsingO31’!

own mssword on Atari or Commodore. still in box. S20 obo

PCWRITE. ovcx 1009W usars. The bes: shmewmwordpxocessorhmeworld. Free dann: Henry Larndry S55 Hillsidc Ave. Victaia B.C. V8T 1Y8

“12008Modem +' Rfldy SctGo. Pngcmakozr. MSWOIII. 31700 533-4524 20MEG SCSI HARD DRIVE 170l‘ Macintosh (Rodimc) S950 Inne: 734-3995 TRS 80COLOR COMPUTER 64k S100 obo. Cussette recorder «E. pamh und:S60 oho. Colorscript W.P. pogrrn & manual S25 obo. Cablc oonvatet S10 obo. Prmv. whels 951 Tempo 12. 359 Presidmfial l2. 356 Elite l2 S10 exh obo 420-8829 "raus [NSTRUMENTS (IBM COMPATIBLE) 1oMcg HD256K Cola: Monitor. 11 355 Primat, um.WordPufecL BASIC Bast Offer 980-4834

3rd Edificn

Mumm;AmoCaI“:si:n9

Vfhm you're shopphg für yoxx

PROGRAMME! dBase III. QJCA. Clipper. Symphony. Leava aussage for Amxy 683-0864

ms

DOS 3rd Edition Running nos; n: Cuuplclc Räume:

TECHNICAL WRITER secking assigmmxs for manuaJs. proposals. newslexmrs, brochuru, press releases. compumr documcnxaxinn o: advutising cupy Call Darlmc Hausen a1 5225385

ELECTRÜNICS (COMPUTER O V H Ü N )

Author

DATABASE

SER CES Subsidiznd Micm Camping’

E“

HQRDWARE MTCIN’ SE ä moomputcr. im»

Bin: Anduson Campbell

Oslnme Sybcx Que

MHR

Que Sybex

33.95

Räumen

Nlicmsoft

529.95

retallers of eomputer books:

y '

319.50 329.95 829.95 57.50

Beachnm Knlly

rmsiaookseaserc Bestseller List ls oomplled by

.

Ü

532.50

acss Iargeel

Novlwntolnwmo FrontSLHOIIWQsImhsInISE-flfio

Westwood Lanka-sann Loughood Hwy coqulthmlfl-ssß

‚Flisfsifiäflflflbf .

o-icauv Aneinan-

ÜWQWWÄÄSWW@;I‘YRPW“Y9Ü . '

2';

(= „

..

E

g m

Vancouvorvflzikßlihm-flis

im 824S arö-suhäääilifiispibfi

‚BUSINESS Ansxksixes nie 515; 2s um: _ wurds.’ o: m. .25 Wm-:sg '

Boxcd ad: u: gigjddiüonalslo TYPWCIÜIlg

alndluyoutsewicesmavailableforsxzndou: -

_ m.‘

'

j.

Emflg;

m-wwptedr

s."

m

'

"l

‘l

71i'°ffiöe=ihä>w-:9:ä_irfißd©näaymFridayi:„im ‘m’.mizgauniym ad ü.BwCK LETi: i5 m i-‘un .' Ä agzd mattiert the caxcgoty

Müybmadm:.__.

Papa

JfHSZOS-WIBIII Ave J

_ sann lhlvcrdty Im.vamowa an. 23-4741

Thetbtnpancfipulfiylflfcfih


Pensum

Kaypro Introduces the Better Power Machine.

A division of:

Ünmmnsn

Tmnnna

Here Are Eight Reasons to Choose the KAYPRO 286. »

.....„‚‘

‚« _’

‚l E.„„5-„.-__;fa„i'x _—-

0

I

7...

1

-

.

I

.

‘b.

V

BUSlMESS AMD HOME

C

Beginner and Advanced Classes

f

l

Non-Obsolete Design. Updates simply snap lnto

-

N

Course

Day

Nlght

Intro 1o IBMIXT &Popular Software programs

Sat, May 7, 14 Wed, May 11, 12

Mon, May 2,3

Mon, May 2.9.1623 Mon, May 30, 6, 13. 20

Intro to Lotus123

wed. May 11, 12

Tues, May 10, 17, 24. 31 Tues, June 7. 14, 21, 28

Wed, May 4. 5 Mon, May 9, 10 Sat. June 4

Tues, May 24, 31, 7, 14

Sat, May 21

Lotus 123 Il

Multirnate

Mon, May 3o, 31

AccPac

Sat, May 7 Mon, May 23, 24

Sat, May 14

Lotus 123 Macro

Sat. May 21

Bedford

Sat, May 28

Mon, June 6,7

Typing Tutor IV

üame

13-

Ü „7

System. Top quality monitor, 101keykeyboax-CLS expansionslotsmrudl ‘MBoiRAM.

»-

__ '-

4.

‘-

u

12 MHz Hlgh Speed Processing, Or switch easily t0 6 lvfl-Iz.

l7.

5

o EGA Standard on Most Any Monitor. EGA,CGA, and Herctfles-

Wed, May 25, 1, 8. 15

compatible graphics.

6oSoftware Package with WordStar 4.0.

Sal, June 18 Mon, June 20 Wed, June

Work. II

High Speed, 4o MB Hard Drive. With a 38 nuilliseoond access time.

The Complete Office

Wed. June 8. 9

MS-word

2.

.

Wed, May 11, 12

dBase III+

platte. Mth 05/2 oompatjbility guaranteed.

)

22. 23

Speedstor, and...

J

And spellcheck. MailMen-ge,

7ol l - M o n t h Warrant)’. Standard with cvery KAYPRO 286

Courses are 12 hours in Iength

— —

Day courses 6 hours per day, 9 amt0 4 pm, 00515150. Nlght courscs 3 hours per night. 7-10 pm, cost 575.

"äomaTs-lsasa UNIQUE Wc will bu hcrc for you aller you havc complctcd our coursc. Should you nccd any hclp or havc qucslioxxs aboul your Computer, wc havc a "l-lclp Hotline" just for you which will answer your questions and pmblcms f0!’ a specific time, manned by qualified instmctors.

soNorth American-Made Quallty, Service 5c Support.

Iota] Manufacmmfis Service and supptyrt.

Call KAYPRO for the dealer nearest you:

(604) 278-5776

KAYPRO CANADA CORPORATION 134-7100 Rlver Hoad, Richmond B.C. V6! 1x5 j

j

j

1

Z

7 . 0

= _ — : = _ ’ . T „ — _ T =

-

-

582-5448

(A divlslon o1Eva Vlncente Media and Talem Group) 200 247 Abbott Street. Vancouver. B.C. V68 2K7

24 The Compum Hpu May 19887

V

i

i

?

= =1 . ?— 1 _ = _ 1 —t = i= 'i _ ’: 1

Z

C 0

M P II I l R 5

In. Fururo‘: n u r

In

Tradezmrks: KAYPRO 286. Kaypm Corpomion; OSIZ. 50A. IBM. Im‘: Hcxcules. Heraus Computer Tedmology; Wortlaut. MailMarga. MicmPro Int'l; Spsedslol. Sang: Dimension.


1988 05 The Computer Paper