Page 1


VISITORS GUIDE Spring/Summer 2016

Published since 1978

Willkommen to a small-town



– Hominick Builders –

A Family Tradition Since 1972

Featuring a delicious menu of fresh handmade foods and a thoughtful collection of unique gifts.

Serving Lunch Monday - Saturday 210 S Adams 路 Fredericksburg 路 830 997 9527 路


Enjoy a sip of local history F

redericksburg has long been known as a “wet” city, not for the rain that falls but because it permitted the sale of beer, wine and other beverages long before other communities after Prohibition ended. Our wineries are booming. But if you want to talk bier, hit up Jeff Holt, the town’s resident expert on suds and their loFDOKLVWRU\ <RXFDQ¿QGKLPDW*ästehaus Schmidt or getting some “fresh beer” at Fredericksburg Brewing Company or Pedernales Brewing Company.) Jeff has given many talks on the subject and mentions that ales were the order of the day in Fredericksburg before refrigeration. He said before Prohibition hit Texas in 1918, Fredericksburg had three breweries. Captain Charles Nimitz, the grandfather of our World War II hero, Admiral Chester Nimitz, ran the Nimitz Hotel. It had a copper-tank brewery in the basement,

but supply shortages during the Civil War forced him to close it in 1861. Frederick Probst paired up with Dr. Adolph Assig to brew at a property at 310 West Austin Street which had a brewery with three cellars where they made a popular weissbier. Assig later moved to Blanco, but Probst continued to serve local patrons. John Knopp opened a saloon at the corner of Main and Milam streets and began to import cheaper beer from San Antonio (5 cents a glass, versus 10 for the Probst EUHZ )UXJDO*HUPDQVPDGHWKHLUFKRLFH and Probst closed his brewery in 1895. Henry Warner and John Mauer owned a brewery in Marlin, but located here in 1875. They operated a lager beer-brewery in the 400 block of East Creek Street for nine years. It’s believed Warner died in 1877 and Mauer likely headed west to El Paso. Today, Fredericksburg boasts two breweries and a third is under construction. (See page 120.) Main Street’s Fredericks-

Get your GoFred t-shirt today!

ead of the burg Brewing Company was ahead curve with the current beer boom, opening in 1994. 2XUORFDOEUHZHULHVEHQH¿W from the popularity of the craft brew explosion, and Fredericksburg’s reputation as a beer and wine mecca. With help from Jeff, we give a nod to its beer history. For those of us who enjoy the suds, we’re glad this is a “wet” town. Prost! Ken Esten Cooke Publisher & Editor Twitter: @KenEstenCooke

If you dig Fredericksburg, consider a subscription to the io Fredericksburg Standard-Radio Post, the state’s top large weeklyy newspaper, to see what’s up in our town.

Now in Billie Red!

Now in 8 Different Colors! s!

ONLY $12 Plus ship ping

At the Fredericksburg Standard Office.

712 W Main St.

Ń&#x2013;Ń&#x203A;Ń&#x2019;Ń&#x203A;Ń ČŹŃ&#x203A;ČŹŃ&#x153;Ń&#x;Ń&#x2019;

est. 1983

Ĺ&#x2122;Ĺ&#x2013;Ĺ&#x2DC;ȹǯȹÂ&#x160;Â&#x2019;Â&#x2014;ČąÂ?Â&#x203A;Â&#x17D;Â&#x17D;Â?ȹȏȹÂ&#x203A;Â&#x17D;Â?Â&#x17D;Â&#x203A;Â&#x2019;Â&#x152;Â&#x201D;Â&#x153;Â&#x2039;Â&#x17E;Â&#x203A;Â?Ç°ČąÂ&#x17D;ÂĄÂ&#x160;Â&#x153;ČąĹ?Ĺ&#x17E;Ĺ&#x153;Ĺ&#x2DC;Ĺ&#x161; Ĺ&#x2014;ČŹĹ&#x17E;Ĺ&#x2013;Ĺ&#x2013;ČŹĹ&#x;Ĺ&#x;Ĺ&#x2013;ČŹĹ&#x2013;Ĺ?Ĺ?Ĺ&#x203A;ȹȏȹ   ǯÂ&#x2022;Â&#x2019;Â&#x2014;Â&#x17D;Â&#x2014;Â&#x153;Â&#x2014;Â&#x2013;Â&#x2DC;Â&#x203A;Â&#x17D;ÇŻÂ&#x152;Â&#x2DC;Â&#x2013;

SPRING & SUMMER BEDDING HAS ARRIVED Featuring Bedding & Pillows from: C&F Donna Sharp Victorian Heart John Robshaw Pom Pom n-more... Luxury Sheets & Bath Towels Bedspreads, Blankets & Bed RufďŹ&#x201A;es - All Natural Fabric of Linen and Cotton

Gift Items: Fine Soaps Lotions Lace Leather Items Custom Plaques Art n-more...



Article Index EVENTS Antique Machinery Show ..................... 18 Bluebonnet Tractor Ride ....................... 18 Crawfish Festival ..................................... 27 Farmer’s Market ...................................... 20 Founders Day ........................................... 30 Fredericksburg PBR .............................. 50 Fredericksburg Wildflower Run ........ 17 Gillespie County Fair ............................. 42 Gillespie Old Teamsters Reunion ....... 47 Harper Frontier Days ............................ 46 Hill Country Film Festival ..................... 21 Hill Country Swap Meet ...................... 40 Horse Racing ............................................ 38 Indian Artifact Show .............................. 13 LBJ 100 Bicycle Tour .............................. 16 Professional Bull Riders ....................... 50 PCAA Marktplatz Concert Series ..... 22 Pioneer Museum Spring Break ......... 114 Scholarship Fest ....................................... 51 Schuetzenfest ............................................ 41 Sommerzeit ............................................... 31 Stonewall Peach JAMboree ............... 28 SystemsGo Rocket Launches .............. 24 Texas Hell Week ....................................... 12 Vereins Quilt Guild Show .................... 48 Volkssportverein ................................... 126 Wings over the Hills ............................... 14 ATTRACTIONS Bat Tunnel ............................................... 100 Breweries ................................................ 120 Country Schools Trail ............................. 64

Emergency Numbers ........................... 134 Hill Country Memorial Hospital ...... 130 Hill Country University Center ........ 122 Nature Trails ............................................. 82 Pioneer Memorial Library ................. 138 Visitor Center ......................................... 128

Enchanted Rock ...................................... 84 Fort Martin Scott ................................... 76 Geocaching ............................................... 60 Hill Country Peaches ............................. 68 Lady Bird Johnson Municipal Park .... 86 LBJ National Historical Park .............. 96 LBJ State Park and Historic Site ....... 94 Luckenbach ............................................... 69 Marktplatz ............................................... 150 Pacific War Museum ............................. 88 Pioneer Museum .................................... 112 Texas Rangers Heritage Center .......... 74 Top Five Places for Kids ........................ 62 Vereins Kirche ........................................ 159 Wildseed Farms ..................................... 143 Wineries .................................................. 104 THE ARTS First Friday Art Walk ............................ 117 Fredericksburg Chorale ........................ 56 Fredericksburg Comm. Orchestra ..... 57 Fredericksburg Music Club .................. 52 Fredericksburg Theater Company ..... 58 German Choirs ........................................ 54 COMMUNITY Airport ....................................................... 125 Churches .................................................. 164 Community Education ......................... 119

& are registered trademarks by Fredericksburg Publishing Company. Download the app at the App Store or Google Play. All content © 2016 Fredericksburg Publishing Company

HISTORY Artistic Pioneers ................................... 152 Cross Mountain ..................................... 146 FVFD Fire Museum .............................. 169 History of Fredericksburg ................. 162 Standard-Radio Post History ............. 171 Street Signs ............................................. 172 Vereins Kirche ........................................ 159

On the cover

Horst Woitalla, who passed away in January, was one of the area’s most distinctive artists. We salute him with a final sendoff, reprinting his vibrant painting of the iconic Vereins Kirche on Marktplatz.

*Advertiser Index on page 176.

Go Fredericksburg Spring & Summer Visitors Guide — March 2016 Published by Fredericksburg Publishing Co., Inc. 712 W. Main St., Fredericksburg, TX 78624 830-997-2155 Fredericksburg Standard-Radio Post (USPS 209-080) Copies will be mailed from P.O. Box 1639, Fredericksburg, TX 78624, at a price of $5 per copy to cover postage.







(our specialty)








Fredericksburg, Texas


Named one of the top three producers in Texas by USA Today Featured in Southern Living Magazine



Concepts and Beliefs Wine is 25% science – 75% art. Wine is supposed to be fun. The only thing you need to know about wine is – What you like and don’t like – Everything else is nice to know, not need to know. We are a family business – two brothers and family. The Switzer Family First release May 1996

247 W. Main (in town - one block west of the Courthouse) Large parking area in front RV parking in back.




Fredericksburg, TX 78624



Mon. - Thurs. 10-5:15 Fri. & Sat. 10-7:15 Sun. 12-5:15 Check website for Holidays Phone: (830) 990-8747








Taste TEXAS wine made from TEXAS grapes. Come do Wine 101 WHP (Wine 101 Without the Horse Pucky). Wine fermented – bottled – labeled – right here in an actual WINERY.



Calendar of events MARCH 4 ........................................................................................First Friday Art Walk 12 ............................................................................. Van Der Stucken Festival 12-19 .......................................................... Texas Hell Week (cycling event) 19 ..................................................................................... Indian Artifact Show 20 ............... Fredericksburg Music Club concert (Nathaniel Mayfield) 11-12, 14-19 ................................... Spring Break at the Pioneer Museum 26 .................................................... Easter Egg Hunt at Pioneer Museum

JULY 1 ....................................................................................... First Friday Art Walk 2-3....................................................................Gillespie Downs Horse Races 4 ............................................................................Fourth of July Celebrations 4 ....................................................................................Rheingold School open 16 ......................................Sommerzeit at Gillespie County Fair Grounds 16-17 .................................................................Gillespie Downs Horse Races 24...................................................PCAA Concert Series (The Copa Kings) 29-31 ......................................................................... Hill Country Swap Meet

APRIL 1 .........................................................................................First Friday Art Walk 2 ................................... Gillespie County Country Schools Open House 2 ....................................................................................... LBJ 100 Bicycle Tour 3 ....................................................... Country Schools Barbecue Fundraiser 9 ................................................................................ Bluebonnet Tractor Ride 14-16................................................................ Lenz Fest at Pioneer Museum 17 ......................... Fredericksburg Music Club concert (The Marcsmen) 24....................................................... Wings Over the Hills Nature Festival 30 ....................................................Fredericksburg Wildflower Run/Walk 28-May 1 ................................................................Hill Country Film Festival

AUGUST 5 ............................................................................... First Friday Art Walk 6 ..... Gillespie County Country Schools (Willow City open house) 13-14........................................................ Gillespie Downs Horse Racing 14 ..........................PCAA Concert Series (Almost Patsy Cline Band) 25-28 ........................................................................Gillespie County Fair 27-28 ...................................................... Gillespie Downs Horse Racing

SEPTEMBER MAY 1 ........................................................................................... Arion Men’s Choir 1 ..............................................PCAA Concert Series (FHS Jazz Ensemble) 5 ....................................................................Fredericksburg Farmers Market 6 ........................................................................................First Friday Art Walk 7 .................................................... Fredericksburg Chorale Spring Concert 12-15...................................................................SystemsGo Rocket Launches 22 ............................................. PCAA Concert Serious (Weldon Henson) 27-29 .........................................................Fredericksburg Crawfish Festival

2 ............................................................................... First Friday Art Walk 2-3.........................................Vereins Quilt Guild’s 9th Biennial Show 3 .... Gillespie County Country Schools Open House (Luckenbach) 3-4............................................................................. Harper Frontier Days 5 ............................................Gillespie County Old Teamsters Reunion 10 ............................................................. Professional Bull Riding (PBR) 11 ...................................................PCAA Concert Series (Off the Grid) 18 .....................................................................Fredericksburg Music Club (14th Van Cliburn Piano Competition contestant)

JUNE 3 ......................................................................................First Friday Art Walk 11 ...............................................................................Antique Machinery Show 12-13...............................................................................................Founders’ Day 16 ......................................................................................... Bach at Luckenbach 17-18 .......................................................................................... Peach Jamboree 19-21 .................... Country School Association of America Conference 26 ..............................................PCAA Concert Series (The Sophisticates)

OCTOBER 4 ................................................................................................. Oktoberfest 7 ................................................................................. First Friday Art Walk 16 ................. Fredericksburg Music Club (Apollo Chamber Players) 22 ................................................. Fredericksburg Food and Wine Fest 22 ............................................................................... Indian Artifact Show

Ȋȱ••ȱ›˜˜–œȱ›˜ž—ȱ•˜˜›ǯ ȊȱŠ›”ȱ›’‘ȱ—Ž¡ȱ˜ȱ¢˜ž›ȱ›˜˜–ǯ

˜ŒŠŽȱ’—ȱ‘’œ˜›’Œȱ›ŽŽ›’Œ”œ‹ž›ȱŒ•˜œŽȱ˜ȱ˜ —˜ —ǰȱ›ŽœŠž›Š—œȱŠ—ȱœ‘˜™™’—ǯ ŞŗŖȱǯȱŠ–œȱȊȱ›ŽŽ›’Œ”œ‹ž›ȱDžȱ’œ’ȱ˜ž›ȱ Ž‹œ’Žȱȓȱ   ǯ›ŽŽ›’Œ”œ‹ž›ŽŒ˜—˜•˜ŽǯŒ˜–


AAA/AARP discounts available. Tour Groups and Buses welcome. Children under 18 stay free. G olf C ourse, HEB, restaurants nearby.

Platinum Award Winner! Ȋȱ›ŽŽȱ‘’‘ȱœ™ŽŽȱ ’›Ž•Žœœȱ’—ȱŠ••ȱ›˜˜–œǯ Ȋȱ ’––’—ȱ™˜˜•ȱŠ—ȱœ™Šǯ Ȋȱ˜‹‹¢ȱŒ˜–™žŽ›ȱ˜›ȱžŽœœǯ Ȋȱ —Ȭ›˜˜–ȱ–’Œ›˜ ŠŸŽœȱŠ—ȱ›Ž›’Ž›Š˜›œǯ Ȋȱ›Žœ‘ȱ Ž›–Š—ȱ™Šœ›’ŽœȱœŽ›ŸŽȱŠ’•¢ǯ Ȋȱ˜ŽŽȱ–Š”Ž›œȱ’—ȱŽŠŒ‘ȱ›˜˜–ǯ



Bicycling enthusiasts will again be in the Hill Country for the eight-day â&#x20AC;&#x153;Texas Hell Weekâ&#x20AC;? celebration March 12-19. During the

week, bikers can enjoy the challenges of the Hill Country during a series of rides. â&#x20AC;&#x201D; Standard-Radio Post file photo

Eight days make a â&#x20AC;&#x2DC;Hell Weekâ&#x20AC;&#x2122; The eight-day cycling event, â&#x20AC;&#x153;Texas Hell Week,â&#x20AC;? will celebrate its 26th anniversary of trekking through Gillespie County on two wheels. Texas Hell week will run March 1219. But, contrary to its name, the event isnâ&#x20AC;&#x2122;t just for hardcore cyclists. Riders of all skills levels are offered daily routes of varying distances to encourage more participation. In fact, the philosophy of Hell Week LVÂł5LGLQJLVWKHÂżUVWDQGIRUHPRVW activity, regardless of oneâ&#x20AC;&#x2122;s speed or endurance on the bike.â&#x20AC;? The locally-based event is nicknamed â&#x20AC;&#x153;The Rides of Marchâ&#x20AC;? and features daily routes of varying lengths for riders of all skill levels. Texas Hell Week has announced that it will donate $10 of each entry fee to ,FDQ6KLQHRUJDQRQSURÂżWJURXSWKDW

provides learning and recreational opportunities for individuals with disabilities and focuses on putting kids on bikes. $OOULGHVOHDYHDQGÂżQLVKDWWKHHYHQW headquarters â&#x20AC;&#x201D; Sunset Inn, 900 South Adams Street, where the hotelâ&#x20AC;&#x2122;s Ushaped structure makes a â&#x20AC;&#x153;courtyardâ&#x20AC;? where cyclists gather in fellowship to exchange information and attend seminars on everything from tire changing to training techniques. Participants will also have a chance to meet with vendors offering some of the latest products in cycling. This year, accomplished cyclists will be offered some highlight challenges. Texas Hell Week Brevets are scheduled to coincide with Texas Hell Week, with a 200K ride on Monday, March 14, a 200K/300K ride on Wednesday, March 16, and a 200K/300K ride on

Friday, March 18. Brevets are sanctioned by RUSA and can be ridden to qualify for 1200K randonee events. Registration is underway at www. or by phoning 1-806499-3210 or 1-806-683-6489. Hell Week tours are also offered in Florida, Wisconsin, Utah, Colorado, Nevada and elsewhere. Hosting the tours is Ultra Sports Marketing of Canyon, which started in 1991 with a Texas Hell Week cycling camp. The company is headed by Dr. Nick and Becky Gerlich. He is an associate professor of marketing at West Texas A&M University in Canyon, where he has taught since 1989. She is a former mathematics teacher at Hereford High School and now takes care of the business end of the Hell Week tours.


Indian Artifact Show with Southwest flair Rare arrowhead collectors will be in town this spring and again in the fall when the Fredericksburg Indian Artifact Show returns. Scheduled again in Pioneer Pavilion at Lady Bird Johnson Municipal Park, the shows are set for March 19 and Oct. 22 to display pieces dating as far back as 10,000 B.C. Each show is scheduled to run from 8 a.m.-4 p.m. As many as 70 tables will be set up by collectors from all over 7H[DVWRGLVSOD\KLVWRULFDUWLIDFWVIRUWKHEHQHÂżWRIEX\HUVVHOOers, traders or lookers interested in stopping by the pavilion that day. â&#x20AC;&#x2DC;This is a hobby for all us collectors and we truly enjoy having the show in Fredericksburg every year and having everyone come out to see what we have on display,â&#x20AC;? said Richard Mentzer of New Braunfels who co-hosts the event along with Rob Bartel of Hunt. Admission for each show is $6 for everyone 15 years of age and older, while children 14-and-under will be admitted free of charge. Free admission will also be provided for Gillespie County law HQIRUFHPHQWRIÂżFHUV Beverages, snacks and barbecue will be provided for purchase throughout both shows.

This merchant shows customers his supply of arrowhead replicas at a 2015 Indian Artifact Show. He casts molds from arrowheads to make â&#x20AC;&#x153;museum quality lithic casts.â&#x20AC;? â&#x20AC;&#x201D; StandardRadio Post file photo


green with envy Lady Bird Johnson Golf Course | 18 holes | ffriendly riendl i dlyy st staff aff f f | golf shop | restaurant | 6,686-yard, 6,6 par-71 design | 46 bunkers beautiful clubhouse | practice range | instruction | affordable affordab green fees | plus, your 19th hole is Fredericksburg | 800 950 8147

Download the

mobile app at the App Store or Google Play


Enjoy nature at its best at


The Wings Over the Hill Festival features many booths with items and information for nature lovers. â&#x20AC;&#x201C; Standard-Radio Post photo


A bird sanctuary worker shows off a raptor at the Wings Over the Hills 2015 festival.


Log Haus and Cottage Heart of Fredericksburg, Texas

½ Blk from

104 E. Austin St One Block off Main to the North between Adams & Llano St.


Llano St.


Adams St.

The Haussegen Cottage sleeps 2-4 and can be rented alone or with Log Haus.

The Haussegen Log Haus rental is for entire 2½ story house and sleeps up to 9.

Main St. / Hwy. 290 Courthouse & Library

Inquire about weekday retreats, workshops, or business meetings. Reservations 855-687-3832 or

 іћ ђћѠȬћȬќ џђ

est. 1983

řŖŘȱǯȱŠ’—ȱǯȱȬȱ›ŽŽ›’Œ”œ‹ž›ǰȱŽ¡ŠœȱŝŞŜŘŚ ŗȬŞŖŖȬşşŖȬŖŝŝśȱȬȱ   ǯ•’—Ž—œ—–˜›ŽǯŒ˜–


  ȱȱ——ŽȱŽ•”Žȱ—Ž ȱ•ž¡ž›’˜žœȱ•’—Žȱȃž¡ŽȄ Žœ™›ŽŠœǰȱ•Š—”Žœǰȱ‘ŽŽœǰȱŽȱžĝŽœȱȬȱ••ȱŠž›Š•ȱŠ‹›’Œȱ˜ȱ’—Ž—ȱŠ—ȱ˜Ĵ˜—ȱ˜ȱ’ŸŽȱ¢˜ž


by Pine Cone Hill and DASH & ALBERT


Over 1,000 bikers pedal the Pedernales Bicycle riders hoping to enjoy spring scenery on the back roads of Gillespie County are invited to join in the LBJ 100 Bicycle Tour at the Lyndon B. Johnson National Historical Park on Saturday, April 2. The annual event features routes of different lengths for cyclists of various skill levels and is designed to attract cyclists of all types and to be family-friendly. Gates are set to open at 7 a.m. on the national park property, with bikes to start lining up on the airstrip that once served President Lyndon B. Johnson and world leaders coming to visit his ranch. A rolling start to the ride will get under way at 9 a.m. The tour will offer 10-mile, 30-mile, 42-mile and 62-mile distance routes through the park property and surrounding Texas Hill Country. Cost to register is $40 for adults through March 11 and $50 after that date. Youths 12 years or younger may be signed up for a fee of $20 through the March 11 deadline and $30 after that until the event day. )DPLOLHVRIWKUHHRUPRUHLPPHGLDWHIDPLO\ULGHUVPD\DOVREHQH¿W from the group rate, paying $95 early or $105 after March 11. As an added bonus, those registering for the ride can participate in a special bike tour of the LBJ Ranch’s historical landmarks led and narrated by Luci Baines Johnson, daughter of the 36th President of the United States, Lyndon B. Johnson. Her tour starts at 2:30 p.m. and throughout the estimated 10 miles of its length, she will offer recollections of living on the ranch when VKHZDVDFKLOGGXULQJKHUIDWKHU¶VWZRWHUPVLQRI¿FH This event is in support of her expressed desire “to get the owners of the park to use it.” Registration also includes support for the rides, maps and other materials, rest stops featuring snacks, facilities and drinks, SAG wagon support and a post-ride hot lunch. (Non-riders may also purchase the post-ride meal.) Registration and maps of the routes are available online at www. The LBJ 100 Bicycle Tour is hosted by the Friends of Lyndon B. Johnson National Historical Park and all net proceeds are used speFL¿FDOO\IRUWKHEHQH¿WRIWKHSDUN

A rolling start at the LBJ Ranch saw cyclists participate in last year’s LBJ 100 Bicycle Tour at the former presidential airstrip. — Standard-Radio Post file photo

LBJ 100 Bicycle Tour riders take off through the LBJ Ranch at the Lyndon B. Johnson National Historical Park in Stonewall. — StandardRadio Post file photo



Runners get ready to begin the Wildflower Run outside of Marktplatz during last yearâ&#x20AC;&#x2122;s 5K and 10K run and walk. â&#x20AC;&#x201D; Standard-Radio Post file photo



7D3B>=C0H;>A ±CWT2^a]TaBc^aT²  4Pbc<PX]BcaTTcÂ&#x2019;'"((&''& 2[^cWX]Vm9TfT[ahm2P]S[Tbm6XUcb 5TPcdaX]V)BcT_WT]9^bT_WL>[S6dhbAd[TL3^]]PBWPa_ <^]P1L:XS´b2P\^L2PRcdb1Ph :^^[BW^TbLBfP]2aTTZLF^^SfXRZL7PQTabWP\ <^]SPhCWdabSPhm )$) 5aXSPhBPcdaSPhm )%)

T-SHIRTS ET CETERA ______________________________________

Monday-Thursday 10-5 )ULGD\ 6DWXUGD\ Open Most Sunday Afternoons 12:30 - 5:00

Serving Texas and the World Since 1981 ______________________________________



T-Shirt Etc. Hudson & Taylor E. Main


$6$GDPV .HUUYLOOH+Z\ Â&#x2021;9 T-Shirts H Caps H Books H Music Mugs H Great Gift Items Souvenirs of Texas, Fredericksburg & the Hill Country

W. Main


Side Street Shopping across from the Courthouse


Something for everyone


>_T]<^bcBd]SPh 0UcTa]^^]b !)"$)


Early-day equipment on display

Foggy weather conditions didnâ&#x20AC;&#x2122;t deter riders like C.J. Staudt of Stonewall on his 1961 Allis Chalmers D from taking part in the annual Bluebonnet Tractor Ride. â&#x20AC;&#x201D; Standard-Radio Post file photo

Leaving the farm behind Members of the Hill Country Antique Tractor and Engine Club will celebrate spring in the Hill Country with a nod to the past during the 11th Annual Bluebonnet Tractor Ride Saturday, April 9. Antique tractors and machinery will chug along a predetermined route at speeds determined by the slowest vehicle, which will probably be about 5 mph. These antique tractors, automobiles, trucks, etc. will be followed by a â&#x20AC;&#x153;People Mover.â&#x20AC;? This vehicle is for friends or relatives who want to participate in the ride but donâ&#x20AC;&#x2122;t have tractors. The cost of riding on a â&#x20AC;&#x153;People Moverâ&#x20AC;? and a meal will be $15 per person. Early registration with payment for a seat on the People Mover is required to guarantee a space. Pre-registration for the tractor ride is $30 and will include lunch and a cap. Registration on the day of the event will cost $35. Youth between the ages of 16 and 19 will get a reduced cost of $15. A driversâ&#x20AC;&#x2122; meeting will be held at 8:30 a.m. As in previous years, a â&#x20AC;&#x153;Sag Wagonâ&#x20AC;? will follow the tractors to provide assistance to those @GoFred1

that experience mechanical or fuel problems. Those driving the tractors must be at least 16 years old and have either a driverâ&#x20AC;&#x2122;s license or learnerâ&#x20AC;&#x2122;s permit. 7KHULGHZLOOFRPSO\ZLWK7H[DVWUDIÂżFODZV including speed and safety regulations. No passing will be allowed. Management team members will be riding tractors within the caravan to help insure safety. Upon registering, all participants will be asked to sign a â&#x20AC;&#x153;driver safety pledge.â&#x20AC;? Awards will be given away for the oldest tractor, oldest driver and the farthest traveled with a tractor. Individuals needing more information or an online registration form may visit or contact Regina Weidenfeller at 830-990-8551 (home) or 830-889-9348 (cell) RUHPDLOUHJLQDZ#ÂżVGRUJ Registration forms with payment may be sent to HCAT and EC, P.O. Box 851, Fredericksburg, TX 78624. More information on where the event will start will be published in the Fredericksburg Standard-Radio Post.

Step back in time into a 1920â&#x20AC;&#x2122;s farm house and an early 20th Century sawmill at the 31st Annual Antique Machinery Show at the Gillespie County Fair Grounds, Saturday, June 11. The show will be open from 8 a.m. until about 6 p.m. Much of the machinery on display â&#x20AC;&#x201D; some of it restored to operate and look as good as when new decades ago â&#x20AC;&#x201D; is expected to again attract enthusiasts from all across Texas to the fair grounds where parking is free. The cost for admission to the show is $6 for adults and those over 12. Children under 12 are free. In addition to old tractors and farm machinery, exhibits will include antique gasoline and steam engines manufactured as far back as 1900. Working exhibits both days will include demonstrations of wheat threshing, wood-planing, corn shelling and horse-drawn hay baling along with operation of an antique saw mill. Tractor exhibitors will have an opportunity to parade their entries around the fair grounds. In addition, pull-sled competitions are planned for conventional tractors. More information is available from Regina Weidenfeller at 830-9908551 or 830-889-9348 or from Troy Rhodes at 830889-0344 or via email at


40-foot Co ntainer of Glazed Pots just arrive d from Vietnam! The

PatioShoppe 614 West Main St

Check Out Our Sister Store!

Not another boring store

UNIQUE POTS We have more pots than all our competitors combined.




Between Marble Falls and Burnet


Farmerâ&#x20AC;&#x2122;s Market brings â&#x20AC;&#x2DC;localâ&#x20AC;&#x2122; to the people

People of all ages enjoy Fredericksburg Farmerâ&#x20AC;&#x2122;s Market at Marktplatz with fruits, vegetables and much more from area vendors. Pizzas, salads, wines, olive oils and lavender products also are sold and a band provides musical entertainment. The event continues each Thursday at the town square through August. â&#x20AC;&#x201D; Standard-Radio Post photo

The Fredericksburg Farmerâ&#x20AC;&#x2122;s Market (FFM) begins its seven-month-long schedule of bringing locally grown and produced foods to downtown Fredericksburg on Thursday, May 5. Every Thursday, rain or shine, from 4-7 p.m., May through August, shoppers can meet farmers while shopping for fresh produce at Marktplatz. The producer/grower market consists of farmers, ranches and wineries located within the geographic neighborhood of Gillespie and adjacent counties, offering a wide variety of tomatoes, vegetables, peaches, blackberries and other fruits, meats, goat cheese, eggs, Gulf seafood, baked goods, wine, lavender and more. Visitors will enjoy the atmosphere at Marktplatz which includes a covered play space for children. Shoppers are invited to come for the food and stay for the family friendly party atmosphere where they can purchase meals and snacks while listening to live music. Pizza baked in a wood burning oven, soups, salads, sliders and pastries are all made with local ingredients and can be enjoyed picnic-style under the pavilion. Wine from local wineries can be purchased by the glass or bottle and non-alcoholic iced beverages are also served. $WWKH&KHIÂśV&RUQHUYLVLWRUVZLOOÂżQGIUHHVDPSOHV prepared by local chefs using ingredients from the market. Chefs and volunteers are happy to â&#x20AC;&#x153;talk shopâ&#x20AC;? and answer questions about how to cook the dish being sampled. Meet the farmer, rancher, chef and artisan baker. Support local agriculture and viticulture in Fredericksburg, the community way to shop for great food. FFM is celebrating its ninth year with support from Capital Farm Credit


Home on the Range B&B

A Bed & Breakfast Guesthouse

Families, children, pets and horses are welcome. Ranch tours, parties, and chuck wagon cookouts are available by special arrangement. Recommended in Great Texas Getaways Your Hosts: â&#x20AC;&#x153;The Stonewall Jacksonsâ&#x20AC;? For reservations: 830-644-2380 or 512-970-4676


Seventh Film Festival brings â&#x20AC;&#x2DC;reel indieâ&#x20AC;&#x2122; Reel indie. Real Texas. Thatâ&#x20AC;&#x2122;s how the 2016 Hill Country Film Festival describes itself. The seventh anQXDOHYHQWDWWUDFWVWRSLQGHSHQGHQWÂżOPV DQGÂżOPPDNHUV 7KLVIRXUGD\LQGHSHQGHQWÂżOPIHVWLYDO will go from Thursday through Sunday, April 28-May 1, at Fritztown Cinema, 2254 U.S. 87 South. At the growing event, audiences will be DEOHWRVHHHQWULHVIRUVKRUWÂżOPVIHDWXUH length movies, documentaries, dramas, DQLPDWLRQDUWÂżOPVFRPHGLHVDQGPRUH 8SWRÂżOPVDUHWREHVFUHHQHGDQG SODQVDUHWRWU\WRKDYHWKHÂżOPPDNHUV available for questions and answers after the screenings so they can discuss their ÂżOP7ZHQW\ÂżYHSHUFHQWRIWKHÂżOPVWR be screened typically are from Texas, alWKRXJKWKHIHVWLYDOZLOOLQFOXGHÂżOPVIURP all over the world. Last year, 11 countries were represented. This year, organizers will also offer DZDUGVLQVWXGHQWÂżOPFDWHJRULHV In its duration, the festival has screened

When a movie ended, screenwriters discussed their writing process and answered audience questions during the 2015 Hill Country Film Festival. â&#x20AC;&#x201D; Standard-Radio Post file photo

ÂżOPVDQGKRVWHGÂżOPPDNHUVIURPDOORYHU the U.S., as well as many other countries. The Hill Country Film Festival will announce its lineup and schedule on March 23, and fans can learn more about the events at On the website, visitors also may purchase all-access badges or day passes and

learn more about the eventâ&#x20AC;&#x2122;s history and ÂżOPPDNHUVDQGYLHZ&KDG0DWKHZVÂśEORJ ,QGLYLGXDOVKRZLQJWLFNHWVPD\EHSXUchased at Fritztown during the festival.) $OODFFHVVEDGJHVJLYHDFFHVVWRDÂżOPPDNHUZHOFRPHRQ7KXUVGD\QLJKWSDQels, parties and then the Sunday send-off event.

Marilynâ&#x20AC;&#x2122;s of Fredericksburg

:HVW0DLQ 830-997-5498

â&#x20AC;&#x153;The Store for Women of Enviable Tasteâ&#x20AC;?


Specializing in Menâ&#x20AC;&#x2122;s Casual Clothing from the USA and Around the World!

&ROXPELDÂ&#x2021;3HUXÂ&#x2021;0H[LFR ,WDO\Â&#x2021;+DZDLLDQG other USA locations... :H7DNH3ULGHLQ4XDOLW\&ORWKLQJ


Download the


221 West Main +RXUV0RQGD\WKUX6DWXUGD\ DPSP Closed on Sunday

mobile app at the App Store or Google Play


Marktplatz concerts showcase musicians Music lovers are invited to pull up their lawn chairs and blankets to enjoy six free outdoor concerts during the upcoming 2016 Pedernales Creative Arts Alliance (PCAA) Marktplatz Concert Series. Admission is free. A repertoire that includes jazz, country, variety dance and polka will be offered during the public performances on select Sunday evenings at Marktplatz in downtown Fredericksburg. :LWKDVWDJHDQGGDQFHĂ&#x20AC;RRUVWDWLRQHGXQGHUWKHODUJHVW pavilion, the Adelsverein Halle, the concerts will each begin at 6:30 p.m. Scheduled to take the stage in 2016 for the PCAA in the Park are: Â&#x2021;0D\²)UHGHULFNVEXUJ+LJK6FKRRO-D]](QVHPEOH Â&#x2021;0D\²:HOGRQ+HQVRQ Â&#x2021;-XQH²7KH6RSKLVWLFDWHV Â&#x2021;-XO\²&RSD.LQJV Â&#x2021;$XJ²7KH$OPRVW3DWV\&OLQH%DQG Â&#x2021;6HSW²2II7KH*ULG 2II7KH*ULGZLOOFORVHRXWWKHFRQFHUWVHULHVIRUWKH\HDU DQGJHWYLVLWRUVLQWKHPRRGIRU2NWREHUIHVW7KLV\HDULWV WKDQQLYHUVDU\2NWREHUIHVWZLOOEH6HSW2FW Dancing to each band is encouraged on an area set aside in front of the bands and the audience seating.

Musicians from various genres help get locals into the groovinâ&#x20AC;&#x2122; mood during the PCAA Marktplatz Concert Series. â&#x20AC;&#x201D; Standard-Radio Post ďŹ le photo

7KRVHSODQQLQJWRDWWHQGDUHLQYLWHGWRHLWKHUDUULYHHDUO\ at the square to secure some of the limited picnic table seating or to bring their own lawn chairs or blankets in order to ÂżQGVRPHVSLOORYHUVSDFHRQWKHJUDVV\DUHDVXUURXQGLQJWKH pavilion. Attendees are encouraged to pack picnic suppers or snacks, as well as to get up and boogie to the live music as the sun sets. 7KHVH3&$$FRQFHUWVDUHIXQGHGE\SURFHHGVIURP2NWREHUIHVW7KH3&$$ÂśVFRQFHUWVHULHVLVWKHJURXSÂśVZD\RI saying thanking the community of Fredericksburg for the continued support it gives toward the success of the annual 2NWREHUIHVWFHOHEUDWLRQV For more information about the 2016 Marktplatz Concert 6HULHVFDOO

Fredericksburg Paper Goods 102 East Main Street (830) 990-5850

102 E. Main St.

(830) 997-5507


Fine Papers, Journals, Albums Cards & Invitations



s ’ y k r o PHamburger &



Onion Ring Co. Mon-Sat 11 to 4

A rocket blasts off at the SystemsGo aeroscience rocket program at Hillview Ranch located north of Fredericksburg off of Willow City Loop. — Standard-Radio Post file photo


Friday: open ’til 8

904 W. Main 830-997-6882

Parking in Rear

“Home Town care and compassion, Big city quality urgent care.”

1426 E. Main St., Ste. 300 Ài`iÀˆVŽÃLÕÀ}]Ê/8ÊÇnÈÓ{ÊUÊnÎ䇙™Ç‡™™™x "* ÊÇÊ >ÞÃÊ>ÊÜiiŽ°ÊÊÊœ˜`>އÀˆ`>ÞÊn‡n]Ê ->ÌÕÀ`>ÞÊn‡È]Ê-՘`>ÞÊ£ä‡È° Most major insurances accepted. We see all ages. "˜ÊÈÌiÊ݇À>Þ]Ê ]ʏ>LðÊ"VVÕ«>̈œ˜>Êi`ˆVˆ˜i°

For a truly unique dining experience during your visit to Fredericksburg and its German-enriched attractions ... Stop by our Main Street Restaurant, where you can find American, German and other foreign-flavored dishes to appease even the most hungry of appetites. And, remember, good times and fellowship are always on our menu! Our skillful chefs take their precious time in preparing dishes (their “masterpieces”) that you CAN write home about and our service staff offers their visitors -- both local and out-of-town -- a refreshing friendliness as they care for all their needs. Whether in town for just a day or making Fredericksburg your home, Der Lindenbaum is ‘a must’. Our comfortable, yet elegant dining atmosphere, welcomes all tastes with open friendship.


German Restaurant Authentic German Cuisine You Will Be Glad You Came

H Authentic H H Schnitzel Burgers H H Sandwiches H H Home Baked Breads H H German Specialties H H Desserts H H Mouth-Watering H

Open 7 Days a Week 11:00 a.m. to 10:00 p.m. After your shopping, come relax in our quiet, cozy atmosphere with some hot spiced wine, European pastries and more. Come join us for delicious international dishes in our comfortable dining room. We’ll be waiting for you ... Close to Nimitz Museum Travelers Checks Personal Checks

312 E. Main

Fredericksburg, TX 78624

(830) 997-9126



Fredericksburg 830.992.2110




Crawfish Festival

features flavorful foodstuffs



The New York Times

Authentic Dirndl and Trachten Wear from Austria and Germany

â&#x20AC;&#x153;Clean, functional and cuteâ&#x20AC;? Couldnâ&#x20AC;&#x2122;t have said it better ourselves.



RU &

Visit our website: w'$,/< w:((./< w0217+/<



mobile app at the App Store or Google Play


Local growers compete for top honors and high bids in the peach show and auction at the annual Stonewall Peach JAMboree and Rodeo. Two days of activities and events, including two rodeo performances (photo at right) are planned Friday and Saturday, June 17-18. — Standard-Radio Post file photos

A peachy celebration in Stonewall Rodeos, dancing, peach show and auction, queen’s contest, more slated June 17-18 Two days of entertainment and activities are planned as part of the 55th Annual Stonewall peach JAMboree and Rodeo. This year’s annual celebration will be held Friday and Saturday, June 17-18, in Stonewall. Sponsored by the Stonewall Chamber of Commerce, the two-day salute will again feature music, rodeo performances, a parade, contests, peach show and auction, queen’s contest, children’s activities and more. Peach JAMboree activities get started on Friday night, June 17, with an 8 p.m. rodeo performance followed by a dance. The gates open at 6 p.m. JAMboree activities resume on Saturday, June 18, when entries are taken that morning in the baking, preserves and salsa contests. There will also be a slack rodeo performance and cowboy breakfast. The annual parade steps off at 10 a.m., and barbecue by the pound will go on sale after the parade. A variety of other foods will also be available on the JAMboree grounds including peaches and ice cream, peach pie and cobbler. Activities planned throughout the afternoon include the Peach Patch area for kids, 42 tournament, washer pitching tournament, peach show and @GoFred1

Reigning over the 55th annual Stonewall Peach JAMboree and Rodeo June 17-18 will be from left, Third Duchess Arleen Ibanez, Queen Mandy Yocham, Second Duchess Katelyn Zuberbueler and First Duchess Miranda Langehennig. — Standard-Radio Post file photo

auction, peach eating and pit spitting contest, mutton busting and more. Coeds competing for the title of Stonewall Peach Queen will take part in an afternoon pageant at 3 p.m. One of the highlights of the afternoon will be the annual auction of prize-winning peaches, pastries and preserves at 4 p.m. The new queen will be crowned in a 7:30 p.m. ceremony just prior to the start of the rodeo performance at 8 p.m. A dance will follow the rodeo perfor-

mance. There will also be mutton busting both nights beginning at 7 p.m. Admission is charged to the dances and rodeos. More information on the Peach JAMboree as well as the other activities in Stonewall is available online at www. or by contacting the Stonewall Chamber of Commerce at 830-644-2735. The Stonewall Chamber mailing address is P.O. Box 1, Stonewall, TX, 78671.

FOODIES AND OENOPHIILES REJOICE! If “food” is your middle name and wine is your game,

but also has the largest Texas wine list in the country

then the Cabernet Grill is your match made in heaven.

— with the knowledgeable waitstaff to go with it.

Chef Ross Burtwell, author of Texas Hill Country

Fresh ingredients sourced from local and regional

Cuisine; Flavors from the Cabernet Grill Texas Wine Country Restaurant, not only serves up some of the most spectacular cuisine,

growers. An elegant yet casual dining atmosphere. A deep-rooted passion for food and wine flowing from the kitchen. Welcome home!

Take the taste home with Chef Ross Burtwell’s new book Texas Hill Country Cuisine.

830 990 5734 | | Fredericksburg, Texas On Hwy 16, just 2.8 miles south of Main Street







SOZIAL HAUS 107 S. Llano, Fredericksburg, TX 78624


31 Walk in the Footsteps of Presidents and World Leaders


LBJ Ranch, Stonewall Lyndon B. Johnson National Historical Park Stonewall, TX 78671 830-868-7128, Ext. 231

since 1985 Adolfo and Veronica Ambriz

807 W. Main Fredericksburg, TX 78624 Studio 830.990.4932 Order Only 1.800.654.3806 Cell 210.410.9622 


Handcrafted, f personalized, unique gifts f ffor all occasions.

Experience Texas Hill Country at The Inn on Barons Creek. Stay in style at Fredericksburgâ&#x20AC;&#x2122;s finest hotel. We offer free hot breakfast, free wireless internet, and are just two blocks from Fredericksburgâ&#x20AC;&#x2122;s Main Street where all the action is.

Relax ~and pamper yourself. Renew ~ Rejuvenate Spend a day at the Spa. Enjoy massages, facials, nail treatments, and more. The Spa - part of the Inn on Barons Creek - provides exceptional service and attention to detail.


Visit Us Online Or Call:222*** -+*.-!!'+)5 

32 Fredericksburg Reservation Service for Property Owners >ĞƚƵƐŬĂŶĚŚĞůƉŽƉĞƌĂƚĞLJŽƵƌǀĂĐĂƟŽŶƌĞŶƚĂů͊

ͻKŶůŝŶĞZĞƐĞƌǀĂƟŽŶ^ĞƌǀŝĐĞ ͻsZKĂŶĚŝƌďŶďĞdžƉĞƌƚƐ ͻϭϮйŬŝŶŐĨĞĞ “Since listing with Fredericksburg Reservation Service, our rental income has doubled!” -Das Jager Haus -

830-456-0698 ŝŶĨŽΛĩŐƌƐ͘ĐŽŵ ǁǁǁ͘ĩŐƌƐ͘ĐŽŵ

A P R I L 2 8 – M AY 0 1



Fredericksburg offers festive Fourth of

Schedule of Events 8:30 a.m. Children’s Parade – Marktplatz 9:30 a.m. 4th of July Party and Parade viewing covers Main Street from the Nimitz museum to Jek’s Pit Stop West DP$LUFUDIWÀ\RYHUZLOOVLJQDOVWDUWRISDUDGH 10 a.m. Fourth of July Parade on Main Street 10 a.m. to 3 p.m. July 4th at the Sauer-Beckmann Living History Farm 11 a.m. Patriotic Program at Marktplatz (following the parade). Fredericksburg High School NJROTC recites excerpts of Declaration of Independence and Pledge of Allegiance, Capt. Roger Spencer invocation, mayor’s welcome, keynote speaker to be announced, Fredericksburg Theater Company, Ted Conerly and Sentimental Journey Orchestra will play music, master of ceremonies: Joe Kammlah

Clockwise from left: An entry in last year’s Fourth of July Children’s Parade at Marktplatz.

7 p.m. Bill Smallwood to performs at Lady Bird Johnson Pioneer Pavilion

Residents and visitors gathered at Lady Bird Johnson Municipal Park and the Gillespie County Airport to watch the Fourth of July fireworks display sponsored by the City of Fredericksburg and launched from Lady Bird Johnson Municipal Park.

Dark-thirty: City of Fredericksburg Fireworks Display at Lady Bird Johnson Municipal Park

Visitors marvel at the inner workings of a C-47 aircraft on display at the Gillespie County Airport during Fredericksburg’s Independence Day celebrations.— Standard-Radio Post photos


July fun-filled family activities

The July 4th city parade had a taste of German heritage with the Oktoberfest float.— Standard-Radio Post photos A proud patriot unfurls a flag prior to the Fourth of July Fireworks at Lady Bird Johnson Municipal Park. The flag once belonged to an ancestor who fought in World War I.

Resttaurantt and d Biergartten KŶĞŽĨ&ƌĞĚĞƌŝĐŬƐďƵƌŐ͛ƐŵŽƐƚƉŽƉƵůĂƌĞĂƟŶ ŶŐ establishments for over 20 years. KīĞƌŝŶŐ͗ ī Ő Authentic German Cuisine, Hand-Cut Steaks, Fresh Fish, Sandwichess an nd Ho omeemaade Des esse seert rtss

– 2013 & 2014 WINNER –

Auslander Restaurant

323 E. Main St. Fredericksburg, TX (830) 997-7714 Restaurant & Bar Open 11am-10pm Closed Wednesdays

Gästehaus Schmidt offers reservation services for vacation rentals, guest houses and bed and breakfasts. Our quality properties come in various sizes and prices. Gift certificates available. Easy to use website and on-line reservations 24 hours. Let us help you create a memorable getaway. Celebrating 31 Years of Hospitality!

Download the

| Free Reservations | Friendly & knowledgable staff | Reservations for wine tours, massages, etc. | Credit Card Convenience | Fredericksburg Baskets available

mobile app at the App Store or Google Play

36 Historic Pecan Grove Store Stock up on Beer, Ice, Drink, Food for a day at Enchanted Rock State Park! Stop in on the way to see wildďŹ&#x201A;owers & bluebonnets xĂ&#x201C;{{Ă&#x160; °Ă&#x160;Ă&#x153;Ă&#x17E;°Ă&#x160;ÂŁĂ&#x2C6;Ă&#x160;UĂ&#x160;Ă&#x20AC;i`iĂ&#x20AC;Â&#x2C6;VÂ&#x17D;Ă&#x192;LĂ&#x2022;Ă&#x20AC;}]Ă&#x160;/iĂ?>Ă&#x192; nĂ&#x17D;äÂ&#x2021;Â&#x2122;Â&#x2122;äÂ&#x2021;{{Ă&#x17D;Ă&#x17D;Ă&#x160;UĂ&#x160;Ă&#x153;Ă&#x153;Ă&#x153;°*iV>Â&#x2DC;Ă&#x20AC;Â&#x153;Ă&#x203A;i-Ă&#x152;Â&#x153;Ă&#x20AC;i°VÂ&#x153;Â&#x201C;


Der Alte Fritz German Antiques

Books on Main &.BJOt

German & American Antiques & Collectibles Primitives Wall & Mantle Clocks WWII Militaria

1890â&#x20AC;&#x2122;s Baby Carriage

German Books Metal & Wooden Toys Garden Decor & More!

2SHQGD\VD:HHNÂ&#x2021;Â&#x2021;&ORVHG7XHVGD\V (0DLQÂ&#x2021;  

Specializing in Texas History Books & Maps #FTU4FMMFST'JDUJPO/PO'JDUJPO Children & Teens /BUVSF5SBWFM Scrapbooking Cookbooks

Tuscany in Texas ~ Over 150 Medals in the last two years from San Francisco to New York ~

! g n o TASTE. TOUR.Bel






Live pari-mutuel horse racing returns to the Gillespie County Fair Grounds in 2016 for eight days of racing at the Class III facility. The

summer season will open on July 2-3 and continue on July 16-17, Aug. 13-14 and Aug. 27-28. â&#x20AC;&#x201D; Standard-Radio Post file photo

Horses ready to run at local track Eight days of live pari-mutuel horse will be featured at the Gillespie County Fair Grounds over four weekends in July and August. To go along with the racing events, WKHÂżQDOUDFHZHHNHQGLVKHOGDVSDUWRI the 128th Gillespie County Fair. In addition to the eight days of live racing at the local Class III facility, a simulcast facility is open at 35 Fair Drive for year-round wagering. Simulcasting at The Race Barn is offered Thursdays through Sundays from horse and dog tracks around the country. The facility also includes a restaurant. The Gillespie County Fair and Festivals Association sponsors the live parimutuel races.


Post time each day is 1 p.m. As in the past, the Gillespie County Fair Grounds will offer race fans a covered grandstand, numerous betting windows, tote board, easy access and

plenty of free parking. General admission, reserved seating and box seating is available. General admission is $7 for adults, $3 for children six to 15 years of age DQGIUHHIRU\RXQJVWHUVÂżYHDQGXQGHU Reserved seats are $10 and box seats are $15. Also available are summer season passes for $60. The passes are good for all Gillespie County Fair Association sponsored summer events. More information on the 2016 summer season activities at the Gillespie County Fair Grounds is available by contacting the Gillespie County Fair and Festivals Association at 830-9972359 or visiting their website at www.


(DVW0DLQ 830-997-6750


Your home comes together here, with distinctive furnishings, elegant accessories and exquisite design, uniquely inspired for extraordinary living.

‡)851,785( ‡$57 ‡/,*+7,1* ‡$&&(6625,(6 ‡'(6,*1 6(59,&(6


Swap meet revs up interest for gearheads, auto collectors

Many vendors put out tables full of car parts in hopes that project owners will find just the piece they’re looking for. — Standard-Radio Post file photo

Whether you’re in the market for a vintage car, auto-related ephemera or just a part, gearheads will be welcomed at the 39th Annual Hill Country Swap Meet. The 2016 meet will be held July 29-31 at Lady Bird Johnson Municipal Park on State Highway 16 South. Just about every square foot of space will be taken up with around 900 vendors showcasing parts, vehicles and much more. &DUHQWKXVLDVWVFDQ¿QGDERXWDQ\WKLQJ at the swap — a “Car Corral” has vintage

autos for sale in various states of restoraWLRQWKHUHDUHÀHDPDUNHWVSDFHVDQGD free trolley that makes the rounds on the massive event’s grounds. Admission is free. Fredericksburg Vintage Car Club, which had built the event into the huge following for nearly four decades, turned over the keys last year to Earhart Productions. Earhart Productions owner Dean Earhart plans few changes as the event had grown to be such a huge success.

So, gearheads hunting that particular piece for their project should head out to the Hill Country Swap Meet the last weekend of July. ONLINE RV accommodations, call (830) 997-4202. Lodging information may call (830) 9976523.

Open Thursday - Monday 10AM - 4PM First Friday Art Walk 10AM - 8PM

& Gallery 308 East Austin Street

We are non-profit, supported in part by the Pedernales Creative Arts Alliance/ Oktoberfest


Schuetzenfest locked and loaded for sharpshooting competition Marksmanship has been a hallmark of the local scene since as long as Fredericksburg has been around. Each summer, there are a few festivals that celebrate residentsâ&#x20AC;&#x2122; continued fondness for sharpshooting. There are six shooting clubs in Gillespie County whose members participate regularly in several competitions each spring and summer season. The Gillespie County Schuetzenbund (Shooting Club) is comprised of the following clubs: *Bear Creek, *Tivydale, Hubertus, *Grapetown, Barons Creek and Scharfschuetzen. Contestants take aim and fire at the Schuetzenfest, a sharpshooting event that is the second-oldest com(*Clubs that maintain munity event in the area (bested only by the Gillespie County Fair). â&#x20AC;&#x201D; Standard-Radio Post file photo the countyâ&#x20AC;&#x2122;s three shooting ranges.) 7KHÂżUVWVKRRWLQJ Gillespie Countyâ&#x20AC;&#x2122;s six shooting clubs Former Schuetzenkoenige (shootcompetition on the 2016 season schedgenerally take turns hosting the annual ing kings) will then lead a parade of XOHLVWKH%HQHÂżW)HVWVHWIRU6XQGD\ festival at one of the three ranges in the VKRRWHUVFDUU\LQJWKHLUFOXEVÂśĂ&#x20AC;DJVLQD April 24 at Grapetown Shooting Range. countyâ&#x20AC;&#x2122;s rural areas. ceremonial procession into the range The Grapetown Shooting Club will Schuetzenfest festivities begin Satwhere the new kings will be crowned sponsor the event. urday morning, July 30 with a parade. for 2016. Three months later, Das Vorfest Thereâ&#x20AC;&#x2122;s also a social hour and bund The strains of â&#x20AC;&#x153;Er Lebe Hochâ&#x20AC;? (May will follow on Sunday, July 17, at Bear meeting. He Live High) are sung as the new Creek Shooting Range. This contest 6XQGD\DIWHUQRRQRIÂżFLDOVZLOOKROG kings are hoisted on the shoulders will serve as a warm-up of sorts for the Schuetzenfest Hall of Fame inductions of teammates and proclaimed the countyâ&#x20AC;&#x2122;s largest shooting competition for both the deceased and living. The new Schuetzenkoenige before being of the yearâ&#x20AC;&#x201D;Schuetzenfest. This event Barons Creek Club will do the nominacrowned in a tradition that dates back will be hosted by Bear Creek Club. tions. WRZKHQWKHWZRULĂ&#x20AC;HERUHV FHQThe 121st Gillespie County SchuetAll ages of shooters who like to demWHUÂżUHDQGULPÂżUH ZHUHVHSDUDWHG zenfest is scheduled for Saturday and onstrate their prowess in the sport into their own divisions for the annual Sunday, July 30-31, also at Bear Creek show up to participate in the annual contest. Shooting Range. Bear Creek Club will event in the hopes of winning one of Also honored during the ceremony, host this event, as well. the two kingsâ&#x20AC;&#x2122; crowns awarded to the besides the two kings, are the winning This large shoot is the second-oldest WRSRYHUDOOVKRRWHUVLQULPÂżUHDQG FHQWHUÂżUHDQGULPÂżUHWHDPVDVZHOODV community event in the area (bested FHQWHUÂżUHGLYLVLRQV the oldest and youngest shooters, and only by the Gillespie County Fair) and At the conclusion of the contest, the the highest shooting female competitor it attracts male and female shooters tallying of scores is conducted late taking part in the countyâ&#x20AC;&#x2122;s long-runZLWKWKHLUORQJEDUUHOHGFHQWHUÂżUHDQG Sunday afternoon. ning traditional event. ULPÂżUHJXQV


Itâ&#x20AC;&#x2122;s always â&#x20AC;&#x2DC;Fairâ&#x20AC;&#x2122; in August Carnival, music, livestock shows, racing, slated Aug. 25-28 An event that traces its roots back more than 100 years will be staged again this summer at the Gillespie County Fair Grounds. Offering events and activities for the entire family, the 128th Gillespie County Fair will be held Thursday through Sunday, Aug. 25-28. The four-day exposition offers live pari-mutuel horse racing, carnival and midway, livestock shows, exhibits, queenâ&#x20AC;&#x2122;s contest, musical entertainment, parade and more. And with the exception of the parade, all activities take place at the Gillespie County Fair Grounds, located about two miles from downtown Fredericksburg off Texas Highway 16 (Kerrville Highway). Sponsored by the Gillespie County Fair and Festivals Association, the 128th Gillespie County Fair opens on Thursday night, Aug. 25, with free admission to the grounds. The carnival and midway will be operating, and judging will take place in the various agricultural and home products divisions. Also that night will be the Country Music Showdown featuring local and area musicians. Kicking off the 128th Gillespie County Fair on Friday, Aug. 26, will be a 10

Lighting up the night sky during the Gillespie County Fair each year is the Ferris wheel. The carnival and midway are just some of the attractions offered at the four-day exposition, Aug. 25-28. â&#x20AC;&#x201D; Standard-Radio Post file photo

a.m. parade down Fredericksburgâ&#x20AC;&#x2122;s Main Street. Activities shift back to the Gillespie County Fair Grounds where three full days of events are planned including dances on Friday and Saturday nights on the outdoor pavilion.

It is serious business for livestock exhibitors at the Gillespie County Fair held at the Gillespie County Fair Grounds. This yearâ&#x20AC;&#x2122;s 128th celebration Aug. 25-28 will again include livestock competitions over in the Show Barn. â&#x20AC;&#x201D; Standard-Radio Post file photo @GoFred1

(QWHUWDLQHUVDUHEHLQJÂżQDOL]HGDQG information will be announced in the regular issues of the Fredericksburg Standard-Radio Post. Another highlight of the four-day exposition is the crowning of the new Gillespie County Fair Queen and her court on Friday night, Aug. 26. Horse racing is not a new attraction to the fair and once again, live parimutuel horse races will be run over two days on Saturday and Sunday, Aug. 27-28. Post time for the races both days is 1 p.m. Throughout the four-day weekend, the Exhibition Hall will be open for onlookers to take in the many displays of agricultural home products. Fruits and vegetables, grain, hay, wool and mohair, baked goods and canned foods along with arts and crafts, sewing, plants and childrenâ&#x20AC;&#x2122;s items are featured. Also, the Hill Country Antique Tractor and Engine Club will offer displays COUNTY FAIR â&#x2013;ś 44

B I L L D U N N C O N S T R U C T I O N, I N C. – e s t. 1 9 8 7 –

Featured in Texas Home & Living, Fine Homebuilding, Texas Architecture, and Architectural Digest

Recipient of Austin Energy’s 5 Star Award for a State-Of-The-Art Luxury Design Home

Custom Homes - Restorations - Remodels - Cabins - and more...

1211 E Main Street

13810 Ranch Road 12

Fredericksburg, TX 78624

Wimberley, TX 78676



44 COUNTY FAIR Cont. from 42

and will host demonstrations. There are also a number of commercial displays and educational booths. Admission is charged Friday through Sunday at the fair grounds. A wide array of foods and drinks will also be available throughout the weekend. History Since its beginning before the turn of the century, the Gillespie County Fair has been held at numerous locations, including the banks of Baronâ&#x20AC;&#x2122;s Creek just east of the city on the site of Old Fort Martin Scott. Later it was moved to where the Turner Hall is now located on West Travis Street, and after that it was held on a knoll near what is today headquarters for the city electrical department off U.S. Highway 87 South. Years afterward, the fair was conducted at what people today call the old fair grounds, two blocks from Main Street on the Kerrville Highway. The present facility, located off Texas Highway 16 South, was dedicated in 1976 during the U.S. Bicentennial. 7KHFXUUHQWVLWHLQFOXGHVDÂżYHHLJKWKVPLOHUDFHWUDFN grandstand, biergarten, exhibition hall, livestock barn, restroom facilities, an outdoor dance pavilion and ample parking. For those wanting more information about the 128th fair, the Gillespie County Fair and Festivals Association address is

Reigning over the 128th Gillespie County Fair Aug. 25-28 will be the 2016 court including, from left, First Duchess Rachel Rothermel, Queen Julie Krebs, Second Duchess Jaleigh Brown and Third Duchess Marah Graef. â&#x20AC;&#x201D; Standard-Radio Post file photo

P.O. Box 526, Fredericksburg, Texas 78624. The telephone number is 830-997-2359, and the website address is Tickets for the fair and other Gillespie County Fair and Festivals Association events can be purchased online at


...West Main Street businesses! A. Post Office B. Pioneer Library C. Vereins Kirche D. Courthouse E. Pioneer Museum





Hours: Mon.-Sat. 11 a.m.-4 p.m. Fri. 11 a.m.-8 p.m. 904 West Main



made from Texas Grapes

14-16 Winery Releases Tasted Daily


WINE + BEER + LIVE MUSIC + EVENT VENUE 607 W. Main St., Fredericksburg, TX 78624 | 830.992.3192


Breakfast & Lunch served all day, 6:30am-2pm Closed Monday Daily Specials Â&#x2021; Dine In or To Go



City CafĂŠ 505 West Main Street 830-307-3346


I 830-456-2513 830-990-0501 0501








BEER, WINE, LIQUOR & ICE Come See Our Large Selection of Whiskeys. Unique Snacks. Locally Owned. Open Mon. thru Sat. 10am-9pm

810 West Main H 830-992-3235 D

211 West Main Street 832.541.7654 618 W. Main St., Fredericksburg, Tx. 10 The Hill Countryâ&#x20AC;&#x2122;s y Choice for Steak & Seafood


Where Vintage and Modern Meet 816 W. Main


  f:0$,167 Reservation Service Office Guest Houses and Bed & Breakfast



Massage & Bodywork



Red Baron Antique Mall

50+ Antique Dealers Furniture - Glassware Chandeliers - Nautical - Oil Lamps & Parts - Primitives - Western Open 7 Days A Week 10-5 Sun.-Fri. Sat. 10-6 502 W. Main, Fredericksburg, TX

830.998.5400 12

Ă&#x201C;{{Ă&#x160;7°Ă&#x160;>Â&#x2C6;Â&#x2DC;Ă&#x160;-Ă&#x152;°Ă&#x160;UĂ&#x160;Ă&#x20AC;i`iĂ&#x20AC;Â&#x2C6;VÂ&#x17D;Ă&#x192;LĂ&#x2022;Ă&#x20AC;} 830-997-4554 17

Put Yourself in â&#x20AC;&#x153;Ourâ&#x20AC;? Place :HVW0DLQÂ&#x2021;)UHGHULFNVEXUJ7;

8 830-997-9009 30-99 30-9 9

Daily Lunch Specials $8.49 - includes iced tea

by LalĂŠtta

Crenwelge Motor Sales, Inc. Serving the Hill Country Since 1940

  :0DLQ Download the

:0DLQ6Wq (0DLQ6Wq Amish crafted furniture, quilts, crafts & gift items 18

Ambriz Jewelry 807 West Main Street Fredericksburg, Texas mobile app at the App Store or Google Play


Harperâ&#x20AC;&#x2122;s Frontier days enters 52nd Year Labor Day weekend means more to Harper residents than the end of summer and wearing white. On Sept. 3-4, the town will hold its 52nd Annual Harper Frontier Days. 7KHDQQXDOHYHQWZLOOEHQHÂżW+DUSHU&RPmunity Park. Frontier Days is a celebration of the way life used to be in this community located in the ZHVWHUQSDUWRI*LOOHVSLH&RXQW\ Besides the downtown parade, the event will also include tournaments for dominos, washers DQGÂżVKLQJ In addition to pitching washers and casting ÂżVKLQJUHHOV+DUSHUZLOOKRVWDURGHRWRFHOebrate. Rodeo admission is $10 for adults, $5 for kids ages six to 12 and free for those under six. &RVWIRUWKHGDQFHLVIRUDJHVDQGXS 7KH+DUSHU&RPPXQLW\3DUNLVORFDWHGDW the east corner of U.S. Highway 290 and North Park Street, in Harper. For more information, visit its website at

Taking in the sights and sounds of the Harper Frontier Days Parade were these young siblings, who were among hundreds to line the streets for the annual parade. â&#x20AC;&#x201D; Standard-Radio Post file photo

Service Since 1927

Crenwelge Motor Sales 815 W. Main Fredericksburg 830-997-4331

Sales Since 1940


Teamsters roots run deep in Hill Country One of the ways people transported goods between Fredericksburg and San Antonio before there were smooth roads and multi-lane highways was by oxen- and horse-drawn wagons. In remembrance of those times, members of the Gillespie County Old Teamsters annually gather here for a reunion which this year will take place Monday, Sept. 5, at the DAV Hall on U.S. Highway 87 North. 7KHRUJDQL]DWLRQ¶V¿UVWPHHWLQJRQ-XO\ ZDVKHOGDW2OG.ODHUQHU¶V3DUNEXWHYHU since the gathering has taken place on Labor Day. ,QLWLDOO\WKHSDUNORFDWHGRQ/LYHRDN&UHHN IRXUPLOHVZHVWRI)UHGHULFNVEXUJRQ86+LJKZD\ZDV RQHRIWKHDUHD¶VIDYRULWHSLFQLFJURXQGVDQGLWZDVWKHUH WKDWYHWHUDQ2OG7HDPVWHUPHPEHUVOLNHGWRJDWKHUWRVZDS stories. 7KHLUWDOHVRIWUDYHORYHUUXJJHGFRXQWU\URDGVUHDFKHG EDFNDVHDUO\DVZKHQ)UHGHULFNVEXUJZDVVHWWOHGLQDQG FRQWLQXHGRQXQWLOWKHFRPLQJRIWKHUDLOURDGLQ (VSHFLDOO\GXULQJWKHHDUOLHVWWLPHVWUDLOGULYHUVKDGWR contend with the possibility of Indian attack or renegades









FRPLQJRXWRIWKHEUXVKWRFRQ¿VFDWHWKHLU cargo. 1RWRQO\GLGWKHVHHDUO\KDXOHUVFDUU\KHDY\ loads containing all types of freight, but they DOVRKDGWRFDUU\SURYLVLRQVIRUWKHPVHOYHVDQG their animals. In addition to trips to San Antonio, their treks DOVRLQFOXGHGFDUU\LQJSURYLVLRQVWRDUP\SRVWV at Mason and more-distant places like San Angelo. One of the secrets of the old teamsters was that, on occasion, they needed to carry large sums of money hidden in nail kegs to San Antonio banks. 7RVHUYHWHDPVWHUV)UHGHULFNVEXUJEDFNWKHQKDGQXPHURXVOLYHU\VWDEOHVDQGFDPS\DUGVZKHUHWUDYHOHUVFRXOGSHQ WKHLUKRUVHVDQGHYHQRQRFFDVLRQSLWFKDWHQW Among the more-prominent locations in town for teamsters to stable their horses was the Hotopp Camp Yard on the VRXWKVLGHRIWRGD\¶VEORFNRI:HVW0DLQ The owner, Henry Hotopp Sr., was one of the best known of the early freight haulers who it is said made as many as WULSVWR6DQ$QWRQLRGXULQJKLVFDUHHU



We Help Locals Sell..... And Auslanders Become Natives..... For Over 22 Years!


200 quilts on display at ninth biennial quilt show with over 200 entries, a tea room, old-fashioned bed turning, The Vereins Quilt Guild’s ninth biennial show, will be held an award-winning donation quilt, vendors, a scissors-sharpFriday and Saturday, Sept. 2-3, at Fredericksburg United Methodist Church. The Methodist church is at 1800 North ening booth, a silent auction and a boutique. The Exhibit Wall in the quilt room will showcase national Llano Street. award-winning quilts. During the show, an American QuilThe show’s theme is “Take My Breath Away.” More than WHU¶V6RFLHW\FHUWL¿HGDS200 quilts and projects will praiser will appraise quilts be on display, along with many new additions to this by appointment, for a $45 fee. show. The quilt drawing will be Hours for the show will 3 p.m., Saturday, Sept. 3. be Friday, Sept. 2 from 9 Tickets will be available at a.m. to 6 p.m. and Saturthe show for $1 each or $5 day, Sept. 3, from 9 a.m. for six. The donation quilt, to 4 p.m. There will be a $6 per person admission titled “More is More,” has been appraised at $37,500. charge. The show is being supThe quilts in the show ported by a grant from the are those made by memPedernales Creative Arts bers of the Vereins Quilt Alliance, the City of FredGuild, a local group of quilericksburg and Gillespie ters from Fredericksburg County. and the surrounding Hill For information, visit Country. Organizers say this will Quilt enthusiasts dig through a tub of scraps during the 2014 or Facebook. be their largest show ever Vereins Quilt Guild show. — Standard Radio-Post file photo


830 997 8587 · · Fredericksburg

Tatsch Well Service, LLC

Specializing in Service & Repair WWW.HILLCOUNTRYWATERWELL.COM

â&#x20AC;&#x153;We go to any depth for your well needs!â&#x20AC;? -Â&#x153;Â?>Ă&#x20AC;Ă&#x160;*Ă&#x2022;Â&#x201C;ÂŤĂ&#x192;Ă&#x160;UĂ&#x160;iĂ&#x152;Ă&#x192;Ă&#x160;UĂ&#x160;-Ă&#x2022;LÂ&#x201C;iĂ&#x20AC;Ă&#x192;Â&#x2C6;LÂ?iĂ&#x160;*Ă&#x2022;Â&#x201C;ÂŤĂ&#x192; *Ă&#x20AC;iĂ&#x192;Ă&#x192;Ă&#x2022;Ă&#x20AC;iĂ&#x160;/>Â&#x2DC;Â&#x17D;Ă&#x192;Ă&#x160;UĂ&#x160;7Â&#x2C6;Â&#x2DC;`Â&#x201C;Â&#x2C6;Â?Â?Ă&#x192; UĂ&#x160;Ă&#x20AC;iiĂ&#x160; Ă&#x192;Ă&#x152;Â&#x2C6;Â&#x201C;>Ă&#x152;iĂ&#x192;Ă&#x160;U Â&#x2DC;Ă&#x192;Ă&#x2022;Ă&#x20AC;i`]Ă&#x160;Â&#x2C6;ViÂ&#x2DC;Ă&#x192;i`]Ă&#x160; Â&#x153;Â&#x2DC;`i`]Ă&#x160;/iĂ?>Ă&#x192;Ă&#x160;Â&#x2C6;V°Ă&#x160;Â&#x203A;{xäĂ&#x201C;Ă&#x160;*

Locally owned and operated by Dennis S. Tatsch TATSCH WELL SERVICE

FREDERICKSBURG, TX FAX: 830-997-4044 PHONE: 830-997-2413



Ride ’em, cowboy! A night of professional bull riding will return to the Gillespie County Fair Grounds on Saturday, Sept. 10. The seventh annual Fredericksburg PBR is sponsored by the Gillespie County Fair and Festivals Association. The bull riding will be on the track in front of the grandstand, and the chutes will be set up so that the bulls will ride out toward the grandstand. The local event is part of the PBR’s Touring Pro Division. Riders are competing for points to earn spots in the PBR’s Built Ford Tough Series. Tickets for the Seventh Annual Fredericksburg PBR are expected to go on sale this spring. To purchase tickets or for more information on the bull riding event as well as other fair association-sponsored events is available by visiting or www.gillespiefair. com.

Bull riders will be back in town to compete in the Seventh Annual Fredericksburg PBR at the Gillespie County Fair Grounds on Saturday, Sept. 10. — Standard-Radio Post file photo

For all of your insurance needs!

+RPH‡‡$ $XWR‡%XVLQHVV‡‡+ +HDOWK‡‡/ /LIH‡‡5 5HWLUHPHQW‡% %V‡‡: :LQHULHV‡‡$JULFXOWXUH Visit with experienced, independent Texas agents, representing major insurance companies. We provide outstanding customer ser vice, including claims assistance!

108 Theodore Specht Drive, P.O. Box 513, Fredericksburg

(830) 997-9531

(800) 280-9531 @GoFred1


Scholarship Fest to return Sept. 24 â&#x20AC;&#x153;College Tailgatingâ&#x20AC;? is the theme for the 20th annual Scholarship Fest on Saturday, Sept. 24, at the Gillespie County Fair Grounds. Gates open at 3 p.m. Sponsored by the Gillespie County Fair and Festivals Association, the event includes afternoon activities, appetizers, a dinner, silent and live auctions and a drawing for thousands of dollars in SUL]HVWKDWLQFOXGHJXQVKXQWLQJDQGÂżVKLQJHTXLSPHQWMHZHOU\ JLIWFHUWLÂżFDWHVDQGPRUH Monies raised from the event go towards the Gillespie County Fair Associationâ&#x20AC;&#x2122;s scholarship program. Since 1991, the fair association has awarded $327,850 in scholarships to 602 Gillespie County high school students. Scholarship tickets are $20 each and will go on sale this spring. 7LFNHWVZLOOEHVROGDWWKHRIÂżFHDWWKHIDLUJURXQGVIURPGLUHFtors of the Gillespie County Fair and Festivals Association and at locations around the county. For dinner, a barbecue meal with all the trimmings will be served. Along with the prize drawing will be a live auction featuring cakes baked and decorated by the 2016 Gillespie County Fair

Two Scholarship Fest attendees get a close-up look at a piece of jewelry before bidding in the silent auction at Scholarship Fest at the Gillespie County Fair Grounds. â&#x20AC;&#x201D; Standard-Radio Post file photo

Queen and Duchesses as well as other items. More information on Scholarship Fest as well as other activities at the fair grounds is available by calling 830997-2359 or visiting

Olmer Native Plants Nursery $SSOH6WUHHWÂ&#x2021;)UHGHULFNVEXUJ7;  

Offering a wide selection of native plants in various gallon sizes. Come see for yourself. Brighten up your garden, porch, or patio! Follow us on Facebook: Download the

mobile app at the App Store or Google Play


Music Club readies for 80th year Stretching over the next 13 months, nine concerts ranging from classic piano and chamber music to operatic and barbershop vocal performances are planned by the Fredericksburg Music Club (FMC). Set for 3 p.m. on the third Sunday of each month in the sanctuary of Fredericksburg United Methodist Church, FMC will complete its 2015-16 concert schedule this spring with three more performances before taking a three-month summer break and then resuming in the fall to mark the organizationâ&#x20AC;&#x2122;s 80th DQQLYHUVDU\\HDUZLWKWKHÂżUVWVL[RIHLJKWSURJUDPV Attendance at Fredericksburg Music Club concerts is free of charge, thanks to grants as well as private and corporate donations received through the mail or at the door of each performance. 7KH)UHGHULFNVEXUJ0XVLF&OXEÂśVJRDOVVLQFHWKHQRQSURÂżW RUJDQL]DWLRQZDVIRXQGHGRQ0D\KDYHEHHQWRSURvide the area with quality musical programs, to support music education and to make the gift of music available to everyone. More information â&#x20AC;&#x201D; including lists of concert schedules, past performers since 2005, board members and assistance on club membership, patronage and donating online â&#x20AC;&#x201D; is available on the FMCâ&#x20AC;&#x2122;s website ( The Fredericksburg United Methodist Church is located at 1800 North Llano.

Pianist Emile Pandolfi will be performing for the May 15 concert hosted by the Fredericksburg Music Club as part of its concert series. â&#x20AC;&#x201D; Submitted photo

Upcoming performances will include: s1DWKDQLHO0D\ILHOGWUXPpets with organ accompaniment â&#x20AC;&#x201D; March 20. s7KH0DUFVPHQ6DQ$QWRnio premier menâ&#x20AC;&#x2122;s a cappella JURXSu$SULO s(PLOH3DQGROILFRQFHUW pianist â&#x20AC;&#x201D; May 15. s)HL)HL'RQJWK9DQ Cliburn International Piano Competition finalist â&#x20AC;&#x201D; Sept. 18.

s$SROOR&KDPEHU3OD\HUV string ensemble â&#x20AC;&#x201D; Oct. 16. s$YD3LQHVRSUDQRu1RY 20. s0LUR4XDUWHWYLROLQLVWV and cello ensemble â&#x20AC;&#x201D; Jan.  s$ODPR0HWUR&KRUXV award-winning barbershop JURXSu)HE s'RXJ0RQWJRPHU\SLDQLVW u0DUFK

108 East Austin Street (1 block off Main to the North between Adams & Llano Streets)

830-990-6992 Whole Pie - ½ Pies or By the Slice Enjoy your pie with us or take it to go.

Thursday-Friday-Saturday-Sunday: 10 a.m. - â&#x20AC;&#x2DC;til ? Come Early For Best Selection Closed when sold out. H Extended days during Spring Break & holidays. H


108 E. Austin St

Marktplatz Courthouse & Library

~ Coffee Whole Bean & Ground a0DQ\GLIIHUHQWpDYRUVDYDLODEOH ~~~

One Block off Main to the North between Adams & Llano St. Main St. / Hwy. 290 Llano St.



Adams St.

Made with Fresh Ingredients from Scratch Selection Changes Daily Up to 20 Different Kinds of Pies To Choose From!

Our 100% Arabica beans are carefully selected and purchased direct from plantations around the world. Our roasts are fullbodied and rich tasting with a GHHSoQHDURPD



Great Selection of Antique Quilts




German song rings throughout town Keeping German tradition Some knowledge of the German and heritage alive are two lolanguage is helpful, but is not recal choirs â&#x20AC;&#x201D; the Arion Menâ&#x20AC;&#x2122;s quired, nor is the ability to sightChoir and the Hermann Sons read music. Mixed Choir. The choirsâ&#x20AC;&#x2122; repertoire ranges The choirs meet weekly from sacred music to classical for fellowship and singing. masterworks to folk songs. Membership is voluntary and They jointly present a freeadults who enjoy singing are admission public concert in the invited to join in and particiVSULQJXVXDOO\WKHÂżUVW6XQGD\LQ pate any time. May (Maifest), and another in the Arion Männerchor (Arion IDOOWKHÂżUVW6DWXUGD\LQ1RYHPMenâ&#x20AC;&#x2122;s Choir), founded ber, a Herbstfest (Harvestfest). in 1908, and the HerBoth of these events are held at mannsĂśhne Gemischter St. Josephâ&#x20AC;&#x2122;s Halle. Chor (Hermann Sons Mixed In addition, they represent Two concerts â&#x20AC;&#x201D; in the spring and in the fall â&#x20AC;&#x201D; as well as Choir), active since 1934, are Fredericksburg in a yearly Sänother performances feature the Arion Menâ&#x20AC;&#x2122;s Choir and the both directed by Mark Hiergerfest (singersâ&#x20AC;&#x2122; festival) along Hermann Sons Mixed Choir. The choirs are under the direcholzer. with German choirs from San Antion of Mark Hierholzer. â&#x20AC;&#x201D; Standard-Radio Post file photo Keyboard artist, choral WRQLR1HZ%UDXQIHOVDQG&RUSXV director and composer HiChristi. erholzer directs the choirs in weekly rehearsals and perforBoth choirs also appear regularly at Oktoberfest, and give mances throughout the year. performances from time to time during the year at nursing Rehearsals are held Thursday evenings at St. Josephâ&#x20AC;&#x2122;s Haland retirement homes. le at 212 W. San Antonio St. The Hermann Sons meet at 7:30 More information is available by calling Heinrich Boenig at p.m. and are followed by the Arion at about 8:15 p.m. 830-669-2104 or Carol Woitalla at 830-997-9671.





Becker Vineyards

Feb 6, 7, 13 & 14 Merlot & Chocolate


Ç Ç Ç Í&#x2DC;Ä&#x201A;ĹŻĆ&#x161;Ä&#x161;Ĺ˝Ć&#x152;ÄŠĹ?Ä&#x17E;Ć&#x152;Ĺ?Ä&#x201A;Ć&#x152;Ć&#x161;Ä&#x17E;ŜͲĊĹ?Í&#x2DC;Ä?Žž Corner of Orange & Main KWEĎ­Ď­Ä&#x201A;žͲϾĆ&#x2030;ĹľH ^ƾŜÍ&#x2DC;Ď­Ď­Ä&#x201A;žͲϰĆ&#x2030;ĹľH Closed Tues.




301 W. Main H Fredericksburg H 997-7865



H 'Ä&#x17E;Ć&#x152;ĹľÄ&#x201A;ĹśĹ?ŜŜÄ&#x17E;Ć&#x152;Ć?H Charbroiled Steaks & Burgers H Sandwiches & Salads H Texas ^Ć&#x161;Ç&#x2021;ĹŻÄ&#x17E;DÄ&#x17E;Ç&#x2020;Ĺ?Ä?Ä&#x201A;ĹśĹ?ŜŜÄ&#x17E;Ć&#x152;Ć?H &Ć&#x152;Ä&#x17E;Ć?Ĺ&#x161;,ŽžÄ&#x17E;ĹľÄ&#x201A;Ä&#x161;Ä&#x17E; Ä&#x17E;Ć?Ć?Ä&#x17E;Ć&#x152;Ć&#x161;Ć?H 'Ć&#x152;Ä&#x17E;Ä&#x201A;Ć&#x161;^Ä&#x17E;ĹŻÄ&#x17E;Ä?Ć&#x;ŽŜŽĨ'Ä&#x17E;Ć&#x152;ĹľÄ&#x201A;ĹśÄ&#x17E;Ä&#x17E;Ć&#x152;Ć? H And Much More!


Mar 19 & 20 Bluebonnets, Bluegrass, and BBQ

April 30 & May 1 Lavender Festival

May 8 Motherâ&#x20AC;&#x2122;s Day Luncheon


July 4

Chili Cook-off


TONY MARTIN BUILDERS Residential Construction Fredericksburg 830-992-3242 Telluride 830-998-4300

Architectural Design 830-456-6242




Historic Fredericksburg

Historic Texas Ranch Compound

Historic Napa Valley Compound

Bordering Robert Mondavi Winery

Historic Aldasora Ranch Telluride

Historic Buffalo River Compound

The Fine Art of Design/Build for over 30 years VISIT US AT TONYMARTININC.COM


Chorale will perform new compositions Performances of new compositions and vocal pieces are a tradition for the Fredericksburg Chorale. Under the direction of Mark Hierholzer, the Chorale is made up of area residents whose ages range from nine to 75 years. Among its year-long schedule of programs, the Chorale offers a concert series — Dialogues and Dances — at 7 p.m. on the second Saturday of each month. The concerts, held at the Hill Country University Center, feature original vocal and instrumental compositions and improvisations. In addition, members of the Chorale also present several special concerts throughout the year. The Spring Concert featuring Bach’s B Minor Mass, will be performed on Saturday, May 7, at a location to be announced. Performances will be at 3 p.m. and 7 p.m. As part of the holiday season, the chorale will perform a Christmas Concert Dec. 3 at St. Joseph’s Halle. In addition to scheduled concerts, the Chorale hosts a summer workshop, which may lead to a concert in August. The Chorale’s New Works Concert is scheduled early February 2017 at St. Joseph’s Halle. For those interested in joining the Chorale, rehearsals are held Monday evenings from 7-8:30 p.m. at Bethany Lutheran.

Under the direction of Mark Hierholzer, the Fredericksburg Chorale continues the tradition of performing new compositions and vocal pieces. — Standard-Radio Post file photo Semester membership dues are $55 for adults and $25 for students. Scholarships are available. Anyone interested in singing is invited to join the group for which there are no auditions. For more information, email info@fredericksburgchorale. com or call 830-456-1713.

405 Whitney St. Fredericksburg, TX 78624 830.997.8615


Orchestra keeps musical tradition alive Organized music has always played a valued role in the lives of Fredericksburg citizens, according to the late Kenn Knopp, co-founder of the Friends of Van Der Stucken. Theresa Britt, executive director of the Frederickburg Community Orchestra, invites the public to not only attend concerts, but to consider joining the organization as a player or volunteer. â&#x20AC;&#x153;This is a public organization aimed at advancing string HGXFDWLRQZLWKDOORIWKHZRQGHUIXOEHQHÂżWVVXFKHGXFDWLRQ brings to a community,â&#x20AC;? Britt said. The orchestra is made up of community members ranging in age from 12 to 75. The purpose of Fredericksburg Community Orchestras is to promote string education in Fredericksburg and surrounding communities, through lessons, Suzuki Group classes for youth ages 3 to 12, Community Ensemble for ages 12 and up, the Community Orchestra for players of all ages and levels, and a Summer Strings camp. For information:,, (806) 549-2483.

FCO Events




Like eating on the runway! A classic 1940s diner 155 Airport Rd. Fredericksburg, TX (at the Gillespie Co. Airport) 830-997-4999

155 Airport Rd. Fredericksburg, TX 830-997-9990 'RZQORDGWKH


58 Jaston Williams (left), co-creator of â&#x20AC;&#x153;Greater Tuna, answers audience questions following his openingnight visit to â&#x20AC;&#x153;Greater Tuna.â&#x20AC;? â&#x20AC;&#x201D; StandardRadio Post file photo

FTC ushers in 20th season Live community theater is alive and well in the Texas Hill Country. Thereâ&#x20AC;&#x2122;s no need to travel to Austin or San Antonio, as those who love plays and musicals can enjoy Fredericksburgâ&#x20AC;&#x2122;s acclaimed community theater troupe. Fredericksburg Theater Company performs its productions at its Steve W. Shepherd Theater at 1668 U.S. 87 South. Season 19 winds down The 19th season is beginning to wind down as the Stephen Sondheim and James Lapine Tony Award-winning musical, â&#x20AC;&#x153;Into the Woods,â&#x20AC;? wraps up its run on March 6. Following that and concluding the 19th season will be the comedy â&#x20AC;&#x153;The Nerd,â&#x20AC;? which will run April 15 until May 1. Past shows in Season 19 included â&#x20AC;&#x153;Evita,â&#x20AC;? â&#x20AC;&#x153;Annie Jr.,â&#x20AC;? â&#x20AC;&#x153;Greater Tuna,â&#x20AC;? â&#x20AC;&#x153;Our Townâ&#x20AC;? and â&#x20AC;&#x153;A Tuna Christmas.â&#x20AC;? Special performances Hideout Theatreâ&#x20AC;&#x2122;s all-star lineup of live, improvisational comedy performers from Austin returned to FTC in March. Eighties lovers partook in the 80â&#x20AC;&#x2122;s Spring Break Party, March 12, as the theater celebrated the 30th anniversary of the Matthew Broderick comedy, â&#x20AC;&#x153;Ferris Buellerâ&#x20AC;&#x2122;s Day Off.â&#x20AC;? Season 20 )7&RIÂżFLDOVZLOODQQRXQFHWKHSODQQHGSOD\VDQGPXVLFDOV for Season 20 on Wednesday, March 16. They will also announce special events that include live music, guest artists and screenings of classic movies. Freddyburg FTCâ&#x20AC;&#x2122;s summer Freddyburg youth theater program is a four-week camp for kids ages eight to 18. It will culminate into a one-act musical thatâ&#x20AC;&#x2122;s part of the FTC main stage season. Sponsorship Most of FTCâ&#x20AC;&#x2122;s funding is from private donations, but the @GoFred1

SHOW TIMES & INFO Showtimes for the 20th season are 7:30 p.m., with Sunday matinees at 2 p.m. Tickets usually go on sale a full two weeks prior to opening night at the FTC Box Office, located at the theater, at 1668 U.S. Highway 87 South. Donors are able to order three weeks prior to opening. Tickets can be reserved by calling the FTC office at 830997-3588 or toll free at 888-669-7114. Office hours are 9 a.m. to 1 p.m., Monday through Friday. Tickets may also be purchased online at

theater also receives grants and corporate donations. A Season Flex Pass is $145 and includes six tickets that can be used as chosen throughout the theater season. Donation levels begin at $250 with the Performer level and include Director ($1,000), Playwright ($2,500), Producer ($5,000) and Tony Award ($10,000). Each level of support comes with tickets, recognition and other special features. Donors can also pledge support in the form of monthly donations, starting at only $25 a month. FTC has earned a positive reputation for its big musicals, dramas and comedies. Some of those productions included: Âł/HV0LVpUDEOHV´Âł0DQRI/D0DQFKD´Âł6RXWK3DFLÂżF´Âł)LGdler on the Roof,â&#x20AC;? â&#x20AC;&#x153;Our Town,â&#x20AC;? â&#x20AC;&#x153;Joseph and the Amazing Technicolor Dreamcoat,â&#x20AC;? â&#x20AC;&#x153;My Fair Lady,â&#x20AC;? â&#x20AC;&#x153;The Sound of Music,â&#x20AC;? â&#x20AC;&#x153;1776,â&#x20AC;? â&#x20AC;&#x153;Annie,â&#x20AC;? â&#x20AC;&#x153;The Music Man,â&#x20AC;? â&#x20AC;&#x153;West Side Story,â&#x20AC;? â&#x20AC;&#x153;The King and I,â&#x20AC;? â&#x20AC;&#x153;Annie Get Your Gun,â&#x20AC;? â&#x20AC;&#x153;The Fantasticks,â&#x20AC;? â&#x20AC;&#x153;Little Shop of Horrors,â&#x20AC;? â&#x20AC;&#x153;The Miracle Worker,â&#x20AC;? â&#x20AC;&#x153;Lost in Yonkersâ&#x20AC;? and â&#x20AC;&#x153;Disneyâ&#x20AC;&#x2122;s Beauty and the Beast.â&#x20AC;? The FTC has also sponsored symphony concerts and a ballet performance. More information aailable online at The theater is also on Facebook.


Your Showcase for Marvin Windows and Doors FREDERICKSBURG | 603 Tivydale Road, #1103 830-990-5717 | Calling ahead for an appointment is suggested

©2015 Marvin® Windows and Doors. All rights reserved. ®Registered trademark of Marvin Windows and Doors.


Found it!

Fredericksburg, county home to geocaches

Of the more than 2.7 million of these items that exist worldwide, more than 20 hide in plain sight in Fredericksburg. Sometimes theyâ&#x20AC;&#x2122;re hidden at the bottom of fences, sometimes inside trees. Other times, theyâ&#x20AC;&#x2122;re in the last place a person would suspect. Some are in cemeteries. The one in Frantzen Park on Orange Street is HDV\WRÂżQGZKLOH the one in the porous rock at Marktplatz requires a luck and intuition. Whether easy or challenging, itâ&#x20AC;&#x2122;s all part of geocaching â&#x20AC;&#x201D; a real-world, outdoor treasure hunting game using GPSenabled devices. where along West Main Street in Fredericksburg. â&#x20AC;&#x201D; Once the coordinates, Two seasoned geocaching veterans introduce their younger friend to a geocache canister hidden someStandard-Radio Post file photo description and clues lead to the right place, KXQWHUVÂżQGWKHJHRthat are then sent to the person who with something they brought. cache. The caches are as small as bison created the geocache. Some geocachers will look for geotubes and are as big as ammunition Once a geocache is found, the searchcaches while they travel, while some boxes. er signs the log. They can also log it may see geocaches in a particular place Other common objects used for geoonline or through their cell phone app and focus their travel plans on that FDFKHVLQFOXGHÂżOPFDQLVWHUVDQGMDUV WRKDYHDQRIÂżFLDOUHFRUG6RPHORYH area. Airtight is preferable. WRWDNHÂłVHOÂżHV´RIWKHPVHOYHVZLWKWKH Across the world, itâ&#x20AC;&#x2122;s probably not Generally, there are three types of cache, although itâ&#x20AC;&#x2122;s advisable to do so surprising there are no geocaches in geocaches: regular ones, which can as to not give away too many clues reNorth Korea. However, it might surbe found with the coordinates and garding the geocacheâ&#x20AC;&#x2122;s location. prise some that China, Iran and Cuba clues; multiple geocaches, which can Many geocaches, except for the ones have geocaches. EHIRXQGRQFHÂżQDOFRRUGLQDWHVDUH too small, also have gifts and other For more information on geocaching DVVHPEOHGIURPÂżQGLQJÂżQDOFOXHV trinkets in them. Itâ&#x20AC;&#x2122;s customary, if takor to set up a free account, go to www. virtual geocaches, where clues help ing one, for the searcher to replace it geocachers locate answers to questions TIPS FROM EXPERIENCED CACHERS: Stay positive. Donâ&#x20AC;&#x2122;t get discouraged if you donâ&#x20AC;&#x2122;t find a lot right away. It takes a bit to get used to. Donâ&#x20AC;&#x2122;t go alone. It is always better to find a friend to go with or a group of people. Be prepared. Make sure to take plenty of water and snacks and

wear comfortable shoes and clothing. Stay charged. Make sure your phone is fully charged before heading out. Take a survival kit. Always carry a bag with you that has the following: bug spray, first aid kit, pen or pencil, flashlight, tweezers, paper, sunscreen, sunglasses, a hat and treasures to exchange.



Open 6 Days a Week 260 E. Main Street Fredericksburg, TX 78624

830.990.5858 Located at Main & Lincoln in the Basement of the old Keidel Hospital. Entrance in the courtyard E\WKHROGĂ&#x20AC;VKSRQG

Open 6 Days a Week Wednesday thru Monday 9:00 a.m. - 3:00 p.m. Dinner 5:00 p.m. - 9:00 p.m. Closed Tuesday Live Music most Fri. & Sat. evenings f)8//6(59,&(%5($.)$67/81&+ ',11(5 f35,9$7(0((7,1*5220f'$,/<63(&,$/6 s4/'//2$%237%,#/-% 7772!4(3+%,,%22%34!52!.4.%4


Always open for later options


Top 5 places for kids in Fredericksburg For those who come to Fredericksburg with kids, there are plenty of things in town for youngsters to do with their parents. +HUHDUHÂżYH


Skate Park

)RUNLGVZKRZRXOGUDWKHUJULQGROOLHVWDOODQGNLFNĂ&#x20AC;LS than be sitting still, the Fredericksburg Texas Skate Park is just the place. Funded by the Fredericksburg Morning Rotary Club and EXLOWE\(YHUJUHHQ6NDWHSDUNVWKHSDUNLVDOOFRQFUHWHFRQVWUXFWHGZLWKLQÂżQLWHOLQHVDQGLVIUHHWRWKHSXEOLF The park is located at Old Fair Park, at the corner of Ufer and Lincoln streets.




Sports Facilities



Marktplatz, German for market place, or market square, contains a playground that features balancing, climbing and VZLQJLQJDWWUDFWLRQV0DUNWSODW]LVIUHHDQGLVORFDWHGDW West Main Street. 2DN&UHVW3DUNLVKRPHWRDFRYHUHGSOD\JURXQGDQGLVORFDWHGRQ6WDWH+LJKZD\WZRDQGRQHKDOIPLOHVVRXWKRI Main Street. Old Fair Park, at the corner of Ufer and Lincoln streets, also has a playground.



There are two public pools in town, Lady Bird Johnson Municipal Park Pool and Coach Tony Knopp Town Pool. %RWKFKDUJHDDGPLVVLRQIHHDQGZLOOEHRSHQVWDUWLQJ -XQHIURPSP The park pool will be open daily and the town pool will be open Tuesdays through Sundays (closed Mondays).

Fredericksburg is home to the Fredericksburg Texas Skate Park, donated by the Fredericksburg Morning Rotary Club for $325,000. The park is located at Old Fair Park and admission is free. â&#x20AC;&#x201D; Standard-Radio Post file photo Above: Liliana Mondragon (left) and Pablo Carrillo chill out at the side of the Coach Tony Knopp Town Pool last summer. Formerly dubbed â&#x20AC;&#x153;Town Pool,â&#x20AC;? the City of Fredericksburg renamed the pool for longtime city pool manager Tony Knopp and held a recognition ceremony and reception for family members. â&#x20AC;&#x201D; Standard-Radio Post file photo



Nature Exhibits

The Old Tunnel State Park is a bat cave that is home to millions of Mexican free-tailed bats that come to stay every May through October. There is an upper viewing deck that is open nightly to allow visitors to watch the bats as they exit the cave around dusk. There is also a lower viewing deck, open Thursdays through Sundays that features a special educational presentation. Admission to the lower deck is $5.

For exit times call 866-978-2287. Enchanted Rock, a naturally formed massive granite dome, is a great place to hike and observe nature as it is home to many animals that are common around Gillespie County as well as animals who are not, like the Fairy Shrimp, tiny translucent freshwater shrimp. Admission for anyone over 12 is $7, but for those 12 and under, admission is free. For more information on Enchanted Rock, call 830-685-3636.

KRAMER’S The Outdoor Store, LLC

Hunting, Archery, Fishing, Sporting Goods, Ammo & Reloading Supplies, Feed, Feeders & Blinds, Hay Seeds, Farm & Ranch, Meat Processing Supplies

ÓÎÈÎÊ °Ê1-ÊÜÞÊnÇÊUÊÀi`iÀˆVŽÃLÕÀ}ÊUʣʓˆiʜÕÌÊnÇ (830) 997-9457UÊÜÜÜ°À>“iÀÃ"ÕÌ`œœÀ-̜Ài°Vœ“

64 Back in the â&#x20AC;&#x153;good olâ&#x20AC;&#x2122; daysâ&#x20AC;? in the 19th and early 20th Centuries, students met in one-room country schools and learned the three Râ&#x20AC;&#x2122;s: reading, writing and â&#x20AC;&#x2122;rithmetic. Then, along came schools like Fredericksburg Independent School District, Harper ISD and Doss Consolidated Common School District, and the country schools took their place in history. Those schools are now things of the past, but the sites and even memories can still be revisited, courtesy of a visit on the Gillespie County Country Schools Trail. â&#x20AC;&#x2DC;Schools Trailâ&#x20AC;&#x2122; The â&#x20AC;&#x153;schools trailâ&#x20AC;? gives visitors and residents alike a chance to venture into the earlier days of Texas, when German settlers came to the Texas Hill Country and established country schools to educate their children. Among the old school houses on the driving trail are Cave Creek, Cherry Mountain, Cherry Spring, Crabapple, Grapetown, Junction, Lower South Grape Creek, Luckenbach, Meusebach Creek, Nebgen, Pecan Creek, Rheingold, Williams Creek (Albert) (where President Lyndon Johnson attended), White Oak, Willow City and Wrede. In the 1950s and 1960s, the schools were consolidated into the Fredericksburg Independent School District. On Jan. 23, 2006, the Gillespie County Commissioners

Open Houses and other events The schools are available to the public for social activities. The following are open houses and other events: Â&#x2021; $SULODP1LQWK$QQXDO/%-%LF\FOH7RXU Â&#x2021; $SULODPWRSPRSHQKRXVHVDW:UHGH Pecan Creek, Cherry Spring, Crabapple, Junction and &KHUU\0RXQWDLQ Â&#x2021; $SULODPWRSPDQQXDOIXQGUDLVHUEDUEHFXHDWWKH$PHULFDQ/HJLRQ+DOO Â&#x2021; -XQHDPWRSP&RXQWU\6FKRRO$VVRFLDWLRQRI$PHULFDFRQIHUHQFH Â&#x2021; -XO\DPWRSP5KHLQJROG6FKRRO2SHQ +RXVH Â&#x2021; -XO\SP:UHGH6FKRRO2SHQ+RXVH Â&#x2021; $XJDPWRSP:LOORZ&LW\6FKRRO2SHQ +RXVH Â&#x2021; 6HSWDPWRSP/XFNHQEDFK6FKRRO2SHQ House. Â&#x2021; 6HSW/RZHU6RXWK*UDSH&UHHN2SHQ+RXVH%DUbecue Fundraiser, TBA. For more information about the historic schools tours, call the Friends of Gillespie County Country Schools at HPDLOWKHPDWLQIR#KLVWRULFVFKRROVRUJ or visit them online at

COUNTRY SCHOOLS â&#x2013;ś 66

Laser Touchless Car Wash

Self Serve Gasoline

Ä&#x17E;ĹŻÄ&#x17E;Ä?Ć&#x152;Ä&#x201A;Ć&#x;ĹśĹ?ϴϲzÄ&#x17E;Ä&#x201A;Ć&#x152;Ć?ŽĨ^Ä&#x17E;Ć&#x152;Ç&#x20AC;Ĺ?Ä?Ä&#x17E;Í&#x160; Complete Petroleum Products & Automotive Services with friendly personnel to assist you.


509 South Adams, Fredericksburg, Texas, 997-4382 â&#x20AC;&#x201C; Serving the Hill Country since 1928 â&#x20AC;&#x201C;

For all your smoking needs. Cigars, Cigarettes, Pipe Tobacco Vapor Pens & Juices Smoking Accessories 150 sq. ft. walk-in humidor Wine, Beer, Snacks & Sodas

Spring/Summer Hours: Monday - Friday 8am-8pm, Saturday 9am-7pm

(830) 990-1472 1639 W 290: 1/4 miles past the â&#x20AC;&#x153;yâ&#x20AC;? across from the Country Inn


66 COUNTRY SCHOOLS Cont. from 64

Court established the Gillespie County Country Schools Trail. This trail linked the 16 former historic country schools with the Vereins Kirche, which is a repOLFDRIWKHÂżUVWVFKRROLQWKHFRXQW\ â&#x20AC;&#x2DC;Friendsâ&#x20AC;&#x2122; of the Country Schools The Friends of Gillespie County Country Schools, in conjunction with several organizations, sponsors the trail and various activities throughout the year so that people can learn more about the countyâ&#x20AC;&#x2122;s educational history. The Friends consists of former students of the closed schools. Their mission statement is â&#x20AC;&#x153;we are preserving the past to enrich the future.â&#x20AC;?

The desks may be empty now, but the history found at the country schools in Gillespie County such as at the Williams Creek (Albert) school, catch the interest of visitors. â&#x20AC;&#x201D; Standard-Radio Post file photo

Hildaâ&#x20AC;&#x2122;s Tortillas

Restaurant & Bar Č&#x160;ČąÂ&#x17E;Â&#x2022;Â&#x2022;ČąÂ&#x160;Â&#x203A; Â&#x160;Â&#x152;Â&#x2DC;Â&#x153;ČąČ&#x160;ČąÂ&#x2014;Â&#x152;Â&#x2018;Â&#x2019;Â&#x2022;Â&#x160;Â?Â&#x160;Â&#x153; Â&#x17D;Â&#x160;Â?Â&#x2DC;Â&#x2DC;Â?ČąČ&#x160;ČąÂ&#x160;Â&#x201C;Â&#x2019;Â?Â&#x160;Čą Č&#x160;ČąÂ&#x203A;Â&#x17D;Â&#x160;Â&#x201D;Â?Â&#x160;Â&#x153;Â?ČąÂ&#x17E;Â&#x203A;Â&#x203A;Â&#x2019;Â?Â&#x2DC;Â&#x153; Č&#x160;ČąÂ&#x17E;Â&#x2022;Â&#x2022;ČąÂ&#x17D;Â&#x203A;Â&#x;Â&#x2019;Â&#x152;Â&#x17D;ČąÂ&#x160;Â?Â&#x17D;Â&#x203A;Â&#x2019;Â&#x2014;Â? Č&#x160;ČąÂ&#x160;Â&#x203A;Â?Â&#x17D;ČąÂ&#x203A;Â?Â&#x17D;Â&#x203A;ČąÂ&#x160;Â&#x203A;Â&#x203A;¢ȏÂ&#x2DC;Â&#x17E;Â?

Â&#x17D;Â&#x203A;Â&#x;Â&#x2019;Â&#x2014;Â?ČąÂ?Â&#x203A;Â&#x2DC;Â&#x2013;Čą Ĺ&#x153;ČąÂ&#x160;ÇŻÂ&#x2013;ÇŻČŹĹ&#x;ČąÂ&#x2122;ÇŻÂ&#x2013;ÇŻČąÂ&#x2DC;Â&#x2014;ÇŻČŹÂ&#x160;Â?ÇŻ Â&#x2022;Â&#x2DC;Â&#x153;Â&#x17D;Â?ČąÂ&#x17E;Â&#x2014;Â?Â&#x160;¢Â&#x153; Everything is made fresh daily!

149 FM 2093 (Tivydale Rd.) 830-997-6105

native and adapted plants organic products pottery gifts 1107 N. Llano~Fredericksburg~830-997-6288 @GoFred1


Peaches keep â&#x20AC;&#x2122;em coming back for more Gillespie County peaches are some of sweetest in the state thanks in large part to the minerals and micronutrients of the Hill Country soil. The 1,700 foot altitude temSHUDWXUHYDULDWLRQKHOSVLQWHQVLI\WKHĂ&#x20AC;DYRURIWKHIUXLW Gillespie County produces roughly one-third of all the peaches produced in Texas on about 600 acres that are dedicated to peach growing. Blooms usually show up around mid-March, and the earliest peaches in this part of the state begin to ripen in May. By June 1, the peach harvest is in full swing, and roadside stands become a hive of activity. Peach lovers come from around the state to Gillespie County to buy their peaches market fresh. Some local peaches are sold outside the county at farmersâ&#x20AC;&#x2122; markets in the cities, including Austin and San Antonio. In addition, peaches are sold at the weekly Fredericksburg Farmerâ&#x20AC;&#x2122;s Market. Varieties The many varieties grown in Gillespie County fall into two general types: â&#x20AC;&#x153;freestoneâ&#x20AC;? and â&#x20AC;&#x153;clingstone.â&#x20AC;? These names describe the peach as the freestone peach Ă&#x20AC;HVKZKLFKUHDGLO\VHSDUDWHVIURPWKHSLWZKLOHWKHFOLQJVWRQHĂ&#x20AC;HVKFOLQJVWLJKWO\WRWKHSLW Both types are delicious for eating, while freestones usuDOO\DUHSUHIHUUHGIRUIUHH]LQJVLQFHWKHĂ&#x20AC;HVKVHSDUDWHV

easily from the pit. Clingstones are best for canning beFDXVHRIWKHLUÂżUPĂ&#x20AC;HVK Peaches harvested in May are the â&#x20AC;&#x153;clingstoneâ&#x20AC;? type, while early-June peaches are â&#x20AC;&#x153;semi-freestoneâ&#x20AC;? and lateJune through the end-of-season varieties are â&#x20AC;&#x153;freestoneâ&#x20AC;?. Natureâ&#x20AC;&#x2122;s production In addition to a climate that features warm summers and mild winters, the areaâ&#x20AC;&#x2122;s geography and topography contribute to successful harvests. When rainfall is sufÂżFLHQWWKHVDQG\ORDPVDQGDQGUHGFOD\VXEVRLOVHUYH as an effective reservoir to preserve moisture during dry periods. %XW0RWKHU1DWXUHFDQEHÂżFNOHZLWKWKHFURS,IWKH area gets a strong frost once blooms have set, much of the crop can be destroyed. Spring hail storms also can be destructive to the crop. The sight of blossoming trees is another attraction for visitors in the early springtime. More information on peaches is available from Gillespie County Extension Agent Brad Roeder or HorticulturLVW-LP.DPDV7KHLURIÂżFHVDUHORFDWHGLQWKH*LOOHVSLH County Agricultural Extension Building, 95 Frederick Road. The telephone number there is 830-997-3452. Information is also available from the Hill Country Fruit Council website at

Buyersâ&#x20AC;&#x2122; Guide When buying peaches, look for ones that are fairly firm or just becoming a bit soft. The skin color between the red areas should be yellow or at least creamy. Avoid very firm or hard peaches with a greenish color â&#x20AC;&#x201D; they are probably immature and wonâ&#x20AC;&#x2122;t ripen properly once plucked from the tree. Soft fruits are ideal for ice cream or jam, but should be used quickly. The best way to buy Gillespie County peaches is direct from grower stands and markets located throughout the area. Roadside stands offer â&#x20AC;&#x153;just pickedâ&#x20AC;? peaches. To let visitors experience more of their favorite treat, some peach growers allow their customers to enter the orchard and pick their own fruit.

Peach ripening Spring Gold, Regal, Flavorich June Gold, Gold Prince Sentinel, Gala, Southern Pearl Harvester, Cary Mac Majestic Loring, Bounty Redglobe Dixiland Redskin Jersey Queen, Elberta Flame Prince, Oâ&#x20AC;&#x2122;Henry Parade, Big Red

schedule May 10-25 May 20-June 5 June 5-15 June 10-27 June 20-30 June 25-July 12 June 27-July 15 July 10-25 July 15-30 July 25-August 5 Aug. 1-12 Aug. 10-25


Here â&#x20AC;&#x2DC;Everybodyâ&#x20AC;&#x2122;s Somebodyâ&#x20AC;&#x2122; There is no telling how many thousands of people have made visiting Luckenbach, Texas a bucket list item since Waylon Jennings and Willie Nelson brought it to life in their 1970s hit. But when itâ&#x20AC;&#x2122;s time to get back to the basics of life and enjoy a pure Texas experience, the storied place about 10 PLOHVIURP)UHGHULFNVEXUJÂżOOVWKHELOO With its store, dance hall and picnic tables underneath arching live oak trees, Luckenbach (A sign jokes â&#x20AC;&#x153;Population 3â&#x20AC;?) is a destination for music fans, bikers and sightseers. Open daily at 9 a.m., the store offers visitors an old-fashioned experience and merchandise ranging from the nostalgic to items bearing the townâ&#x20AC;&#x2122;s oval-shaped logo. With nearly daily performances on the outside stage or in the dancehall, musicians provide tunes with a Texas Ă&#x20AC;DLU$QGDQDGMDFHQWÂł)HHG/RW´FDWHUV to appetites with barbecue, burgers, sandwiches and other dishes.

Luckenbach draws eclectic groups of musicians to perform on a regular basis, such as this duo that consisted of a Texas-born husband and Canadian-born wife. â&#x20AC;&#x201D; Standard-Radio Post file photo

Major events Among the biggest spring and summer events at Luckenbach are: March 5: Texas Independence Day Celebration; March 12: Spring Break Saturday; March 19: Mud Dauber Rock â&#x20AC;&#x2DC;Nâ&#x20AC;&#x2122; Chili Billy Fest; March 26: Asleep at the Wheel; April 9: Outlaw Half Marathon and 5K; May 6-7: Hill Country Run Motorcycle Rally fundraiser; May 20-21: Thomas Michael Rileyâ&#x20AC;&#x2122;s Music

Fest; May 29: Ice Cream Social; June 25: Hill Country Food Truck Festival; July 4: 11th Annual Wilkins Family Live Free and Fly event.

History Luckenbach began in 1852 when Jacob Luckenbach and his brothers, William and August, moved to the area from Fredericksburg and began farmLUCKENBACH â&#x2013;ś 70

Nestled on ďŹ ve beautiful acres on Barons Creek and just steps from Downtown Main Street, our hotel enjoys the best location in town: so close to all the action and yet so serene and peaceful. All of our 93 guestrooms and 10 suites feature free high-speed wireless internet, microwave, minifridge, coffeemaker, iron & ironing board, hairdryer, free local & 1-800 phone calls and deluxe continental breakfast.

A free deluxe Continental breakfast is served each morning in our original German home, a recorded Texas Historic Landmark built in 1848.

We have accommodations for weddings, reunions, meetings or any other special event you might be planning.

Relax outside by our two resort-style swimming pools, family-size hot tub, stone gazebo with television & fireplace, and picnic area.


mobile app at the App Store or Google Play

70 LUCKENBACH Cont. from 69


LUCKENBACH 412 Luckenbach Town Loop Fredericksburg, TX 78624 Phone: 830-997-3224 Web:


For many, a visit to Luckenbach includes getting oneâ&#x20AC;&#x2122;s picture taken under the post office sign. Luckenbachâ&#x20AC;&#x2122;s former post office is now a gift shop. â&#x20AC;&#x201D; Standard-Radio Post file photo

Come In for our Famous Pancakes, Schnitzels and our wonderful Pastries

Old German Bakery & Restaurant

Willkommen Featuring the best European pastries, breads and desserts, delicious sandwiches and German specialties. Fresh brewed coffee always and everything is homemade. 0QFOBU".tEBZTBXFFL Breakfast & Lunch

225 West Main Street Fredericksburg, Texas Phone 830-997-9084

Amish Market Specializing S i li i iin 100% A Amish i h and d Mennonite M it Crafted C ft d Products P d t

The Best of American Furniture Antiques in the making... family heirlooms for your grandkids and great-grandkids.

Willkommen Cheerfully Open Mon-Fri 10-5, and Sun 10-4

139 East Main Street and 410 West Main Street 830-992-3546 830-990-2977


Heritage center new city landmark Anyone traveling west into Fredericksburg from U.S. 290 are bound to see the newest member of the city’s “skyline” — a 50-foot tall campanile. The tower “serves as the centerpiece for the future Texas Rangers Heritage Center,” said Joe B. Davis, president of the Former Texas Ranger Foundation. The recognizable landmark will draw attention to the museum’s main entrance, as well as to the Texas Rangers “Ring of Honor” outdoor memorial area on the ground level, said Davis, a retired Texas Ranger. Phase I of the project, which is completed, includes the bell tower and Ring of Honor and an amphitheater, a living history area, a pavilion, parking lot, the main entrance off the highway and a crosswalk/pathway that leads to the adjacent Fort Martin Scott Historic Site. Those elements combined represent about two-thirds of the overall project, Davis said.

Phase I (including the campanile) of the Texas Rangers Heritage Center is completed. Next will be the 25,000 square foot Phase II project, which includes a living history program. — Standard-Radio Post photo

They are also currently raising money for the capital building fund for Phase II. The building will be about 25,000 square feet. It contains an education center, video presentations, speakers and a living history program. The focus is on teaching Texas Rangers history to the public. It also includes programs to work closer with youth regarding developing good character traits and becoming better citizens. Regular-sized brick pavers to be placed at the base of the bell tower may be purchased for a $100 contribution. Each brick paver affords donors three lines of text (with 14 characters per line, including spaces.) A larger, 16-inch by 16-inch paver is also available for $1,000. It may feature a custom design, such as brands, logos, or a longer list of family names, Davis said. Anyone interested in purchasing HERITAGE CENTER ▶ 80

Clothing Jewelry Bed Linens & Bath To Delight The Woman In You

105 N. Llano Fredericksburg, Texas 10:00 - 5:00 Mon - Sat 11:00 - 4:00 Sundays

830-997-7071 @GoFred1


Lone Star Candy Bar Come be a kid in a candy store! CHOCOLATE DIPPED BACON! Try a FREE sample of our fresh HOMEMADE FUDGE! - Over 36 Flavors Everyday We Ship Fudge! See BOB, our 27 pound gummy bear and all our other giant candies M&Mâ&#x20AC;&#x2122;s in 21 colors & Jelly Bellys in lots of flavors! Fresh Roasted Nuts Pucker Powder Old Fashioned Sodas in Glass Bottles

(0DLQÂ&#x2021;)UHGHULFNVEXUJ7H[DV 830-990-9100

Only at Fitz and Hollerin! Right before your eyes we can build, accessorize and customize your own stuffed animal.


Fort a lesson in military history

Dressed as a 19th century sheriff, this man talks to Boy Scouts about courage during a 2015 camping trip to Fort Martin Scott. The scouts also learned facets of the fort’s history and earned “Polar Bear Award” patches. — Standard-Radio Post file photo



Fredericksburg was once home to a U.S. Army base. )RUW0DUWLQ6FRWWZDVRQHRIWKH¿UVW frontier military outposts in Texas, and a self-guided tour exploring Hill Country life in the 19th Century tells visitors more about this military installation. Located just east of town at 1606 East Main (on U.S. Highway 290), the fort is open 9 a.m. to 5 p.m., Thursday through Monday. It is closed Tuesday and Wednesday. David Bianchi, site manager for the fort, is on site from 10 a.m. to 5 p.m., Fridays through Mondays. The City of Fredericksburg has installed informational kiosks to be set up around the grounds to help visitors better experience the history of the fort. Admission to the historic site is free, although donations are accepted. Available for inspection along a tour FORT MARTIN SCOTT ▶ 80








f f a w f. c o m ͝






F R E D E R I C K S B U R G ,T E X A S  10.

is a self-guided walking tour of art exhibitions at member venues which is free to the public and held on the first Friday of every month from 10a ʹ 8p. Enjoy great art, food & wine, live music and much more!

An American Art Destination!


1. 2. 3. 4. 5. 6. 7.

AGAVE GALLERY | 208 E. San Antonio | 830.990.1727 ARTISANS - A TEXAS GALLERY | 234 W. Main | 830.990.8160 CATE ZANE | 107 N. Llano | 830.992.2044 COWBOY BRONZE | 226 W. Main | 830.997.2822 DAN PFEIFFER GALLERY | 102 S. Lincoln | 210.882.6446 ELEVEN SQUARED VENUE | 408 N. Llano | 512.547.9506 FREDERICKSBURG ART GALLERY | 314 E. Main | 830.990.2707


8. 9. 10. 11. 12. 13. 14.

 FREDERICKSBURG ART GUILD | 308 E. Austin | 830.997.4949 THE GALLERY AT VAUDEVILLE | 230 E. Main | 830.992.3234 INSIGHT GALLERY | 214 W. Main | 830.997.9920 LARRY JACKSON FINE ART & ANTIQUES | 209 S. Llano | 830.997.0073 R S HANNA GALLERY | 208 S. Llano | 830.307.3071 RIVER RUSTIC GALLERY | 222 W. Main | 830.997.6585 WHISTLE PIK GALLERIES | 425 E. Main | 800.999.0820


&DWILVK+DYHQ The Hill Country’s Choice for Steak and Seafood 816 West Main Street, Fredericksburg, Texas

(830) 997-9009 Hours of Operation: Tuesday-Saturday 11 a.m.-8 p.m.; Friday 11 a.m.-9 p.m.; Sunday 11 a.m.-2 p.m.

Seafood Specialties All Entrees Include A Choice of Baked Potato, Fries or Tater Tots And Our Unique Salad/Veggie Bar

Oyster Plate (6) or (12) Oyster & Fish Plate (4) Fish Fillets & (6) Oysters Oyster & Frog Legs (6) Oyster & (4) Frog Legs Oyster & Shrimp Plate (6) Fried Oysters & (4) Shrimp Oysters & Stuffed Crab (2) Crabs & (6) Oysters Stuffed Crab & Fish (2) Fish Filets & (2) Stuffed Crab Small Combo Plate (2) Fish Fillets & (2) Jumbo Shrimp Large Combo Plate (4) Fish Fillets & (4) Jumbo Shrimp Butterflied Shrimp (5) Shrimp (8) Shrimp (10) Shrimp Fried Shrimp (15) Medium Shrimp

Texas Sized Favorites Chicken Fried Steak Steak Fingers Chicken Strips Chicken Fried Chicken Grilled Chicken Breast Hamburger Steak

Charbroiled Steaks

Black Angus Hand-Cut Steaks with Grilled

Onions & Mushrooms served with your choice of baked potato, fries or tater tots and a trip to our unique salad/veggie bar

8 oz. Sirloin 8 oz. Sirloin & (4) Jumbo Shrimp 14 oz. Ribeye 14 oz. Ribeye & (4) Jumbo Shrimp

From Our Grill

Served Blackened or Lemon-Peppered on a bed of rice. Choice of baked potato, fries or tater tots and a trip to our unique salad/veggie bar

Catfish Mahi-Mahi Sockeye Salmon Blackened Redfish Flounder Tilapia Crab Cakes Fish ‘N Chips

German Favorites Schnitzel Jaeger Schnitzel Sausage Plate Bratwurst Plate

Butterflied Coconut Shrimp (5) Shrimp (8) Shrimp Seafood Platter (3) Fish Fillets, (1) Stuffed Crab & (5) Med. Shrimp Sampler Plate (2) Fish Fillets, (2) Frog Legs, (2) Jumbo Shrimp, (1) Stuffed Crab, (2) Oysters, (2) Med. Shrimp Stuffed Crab (3) Stuffed Crab Stuffed Crab & Shrimp (2) Crab & (4) Jumbo Shrimp Frog Legs Plate (6) Fried Frog Legs (12) Fried Frog Legs Frog Legs & Fish (4) Fish Fillets & (4) Frog Legs

Lunch Specials All Specials include a trip to our unique salad/veggie bar & iced tea Tuesday: Liver & Onions w/Mashed Potatoes Wednesday: Pot Roast & Mashed Potatoes Thursday: Steak Bites with grilled onions & mushrooms w/mashed potatoes Friday: 3 pc. Catfish Plate & choice of baked potato, fries or tater tots



Catfish, Catfish & More Catfish! Catfish Plate 2 pieces 3 pieces 4 pieces 5 pieces Whole Catfish (1) or (2)

Frog Legs & Shrimp (4) Jumbo Shrimp & (4) Frog Legs ůĂŬĞDŝƐƟĐŚΞ

For the Kids

(10 and under) Served with Fries or tater tots - subsitute baked potato for $1

Grilled Cheese Corn Dog 1 Piece Fried Fish 6 Piece Fried Shrimp 2 Piece Chicken Strips with Texas Toast & gravy

Beverages ,FHG7HD‡+RW7HD Coffee Soft Drinks



Appetizers Onion Rings (12-15 rings) Fried Pickles Basket of Shrooms Fried Jalapeños Sampler Appetizer Onion Rings, Jalapeños, Mushrooms, Pickles Catfish Haven would like to Thank You for your continued patronage. 18% gratuity added to parties of 8 or more.


Chef Salad Grilled Chicken Salad Grilled Chicken Caesar Salad Grilled Fish Salad Fried Shrimp Salad Salad & Veggie Bar

Burgers & Sandwiches 1/2 pound Burger 1/2 pound Cheeseburger Patty Melt Burgers served with lettuce, tomatoes, pickle & onions Blackened Chicken Sandwich

New Orleans’ Style Po’Boys Shrimp Po’Boy Oyster Po’Boy Catfish Po’Boy

Texas Association Texas of Builders Custom of Association Builder of the Year andBuilders Remodeler of theRemodeler Year; 2015 Best in American Living Year of the National Awards Remodeler of the Year, and Best Southern Home Custom Builder and Best Specialty of the year Interior Design



Shrimp & Oyster Combo Po’Boy


Lettuce, tomato and tartar sauce Served with fries or tater tots



Southern Pecan Pie Tootie’s Buttermilk Pie Chocolate Mousse Cake NY Style Cheesecake Everything is freshly made, so please be patient (No MSG).

ϲϭϲtĞƐƚDĂŝŶ^ƚƌĞĞƚ &ƌĞĚĞƌŝĐŬƐďƵƌŐ͕dĞdžĂƐϳϴϲϮϰ ϴϯϬͲϵϵϳͲϰϵϳϰ ttt͘,/>>KhEdZzh/>Z͘KD


ee t Ce

St .

St .

















re e



re e






St . St St . or e




Sy ca m

e Pi n .

87 28




290 Rd. Hahn


ar re tt

. St

St re et


Luckenbach Rd.


r Ba ke

rl Ea

. St n ng to

St .




W as hi

St. es



ne y

an Pec

eet Str






Join us every first Friday of the month in Fredericksburg for the First Friday Art Walk showcasing local artists’ work.


e. Av








at W







d oo






. Ave


A San



Si d




M 17



1..... Agave Gallery 2..... Artisans - A Texas Gallery 3..... August E’s 4..... Burger Burger 5..... Cabernet Grill 6..... Carriage House Gallery (Boerne) 7..... Cate Zane Gallery 8..... Cowboy Bronze 9..... Dan Pfeiffer Gallery 10.... East Hills 11.... Eleven Squared Gallery 12.... Fredericksburg Art Gallery 13.... Fredericksburg Art Guild 14.... Grape Creek Vineyards 15.... Hill Country Frame Company 16.... Insight Gallery 17.... Kerr Arts & Cultural Center (Kerrville) 18.... Larry Jackson Art & Antiques 19.... Misha’s Gallery 20.... Pedernales Cellars 21.... River’s Edge Gallery (Kerrville) 22.... River Rustic Gallery 23.... RS Hanna Gallery 24.... SG Home (Kerrville) 25.... Schreiner Goods (Kerrville) 26.... Slate Gray Gallery (Kerrville) 27.... West End Pizza 28.... Whistle Pik Galleries 29.... Yellow Door Studio



ffe Kerr County Court House






a Ro

Hwy. 290 East From Fredericksburg


Woodland Dr.



















re e




18 St

Tr a Sc








13 St

re e





Creek in


tC ree 23 k




re e



t re e




Tivydale 15 Road

Ad am s co ln








hi ng to

10 t


Tr a



re e





St re e



W as





. re e



re e

re e












re e

. St St ra Co

re e





wn To










at z



re e

Art galleries and establishments that feature local artists.

re e







s da m .A



St St





se 29







St .


Cr oc k

re e

Cr ee

St Cr oc ke



et t



re e




re e


St re et






2 28 8 St 22 re 16 et

ra ng e


O ra

.M ila m N

St re et





M An


wn To




re e

re e




re e







t re e St




S. M ila m






Tr av



ng e


St .

t re e St n i so Ed




ar d



rc h



St. n





W. Evergreen St.




E. Evergreen St. 46

107 North Llano St


Fredericksburg, TX 78624




18th ANNUAL LAVENDER FESTIVAL April 30 & May 1, 2016

Cont. from 76

Stonewall, Texas Becker Vineyards will host its 18th Annual Lavender Festival, April 30 & May 1. The event will feature speakers and vendors promoting lavender education as well as herb related products. There will also be gardening tips, cooking demonstrations, wine tasting and tours. Business hours are Saturday, 10 a.m.-- 6 p.m. & Sunday, Noon--6 p.m. The event is complimentary, Parking is $5. The Lavender Luncheons will be catered by two local chefs at 12:30 p.m. both days. The luncheons (prices and menus tba) are by reservations only. For more information and reservations contact: 830-644-2681.



For more information about Becker Vineyards and the Lavender Fields visit the website at

P.O. Box 393 Located 11 miles east Stonewall, Texas 78671 of Fredericksburg, 830-644-2681 phone 3 miles west of Stonewall, off 830-644-2689 fax US Hwy 290.




ĆľÇ&#x2021;KĹśÄ&#x17E; D/E/>/Z Ä&#x201A;ĹśÄ&#x161;Ĺ?Ä&#x17E;Ć&#x161;ŽŜÄ&#x17E;&ZÍ&#x2DC; >ÂŽĂ&#x192;ÂŽĂŁĂ&#x160;ÂĽĂ&#x160;Ă&#x201E;Â&#x203A;&Ă&#x2122;Â&#x203A;Â&#x203A;½ŽÞÞÂ&#x192;Ă&#x2122;Â&#x2014;Â&#x192;Ă&#x201E;Â&#x2014;Ă&#x160;Ă&#x201E;Â&#x203A;Â&#x2018;Ă&#x160;çĂ&#x2013;Ă&#x160;Ă&#x201E;Ă&#x2013;Â&#x203A;Ă&#x2122;Â&#x2018;çĂ?ĂŁĂ&#x160;Ă&#x192;Â&#x203A;Ă&#x2122;

#35 Spring 2016 VG




Get your GoFred T-shirt today!

ONLY $12

Now in 8 Different Colors!

At the Fredericksburg Standard Office. 712 W Main St.

There is no other place in Fredericksburg like it! We are in an adorable 1930â&#x20AC;&#x2122;s house with rooms full of wonderful things for you, your home and your friends. New and old, fun and funky, stylish and serene.

Located two blocks South of Main St. on the corner of Washington and E. Auguste across from Inn on Baronâ&#x20AC;&#x2122;s Creek


Take a hike Three nature trails at the Lady Bird Johnson Municipal Park offer nature lovers a multitude of species of birds, forbs, grasses, woody plants, amphibians, reptiles and insects to view. There are three different mile long nature trails, designed and built by the Friends of the Fredericksburg Nature Center, that wind through seven distinct microhabitats. The 10-acre area features forests, prairie, riparian, creek and lake side wetlands, post oak savannah and semi-arid brush land ecosystems. Kiosks along the trail feature displays of the various groups of wildlife found in the park and a television PRQLWRULQWKHSDUNRIÂżFHVKRZVSKRWRVRIWKHZLOGĂ&#x20AC;RZHUVELUGVEXWWHUĂ&#x20AC;LHVDQGGUDJRQĂ&#x20AC;LHVVHHQLQWKHQDWXUH area. There is a 70 foot x 70 foot garden located between the swimming pool and the RV park that was designated the Âł3ROOLQDWRU*DUGHQ´7KHZLOGĂ&#x20AC;RZHUVDUHKRPHWREHHV EXWWHUĂ&#x20AC;LHVKXPPLQJELUGVDQGPRWKVFDUU\LQJRXWSROlination processes. Checklists are available in the park headquarters ofÂżFHWKHOLVWVLQFOXGHZLOGĂ&#x20AC;RZHUVELUGVEXWWHUĂ&#x20AC;LHVRGRQDWHV GUDJRQĂ&#x20AC;LHV DQGUHSWLOHVPDPPDOVDQGÂżVK


One of many sites along Lady Bird Johnson Municipal Park nature trails. â&#x20AC;&#x201D; Standard-Radio Post file photo

‘THE ROCK’ enchants visitors

A unique pink granite dome that sits in the heart of the Hill Country, called Enchanted Rock, is a must visit destination for any outdoor enthusiast. Enchanted Rock State Natural Area is a wonder to behold any time of day or night. Seen from miles away due to its size and shape, Enchanted Rock stretches up 1,825 feet in elevation and reaches out to grab the interest of thousands of hikers, campers and other outdoor lovers who take the time to visit the 640-acre park near the Gillespie/Llano county line each year. Located about 16 miles north of Fredericksburg, the park also is one of the best area places to see the stars at night shine big and bright. It was one of two parks in Texas to be designated an International Dark Sky Park. The designation means that Enchanted Rock’s lighting sources now comply with the International Dark Sky Alliance requirements, which not only saves energy for the park, but assures that visitors from the city experience a night sky uninterrupted by bright lights. It also helps the area promote low-impact ecotourism in one of the Hill Country’s major tourist destinations.


The hike up Enchanted Rock offers a full view of the Texas Hill Country. On previous page, bluebonnets are scattered around the base of the Enchanted Rock State Natural Area dome during the springtime. — Standard-Radio Post file photos

Enchanted Rock State Natural Area  ZZZWSZGVWDWHW[XV


7-Ê , tÊÊÊÊ7-Ê "7tÊÊÊÊ7-Ê"/ tÊÊÊÊ7-Ê , tÊÊÊÊ7-Ê "7tÊÊÊÊ7-Ê"/ t

ՏÊ-iÀۈViÊ>˜`Ê Ý«ÀiÃÃÊ-iÀۈViÊÊ





$1.00 MAT WASH!


œÕÀÃ\Êœ˜°Ê‡ÊÀˆ°Ê™‡ÈÊUÊ->̰ʇÊ-՘\ʙ‡Î Download the

mobile app at the App Store or Google Play


Relax, enjoy amenities at city park Rolling hills and rambling Live Oak Creek are just a few of the features of the 150-acre Lady Bird Johnson Municipal Park. Just three miles from downtown attractions, the park provides a recreational getaway for locals and visitors alike. There is no admission charge for entering the park located southwest of town on Texas 16 South. Day use activities Daytime visitors to the park can use picnic tables (available on a ÂżUVWFRPHÂżUVWVHUYHGEDVLV DQG four playgrounds at no charge to accommodate those just wanting to get away from it all for a couple of hours. Three free nature trails that take hikers across Live Oak Creek give nature lovers a chance to get up close and personal with the natural habitat. The pathways were established by the Friends of the Fredericksburg Nature Center. )RUYDFDWLRQHUVZKRHQMR\ÂżVKing, the park offers a 17-acre lake and plenty of spots to wet a line. Motor boats, however, are prohibited, as are trotlines and swimming. Elsewhere in the park, there are EDVHEDOODQGVRIWEDOOÂżHOGVDVDQG

AMENITIES Five outdoor pavilions Baseball field Golf course Softball field Practice field Volleyball court Basketball court Tennis courts Swimming pool (open summer months only) Fishing at Live Oak Creek Restrooms adjacent to Lady Bird Johnson RV Park

An 18-hole golf course is just one of the many attractions found at Lady Bird Johnson Municipal Park. â&#x20AC;&#x201D; Standard-Radio Post file photo

volleyball court, an outdoor basketball court, a swimming pool (with kiddie SRROWRWKHVLGH DQGWHQQLVFRXUWV Rental facilities Visitors who plan large gatherings may want to look into using one of the parkâ&#x20AC;&#x2122;s ÂżYHODUJHRXWGRRUFRYHUHGSDYLOLRQVRU one of three indoor sites, including the Tatsch House, the Cardinal Room at the golf course clubhouse or the spacious Pioneer Pavilion. (DFKRIWKHÂżYHRXWGRRUSDYLOLRQVLV DYDLODEOHRQDÂżUVWFRPHÂżUVWVHUYHGEDsis or by reservation. Information about the facilities and reservation opportunities is available from the City of Fredericksburgâ&#x20AC;&#x2122;s website at Overnight camping Camping under the stars is available at

the park, which accommodates RVs and tents. In all, there are 98 RV spaces available for travel trailers with 30-50 amp electrical hookups, water and sewer, cable TV, wireless Internet and shade trees. Rates are $35 per day, $210 per week and $420 per month (available Sept. 0DUFKRQO\  Campers who want to tent camp pay $10 per night. All campers must check in at the park RIÂżFHWRUHFHLYHDFDPSLQJSHUPLW7KHUH are nine comfort stations to serve visitors, while three bathhouses are available. Reservations for camping, use of the parkâ&#x20AC;&#x2122;s picnic tables or other facilities can be made by calling the park at 9974202 or by writing Lady Bird Johnson Municipal Park, 432 Lady Bird Drive, Fredericksburg, TX 78624.

Daily Specials Combos Liquid Sunshine Smoothie Riding Hill Country Jolt Yummi Splash

Popular Smoothie Recipes Strawberry Rave Very Cool Berries Summer Sunrise

Coco PiĂąa Tropical Teaser Peachy Keen

Popular Juice Recipes Carrot-Kale Green Lemonade Veggie Ranch Emerald Isle Carrot or Beet

Boosts Mind Immune Vitamin Joint Stress/Energy Kids Vitamin

Whey Protein Soy Protein Plant Protein Agave Local Raw Honey

Orange/Grapefruit Squeezed Wheatgrass Shot Wheatgrass & Ginger Lemongrass Shot

Coffee Drinks Frappe Freeze Jitterbug Fruit Latte

Gourmet Pressed Coffee

Smoothies â&#x20AC;&#x201C; Workout Energy Energy Blast Muscle Madness Ironman Power Punch Chocolate Energy Peanut Butter Razzler

Ask about our Juice Specials

Smoothies Immune-Aid Vita Revive Sunset Sipper

Mind Fuel Sweet Cherry-Ot Find us on FaceBook, Yelp,



The National Museum of the Pacific War, one of Fredericksburgâ&#x20AC;&#x2122;s most popular tourist attractions, tells the story of how the Pacific in World War II was won. â&#x20AC;&#x201D; Standard-Radio Post file photo

Want a WWII history lesson? â&#x20AC;&#x201D; visit Pacific War Museum (LJKWPLOOLRQ$PHULFDQVVHUYHGLQ:RUOG:DU,,ÂśV3DFLÂżF Rim against Japan, and more than 100,000 of them gave their lives. Among those who served was Fredericksburg native Fleet Admiral Chester Nimitz. )RU1LPLW]DQGIRUDOOWKRVHZKRVHUYHGLQWKH3DFLÂżFWKH GRZQWRZQ1DWLRQDO0XVHXPRIWKH3DFLÂżF:DUKRQRUVWKHLU service. History and mission The museum originally began in 1968 with the establishment of the Nimitz Museum in the restored Nimitz â&#x20AC;&#x153;Steamboatâ&#x20AC;? Hotel. It has since expanded to occupy a six-acre campus and has become one of the elite military museums in the nation. The 33,000-square-foot exhibition area features 40 media installations, about 900 artifacts in 97 climate-controlled cases, 15 macro-artifacts and hundreds of photographs.

The museum strides to teach the history and lessons OHDUQHGIURPWKH3DFLÂżF$VLDWLF7KHDWHURI2SHUDWLRQVGXULQJ WWII. Admiral Nimitz Museum 7KHĂ&#x20AC;DJVKLSRIWKH1DWLRQDO0XVHXPRIWKH3DFLÂżF:DU &RPSOH[LVWKH$GPLUDO1LPLW]0XVHXP7KH3DFLÂżF:DU Museum was originally located here before expanding into three museums and a six-acre campus. Previously, the building was the old Nimitz Steamboat Hotel, owned and operated by Admiral Nimitzâ&#x20AC;&#x2122;s grandfather Charles Henry Nimitz Sr., and is where the admiral spent his early childhood. George H.W. Bush Gallery Named after former President George H.W. Bush, the ÂżJKWHUSLORWGXULQJ:RUOG War II, the gallery exhibitions MUSEUM â&#x2013;ś 90




award-w a ward-wiin nniin ng OPENING FEBRUARY 2016


+++WEDDING OAK WINERY +++ 10x Medal Winner — 2016 Houston Livestock Show & Rodeo International Wine Competition

In spring of 2016, Wildseed Farms, the largest wildflower farm in the world, will join forces with Wedding Oak Winery and become the newest winery on Hwy. 290. Located in the heart of Texas Wine Country, it’s 200 acres — and 1 unforgettable place. G i f t s G a r d e n s N u r s e ry P o t t e ry w w w. w i l d s e e d fa r m s . c o m

90 MUSEUM Cont. from 88

Upcoming Events Events scheduled for the late winter, spring and summer this year include: March 8, 10, 15, 17: March Nimitz Junior Corps, an educational program; March 25: Readings in History; $SULO)LUVW)ULGD\$UWIHDWXULQJ/LIHDQG:RUOG War II artist Tom Leaâ&#x20AC;&#x2122;s work; April 22: Premier Business Partners Leadership Seminar, featuring William W. Sherrill; April 29: â&#x20AC;&#x2DC;Alert Today, Alive Tomorrow: Living with the Atomic Bombâ&#x20AC;&#x2122;; May 20: Talks and Tour with curator Dr. Michael Scheibach; June 14: June Nimitz Junior Corps, an educational program; July 15: Talks and tour with the curator in the photo studio; Aug. 10: August Nimitz Junior Corps, an educational program; Aug. 27: Battle Buddies Classic; 6HSW1RUPDQ5RFNZHOOLQWKHV$9LHZ of the Homefront.

Temporary exhibits, such as this one remembering the life of honorary U.S. veteran Bob Hope, are also a part of the National Museum of the Pacific War and can be viewed for free in the Admiral Nimitz Museum, which is housed in the Pacific War Complex. World War II veterans are considered dignitaries at the museum and are granted free admission, whenever they visit. â&#x20AC;&#x201D; StandardRadio Post file photo


The garden was a gift from the military leaders of Japan to the people of the United States, in honor of Admiral Nimitz. The garden features a replica of the Imperial Japanese Navyâ&#x20AC;&#x2122;s Marshal-Admiral Togo Heihachiroâ&#x20AC;&#x2122;s garden meditation study. )ROORZLQJUHQRYDWLRQVWKHJDUGHQUHRSHQHGWRWKHSXEOLF LQ)HEUXDU\

Japanese Garden of Peace After World War II ended, eventually, relations between the United States and Japan healed. Both nations became allies with solid diplomatic ties. Located adjacent to the Memorial Courtyard, the Japanese Garden of Peace is designed to remind people there is another side to humanity. Just as there is a time for war, there is also a time for peace.

Memorial Courtyard This special place is where the museum honors the indiYLGXDOVVKLSVDQGXQLWVZKRIRXJKWLQWKH3DFLÂżF7KHDWHU The 19th Century limestone walls that surround this solemn garden now bear plaques that recognize heroic contriEXWLRQVWRWKHZDUHIIRUWLQWKH3DFLÂżF7KH9HWHUDQVÂś:DON of Honor winds through the courtyard, paved by bricks inscribed with additional tributes.


MUSEUM â&#x2013;ś 92

124 E. Main St. 830-992-2121





92 MUSEUM Cont. from 90

Plaza of Presidents Before visiting the Bush Gallery, visitors can take a moPHQWWRSDXVHDQGUHÃ&#x20AC;HFWDWWKH3OD]DRI3UHVLGHQWVDQRXWdoor tribute to the 10 American presidents who served in the armed forces during WWII. 7KHVWRQHPRQXPHQWVKROGEURQ]HSODTXHVGHVFULELQJHDFK presidentâ&#x20AC;&#x2122;s WWII military service, from Franklin Roosevelt through George H.W. Bush.


3DFL¿F&RPEDW=RQH 7KHPXVHXP¶V3DFL¿F&RPEDW=RQHSURYLGHVOLYLQJKLVWRU\ reenactments that let visitors feel what it was like to walk the wooden dock alongside a patrol torpedo boat, stand in the hangar deck of an aircraft carrier as a torpedo bomber is UHDGLHGIRUDVWULNHDQGYLHZ-DSDQHVHEDWWOH¿HOGHQWUHQFKments. 7KHOLYLQJKLVWRU\SURJUDPVDOVRGHPRQVWUDWHWKHHTXLS-




Engaged! 1606 East Main Street 830-997-7521

WEdding & Event Showcase Sunday, June 12, 2016 Noon - 5:00pm Join us for a gathering of the best wedding & event vendors in Fredericksburg!

Fourth Weekend In April Fort Martin Scott Days: Featuring continuous Living History with Horses and Wagons, Canon Firing, Pioneer Crafts and Chuck Wagon Food. Friday is School Day.

Second Weekend In November Frontier Days: Featuring continuous Living History with Horses and Wagons, Canon Firing, Pioneer Crafts and Chuck Wagon Food. Friday is School Day. Regular Hours: Open Friday thru Monday, 9am to 5pm Owned and Operated by the City of Fredericksburg Website: - Email:

Inn on Barons Creek Conference Center 308 S. Washington St. Fredericksburg, TX Visit us at

201 East Creek H Fredericksburg H 830.997.2263 H 830.285.2263 cell H e-mail:


Step back in to the 1915-1918 era with a visit to the Sauer-Beckmann Living History Farm located inside the Lyndon B. Johnson State Park and Historic Site at Stonewall. At the farm, interpreters

dress in period clothing and demonstrate every phase of life from that era. The state park also pays tribute to its namesake, President Lyndon B. Johnson. â&#x20AC;&#x201D; Standard-Radio Post file photo

State park a lesson in history Visitors also get chance to explore nature, the outdoors Lyndon B. Johnson State Park and Historic Site at Stonewall combines lessons in history with a step back in time and a chance to enjoy the outdoors. Along with walking the nature trails, visiting a living history farm and browsing through historical exhibits and memorabilia, the park also offers recreational facilities, shopping and more. In fact, there is so much to see and do at the state park that â&#x20AC;&#x153;folks should plan to stay a while and shouldnâ&#x20AC;&#x2122;t be in too big a hurry if they want to really enjoy it all,â&#x20AC;? said, Iris Neffendorf, park superintendent. LBJ State Park and Historic Site is a day-use park with no park entrance fees, but donations are accepted. SPRING, SUMMER EVENTS s0DUFK/%-.LWH'D\IURPSP s0DUFK-XQLRU5DQJHU'D\IURP DPWRSP s0DUFK(DVWHUDWWKH)DUPIURP DPWRSP s$SULO,W]$*DUGHQIURPSP

Honoring a president The LBJ State Park and Historic Site honors Gillespie County native Lyndon B. Johnson, the 36th President of the United States. A Visitor Center Complex houses exhibits and memorabilia IRFXVLQJRQWKHODWHSUHVLGHQWÂśVWZRWHUPVRIRIÂżFH Park facilities Thereâ&#x20AC;&#x2122;s also an auditorium that accommodates up to 250 SHUVRQVIRUIUHHÂżOPVVKRZQGDLO\DQGDJLIWVKRSWKDWLVRSHQ daily from 9 a.m. to 5 p.m. 7KH9LVLWRU&HQWHULVWKHÂżUVWVWRSIRUDQ\WRXUWRWKH/%- Ranch, which is a part of the Lyndon B. Johnson National



95 Historical Park. (See separate article.) Attached to the Visitor Center is the Behrens Cabin, a two-room dogtrot cabin built during the 1840s by German immigrant Johannes Behrens. There’s also an outdoor amphitheater. Sauer-Beckmann Living History Farm The park is also home to the Sauer-Beckmann Living History Farm, which depicts the life of a German/Texas family from 1915-1918. East of the Visitor Center and off the nature trail, the farm is open 8 a.m. to 4:30 p.m. daily. Guided tours there allow park interpreters to demonstrate every phase of life characteristic of that era. School classes and other large groups of 15 or more are encouraged to make reservations for one-hour farm tours by phoning 830-644-2252, ext. 229. Nature trails Elsewhere in the park, a winding nature trail leads walkers to a larger-than-life bronze statue of the former president overlooking the Pedernales River. It also trails near a wildlife enclosure housing American Bison and other areas with the members RIWKH2I¿FLDO7H[DV6WDWH Longhorn Herd. Since May of 2014, the park

Big catch — Youngsters and their families are invited to participate in the Annual LBJ Fishing Day, set this year for June 4 along the banks of the Pedernales River at Stonewall. — Standard-Radio Post file photos

KDVEHFRPHKRPHWRSDUWRIWKH2I¿FLDO Texas State Longhorn Herd. Another trail approximately a mile long is handicapped accessible and suitable for wheelchairs, bicycles and strollers. It departs the Visitor Center and travels WKURXJK¿HOGVRIZLOGÀRZHUVDQGSDVWWKH Texas longhorns’ pen to the Danz cabins before looping back. Every trail in the park is linked with directional signs and strategically-placed markers giving a brief description of highlights along the path. There’s more Numerous shaded picnic and rest areas (some with restroom facilities) are available at the state park. From early June throughout the summer, a large pool facility — complete with chil-

“Bestfest” at Marktplatz A Celebration of German Favorites Beer, Sausage and Polka Music.

SAT., OCTOBER 15, 2016 11 a.m. to 11 p.m.

2016 KAWASAKI 4X4 MULE Limited Ticket Drawing

Visitors to the ‘Easter at the Sauer-Beckmann Living History Farm’ try their hand at building grass nests for the Easter Bunny. This year’s Easter celebration is planned March 26.

dren’s wading pool and a covered pavilion ²LVPDQQHGE\FHUWL¿HGOLIHJXDUGV Nearby are two lighted tennis courts. Available by reservation is the park’s dining hall and group picnic area, located on the banks of the Pedernales River, as well as a separate baseball diamond facility. Fishing is allowed without a license from the banks of state park lands. More information More information on park events, as well as rental of the park and its facilities, is available by calling 830-644-2252, ext. 226; e-mailing, or visiting All of the current park information is also posted on Facebook at


“21 GUN SALUTE” DRAWING FOR A SELECTION OF AT LEAST 21 SHOTGUNS, RIFLES & HANDGUNS. An All-You-Can-Eat Meal of Sausage, Sauerkraut & German Potatoes Ages 14 and up ... $10 5 to 13 ... $5, kids under 5 are free %HHU :LQHf/LYH3ROND &RXQWU\0XVLF Felix Truvere & The Open Road Band from 7-11pm

Drawings for other Great Outdoors and Hunting Prizes will be held. Mule and Gun Tickets will be sold at: Arrowhead Bank, Builders FirstSource and Stroeher & Olfers :LQQHUVPXVWSDVVDOOUHTXLUHGIHGHUDO¿UHDUPVUHJXODWLRQVDQG EDFNJURXQGFKHFNV2QO\WKHZLQQLQJWLFNHWRZQHU RUWKHLUSDUHQWJXDUGLDQPD\UHFHLYHWKHJXQ

* Children’s Games and Activities *


LBJ National Historical Park offers year-round events


race the birth, childhood, political career, retirement and death of the 36th President of the United States at the Lyndon B. Johnson National Historical Park in Stonewall. The park is actually divided into two components â&#x20AC;&#x201D; one in Johnson City and the other in Stonewall. The LBJ Ranch is a mile east of Stonewall on the north side of the Pedernales River. It is a companion attraction to the Lyndon B. Johnson State Park and Historic Site, which is lo-

Stonewall District The national parkâ&#x20AC;&#x2122;s Stonewall District operating hours are 9 a.m.-4:30 p.m. It is open daily except Thanksgiving, Christmas and New Yearâ&#x20AC;&#x2122;s Day. Gates close at 5:30 p.m. and the ranch is open from 9 a.m. to 5:30 p.m. 7KHÂżUVWVWRSIRUDQ\WRXULVDWWKH/%-6WDWH3DUNDQG Historic Site Visitor Center, 17 miles east of Fredericksburg off U.S. 290. Free permits for the driving tour are issued from 9 a.m.4 p.m. The tour leads travelers to the Junction School, where Johnson began his education at the age of four, to the presidentâ&#x20AC;&#x2122;s birthplace, then to the Johnson family cemetery, where President and Mrs. Johnson are laid to rest. 9LVLWRUVFDQJRWRWKH/%-5DQFK+DQJDUIRUDÂżUVW FRPHÂżUVWVHUYHWRXURIWKHUHVWRUHGÂżUVWĂ&#x20AC;RRURIWKH7H[DV White House form 10 a.m.-4:30 p.m. each day. Cost is $3 for those 18 years of age or up, free for those 17 and under.

cated along the riverâ&#x20AC;&#x2122;s southern banks. The other district in Johnson City, in Blanco County, is made up of the LBJ Boyhood Home and the Johnson Settlement. Among the annual spring and summer events at the LBJ Ranch are the LBJ 100 Bicycle Tour on April 2, â&#x20AC;&#x153;Movies Under the Starsâ&#x20AC;? events (June 4, June 7, July 16 and Sept. 10) and the 108th anniversary of LBJâ&#x20AC;&#x2122;s Birth Wreath Laying Ceremony on Aug. 27.

LBJ National Park â&#x2013;ś 98

More than a thousand riders test their endurance on the long routes of the LBJ100 Bicycle Tour, held in March of last year. This yearâ&#x20AC;&#x2122;s tour is scheduled for April 2 at the LBJ park. â&#x20AC;&#x201D; StandardRadio Post file photos

The Beginning

Work in Progress

Home Sweet Home

Youâ&#x20AC;&#x2122;ll fall in love with the casual lifestyle at Stone Ridge, Fredericksburgâ&#x20AC;&#x2122;s premier neighborhood located only two miles north of Main Street on Texas Highway 16 and Lower Crabapple Road. 830-997-3400, Real Estate Advisory

98 LBJ National ParkCont. from 96

Education During his administration, Johnson signed more education bills into law than any other president. He signed the landmark Elementary and Secondary Education Act of 1965 at the Junction School, where he attended classes. The Junction School is located in the Lyndon B. Johnson National Historical Park at Stonewall. For listing of all events at the site visit state-parks/lyndon-b-johnson.

Johnson City District Fourteen miles east of the LBJ Ranch is the Blanco County seat, Johnson City. This park district includes a visitor center at 100 East Ladybird Lane, the LBJ Boyhood Home and the Johnson Settlement. The visitor center is open daily from 9 a.m. to 5 p.m. The LBJ Boyhood Home is open for guided tours with a park ranger from 9 a.m. to 4:30 p.m., excluding the noon hour, seven days a week.


The Johnson Settlement transports visitors back to the early settlement days of Texas. A visitor contact station is open in the Withers and Spauldings Building in downtown Johnson City. There, the public will see how a general store looked, circa 1915. More information is available from the visitor center at 830-868-7128, ext. 244.


Pasta Bella

Italian Restaurant Daily D aiilyy Lunch Lunnch Specials

served serve ser se erveeedd wwith ith itth our ouur Fresh Freeesh Fre shh Bre Brea Bread, rea eaad, Sa Salad & Ice Iced ceed Tea Tea MONDAY MO ONDA AY - Lasa Lasagna agna TU TUESDAY UESD DAY Y-C Chicken hic cken P Parmigiana armigiana WEDNESDAY WED DNE ESDA AY - Spa Spaghetti agh hetti w with ith Meatballs THURSDAY THU URS SDAY Y-) )ULHG&DWÃ&#x20AC;VK ULHG&DWÃ&#x20AC;VK FRIDAY FRID DAY Y - Fe Fettucini etttucini Alfredo SATURDAY SAT TUR RDAY Y - Fried d Ravioli SUNDAY SU UNDA AY - CLOS CLOSED SED APPE PPETIZERS ETIZZERS S/A ANTIPASTO

Letâ&#x20AC;&#x2122;s Go To Luckenbach Texas...












OPEN 9 til Close 830-997-3224

GENERAL STORE â&#x2DC;&#x2026; BAR â&#x2DC;&#x2026; DANCE HALL 87


290 290




Hours Hou H Ho ourrss of of Operation Oppeeraattioon Monday-Saturday M onda dday-Satu ayy-S -S Sat Sat aturda rdda day f         f f            6RXWK/ODQRf)UHGHULFNVEXUJ7H[DV  6  6R 6RXWKK/O K//ODQ ODDQQRf RRf) f )U )UHG UHGH HHGGH GHHULFNVEXUJ ULF LFNV NVEXUJ XUUJJ7 7H[DV 7 7H H[DV [DDV             830.990.9778 830 8 83 30.990 3 0..99 990 9 90.9 0.97 .97 778 8 Call Call Us Ca U for for Catering! fo Cate Cat Ca te tering ing! ng! g! Or Or Get Geet it i To Go! Goo!




87 1376

10 Sisterdale


Comfort 46

Boerne To San Antonio

To San Antonio

To Austin

Johnson City


LUCKENBACH IS LOCATED: 8 miles SE of Fredericksburg. Five miles south of the intersection of Hwy. 290 & FM 1376 and turn right onto Luckenbach Town Loop.


Bats call old tunnel park home Visitors of Fredericksburg who have never seen a bat donâ&#x20AC;&#x2122;t have to travel too far to get their chance. The smallest Wildlife Management Area in Texas â&#x20AC;&#x201D; Old Tunnel State Park, a mere 16.1 acres, houses more mammals than any other WMA in the Lone Star State. For six months out of the year, three million-plus bats make their home inside the 920-foot landmark railroad tunnel, which was built in 1913 and used by the Fredericksburg and Northern Railway until its abandonment in 1941. Brazilian Free-tailed Bats, as well as an estimated 3,000 cave myotis bats, funnel out of a now-defunct railroad tunnel between May and October. The Old Tunnel WMA, located at 10619 Old San Antonio Road (around 11 miles south of Fredericksburg), is open sunrise to sunset, 365 days a year. During the summer and early fall months, Texas Parks and Wildlife Department hosts daily sessions to educate visitors about the bats. Then, at dusk, viewing sessions are held where spectators can watch as a â&#x20AC;&#x153;black tornadoâ&#x20AC;? forms before their eyes as thousands of bats leave their roosts inside the abandoned railroad tunnel, swirling out en masse on their QLJKWO\IRUDJLQJĂ&#x20AC;LJKWV To better see the bats on their nightly runs, the park offers an upper viewing deck and a lower observation level which is closer to the bat tunnel and walking trail. The largest bat populations and corresponding longer emergence times (up to 45 minutes) fall later in the summer. $VEDWVDUHVHQVLWLYHWROLJKWĂ&#x20AC;DVKSKRWRJraphy is permitted only from the upper-level viewing area. In addition, the upper viewing deck contains glass-plated biological displays aimed at educating the public on the life cycle of the bats and their importance to the ecological system. Park guides conduct an educational program in the lower observation area closer to the tunnel about 30 minutes to an hour prior to the estimated bat emergence times on

A dark hole shows the entrance and exit where the bats fly out of at Old Tunnel State Park. â&#x20AC;&#x201D; Standard-Radio Post file photo

Thursday through Sunday evenings. Cost for that program, as well as admission to the lower trail and lower viewing seats, is $5 per person. 2QO\VHDWVDUHDYDLODEOHIRUWKHSUHVHQWDWLRQDQGVHDWLQJLVRQDÂżUVW FRPHÂżUVWVHUYHGEDVLV Since the program start depends upon the emergence times (which vary with sunset times), the Old Tunnel WMA maintains an informational phone line to distribute updated information. Information on estimated â&#x20AC;&#x153;showâ&#x20AC;? times is available at 1-866-978-2287. Further information is also available on the Internet on the Old Tunnel WMAâ&#x20AC;&#x2122;s TPWD web page at: Picnic tables are available at the park, along with a half-mile bird-watching trail.



1110 E MAIN 830-997-8771





1305 N Milam Street, Fredericksburg ĐĐĞƉƟŶŐŵŽƐƚŝŶƐƵƌĂŶĐĞƐŝŶĐůƵĚŝŶŐ͗ ^ƵƉĞƌŝŽƌDĞĚŝĐĂŝĚΘŚŝƉƐͬDĞĚŝĐĂƌĞ

We have only ONE story.

3.5 acres on Main Street with 10 historic buildings Hundreds of artifacts you can see up close Volunteer Fire Department Museum

Vereins Kirche

| 100 West Main

Artifacts and displays telling our 170-year old story, right in the middle of Marktplatz

Come be part ooff ourr ne next xt cchapter hapt ha pter ter

Soy Candles, Books, Antiques, Lamps, Signs, Wreaths, Apparel, Organic Soaps & Lotions, Salt Water Taffy and so much more!

Visit W Website ebsite for for a CCalendar alendar of of Events Ev 830-990-8441


Open every day at 10:00 am except Sundays, Thanksgiving and Christmas

Farm Fresh Eggs For Sale Every Day


Pioneer Museum | 325 West Main


Two Museums on Main Street

830-997-7070 830-9 997-70 97 97-7070 7-7070 70


It’s just taken us 170 years to tell it.

411 11 E E. Main M i F Fre Fredericksburg, ed dericksburg i k b rg, T Txx 7862 7 78624 8624 4

Where We Make Your “Dream” a Reality!

830-997-1950 156 FM 2093 (Tivydale Rd.) Fredericksburg, TX 78624

MEMORBILLIA Financing, Insurance and worldwide delivery available


Wine and wildflowers. ...


make a great combination Bluebonnets and other wildflowers blanket the 290 Wine Corridor. â&#x20AC;&#x201D; Standard-Radio Post file photo

Alexander Vineyards 830-865-3975 The mission at Alexander Vineyards is to create an educational and exciting wine experience for everyone to enjoy. Located at U.S. 290 East and Goehmann Lane intersection, Alexander Vineyards is about five miles east of downtown Fredericksburg. Established in April 2013, Alexanderâ&#x20AC;&#x2122;s wine offerings promise to grow each year. Alexander specializes in champagne and Bordeaux wines. The winery is open daily from 11 a.m.6 p.m.

Bell Mountain Vineyards 830-685-3297 Bell Mountain, operated by the Oberhelman family, planted its first test vineyard in 1976. The vineyard produces and bottles wines from the classic wine varieties branded with the Bell Mountain label. It also offers specialty wines under the Oberhof label, as well as Vina Rita Wine Cocktails. The winery, located 14 miles north of Fredericksburg off Texas Highway 16, is open for complimentary tours and tastings from 10 a.m. until 5 p.m. every Saturday.

Baronâ&#x20AC;&#x2122;s Creek Vineyard 830-330-4052 Brothers Mike, Chris and Marc Chase began Baronâ&#x20AC;&#x2122;s Creek Vineyard with different visions â&#x20AC;&#x201D; one imagines a bountiful vineyard, another sees a gathering place for friends and family, while the last looks forward to new and lasting memories created nightly. These three dreams have become a collective vision of the vineyard and winery. Baronâ&#x20AC;&#x2122;s Creek is located 5865 U.S. 290 East, Fredericksburg and is open 10 a.m.-6 p.m. Thursday through Saturday and 11 a.m.-5 p.m. Sunday.

Becker Vineyards 830-644-2681 Established in 1992, this vineyard is located out U.S. 290 East toward Stonewall, down Jenschke Lane. Owners are Dr. Richard and Bunny Becker. Its grounds feature retail sales, a gift shop and tasting room which are open Monday through Thursday 10 a.m. to 5 p.m.; Friday and Saturday 10 a.m. to 6 p.m., and Sunday noon to 6 p.m. The vineyard also offers a selection of products made from lavender grown in its three-acre lavender field. Becker Vineyards

Lavender Festival is set for April 30. Bending Branch Winery 830-9952948 Bending Branch Winery, a boutique winery near Comfort is a sustainable practices and organically focused operation with 20 acres of vines, comprising 16 varietals. Their tasting room hours are Thursday, 11 a.m. to 5 p.m.; Friday and Saturday, 11 a.m. to 6 p.m., and Sunday, noon to 5 p.m. Tours are available by appointment only. The winery is located at 142 Lindner Branch Trail, Comfort. Chisholm Trail Winery at Spring Creek Vineyards 830-990-2675 This winery is located at 2367 Usener Road (about 10 miles west of Fredericksburg on U.S. 290 toward Harper). The Old West-style winery, established in 2001, has a 6,000-square-foot saloonstyle tasting room. Special events with live music and hosted by the wineryâ&#x20AC;&#x2122;s Saloon Girls are held throughout the year. Woodfired gourmet pizza is prepared in the Oval Oven. Chisholm Trail is now open daily, noon to 6 p.m.

105 Compass Rose Cellars 830-868-7799 This winery is located in Hye, Texas, 1197 Albert Road (about 20 miles east of Fredericksburg on U.S. 290 toward Johnson City). Compass Rose Cellars, established in 2011, is a boutique winery based out of Hye, Texas. The winery started as a far-off dream for Mark Watson that slowly matured into reality. The tasting room is open 11 a.m.-6 p.m. Thursday to Sunday. Other hours are available by appointment. Fat Ass Ranch Winery 830-644-2300 This winery, found between Stonewall and Fredericksburg at 51 Elgin Behrends Rd., started when Gail and Jennie McCulloch married and found the perfect Hill Country Ranch. The three square meals a day made the McCullochs, their ranch dog and their donkey gain weight. This is when they decided they lived on a Fat Ass Ranch. The winery is open 11 a.m. to 5 p.m. every day except Saturday when it is open 10 a.m. to 6 p.m. Fiesta Winery 830-307-3328 Fiesta Winery began in Bend, Texas, but the wineryâ&#x20AC;&#x2122;s success spawned two local outlets. Fiesta Winery Main Street is located at 147A E. Main (with Books on Main), and Fiesta Winery 290 is located at 6260 U.S. 290 East. Karen (K.K.) Taylor manages both locations. Serving begins at 10 a.m. downtown, except for Sundays (11 a.m.). Closing times vary so call ahead to check. The winery has won awards in Dallas and

San Antonio contests. 4.0 Cellars 830-997-7470 4.0 Cellars, featuring modern architecture, is a collaboration between three well-regarded Texas wineries: Brennan Vineyards in Comanche; Lost Oak Winery near Burleson and McPherson Cellars in Lubbock. Kim McPhersonâ&#x20AC;&#x2122;s father, â&#x20AC;&#x153;Docâ&#x20AC;? is considered one of the â&#x20AC;&#x153;fathersâ&#x20AC;? of the modern Texas wine industry, having cofounded Llano Estacado in Lubbock. The winery is open Friday and Saturday from 10 a.m. to 6 p.m. and Sunday through Thursday from 11 a.m. to 5 p.m. Located seven miles east of Fredericksburg, on U.S. 290 East, the winery offers wine tastings, tours and other special events. Fredericksburg Winery 830-990-8747 Located at 247 W. Main St., Fredericksburg Winery was named one of the top three producers in Texas by â&#x20AC;&#x153;USA Today.â&#x20AC;? The winery is owned and operated by the Switzer family, and was established in 1996. The winery, which has its own vines, produces wines at its 10,600-square-foot facility on West Main Street, offering a large selection of wines from the very dry varieties to late harvest dessert wines and



port. The winery is open seven days a week: 10 a.m. to 5:30 p.m. Monday through Thursday; 10 a.m. to 7:30 p.m. Friday and Saturday, and noon to 5:30 p.m. Sunday. (The last tasting each day begins 15 minutes prior to closing.) Grape Creek Vineyards 830-644-2710 Grape Creek Vineyards offers visitors a feel of â&#x20AC;&#x153;Tuscany in Texasâ&#x20AC;? on its grounds, less than 10 miles east of Fredericksburg. General hours of operation are Monday through Friday, 11 a.m. to 6 p.m.; Saturday, 10 a.m. to 6 p.m., and Sunday, 11 a.m. to 5 p.m. In addition to having a tasting room at the winery, Grape Creek on Main offers a tasting room in downtown Fredericksburg, 314 E. Main St. WINERIES â&#x2013;ś 106

Curtis Staudt Construction Quality Built Custom Homes Restoration & Remodel Over 40 Years Experience In Fredericksburg And The Hill Country

Fax: 830-997-4709 2585 White Oak Road Fredericksburg


106 WINERIES Cont. from 105 Hilmy Cellars 830-644-2482 Hilmy Cellars offers a vineyard and winery with the focus of making wines from hot climate varietals from around the world. It offers six wines at its tasting room produced by owners Erik and Neldie Hilmy. The tasting room is open Monday through Saturday from 11 a.m. to 6 p.m. and Sunday noon to 6 p.m. Hye Meadow Winery 855-HYE-WINE Located on 62 acres in Hye, just outside the Gillespie County line, winemakers at Hye Meadows say they take their wine seriously, but know how to have fun. â&#x20AC;&#x153;Grape Guruâ&#x20AC;? Mike Batek joined forces with Jeff Ivy and Chris Black to open the winery in 2013. Hye Meadow is located at 10257 U.S. 290 West in Hye. Hours are 11 a.m. to 5 p.m. Monday, Wednesday and Thursday; 11 a.m. to 6 p.m. Friday and Saturday, and noon to 5 p.m. Sunday. Inwood Estates Vineyards 830-997-2304 This winery brings 30 years of winemaking experience to its newest location nine miles east of Fredericksburg in the

290 wine corridor. Its other operations are located in Dallas and Florence. Founder Dan Gatlin has an extensive background in the retail beverage trade and in vineyard research. He established one of the first vineyards in the state in 1981 in Denton County. The local facility includes a tasting room, outdoor patio and bistro. Hours are 11 a.m. to 5 p.m. Sunday, Monday and Thursday; 11 a.m. to 6 p.m. Friday, and 10 a.m. to 7 p.m. Saturday. Kerrville Hills Winery 830-895-4233 Kerrvilleâ&#x20AC;&#x2122;s first winery is situated at the top of a hill high above Kerrville and the Guadalupe River Valley. The winery and tasting room are built on the footprint of a Kerrville homestead. Tasting room hours are 11 a.m.-6 p.m. Thursday through Monday.

Kuhlman Cellars 512-920-CORK (2675) Chris and Jennifer Cobb opened Kuhlman Cellars in October 2014. The name was derived from the Kuhlman Creek which originates on their family farm and ultimately empties into the Pedernales River. BĂŠnĂŠdicte Rhyne, joined the team in 2012 as winemaker and partner. Inspired by the winding waterways, geological formations and mineral rich soil types found in the Texas Terroir, Kuhlman Cellars pays homage to this unique terrain in each of its proprietary blends. The cellarsâ&#x20AC;&#x2122; tasting room, 18421 U.S. 290 East, is open 11 a.m. to 6 p.m. Thursday through Saturday and noon to 5 p.m. Sunday. The last tasting starts an hour before closing each day. Lewis Wines 512-987-0660 Lewis Wines is a boutique producer of handcrafted Texas wines. Located near Johnson City in the heart of the Texas Hill Country, they specialize in Mediterranean varieties with a focus on Spanish and Portuguese. They work with quality focused growers across the state to farm wine grapes that thrive in the wide ranging landscape that is Texas and they planted vineyards on the Lewis Estate in Spring 2014. Tastings are done by appointment seven days a week from 10:30 a.m. to 5 p.m.


830-990-4517 0RQ7KXUVDPSPÂ&#x2021;)UL6DWDPSP Sun 8am-5pm

Fredericksburg The Best Western Fredericksburg is conveniently located only a few blocks from historic downtown. The hotel includes Texas Lobby, Lone Star Hospitality Room, Hill Country Breakfast Room, an outdoor swimming pool, and luxurious rooms & suites. Our guest rooms are decorated with a Fredericksburg style theme and offer the latest amenities & technologies of a full service hotel: interior entrances, internet, 32â&#x20AC;? LCD televisions, cable TV with HBO, alarm clocks, coffee makers, irons, ironing boards, hair dryers, granite countertops, guest laundry available on property, leather love seats, microwaves & refrigerators & suites have separate living areas. Enjoy a hot breakfast. Proud Member of the Fredericksburg Chamber of Commerce

For Reservations Call 888-908-2929 or 830-992-2929 Ă&#x17D;ÂŁ{Ă&#x160; >Ă&#x192;Ă&#x152;Ă&#x160;Â&#x2C6;}Â&#x2026;Ă&#x153;>Ă&#x17E;Ă&#x160;-Ă&#x152;Ă&#x20AC;iiĂ&#x152;Ă&#x160;Ă&#x160;UĂ&#x160;Ă&#x160;Ă&#x20AC;i`iĂ&#x20AC;Â&#x2C6;VÂ&#x17D;Ă&#x192;LĂ&#x2022;Ă&#x20AC;}]Ă&#x160;/iĂ?>Ă&#x192;Ă&#x160;Ă&#x2021;nĂ&#x2C6;Ă&#x201C;{ Ă&#x153;Ă&#x153;Ă&#x153;°LiĂ&#x192;Ă&#x152;Ă&#x153;iĂ&#x192;Ă&#x152;iĂ&#x20AC;Â&#x2DC;vĂ&#x20AC;i`iĂ&#x20AC;Â&#x2C6;VÂ&#x17D;Ă&#x192;LĂ&#x2022;Ă&#x20AC;}°VÂ&#x153;Â&#x201C; @GoFred1

as d our own Tex e, n a r a b o s s e r , Win Enjoy full esp oothies, Beer m S , s e p p a r F , es Roasted Coffe rgaritas. Bellinis, & Ma , & Pies. kies

e Pastries, Coo


nch alongsid Breakfast & Lu

107 the semi-arid climate of the Texas High Plains in their wines. Lost Draw Cellars produces wines that can be tasted in Fredericksburg at 113 E. Park St. Tasting room hours are 11 a.m. to 6 p.m. Monday; 11 a.m. to 6 p.m. Wednesday through Saturday, and 1 to 5 p.m. Sunday.

Lost Draw Cellars 830-992-3251 A High Plains grape farmer, a retired oil and gas distributer, and a young civil engineer developed a partnership with a mission to open up a winery in the city limits of Fredericksburg. Their vision was to make Lost Draw Cellars a place where locals, tourists, wine enthusiasts and wine connoisseurs could come together to enjoy good company, an inviting atmosphere and a quality Texas wine. The trio of Andy Timmons, Andrew Sides and Troy Ottmers use grapes that handle

Mendelbaum Cellars 830-997-7000 Mendelbaum Cellars offers wines from the Texas Panhandle and the Texas High Plains. It recently added wines from Israel, its “Holy Land Wines” that feature grapes grown in the Judean Hills and the Galilean Mountains. The winery is located at 10207 U.S. 290 East. Hours are Monday, 11 a.m.-4 p.m.; Tuesday and Wednesday, 1-6 p.m.; Thursday, 11 a.m.-6 p.m.; Friday-Saturday, 10 a.m.-8 p.m.; Sunday, 11 a.m.-6 p.m. Messina Hof Hill Country 830-990-4653 Messina Hof Hill Country opened in 2011,

sporting a rich family-based background rooted in the wine-making process. Located next to U.S. 290 East, near Stonewall, the 10-acre estate includes a Wine Garten, “Manor Haus” B&B, VIP Room and Guest Center. Tasting room hours are 11 a.m. to 6 p.m. Monday through Wednesday; 11 a.m. to 7 p.m. Thursday and Friday; 10 a.m. to 7 p.m. Saturday, and 11 a.m. to 6 p.m. Sunday. The local facility is an outgrowth of Messina Hof Winery and Resort in Bryan, which was started in 1977 by Merrill and Paul Bonarrigo VI. The Bonarrigo family began making wine in 1880. Narrow Path Winery 830-992-1404 Narrow Path Winery is the result of a passion of the Turbeville family for the complete process of wine making (vine to glass) and an even bigger passion for creating community. The vision for Narrow Path Winery is to provide a platform for sharing life’s journeys while sharing great wine. The winery is open noon-6 p.m. Monday and Thursday, noon-7 p.m. Friday and Saturday and noon-4 p.m. Sunday. WINERIES ▶ 108

The Friends of Gillespie County

Country Schools Living Histories Museums

Country Schools Driving Trail (Est. 2006)

120 Miles of Texas Hill Country on the most scenic roads in Texas! Download your copy of the Gillespie County Country Schools Trail map and start your HISTORIC adventure today! Stop along the route and visit 17 one-room schools dating from 1847 to 1978 and learn the 3 R’s with a German touch. Download the

mobile app at the App Store or Google Play

108 WINERIES Cont. from 107 Pedernales Cellars 830-644-2037 Pedernales Cellars is dedicated to the creation of world-class wines using ecologically sound practices, with a focus on grape varieties that can be grown with exceptional quality in the Texas Hill Country. Winemaker David Kuhlken uses gravity winemaking and extended barrel aging to produce ultra-premium wines. The underground cellar is the largest in Texas. Tasting room hours are: 10 a.m. to 5 p.m. Monday through Thursday; 10 a.m. to 6 p.m. Friday and Saturday, and noon to 6 p.m. on Sunday. The winery is located in Stonewall, 15 minutes east of Fredericksburg, at 2916 Upper Albert Road (at the corner of Ranch Road 1623 South). Pontotoc Vineyard 512-658-0023 Carl and Frances Money purchased the turn-of-the-century sandstone buildings in Pontotoc and made the town into the Pon-

totoc Vineyard Weinhalle and Winery. The mission of Pontotoc Vineyard is to make vintage wines of exceptional quality from grapes grown in and well-suited to Texas. All of the wines are made with at least a portion of the grapes grown at Pontotoc Vineyard and are named after historic locations and geological formations in the Northern Hill Country. All Pontotoc Vineyard wines are offered at their Weingarten located at 320 West Main Street, in Fredericksburg, on Friday and Saturday from noon-8 p.m. and Sunday from noon-5 p.m. Rancho Ponte Vineyard 830-990-8555 Rancho Ponte Vineyard was established locally in 2009 as a continuation of a family tradition of quality winemaking that began in 1895 in Italy. The winery and tasting room are nestled on 20 acres surrounded by cattle and horse ranches. Its location is 315 Ranch Road 1376, about five miles east of Fredericksburg (be-

hind KOA, on the road to Luckenbach). Rancho Ponte is open from 11 a.m. to 5 p.m. Sunday through Friday, and 11 a.m. to 6 p.m. Saturday. The winery features a variety of wines, sold exclusively at the winery. Sandstone Cellars Winery 325-347-WINE Sandstone Cellars Winery is a boutique winery just off the town square in Mason. The winery opens 11 a.m.-11 p.m. Thursday through Saturday and 11 a.m.-2 p.m. Sunday. SantaMaria Cellars 830-998-5357 Located at 12044 Texas 16 South, about five miles from downtown Fredericksburg, owner and winemaker Martin Santamaria adds an Argentinian flare to Texas winemaking. The former professional rugby player studied viticulture and oenology in Italy. The winery is open Thursday and Friday noon-5 p.m.; Saturday 11 a.m. to 5 p.m., and Sunday noon-3 p.m.


Quiet Creek

~ RV Resort ~ 2647 N. US Hwy. 87 (5 minutes from downtown)

Fredericksburg, TX 78624 830-992-1237

109 Singing Water Vineyards 830-995-2246 The name Singing Water describes the sound that fills the air as the water of Bruins Creek cascades over a waterfall on Dick and Julie Holmbergs’ property near Comfort. What started out as the Holmbergs making wine for themselves and friends grew into a bonded winery in 2004. In May of 2005, the first commercial wines were sold. By October, they were sold out. The tasting room is open 11 a.m.-6 p.m. Thursday through Saturday; noon-5 p.m. Sunday, and 11 a.m.-6 p.m. Monday. Sister Creek Vineyards 830-324-6704 Since 1988, Sister Creek Vineyards has been located in the heart of the Texas Hill Country in Sisterdale, (pop. 25). Bordeaux and burgundy wine making techniques are employed to produce chardonnay, pinot noir, cabernet sauvignon, and merlot wines. These traditional wines are aged in 60-gallon oak barrels for up to three years. In addition to these wines, an Italian-style muscat canelli is also produced. The winery

Six Shooter features wines from Cowtown Winery (Fort Worth), Clear Creek Vineyards (Kemah), Yepez Vineyard (Baytown), Cross Timbers Winery (Grapevine) and Retreat Hill (Navasota) and Blazing Barrels (Lubbock). Visitors will find an assortment of reds, whites, blushes and dessert wines, all from Texas winemakers. Hours are Monday and Thursday, noon to 6 p.m.; Friday and Saturday, 11 a.m. to 6 p.m.; Sunday, 11 a.m. to 5 p.m. The winery is located at 6264 U.S. 290 East.

is located between the cypress lined east and west Sister Creeks in a restored 1885 cotton gin. The tasting room is open Monday through Friday 10 a.m.-5 p.m.; Saturday 10 a.m.-6 p.m., and Sunday 10 a.m.-6 p.m. Six Shooter Cellars 830-428-0810 Six Shooter Cellars is a collection of six wineries from around the Lone Star State.

Texas Hills Vineyards 830-868-2321 Texas Hills Vineyard is located in the gentle hills of the picturesque Pedernales River Valley in the Texas Hill Country near Johnson City. A perfect location for growing quality grapes, the intense Texas sun by day and the cooler Hill Country nights gives grapes an intense and quality flavor, ideal for wines. Texas Hills Vineyard is open Monday through Thursday 10 a.m.-5 p.m.; Friday and Saturday 10 a.m.-6 p.m., and Sunday noon-5 p.m. WINERIES ▶ 115

COME FIND OUT ABOUT OUR NEW ADDITION TO OUR WONDERFUL COMMUNITY! We are so excited to show you just how you will fit right in.

Schedule a tour today by calling 830-997-9406! We have a place just for you!

“ASSISTANCE WHEN YOU NEED IT. . . INDEPENDENCE WHEN YOU WANT IT” The Help You Need–The Respect You Deserve! * Bathing and Dressing * Medication Dispensing * Transfers * Transportation * Housekeeping & Laundry * Three Restaurant Style Meals & Snacks * One Bedroom & Studio with Private Baths * Kitchenettes * Tons of Social Activities

98 Frederick Rd., Fredericksburg, Texas 78624

/HDWKHUV:LWK6W\OH by Texian Leathers

i>Ă&#x152;Â&#x2026;iĂ&#x20AC;Ă&#x160;>Â&#x2DC;`L>}Ă&#x192;Ă&#x160;UĂ&#x160; iÂ?Ă&#x152;Ă&#x192;Ă&#x160; Ă&#x160; Â&#x153;Â&#x153;Ă&#x152;Ă&#x192;Ă&#x160;UĂ&#x160;7>Â?Â?iĂ&#x152;Ă&#x192;Ă&#x160; Ă&#x160; Ă&#x20AC;Â&#x2C6;ivV>Ă&#x192;iĂ&#x192;Ă&#x160;UĂ&#x160;VViĂ&#x192;Ă&#x192;Â&#x153;Ă&#x20AC;Â&#x2C6;iĂ&#x192;Ă&#x160; Ă&#x2022;}}>}iĂ&#x160;UĂ&#x160; >VÂ&#x17D;ÂŤ>VÂ&#x17D;Ă&#x192; >Â&#x2DC;`L>}Ă&#x192;Ă&#x160;vĂ&#x20AC;Â&#x153;Â&#x201C;\Ă&#x160; Â&#x201C;iĂ&#x20AC;Â&#x2C6;V>Â&#x2DC;Ă&#x160;7iĂ&#x192;Ă&#x152;]Ă&#x160;,>Ă&#x203A;Â&#x2C6;>Â&#x2DC;Â&#x2C6;] Ă&#x160;Ă&#x2022;Ă&#x20AC;Ă&#x152;Â&#x201C;iÂ&#x2DC;Ă&#x160; iĂ&#x192;Â&#x2C6;}Â&#x2DC;Ă&#x192;]Ă&#x160;

Â&#x153;Ă&#x2022;LÂ?iĂ&#x160;Ă&#x160;->``Â?iĂ&#x20AC;Ă&#x17E;]Ă&#x160; /iĂ?Â&#x2C6;>Â&#x2DC;Ă&#x160;i>Ă&#x152;Â&#x2026;iĂ&#x20AC;Ă&#x192;

123 E. Main St. Fredericksburg, Texas 78624 830-997-6001





ϭϰϵ͘DĂŝŶ^ƚ͘H &ƌĞĚĞƌŝĐŬƐďƵƌŐ͕dy 830.997.3281 ǁǁǁ͘ũŽŚŶŶLJůĞĞƐ͘ĐŽŵ Hats H Belts H Briefcases H ŚƌŝƐƟĂŶ'ŝŌƐ H Caps DŝŶĚWƵnjnjůĞƐH <ŶŝǀĞƐĨƌŽŵĂƐĞ, ŽŬĞƌ͕ <ĞƌƐŚĂǁ͕^ŵŝƚŚΘtĞƐƐŽŶĂŶĚDĂŶLJKƚŚĞƌƐ H ŶĚ&ƵŶ^ƚƵī

Our New Store,

All Gussied Up

Here in Fredericksburg, Texas! Stop by and check us out, Jewelry, Accessories and Clothing* that fit any style no matter where you want to go. *We carry Plus sizes too!

Ó£{Ê >ÃÌÊ>ˆ˜Ê-ÌÀiiÌÊUÊÀi`iÀˆVŽÃLÕÀ} 830.992.3250



A haven for historically minded Visitors can get a glimpse into what life was like for Gillespie Countyâ&#x20AC;&#x2122;s early settlers by first stopping in the Pioneer Museumâ&#x20AC;&#x2122;s entry

point, 325 West Main Street. Special tours and rates are available for large groups. â&#x20AC;&#x201D; Standard-Radio Post file photo

History buffs can immerse themselves in the life of Fredericksburg by exploring the historic structures, authentic objects, photographs and much more at Pioneer Museum, owned and operated by the Gillespie County Historical Society (GCHS). The GCHS and Pioneer Museum work together to create a shared narrative of Fredericksburg history. The GCHS manages historical collections from donors and the Pioneer Museum complex brings the collections to life through exhibits, demonstrations and educational programs.

Pioneer Museum Located at 325 West Main Street, the museum complex features year-round activities, displays, hands-on demonstrations and more for families. The museum is open from 10 a.m.-5 p.m. Monday through Saturday. It is closed on Sundays and major holidays. Regular museum admission is $5 for adults, $3 for youth ages 6 to 17 and free for children 5 years of age and younger. One $5 ticket admits the holder to both Pioneer Museum DQGWKH9HUHLQV.LUFKHORFDWHGRQ0DUNWSODW]GRZQWRZQ Special tours and rates are available for groups of 15 or more.

GCHS The GCHS was formed in 1935 to preserve and share the history of Gillespie County and the surrounding Texas Hill Country. 7KHÂżUVW3LRQHHU0XVHXPVLWHZDVWKH9HUHLQV.LUFKH ORFDWHGLQWKHEORFNRI:HVW0DLQ6WUHHW7KH9HUHLQV .LUFKHLVDUHSOLFDRIWKHRULJLQDOVWUXFWXUHDQGLVDQH[tension of Pioneer Museum. ,QWKHVRFLHW\ERXJKWWKHKLVWRULF.DPPODKKRXVH store and property, which included a smokehouse and barn. All are at the Pioneer Museum Complex site. With other purchases and donations by the GCHS, the Pioneer Museum site has grown to encompass three acres and 11 buildings. Nine of the buildings are historic structures included on a tour of the Pioneer Museum grounds. The society has over 300,000 artifacts within its rich and diverse collection.

Special activities The museum hosts several special activities during the spring and summer. Â&#x2021; 6SULQJ%UHDNDW3LRQHHU0XVHXP²0DUFKDQG 19; Â&#x2021; (DVWHU(JJ+XQW²6DWXUGD\0DUFK Â&#x2021; /HQ])HVW²$SULODQG Â&#x2021; )RXQGHUV'D\²6DWXUGD\0D\ Museum complex 7KH'DPEDFK%HVLHU+RXVHDW:HVW0DLQ6WUHHWKDV been reconstructed to form the entrance to Pioneer Museum DQGWKH9LVLWRU:HOFRPH&HQWHU7KHVWUXFWXUHDOVRKRXVHV the museumâ&#x20AC;&#x2122;s gift shop. 7KHROGOLPHVWRQHKRXVHZDVEXLOWLQE\)'DPEDFK PIONEER MUSEUM â&#x2013;ś 114


2 Fredericksburg Locations: 147A East Main Street 6260 US Hwy 290 East While on Main Street be sure to check out Savy E’s Boutique, located in the back.

Stay on Main or take a short drive out 290 East– at Rocky Hill complex. Live music every Saturday and Sunday. Phone: 830-997-4466 5 Tastings for $10 and a complimentary stemless Fiesta glass.

With a 3-bottle purchase, your tasting is FREE!

Hours: Open 7 days a Week. Call for times. ™™™Ǥϐ‹‡•–ƒ™‹‡”›Ǥ…‘


A peek into yesteryear at Pioneer Museum during Spring Break Time to put down the cell phones and catch a glimpse into Fredericksburgâ&#x20AC;&#x2122;s early days. Spring Break revelers can take to experiencing some special activities planned at Pioneer Museum, 325 West Main Street. The museum will host a variety of hands-on activities, demonstrations and reenactments and organizers promise something for all ages. Dates are March 11-12, and March 14-19. Activities planned include rope making, quilting, spinning and hammering at the blacksmithâ&#x20AC;&#x2122;s forge, and a chuck wagon display. There will also be re-enactors on site to help experience the days of mountain men, Buffalo Soldiers, early Texas Rangers and the vaquero.

Attendees can experience a one-room schoolhouse and share in storytelling and folk song singing. A Native American dancer also will be there as a part of the activities. Visitors also can try their hand at the German language with some of Fredericksburgâ&#x20AC;&#x2122;s many local speakers. In the one-room schoolhouse, every day theyâ&#x20AC;&#x2122;ll have different former oneroom school students. The museumâ&#x20AC;&#x2122;s regular exhibits and buildings will be open for viewing and interpreters welcome questions and love to share stories of the past, the spokesman added. Admission to daytime Spring Break activities is included with the regular museum admission of $5 for adults, $3 for youths aged 6-17 years and free for those 5 and under.

Youth can try on traditional garb of the areaâ&#x20AC;&#x2122;s Native American population. â&#x20AC;&#x201D; StandardRadio Post file photo

PIONEER MUSEUM Cont. from 112

and in more recent times had been used as a restaurant. Visitors to Pioneer Museum will be immersed in the stories of those who built this community. 7HQKLVWRULFVWUXFWXUHVÂżOOHGZLWKDXWKHQWLFDUWLIDFWVDQG images, encourage visitors to imagine the struggles of the founding generations â&#x20AC;&#x201D; thousands of miles from their birth place, with scant supplies and equipment, to survive and create a new life. The Kammlah House and Store began in 1849 as a oneroom structure, but grew through the years with the addition of three kitchens, a cellar, a stone patio, bedrooms and living areas. When the society purchased the Kammlah property in 1955, four generations of Kammlahs had lived in the house. Between 1870 and 1924, the Kammlahs operated a general store in the front rooms. The house is the oldest building in Fredericksburg open to the public. Each historic structure at the museum complex tells part of the story of this communityâ&#x20AC;&#x2122;s past. The Kammlah Smokehouse and Barn, located behind the KRXVHDUHÂżOOHGZLWKERWWOHOLQHGĂ&#x20AC;RZHUEHGVDZLQGPLOO chicken pen, farm implements and outhouse reminiscent of a past era. The Arhelger Bathhouse, originally built as a bathhouse behind the Arhelger Barber Shop, now houses an exhibit on the Fredericksburg & Northern Railroad (1914-1942). @GoFred1

The White Oak School recalls the days of the one-roomed country school, common before Texas consolidated its schools into larger districts after World War II. Three additional homes offer a comparison between different types of structures found in 19th century Fredericksburg. The Walton Smith Log Cabin, built around 1880, is a typical log-stone-mortar house. The Fassel-Roeder House, begun in the 1870s, served as a butcher shop before a kitchen, living room and front porch were added. Furnished with household items typical of the late 19th century, the Fassel-Roeder House illustrates domestic life during that period. The Weber Sunday House is typical of small wooden structures built by German families who lived too far from town for one-day trips. These little houses served as places to eat and rest when families came to town for church, shopping or funerals. Also located on the grounds is the Fredericksburg Volunteer Fire Department Museum, built by the Fredericksburg +HULWDJH)HGHUDWLRQ)RXUSLHFHVRIHDUO\WK&HQWXU\ÂżUHÂżJKWLQJHTXLSPHQWRIIHUDJOLPSVHRIWKHKLVWRU\RIWKH)UHGericksburg Volunteer Fire Department. The bell on top of the EXLOGLQJVWRRGDWRSWKHÂżUVWÂżUHVWDWLRQLQWRZQ More information on the museum is available at 997-2835 or on the internet website:


WINERIES Torre di Pietra Vineyards - Texas Hill Country Wine 830-644-2829 Torre di Pietra is operated by the Ken and Jenise Maxwell family, fourth- and fifthgeneration Texans whose family has been making wine for over 100 years. The Maxwell familyâ&#x20AC;&#x2122;s tradition of farming and wine making dates back to the late 1800â&#x20AC;&#x2122;s. The winery and vineyard is located 10 miles east of Fredericksburg on U.S. 290, and is open 11 a.m. to 5 p.m. Monday through Thursday and 11 a.m.-6 p.m. Friday through Sunday. The Vintage Cellar 830-992-7699 The Vintage Cellar specializes in Texas Wines and Texas Olive Oil. They carry locally made wines and oils. The Vintage Cellar is located at Rocky Hill School, 6258 U.S. 290 East. The school built in 1902 was in operation until 1977. Hours are Monday, 11 a.m.-5 p.m.; Thurs-

Der KĂźchen Laden â&#x20AC;&#x153;for the little chef in all of usâ&#x20AC;?



Cont. from 109 day and Friday, 11 a.m.-5 p.m.; Saturday, 11 a.m.-6 p.m. and Sunday, 1-5 p.m.

ity boasts an award-winning portfolio of wines. William Chris is located at 10352 U.S. 290 in Hye. Hours are 10 a.m. to 5 p.m. Monday through Wednesday, and 10 a.m. to 6 p.m. Thursday through Saturday. Sunday hours are noon to 5 p.m.

Westcave Cellars Winery 512-431-1403 Westcave Cellars Winery was founded in 2010 and has established a reputation for crafting fine 100 percent Texas wines. The family-owned and operated winery is a few miles west of Hamilton Pool Preserve. The tasting room is open Monday, Friday and Saturday 11 a.m.-6 p.m.; Sunday noon-6 p.m., and Tuesday and Thursday by appointment.

Woodrose Winery 830-644-2539 Woodrose Winery is located just west of the Stonewall community, on the south side of U.S. 290, about 14 miles east of Fredericksburg, on Woodrose Lane. Founded in 1995 in Austin as Oak Hill Cellars, Woodrose planted its first vines in Stonewall in 2000. In 2005, wine maker and enthusiast Mike Guilette bought the winery and expanded it to 34 acres. Winery tasting room hours are 11 a.m. to 6 p.m. Monday through Saturday; and noon to 6 p.m. Sunday. The facility currently includes a tasting room with outdoor seating.

William Chris Vineyards 830-998-7654 Environmentally friendly and Texas grown, William Chris Vineyards in Hye is becoming known for quality wines that have won many awards. Opened in 2009 by Bill Blackmon and Chris Brundrett, the family-owned facil-




Construction, Inc.


(830) 997-9397 1798 S. Hwy 87 FREDERICKSBURG Download the

mobile app at the App Store or Google Play


Full Line Boutique including Old Gringo Boots, Miss Me Jeans, Cinch Clothing, Refined Rustic Furniture, Cowhides, Longhorn & Buffalo Mounts, Home Accessories, Gifts & More.


3245 Hwy 290 East, Fredericksburg


Artists talk about the walk

Roxana Tuff and Lee Ann Graff discuss the grand opening of the Eleven Squared Venue, during the First Friday Art Walk, on Oct. 2 last year. Tuff and Graff are the owners.

hether itâ&#x20AC;&#x2122;s a special exhibit, new works, demonstrations or artist receptions, it is all about the art each month when local galleries join together to celebrate First Friday Art Walk Fredericksburg. 2QWKHÂżUVW)ULGD\RIHDFKPRQWKWKHSDUWLFLSDWLQJJDOOHULHVIHDWXUHVSHFLDOHYHQWVVKRZVDQGH[KLELWVDUWLVWGHPRQstrations, special appearances, receptions and more.



Agave Gallery 208 East San Antonio 830-990-1727 Agave Gallery â&#x20AC;&#x153;Fine art. Texas style.â&#x20AC;? features a collection of original works of art by 20 Texas artists. Showcased in a historic 1870â&#x20AC;&#x2122;s limestone â&#x20AC;&#x153;Sunday houseâ&#x20AC;? in downtown Fredericksburg, just one block south of Main Street, are original paintings, etchings, sculpture, jewelry, engraved silver buckles, gourds and photography. Also inside is a sculpture studio where one can observe work in progress by Texas State Artist John Bennett. Hours are 10 a.m.-5 p.m., Monday through Saturday and sometimes on Sunday afternoons. Patrons are encouraged to call if they know when they are coming. Additional parking is available up the drive behind the gallery. Special events and shows are being planned for the coming months. Agave Gallery will feature Roy and Blanche Cavarretta, awardwinning gourd artists, during the April 1 First Friday Art Walk. Both are skilled at carving, pyrography, staining, dying and incorporating other mediums into their finished art pieces. They will demonstrate their techniques using gourds for their canvases. A reception will be held from 5-8 p.m. on April 1.

Artisans â&#x20AC;&#x201C; A Texas Gallery 234 West Main 830-990-8160 Artist and owner, Patricia Karr, and her family of Texas Hill Country artists continue to present an array of fine art and fine craft that includes paintings, ceramics, fine furnishings, wood turnings, sculpture, jewelry and kinetic outdoor art. Artisans offers a wide range of artwork from functional to decorative with an emphasis on the highest level of quality and distinctiveness in every medium. Upcoming events include the following: s0DUFK7KH&RORUVRI6SULQJ3DUWt7ZR7H[DVRLOSDLQWHUV Becky Rogers and Marion Loucks, bring the Hill Country to life in their unique styles of painting local landscapes. s$SULO7KH&RORUVRI6SULQJ3DUWt7KLVSRUWLRQRI$UWLVDQVp spring show includes three-dimensional color as ceramicist Jennifer Hoeksema, and mosaic artists, Pamela Quest and Patricia Karr, bring the flora and faunae of spring to life in ceramic sculptures and wall mosaics. s0D\,QWKH*DUGHQt$UWLVDQVpFRXUW\DUGZLOOEHRYHUWDNHQ with beauty as we celebrate our Texas Spring weather. Artists and refreshments will be available in the courtyard as they enjoy new kinetic sculptures, bronze and metal sculpture, mosaics, ceramics, and concrete outdoor art. ART WALK â&#x2013;ś 118

118 ART WALK Cont. from 117 Cate Zane 107 North Llano 830-992-2044 Cate Zane Gallery features a contemporary setting exhibiting 19th20th Century landscape paintings. A brief list of featured historic artists include Emilio Lanzi, Karl Bodmer, John Edward Borein and William Stephens. Also represented are North American and European artisan jewelry designers featuring the highest quality goldsmith, silversmith and gemstone creations. Upcoming Art Walk events include the following: s$SULO$UWLVWRQ+RUVHEDFNtq+HUGLQJ:LOG0XVWDQJVrHWFKLQJV by saddle maker and cowboy artist John Edward Borein, 1872-1945. s0D\-HZHOHG7H[DV/DQGVFDSHVt0L[HGPHGLDSOHLQDLUSDLQWLQJVRI&KLVRV0RXQWDLQV(QFKDQWHG5RFNDQG(O&DSLWDQ*XDGDOXSH 0RXQWDLQV s-XQH)LUVW3HRSOHVt5DUHVWHHOHQJUDYLQJVRI1DWLYH $PHULFDQVE\.DUO%RGPHUGXULQJKLVWUDYHOVWRWULEHVDORQJWKH0LVsouri. s-XO\+LOO&RXQWU\+RPHVWHDGVt/DQGVFDSH3DLQWLQJVRI)UHGHULFNVEXUJDUHD*HUPDQKRPHVWHDGVE\+DQN=DQH s$XJ3RUWUDLWVRI1RUWK$PHULFDQ,QGLDQ/LIHt+LVWRULF(GZDUG &XUWLV3KRWRJUDSKHUt:RUNVUHSUHVHQWLQJ:HVWHUQ1DWLYH$PHULcan tribes. s6HSW)XU7UDGH$UWLIDFWVIURP)RUW4XLDWHQRQt5DUHH[KLELWRI WK&HQWXU\)UHQFK%ULWLVKDQG0LDPL1DWLYH$PHULFDQWUDGHJRRGV from the fort and surrounding villages. Cowboy Bronze Fine Art Gallery :HVW0DLQ 830-997-2822 &RZER\%URQ]H)LQH$UW*DOOHU\QRZRIIHUVRQJRLQJSRWWHU\FODVVes with artist Bub Vickers. Vickersâ&#x20AC;&#x2122; pottery is featured in the gallery, and a showing of student work is planned in the near future. Visitors to the gallery can also see new bronze works in progress and watch as bronze sculptures are made. Western artists working in oils, pastels, acrylic, watercolors and pencil art are featured at the gallery, including Don Weller, Roger $UFKLEDOG0LFKDHO6ZHDULQJLQ3DXO.HWKOH\6KLUOH:HPSQHU.DUHQ &RRSHU*D\ORQ'LQJOHUDQG9LFNHUV-HZHOU\DUWLVW5H[)RVWHULVDOVR represented. Dan Pfeiffer Gallery 102 South Lincoln 'DQ3IHLIIHU*DOOHU\LVDFRQWHPSRUDU\DUWJDOOHU\WKDWLVORFDWHGLQ a venue that was once an 1890â&#x20AC;&#x2122;s butcher shop. 7KHJDOOHU\DLPVWRRQO\LQFOXGHqILQHDUWWKDWKDVDP\VWHU\WRLW WKDWZLOOLQYRNHIHHOLQJVrLQSDWURQV Eleven Squared Venue and Flying Frame Studio 408 North Llano  (OHYHQ6TXDUHG9HQXHDQG)O\LQJ)UDPH6WXGLRRIIHUVILQHDUWDQG FXVWRPIUDPLQJZLWKH[FOXVLYHGHVLJQVE\*ROG/HDI)UDPHUVRI6DQWD )H7KHVWDIIKDVILIWHHQ\HDUVRIPXVHXPDUFKLYDOIUDPLQJH[SHULHQFH and professional art installation. ,WLVDQDFFUHGLWHGPHPEHURIWKH,QWHUQDWLRQDO6RFLHW\RI$SSUDLVers, specializing in fine art and represents 11 artists that work in media from sculpture to oils, photography and mixed media. This venue provides art consultations, portfolio reviews, and collector advice for the art connoisseur and will broker art or find the perfect accent

$UWLVWV IURPOHIW %DUU\%UDGOH\6\O6KRHPDNHUDQG7RQL0DUVKDOOFKDW about their most recent pieces at Artisans â&#x20AC;&#x201D; A Texas Gallery during WKH PRQWKO\ )LUVW )ULGD\ $UW :DON )UHGHULFNVEXUJ HYHQW KRVWHG E\ GRZQWRZQDUWJDOOHULHVu6WDQGDUG5DGLR3RVWILOHSKRWR piece for a home. Fredericksburg Art Gallery (DVW0DLQ 830-990-2707 )UHGHULFNVEXUJ$UW*DOOHU\FDUULHVDUWE\QDWLRQDOO\FHOHEUDWHGDQG HPHUJLQJDUWLVWVIURP7H[DVDQGEH\RQG,QDGGLWLRQWRRULJLQDODUWwork, the gallery also carries a selection of ready-made frames and museum-quality custom picture framing. The gallery specializes in representational wildlife, western, still life, portraiture and landscape. The artists work in various mediums and styles from the realm of realism to the world of impressionism. Upcoming events include: s0DUFK$UWGHPRQVWUDWLRQPRQWK$UWLVWVJLYHIUHHGHPRQVWUDWLRQVHYHU\ZHHNHQGLQ0DUFK s$SULO:LOGIORZHUPRQWK0DQ\RIWKHDUWLVWVZLOOKDYHZLOGflower paintings for sale. s0D\&KXFNDQG%DUEDUD0DXOGLQq7H[D6FDSHVr7KLVKXVEDQG ZLIHWHDPERWKFUHDWHZRUNVRI+LOO&RXQWU\EHDXW\RQ0D\WKH 0DXOGLQVZLOOEHGRLQJSDLQWLQJGHPRQVWUDWLRQVIURPSP s-XQH'RQDOG'DUVWDQG&6 6WHYH 7DOOH\'DUVWSDLQWVLQD moody old world mastersâ&#x20AC;&#x2122; style in contrast to Talleyâ&#x20AC;&#x2122;s vibrant plein air landscapes. Darst and Talley will do a painting demonstrations 1-4 SPRQ-XQH s-XO\&OD\WRQ6DPPRQVDQG-R\FH&RPEV6KHFUHDWHVFRORUIXO abstract landscapes while he prefers thought provoking and whimsical paintings and drawings. s6HSW:RUNVRQSDSHU6HYHUDODUWLVWVpDUWRQSDSHUZLWKYDU\LQJ styles and subject matter is brought to life using water color, pen and ink, charcoal, pencil and pastels. ART WALK â&#x2013;ś 142


Community Ed offers classes for everyone From ceramics to tennis the Fredericksburg Independent School District’s Community Education program just might have the program you’re looking for. Among the classes offered to visitors and locals are oil painting, rug hooking, drill team preparations, country-and-western dancing, dog obedience, Zumba and yoga. Summer camp classes for kids have proven to be very popular. Among them: Rockets, art, cooking, theater, tennis, volleyball, football and Lonestar hoops. Community Education director Carol Reeh said community education is popular due to the variety of classes offered, ranging from computers to dance, sign language, crafts and more — and the reasonable prices. Brochures are available at the Fredericksburg Chamber of Commerce, Pioneer Memorial Library, local banks and RV parks. For more information, contact Reeh at 830-997-7182 or HPDLOKHUDWFDUROU#¿VGRUJ

Fredericksburg Independent School District’s Community Education summer art classes are a popular draw for kids. Adult classes are also offered for reasonable prices. Visitors can pick up brochures about the program at numerous locations throughout Fredericksburg. — Standard-Radio Post photo

Hill Country Bicycle Works 702 B East Main St. Fredericksburg, TX 78624 tel 830-990-2609 141 West Water St. Kerrville, TX 78028 tel 830-896-6864 Local route maps available ΎΎΎΎΎΎΎttt͘,/>>KhEdZz/z>͘KDΎΎΎΎΎΎΎ

^  Z s /    ͻ d Z /  d , > K E  '   Z




Tapping into a trend While the growth in wineries is booming, some here in Germantown still prefer beer or something stronger. Fredericksburg has two breweries, with a third under construction, and a nearby distillery, ripe for exploration by visitors who seek adult beverages.

BREWERIES Fredericksburg Brewing Company 830-997-1646 Fredericksburg Brewing Company was ahead of the curve in the boom in microbreweries. Opened in 1994, the brewery offers five excellent beers on tap, plus seasonal brews. Today, Fredericksburg Brewing Company is the oldest brewpub in Texas, also called the “Best in Texas” by several publications. The brewery claimed a gold medal at the 2008 Great American Beer Festival Competition, plus other medals in various competitions. The brewery, located at 245 E. Main St., sits in two restored 1890s-era buildings. In addition to its main room, the brewery has a large, air-conditioned biergarten. The second floor of the buildings provides “Bed & Brew” facilities, 12 rooms with baths, each decorated in a different theme. The brewery’s restaurant also features a variety of freshly prepared foods, from burgers, to pizza, to Scotch eggs, and more. Fredericksburg is one of the few towns in the nation that allows sidewalk consumption, so visitors may take a cold brew on a Main Street stroll. Pedernales Brewing Company 830-998-7486 Open since April 2012, Pedernales Brewing Company is growing rapidly as the popularity of its four in-house beers grows around the Hill Country and Central Texas regions. President Lee Hereford brought in brewmaster Peter McFarlane to produce its LOBO Texas Lager, LOBO Negro, Classic IPA and Classic Hefe-Weizen, plus seasonal offerings. Located on U.S. Highway 87 South, its suds can be found at many

Fredericksburg Brewing Company owner Dick Estenson and Brewmaster Rick Green were long established by the time the microbrew boom came to pass. – StandardRadio Post photo local outlets, including Judy’s Liquors, Western Beverages, H-E-B, JEK’s convenience stores, and more. Its distribution now covers 15 counties and its representatives are adding retail sales locations daily. Additionally, the brewery’s tasting room is open from 3-5 p.m. Fridays, and 1-5 p.m. Saturdays. On the first Saturday of every month, Pedernales Brewing Company stays open from 5-6 p.m. for Beer and Hymns. Beer and Hymns is an informal and nondenominational gettogether that is free to the public. Singers gather in the brewing room and sing hymns with a music leader. BOURBON DISTILLERY Garrison Brothers Distillery 830-392-0246 Garrison Brothers offers fine bourbon made the old-fashioned way, a time-consuming process, but one that results in a smooth sip of hand-made, artisan bourbon. Garrison Brothers offers $10 “Sit & Sip” tours on Wednesdays through Sundays at 10 a.m., noon, 2 p.m. and 4 p.m. The tour is a guided walk of the ranch and distillery with detailed information about the whiskey and the operation’s history. (First-come, firstserve, and large groups must be arranged in advance. No children or smoking are allowed.) Garrison Brothers’ Cowboy Bourbon was named American Micro Whiskey of the Year by “Jim Murray’s Whiskey Bible.” The distillery is located just east of the Gillespie County line on Hye-Albert Road, just south of the tiny community of Hye. The bourbon is available at various retailers around the state, at Hye Spirits in Hye, and a variety of items are for sale on its website.

Barons The Romantic



Home of the “Cabelas” photo shoots

15 cabins on 26 acres just two minutes to Main Street along the creek.



Bluesic - Wine - Bistro The Locals’ Place Thur - Sat 5 - 10+pm Þ³ØÚ¬v•£J¨¨Ú¨ÀÚÚÚÐvlvИbžÓXåЍiÚ7CÚÚaÚÚ{Þô—©©ã—Þ‹ã³


Higher education helps transform Hill Country

Hill Country University Center (HCUC) serves the 200,000 residents of Central Texas, from Junction to Brady and Burnet to Blanco. HCUC, located at Fredericksburgâ&#x20AC;&#x2122;s eastern city limits, houses Texas Tech Universityâ&#x20AC;&#x2122;s (TTU) regional campus and is a branch of Central Texas College (CTC). The 24,000-square-foot facility is comprised of seven classURRPVRIÂżFHVDVFLHQFHODEVWXGHQWORXQJHFRPSXWHUOLEUDU\ and the H-E-B Community Room (for larger gatherings) on 69 acres. Eyeing this growing market, directors are looking toward professional development to help meet the areaâ&#x20AC;&#x2122;s workforce needs. TTU-Fredericksburg is leading the way in the study of winePDNLQJZLWKYLWLFXOWXUHDQGHQRORJ\FHUWLÂżFDWHDQGDFDGHPLFSURgrams. The center also offers a variety of bachelor and master level FRXUVHVLQJHQHUDOVWXGLHVHGXFDWLRQVXSHULQWHQGHQWFHUWLÂżFDWLRQ multidisciplinary science, agriculture and educational leadership, as well as bachelorâ&#x20AC;&#x2122;s degrees in several programs. CTC-Fredericksburg branch offers a variety of core curriculum courses in a face-to-face setting. Their focus is on helping students achieve skills training and on programs catered to the needs of the local market. The college based out of Killeen, offers PRUHWKDQDVVRFLDWHVÂśGHJUHHVDQGFHUWLÂżFDWHVWKURXJKDFRPbination of face-to-face and online classes.

Â&#x2021;FURNITURE Â&#x2021;)5$0(6 Â&#x2021;ART

Hill Country University Center houses seven classrooms, 10 offices, a science lab, student lounge, computer library and the H-E-B Community Room (for larger gatherings). Parts of HCUC are available for rent and public events. The facility is owned by the Texas Hill Country University Center Foundation.

HILL COUNTRY UNIVERSITY CENTER is housed in a 24,000-square-foot facility, located on 68 acres. The building opened in 2010. 2818 U.S. Highway 290 East, Fredericksburg, TX 78624 Phone: 830-990-2717; Email: Web:

Quality Thatâ&#x20AC;&#x2122;s Guaranteed!

Â&#x2021;-(:(/5< Â&#x2021;:$7&+(6 Â&#x2021;0(1¡6,7(06 Â&#x2021;$17,48(6 Â&#x2021;COLLECTIBLES


Â&#x2021;'(&25$7,9(  6($621$/,7(06 Â&#x2021;1$0(%5$1'


&/27+,1* SHOP WITH US:


Resale Shop


because every animal matte


We have the best selection of window coverings and fabric samples for your home dĂŠcor needs! In our convenient showroom, we offer a friendly, no-pressure environment to view our samples, try our remote window coverings and receive expert advice on the best solution for you and your home!

blinds - shades - shutters drapery - interior or exterior


In-home Consultations!

Call us today!


407 Junction Hwy Kerrville, TX 78028



Hours: F & SAT 9-6 FRI SUN 10-5

8636 HWY 290 90 E ½ mile past Wildseed seed Farms

OPEN EVERY FRI., SAT. & SUN. BEST PRICES and DEALS in the HILL COUNTRY! Acres of Yard Art and over 20,000 square feet of Antiques and Collectibles

H NEW INVENTORY WEEKLY H While on Main Street, be sure to drive out to Hill Country Trading Post, and shop from over an acre of the largest pottery, iron and yard art selection around! Treasure hunters can also search through over 20,000 square feet of antiques, art, collectibles, furniture, glassware, jewelry, knives, and much more in the Red, White & Blue buildings.



Inwood Estates Winery & Bistro since 1981


Red Baron H Antique Mall

:0DLQq)UHGHULFNVEXUJ7;  Fredericksburgâ&#x20AC;&#x2122;s largest antique mall with 10,000 sq. feet.

h4OP7INERIESIN!MERICAv -The Daily Meal, NY, July â&#x20AC;&#x2DC;15

Specializing in Boutique Handcrafted Wines


~Served in Texasâ&#x20AC;&#x2122; Top Restaurants~ TEXASâ&#x20AC;&#x2122; Most PREMIUM Wine Experience With

TEXASâ&#x20AC;&#x2122; FINEST WINES THE RESERVE TASTING ROOM Educational Tastings Taste FREE with 3-Bottle Purchase

Featuring F i more than h 50 off T Texasâ&#x20AC;&#x2122;â&#x20AC;&#x2122; bbest antique i dealers, Red Baron Antique Mall carries furniture, glassware, chandeliers, electric lamps, oil lamps and lamp parts, jewelry, china, pottery, primitives, western, nautical, architectural, toys and much more. We have dealers coming in on a daily basis to add to their booths to offer you the best selection of merchandise possible.


Private Tastings with the Winemaker Dan Gatlin Up Close & Personal Interaction with One of the Industryâ&#x20AC;&#x2122;s Founders Offering â&#x20AC;&#x153;Super Flightsâ&#x20AC;? comparing Inwoodâ&#x20AC;&#x2122;s Finest vintages to famous International Wines Over $200/bottle

Our convenient location is just blocks from downtown, and has plenty of parking. Our friendly staff will do everything possible to make your shopping experience a pleasant one.


Fun, Food and Wine, Meat and Cheese Boards, â&#x20AC;&#x153;Smokehouseâ&#x20AC;? Boards, BBQ Sliders, Famous Slowed Smoked Brisket, and Baby Back Ribs Catering and Group Events Welcomed

Ask About . . . The Exclusive INWOOD CLUB WINE GUILD

53(WY%AST (9 Miles East of Fredericksburg)

  sWWW)NWOOD7INESCOM Follow Us Online


Open O pen 7 D Days a a Week 10-5 Sunday thru Friday and 10-6 on Saturday



Spooled up and ready to go Gillespie County Airport hosts a variety of aircraft GILLESPIE COUNTY AIRPORT (830) 990-5794 191 Airport Road Fredericksburg, TX 78624 FAA Identifier: T82

Youth have the opportunity to sit in aircraft and visit with pilots at fly-ins and other events held at the Gillespie County Airport. â&#x20AC;&#x201D; Standard-Radio Post files photo

For years, the Gillespie County Airport has been a key component to the growth and success of the area in attracting residents and new businesses. Corporate jets, single engine aircraft and pilots of a variety of other types of aircraft are all accommodated at the facility, located at 191 Airport Road, just three miles south of downtown Fredericksburg on Texas Highway 16. (The facility sits between the Gillespie County Fair Grounds and Lady Bird Johnson Municipal Park.) Classed as a general aviation airport, it features a 5,000foot runway and full-length parallel taxiway and has runway lights and a beacon that operate from sunset to sunrise, giving the airport a 24-hours-a-day, seven-days-a-week, operational capability. During daylight hours of limited visibility, the lights can be turned on by the approaching pilot. Instrument approaches are available to both ends of the runway, and precision approach path indicators provide pi-

lots with visual assistance during night landing operations. A fully-automated weather system (AWOS) informs pilots about local conditions. The airportâ&#x20AC;&#x2122;s terminal building provides a comfortable environment for pilots, crew and passengers waiting on aircraft. An additional convenience is available with the credit cardoperated refueling system that provides aviation gasoline (100LL) and jet fuel 24 hours a day. Airport manager Roger Hansen can provide information on two 12,000-square-foot insulated hangars which have 52 tie-down positions for public use (with more in the works). Long-term T-hangar spaces are available through three different entities. There are also 1.5 acres dedicated for aircraft parking. The adjacent Hangar Hotel and Conference Center boasts XSVFDOHJXHVWURRPVDQRIÂżFHUÂśVFOXEPHHWLQJIDFLOLWLHV for large groups and a classic 1940s-style diner, unique facilities at a non-metropolitan airport. Businesses at the airport include the Pippen-York Flying Machine Company, which provides avionics installation and repair; Fritz Aviation, which provides major and minor airframe and engine repair and aircraft rental, and Gillespie Air Services which provides fuel service. The Gillespie County Airport also features the FredericksEXUJ)%2DIXOOVHUYLFHÂż[HGEDVHGRSHUDWRUWKDWSURYLGHV information and service to pilots and crews. Ground transportation options include rental cars from The Motor Pool or Enterprise at Fredericksburg FBO.




mobile app at the App Store or Google Play


â&#x20AC;&#x2DC;Iâ&#x20AC;&#x2122;m walking,â&#x20AC;&#x2122; â&#x20AC;&#x201D; Yes, indeed

Whatever the season, any time is a good time for a walk through the Texas Hill Country. The local walking club â&#x20AC;&#x201D; Volkssportverein Friedrichsburg (VVF) â&#x20AC;&#x201D; has established six self-paced, year-round routes for walkers to enjoy. All six walks have been developed between 5K (3.1 miles) and 10K (6.2 miles) distances although it is possible to shorten the distances unless walking for credit. In addition to the four normally-designated routes inside the city limits, the club has also plotted out routes at the Lyndon B. Johnson State Park and Historic Site in Stonewall and at the Enchanted Rock State Natural Area. These walks are sanctioned by the American Volkssport Association as Year-Round Walks. Check-in for the in-town walks is at Windcrest Inn and Suites, 908 South Adams Street. The two rural walks both have starting points inside park visitor centers. At each location, participants should ask the personnel for the Walk Box from which they can obtain maps of the selfguided walks as well as other items needed if walking for credit. The start of the walk itself may involve a drive to a different location. It was noted that the walks can only be done during daylight hours.


Fredericksburg Walks The four city walks include: Â&#x2021;$9$3LOJULPDJHâ&#x20AC;&#x201D; This walk is a self-guided tour of the Historical District and honors the heritage of Volkssporting in America, which began here in June of 1976. The 10K walk begins at Windcrest Inn and Suites and the 5K walk begins in the parking lot at HEB. Â&#x2021;&HPHWHU\:DONâ&#x20AC;&#x201D; Participants taking this route will start at Marktplatz and will walk through two historical cemeteries in Fredericksburg. One location â&#x20AC;&#x201D; Der Stadt Friedhof â&#x20AC;&#x201D; was established in 1846 when the town was founded, and the other â&#x20AC;&#x201D; the Catholic Cemetery â&#x20AC;&#x201D; was established in 1850. The route continues on tree-lined streets on the north side of town. Â&#x2021;7RZQ&RXQWU\:DON â&#x20AC;&#x201D; Outdoor enthusiasts who take this route will walk through the outskirts of Fredericksburg

on the way to catching a scenic look of the town from atop a nearby hill. Â&#x2021;&URVV0RXQWDLQ:DON â&#x20AC;&#x201D; The beginning location for this trek is Cross Mountain. At the top participants receive a 360-degree view of Fredericksburg and the surrounding countryside. The 10K walk also goes to a pioneer cemetery. LBJ State Park The route at LBJ State Park and Historic Site will take walkers to the Sauer-Beckmann Living History Farm where life in the rural areas of the early-1900s is shown daily by living history demonstrations. The route also takes walkers along Ranch Road 1 and the banks of the Pedernales River. A new 10K trail crosses the Pedernales River to the LBJ National Historical Park and the Texas White House. Most of the trail runes along the river.

ry Antique T t n ou as Engine Club rac C G Preserving , In t ill ndAgriculture Heritage c. or a

For The Future


Antique Tractors, Gas Engines, Wheat Threshing, Tractor Pulls, Static Displays, Baling Demonstrations, Working Blacksmith, Childrenâ&#x20AC;&#x2122;s Activities and much more. Sponsor of Texas Bluebonnet Tractor Ride - April 9, 2016 31st Annual Heritage Show - June 11, 2016 Gillespie County Fair Grounds Gillespie County Fair, August 25-28, 2016


830-990-8551 or 830-889-9348

for information

Marty Vaughn Â&#x2021;

127 Enchanted Rock A new 10K trail crosses the Pedernales The route at EnAll Walks River to the LBJ Nachanted Rock State For all walks, people desiring credit from AVA will pay $3; all Natural Area, located tional Historical Park others may walk for free, although donations to help with printing 18 miles north of and the Texas White expenses are appreciated. Fredericksburg on House. Also, all participants are required to register, carry a start card Most of the trail runs Ranch Road 965, will and return the card to the start point. along the river. give hikers a variety Anyone may participate, although children under the age of 12 of routes, including a The park has initimust be accompanied by an adult. more-rigorous option ated a new walking Pets are welcome, must be kept on a leash and are not allowed of walking up Enand biking trails in the buildings. chanted Rock itself. project, which will be These events may be done during daylight hours only. Dominating the incorporated into new For a brochure on any of the events, write VVF, P.O. Box 503, Volksmarch routes as park is a large pink Fredericksburg, TX 78624. granite exfoliation appropriate. The VVF website is dome that rises 425 LBJ State Park and feet above ground Historic Site is located and 1,825 feet above in Stonewall, 15 miles east of Fredericksburg on U.S. Highway 290. sea level. While the park operates year-round, the facilities are open *DWHVRSHQDWDPDQGWKHRIÂżFHRSHQVDWDP The entry fee to the park is $7 per persons 12 and older. from 8 a.m. to 5 p.m., closed only on Thanksgiving, ChristTexas State Parks Pass holders get in free. mas Day and New Yearâ&#x20AC;&#x2122;s Day.

F>;5<D4;;4A´B 1>>:B TWO FLOORS

30,000 BOOKS

Used & Rare Books, Lots Of Signed Copies, Texana, History, Art, Plants, Birds, Cookbooks, Fiction & More

Slaughter Design Studio, LLC 150 East Main Street, Suite 301 Fredericksburg, Texas 78624 OfďŹ ce: 830.307.3397




&"3-("33&55453&&5t M-SA 9AM-5PM 830-257-7323

Get your GoFred t-shirtt today!

Now in 8 Different Colors! rss!

ONLY $12

Now in Billie Red!

Plus ship ping

At the Fredericksburg Standard Office.

712 W Main St.


Three entities promote one vision Visitors Center, Economic Development and Chamber have Fredericksburg covered

If you need information about Fredericksburg’s many attractions, head by the Fredericksburg Visitor Information Center, which has a plethora of information on local attractions at 302 East Austin Street. The building currently houses the Fredericksburg Convention and Visitor Bureau and the Gillespie County Economic Development Commission. The Fredericksburg Chamber of Commerce is located next door at 306 E. Austin St. This became the Chamber’s home after the recent remodel of a historic home and conversion into an open, inviting business space. The Visitor Center is located one block north of Main Street DFURVVWKHVWUHHWIURPWKH1DWLRQDO0XVHXPRIWKH3DFL¿F War. The site offers free parking for vehicles, including RVs and buses. The Fredericksburg Convention and Visitor Bureau is a marketing, sales and service organization, funded by a portion of the city’s and county’s hotel/motel occupancy tax. FCVB promotes Fredericksburg and Gillespie County as a leisure destination for group tours, reunions, weddings and meeting site. The FCVB staffs and operates the Visitor Information Center, which is open to assist visitors every day except Easter, Thanksgiving, Christmas and New Year’s Day. In the center, visitors can watch a free, 10-minute video in

The inside of the Visitors Center is open Monday thourgh Friday 8:30 a.m.-5 p.m.; Sat., 9 a.m.-5 p.m. and Sun., 11 a.m.-3 p.m. — Standard-Radio Post file photo

the building’s 48-seat theater. Visitors also can gather information on potential activities,


official know-it-alls one block off Main Street | knowledgeable & friendly staff | area brochures | clean restrooms ample parking | complimentary Internet | short informational video in theater | open 7 days a week

Ad a


Visitor Information Center 302 East Austin Street Open 7 days a week Mon–Fri 8:30AM–5PM Sat 9AM–5PM Sun 11AM–3PM


St .

Downtown Fredericksburg


An to ni o

Wa s

Sa n

Lin co ln

16 | 866 997 3600


gt on



Visitor Information Center & Parking

Au s






129 accommodations and businesses of interest through brochures and other literature in the lobby area, including info on walking tours, historic sites, an events calendar, city and county maps and driving trail maps. Additionally, public restrooms are provided. The Fredericksburg Chamber of Commerce works on business education, advocacy, communication and business-to-business assistance. Catering to more than 850 members — an incredible amount for a town of 11,000 — the Chamber works to create a positive business environment. Its staff coordinates events, volunteers and highlights accomplishments at its annual March banquet.

Fredericksburg Convention and Visitor Bureau 302 E. Austin St. Fredericksburg, TX 78624 Phone: 830-997-6523 Email: Web: www.visitfredericksburgtx. com

Chamber President and CEO Penny C. McBride writes a column in the Fredericksburg Standard-Radio Post each week. Tim Lehmberg is executive director of the Gillespie County Economic Development Commission. He NHHSVKLV¿QJHURQWKHHFRQRPLFSXOVH*LOOHVSLH&RXQW\DQG helps recruit and ease the transition for new businesses who are right for the market to locate here. 7KH*&('&LVDFROODERUDWLYHSDUWQHUVKLSEHWZHHQWKHFLW\ and county and its mission is to encourage, enhance and promote managed economic development throughout the FRXQW\7KH*&('&LVJRYHUQHGE\DERDUGRIGLUHFWRUVZLWK nine voting members.

Fredericksburg Chamber of Commerce at right 306 E. Austin St. Phone: 830-997-5000 Email: Gillespie County Economic Development Commission Phone: 830-997-6523 Email:

ONE OF A KIND FINE THINGS Original ArtoAntiques JewelryoCabinets Farm TablesoLighting CrystaloCut GlassoRugs Designer Furnishings in Consignment & Much More



Deep roots in Gillespie County keep HCM at top of their game Hill Country Memorial is not only one of the nationâ&#x20AC;&#x2122;s top rural hospitals. It is one of the top hospitals in the nation by any measure. Hill Country Memorialâ&#x20AC;&#x2122;s strength stems from deep roots in Fredericksburg and Gillespie County, and it has come to be recognized for quality by medical professionals and patients from around the nation. $VDQRQSURÂżWQRQWD[VXSSRUWHGKRVSLWDO+&0FRQWLQ ues to draw on local support through the HCMH Foundation. With the generous support of donors, the foundation KDVIXQGHGWKH&DUGLDF5HKDE3URJUDPDFRPPXQLW\ÂżW QHVVWUDLODQLQGRRUÂżWQHVVDQGWKHUDS\SRROWKH:RPHQÂśV Pavilion, the Cancer Resource Center, ICU equipment and furnishings, a 3D digital mammography unit, angiography equipment, private patient rooms, a CT scanner, and other OLIHVDYLQJLPSURYHPHQWV 7KHKRVSLWDOLVQRZDQOLFHQVHGEHGIDFLOLW\DQGKDVD VWDWHRIWKHDUW,&8DQGVXUJLFDOGHSDUWPHQW Today, HCMâ&#x20AC;&#x2122;s 650 employees and 200 volunteers share the hospitalâ&#x20AC;&#x2122;s vision to â&#x20AC;&#x153;Empower Others. Create Healthy.â&#x20AC;?

Women & Childrenâ&#x20AC;&#x2122;s Boutique

Visit or call 830-997-4353 for more information. The hospital is located at 1020 S. State Highway 16 in Fredeicksburg. â&#x20AC;&#x201D; Standard-Radio Post file photo HOSPITAL â&#x2013;ś 132

Have A Splash!

Custom Purses & Bags Artisan Jewelry Kitchen Collection

Water Park Open: March 19-May 31: Weekends Only

Cherokee Charm

June 1: Open Daily

A Collection of Shops

Lap Pool: Open Daily

Metal Art & Gifts Candy & Pecans 215 W. Main St. 830-992-2100 @GoFred1

201 Holdsworth Dr., Kerrville 830-315-5762

132 HOSPITAL Cont. from 130

Prevention insurances are acand wellness cepted. As the most compreThe Go Clinic is KHQVLYHÂżWQHVVFHQWHULQ open from 11 a.m. to Fredericksburg, the HCM 8 p.m. Wellness Center focuses on a holistic approach to Community healthy living. Community is the It provides a range of purpose and cornerÂżWQHVVHTXLSPHQWJURXS stone of Hill Country ÂżWQHVVFODVVHVSHUVRQDO Memorial. training, an indoor heatFrom the hospital ed pool, a therapy pool, in Fredericksburg PDVVDJHWKHUDS\ÂżWQHVV to medical clinics in camps for kids and more. Boerne, Kerrville and Daily, weekly and anMarble Falls, HCM nual memberships are is able to continue its The seven-day-a-week urgent care Go Clinic is located at 1031 S. State Highavailable to anyone. mission of remarkable way 16 in Fredericksburg. â&#x20AC;&#x201D; Standard-Radio Post file photo Patients can also use health care by comthese facilities to restore mitting every day to IXQFWLRQDQGZRUNWKHLUZD\EDFNWRÂżWQHVVDQGDFWLYLW\DIWHU this community. surgery. $VSURRIRIWKLVFRPPLWPHQW+&0ZDVWKHÂżUVWKRVSLWDO HCM also offers free heart screenings and orthopedic LQWKH8QLWHG6WDWHVWRRIIHUDÂżYHVWDU5DWLQJVDQG5HYLHZV evaluations for teenagers and other screenings for adults system for patients and families to give â&#x20AC;&#x153;real timeâ&#x20AC;? feedback throughout the year. on their experiences with the hospital. Such engagement drives continual improvements across the organization and ER, follow-up, Go Clinic is available for viewing at The hospitalâ&#x20AC;&#x2122;s 24-hour Emergency Department handles more than 1,000 admissions per month. Diagnostics The hospital treats approximately 70,000 outpatient reg7KHÂżUVWVWHSLQGHOLYHULQJKHDOWKFDUHLVSURSHUDQGWLPHO\ LVWUDWLRQVDQQXDOO\DQGWKHÂżYHVXLWHVXUJHU\GHSDUWPHQW diagnosis. handles more than 4,000 surgery cases a year. HCMâ&#x20AC;&#x2122;s modern imaging department offers heart cathAcute care is complemented by HCMâ&#x20AC;&#x2122;s post-discharge care HWHUL]DWLRQV05,V&7VFDQVZKROHERG\LPDJLQJQXFOHDU that helps patients who are at high-risk for readmission tranmedicine and interventional radiology, all with the lowest sition from the hospital to home. radiation dose in mind. Aftercare can also include multi-faceted rehabilitation 7KH+&0%UHDVW&HQWHULVHTXLSSHGZLWKDQXOWUDVRXQG programs and hospital-owned home care and hospice care. room and a leading edge 3D digital mammography unit that Beyond the hospitalâ&#x20AC;&#x2122;s walls care continues. RIIHUDIDVWHUH[DPDQGVXSHULRULPDJHTXDOLW\RYHUWKDWRI In 2015, HCM opened its seven-day-a-week urgent care ÂżOPEDVHGWHFKQRORJ\ â&#x20AC;&#x153;Go Clinicâ&#x20AC;? across from the hospital at 1031 State Highway HCM also uses multi-disciplinary medical conferencing, 6RXWKIRUQRQHPHUJHQWFDUHRIFROGVĂ&#x20AC;XVSUDLQVQDXVHD bringing together surgeons, pathologists, radiologists, onstings, minor injuries and more. cologists, nurses and technologists to review test results and Walk-ins are welcome, and Medicare, Medicaid and most coordinate treatment options. HOSPITAL â&#x2013;ś 136


ZION LUTHERAN CHURCH 426 West Main Streetâ&#x20AC;&#x201D; 

â&#x20AC;&#x153;We Share the Joy, We Worship, Love & Serveâ&#x20AC;? 


Historical Zion Since 1852


Your one-stop shopping grocery store and a fuel stop for gas & diesel! 23682 W. US Hwy 290 Harper, Tx 830-864-4040





of Fredericksburg 9th Biennial Quilt Show

Take My Breath Away September 2-3, 2016 Friday, Sept 2, 9am - 6pm Saturday, Sept 3, 9am - 4pm

Location: Fredericksburg United Methodist Church 1800 N. Llano (Hwy 16 N) Fredericksburg, Texas

Featuring: Bed Turning - Tea Room ^ŝůĞŶƚƵĐƟŽŶͲŽƵƟƋƵĞ Quilt Appraisals (contact us for an appointment) Vendors (including scissor sharpening)

sY'ϮϬϭϲŽŶĂƟŽŶYƵŝůƚ͞DŽƌĞŝƐDŽƌĞ͟ Tickets Available (Appraisal replacement value for insurance purposes, $37,500)



Emergency numbers Fine Fashion 6XSHULRU6WDÉą Memorable Shopping

When an emergency arises, the most important telephone number to call is 9-1-1. However, there are times when people just need information of a non-emergency nature from the Gillespie County 6KHULIIÂśV2IÂżFHWKH)UHGHULFNVEXUJ3ROLFH'HSDUWPHQW RWKHUODZHQIRUFHPHQWDJHQFLHVRUDQ\RIWKHYROXQWHHUÂżUH departments. Listed below are the non-emergency phone numbers for the various agencies in the county. Volunteer Fire Departments/EMS sDoss â&#x20AC;&#x201D; 830-669-2220 sFredericksburg â&#x20AC;&#x201D; 830-990-2050 sFredericksburg EMS â&#x20AC;&#x201D; 830-990-2055 sHarper VFD, EMS â&#x20AC;&#x201D; 830-864-4253 sStonewall â&#x20AC;&#x201D; 830-644-5571 sTierra Linda â&#x20AC;&#x201D; 830-792-3533 s Willow City â&#x20AC;&#x201D; 830-685-3376 Law Enforcement Non-emergency numbers for the various departments include the following: sFredericksburg Police Department â&#x20AC;&#x201D; 830-997-7585 sGillespie County Sheriffâ&#x20AC;&#x2122;s Office â&#x20AC;&#x201D; 830-997-7585 or 800735-0362 sGillespie County Constables â&#x20AC;&#x201D; 830-997-7585 sTexas Cattle Rangers â&#x20AC;&#x201D; 830-997-7585 sTexas Parks and Wildlife Department Game Wardensâ&#x20AC;&#x2122; Office â&#x20AC;&#x201D; 830-997-7585, 210-287-3905 or 210-215-5367 Hospital sHill Country Memorial â&#x20AC;&#x201D; 830-997-4353. (Note: When requiring emergency ambulance service, dial 9-1-1 rather than the business number.)

On your mark, Get Set,


See Fredericksburgâ&#x20AC;&#x2122;s

top spots

for shopping, sight-seeing, dining, drinking and more! What to DO What to EAT What to DRINK Where to STAY Where to SHOP

115 East Main ¡ 830 997 3761

Download at

Search for â&#x20AC;&#x153;GoFredâ&#x20AC;?


136 HOSPITAL Innovative programs HCM has earned a national reputation for innovative treatment programs such as Restore. Restore â&#x20AC;&#x201D; The Remarkable Joint Center uses easy-to-understand preoperative classes that inform patients about their surgery and recovery process. A personalized recovery regimen gets patients back in action sooner, safer and sounder. These distinctions and excellent clinical outcomes earned 5HVWRUHD-RLQW&RPPLVVLRQ&HUWLÂżFDWLRQ$ZDUGDQGUHFRJQLtion as a top 100 Destination for Total Joint Replacement in the US. 0RGHOHGDIWHU5HVWRUH+&0ÂśV5HQHZSURJUDPIRUFRORQ surgery includes pre-operative patient education, minimally invasive approaches and dedicated nurses, all aimed at returning patients to normal eating and activity faster. Health education +&0UHFRJQL]HVWKDWKHDOWKDQGZHOOQHVVEHJLQZLWKHGXFDtion. To that end, its physicians and staff offer regular education programs to help the community understand medical issues and outcomes. Throughout the year, HCM hosts â&#x20AC;&#x153;Healthy Youâ&#x20AC;? educational events across the Hill Country featuring relevant medical topLFVVXFKDVMRLQWUHSODFHPHQWZRPHQÂśVKHDOWKVOHHSGLVRUGHUV the importance of colonoscopies, vascular health and more. Additionally, HCM offers nutritional counseling, classes for H[SHFWDQWSDUHQWV&35DQGÂżUVWDLGFODVVHVGLDEHWHVVHPLQDUV and more.

Cont. from 132

Awards +LOO&RXQWU\0HPRULDOZDVUHFRJQL]HGLQ DQGE\7UXYHQ+HDOWK$QDO\WLFVDVRQHRIWKHQDWLRQÂśV7RS 100 Hospitals. This accolade is based on outcomes in 10 categories ranging from patient safety and satisfaction to adherence to medical and clinical standards. ,Q+&0UHFHLYHGWKH0DOFROP%DOGULJH1DWLRQDO4XDOLW\$ZDUGDSUHVLGHQWLDODZDUGUHFRJQL]LQJWKHKRVSLWDOÂśVIRFXV on leadership, strategic planning and customer satisfaction. And, HCM continues to outperform other Texas hospitals in value-based purchasing, a ranking that highlights quality health care performance. )URP+&0ÂśVREVWHWULFVGHSDUWPHQWUHFHLYHGWKH :RPHQÂśV&KRLFH$ZDUGDQDZDUGWKDWIRFXVHVRQIHPDOHSDtient satisfaction, physician communication, and staff responsiveness.

We are worth the drive!

Joseph M. Cohn, M.D.

Specializing In:

Agility Orthopaedic & Sports Medicine

â&#x20AC;&#x153;Homemade Mexican Foodâ&#x20AC;? Family Dining Since 1968

â&#x20AC;&#x153;Because Life Requires Motionâ&#x20AC;?

HOURS: HOU URS: We WednesdayWednesday Wednesday-Thursday-Friday ayy-Thursday hursday-Friday ayy-F Fri riday ay ~ 4-9 p.m p.m.. Saturday, Sat atu turday ay, y, 11 a.m.-2 p.m.; 4-9 p.m. p.m. 12 Miles Out Hwy 290 West 830-669-2406 NO CREDIT CARDS ACCEPTED Serving Fredericksburg, Brady & Kerrville

ÂŁĂ&#x17D;äxĂ&#x160; Â&#x153;Ă&#x20AC;Ă&#x152;Â&#x2026;Ă&#x160;Â&#x2C6;Â?>Â&#x201C;Ă&#x160;UĂ&#x160;Ă&#x20AC;i`iĂ&#x20AC;Â&#x2C6;VÂ&#x17D;Ă&#x192;LĂ&#x2022;Ă&#x20AC;} 830-266-5576

MarktPlatz PCAA Concert Series 2016 MarktPlatz PCAA Concerts

OfďŹ ce Hours: Monday - Thursday 8:30am to 5pm Closed daily from 12 to 1 for lunch

Ă&#x20AC;Â&#x2C6;`>Ă&#x17E;Ă&#x160;n\ää>Â&#x201C;Ă&#x160;Ă&#x152;Â&#x153;Ă&#x160;ÂŁĂ&#x201C;ÂŤÂ&#x201C; ofďŹ

ic! A Picn Bring e r a s rt Conce EE FR

May 1 | FHS Jazz Ensemble May 22 | Weldon Henson June 26 | The Sophisticates July 24 | Copa Kings August 14 | Almost Patsy Cline Band September 11 | Off The Grid

6:30 - 8:00 | Adelsverein Halle | MarktPlatz | 100 W. Main Pedernales Creative Arts Alliance sponsors of Oktoberfest


Library satisfies countyâ&#x20AC;&#x2122;s information, literary needs Pioneer Memorial Library offers many â&#x20AC;&#x153;escapesâ&#x20AC;? for those who want to relax and read. Located at 115 West Main Street, the library is in the former Gillespie County Courthouse (known as the McDermott Building), adjacent to the current courthouse. It welcomes patrons to read, research and learn from thousands of book and periodical titles, as well as some up-todate technological services. Library services Borrowersâ&#x20AC;&#x2122; cards are issued free of charge to residents of Gillespie County who can provide proof of residency (usually a driverâ&#x20AC;&#x2122;s license, lease agreement or printed checks with local address.) Children age six and above will be issued a card when their applications are signed by a parent or guardian. All non-residents of Gillespie County are charged a $5 per year fee for a family library membership. Books may be checked out for two weeks and if not requested by another reader, may be renewed for an additional LIBRARY â&#x2013;ś 140 two weeks only.

DVD rentals are available at the Pioneer Memorial Library, as are books. For others, the library offers the solitude needed to study and a copy machine and microfilm reader-printer. â&#x20AC;&#x201D; Standard-Radio Post file photo


Fredericksburg Visitors


Established 1923

Conveniently Located In Downtown Fredericksburg (DVW0DLQÂ&#x2021; GRROH\V#DXVWLQUUFRP @GoFred1


Weâ&#x20AC;&#x2122;re Open Every DayÂ&#x2021;Best Food On The Llano River

Â&#x2021;Only 30 minutes from FBG

Burgers - Fri at Noon & Evenings; Sat Evenings Only BBQ - Every Saturday at Noon Steaks - Choice Top Ribeyes Every Sunday at Noon Featured in Texas Highways magazine and the Houston Chronicle

Mason 29


377 87

Castell Castell 152











140 LIBRARY Cont. from 138



Peterson Real-Fyre Gas Logs

XL Primo Oval Grill

featuring grills for all your cooking needs...

Linear Fireplace

...and seasonings by John Henry Food Products and Fredericksburg Farms

AOG T-Series Grill

Holland Grill

Phoenix Grill

142 ART WALK Fredericksburg Art Guild 308 East Austin 830-997-4949

Founded over 40 years ago, the Fredericksburg Art Guildâ&#x20AC;&#x2122;s purpose is to encourage, promote, educate and cultivate the arts throughout the Texas Hill Country. There are 26 members and nine associate members who reflect varying styles and media. The guild is open from 10 a.m. to 4 p.m. Thursday through Monday with special hours for First Friday Art Walk. Upcoming exhibits include the following: s$SULO0D\q+LOO&RXQWU\3DVVLRQr7KLVLVDQDOOPHPEHU show of new work with a featured artist. s0D\q(DUWKO\'HOLJKWVr7KHDQQXDOMXULHGVKRZRSHQWR all artists 18 years and older. s-XQH-XO\q7KH/RQJ+RW6XPPHUr$OOPHPEHUVKRZRI QHZZRUNZLWKIHDWXUHGDUWLVWVIRU-XQHDQG-XO\ s$XJ2FWq'LIIHUHQW6WURNHVr$OOPHPEHUVKRZRIQHZ work with featured artists. s$XJ9LVLWZLWKWKHJXLOGDWWKH*LOOHVSLH&RXQW\)DLU s6HSW2FW7KHJXLOGZLOOEHDW2NWREHUIHVW The Gallery at Vaudeville 230 E. Main 830-992-3234 7KH*DOOHU\DW9DXGHYLOOHLVDYHQXHIRUFRQWHPSRUDU\DUWDQG the primary goal is to showcase and sell conceptually based work that engages contemporary issues and is culturally relevant, ex-

Cont. from 118 plained a gallery spokesman. The gallery specializes in representing artists who are currently OLYLQJLQ7H[DVDQGZKRVHZRUNLVqLQWHOOHFWXDOO\HQJDJLQJDQG aesthetically pleasing through its maturity in craft and execution of PDWHULDOVr 8SFRPLQJH[KLELWVLQFOXGHWKHZRUNVRI$ELGHPL2ORZRQLUD Echoes in Fragment, March 4-May 2. 2WKHUDUWLVWVZKRKDYHEHHQIHDWXUHGDW9DXGHYLOOH*DOOHU\DUH %HYHUO\3HQQ5RGROIR&KRSHUHQD6\GQH\<HDJHU$QQHWWH/DZUHQFH0DUJR6DZ\HUDQG0F.D\2WWR  InSight Gallery 214 West Main aZZZ,Q6LJKW*DOOHU\FRP ,Q6LJKW*DOOHU\UHSUHVHQWVDVHOHFWJURXSRISDLQWHUVDQGVFXOStors working in landscape, figurative, still life, impressionistic, wildlife, sporting and western art. 2ZQHUV6WHSKHQDQG(OL]DEHWK+DUULVDUHGHGLFDWHGWREULQJLQJ only the highest quality of fine art to the Texas Hill Country and to the national art market. The gallery is home to numerous award ZLQQLQJ2LO3DLQWHUVRI$PHULFD&RZER\$UWLVWRI$PHULFD3UL[ GH:HVW$PHULFDQ,PSUHVVLRQLVW6RFLHW\0DVWHUVDQG$XWU\0DVters of the American West artists. Upcoming shows: s0DUFK6HYHQWK$QQXDO7H[DV0DVWHUVp6KRZ0RUHWKDQ of the finest Texas artists will be on display. s$SULOq/XUHRIWKH:HVW2QH0DQ6KRZIHDWXULQJ&RZER\ Artist of America, Tom Browning s0D\)UHGHULFNVEXUJ)LUVW)ULGD\$UW:DON ART WALK â&#x2013;ś 168

NATIVE NURSERY Specializing in native & drought-tolerant plants

LANDSCAPE design/install consultations available

Oil Changes 6 Brakes 6Ĺ?Ć&#x152;ŽŜÄ&#x161;Ĺ?Ć&#x;ŽŜĹ?ĹśĹ? Minor Mechanical Transmission Fluid Changes Trailer Rentals Open Monday through Friday 8:00 to 5:00 dĆľÄ&#x17E;Ć?Ä&#x161;Ä&#x201A;Ç&#x2021;Ä&#x201A;ĹśÄ&#x161;dĹ&#x161;ĆľĆ&#x152;Ć?Ä&#x161;Ä&#x201A;Ç&#x2021;ƾŜĆ&#x;ĹŻĎąÍ&#x2014;ĎŻĎŹ Saturday 9:00 to noon

LOCATED AT THE RIDGE MARKETPLACE 13439 South Ranch Rd. 783 (Harper Rd) Kerrville TX 78028

619 East Main Street 6 Fredericksburg, Texas ϴϯϏ͏ϾϾϳͲϾϯϹϾ


Always in bloom

Wildseed Farm offers natureâ&#x20AC;&#x2122;s color for visitors

Hundreds of thousands of visitors who enter Fredericksburg from U.S. Highway 290 East get a huge blast of natural color as they pass a local institution. Wildseed Farms began 35 years ago as a seed provider, but owner John R. Thomas and wife Marilyn expanded over the years after they moved WR)UHGHULFNVEXUJWRLQFOXGHÂżHOGVRIĂ&#x20AC;RZHUVDQGDUHWDLOVKRSERWKRI which bloomed into their own visitor-attracting offering. Today, more than 300,000 people a year stop by the center. Wildseed Farms, located on U.S. 290 East at 100 Legacy Drive, is home WRWKHODUJHVWIDPLO\RZQHGZLOGĂ&#x20AC;RZHUIDUPLQWKH860RUHWKDQ DFUHVDWLWVKHDGTXDUWHUVDUHÂżOOHGZLWKFRORU\HDUURXQGDVEORRPVEHDXtify the roadside attraction. The company has more than 1,000 acres of FXOWLYDWHGÂżHOGVDURXQGWKHVWDWHDQGXVHVSURYLGHUVIURPRWKHUVWDWHVIRU seed. Its business is made up of bulk seed sales, mail order sales and retail. ,I\RXVHHZLOGĂ&#x20AC;RZHUVRQURDGVLGHVRULQFRUSRUDWHRUSULYDWHODQGVFDSHV thereâ&#x20AC;&#x2122;s a good chance the seeds came from Wildseed Farms. Thomas has won local, state and national recognition for his contribuWLRQVWRODQGFRQVHUYDWLRQDQGEHDXWLÂżFDWLRQ WILDSEED â&#x2013;ś 144

Log Haus and Cottage Heart of Fredericksburg, Texas

½ Blk from

104 E. Austin St One Block off Main to the North between Adams & Llano St.


Llano St.


Adams St.

The Haussegen Log Haus - rental is for entire 2½ story house and sleeps up to 9.

The Haussegen Cottage is also on the property and sleeps 2-4.

Main St. / Hwy. 290 Courthouse & Library

Inquire about weekday retreats, workshops, or business meetings. Reservations 855-687-3832 or

144 WILDSEED Cont. from 143

The farm offers a comVisitors can explore WILDSEED FARMS plimentary seed catalog walking trails, watch the farm staff work to each visitor and a re1-800-848-0078 or 830-990-1393 source guide, which offers and take photos. In Hours 9 a.m.-6 p.m. daily helpful planting tips and 3LFN<RXU2ZQÂżHOGV (Features onhow-toâ&#x20AC;&#x2122;s. visitors can create line Resource Guide and Catalog.) Outside the store can bouquets. Among the areas at be found one of the Hill Photo on page 143, each spring, WildCountryâ&#x20AC;&#x2122;s largest selecWildseed to visit are seed Farms hosts the Texas Flower tions of live plants and Blossomâ&#x20AC;&#x2122;s Boutique, Country Womenâ&#x20AC;&#x2122;s 5K and 10K on its colorful imported pottery. Lantanaâ&#x20AC;&#x2122;s Nursery, grounds. â&#x20AC;&#x201D; Standard-Radio Post photo Many of the native plants Brewbonnet Biergarare featured in Wildseed ten and the Meadows. Farmsâ&#x20AC;&#x2122; own landscape. Staff members are available to make Soon to be added is a location for Wedding Oak Winery, based in San Saba, featuring pioneering female winemaker suggestions and help shoppers create their own version. Penny Adams. Events 3ODQWDQGĂ&#x20AC;RZHUORYHUVFDQRUGHUVHHGVRILQGLYLGXDOVSHFLHV 7KHDQQXDO:LOGĂ&#x20AC;RZHU&HOHEUDWLRQLVKHOG$SULODW UHJLRQDOPL[HVYDULHWLHVRIFRVPRV]LQQLDVDQGVXQĂ&#x20AC;RZHUV Wildseed Farms, and marks the arrival of spring with blosalong with native grasses and culinary herbs. There are also VRPVVKRSSLQJEXWWHUĂ&#x20AC;\JDUGHQVDQGZDONLQJWUDLOV garden products and specialty foods. Their catalog features 2Q0D\WKH7H[DV)ORZHU&RXQWU\:RPHQÂśV.DQG. RYHUYDULHWLHVRIZLOGĂ&#x20AC;RZHUVJUDVVHVKHUEVDQGH[RWLFJDUhosted by Run in Texas, will be held on the grounds. The den variety seeds. FRXUVHORRSVDURXQGWKHÂżHOGVDW:LOGVHHG)DUPVDQGDORQJ Open to the public daily, Wildseed Farms offers a lot more WKH3HGHUQDOHV5LYHU$WWKHÂżQLVKOLQHUXQQHUVFDQHQMR\D WKDQWKHĂ&#x20AC;RZHUVWKHVHGD\VDQGLQYLWHVWKHSXEOLFWRFRPHRQ champagne brunch, massages, music and shopping. by and stay a while.

Concert Schedule March 20, 2016

Nathaniel Mayfield

Trumpets with Organ Accompaniment

September 18, 2016

Fei-Fei Dong

14th Van Cliburn International Piano Competition Finalist

January 15, 2017

Miró Quartet Violinists & Cello

April 17, 2016

The Marcsmen

San Antonio’s Premier Men’s A Cappella Group

October 16, 2016

Apollo Chamber Players Chamber

May 15, 2016

Emile Pandolfi Concert Pianist

November 20, 2016

Ava Pine Soprano

February 19, 2017

March 19, 2017

Alamo Metro Chorus

Doug Montgomery

Award Winning Barbershop At Its Best!


No tickets required - There is a free will donation basket at the door - Concerts will be held at 3:00 p.m. Fredericksburg United Methodist Church - 1800 N. Llano (Hwy. 16 North) - Fredericksburg, Texas


Early settlers named Kreuzberg A recognized historic landmark in this part of the Texas Hill Country even before Fredericksburg was founded in 1846, Cross Mountain is named for the crosses that have topped its summit for more than 160 years. CROSS MOUNTAIN â&#x2013;ś 146

Twenty-four hours a day, the cross atop Cross Mountain keeps watch over Fredericksburg. The cross is lit from 6 p.m. to midnight every evening. â&#x20AC;&#x201D; Standard-Radio Post file photo

La Quinta Inn & Suites You are invited to come stay in one of Fredericksburgâ&#x20AC;&#x2122;s newest hotels located on Main Street, next to Wal-Mart, which is convenient to historic downtown shopping. NEWLY RENOVATED! The hotel is decorated in a colorful Tuscan Mediterranean style. Our guest rooms offer the latest amenities and technologies in a full service hotel. All rooms have interior entrances and are equipped with high speed internet, 32â&#x20AC;? flat screen high definition television with cable, alarm clocks, coffee makers, irons, ironing boards, hair dryers, granite bathrooms, microwaves and refrigerators.Our guests will enjoy a complimentary continental breakfast, always with a friendly greeting, an outdoor pool, hot tub and exercise room. The Tuscan Room is for meetings and parties.


147 BlackberriesRaspberries-ApplesPeaches-StrawberriesIce Cream+Fruit Cobbler+Fruit SmoothiesJams+Jellies+Sauces+ Ciders+HoneySpecialty Items+Lavender Bouquets+Soy CandlesGoat’s Milk Bath and Body Products+More!

Don’t miss a chance to enjoy our...

Homemade Ice Cream! Farm Fresh Fruit Smoothies! Peach and Blackberry Cobbler, Pastries & Pies! and home baked daily!!



<<<10 Miles to Fredericksburg

HWY 290

Fredericksburg’s Hottest Night Spot! 830-990-1283

Be sure to follow us on Facebook for the latest news. OPEN DAILY ~ 4 pm ‘til 2 am HappyHourMon.-Fri.4pm-8pm



Grill Now Open 304 North Llano Street, Fredericksburg Check Out Our Menu Online!



Winter & Spring Texas

Summer & Fall Idaho



RUSTIC TO ELEGANT :22'‡,521‡6721( )851,785(‡$&&(176‡/$036‡*,)76 $17,48(6‡6&8/3785(‡&$59,1*‡ART

(830) 998-8214


148 CROSS MOUNTAIN Cont. from 146

Rising to an elevation of 1,951 feet above sea level, Cross Mountain is located on North Milam Street alongside Ranch Road 965. A sign at the entrance makes the entryway easier to spot. After recent volunteer work done by The Friends of the Fredericksburg Nature Center, visitors can now walk up the hill on a stairway path to reach the top of the mountain for a panoramic view of the area. There are also two trails that circle the mountain, one at the base and the other half way up the mountain, where visitors can look at the different plant life and wildlife in the area. No vehicles are allowed up the hill but parking is available at the foot of the mountain. History The history of Cross Mountain reaches back to when early settlers arrived in 1846, they found the remnants of a wooden cross that had been erected there most probably by the Spanish missionaries who had by then established missions in San Antonio, San Saba and other areas of Texas. For the Indians, too, it was a landmark as it lay on the Pinta Trail, one of the oldest Indian trails in the state. From the Pinta Trail crossing on the Pedernales River, the trail divided, with this branch following the Upper Crabapple Road in the direction of Bear Mountain and then on to Enchanted Rock and beyond.

Cross Mountain gained its name when an early-day German settler, John Christian Durst, found the old cross of heavy timbers at its summit that was erected by the Spanish missionaries. He named it â&#x20AC;&#x153;Kreuzbergâ&#x20AC;? (Cross Mountain), a name that has never changed. In the summer of 1848, Father George Menzel, a Bohemian priest, erected a more substantial cross as a symbol of redemption and civilization. During the Diamond Jubilee of St. Maryâ&#x20AC;&#x2122;s Catholic Church in 1921, a more permanent cross was placed on top of the hill. It was constructed of concrete, reinforced steel and sheet metal. It was vandalized over the years, but was rebuilt by St. Maryâ&#x20AC;&#x2122;s in 1940. :KHQUXUDOHOHFWULÂżFDWLRQFDPHWRWKHDUHDLQWKH cross was illuminated. It burns bright each evening from 6 p.m.-midnight. The park was purchased by Dr. J. Hardin Perry in the 1900s to keep it from being developed. It then ended up in the ownership of the Gillespie County Historical Society. In 1999, the City of Fredericksburg obtained ownership of the historic landmark. The park is now maintained by the City of Fredericksburg Parks and Recreation Department. $QRIÂżFLDO7H[DV+LVWRULFDO&RPPLVVLRQPDUNHUZDVGHGLcated in observance of Founders Day on May 7, 1977, and the Nature Trail was dedicated during the 1978 Founders Day activities at the site.

Family Medicine with Obstetrics

Resurrection Lutheran Church (LCMS) 2215 North Llano Highway Fredericksburg, TX 78624 830-997-9408


Sunday School 9am ~ Sunday Worship Service 10:30am â&#x20AC;&#x153;Grow in Christ, Serve with Joy!â&#x20AC;?

Karen G. Cornett, M.D. John P. Ramsay, M.D. Nancy M. Rickerhauser, M.D. Kristi A. Stafford, M.D. Family Medicine

Matthew J. Hoermann, M.D. Family Medicine - Functional Medicine

Suzanne E. Ellison, M.D.


Chris Kaiser Builder, Inc. 103 E Main Street Fredericksburg, TX 78624 830-990-2255

Restoring the Past | Building the future


Fredericksburgâ&#x20AC;&#x2122;s Marktplatz has been Located in the center of Fredericksburg, Marktplatz offers a place to relax as well as take in a bit of local history. Marktplatz is also home to many festivals and events going on throughout the year. The Vereins Kirche, widely recognized as the symbol of Fredericksburg, stands in the center of the square and is a UHSOLFDRIWKHÂżUVWKRXVHRIZRUVKLSPHHWLQJSODFHDQGIRUtress built soon after the city was founded in 1846. 7RGD\WKHEXLOGLQJVHUYHVDVDFRXQW\DUFKLYHVÂżOOHGZLWK mementos and information of the cityâ&#x20AC;&#x2122;s history. Marktplatz was originally known as Market Square until the area was redeveloped to its present state in time for the cityâ&#x20AC;&#x2122;s 150th anniversary in 1996. This area was originally designated by the cityâ&#x20AC;&#x2122;s founder, John O. Meusebach, as a place for people to gather and enjoy themselves. Today, the area is a showplace, far from the days when the DUHDKDGÂżOOLQJVWDWLRQVXVHGFDUORWVDQGDYDULHW\RIRWKHU VWUXFWXUHVSOXVD\RXWKEDVHEDOOÂżHOG The â&#x20AC;&#x153;Marktplatz Service Buildingâ&#x20AC;? is located at the corner of Main and Adams streets and houses a substation for the Fredericksburg Police Department, where downtown bicycle patrolmen and the citizensâ&#x20AC;&#x2122; police volunteer organization also operate out of.

Fredericksburg founder John O. Meusebachâ&#x20AC;&#x2122;s unbroken peace treaty with the Comanche Indians is depicted with a near-life-size bronze sculpture on Marktplatz.


offering visitors respite since 1846 Public restrooms are located on the Adams Street side of the building.

Memorials Also included on Marktplatz are brick walkways, numerous arbors and a History Walk that honors the pioneers of the community, including President Lyndon B. Johnson, Admiral Chester W. Nimitz and the men and women who have served in the armed forces, along with Jacob Brodbeck, a pioneer resident of here who was an early aviator. A statue of Fredericksburg-born composer Frank Valentin van der Stucken is located in the Pioneer Garden on the square. Also located in the Pioneer Garden near the water wheel is a near-life-size bronze statue of Meusebachâ&#x20AC;&#x2122;s yet-unbroken peace treaty with the Comanche Indians. Dedicated in 1997, the memorial was placed by the cityâ&#x20AC;&#x2122;s 150th Anniversary committee. A bust of the cityâ&#x20AC;&#x2122;s founder, John O. Meusebach stands in front of the Vereins Kirche.

Additional restroom facilities are located in an adjacent building. One of the most active areas of the square is a shaded playground that is a favorite spot for parents to bring their children. Children can keep entertained at the playground while their parents participate in events being held on the grounds at one of the three covered pavilions â&#x20AC;&#x201D; the Adelsverein Halle, the Oktoberfest Halle and the Kinder Halle. Brick walkways in the area include engraved bricks recogQL]LQJGRQRUVZKRKDYHSXUFKDVHGWKHPWRKHOSÂżQDQFHWKH redevelopment and help perpetuate their names in the history of the community. $WRWKHUSODFHVWKHUHDUHEHQFKHVODPSVDQGRWKHUÂż[tures. A Maibaum graphically depicting early history, individuals, festivals and customs of the community, is located near the Adelsverein Halle and attracts wide attention and is a touch of the type of installations found in major town squares in Germany. A historical marker, facing Main Street near one of the pathways to the Vereins Kirche, tells of the historical sigQLÂżFDQFHRI0DUNWSODW]DQGLQYLWHVUHVLGHQWVDQGYLVLWRUVWR make use of the facilities.


Settlers chronicle history in paint Early pioneers Herman Lungkwitz and Richard Petri settled near Fredericksburg more than 150 years ago. And like hundreds of other settlers, they were determined to survive and thrive. What made them different was the artistic record they left of the world in which they lived. Their sketches and paintings became prized as rare interpretations of an era whose works of art are few and far between today. Now museum treasures, their artwork provides a vivid reminder of what life was like “back then”, particularly here in Gillespie County. Petri and Lungkwitz had become friends at the Royal Academy of Art in Dresden, Germany, and Lungkwitz later married Petri’s sister, Elisabet. These three were joined in their move to America by Friederike Lungkwitz, Herman’s aged mother; his sister, Therese, and Petri’s sister, Marie. The group left Germany late in the summer of 1850, landed in Hoboken, NJ, and moved to Wheeling in what was then Virginia. Richard Petri’s health was poor, so they decided to come to Texas, sailing down the Ohio and Mississippi Rivers to New Orleans where Adolph Lungkwitz, Herman’s younger brother, joined them. They traveled to Indianola and then to New Braunfels, before moving to the Fredericksburg area in



late-spring or early-summer of 1852. They bought 320 acres of land on the Pedernales River DERXW¿YHPLOHVVRXWKZHVWRI)UHGHULFNVEXUJRQZKDWLVQRZ known as the “Old Kerrville Road” and proceeded to build their homes and farm the land. These two artists, however, also devoted much of their time to painting the Texas landscape as they saw it, leaving for today many prized pictures of scenes, buildings, frontier life, even Indians, which are found in private collections and museums. Two books have been published about them. ART HISTORY ▶ 157

H. MOELLERING CONSTRUCTION, LLC Fredericksburg, TX 78624 830-998-1686 Land Clearing, Road Building (Red Granite Crushed Base), Tanks, Building Pads Land Preparation (Raking, Plowing), Cattle Guards, Cedar Shearing Customized Gates & Entrances, Concrete Dams & Crossings

Debbie & Harvey Moellering Jr. Ferrl, Keven and Mike


A Heartache Coundn’t Happen to a


Available at cdbaby, iTunes, Amazon & Waterloo Records, Austin


Ron Fagan - Questover Studios Specialty - Chet Atkins Style Available for Solo Performance (H) 830-669-2110 (C) 830-307-4612 email: ronfagan3

VISIT OUR UNIQUE MARKET We offer Sandwiches, Meat & Cheese Trays, Sausages, Salami, Jerky, Fresh Meats, Bacon, Hams and much more. We offer many condiments for your meats.

Fredericksburg Clinic, PA Welcomes Everyone to Fredericksburg and Gillespie County Dedicated Physicians & Friendly Staff Ready to address your Healthcare Needs

Since 1939

1308 South State Hwy. 16

Phone (830)997-2181 Fax (830) 997-4453

Red meats are cut fresh daily, are not pre-packaged, and are not injected.

DUTCHMAN’S MARKET, INC. Processing Plant and Wholesale/Retail Sales Store 1609 East Main St., Fredericksburg, Texas 78624

Telephone 830/997-5693 Monday - Friday 8:00 - 5:30 Saturday 8:00 - 1:00

FAMILY MEDICINE Charles E. Burg, M.D.; John R. Kothmann, M.D. :ĞīƌĞLJZ͘,Žůƚ͕D͖͘͘ZĞďĞĐĐĂt͘ĂůĞLJ͕͘K͘

INTERNAL MEDICINE Jennifer K. Mayben, M.D., MPH; Michael M. Johnson, M.D. MDVIP Physicians: Leo C. Tynan, M.D.; Philip J. Maple, M.D.

D/Ͳ>s>WZKs/Z >ŽƌĞƩĂ<ĞĞƐĞ͕D͘W͘͘^͕͘W͘͘Ͳ


INSPIRING IDEAS FOR YOUR HOME ProBuild offers a complete solution for all of your building needs. With high quality lumber, custom trusses, and a robust selection of building products, we can provide you with the best materials for the foundation of your home. We recognize the importance of offering products that meet your high standards and lumber and wood products are what we know best. We have the necessary relationships with a cross section of North American mills that ensures our access to excellent quality, well milled wood at the right price and at the right time for our customers. But ProBuild doesnâ&#x20AC;&#x2122;t stop there. We also offer a full line of windows and doors to put the final touches on a product you will be proud to put your name on. If you need it, we have it. Please call or come in today with all of your building needs.


Looking for that Investment Dream Opportunity of a Lifetime? Well here is it...nestled within the beautiful Hill Country! Main House of approximately 2,000 sq ft (3BD/2BA)

Exceptional Views over 15 acres

Includes 6 fully furnished Guest Cabins 13 mi South of Fbg

The Lookout Cabin - one of six charming cabins on the property Check our website for cabin availability, rates, and reservations

All the peace and tranquility you could ever dream of

This little piece of heaven could be all yours A great return on your investment for your future

Walnut Canyon Cabins 503 Deer Rd, Fredericksburg, TX 78624

FOR SALE BY OWNER Please contact David for further details and to view this investment paradise at



Things in a Room


Gifts & Souvenirs

Fabric, Oil Cloth, Colored Burlap and Sewing Notions Gifts, Clothes & Jewelry

Designs by Rita Irons

Specialty Foods

Rags by Elaine

Where The Fun Is Free! A store just brimming with memories the candy you ate as a kid, toys that don’t need batteries, and those old familiar VRQJV<RX¶OO¿QGLWDOOKHUH

LaMar’s Signs & Stuff Sunshine Knitting

Cute items for your little tots & babies

We carry a wonderful assortment of Fredericksburg postcards, lots of Fredericksburg souvenirs, t-shirts and caps. We are proud to offer the largest selection of made in Texas Christmas ornaments and magnets in the state! There is always something new and different alongside the old and familiar.

We are happy to be here 7 days a week!

239 E. Main Fredericksburg, Texas 78624 @GoFred1

Open earlier and later than most!

143 E. MAIN ST. ~ 830.990.4100

Proud member of




Cont. from 152



Download the

mobile app at the App Store or Google Play

158 AAA Diamond Rated

UÊ iÜÊ*ˆœÜ̜«Ê i`à UÊ"ÛiÀÊ£ääÊÀiiÊ >LiÊÊÊÊÊ ÊÊÊ …>˜˜iÃ UÊÕiÃÌÊ>՘`ÀÞʜ˜ÊÈÌi UʈVÀœÜ>ÛiÃɈ˜ˆÊ ÊÊÊÀˆ`}iÉ œvvii“>ŽiÀÃ

Top Rated Sunset Grill Restaurant on site.

1 & 2 Bedroom Suites Available by Day, Week or Month Discounts For Seniors, AAA, Groups and Government Agencies

900 S. Adams Fredericksburg, TX 78624




You Fish... We Handle the Rest!

* Lake Design * Vegetation Management * Site Evaluation * Monthly Maintenance * Management Plans

* Fish Stocking * Grass Carp * Habitat Enhancement * Aeration/Fountains * Electrofishing/Fishery Surveys

Located in Fredericksburg, TX – Serving the Texas Hill Country, Central, South and West Texas



Vereins Kirche city landmark Located in the center of Marktplatz in downtown FrederLFNVEXUJWKH9HUHLQV.LUFKHVHUYHGDVWKHFLW\ÂśVÂżUVWFKXUFK DIRUWVWRUHKRXVHPHHWLQJKDOOOLEUDU\RIÂżFHDQGPXVHXPDW one time or another. Today, the hexagonal landmark is owned and managed by the Gillespie County Historical Society and is home to exhibits on the history of the community. The original building was demolished in 1896, but local citizens long dreamed of rebuilding it â&#x20AC;&#x201D; a dream that came true in 1935 when a gala celebration was held to dedicate the new structure as a pioneer memorial. 7KH9HUHLQV.LUFKHLVRSHQWRYLVLWRUVÂżYHGD\VDZHHN² Tuesdays through Saturdays â&#x20AC;&#x201D; from 10 a.m. until 4:30 p.m. It is closed on Sundays, Mondays and major holidays. During the summer season, it is open on Mondays. There is no admission fee, although donations are accepted. 9LVLWRUVWRWKH9HUHLQV.LUFKHZLOOÂżQGPDQ\KLVWRULFDO exhibits, including photograph collections that depict life in early-day Gillespie County. The white building with a steep roof often referred to as the

A replica of the communityâ&#x20AC;&#x2122;s first church, the Vereins Kirche is located on Marktplatz. â&#x20AC;&#x201D; Standard-Radio Post file photo

London Times Â&#x2021; Pendleton Â&#x2021; NYDJ Â&#x2021; Match Point Â&#x2021; Multiples p Â&#x2021; Votivo Â&#x2021; FDJ

3HWLWHÂ&#x2021;0LVV\Â&#x2021;:RPHQ¡V 2106 Hwy. 281 N. Marble Falls 830-693-5300

202 N. Milam Fredericksburg 830-997-3113


Â&#x2021; Foxcroft oftf Â&#x2021; Erin London Â&#x2021; Miss Elaine Â&#x2021; Alex Evening Â&#x2021; Spanx Â&#x2021; London Times Â&#x2021; Pendleton Â&#x2021; NY NYDJ Â&#x2021;

p Â&#x2021; Vo V Votivo tivo Â&#x2021; )'-Â&#x2021; Alex Evening Eveening Â&#x2021; Spanx Spanx Â&#x2021; London London Times Â&#x2021; Pendleton Â&#x2021; NYDJ Â&#x2021; Match Point Â&#x2021; Multiples

See VEREINS KIRCHE â&#x2013;ś 161

Inspiring a lifelong love of God and service to neighbor since 1856. For over 150 years, St. Maryâ&#x20AC;&#x2122;s School has been raising an exceptional family. Strong community, superior academics, character-building athletics and life-changing service projects are just a few of the things that prepare our graduates for future success. Itâ&#x20AC;&#x2122;s new technology and deep tradition all rolled into one. Come. Visit. And experience our open arms. Pre-K â&#x20AC;&#x201D; 8th Grade ( 202 S. Orange St. ( Fredericksburg, TX 830.997.3914 (

Match Point Â&#x2021; Multiples Â&#x2021; Votivo Â&#x2021; FDJ Â&#x2021; Foxcroft Â&#x2021; Erin London Â&#x2021; Miss Elaine Â&#x2021;

160 Luxeâ&#x20AC;&#x201C;Living â&#x20AC;&#x153;Designed Especially for Youâ&#x20AC;? Č&#x160;Čą Čą  Č&#x160;Čą  Čą  Č&#x160;Čą   Čą

Â&#x2018;Â&#x17D;ČąÂ&#x2DC;Â&#x;Â&#x17D;Â&#x203A;Â&#x17D;Â?ČąÂ&#x203A;Â&#x2019;Â?Â?Â&#x17D;Čą Â&#x2DC;Â&#x17E;Â&#x153;Â&#x17D;

605 E. Austin St. Fredericksburg, Texas 830.997.2484

161 VEREINS KIRCHE Cont. from 159

â&#x20AC;&#x153;coffee millâ&#x20AC;? structure, was erected in 1935 as a replica of the original Vereins Kirche which was constructed by the townâ&#x20AC;&#x2122;s settlers in 1847 a few yards away in the center of what is now Main Street. The original Vereins Kirche (community church) was used not only as a church (kirche), but also as a fort, a storehouse and a community meeting hall. As different denominations built their own houses of worship, it fell into disuse and disrepair. For the cityâ&#x20AC;&#x2122;s 50th anniversary jubilee celebration in 1896, the structureâ&#x20AC;&#x2122;s outer walls were removed and it was used as a pavilion for the jubilee celebration. The next year it was completely demolished. For many years, local citizens had the vision and dream of building a replica. By the end of 1933, one of the bright spots to emerge out of the Great Depression was the culmination of this dream. The Gillespie County Historical Society was formed to raise funds for building this memorial to the pioneers and local funds were matched with federal funds. In 1935, when the building had been completed and the grounds landscaped, a gala celebration was held to dedicate the structure. It was used as a museum to display memorabilia and collectibles of pioneer days. A part of the building was later set

aside for use as a library. When the GCHS acquired the Kammlah property (located at Pioneer Museum Complex), the museum exhibits were moved there and the entire space was devoted to Pioneer Memorial Library. When the countyâ&#x20AC;&#x2122;s second courthouse was recycled for use as a library, through the generosity of Eugene and Margaret McDermott of Dallas, all the books were moved across the street to the new library facility. For a few years, part of the Vereins Kirche was used as an RIÂżFHIRUWKH&KDPEHURI&RPPHUFHDOWKRXJKWKH*&+6 maintained some exhibits in it. Soon, a number of GCHS members became involved in putting together the present Archives Collection. When the chamber moved out of the Vereins Kirche, the entire space was given over to the archives (which have now been relocated to the GCHS Center, 312 West San Antonio Street). A depiction of the peace treaty with the Comanches, painted by Lucy Meusebach Marschall in the 1920s, hangs in the Vereins Kirche. Also located inside the Vereins Kirche is a store where a variety of items are sold, including a large collection of books on German Texas history, postcards, pictures and souvenirs.

the farmhouse boutique has relocated to 114 North Crockett

Hilltop Cabin Beautiful historic accommodations in the heart of the city Located ½ block from Main Street on west side of Marktplatz at 112 North Crockett

the farmhouse boutique and

Hilltop Cabin 830-990-8121





342 West Main Fredericksburg, TX 830-997-7753

Custom Bar-B-Q & Catering Available Open 7 Days at 11 a.m. Open late on Fridays and Saturdays Daily Lunch Specials Dine In & Take Out

Das Jager Haus Fredericksburg, Texas

Enjoy Being a World Away from City Life . . . Small Secluded, Eclectic Cabin 10 Acres H WiFi H DirecTV H Blu-ray H SiriusXM H Keurig

Book Online at 830-456-0698 @GoFred1


Parking and automobile traffic in downtown Fredericksburg were already a “driver’s nightmare” in the late 1930s as shown in this

colorized artist’s rendition of an early-day photo of Main Street. — Standard-Radio Post/Marc Land

Located at 408 N. Llano Street, Fredericksburg, TX , 512-547-9506 Fine Art Framing, Accredited Art Appraisals, Art Brokering, Gallery & More. Open Monday – Friday 8:00- 4:00 Weekends by appointment

Download the

mobile app at the App Store or Google Play


Churches welcome all Weekly worship services are conducted at more than 50 churches across Gillespie county. Following is a list of those congregations and their addresses that might prove helpful to those who are searching for a place of worship. )RUVSHFLÂżFWLPHVRIVHUYLFHVWRJHWKHUZLWKRWKHULQIRUPDWLRQ IRUHDFKFKXUFKFRQVXOWWKHVSHFLDOOLVWLQJRIFKXUFKHVSXEOLVKHG each week in the Fredericksburg Standard-Radio Post. Adventist Fredericksburg Seventh-Day Adventist Church, 101 East Highway Street, 997-6042. Iglesia Adventista â&#x20AC;&#x2DC;Los Peregrinosâ&#x20AC;&#x2122;, 603 FM 2093 in the Tivydale Business Park, Ste. 1204. Assembly of God New Life Worship Center, 102 East Travis Street, 997-2607. Baptist Faith Baptist Church, (Southern Baptist), 3022 State Highway 16 North (Llano highway), three miles from Main Street, 997-9836, First Baptist Church, 1407 East Main Street (BGCT/SBC), 997-9511, First Baptist Church of Harper, Main Street, Harper, 864-4241.

CHURCHES â&#x2013;ś 166



Residents and visitors alike are welcome at the many churches in Fredericksburg and Gillespie County. Trinity Lutheran Church is visible from U.S. 290, a short distance east of Stonewall. â&#x20AC;&#x201D; Standard-Radio Post file photo

tŽ½Â&#x2014;¼½Ă&#x160;ĂłÂ&#x203A;Ă&#x2122;ZÂŽÂ&#x2014;ÂŚÂ&#x203A;½Ă&#x2013;Â&#x192;Â&#x2018;Â&#x192;ZÂ&#x192;Ă&#x201E;Â&#x2018;ÂŤ tÂ&#x203A;½Â&#x2018;Ă&#x160;Ă&#x192;Â&#x203A;Ă?&Ă&#x2122;Â&#x203A;Â&#x2014;Â&#x203A;Ă&#x2122;ÂŽÂ&#x2018;ÂťĂ?Â?çĂ&#x2122;ÂŚsÂŽĂ?ÂŽĂŁĂ&#x160;Ă&#x2122;Ă?


Ç&#x2020;Ć&#x2030;ĹŻĹ˝Ć&#x152;Ä&#x17E;ŽƾĆ&#x152;KŜͲ^Ĺ?Ć&#x161;Ä&#x17E;ĹŻĆ&#x2030;Ä&#x201A;Ä?Ä&#x201A;Ć&#x152;Ä&#x17E;Ä&#x201A;Ć&#x;ŽŜĆ?&Ä&#x201A;Ć&#x152;Ĺľ^Ć&#x161;Ĺ˝Ć&#x152;Ä&#x17E; &Ä&#x17E;Ä&#x201A;Ć&#x161;ĆľĆ&#x152;Ĺ?ĹśĹ?&Ĺ?ĹśÄ&#x17E;ĹŻĆ&#x2030;Ä&#x201A;Ä?Ä&#x201A;WĆ&#x152;Ĺ˝Ä&#x161;ĆľÄ?Ć&#x161;Ć?Í&#x2DC; ÍžzÄ&#x201A;Ć&#x152;ĹśÍ&#x2022;ZĆľĹ?Ć?Í&#x2022;/ĹľĆ&#x2030;Ĺ˝Ć&#x152;Ć&#x161;Ä&#x17E;Ä&#x161;^Ç Ä&#x17E;Ä&#x201A;Ć&#x161;Ä&#x17E;Ć&#x152;Ć?Î&#x2DC;,Ä&#x201A;ĹśÄ&#x161;DÄ&#x201A;Ä&#x161;Ä&#x17E;/Ć&#x161;Ä&#x17E;ĹľĆ?Íż



WĹŻÄ&#x17E;Ä&#x201A;Ć?Ä&#x17E;Ä&#x201A;ĹŻĹŻĹ˝Ć&#x152;ͲžÄ&#x201A;Ĺ?ĹŻĹ&#x161;Ä&#x17E;Ä&#x201A;Ä&#x161;Ć&#x161;Ĺ˝^Ä?Ĺ&#x161;Ä&#x17E;Ä&#x161;ƾůÄ&#x17E;Ä&#x201A;ZÄ&#x201A;ĹśÄ?Ĺ&#x161;sĹ?Ć?Ĺ?Ć&#x161; Ä&#x201A;ĹŻĹŻώϭϏͲϯϾϰͲϹϯϳϴĹ˝Ć&#x152;,ŽžÄ&#x17E;ϴϯϏͲϾϾϏͲϾϭώϹ ϹϴϏϏÄ&#x17E;ĹśĆ&#x161;Ä&#x17E;Ć&#x152;WĹ˝Ĺ?ĹśĆ&#x161;ZĹ˝Ä&#x201A;Ä&#x161;ÍťÇ Ç Ç Í&#x2DC;Ç Ć&#x152;ͲÄ&#x201A;ĹŻĆ&#x2030;Ä&#x201A;Ä?Ä&#x201A;ͲĆ&#x152;Ä&#x201A;ĹśÄ?Ĺ&#x161;Í&#x2DC;Ä?Žž



             !56%.1%+"%/ -#!* -+%&/-4, /-$2#% -#!*-+%&/-4,/-$2#% /&!,(#*21%,/%% /&!,(#*21%,/%% /-$2#10 /-$2#10 2(#%4%%1%,%$/%0%/3%0 2(#%4%%1%,%$/%0%/3%0 %!#'($%/ %!#'($%/ (**-2,1/5.%#(!*15 (**-2,1/5.%#(!*15 /-$2#10 /-$2#10 -+%015*%/%0%/3%0 -+%015*%/%0%/3%0  ( )* (#)*%0 (#)*%0 %!#'%0#%/%!+ !12/!*-,%5 !12/!*-,%5 %!#'!*0! %!#'!*0!

        45    45 !011-,%4!** !011-,%4!**                            





166 CHURCHES Cont. from 164 Fredericksburg Baptist Church, 104 Pyka Road, 997-6941. Fredericksburg Christian Fellowship, (Reformed Baptist), 157 Schmidtzinsky Road, 997-8612. New Hope Primitive Baptist Church, 405 West Burbank Street. Primera Iglesia Bautista Hispana, (Spanish Mission), 301 East Liveoak Street. Squaw Creek Primitive Baptist Church, Ranch Road 648, Doss. Stonewall Baptist Church, Ranch Road 1623 North, Stonewall. Bible Fredericksburg Bible Church, 107 East Austin Street, fbgbible. org. Hill Country Church (EFCA), 107 East Lower Crabapple Road, 997-3968, South Church, 758 S. Washington St. (meets at BBâ&#x20AC;&#x2122;s Bowling Alley), 997-9785, Catholic Our Lady of Guadalupe Catholic Mission, Lincoln and College streets, 997-9523. St. Anthonyâ&#x20AC;&#x2122;s Catholic Church, 163 Third Street, Harper, 8644026. St. Francis Xavier Catholic Church, Stonewall, 644-2368. St. Maryâ&#x20AC;&#x2122;s Catholic Church, 304 West San Antonio Street, 997-9523.

Steeples from the Marienkirche and St. Maryâ&#x20AC;&#x2122;s Catholic Church rise above the city. â&#x20AC;&#x201D; Standard-Radio Post file photo Christadelphian Christadelphian Church, Hye (located west of Hye, across from Pedernales River from Ranch Road 1). Christian First Christian Church, (Disciples of Christ), 2042 N. Llano

GOLD ORCHARDS, INC. Established 1940

Peach Season: May- August




(86+Z\ Units: AmorĂŠ, Buona Sera & Bellissimo Located L in Stonewall 2 Minutes from the Wine W Trail and a 15 minutes from Fredericksburg A Award Winner ffor 2009 aand 2010 B F ti For R Reservations: 888-702-7288 Bill & Amber Nanni

167 Street, 997-9030. Church of Christ Church of Christ, 507 North Llano Street. Episcopalian St. Barnabas Episcopal Church, corner of Bowie and Creek streets, 997-5762. Lutheran Bethany Lutheran Church, 110 West Austin Street, 997-2069. Christ Lutheran Church, 1419 Cherry Spring Road. Holy Ghost Lutheran Church, (NALC), 115 East San Antonio Street, 997-2288. Resurrection Lutheran Church, (Missouri Synod), 2215 North Llano Street, 997-9408, Shepherd of the Hills Evangelical Lutheran Church, (Wisconsin Synod), 219 West Lower Crabapple Road, 997-2677, St. James Lutheran Church, Harper, 864-4193. St. Paul Lutheran Church, 9732 Ranch Road 1631 (Cave Creek). St. Peter Lutheran Church, 14238 Ranch Road 783, Doss. Trinity Lutheran Church, 4270 Ranch Road 1, Stonewall. Zion Lutheran Church, 426 West Main Street, 997-2195, Messianic Torah Ob Kehila: B’Rit Chadashah, (Del Nuevo Testamento); 302 W. Park St., 990-2607. Methodist Fredericksburg United Methodist Church, 1800 North Llano Street, 997-7679, United Methodist Church, Main Street, Harper, 864-4533. LDS/Mormon The Church of Jesus Christ of Latter-Day Saints, 106 East Driftwood Street, 997-9451. Nondenominational Final Cut Cowboy Church, 8969 Old San Antonio Road, Fredericksburg, 830-456-3266. Grace Family Church, 1603 E. Main St., 830-998-8402. Hill Country Fellowship, 1009 N. Lincoln St. (meets at Golden Hub), 970-596-2344. Journey Church, 701 East Morse Street. Lighthouse Fellowship Chapel, Robert Street, Harper, 8645293. Oak Hills Church, 224 FM 2093 (Tivydale Road), 990-0402, Rocky Community Church, two miles east of Hye on Rocky Road. Sonday House Fellowship, 5532 State Highway 16 South, 9902961, Victory Fellowship, 414 East College Street, 997-9717. Wild Ride Ministries Cowboy Church, two miles east of Harper on U.S. Highway 290, 864-5577. Orthodox St. Thomas Antiochian Orthodox Christian Church, 1201 N. Llano St., 512-632-8188; Pentecostal Calvary Pentecostal Church, 1015 Friendship Lane, 997-7217. Greater Life Christian Center, 106 South Edison Street, 9977006. Iglesia Pentecostes (“El Buen Pastor”), 104 East Live Oak Street, 997-8347. Presbyterian Memorial Presbyterian Church, 601 North Milam Street, 9973543, Harper Presbyterian Church, Harper.

168 ART WALK Cont. from 142 Larry Jackson Fine Art and Antiques 209 South Llano 830-997-0073

Larry Jackson Fine Art and Antiques exhibits a collection of original Texas art and estate art in its expansive historical warehouse gallery. â&#x20AC;&#x153;Our original art and sculpture comes from the secondary market,â&#x20AC;? said Jeannie Jackson. The gallery features a selection of G. Harvey bronzes and paintings that have been previously owned. Each First Friday Art Walk is a special event with new and diverse works that the owners seek out each month. The gallery specializes in Texas art by notable artists such as Porfirio Salinas, Vives Atsara and many others. The gallery gets in new works every week and the owners never know what will come in advance. The Jacksons note that they rarely have artists in for a special show since most no longer make appearances. Some of them are deceased, but their art lives on and is highly sought after. The gallery is open Monday through Friday from 9:30 a.m.-5 p.m. and from 10 a.m.-5 p.m. on Sunday. River Rustic Gallery 222 West Main 830-997-6585 The gallery is open from 10 a.m.-5 p.m., Tuesday through Saturday and by appointment on Sundays and Mondays by calling 830-4568701. The gallery features rock art by artist and gallery co-owner, Carlos Moseley. The gallery also represents 40 other artists that are local, from throughout Texas and the United States. The gallery is home to stone and wood furniture, pressed flowers, metal work, wood turnings, drawings, paintings, photography, stained glass and fused glass, gourds, bronze sculptures, raku, ceramics, mixed media and alabaster luminaries. RS Hanna Gallery 208 South Llano 830-307-3071 RS Hanna Gallery represents 30 recognized artists from 14 states, Scotland and Canada.

The gallery celebrates the arts in their shows, artist receptions and live demonstrations. It hosts the Society of Animal Artists National Show in May and the Women Artists of the West in November. The gallery aims to be about art connecting people in a moment and delighting them for a lifetime. The gallery is open from 10:30 a.m.-5:30 p.m. Tuesday through Saturday. Upcoming events include: s0DUFK â&#x20AC;&#x153;Contemporary Texasâ&#x20AC;? Artist Reception Friday, March 4 from 6-8 p.m. s$SULO â&#x20AC;&#x153;All Creatures Great and Smallâ&#x20AC;? Artist Reception Friday, April 1 from 6-8 p.m. s-XO\ Artist Reception Friday, July 1 from 6-8 p.m. Star-spangled work on display for the 4th of July holiday. s$XJ6HSW â&#x20AC;&#x153;Figuratively Speakingâ&#x20AC;? Artist Reception Friday, Aug. 5, 6-8 p.m. Artist Reception Friday, Sept. 2, 6-8 p.m. â&#x20AC;&#x153;Figuratively Speakingâ&#x20AC;? will show the power of form in a tour de force of three masters of the genre, Dan Beck, Kevin Beilfuss and Bryce Cameron Liston. Whistle Pik Galleries 425 East Main 1-800-999-0820 Whistle Pik Galleries is a national art gallery established in Fredericksburg in 1995 by Tim and Pamela Taylor. Offering some of the finest traditional original paintings and bronzes, Whistle Pik showcases work in two galleries joined by a courtyard and sculpture garden. Whistle Pike is one of only two galleries in the Untied States to represent the original work of Texas artist G. Harvey, a legend in the art world. Special events at the gallery include a Spring Showcase in April and May. Other months feature an All Gallery Showcase. The gallery is open Monday through Saturday.

 2II  R R a single item

*for use in store only*


*Canâ&#x20AC;&#x2122;t be combined with other offers* expires: 8-31-16*



Antique firefighting equipment from the early days of the community is displayed by the Fredericksburg Volunteer Fire Department at their museum on the Pioneer Museum grounds. â&#x20AC;&#x201D; Standard-Radio Post file photo




More Info 830-997-8515 Be our friend!

210-413-9354 Fredericksburg, TX 78624

Hill Country Run Motorcycle Rally


Texas Mesquite Arts Festival

Fredericksburg Food & Wine Fest

Luckenbach | May 6-8 Not just your plain ole motorcycle rally!

Sept. 30, Oct. 1-2 | MarktPlatz Fredericksburg is the Polka Capital of Texas

October 7-9| MarktPlatz Like an outdoor museum!

October 22| MarktPlatz Celebrate Texas wine and food!

170 MUSEUM Cont. from 169



Holy Ghost Lutheran Church NALC Member

Where everyone is welcome! Saturday Evening Service - 6:00 p.m. Sunday Services - 8:00 & 10:30 a.m. Sunday School for All Ages - 9:15 a.m. Sunday Radio Broadcast - 10:00 a.m. on AM910 Pastors: Bobby Vitek & David Priem Pastor Clint Pluenneke, Youth & Family Daniel Hofmann, Minister of Children & Young Families (6DQ$QWRQLR6WUHHWÂ&#x2021; E-mail: Website:


'JOEVT t36(4t5*-&t)"3%800%t1"*/5t#-*/%4t$635"*/4t)0.&"$$&/54t 44U)XZt'SFEFSJDLTCVSH 830-997-8413 THIS ESTABLISHMENT WAS NAMED ONE OF

CRANKY FRANKâ&#x20AC;&#x2122;S BARBEQUE COMPANY As seen in the June 2013 issue of @GoFred1


Open for Lunch 11 am-SOLD OUT Closed Sundays & Mondays LOCATED 1 ½ MILES SOUTH OF MAIN STREET on HWY 87 (WASHINGTON STREET).

1679 HWY 87 SOUTH * (830) 997-2353 FREDERICKSBURG, TEXAS


Newspaper covers century of news One of Fredericksburg’s oldest business members, the Fredericksburg Standard-Radio Post has been covering this part of the Texas Hill Country for 128 years. It was founded in late-1888 by Green Harrison as the Gillespie County News. A string of ownership changes ensued as Harrison sold the paper to Webster McGinnis in 1889. It sold two more times before O.W. Faubion, the man responsible for changing the name to the Fredericksburg Standard, bought it in 1907. The Fredericksburg Publishing Company bought the Standard in 1915 from Harry Kusenberger and maintains ownership today. The company named Robert Penniger editor. When Penniger bought Freie Presse fuer Texas, he terminated his editorship and was succeeded by William Dietel. The title of editor transferred to Oscar R. Schumacher in 1922 and then to Robert S. Klett in 1925. Upon Klett’s death in 1940, assuming the leadership role was Arthur H. Kowert, who had joined the Standard as advertising manager upon graduation from the University of Texas at Austin in 1934. He was succeeded as editor by Terrill D. Collier,

who joined the Standard staff as news editor in September 1973. Collier was president and editor in 1988 until KHZDVQDPHGSXEOLVKHUE\WKH¿UP¶VERDUGRI directors in 2003 after the death of Kowert. In his place, his wife, Cathy Collier was named editor. The company sold to Moser Community Media, LLC in 2012. Ken Esten Cooke was named publisher and editor the same year. In addition to the Standard, the company also once published the Fredericksburg Wochenblatt. Founded in 1873, it had a succession of owners before it was purchased in June of 1893 by Robert Penniger. In 1915, when the Fredericksburg Publishing Company was formed, the Wochenblatt became part of that company. The last issue of the Wochenblatt was published on Dec. 27, 1945. The length of the Standard’s name grew considerably in November 1984, when the Fredericksburg Publishing Co., Inc. purchased the other local newspaper, Fredericksburg Radio Post, which was established by the William Dietel family in 1922. It has continued to print under the Fredericksburg Standard-Radio Post ÀDJVLQFH

Today’s paper still gives news and information, as did the town’s German-language paper, which printed until 1945.

Erbstuck Ranch Guest House A historic log and rock home on an original German Homestead. Enjoy the peaceful Hill Country on a working Texas ranch! H Home cooked breakfast H Unsurpassed star gazing H Indoor fireplace/outdoor firepit H Accommodates up to 8 people

1039 Welge Lewis Road Fredericksburg, TX 78624 325-234-7531/830-998-3847 Download the

mobile app at the App Store or Google Play


All are ‘Willkommen’ in People travel up and down Fredericksburg’s streets day in and day out without ever giving any thought as to how they were named. When the town’s planners picked names for the streets on the main thoroughfare, they encoded into the names of consecutive streets a ‘welcome’ and a ‘goodbye’. Most of the city byways have large signs showing the name of the street and an illustration of the Vereins Kirche, a symbol of Fredericksburg that stands in the center of the city on Marktplatz. The Vereins Kirche through the years has become a commonlyrecognized landmark of Fredericksburg and placing a sketch of the venerable structure on the street signs was a part of the city’s “dressing up” for the 125th anniversary of the founding of Fredericksburg in 1971. Among the more German names of streets is Ufer, which runs parallel to Main Street and three blocks south. Ufer, in English, means stream bank, and undoubtedly was so named because it runs along the southern bank of Baron’s Creek, the main stream WKDWÀRZVWKURXJKWKHFLW\ Originally, the street that runs along the north side of the creek was probably called Bach Strasse, but was translated to Creek 6WUHHWZKHQDOORIWKHFLW\¶VVWUHHWVZHUH¿UVWRI¿FLDOO\QDPHGDQG marked after the city was incorporated in 1933.

It was several years later that the Fredericksburg Lions Club took on the project of giving all the streets names and purchased and installed street signs. It was then that it was decided to name the streets running north and south across Main to spell out words. Starting at Courthouse Square, all of the streets crossing Main WRWKHHDVWZHUHQDPHGVRWKDWWKHLU¿UVWOHWWHUVZRXOGVSHOORXW “All Welcome”. These streets are Adams, Llano, Lincoln, Washington, Elk, Lee, Columbus, Olive, Mesquite and Eagle. Traveling west from the Courthouse Square, the streets spell out “Come Back”. These street names are Crockett, Orange, Milam, Edison, Bowie, Acorn, Cherry and Kay. Many of the streets found throughout the city are named in honor of trees -- Mesquite, Cherry, Cottonwood, Hackberry, Liveoak, Mulberry, Apple, Orange, Plum, Pear, Pecan, Poplar, Spruce, Sycamore and Walnut. Naturally, there is a street named Peach, in honor of the counW\¶VPRVWSRSXODUDQGSUROL¿FIUXLW There is an Elk Street and a Deerwood Street, but no deer street. There are several named for famous native son Admiral Chester W. Nimitz, including Nimitz Street, Nimitz Drive, Nimitz Circle



the City of Fredericksburg and Nimitz Parkway. But, there are no Johnson streets or Meusebach streets. There is a Bunny Drive, in the shadow of Cross Mountain, which is undoubtedly named for the cityâ&#x20AC;&#x2122;s famed Easter Fires characters. There are some unusual street names, such as Kraupahen, a contraction of the names of Mayor Edward Krauskopf and Commissioners WilOLH3DSHDQG0D[7+HQNHZKRZHUHLQRIÂżFHZKHQWKHVWUHHWVZHUH named. $QGZKHQWKHQHZ)UHGHULFNVEXUJ3RVW2IÂżFHZDVEXLOWWKHFLW\QDPHG DVWUHHWWKHUHÂł7KHRGRUH6SHFKW'ULYH´LQKRQRURIWKHFLW\ÂśVÂżUVWSRVWmaster. Actually, there were some streets named before the project began in the early-1930â&#x20AC;&#x2122;s, among them San Antonio, Travis and Austin Streets, which retained their old names. However, what is today known as Main Street was originally San Saba Street. Despite the fact that all of the streets in the city are now named, chances are that if one meets a native of long standing in the community and asks directions, heâ&#x20AC;&#x2122;ll give directions using landmarks in the city, by prominent businesses or houses, or by sketching out a route on a slip of paper. Fredericksburg still likes to think of itself as a small town, where most people know each other and where they live. )RUWKRVHZKRDUHQHZWRWKHFRPPXQLW\DQGZDQWWRÂżQGWKHLUZD\ around town, a map in included toward the back of this Visitors Guide.

Visitors to Fredericksburg are welcomed by the street signs. â&#x20AC;&#x201D; Standard-Radio Post file photo

Monarch Physical Therapy, LLC Transformation into Wellness

Physical Therapists and Massage Therapists trained in John F. Barnes Myofascial Release to decrease pain, improve function and align posture. Commercial Insurance, Medicare and Self-Pay accepted. Physical Therapy - Massage Therapy Biomat (in house or available for rental)

830.431.0773 28604 IH 10 West, Suite 4 Boerne Texas 78006

Locally Owned n£äĂ&#x160;7iĂ&#x192;Ă&#x152;Ă&#x160;>Â&#x2C6;Â&#x2DC;Ă&#x160;-Ă&#x152;Ă&#x20AC;iiĂ&#x152;Ă&#x160;UĂ&#x160;nĂ&#x17D;äÂ&#x2021;Â&#x2122;Â&#x2122;Ă&#x201C;Â&#x2021;Ă&#x17D;Ă&#x201C;Ă&#x17D;x

203 Hwy. 87, Suite 202, Comfort TX 78013


THE SPIRIT OF FREDERICKSBURG Bravery. Honesty. Cooperation. Those are just some of the positive traits shown by early settlers to Fredericksburg. Together, they carved out an existence rich in culture and quality of life, while building the foundation for a town that continues to flourish more than a century and a half later. Clean streets, pride in property, and respect for neighbors are a part of what makes Fredericksburg one of America’s favorite small towns. And working together is still an attribute that pervades the city’s spirit.

FREDERICKSBURG STREET INDEX Acorn .....................B3 Adams N. ...............B3 Adams S. .........B3-D2 Agave ....................A3 Airport Rd. .........D,E1 Alfred .................... C3 Amberstone ...........A5 Apple .................... C4 Armory Rd. . .A1,2-B2 Austin E. ...A,B3-B,C4 Ave A .....................A3 Ave B .....................A3 Ave C .....................A3 Ave D .....................A3 Barons St. ..............B2 Basse Ln................B2 Bell........................ C4 Bending Oaks ........E5 Bernhard Rd. ........ D1 Beverly.................. C4 Bluebird .................B3 Bluebonnet ........C,D4 Bob Moritz Dr. ........A2 Bob White Tr. ........ D3 Boos Lane .............E2 Bowie ...............B2-A3 Brehmer .............C,D4 Briarwood Cir. ........A5 Broadmoor Dr. .......A4 Buena Vista .......... C3 Bunny Dr. ...............A3 Burbank ...........A3-B4 Business Ct. ..........E1 Campers Loop .......E1 Candlelight Dr. .......A4 Catholic Cemetery Rd. ...............................A3 Cedar .................... C3 Centre ..............A3-B4 Chase Oaks ...........E5 Cherry ................ A,B3 Cherrywood Dr.......A4 Clyde Run ..............A4 College ...............B3,4 Columbus ..........C,D4 Cora .......................B4 Cottonwood ...........B3 Country Haven.......A5 Countryside Bend . D5 Courtney ................B3 Creek ...............B3-C4 Creekview ..........D,E5 Crenwelge ............ C4 Crestwood .............A5 Cristol Dr. .............. D4 Crockett ...........C3-A4 Cross .....................B4 Cross Mtn. Dr......A3,4 Crosswind ..............E1 Cypress .................A3 Darlington Dr..........C2 Dawn .................... D4 Deer Creek ........... C5 Deer Hollow .......... C5 Deer View ............. C5 Deer Way .............. C5 Deet Trail .............. C5 Doe Run Hollow.....A3

Driftwood ............A4,5 Dudley Way ...........A4 Dusk ..................... D4 Eagle .................C,D4 Eckhardt Ln. ......... D3 Edgewood..............A4 Edison................ A,B3 Elk......................B,C4 Ellebracht...............A5 Elm ..................A4-B3 Englemann Dr........C2 Ettie ...................... C3 Fair Dr. ......... D,E1-E2 Forest Trail............ C4 Franklin ................. C4 Frederick Rd. .........A5 Friendship Lane ......... ............................D2-5 Fulton...............B2-C3 Glenmoor ...............A4 Glenwood ..............A5 Goehmann Lane ........ ...........................C4-5 Gold Rd. ................A2 Golf Course Loop...E1 Grothe................ A,B4 Granite Ave. .......... C3 Green Meadows Ln. .. ...............................D2 Green Meadows Blvd. ..............................D2 Green Meadows .Ct... ..............................D2 Green Oaks Loop ...... ..............................D2 Hackberry W. ......B3,4 Hale St. ................. C3 Hawthorn Ln ..........A3 Hedgestone ...........A5 Henrietta ............... C3 Henrietta Ct. ......... C3 Heritage Hills Dr.....E5 Highway St. ....... C3,4 Hill St. ................... C3 Hollmig Lane......D,E3 Holly Lane..............A3 Industrial Loop ...... D5 Irene ..................... D3 Jack Nixon .............A2 James ....................A2 Jerry...................... D3 Jessica...................A3 Jessie ................... D2 Joe Duderstadt Ln. .... ...............................B2 Jon ........................ C5 Kay .................... A,B3 Kerr Rd. .............C,D1 Kraupahen ............ C3 Kristofer .................A3 Lady Bird Dr...........E1 Laurel.....................A3 Lee........................ C4 Lightstone ..............A5 Lincoln .............C3-B4 Live Oak ............ C1-3 Llano St. ..........B4-C3 Lone Oak .............. C4

Longhorn ........... C3,4 Lower Crabapple ....... ......................B4-A4,5 Lupine Lane ...........A3 Main St. (290) ..B3-C4 Maple St. ...............A2 Mariposa Dr. .......... E5 Mazurek Loop ........B2 Meadowbrook ........E5 Meadow Lark ........ C4 Mesquite ............... C4 Metzger Rd. ...........A3 Milam ...............A4-C3 Mistletoe ................B3 Mockingbird ...........B3 Morning Glory Dr.. .A4 Morse...............A3-B4 Mountain View .......A4 Mueller .................. C3 Mustang .............C-D4 Nature ....................E5 Nimitz Circle ..........A4 Nimitz Pkwy. ..........B3 Nimitz St. ........... A,B4 Northern Red Oak..... ...............................D2 Northwood Hills .....A4 Oakhaven ............. C4 Olive ..................... C4 Orange.............A4-C3 Orchard...............B3,4 Paintbrush Hollow..A3 Park St. ................. C3 Parkview ............... D2 Pavilion Dr. ............E1 Peach ....................B3 Peach Tree Ln .......E5 Pear ...................... C4 Pecan ....................B3 Persimmon Ct. .......A3 Petsch Dr. ..............E1 Pike....................... C4 Pine .......................B4 Plum ......................B3 Poplar ................... C3 Post Oak Rd. ...B2-C3 Prickly Pear Ct. ......A3 Pyka Rd. ............ D1,2 Quailwood Dr. .....A4,5 Recreation Loop ....E1 Redbird Ln. ............E5 Reuben ................. C3 Ridgewood.............A5 Riley Ln..................A4 Robert ....................A2 Rock House Rd .....A2 Rose ......................B3 Royal Oaks Dr. ......B1 Running Buck ........A3 San Antonio St ........... . .........................B3-C4 Santa Rosa ........... C3 Scarlet Oak Ct ...... D2 Schubert St. .....B3-C4 Seamoor ................A4 Settlement Dr. ........A3 Shannon ............... D2 Shaw..................... C3 Shorty Crenwelge Rd. ...............................A2

Shorty’s Lane.........A2 Silver Maple .......... C3 Sky Lane............... D2 Skylark .................. C4 Smith Rd. .............. C2 Smokehouse Rd........ ...............................C2 Song Bird .............. D5 Spotted Fawn ........A3 Spruce St. ..............B4 St. Ann St.............. C3 St. Geralda ........... C3 St. Marys .............. C3 Stadium Dr. ........... D3 Stone Canyon ........A5 Stone Forest ..........A5 Stone Gate ............A5 Stone Haven ..........A5 Stone Hollow .........A5 Stone Ledge ..........A5 Stone Nook ............A5 Stone Oak..............A5 Stone Way .............A5 Stone Wood ...........A5 Summer Hill ...........E5 Summit Circle ....... C3 Summit Forest .......A5 Sunday Circle ........E5 Sunrise ................. D4 Sunset ...................A3 Sycamore ..............B4 Tanglewood ...........A5 Tanya .....................A3 Theodore Specht ...A2 Thiele .................C,D3 Timberidge .............A4 Tivydale Rd. ....... D1,2 Town Creek Ct. ......B3 Trailmoor ...............A4 Travis ........A,B3-B,C4 Ufer .................... C3,4 Upper Liveoak Rd. ..... ...............................D1 Vera .......................A2 Walch .................... C3 Waldrip ................. C4 Walnut .................. C3 Washington ......C3-B4 West Ln. ............... C3 Weston Ln. ........... D3 W Royal Oaks Dr ...B1 Westmoor Dr..........A4 Whitney..................B3 Wildwood ...............A5 William .................. C3 Windcrest.............. C3 Winding Oak ......... D4 Winding Way ..... C2,3 Winding Way Ct. ... C2 Windmill Oaks....... D2 Windsong.............. D1 Winifred .................B3 Wisteria..................A2 Woodcrest .............A3 Woodway Ct. .........A5 Yaupon St ..............A3 Yucca St. ...............B2


Advertiser Index Looking For A Place To Eat? Airport Diner .............................................. 57 Altdorf ...........................................................54 Aüslander......................................................35 Becky’s Juicerie ..........................................87 Buc’s Bar & Grill........................................147 %XUJHUs%XUJHU..........................................23 Cabernet Grill .............................................29 Castell General Store ............................. 138 Catfish Haven .............................................. 77 Cranky Frank’s Barbeque....................... 170 Crossroads Saloon & Steakhouse.........83 Dairy Queen ............................................... 80 David’s Old Fashioned Barbecue ........162 Der Daiwel Rock Bar .............................166 Der Linden Baum .......................................25 Dutchman’s Market ................................. 153 El Gallo........................................................ 136 Fredericksburg Brewing Co. .................. 57 Fredericksburg Herb Farm .....................56 Fredericksburg Pie Co .............................52 Hilda’s.............................................................66 Hondo’s .........................................................36 Java Ranch - Fredericksburg ...............106 JEK’s Pit Stop ...........................................102 Lincoln St. .....................................................61 Old German Bakery & Restaurant.......70 Opa’s Smoked Meats .............................. 163 Pasta Bella ....................................................99 Peach Tree, The............................................. 3 Porky’s ...........................................................24 Race Barn .................................................... 151 Rathskeller Restaurant ............................61 Sozial Haus ...................................................30 The Club .......................................................121 West End Pizza ........................................ 164 Need A Place To Stay? Absolute Charm ....................................... 139 Barons CreekSide .....................................121 Best Western ............................................106 Cottage on Spotted Fawn .................... 125 Das Jager Haus.........................................162 Econo Lodge. .................................................11 Erbstuck Ranch .......................................... 171 Frederick Motel ..........................................27 Fredericksburg Guest House Reservations ........................................148 Fredericksburg Reservation Service .....................................................32 Fredericksburg Inn & Suites ...................69 Gastehaus Schmidt....................................35 Hangar Hotel............................................... 57 Haussegen Platz .................................14, 143 Inn on Baron’s Creek .................................31 Italian Place, The ..................................... 166 King Wood Suites.....................................172 La Quinta Inn & Suites ........................... 146 Quiet Creek RV Resort .........................108 Rock House Hideaway ............................177 Stonewall Valley Ranch........................... 20 Sunset Inn & Suites ................................. 158 Ready To Go Shopping? All Gussied Up ............................................111 Ambriz Jewelry ...........................................31 Amish Market .............................................. 73 Antique Mall of Fredericksburg ..........105 Auer Haus.....................................................39 Barefoot ......................................................168 Beauty Lounge, The....................................91 Blue Steak Records ................................. 153 Books on Main ............................................36 Burg’s Corner ............................................ 165


Cate Zane .....................................................79 Champé Jennings...................................... 20 Cherokee Charm ......................................130 Choo Choo Trolley ......................................19 Cowgirl Loca ...............................................65 Der Alte Fritz ..........36Der Küchen Laden 115 Dogologie....................................................161 Dooley’s Store........................................... 138 Dutchman’s Market ................................. 153 D’vinely Designed ......................................53 East Hills .....................................................102 Eleven Squared Venue............................ 163 Farm House ................................................161 First Friday Art Walk................................ 76 Fischer & Wieser das Peach Haus .......33 Fitz and Hollerin ........................................ 75 Fredericksburg Art Guild ........................40 Fredericksburg Fudge .............................. 51 Fredericksburg General Store ............. 156 Fredericksburg Jewelers ..........................91 Fredericksburg Paper Goods .................22 Fredericksburg Popcorn Emporium .....91 Friendly Natives..........................................66 Funky Monkey ..............................................91 Gardens at the Ridge, The .................... 142 GoFred ............................................................ 6 Grasshopper & Wild Honey ................. 135 Haberdashery ............................................ 165 Havana Reef..................................................21 HCM Thrift Shop ...................................... 170 Heirlooms .....................................................44 Henfeathers ...............................................102 Hill Country Antler Art ...........................93 Hill Country Bicycle Works ...................119 Hill Country Outfitters .......................... 134 Hill Country Propane .............................140 Hill Country Trading Post ................... 123 Hudson & Taylor ..........................................17 Jabberwocky ............................................... 74 James Avery Jewelry ...............................26 Kramer’s, The Outdoor Store ................63 Kuckuck’s Nest ............................................27 Larry Jackson Antiques .......................... 129 Leathers with Style ..................................110 Linens-N-More ........................................7, 15 Lone Star Candy Bar ................................. 75 Luckenbach, Texas ......................................99 Madlyn’s....................................................... 159 Main Street of Fredericksburg (West) 45 Marilyn’s of Fredericksburg ....................21 Olmer Native Plants Nursery.................51 Peach Tree, The............................................. 3 Red Baron Antique Mall ........................ 124 Romancing the Stone................................91 Secret Garden, The ...................................22 Smitten ...........................................................81 Something for Men ...................................111 Steve Horn Originals ...............................147 Street Dreams ...........................................103 Talk of the Town ..........................................91 Tejas Smoke Depot................................... 64 Tenley’s Boutique .......................................65 Texas Jack Wild West Outfitter ................ ...........................................................72, 131 Things in a Room ..................................... 156 T-Shirts Etc ...................................................17 Timeless Menagerie ................................162 Trudy’s Treasures Resale Shop ............. 122 Waldos......................................................... 132 Western Galleries ................................... 169 Wildflower Ridge Alpaca Ranch ........ 164 Wildseed Farms..........................................89 Wolfmueller Books ..................................127

Yee Haw Ranch Outfitters ....................116 What Can We Do For Fun? Admiral Nimitz Foundation.....................71 Becker Vineyards Lavender Fest .......... 80 Bestfest at Marktplatz ..............................95 First Friday Art Walk................................ 76 Fredericksburg Art Guild ........................40 Fredericksburg Crawfish Festival ......... 47 Fredericksburg CVB ................................128 Fredericksburg Festivals ........................ 169 Fredericksburg Music Club ................... 145 Fredericksburg Theater Co .................... 171 Friends of Gillespie Co. Country Schools ................................................................. 107 Ft. Martin Scott ..........................................92 Gillespie County Fair & Festivals Assn .... ................................................................. 179 Hill Country Antique Tractor Club ..... 126 Hill Country Film Festival .......................32 Lady Bird Johnson Golf Course .............13 Luckenbach, Texas ......................................99 Lyndon B. Johnson National Historical Park ...........................................................31 National Museum of Pacific War..........71 Pecan Grove Store ....................................36 PCAA ........................................................... 136 Pioneer Museum ......................................102 Questover Studios ................................... 153 Salvation Army Community Center...130 Tabak Haus ..................................................167 The Club .......................................................121 Texas Rangers Heritage Center ............26 Wedding & Event Showcase .................92 Wildseed Farms..........................................89 Verein’s Quilt Guild................................. 133 Builders/Designers/Remodelers Bill Dunn Construction ............................43 BMC ................................................................59 Builders First Source .............................. 154 Boot Ranch ................................................137 Chris Kaiser Builder, Inc .........................149 Curl’s Construction.................................. 115 Curtis Staudt Construction...................105 Durst Homes ...............................................48 Farm & Ranch Construction.................160 Galle Designs ............................................160 Hominick Custom Builders ....................... 2 Inside Story ................................................ 170 Kerrville Window Fashions .................. 122 Latigo Builders ..........................................180 Laughlin Homes & Restoration ............. 77 Maggie Gillespie Designs........................ 67 Moellering Construction, Inc .............. 152 Sierra Homes...............................................98 Slaughter Design Studio.........................127 Stone Ridge .................................................97 Tatsch Well Service ...................................49 Texas Steel Building ................................ 126 Tony Martin, Inc ..........................................55 Vollmar Pond & Lake Management... 158 Churches First Baptist Church ................................ 153 Holy Ghost Lutheran Church ............... 170 Oakhills Church ..........................................46 Resurrection Lutheran Church ............148 Zion Lutheran Church ............................ 132 Health/Medical Agility Orthopedic & Sports Medicine ............................................... 136 Cornerstone Clinic...................................148

Fredericksburg Clinic.............................. 153 Heritage Place ..........................................109 Hill Country Memorial Hospital................. ...............................4, 5, 101, 113, 133, 170 Main St. Urgent Care ...............................24 Mid-Texas Health Care ...........................102 Standards Home Health ..........................82 Monarch Physical Therapy .....................173 Walker, Michael M.D. ............................ 144 Real Estate/Realtors Absolute Charm ....................................... 139 Boot Ranch .................................................137 Fredericksburg Realty .............................178 Ranch Enterprises .................................. 150 Real Living Fredericksburg ..................... 47 Sage ...............................................................172 Walnut Canyon Cabins .......................... 155 Schools Heritage School .........................................32 St. Mary’s Catholic School .................... 159 Spas/Massage/Yoga Reiki in the Hill Country........................ 125 Nature’s Spa.................................................56 Spa at Inn on Baron’s Creek....................31 Breweries/Wineries/Orchards AJ Liquors....................................................173 Bariloche Farm ..........................................147 Becker Vineyards ........................................54 Burg’s Corner ............................................ 165 Der Daiwel .............................................. 166 Fiesta Winery............................................. 113 Four Point Cellars.....................................141 Fredericksburg Winery .............................. 9 Gold Orchards...........................................166 Grape Creek Vineyards ............................ 37 Hill Country Express Tours ................... 169 Inwood Estates ......................................... 124 Messina Hof Hill Country Winery....... 90 Narrow Path Winery ............................. 135 Pedernales Brewing Company ............ 146 Pedernales Cellars ....................................116 Torre di Pietra ............................................157 Wedding Oak Winery ..............................89 Automotive Crenwelge Motor Sales...........................46 Kustom Klean Car Wash..........................85 Quality Lube .............................................. 142 Stroeher & Son/Stroeher & Olfer’s ....64 Sweet Dreams ..........................................103 Services Capitol Farm Credit ............................... 26 Frantzen, Kaderli & Klier Ins ..................50 FIrstmark Credit Union.......................... 154 Fredericksburg CVB ................................128 Hill Country Propane .............................140 Joseph Financial Partners .................... 138 Maggie Gillespie Designs........................ 67 Shweiki Media........................................... 152 SRJ Photography .......................................36 Tatsch Well Service ...................................49 Maps Maps ...............................................78, 174-175


 V(UD5HQRYDWHG%DUQv/DUJHRU6PDOO*DWKHULQJV On-site Accommodations for Immediate Family and Friends 20 Acres of Pristine Land Less than 1 mile from downtown Fredericksburg


217 East Main 路 Fredericksburg, Texas

830-997-6531 路 830-739-2547

Selling Quality, Unique Homes & Ranches in the Texas Hill Country for over 50 years.

2016 CALENDAR OF EVENTS February 7 .................. Fredericksburg Band Booster Turkey Dinner February 20-21 ........... Texas Gun & Knife Show February 27 ................ Gillespie County BB Match February 26-28 ........... Hill Country Home & Garden Show March 3 ...................... Fredericksburg Chamber of Commerce Banquet March 4 ...................... Original Texas Star Trail Ride March 19-20 ............... Silver Spur Gun & Blade Show

Invites You To Join In The Family Fun, Entertainment, Dancing and Pari-Mutuel Horse Racing This Season at the Gillespie County Fair Grounds.

April 9 ......................... Ambleside School Fundraiser April 15 ....................... Ragnar Relay-Fredericksburg to Austin April 23 ....................... 4-H District 10 Livestock Judging May 5.......................... Farm & Ag Day May 12........................ Beef Range Field Day May 14........................ American Cancer Society Relay for Life June 10-12 .................. Antique Tractor & Engine Show July 2-3 ....................... Pari-mutuel Horse Races July 16 ........................ Sommerzeit with Concert & Dance July 16-17 ................... Pari-mutuel Horse Races TBA ............................. GCFFA Meat Goat & Lamb Futurities August 13-14 .............. Pari-mutuel Horse Races August 14 .................. Gillespie County Race Day Classic Steer Show August 14 ................... GCFFA Lamb Futurity August 25-28 .............. 128th Gillespie County Fair August 25 ................... Texas Country Showdown August 26 ................... 128th Gillespie County Fair Parade August 26 ................... Concert & Dance August 27 .................. Concert & Dance August 27-28 .............. Pari-mutuel Horse Races August 28 ................... Texas Wether Buck & Doe Sale September 10 ............ 7th Annual Fredericksburg Professional Bull Riding September 10 ............ Hill Country Dorper September 24 ............ 20th Annual Scholarship Fest October 15 ................. Gillespie County Swine Producers Sale October 29-30 ............ Texas Gun & Knife Show November 12-13 ........ Texas Presentations Antique Show November 19 ............. Wild Game Dinner November 25-27 ........ The Peddler Show December 16-18 ........ Silver Spur Gun & Blade Show


GILLESPIE COUNTY FAIR & FESTIVALS ASSOCIATION P.O. BOX 526 - FREDERICKSBURG, TX 78624 830/997-2359 - WWW.GILLESPIEFAIR.COM Schedule is subject to change without notice.

bu i l di ng th e te xas hom e stead For over 19 years, Latigo Builders have crafted and restored fine custom homes throughout the Texas Hill Country and South Texas. For information scan the QR code, see us online at or visit our new office on West Main in the newly restored 1870 German homestead. 714 we st mai n str eet

fredericksburg, texas


Go Fredericksburg  

Spring/ Summer 2016

Go Fredericksburg  

Spring/ Summer 2016