Skip to main content

Liam Gillick, One long walk… Two short piers…

Page 1

LIAM

GILLICK


SNOECK

1. April bis 8. August 2010 Kunst- und Ausstellungshalle der Bundesrepublik Deutschland, Bonn


LIAM

GILLICK Ein langer Spaziergang … Zwei kurze Stege …*

*One long walk … Two short piers…


Cover Image Developmental, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 4 Teile je 4 elements each 30 x 120 x 8 cm GegenĂźberliegende Seite facing page Everything Is Possible, 2008 GraďŹ k Graphic A Guide to Democracy in America, New York, Creative Time Books

4.

Liam Gillick


5.

Ein langer Spaziergang... Zwei kurze Stege...*


VORWORT

Die skulpturalen Gebilde und Setzungen von Liam Gillick sind seit 20 Jahren ein markanter Teil der aktuellen Kunst und ihrer Ausstellungen. Mit ihrem scheinbar lapidaren Auftreten lassen sie sich auf den ersten Blick keinem herkömmlichen Skulpturbegriff zuordnen. Doch zugleich zeigen sie eine starke – nahezu feierliche – geistige Präsenz. Der Betrachter erkennt, dass es nicht um die Regale, Bühnen, Deckenelemente geht, die man zunächst wahrzunehmen glaubt, sondern um autonome, funktionslose Gebilde, die ihn mit vielfältigen, offenen Fragen konfrontieren und einen Denkprozess in seinem Kopf auslösen. Diese meisterliche Weise, die Skulptur aus ihrem hehren Auftreten zu lösen und sie zugleich geistig aufzuladen, erneuert auf unerwartete Weise die beste Tradition der Skulptur. So war es überfällig, eine erste große museale Übersicht von Liam Gillicks Werk zu geben und seine schon über 25 Jahre andauernde Entwicklung zu bilanzieren. Die Ausstellung der Kunst- und Ausstellungshalle der Bundesrepublik Deutschland in Bonn sucht die wesentlichen Linien dieser Entwicklung herauszuarbeiten und kritisch zu gewichten. Es geht darum, Liam Gillicks Vision einer Kunst, die sich ohne Umweg über die Sprache an das Denken des Betrachters wendet und zugleich neue Bilder und eine neue Formensprache für unser Jahrhundert schafft, einer breiteren Öffentlichkeit vorzustellen. Diese erste große Zwischenbilanz eines Werks, das zu den einflussreichsten Werken dieses Jahrhundertumbruchs zählt, besitzt aber auch einen zweiten Anlass, der in besonderer Weise mit dem Sinn und Zweck der Kunst- und Ausstellungshalle in der deutschen und internationalen Museumslandschaft eng verbunden ist. Im Februar 2009 berief Nicolaus Schafhausen, Kommissar des deutschen Beitrags zur 53. Biennale von Venedig, Liam Gillick als einzigen Künstler für den deutschen Pavillon. Diese Wahl war in künstlerischer Hinsicht mehr als begründet, wie die eingangs geschilderte eminente Rolle von Liam Gillick im Kunstgeschehen der letzten zwanzig Jahre belegt. Diese Entscheidung bedeutete aber auch ein kulturpolitisches Statement. Erstmals seit der Gründung der Biennale von Venedig im Jahr 1895 ließ sich ein Land ausschließlich durch einen Künstler mit ausländischem Pass vertreten, der ganz allein den Landespavillon bespielte. Schon damals erachteten wir es als genuine Aufgabe der Kunst- und Ausstellungshalle der Bundesrepublik Deutschland, den Künstler anschließend auch dem Publikum in Deutschland vorzustellen. Dies schien umso wichtiger, als die bereits mehrfach anvisierte Überblicksausstellung zu seinem Werk bislang noch nicht zu Stande gekommen war. Unsere Ausstellung wurde demgemäß in den letzten 14 Monaten erarbeitet, wobei die ersten Überlegungen noch im Vorfeld der 53. Biennale von Venedig im Juni 2009 angestellt wurden. Wie oftmals in Venedig, kam es vor Ort dann aber zu unerwarteten Reaktionen der Kunstkritik, die sich, grob gesehen, in zwei Lager teilte. Weltweit betrachtet, erzielte der deutsche Pavillon der Biennale von Venedig 2009 das breiteste Medienecho, das einer deutschen Ausstellungen seit Jahrzehnten zuteil geworden war. Liam Gillicks raumfassende Skulptur „How Are You Going to Behave? A Kitchen Cat Speaks“, die alle Räume des deutschen Pavillons bespielte, wurde sachlich im Kontext des bisherigen Werks des Künstlers diskutiert. Demgegenüber reagierte die deutsche Kunstkritik überwiegend negativ. Die Berechtigung, einen ausländischen Künstler mit der Vertretung des Landes bei einer derart bedeutenden internationalen Ausstellung zu betrauen, wurde dabei kaum problematisiert – weniger jedenfalls als in der internationalen Presse. Doch bemängelte ein Teil der deutschen Kunstkritik, die Skulptur thematisiere zwar die nationalsozialistische Architektur des deutschen Pavillons, der 1938 auf Veranlassung von Adolf Hitler errichtet worden war, bediene sich

6.

zu diesem Zweck aber zu unscheinbarer Mittel. Andere Kritiker vermissten gar jegliches Eingehen auf die Architektur des Dritten Reichs. Insgesamt betrachtet, suchte die deutsche Kunstkritik also offensichtlich vergeblich nach der großen Geste, die seit der Einzelausstellung von Gerhard Richter in diesem Pavillon 1972 zum Paradigma der künstlerischen Reaktion auf die Vergangenheit des Pavillons geworden war. Diese Divergenz zwischen Innen- und Außensicht macht es noch dringlicher, das Werk von Liam Gillick dem deutschen Publikum breiter vorzustellen. Entsprechend den Aufgaben der Kunst- und Ausstellungshalle geht es dabei darum, das in den Augen der internationalen Öffentlichkeit mit der Berufung Gillicks in den deutschen Pavillon aufgestellte Manifest zur Überwindung des Nationalitätenprinzips – es stammt noch aus der Gründungsphase der Biennale vor dem Ersten Weltkrieg – als innovativen Akt zu begreifen und mit all seinen Implikationen zu erörtern. Der deutsche Pavillon der Biennale von Venedig mit der ,Küche‘ von Liam Gillick hat Fragen zur Vision der Kunst im 21. Jahrhundert und zum Kunstverständnis in der Epoche der Globalisierung gestellt, die es verdienen, aufgegriffen und eingehender zur öffentlichen Diskussion gestellt zu werden. Der kulturpolitische Akt dieser Berufung in den deutschen Pavillon der Biennale 2009 wäre möglicherweise nur als eine artifizielle Geste aufgefasst worden, wenn Liam Gillick nicht einer der wenigen Künstler der Gegenwart wäre, dem das Prädikat des visionären Künstlers zuerkannt wird. Dem Visionären im Werk Liam Gillicks gilt denn auch das Hauptaugenmerk unserer Ausstellung. Eingangs wurde darauf hingewiesen, wie sehr Liam Gillick auf seine Weise den Skulpturbegriff erneuert, ihn vom Pathos der Moderne und der Minimal Art reinigt und eine direkte Verbindung von Sehen und Denken, von Wahrnehmung und Nachdenken über soziale Tatbestände initiiert. Mit diesem Aspekt seines Werks zählt Liam Gillick zu den einflussreichsten Vorbildern der jüngeren Künstlergeneration. Er wird von vielen jüngeren Künstlern als Vordenker eines neuen Kunstbegriffs für das 21. Jahrhundert gesehen. Ein weiterer wichtiger Aspekt ist Liam Gillicks Umgang mit eigenen Texten und verbalen Statements, die, obgleich von der bildnerischen Arbeit getrennt, mit dieser doch ihre Suche nach einer neuen Vision und einer neuen Rolle der Kunst in einem komplexer werdenden sozialen Gefüge teilt. Der Einklang von bildnerischer Arbeit und präziser verbaler Äußerung bringt Liam Gillick streckenweise eine künstlerische und theoretische Rolle ein, die – wiederum vor allem für die jüngere Generation – durchaus jener von Joseph Beuys in den 1970er und frühen 1980er Jahren vergleichbar ist, auch wenn sich die generelle Tonlage beider vor dem Hintergrund gewandelter künstlerischer und gesellschaftlicher Rahmenbedingungen nachhaltig unterscheidet. Der immense Einfluss, den Liam Gillicks Werk ausübt, wird freilich erst ermöglicht durch einen dritten Aspekt: die stupende Sicherheit in der Behandlung von Form und Farbe, aus der heraus er mit seinem Werk die Grenzen von reiner und angewandter Kunst, von Skulptur und Design verschiebt und neu bestimmt. Unser Dank gilt zuallererst dem Künstler für die intensive Kooperation und seinen Einsatz bei Ausstellung und Katalog sowie den privaten und öffentlichen Leihgebern, die sich für die Ausstellung von wichtigen Stücken ihrer Sammlung getrennt haben. Die Ausstellung wurde von Rainald Schumacher kuratiert und von Susanne Kleine als Ausstellungsleiterin organisiert. Unser besonderer Dank gilt den Galerien von Liam Gillick für die mannigfaltige Kooperation sowie allen Beteiligten und Verantwortlichen des deutschen Pavillons der Biennale von Venedig 2009 für die verständnisvolle Aufnahme und Unterstützung des Vorhabens. Robert Fleck Intendant Kunst- und Ausstellungshalle der Bundesrepublik Deutschland


FOREWORD

Liam Gillick’s sculptural forms and settings have become established over the past twenty years as a prominent part of contemporary art and its exhibitions. With their seemingly terse appearance, they cannot be classified, at first glance along traditional sculptural lines. And yet at the same time, they evince a strong – almost celebratory – intellectual presence. The viewer recognises that it isn’t about the shelves, stages, and ceiling elements themselves, which one thinks one is looking at first, but rather the autonomous, functionless forms that confront him with diverse, open questions and duly initiate a thought process in his mind. The masterful way in which sculpture is released from its noble, portentous aspect and, at the same time, is charged intellectually, renews the best traditions of sculpture in a most unexpected way. Thus, the first museumbased retrospective of Liam Gillick’s work, imbued with the aim of taking stock of over twenty-five years of continued development, is indeed long overdue. The exhibition, held by the Kunst- und Ausstellungshalle der Bundesrepublik Deutschland in Bonn, has endeavoured to trace and critically assess the essential trajectory of this development. The purpose is to introduce Liam Gillick’s vision of art to a wider audience – a vision that appeals to the viewer’s thought processes without deviation via language and creates new images and a new lexicon of form for our young century. This first interim assessment of Gillick’s work – considered to be one of the most influential oeuvres at the turn of the millennium – is motivated by a second reason, intimately connected with the specific aim and purpose of the Kunst- und Ausstellungshalle der Bundesrepublik Deutschland within the German and international context of contemporary museums. In February 2009, Nicolaus Schafhausen, commissioner for the German contribution to the 53rd International Venice Biennale, selected Liam Gillick as the sole artist responsible for the entire German Pavilion. This choice was more than justified on artistic merit alone, to which Gillick’s aforementioned pre-eminent role within art over the past two decades amply testifies. This decision was also a cultural-political statement. For the first time since the foundation of the Venice Biennale in 1895, a country had chosen an artist with a foreign passport to provide the sole contribution to the entire National Pavilion. Even at the time, we considered it to be a true duty of the Kunst- und Ausstellungshalle der Bundesrepublik Deutschland to present this artist to the public in Germany, following the exhibition in Venice. This seemed all the more imperative, as the retrospective exhibition – already scheduled many times previously – had not yet materialised. Accordingly, our exhibition has been developed during the past fourteen months, although our initial considerations had already been mooted in the run-up to the 53rd Biennale in Venice, in June 2009. However, as is often the case in Venice, there were some unexpected reactions from the art critics, which can be split broadly into two camps. On a worldwide scale, the German Pavilion at the 2009 Venice Biennale received the broadest media response that a German exhibition has received for decades. Liam Gillick’s spatial sculpture “How Are You Going to Behave? A Kitchen Cat Speaks”, occupying every room in the German Pavilion, was discussed with an objective focus within the context of his previous works. In view of this, the voice of German art criticism was predominantly negative. The justification for entrusting a foreign artist with the representation of a country at such an important international exhibition was, however, not only not questioned, but also even scarcely raised as problematic in itself – at any rate, less so than in the international media. A section of German critical opinion regretted that although the sculpture “How Are You Going to Behave? A Kitchen Cat Speaks” treated thematically the aspect of the German Pavilion’s National Socialist architecture,

7.

commissioned by Adolf Hitler in 1938, yet its use of material was far too random and insignificant for this purpose. Other critics were even at pains to find any engagement at all with the architecture of the Third Reich. On the whole, German art criticism was searching in vain for the grand gesture which, since Gerhard Richter’s solo show in the same pavilion in 1972, had become paradigmatic of an artistic reaction to the pavilion’s past. This divergence between both an internal and an external view makes it all the more pressing to present Liam Gillick’s work to the German public. In accordance with the remit of the Kunst- und Ausstellungshalle der Bundesrepublik Deutschland, the aim here is to comprehend the programmatic intention of a surmounting of the nationality principle – which Gillick’s selection for the German Pavilion clearly represents in the eyes of an international audience and which dates back, incidentally, to the initial foundation phase of the Biennale before the First World War – as an innovative act, and moreover, to discuss all its implications. Liam Gillick’s ‘kitchen’ in the German Pavilion at the Venice Biennale has undeniably posed questions of both the vision of art in the twenty-first century and the understanding of art in the era of globalisation – questions that deserve to be taken up and subjected to a more thorough public debate. The cultural-political act of this selection for the German Pavilion at the 2009 Biennale could possibly have been regarded as an artificial gesture, if Liam Gillick were not the only contemporary artist whose work has been unanimously described as visionary. This visionary aspect of Gillick’s work forms the main focus of attention in our exhibition. At the outset, reference was made to the individual way Liam Gillick has revitalised the concept of sculpture, divesting it of the pathos of Modernism and even of Minimal Art and initiating a direct link between seeing and thinking, between a perception of and a reflection on social circumstances. On account of this particular aspect of his work, Liam Gillick is now deemed to be one of the most influential exponents among the younger generation of artists. Furthermore, he is considered by many young artists to be the initiator of a new concept of art for the twenty-first century. A further important aspect here is Liam Gillick’s use of his own texts and verbal statements that despite being separate from the artistic oeuvre in a strict sense, nevertheless share the quest for a new vision of and a new role for art within an increasingly complex social framework. The consonance of his artistic work and his precise verbal utterances lends Liam Gillick – above all, for the younger generation – a partly artistic, partly theoretical role eminently comparable with that of Joseph Beuys in the 1970s and early 1980s, even if the general tonality of both artists’ work is enduringly different against the backdrop of markedly altered, underlying artistic and social conditions. The prodigious influence wielded by Liam Gillick’s work is admittedly only possible through a third aspect which, despite being self-evident, is definitely deserving of mention: namely, his stupendous assuredness in the treatment of form and colour by means of which he shifts and redefines the boundaries of pure and applied art, of sculpture and design. Our thanks are due first and foremost to the artist for his intense level of cooperation and invaluable input into the exhibition and the catalogue, as well as to the private and public lenders, who have managed to spare important pieces from their collections. The exhibition was curated by Rainald Schumacher and organised by the manager of exhibitions, Susanne Kleine. We are most grateful to Liam Gillick’s galleries for their cooperation on many different levels, as well as to all those who were involved in and responsible for the German Pavilion at the 2009 Venice Biennale through embracing and supporting our undertaking. Robert Fleck Director

Kunst- und Ausstellungshalle der Bundesrepublik Deutschland


NICOLAS BOURRIAUD UND WOZU SOLL EIN TITEL GUT SEIN? DIE DISKURSIVE TOPOLOGIE LIAM GILLICKS

ist, die es einschreiben. An diesem präzisen Standort befindet sich somit das Sujet des Werks, das unsichtbare Zentrum seiner Diskursivität: das Ende der Utopie, die Entropie des Imaginären, der Versuch, das Reale zu erfassen.

Zunächst einmal das Personal: der Schalterbeamte der Eisenbahngesellschaft, der Sie dennoch ‚Kunde‘ nennt statt ‚Passagier‘; die Angestellten eines großen Unternehmens und dann die Mitglieder des Thinktanks; Subunternehmer; die selbstverwalteten Arbeiter, die beschließen, die Produktion ihrer Fabrik umzustellen; Aktivisten, denen nichts anderes einfällt, als für die ausländischen Arbeitnehmer Tuba zu spielen; die Firmen Ikea, Volvo und Sony; Materialien wie Aluminium oder Glimmer; schließlich der Vice President von Sony selbst, Masaru Ibuka, der libertäre Bruder Charles Darwins, Erasmus, der US-Politiker Robert McNamara, Robert Buttimore etc. Für ein Œuvre, das als ‚konzeptuell‘, streng oder sogar karg gilt, ist das Werk Liam Gillicks sehr bevölkert. Sowohl von konzeptuellen Personen als auch von Erzählungen, Dialogen, Biografien und Landschaften. Konzeptuell? Sicherlich lässt sich ein solch übereiltes Urteil auf die Tatsache zurückführen, dass der Text darin eine wichtige Rolle spielt und die Grundlage für die gezeigten Formen bildet, wie ein Opernlibretto. Aber gilt dies nicht auch für Tizian oder Sandro Botticelli, wenn es darum geht, das Werk zu verstehen und es nicht nur zu sehen? Und ist das nicht genau der Deal, den zum Beispiel das Werk Marcel Broodthaers’ dem Betrachter offeriert? Es ließe sich besser in das multidimensionale Universum Liam Gillicks eintreten, wenn man seinen Realismus untersuchen würde – in einem breiten historischen Spektrum, angefangen bei Gustave Courbet. Um dann daraus jene Realität herzuleiten, die er beschreiben will: in diesem Fall ein Reales, das nicht weit entfernt ist von der Definition Jacques Lacans, das heißt einen Raum, der nicht auf eine Symbolisierung reduziert werden kann und der sich somit ausschließlich über eine Topologie erschließen lässt. Unter Zuhilfenahme eines formalen Wortschatzes, der auf Minimalismus und Konzeptkunst basiert, problematisiert Gillick die Existenzbedingungen des globalisierten Individuums zu Beginn des 21. Jahrhunderts – und verweist mit diesem Projekt durchaus auf ähnliche Analysen, wie sie fast ein Jahrhundert zuvor in der modernen Malerei auftauchten. Das Werk Gillicks beschränkt sich keinesfalls darauf, ,konzeptuell‘ zu sein, sondern erweist sich als ein narratives Referenzwerk voller Regieanweisungen. Aber ebenso wie die Gedichte von Stéphane Mallarmé oder Blaise Cendrars, manche Filme Jean-Luc Godards oder das Theater Samuel Becketts versammelt es seine Figuren auf leeren Bühnen oder in fragmentarischen Rahmen und bewirkt so ein permanentes Hin und Her zwischen dem Text und den topologischen Strukturen, die ihnen als Stützen, Bühnen oder Rezipienten dienen, wobei die folgende Frage zur zentralen Perspektive wird: Wer entscheidet – und wie – über die Organisation der menschlichen Gesellschaft? „Das Schreiben und die Arbeit der Netzhaut“, erklärt Liam Gillick, „hat alles mit diversen Aspekten zu tun, die mit Fragen von Kompromiss, Strategie, Verhandlung und Erneuerung verbunden sind. Die Arbeit, die Sie in der Galerie oder in spezifischen anwendungsbezogenen Situationen sehen, funktioniert parallel, sowohl in Bezug auf sich selbst, auf andere ähnliche Arbeiten und auf die Texte, die ich verwende.“1 Parallel: ein weiteres Schlüsselwort. Die Strukturen, Pläne, Bilder, Erzählungen und Beschriftungen, die sein Werk bilden, sind keine Linien, die sich treffen, sondern im Gegenteil mit ihrer Parallelität spielen, um eine Landschaft darzustellen, der immer etwas fehlt. Was? Berücksichtigt man, dass Geschichte, Strukturen und Ideologie die drei Säulen der Gillick’schen Ästhetik sind, so gilt es festzustellen, dass das Imaginäre sich dort nur in Form eines Rests zeigt, eines Funkens, der aus dem Clash der weltanschaulichen, formalen und historischen Materialien entstanden

I. Die gesellschaftliche Realität in Echtzeit

8.

In meinen Augen ist Liam Gillick ein realistischer Künstler. Damit will ich sagen, dass seine Arbeit letztendlich eine exakte Wiedergabe dessen darstellt, was er sieht. Das, was er durch unsere unmittelbare Umgebung hindurch wahrnimmt, was also in seinen Ausstellungen im Vordergrund stehen wird, ist nichts anderes als die weltanschauliche Infrastruktur, die die Objekte und die Verhaltensweisen umhüllt, eine Infrastruktur, die die politischen Entscheidungen und die Organisation menschlicher Gesellschaften in Raum und Zeit bestimmt. Realistisch? Das mag bei einem Künstler, dessen Thematik man gern mit Begriffen wie Vorhersage, Drehbuch oder Planung beschreibt, paradox erscheinen. Aber sie werden ja in seinem Werk durchaus als Teil der Gegenwart geschildert; die Vorhersage und ihre ideologischen Derivate bestimmen unsere Aktualität, so wie die hellseherischen Fähigkeiten einiger Figuren in den Romanen Philip K. Dicks die Realität verändern können – von der Zukunft aus, und nicht etwa andersherum. „Der Schlüssel zu allem“, so Gillick in seinem ersten Buch „Erasmus Is Late“, „ist die Erkenntnis, dass der Wunsch, die Zukunft vorherzusagen, für die Entwicklung einer bestimmten Form der freien Marktwirtschaft unverzichtbar ist. Ein Fokus für den Fortschritt. Aber ein Prozess, der durchaus rückwärts ablaufen, mythologisiert oder sogar vergessen werden kann.“2 Die Zukunft ist verschlüsselt in der Gegenwart vorhanden: Sie ist nicht mehr als eine Folge jener geistigen Projektionen, die die ideologischen Rahmen permanent bestimmen, Schatten in einer platonischen Höhle, in der nicht mehr Ideen, sondern Drehbücher oder Pläne das Geschehen lenken. Das ist die Welt, die Liam Gillick beschreibt – durch die Ausarbeitung von Rastern in Volumen, leicht zittrigen Skizzen, Skripten, die er mit Formen inszeniert, welche dem wirtschaftlichen und politischen Feuilleton unserer Zeit entstammen. Das ‚Motiv‘, das Gillick in all seinen Aspekten – ebenso obsessiv wie Paul Cézanne den Mont Sainte-Victoire – darzustellen versucht, ist das Kapital. Ebenso wie der französische Maler versuchte, das chromatische Balkenwerk, die Grundlage für das Schauspiel der Welt, aus dem Chaos freizusetzen, so will auch Gillick – überall, wo sie auftaucht – die Struktur des Kapitals erfassen, welche die menschlichen Aktivitäten und gängigen Bilder beherrscht. Cézanne nahm die Montagne Sainte-Victoire deshalb als kristallisierte Architektur wahr, und nicht als Geflecht von Mineralischem und Pflanzlichem, weil er seine Kompositionen erklärtermaßen aus den ‚geologischen Schichtungen‘ der Landschaft erarbeitete. Gillick dagegen geht von den ideologischen Schichtungen aus, das heißt von den fließendsten, aber auch dauerhaftesten Elementen, die die Gesellschaft durchziehen. Wenn es ihm also darum bestellt ist, die Lebenswelt der Menschen und der ‚Massen‘ in unserer Zeit darzustellen, so geschieht dies nicht in der Art und Weise eines Andreas Gursky, der sie in spektakuläre Bilder verwandelt, die jeder Mediennarzisst sofort verarbeiten kann. Und auch nicht, um irgendwelche Elemente ‚aufzudecken‘, die angeblich vom Kapital unterdrückt werden, zumal seine Arbeit im Gegenteil eher dahin tendiert zu zeigen, dass alles durchaus für alle gut sichtbar ist – so wie „Der gestohlene Brief“ von Edgar Allen Poe. Die ,ideologischen Schichtungen‘, von denen Liam Gillick bei der Entwicklung seiner Arbeiten ausgeht, gehören somit ebenso in den Bereich der Zeitlichkeit wie in den des Raumes: Der grundsätzliche Anachronismus, der „Erasmus Is Late“ charakterisiert, die Erzählung von einem Londoner Dinner, bei dem die Gäste aus verschiedenen Epochen stammen, gehört


zu einem konzeptuellen Realismus, der auf dem Fortbestand oder der Metamorphose bestimmter Einstellungen, Ideologien oder Diskurse im Laufe der Zeit beharrt. „Sollte die Zukunft der Vergangenheit helfen?“ Ist das nicht die Gillick’sche Frage par excellence?3 Der Vice Chairman von Sony und etwa die libertären Denker des 19. Jahrhunderts haben sich tatsächlich etwas zu sagen, und das Werk Gillicks lässt sich als der Raum ihres hypothetischen Treffens in den Shopping-Malls und den FirmenLobbys unserer Zeit betrachten. „Im Text geht es um das korrumpierte Vermächtnis der Aufklärung sowie um die Implikationen, die sich aus der fehlenden Revolution in Großbritannien im ausgehenden 18. Jahrhundert ergaben“4, erklärt Gillick. In Wortfetzen zerstückelte Reden, elliptische oder sybillinische Dialoge, Äußerungen, die an Abstraktion grenzen: In „Erasmus Is Late“ realisiert Gillick ein Relief aus der Grammatik des Planungsund Entscheidungsdiskurses und stellt die abstrakte Logik der politischen Aktion in den Vordergrund – mit stets derselben bohrenden Frage: Wie sieht die Form des Informationsprotokolls, des theoretischen Protokolls, beides Grundlagen der politischen Implementierung, genau aus? Daraus ergibt sich die Verbindung zum Realismus, wie ihn Courbet Mitte des 19. Jahrhunderts anstrebte, und zu seiner „auf Aktion, Engagement und die Fähigkeit zur Transformation gegründeten Ästhetik“5. „Ich male nur das, was ich sehe“, sagte der Schöpfer von „Das Atelier des Malers“, der damals unter dem Gefühl der Bedrohung durch die Fotografie malte: Der Bildrealismus als technische Reproduktion des Sichtbaren kündigte sich an – ein Abenteuer, das wenig aufregend zu werden versprach. Darum hat auch Gustave Courbet den Realismus neu definiert – als einen geistigen und optischen Ort, an dem sich die allegorische Erzählung mit einem politischen Projekt vermischt. Immerhin musste er nach dem Aufstand der Pariser Kommune, bei dem er durch seine Beteiligung an der Zerstörung der Vendôme-Säule Aufsehen erregt hatte, ins Exil gehen. 1855 errichtete der Rebell der Malerei den „Pavillon des Realismus“, nachdem seine Bilder vom offiziellen Pariser Salon abgelehnt worden waren. Auch „Das Atelier des Malers“ wurde dort ausgestellt. In einem Brief an seinen Freund, den Kritiker Champfleury, beschreibt Courbet sein Bild: „Es ist die moralische und physische Geschichte meines Ateliers. Erster Teil: Das sind die Menschen, die mir dienen, mich in meiner Idee unterstützen, an meiner Aktion teilnehmen. (…) Links: die andere Welt des täglichen Lebens, das Volk, das Elend, die Armut, die Reichen, die Ausgebeuteten, die Ausbeuter, die Menschen, die vom Tod leben. (…) Dann sind da noch gegen die Wand gelehnt einige Gipsabgüsse, ein Brett und darauf ein kleines Mädchen, eine Lampe, Töpfe, dann umgedrehte Bilder, dann ein Paravent und dann nur noch eine große nackte Wand.“6 Parallele Strukturen: einerseits der konkrete Pavillon, den der Künstler gebaut hat und über den er die Ausstellungsbedingungen seiner Arbeit kontrolliert; andererseits dieses gemalte ,Atelier‘, dessen vollständiger Titel lautet „Das Atelier des Malers. Eine wirkliche Allegorie, die sieben Jahre meines Künstlerlebens zusammenfasst“. Wenn sich in der Arbeit Liam Gillicks eine solche Nähe zum Realismus Courbets feststellen lässt, so liegt das daran, dass sie wie eine Allegorie der zeitgenössischen Produktionsweisen funktioniert: Fetisch-Materialien der Unternehmensarchitektur (eloxiertes Aluminium, Plexiglas, Kabel etc.), mehr und mehr Logos und Grafiksoftware, das Arbeiten in Netzwerken, die Thinktanks und ‚Projektgruppen‘ etc. Diese Kombination aus Materialien, Stilen und Verfahren, die das Universum Gillicks ausmachen, ist durchaus eine Allegorie der zeitgenössischen Arbeitswelt: Es kommen alle Elemente darin vor, aber isoliert voneinander und reduziert, wie ausgetrocknet durch ihre Präsenz im Kritiker-Herbarium der Ausstellung. Man könnte fast sagen, dass eine Ausstellung Liam Gillicks für die Arbeitswelt dasselbe ist wie ein Suppenwürfel für die Suppe: Man braucht sie nur in etwas ideologische Flüssigkeit einzutauchen, und schon findet man sich in einem Vorzeigebüro der Management-Ära oder einem Sitzungsraum der Apple Corporation wieder.

9.

Kam die Schärfe von Courbets Realismus aus der bedrohlichen Präsenz der Fotografie, so ist der Realismus Gillicks von einer eher vagen, aber akuteren Gefahr geprägt. Einerseits die Transformation der Privatsphäre in einen ‚Freizeit‘-Anhang zum allgemeinen Produktionssystem, das heißt die Ausweitung des Fließbands auf die Privatsphäre. Andererseits die Tatsache, dass Künstler heute unter der drohenden Gefahr einer kompletten Auflösung der Aufmerksamkeit in diesem beliebigen Spektakel produzieren, was einer ‚Verwüstung der Bedeutung‘ („Devastation of Meaning“) gleichkommt, um den Titel eines Textes aufzunehmen, den Gillick Cerith Wyn Evans widmete. Daher diese Neigung, niemals Werke anzubieten, die als irgendein Fazit gelten könnten: „Ich versuche, die Leute zu ermutigen, in einer Reihe paralleler Richtungen zu arbeiten“, erklärt er, „und schließlich einfach zu akzeptieren, dass ein in einer Galerie ausgestelltes Kunstwerk nicht die Lösung einer Idee ist.“7 Dieses Unvollendete trägt – anders als man denken könnte – mehr zur Herstellung eines Realismus bei als es ihr widerspricht. Denn schon die Impressionisten bevorzugten, gerade weil sie Zeitgenossen der industriellen Revolution und dann des Taylorismus waren, das ‚Unfertige‘ in der Malerei, die sichtbare Spur der Hand an der Arbeit. Die Werke Gillicks situieren sich außerhalb des Bereichs der Lösungswege oder der verpackten Objekte, sie verlängern diese Funktion des Widerstands und erweitern den Bereich – in einer Welt, in der sogar die Ideen sich zusammenschnüren lassen müssen wie Produkte. Kann man hier – um einen Ausdruck wieder aufzunehmen, den ich bereits Anfang der 1990er Jahre verwendet habe – von einem ‚operativen Realismus‘ sprechen? Der Autor von „Erasmus Is Late“ besteht darauf, dass er „mit realen Objekt-und-Idee-Beziehungen zu kämpfen hat, die sich auf die eigenen, persönlichen Politikstrategien auswirken; wie bewegen wir uns innerhalb der Stadt; wer kontrolliert die nahe Zukunft; wie verstehen wir Sanierungsprozesse etc.“8 Planung und Ausführung: Das sind die beiden Wirkungsweisen des Fließbanddenkens. Diese Problematik ist seit den ersten Arbeiten präsent, aber insbesondere seit der Serie der Pinboards, die der Künstler ab 1992 realisierte: Einfache Arbeitspläne, deren Verwendung zwischen amateurhaft und professionell schwankt, Pinboards, die einem wie Oberflächen zur Sammlung von Informationen in Form von Presseausschnitten erscheinen, Notizen, hier und dort gefundene Fotografien. Das Werk produziert keine Information, sondern bestimmt den Rahmen. Auch hier geht es darum, die Verfahrensstruktur menschlichen Handelns sichtbar zu machen – durch eine ungewöhnliche Annäherung zwischen dem Kunstwerk und der Form der Büroartikel sowie durch die systematische Verweigerung jeglicher abgeschlossenen Bedeutung in der permanenten Öffnung hin zu Texten und Parallelhandlungen. In Bezug auf seine erste Ausstellung 1989 erklärte Gillick, dass er sich, anstatt Objekte zu produzieren, bemühe, „eine Art Parallelhandlung zu entwickeln, die mit einer Reflexion über die Idee der kulturellen Erlaubnis verbunden ist. Ich spürte, dass es nicht nötig war, eine Erlaubnis einzuholen, um als Architekt oder Archivar zu fungieren.“9 Dieses Konzept der vorherigen Erlaubnis verweist natürlich auf die Machtstrukturen: Wer trifft die Entscheidungen, wer wendet sie an? Im Bereich der künstlerischen Produktion geht es – so wie auf allen Ebenen professioneller ‚Qualifikation‘ – darum, die Dekapitalisierung zu fördern, das Kapital also so weit wie möglich zu verstreuen, sowohl in seiner konkreten Form als auch in seinen zahlreichen symbolischen Formen. Man erkennt – egal in welcher Ausstellung Liam Gillicks – industrielle Strukturen, Bücher, Fernseher, Zeichen der Kunst, aber diese Elemente erscheinen uns wie isoliert von der symbolischen (ideologischen) Infrastruktur, die sie in der Kulturwirtschaft zusammenhält. Im Gegensatz zu Damien Hirst, dessen Vorgehensweise darin besteht, in spektakulären Objekten Kapital anzusammeln, stellt Gillick Formen aus, deren symbolisches Kapital zuvor entleert wurde: aus einem nicht vorhandenen Text extrahierte Strukturen, Texte, die auf


anderweitig gezeigte Formen oder künftige Prozesse verweisen etc. Diese Abwesenheit – die durch die Parallelstruktur des Werkes unterstrichen wird – bezeichnet somit das ,unmögliche‘ Sujet des Werkes von Liam Gillick: die Utopie beziehungsweise die Selbstbestimmung menschlicher Gruppen in Bezug auf ihre Zukunft. „Da das Gegenteil des Möglichen sicherlich das Reale ist“, so Lacan, „müssen wir wohl das Reale als das Unmögliche definieren …“10 Es ist nicht nötig, ein Objekt zu verstecken, damit es unauffindbar bleibt, wie uns Edgar Allen Poe in der Geschichte vom ‚gestohlenen Brief‘ gelehrt hat: Für Lacan ist das Reale das, was an seinem eigenen Platz fehlt, so wie der für alle sichtbare Brief. Im vorliegenden Fall ist das Reale für Gillick das politische Konzept, das aus der Sphäre der Macht verschwunden ist und ,an seinem Platz fehlt‘ – und zwar in einem solchen Maße, dass es zu einem einfachen Ausstellungsobjekt wird. Es gibt also nichts im Inventar Gillicks, das nicht sichtbar und für jeden beliebigen Beobachter der zeitgenössischen Welt zugänglich wäre; es gibt aber auch nichts, was den Verbraucher mit Bedeutung honoriert. Denn diese Arbeit ist gleichzeitig düster und hell – oder vielmehr beides parallel. Mit dem Maßstab dieser Prinzipienklarheit lässt sich auch seine Kritik an der unter Künstlern verbreiteten Neigung zur modischen ‚Enthüllung‘ interpretieren – die Gillick als ‚Hundekunst‘ abqualifiziert: Kunst als eine Technik mit dem Ziel, das auf den Ausstellungsteppich zu bringen, was die Gesellschaft gern verbergen will. „Die Gesellschaft versteht etwas implizit in den Bildern und den Erzählungen, die ihr präsentiert werden, und lehnt sie im nächsten Moment ab – weil sie bei der weiteren Aufnahme von Bildern und Erzählungen stören. Der Künstler bringt in diesem Fall jene Bilder lediglich zurück, wie ein Hund, der einen Stock wiederbringt und ihn stolz seinem Halter zeigt, der bereits weiß, wie der Stock aussieht, denn er hat ihn ja geworfen.“11 Weil er keine Lust mehr hat, einen Stock zu werfen, der sowieso zurückkommt, behält der Hundebesitzer ihn schließlich in der Hand: Das ist die aktuelle Situation und die perfekte Metapher für die Kultur, die von der dominanten Lehrmeinung vertikal in ‚high‘ und ‚low‘ aufgeteilt wird. Das Herrchen erwartet die Rückkehr des Stocks auf den Teppich, und das kommt ihm durchaus zupass: Die Kulturindustrie kommt damit auf ihre Kosten, zumal ihre Produkte nunmehr ein zweites Leben genießen und zunächst ‚en gros‘ und dann ‚en détail‘ konsumiert werden. Unter den binären Strukturen, die durch das postmoderne Denken in die zeitgenössische Ideologie gelangten, ist die Zwangseingliederung der Kulturproduktion in diese Trennung von high und low sicherlich die Schlimmste. Auch in diesem Sinne strebt Gillicks Werk nach Realismus: Es schlägt sich mit dem Sichtbaren und dem Ausgestellten (displayed) herum, ohne jemals dieser Krypto-Metaphysik nachzugeben, die das ‚Verborgene‘ aufwertet und doch nur ein Verbraucher-Avatar der Verschwörungstheorie ist. Das wäre letztendlich die Bedeutung eines Werks wie „Big Conference Centre. Limitation Screen“ (1998): Alles ist da, vor unseren Augen; die Wand filtert lediglich das Licht und beschränkt den Zugang zum Raum – das Werk suggeriert, dass man ,der Entwicklung und der Debatte Grenzen setzen‘ könnte … Oder wie Gillick es ausdrückt: „Die Dinge werden richtig interessant, wenn die Kunst über eine Reflexion der abgelehnten Wahlmöglichkeiten der dominanten Kultur hinausgeht und versucht, die tatsächlichen Prozesse zu konfrontieren, die unser zeitgenössisches Umfeld formen.“12

II. Eine Topologie des Kapitals (Erzählungen und Drehbücher) Was findet man also in diesem formalen Universum, das das zeitgenössische Umfeld reflektiert? Geometrische Körper und Flächen, Pulver, Texte. Dieser knappe Wortschatz erlaubt es Liam Gillick, wie wir gesehen haben, ein Reales zu beschreiben, das sich zweifach definieren lässt:

10.

Nicolas Bourriaud

einerseits als konkrete Wirkung des kapitalistischen Systems und der von ihm erzeugten zwischenmenschlichen Beziehungen; andererseits als ein blinder Fleck, der der Formel Lacans entspricht, dass das Reale unmöglich ist. Um es darzustellen, gibt es nur eine Möglichkeit, die des Psychoanalytikers: Da das Reale genau das ist, ,was sich jeder Symbolisierung verweigert‘, muss es Gegenstand einer Topologie sein. Die Lehre Lacans erfolgte ab Ende der 1960er Jahre weitgehend über die Vermittlung von ‚Mathemen‘, die aus der Topologie entlehnt waren. Das Mathem lässt sich als ein ‚Wissensatom‘ definieren, dessen primäre Eigenschaft seine Übertragbarkeit ist. Torus, Möbiusband, Kleinsche Flasche, Cross-Cap, Borromäischer Knoten etc. Die topologischen Objekte Lacans sind tatsächlich erstaunlich und zeigen, in welchem Maße unser Denken abhängig ist von der Figur des Kreises, der den Raum in Innen und Außen zerschneidet – wie uns auch das Bild bewegt, das wir von unserem eigenen Körper haben. So wurden die Lacan’schen Matheme zu den bevorzugten Instrumenten zur Unterbrechung eines ‚Realen‘ in der Psychoanalyse. Die visuelle Simplizität, die Gillick für sich in Anspruch nimmt, der zeitweise enigmatische Charakter seiner Aussagen, der Rekurs auf die Geometrie sind ebenso Anhaltspunkte, die es uns erlauben voranzuschreiten, wie jedes seiner Werke das Mathem eines Wissens darstellt. Ohne Außen und ohne Innen, wirken seine Arbeiten wie Möbiusbänder. Das Werk Liam Gillicks – und das ist die beste Art und Weise, seine Kohärenz zu erfassen – ließe sich somit als eine Topologie der Beziehungen zwischen Menschen und sozialen Strukturen definieren, die durch signifikante Ketten beschrieben werden. Und die Linie des Diskursiven, die die Werke Gillicks durchzieht, funktioniert auf die gleiche Weise, wie die Kette der Signifikanten (die das menschliche Subjekt bilden) sich von den Ankerpunkten aus entfaltet, welche die Segmente in regelmäßigen Abständen verknoten und sie miteinander verbinden. Platziert man einige seiner Werke nebeneinander, etwa „Isolation Platform“ (1999), „Big Conference Center Legislation Screen“ (1998), „Post Conference Platform“ (1998) und unterschiedliche Versionen der Thinktanks, sieht man, wie sich eine Grammatik entwickelt, deren Seme jeweils einen Verhaltenstypus kodifizieren: sich isolieren, symbolisieren, einen Arbeitsbereich verlassen, nachdenken, verhandeln etc. Dieses Kodierungs- oder Anmerkungssystem wurde besonders sichtbar anlässlich seiner Ausstellung „A Short Text on the Possibility of Creating an Economy of Equivalence“ (2005) im Palais de Tokyo in Paris, die sich auf ein Buch mit dem Titel „Construcción de Uno“ bezog, das damals parallel entstand. Es geht dabei um das Abenteuer einer Gruppe von Arbeitern, die sich entscheiden, ihre Autofabrik nach der Schließung selbstbestimmt weiterzuführen; als sie an ihren Arbeitsplatz zurückkehren, beschließen sie, künftig statt der Autos Ideen zu produzieren, und bauen zunächst einmal das Gebäude selbst um, bevor sie anschließend neue Produktionsmodelle in Richtung einer ‚Äquivalenzwirtschaft‘ testen, bei der eine Output-Einheit jeweils einer Input-Einheit entsprechen soll, eine Wirtschaft also, in der jegliches menschliche oder finanzielle Investment einfach ohne Verlust oder Veränderung ersetzt wird. Die Ausstellung war auf eine mentale Topologie fokussiert: Die Berglandschaft, die die Arbeiter von ihren Fenstern aus zu sehen wünschten, wurde durch eine Installation aus farbigen Stahlblumen dargestellt, deren gezackte Form an das Diagramm erinnerte, das Peter Saville auf der Hülle des ersten Albums von Joy Division verwendet hatte; der Weg zwischen Fabrikkantine und Haus war durch roten Glimmer gekennzeichnet. Aber auch hier dringt die Form über den Bereich der Ausstellung hinaus: Gillick bringt die Prinzipien der ‚Äquivalenzwirtschaft‘ tatsächlich zur Anwendung, recycelt die in Paris ausgestellten Strukturen und bringt sie nach Madrid, wo sie als Grundlage für die Einrichtung einer Bar in „La Casa Encendida“ dienen – auch das ein komplettes formales Element. Diese Topografie bildet das Grundvokabular einer Erzähllinie, die – mehr noch als in den Erzählungen als solchen – im mehrdeutigen Format des Szenarios zum Ausdruck kommt, das immer wieder in multiplen meta-


phorischen und/oder konkreten Varianten in der Arbeit Gillicks auftaucht. Dieses komplexe und evolutive Konzept geht über die technische Definition der Kinowörterbücher hinaus und ließe sich als ein Erzählbündel definieren, in dem ein Raum, diverse Prozesse, ein Text oder ein Textkorpus, Handlungen oder Ereignisse, die eventuell ablaufen könnten, eine Rolle spielen. Das Szenario bezeichnet somit bei Gillick vor allem einen Raum in der Erwartung von Sujets, eine Virtualität, die von Formen eingerahmt wird. Aber es gibt noch eine zweite Bedeutung, die manchmal an seine Stelle tritt: Dann wird das Szenario zu einem Protagonisten der Geschichte, zu einem jener Denkrahmen, die zum Kampf um die Kontrolle der Zukunft angetreten sind; dann widersetzt sich das Szenario der Planung, dem Programm, der Spekulation. „Einer der großen Kämpfe des 20. Jahrhunderts war wohl der zwischen Spekulation und Planung, und man könnte sagen, dass die Spekulation so ziemlich gewonnen hat.“13 Gillick kommt noch einmal auf diesen Konflikt zurück, als er „Literally No Place“ (2002) beschreibt: „… ein Text, der nach neuen Wegen suchte, um über den bleiernen Neoliberalismus der Gegenwart hinauszugehen (den Sieg der Spekulation über die Planung) und in der konstruierten Welt, die uns umgibt, ethische Spuren zu finden.“ Es gibt eine weitere Analogie zur Topologie Lacans, nämlich die Tatsache, dass das ‚Sujet‘ von Gillicks Werk nur in Form einer Lücke auftritt: Es geht also um das Reale. Aber das, was der Künstler mit seiner Arbeit unermüdlich anstrebt, diese Selbstverwaltung der Zukunft, der Arbeitsund Existenzbedingungen durch die Menschen, wird unablässig durch vorgefertigte Räume (Trennwände, Kästen, Sitzungsräume, Bars, Decken etc.) mediatisiert, die diese Suche in eine linguistische und formale Odyssee verwandeln. Die Sehnsucht nach einer Utopie wird bei Gillick gemäß einem ebenso komplexen und elastischen analytischen Prinzip in Szene gesetzt wie der 16. Juni 1904 durch James Joyce in seinem „Ulysses“. Als Leopold Bloom in einen Dubliner Pub kommt, um hier einen Teller Nieren zu essen, erzeugt die Überlagerung dieser alltäglichen Szene mit der Lästrygonen-Episode bei Homer einen endlosen Dehnungseffekt: Indem er das Banale wie ein Heldenepos beschreibt, bricht Joyce das Reale durch die Sprache auf, so als könnte die kleinste Geste eines menschlichen Wesens, gleichsam als Molekül im Teilchenbeschleuniger der Literatur, sich bis ins Unendliche aufschwingen. Hundert verschiedene Stile treffen in Joyce’ Roman aufeinander, vom Juristenkauderwelsch bis zum Slang, vom Essay bis zur Predigt: Blooms Tag wird auf tausenderlei Weise erzählt und von tausend verschiedenen Standpunkten aus, aber das Reale lässt sich nur streifen, um sich dann umso mehr zu entziehen. Es gibt bei Gillick einen Joyce’schen Drang, mit manischer Genauigkeit Situationen zu rahmen, die plötzlich unendlich schnell in eine millimetergenaue Präzision umzukippen scheinen. Die fehlenden Satzzeichen in einigen Wall Drawings erinnern an das Protokoll des inneren Monologs bei Joyce, hier angewandt auf Slogans oder Standardsprüche. Eine weitere Parallele: Das Werk Liam Gillicks ist die Odyssee der Politik im Zeitalter ihrer Auflösung in der monetären Virtualisierung des Kapitals und in der bürokratischen Anhäufung von Entscheidungen. Ein Projekt, auf das der Künstler anzuspielen und das er schließlich zu resümieren scheint, wenn er sagt, dass „die permanente Verlagerung und Projektion des kritischen Moments das politische Potenzial des Diskursiven ist“14.

III. Die Positionen der Formen und Sujets Man kann gar nicht genug unterstreichen, welchen ästhetischen Schaden die Texte Michael Frieds in den 1960er Jahren verursacht haben; insbesondere der Text „Art and Objecthood“, in dem er sich gegen die ‚Theatralität‘ der Minimal Art erhebt und der noch heute dazu dient, das Greenberg’sche Dogma künstlich am Leben zu halten, selbst über seinen Anwendungsbereich hinaus. Diese Theorie basiert auf einer nahezu

11.

Und wozu soll ein Titel gut sein?

obsessiven Ablehnung des Anthropomorphischen, deren ultimative Fantasie der radikale Ausschluss jeglicher menschlichen Spur außerhalb des ‚kreativen Prozesses‘ ist – zu Gunsten einer Ästhetik, die sich als antisituativ bezeichnen ließe. „Was zwischen den Künsten liegt, ist Theater“, schreibt Fried, ist „wörtlich“ – und somit schlecht … Er verhöhnt auch die Sorge um die Temporalität, an deren Stelle seiner Meinung nach ein „kontinuierliches und immerwährendes Präsens“ treten sollte, der Garant einer „authentischen Kunst“.15 Die Schmähschriften eines George Baker oder einer Claire Bishop gegen die ‚relationale Ästhetik‘ und insbesondere gegen die Arbeiten von Rirkrit Tiravanija und Liam Gillick wären nicht zu verstehen, wenn man sie nicht auf diese enge Konzeption der Form bezöge, wie sie der Polemik Frieds und dem Modernismus gemäß Clement Greenberg entstammt. Das Vermächtnis Michael Frieds suchte in den 1990er Jahren vergeblich, sich in einem progressistischen und aktivistischen Milieu zu entwickeln, denn es zeichnete sich letztendlich durch schiefe Positionen aus, und die angeblich guten Absichten wurden immer wieder durch ein reaktionäres ästhetisches Substrat widerlegt. Aber kommen wir zurück zu den Begriffen der Debatte: „Wenn Bourriaud sagt‚ ‚Begegnungen sind wichtiger als die Menschen, zwischen denen sie stattfinden‘“, schreibt Bishop, „merke ich, dass diese Frage (für ihn) unnötig ist; alle Beziehungen, die einen ‚Dialog‘ ermöglichen, gelten automatisch als demokratisch und somit als gut. Aber was bedeutet ‚Demokratie‘ in diesem Kontext wirklich? Wenn relationale Kunst zwischenmenschliche Beziehungen produziert, dann ist die nächste logische Frage, die sich stellt: Was für Beziehungen werden produziert, für wen und warum?“16 Oder auch: „Die durch relationale Ästhetik aufgebauten Beziehungen sind nicht intrinsisch demokratisch (…), da sie allzu bequem innerhalb eines Ideals von Subjektivität als Ganzes und von Gemeinschaft als immanentes Miteinander ruhen.“17 Absicht dieses Prozesses: Es wird per Definition keine durch ein Kunstwerk produzierte Beziehung ohne einen spezifischen Inhalt sichtbar, wobei die Beziehung im Wesentlichen ein Format ist wie ein Bild oder eine Skulptur. Die in „Relationale Ästhetik“ beschriebene künstlerische Situation ist nichts anderes als der historische Moment, in dem einige Künstler ein Prinzip auf ihre künstlerische Praxis angewandt haben, das Karl Marx in den Thesen über Feuerbach aufstellt und in dem er erklärt, dass man die ‚menschliche Natur‘ nur als ein System von Beziehungen definieren kann. Das Menschliche ist nichts anderes als das Zwischenmenschliche, also ein abgeschlossenes Ensemble von Interaktionen, die von den Menschen konstruiert und von Institutionen, Systemen des Austauschs oder der Produktion implementiert werden; das Soziale basiert daher, ebenso wie die Kunst, auf keinerlei ,Natur‘ und auch auf keiner Vorab-Definition, sondern ist lediglich das Produkt immenser und permanenter Verhandlungen, deren Windungen und Produktivität das Werk Liam Gillicks in besonderem Maße verkörpert. Einige Kritiker sahen die Dinge anders, und die theoretische Opposition war besonders in Großbritannien stark, wo die spektakulären Objekte der ‚Young British Artists‘ in den 1990er Jahren anspruchsvollere oder einfach diskursivere Praktiken in den Schatten zu stellen drohten. Auch Claire Bishop scheint – als Hauptvertreterin der Opposition – zu jener Klasse der Betrachter zu zählen, die laut Gillick bedauerlicherweise im Kunstwerk eine ‚Lösung‘ suchen. Die Kritik Bishops beruht auf einer restriktiven Konzeption der Form, so wie sie es im Februar 2006 im Magazin „Artforum“ in einem zweiten Text über die ,relationale Ästhetik‘ klar ausdrückt: „Ein solches Werk scheint einer kreativen Fehlinterpretation der poststrukturalistischen Theorie zu entstammen: Anstatt dass die Interpretationen eines Kunstwerkes offen wären für kontinuierliche Neubewertungen, ist das Kunstwerk hier selbst in ständigem Fluss. Es gibt viele Probleme bei dieser Idee, nicht zuletzt die Schwierigkeit, eine


Arbeit zu erkennen, deren Identität vorsätzlich instabil ist.“18 Man muss zugeben, dass solche Arbeiten, deren Identität als ‚instabil‘ wahrgenommen wird, sich eigentlich jeder Etikettierung und sogar jeder Identifizierung widersetzen. Das ist ihre hervorstechende Eigenschaft, die eine Trennlinie bildet zwischen den traditionalistischen Kunstkonzeptionen und Praktiken, die, wie bei Gillick, auf der Verhandlung und der Verweigerung der apriorischen Zuweisung von Statuten und Rollen unter der Ägide eines vorgefassten Kunstbegriffes basieren. In seiner Antwort an Claire Bishop, die in der Oktober-Ausgabe desselben Magazins veröffentlich wurde, unterstreicht Gillick die Tatsache, dass die entsprechende Kunstkritik nirgends die Texte erwähnt, die die Werke ausdrücklich begleiten, und diese damit wissentlich verstümmelt: „(‚Discussion Island‘) ist kein Buch über offene Enden oder Kompromisse; es ist eine Kritik an diesen Dingen, was klar wäre, wenn Bishop das Buch oder die anderen spezifischen Texte, die eine zentrale Rolle in meiner künstlerischen Praxis einnehmen, auch nur einmal erwähnt hätte. (…) Die mit dem Text ‚Discussion Island‘ verbundenen Illustrationen bildeten eine Vorlage für die Entwicklung des Buches, daher auch die ‚Discussion Platforms‘ aus den späten 1990er Jahren, die einen spezifischen Standort zur Erörterung der involvierten spezifischen Ideen entwarfen.“19 Hier haben wir es mit der fortlaufenden Präsenz eines theoretischen Paradoxons zu tun: Die vehementesten Verächter der Kunst Liam Gillicks, die sich hier im Namen des sozialen Kampfes und einer politisch engagierten Kunst zu Wort melden, sind jene Leute, die besonders gerne und aus Prinzip die Besucher aus den Ausstellungen ausschließen – im Namen der geheiligten Autonomie des Kunstobjektes. Ebenso gut könnte man die Bürger im Namen der Reinheit der demokratischen Idee aus dem demokratischen Raum ausschließen; so ist es übrigens schon mehrfach in der Geschichte umgesetzt worden. Demgegenüber heißt es bei Gillick: „Meine Arbeit ist wie das Licht im Kühlschrank, es funktioniert nur, wenn Leute da sind und die Kühlschranktür öffnen. Ohne Menschen ist es keine Kunst – es ist etwas anderes – Zeug in einem Zimmer.“20 Mitunter so bringt der Künstler die ,vielen Menschen‘ zusammen, die laut Tiravanija Teil all seiner Installationen sind und die er in die Liste der ‚Materialien‘ einschließt, die in seinen Werken präsent sind. Eine Analyse der Diversität der Positionen, die dem Betrachter bei Gillick, Tiravanija, Philippe Parreno oder Carsten Höller angeboten werden, hätte es erlaubt, sich an der Gattungsdefinition des ‚Teilnehmers‘ zu orientieren, ein aus den 1950er Jahren übernommenes Konzept, das gerade die relationale Ästhetik in die Vergangenheit verwiesen hat, so wie die Pop-Art damals das Ready-Made Duchamps historisierte. Entsprechend hat auch keiner der genannten Künstler irgendetwas mit der vagen und obsoleten Untergattung der ‚partizipativen Kunst‘ zu tun, auf welche Bishop die relationalen Praktiken reduziert. Wenn man so wie Bishop eine Unterscheidung vornimmt zwischen ‚sozialer Zusammenarbeit‘ einerseits und der ‚konzeptuellen und bildhauerischen Praxis‘ der Künstler andererseits, ist dies im Übrigen in hohem Maße widersinnig: Es existiert in der Vorgehensweise Liam Gillicks keinerlei Kluft – ebenso wenig wie bei den in „Relationale Ästhetik“ genannten Künstlern – zwischen dem, was zu einer ‚ethischen‘ Praxis außerhalb der Form gehört, und purer Ästhetik. Eine solche Unterscheidung scheint in erster Linie auf einem empirisch ungedeckten Apriori zu basieren, zumal schon eine flüchtige Prüfung der Praktiken Gillicks in ausreichendem Maße zeigt, dass in ihnen keinerlei Trennung vorgenommen wird zwischen politischem Engagement und künstlerischer Praxis, ganz im Gegenteil: Diese Unterscheidung zu treffen, ist ganz und gar unmöglich. Es erscheint seltsam, wenn man liest, dass diese Praktiken – ich habe sie als relational bezeichnet, weil sie den zwischenmenschlichen Bereich als theoretischen und/oder praktischen Bezugspunkt wählen – angeblich die Moral gegenüber der Form bevorzugen und eine rein ‚soziale‘ Kunst, ein scheinbar ‚himmlisches‘ ethisches Modell generieren,

12.

Nicolas Bourriaud

um – so der angeführte simple Grund – die in der Gesellschaft real existierenden Antagonismen zu verbergen. Dieses Missverständnis ist umso frappanter, als das Buch einen neuen Stand der Form zum Thema hat (neue ‚Formationen‘, um den dynamischen Charakter der fraglichen Elemente zu betonen, deren Definitionsbereich die Disposition der Körper und auch die Temporalität umfasst, der sich die Formen beugen müssen). Kurz – es ist sicherlich nicht die ethische Dimension des Werks von Rirkrit Tiravanija oder Liam Gillick, die zählt, sondern ihre Fähigkeit, ausgehend vom zwischenmenschlichen Bereich innovative Methoden der Ausstellung und der Reflexion zu erfinden. So definiert Gillick sein ganzes bisheriges Œuvre als einen „Verhandlungsraum für Ideen, in dem die Menschen tatsächlich die Welt, in der sie tätig sind, bestimmen.“21 Dennoch, so Gillick: „Tatsache ist, wenn Sie nicht aufhören, ständig die Spielregeln zu ändern, so dass niemand seine Regeln kennen kann, dann haben Sie ein politisches Phänomen.“22 Ein weniger zerstreuter Blick auf die Komplexität des Gillick’schen Denkens hätte etwa zeigen können, dass der Künstler seine Arbeit im Kontext des für ihn durchaus maßgeblichen Einflusses von Felix González-Torres situiert, der seit Ende der 1980er Jahre den Wortschatz kämpferischen Engagements in der Kunst brillant erneuert hat. González-Torres, so Gillick, „ist sehr wichtig, da er den klassischen dialektischen Diskurs in Bezug auf Fragen der Identität und Sexualität erlebt und neue Formen der Schönheit geschaffen hat, die in tiefschürfenden und ernsthaften Konzepten gründeten. Aus der Art und Weise, wie seine Arbeit mit der Form spielt und wie man zu einem gewissen Grad lockerer werden kann, habe ich etwas gelernt.“23 Ebenso wie die Arbeit Gillicks wurde auch das Werk des kubanischen Künstlers zu Beginn von der Kritik unterschätzt: Man sah in ihm eine Zeit lang nur den Künstler, der Bonbons verteilte oder Go-go-Boys auf dem Podium tanzen ließ. Diese Art des kategorialen Missverständnisses ist inzwischen paradigmatisch: Man schließt vom formalen Apparat, auf den der Künstler rekurriert (in diesem Falle ein Sitzungsraum oder eine Bar bei Gillick bzw. ein Ballsaal oder Nachtclubdekorationen bei González-Torres), auf den ‚Apolitismus‘ eines Künstlers, der mit dem Entertainment zusammenarbeitet oder mit oberflächlichen Wohlfühl-Events operiert. Ebenso gut könnte man aufgrund der vielen Früchte in Cézannes Bildern schreiben, er hätte für den Gartenbau gekämpft … Aber weder bei González-Torres noch bei Gillick hat der Betrachter objektiv die Möglichkeit, sich als jener Stimmungskonsument zu positionieren, den solch analoge Fehlschlüsse suggerieren wollen. Im Gegenteil – die mit dem Betrachter aufgebaute Beziehung ist präzise eingerahmt und wird jedenfalls nie einer Improvisation oder einem ‚Unterhaltungsprinzip‘ geopfert. Die Besucher der Ausstellung, erläutert Gillick, „können über das zentrale Ideenbündel kommen, über die Szenarien oder Texte oder auch über den visuellen Aspekt der Arbeit, die formalen Bezüge – und über diese verschiedenen Wege schnell einen Rahmen ersteigen, damit etwas stattfindet.“24 „A Note on Discussion Island: Item A001“, ein Werk, das aus einem Häufchen grauen Glimmers besteht, macht klar, dass „(d)ie Arbeit einen fragmentierten Bereich (bezeichnet), in dem es möglich sein könnte, das Potenzial von Diskussion und Kompromiss zu erörtern.“ Keine Spur, weder hier noch anderorts, vom angeblich zersplitterten und Pawlowschen ‚Teilnehmer‘, auf den Claire Bishop die Integration des Betrachters in die Ausstellungsanordnung beschränkt … Es stört den kritischen Diskurs außerordentlich, dass der politische Inhalt, den die Arbeiten Liam Gillicks transportieren, sich anderen angesagten Formen radikal widersetzt, die zweifellos den Vorteil hätten, expliziter zu sein: Neben der bereits genannten ‚Hundekunst‘ wären hier weitere Praktiken zu erwähnen, die – mit unterschiedlichen Maßstäben, zumeist aber eins zu eins – auf der Darstellung wirtschaftlicher und politischer Entfremdung basieren. Im Gegensatz zu ihnen zeigt die Arbeit Gillicks keine Zeichen der Unterdrückung, der Kontrolle oder


der Biokraft und spielt schon gar nicht auf dem Register der Anekdote oder der Aktualität, sondern bezeichnet die formalen Rahmen und Prozesse, die es diesen Spielarten der politischen Repression erlauben zu funktionieren. Es handelt sich dabei um eine in der Form enthaltene Kritik – eine Art Eidopolitik –, die spezifische Formate und Zeichen einer klar bezeichneten Praxis versammelt und sie systematisch einer Batterie von Fragen in Bezug auf die Einschreibung dieser Praxis in einen globalen Kontext unterwirft. Ein anscheinend auf Funktionalität ausgerichtetes Werk als Prototyp-Design für „Conference Room“ (es wurde 1999 im Frankfurter Kunstverein ausgestellt) stellt daher letztlich eine Studie dar über die Art und Weise, wie das konstruierte Umfeld das Verhalten verändert; ist also quasi ein Wirkungsmodell. „64th Floor Lobby Diagram“ (1999) funktioniert auf die gleiche Weise, integriert jedoch in dieses Modell einen zusätzlichen künstlerischen Koeffizienten, der den Dialog aufgreift zwischen einigen Minimal-Art-Formen und dem Unternehmensdesign. Doch reichen die Missverständnisse um die Kunst Liam Gillicks noch weiter zurück, zu einer ersten Debatte, die Anfang der 1990er Jahre im Rahmen der Kölner Kunstszene stattfand. Liam Gillick notiert nachträglich, dass „… eine Spannung zu spüren (war) zwischen den Künstlern, die Transparenz in der Kunst befürworteten (Andrea Fraser, Clegg und Guttman und auch andere, die mit der Galerie Christian Nagel verbunden waren), und jenen, die glaubten, eine Folge von Schleiern und Windungen könnte durchaus nötig sein, um das Chaos von Ebbe und Flut des Kapitalismus zu bekämpfen (Philippe Parreno, Dominique Gonzalez-Foerster sowie andere, die mit der Galerie Esther Schipper verbunden waren). Übrigens kamen diejenigen, die in Bezug auf das Konzept der Transparenz und eine geradlinige Beziehung zwischen Absichten und Resultaten skeptisch waren, in der Regel aus Umfeldern, in denen ihnen der Glaube an Transparenz historisch von der dominanten Kultur auferlegt wurde.“25 Hier findet man tatsächlich eine echte Bruchlinie, deren Auswirkungen noch heute wahrzunehmen sind: einerseits die Verpflichtung zur Transparenz in der Art der historischen Konzeptkunst der 1960er Jahre; andererseits die Anerkennung der Notwendigkeit, ihre Parameter zu modifizieren, um ihren kritischen Impakt aufrechterhalten zu können – in einer Gesellschaft, die weit komplexer ist als die der 1960er Jahre. Als Kosuth „Art after Philosophy“ schrieb, wollte er damit die Kritik an ihre Stelle setzen, als Paradigma einer künstlerischen Intervention. Ab den 1990er Jahren war es diese kritische Philosophie selbst, die überwunden werden musste, und zwar über die Erkenntnis, dass keine kritische Position von einem externen Gesichtspunkt aus haltbar ist – niemand kann die Gesellschaft von außen betrachten, höchstens ein Gott … Die Fantasie von der Transparenz, deren Komplementarität mit der Glasarchitektur der Firmengebäude, mit der Kontrollgesellschaft und ganz allgemein mit der herrschenden Ideologie Gillick unterstreicht, ist heutzutage buchstäblich nichts anderes als eine Adaptation der Konzeptkunst in einer Gesellschaft, in der die Personifizierung herrscht, in der also jedes Produkt seine Identität eifrig kundtut. So stellt sich jetzt das Problem der konzeptuellen Zugeständnisse: Sind nicht alle Künstler, egal in welcher Form sie sich engagieren, gehalten, an den Diskursen, die sie kritisieren, mitzuwirken? Die Künstlergeneration, die die ‚Schleier und Windungen‘ anstelle der postkonzeptuellen Transparenz gewählt hatte, reagierte mit einer vermeintlichen Immersionstaktik, vergleichbar mit der ‚Linie des Establishments‘, wie sie nach dem Mai 1968 von Robert Linhardt, dem Chef der französischen Maoisten gepredigt wurde. Auch hier stellte der persönliche Text, ein Immersionsbericht, eine politische Antwort dar: Die Aktivisten sollten in der Fabrik arbeiten, die Revolution von innen heraus vorbereiten, anstatt mit ihren Flugblättern vor den Toren des Produktionssystems zu stehen. Mehr Transparenz, aber Geheimnis und Untergrund; mehr Frontalkampf, aber ein Verhandlungsorgan im Innern des Systems.

13.

Und wozu soll ein Titel gut sein?

Weit weg von den vermeintlichen ‚Rändern‘, wo der Künstler das System von der Rückseite aus kommentieren und beurteilen könnte, ist das ‚Milieu‘ zum jetzigen Zeitpunkt der Ort, an dem sich der Künstler äußert. Dort entfaltet sich seine Problematik in sukzessiven Erweiterungen, durch Investments in die verschiedensten Bereiche, durch Zusammenarbeit mit Gruppen oder Menschen aus heterogenen Disziplinen. Liam Gillick hat sich in diesem Raum, im Herzen der wirtschaftlichen Dominanz, etabliert und hier seine Parallelaktivitäten installiert.

Liam Gillick, „The Wood Way“, Ausst.-Kat. Whitechapel Gallery, London 2002, S. 81 2 Liam Gillick, „Erasmus Is Late“, London 1995, S. 39 3 Liam Gillick, „Five or Six“, New York 1999 4 Liam Gillick, ,Contingent Factors: A Response to Claire Bishop’s „Antagonism and Relational Aesthetics“‘, in: „October“, Nr. 115, Winter 2006, S. 102 5 Catherine Strasser, „Le Temps de la production“, École des arts décoratifs de Strasbourg, 1997, S. 26 6 Ebd., S. 17 7 Liam Gillick, Gespräch mit Eric Troncy, in: „Documents sur l’art“, Nr. 11, 1997–98 8 Liam Gillick (siehe Anm. 1), S. 18 9 Gespräch mit Hans Ulrich Obrist, in: Hans Ulrich Obrist, „Conversations“, Volume I, Paris 2009, S. 283 10 Jacques Lacan, „Le Séminaire, Livre XI. Les quatre concepts fondamentaux de la psychanalyse“, Paris 1990, S. 152 11 Liam Gillick, „Proxemics: Selected Writings“, Zürich 2007, S. 226 12 Liam Gillick (siehe Anm. 4), S. 95–107 13 Liam Gillick (siehe Anm. 1), S. 17 14 Liam Gillick, „Hermes Lecture“, Amsterdam 2008 15 Michael Fried, ,Art and Objecthood‘, in: „Artforum“, V, Nr. 10, Sommer 1967, S. 12–23 16 Claire Bishop, ‚Antagonism and Relational Aesthetics‘, in: „October“‘, Nr. 110, Fall 2004, S. 51–79, S. 64 17 Ebd., S. 66 18 Claire Bishop, ,The Social Turn: Collaboration and its Discontent‘, in: „Artforum“, Vol. 44, Nr. 6, Feb. 2006, S. 178–183 19 Liam Gillick (siehe Anm. 12) 20 Liam Gillick, „Renovation Filter: Recent Past and Near Future“, Ausst.-Kat. Arnolfini, Bristol 2000, S. 16 21 Gespräch mit Hans Ulrich Obrist (siehe Anm. 9), S. 290 22 Ebd., S. 288 23 Liam Gillick (siehe Anm. 1), S. 18 24 Gespräch mit Hans Ulrich Obrist (siehe Anm. 9), S. 290 1

25

Liam Gillick (siehe Anm. 12)


NICOLAS BOURRIAUD AND WHY WOULD THERE BE A TITLE? LIAM GILLICK’S DISCURSIVE TOPOLOGY

First of all, the personnel: the ticket clerk at the railway station who still refers to you as a ‘customer’ instead of a ‘passenger’; the employees of a large corporation and then the members of its think-tank; subcontractors; self-governing workers who decide to switch production in the factory; activists, who can’t think of anything better to do than to play the tuba for immigrant workers; the firms Ikea, Volvo, and Sony; materials, such as aluminium or glitter; finally, the cofounder of Sony himself, Masaru Ibuka; Charles Darwin’s libertarian brother, Erasmus; the American politician Robert McNamara; Robert Buttimore, etc. For an oeuvre considered to be ‘conceptual’, austere rigorous, or even sparse, Liam Gillick’s work is certainly densely populated – both by conceptual personages as well as narratives, dialogues, biographies, and landscapes. Conceptual? Such a hasty judgement can undoubtedly be traced back to the fact that texts play an important role here and underpin the forms on show, rather like the libretto for an opera. And yet isn’t this also the case for Titian or Sandro Botticelli when one tries to understand the work and not just look at it? And isn’t this exactly the same contract, for example, that Marcel Broodthaers’ work proposes to the viewer? A better way to access Liam Gillick’s multidimensional universe would be to examine his concept of realism within a broad historical spectrum, starting with Gustave Courbet. In order then to derive that very sense of reality he wants to describe: in this case, something essentially real, not far removed from Jacques Lacan’s definition, that is to say, a space that cannot be reduced to mere symbolisation and thereby be apprehended solely via a topology. With the aid of a formal vocabulary predicated upon minimalism and conceptual art, Gillick exposes the problems of the existential conditions for the globalised individual at the turn of the twentieth and twenty-first centuries – thereby referring with this project to comparable studies that arose in modern painting almost a century before. Gillick’s oeuvre is by no means limited to the purely ‘conceptual’, but proves to be a narrative reference work scattered with stage directions. However, as in the poems of Stéphane Mallarmé or Blaise Cendrars, and in some of Jean-Luc Godard’s films or Samuel Beckett’s plays, his protagonists congregate on empty stages or in fragmentary frameworks, thereby effecting a permanent toing and froing between the text and his topological structures that serve as supports, stages, or as recipients – a context in which the questions emerge of who determines the organisation of human society and how is this done. “The writing and the retinal work”, as Liam Gillick explains, “all deal with different aspects related to issues of compromise, strategy, negociation and renovation. The work you see in the gallery or in specific applied situations is functioning in parallel, both to itself, other similar works and to the texts I use.”1 Parallel: another keyword. The structures, plans, images, narratives, and labelling which constitute his work are not converging lines, but, on the contrary, lines which play with their very parallelism in order to depict a landscape from which there is always something missing. But what? In view of the consideration that history, structures, and ideology form the three pillars of Gillick’s aesthetic, then one might conclude that the imaginary appears in the form of a residue or spark arising from the clash between the ideological, formal, and historical materials that mark it out. Thus, the subject matter of the work can be found in a precise location, at the invisible centre of his discourse: the end of utopia, the entropy of the imaginary, and the attempt to chart the real.

14.

I. Social Reality in Real Time In my view, Liam Gillick is a realist artist. By that I mean that his work ultimately represents an exact reproduction of what he actually sees; what he perceives through the immediate environment, which will be at the forefront of his exhibitions, is none other than an ideological infrastructure that conceals objects and behaviours and determines political decisions and the organisation of human social relations in time and space. Realist? This may seem paradoxical when applied to an artist whose thematic scope is readily labelled with such terms as forecast, scenario, or planning. However, these are represented in his work as an integral part of the present; the forecast and its ideological derivatives determine our actuality, in the same way that the clairvoyant propensities displayed by some characters in the novels of Philip K. Dick can also change reality – from the future, but not the other way round. “The key to everything”, according to Gillick in his first book “Erasmus Is Late”, “is an understanding that a desire to predict the future is central to a development of a particular form of free-marketeering. A focus for progress. But a process that can happen in reverse, become mythologised or even forgotten.”2 The future is encoded in the present: it is no longer a consequence of those intellectual projections that permanently determine the overall ideological framework, those shadows in Plato’s cave, whereby the action is directed by scenarios or plans and no longer by ideas. That is the world Gillick is describing – by processing structures in terms of volume, slightly shaky sketches, and scenarios that he stages with forms deriving from the economic and political ‘feuilletons’ of our time. The ‘motif’ that Gillick tries to portray in all its various aspects – just as obsessively as Paul Cézanne tried to portray Montagne Sainte-Victoire – is Capital. In the same way that the French painter tried to free the chromatic framework – the basis for the spectacle of the world – from chaos, Gillick likewise wishes to capture, wherever it manifests, the structure of the capital that determines human agency and current imagery. Cézanne perceived Montagne Sainte-Victoire to be a crystallized architecture, and not just a tangle of vegetable and mineral matter, because he fashioned his composition declaredly out of the ‘geological sediment’ of the landscape. By contrast, Gillick proceeds from an ideological sediment, that is to say, from the most fluid and yet the most enduring elements that permeate society. If it is his intention to depict both the world we live in nowadays and the ‘masses’ in our time, then he doesn’t approach it in the way an Andreas Gursky might, duly transforming it and them into spectacular images that any ‘media narcissist’ can immediately assimilate. His purpose is not one of ‘revealing’ any old elements that have been suppressed by capital, inasmuch as his work has the contrasting tendency to show that everything is clearly visible for everybody – indeed, not unlike Edgar Allan Poe’s short story “The Purloined Letter”. The ‘ideological sediment’ underlying the development of Liam Gillick’s work belongs, in equal measure, to temporality and space: the fundamental anachronism that characterises “Erasmus Is Late” – the story of a London dinner party with guests from different historical epochs – belongs to a kind of conceptual realism that insists upon the continuance or metamorphosis of particular attitudes, ideologies, or discourses over the course of time. “Should the future help the past?” is the Gillickian ‘question par excellence’?3 The cofounder of Sony and the two libertarian thinkers from the nineteenth century, for instance, actually do have something to say to one another, and Gillick’s work can be viewed as the space of their hypothetical encounter in the shopping malls and corporate lobbies of our time. “The text is about the corrupted legacy of the Enlightenment, as well as the implications raised by the lack of a revolution in Britain in the late eighteenth century”,4 explains Gillick.


Comprising fragmentary speeches, elliptical or sibylline dialogues, and statements bordering on abstraction, “Erasmus Is Late” is a relief derived from the grammar of discourse surrounding planning and decisionmaking; it places the abstract logic of political agency in the foreground, always with the same nagging question: what is the form exactly of the information and theoretical protocol – both substructures of political implementation? This gives rise to the association with both the realism for which Courbet was striving during the middle of the nineteenth century and indeed his “aesthetic founded upon action, engagement, and the capacity for transformation”.5 “I only paint what I see”, asserted the creator of “The Painter’s Studio”, who painted whilst under threat from photography: pictorial realism, as technical reproduction of the visible, announced itself – an adventure that presaged little excitement. Courbet therefore redefined realism as an intellectual and optical confluence of the allegorical narrative and the political project. Nevertheless, he was forced into exile after the uprising of the Paris Commune in which he had attracted attention by his involvement in the destruction of the Vendôme column. In 1855, the rebel of the art world erected the “Pavilion of Realism” after the Paris Salon had rejected his work. “The Painter’s Studio” was also exhibited there. Courbet describes his painting in a letter to his friend, the critic Champfleury: “It is the moral and physical history of my studio. Part One: these are the people who serve me, who support my ideas, who take part in my actions… On the left: the other world of everyday life, the people, misery, poverty, the wealthy, the exploited, the exploiters, people who earn their living from Death… Then there are some plaster casts leaning against the wall over there, a board and atop it, a small girl, a lamp, pots, then paintings facing the other way, a screen and then just a large, empty wall.”6 Parallel structures: on the one hand, the physical pavilion built by the artist and through which he controls the conditions for the exhibition of his works; on the other, the painted ‘studio’, the full title of which is “The Painter’s Studio. A Real Allegory Summarizing my Seven Years of Life as an Artist”. If it is possible to detect such a proximity to Courbet’s realism in the individual works of Liam Gillick, then it is because they function as an allegory of contemporary modes of production: the fetish materials of corporate architecture (anodized aluminium, Plexiglas, cables, etc.), more and more logos and graphics software, networking, think-tanks, and ‘project groups’. This combination of materials, styles, and processes that characterize Gillick’s universe is a veritable allegory of the contemporary working environment: it contains all the elements, yet they are isolated from one another and reduced, as though desiccated by their very presence in the critical herbarium of the exhibition. One could say that a Liam Gillick exhibition is to the world of labour what a stock cube is to soup: no sooner has one dissolved it in some ideological liquid than one finds oneself in a model office in the management era or a conference room owned by the Apple Corporation. If the acuity of Courbet’s realism obtained from the menace of photography, Gillick’s realism is shaped more by a vague, but nonetheless acute, danger. On the one hand: transformation of the private sphere into a ‘leisure’ appurtenance of the general system of production, i.e. the extension of the factory assembly line to the private sphere; on the other, the fact that artists nowadays create their work in an atmosphere constantly beset by the threat of a complete dissolution of the public’s attention within this random spectacle, which is itself tantamount to a “Devastation of Meaning”, to quote the title of a text dedicated to Cerith Wyn Evans by Gillick. Hence, there is a tendency never to propose works that might be regarded as conclusive in any way: “I try to encourage people to work in parallel directions”, he explains, “and ultimately to accept that a work exhibited in a gallery isn’t the resolution of an idea.”7 This inchoate, unfinished state contributes – in ways different from those one might imagine – more to the creation of realism than to its contradiction. The Impressionists already preferred the ‘unfinished’ in painting, the visible

15.

trace of the hand at work, precisely because they were contemporaries of the Industrial Revolution and Taylorism. Gillick’s works are situated beyond the arena of packaged objects and solutions, prolonging the function of resistance and extending this arena – within a world in which even ideas, like products, have to be neatly bundled. Is it possible – taking up an expression I used at the beginning of the 1990s – to speak of an ‘operative Realism’ here? The author of “Erasmus Is Late” insists that he is fighting against “grappling with real object and idea relationships that affect personal politics; how to negotiate a city; who controls the near future; how can we understand the processes of renovation and so on.”8 Planning and implementation: both are the behavioural modes of the thinking of the assembly line. This has been a salient feature in Gillick’s first works, but particularly in the series of pinboards created by the artist from 1992 onwards. Simple work plans, oscillating between household and professional use – pinboards that present themselves as surfaces upon which information is collected in the form of press cuttings, notes, photographs here and there. The work doesn’t actually produce any information, but it designates the frame of information. Here, too, we are concerned with laying bare the procedural structure of human action – via an unusual approximation of artwork and the form of an office accessory, as well as through the systematic rejection of any conclusive meaning in the permanent state of openness towards the texts and parallel activities. With reference to his first exhibition in 1989, Gillick explained that instead of producing objects he was at pains “…to develop a kind of parallel mode of action that is bound up with reflection upon the idea of cultural permission. I felt that it was not necessary to be granted permission to function as an architect or archivist.”9 This concept of gaining prior permission naturally alludes to power structures. Who makes the decisions? Who implements them? In the sphere of artistic production, as at every level of professional ‘qualification’, it is a matter of demanding decapitalisation, of dispersing capital as widely as possible in both concrete terms, as well as all its numerous symbolic forms. It is possible to recognise – irrespective of which Liam Gillick exhibition one is viewing – industrial structures, books, television sets, and the signs of art, but to us, these elements seem isolated from the symbolic (ideological) infrastructure which binds the cultural economy. In contrast to Damien Hirst, whose methods consist of accumulating capital within spectacular objects, Gillick exhibits forms that have previously been emptied of their symbolic content: the structures are extracted from a nonexistent text, texts allude to forms exhibited otherwise, or to future processes… Underscored by the parallel structure of the work itself, this absence designates the ‘impossible’ subject of Liam Gillick’s oeuvre: utopia, that is to say, the self-determination of human groups with regard to their future. “In view of the fact that the opposite of the possible is assuredly the real”, according to Lacan, “we must needs define the real as the impossible.”10 No need to hide an object to render it untraceable as Edgar Allan Poe teaches us in his tale of the ‘purloined letter’; for Lacan, the real is that which is absent from its rightful place, like the letter so clearly visible to all. And as it happens, the real is for Gillick the same political concept which has disappeared from the sphere of power and is ‘no longer in its place’ – to such a degree indeed that it has become a simple exhibition piece. There is nothing then in Gillick’s artistic inventory that isn’t visible and accessible to any viewer from the contemporary world; however, there is nothing that rewards the consumer with meaning. For his work is both dark and light at the same time – or rather both in parallel. Using the yardstick of these clear principles, it is also possible to interpret his critique of the widespread tendency amongst artists toward fashionable ‘revelation’ – something he disqualifies as ‘dog-art’, in short art as a form of technology, with the express aim of exhibiting the very things that


society wants to dissimulate. “Society understands something implicit in the images and narratives that are presented to it, and rejects them moment to moment as inconvenient to the continuation of the process of absorbing images and narratives. The artist in this case merely brings back those images, like a dog bringing back a stick and proudly showing it to the owner of the dog who already knows what the stick looks like because he or she was the one throwing it in the first place.”11 Because he is fed up with throwing a stick that in any case never comes back, the dog owner keeps hold of it: that is the current situation and the perfect metaphor for the type of culture that has been divided into ‘high’ and ‘low’ by the dominant orthodoxy. The master expects the return of the stick on the carpet and that is precisely what happens: thus, the culture industry is duly compensated, inasmuch as its products enjoy a second life and are initially consumed wholesale, and then in detail. Among the binary structures that have entered contemporary ideology via postmodern thinking, the compulsory subdivision of cultural production into ‘high’ and ‘low’ is certainly the worst. In this sense also, Gillick’s work strives for realism: it battles with the visible and the displayed without giving in to this brand of cryptometaphysics that elevates the ‘concealed’ and yet is only a consumer avatar of conspiracy theory. Ultimately, that would be the meaning of a work such as “Big Conference Centre Limitation Screen” (1998): everything is before our very eyes, with the wall only filtering the light and limiting access to the room so that the work simply suggests the possibility of ‘limiting development and debate’. As Gillick summarises: “Things get truly interesting when art goes beyond a reflection of the rejected choices of the dominant culture and attempts to address the actual processes that shape our contemporary environment.”12

II. A Topology of Capital (Narratives and Scenarios) What can be found within this formal universe that reflects our contemporary environment? Geometric bodies and surfaces, powder, texts. As we have seen, this terse vocabulary permits Liam Gillick to describe a ‘real’ that can be defined in two ways; on the one hand, as a concrete effect of the capitalist system and the sum of human relations produced by it; on the other, as a blind spot corresponding to Lacan’s formula that the real is impossible. In order to portray it, there can only be one possibility, namely that of the psychoanalyst: as the real is the very thing “that defies every form of symbolisation”, the object has to be a topology. Lacan’s doctrine was transmitted from the 1960s onwards mostly in the form of mathemes borrowed from topology. A matheme can be described as an atom of knowledge of which the primary characteristic is its transferability – the torus, the Möbius strip, Klein’s bottle, the cross-cap, and Borromean knots. Lacanian topological objects are indeed astounding and show the degree to which our thinking is dependent upon the figure of the circle that dissects space on both the inside and the outside – in the way the images we have of our own bodies incite us. Thus, Lacan’s mathemes became the preferred instruments for the disruption of the ‘real’ in psychoanalysis. The visual simplicity which Gillick embraces, the occasionally enigmatic nature of his pronouncements, and a recourse to geometry are likewise criteria that allow us to progress, in the same way that each of his works represents the matheme of an item of knowledge. Bereft of an inside and an outside, his work functions like a Möbius strip. Liam Gillick’s work – and that is the best way to sum up its overall coherence – could be defined as a topology of contemporary human relations and social structures described by means of signifying chains. And the line of discursiveness permeating Gillick’s work functions in the same way that signifying chains (that constitute the human subject)

16.

Nicolas Bourriaud

develop from their anchor points, knotting together and linking segments at regular intervals. If one places some of Gillick’s works side by side, for example, “Isolation Platform” (1999), “Big Conference Center Legislation Screen” (1998), “Post Conference Platform” (1998), and different versions of the think tanks, it is possible to witness the way a grammar develops, whose semes are codified according to behaviour types: isolating oneself, symbolising, leaving a work area, thinking, and negotiating. This system of codification or notation became particularly evident in the exhibition “A Short Text on the Possibility of Creating an Economy of Equivalence” (2005) at the Palais de Tokyo in Paris, which referred to a book entitled “Construcción de Uno” that appeared whose writing was in progress. It deals with the adventures of a group of workers who decide to run their car factory themselves after it has been closed down; on returning to their place of work, they decide to produce ideas instead of cars and initially reorganise the layout of the building, before testing out new production models along the lines of an “economy of equivalence”, whereby a unit of output corresponds to a unit of input, an economy therefore in which every human or financial investment is simply replaced without loss or alteration. The focus of the exhibition was mental topography: the mountainous landscape that the workers wanted to look at from their factory windows was created by means of an installation comprising colourful steel flowers, the jagged form of which was reminiscent of the diagram used by Peter Saville on the cover of Joy Division’s first album; the path between the factory canteen and the building was marked out in red glitter. However, once again form extended beyond the area of the representation: Gillick indeed used the “economy of equivalence”, recycling the structures used in Paris, transporting them to Madrid where they became the basis for the fittings of a bar in La Casa Encendida – constituting thus a fullyfledged, formal element. This topography forms the basic vocabulary of a narrative line that is articulated – more than, say, in the stories – in the multivalent format of the scenario, which crops up in multiple metaphorical and concrete variants in Gillick’s work. This complex and evolutional concept surpasses the technical definition of in the lexicon of cinema, and could be defined as a narrative bundle in which a space, diverse processes, a text or a body of texts, and action or events that may unfold, can all play a part. Thus, in Gillick’s work the term scenario refers above all to a space that leaves subjects pending, a virtuality framed by forms. There is a second meaning however, which sometimes replaces it: in this case, the scenario becomes a protagonist of History, becomes one of those intellectual frameworks deployed in the struggle for control of the future; the scenario then resists planning, programme, and speculation. “You could argue that one of the great battles of the twentieth century was between speculation and planning and you could pretty much say that speculation won.”13 Gillick returns to this area of conflict once more when he describes “Literally No Place” (2002): “a text that sought new ways to go beyond the stifling neoliberalism of the present (the victory of speculation over planning) and to find ethical traces in the built world that surrounds us.” There is a further analogy to Lacanian topology, namely the ‘subject’ of Gillick’s work which appears as a hole: it is then about the real. However, what the artist indefatigably strives for in his work – this self-governance of the future, of the conditions of work and existence for humans – is ceaselessly mediatised by means of prefabricated spaces (the separation screen, boxes, conference suites, bars, ceilings, etc.) that transform this quest into a linguistic and formal Odyssey. Gillick stages the desire for utopia in keeping with a complex and elastic analytic principle equal to that enacted by James Joyce for June 16, 1904 in “Ulysses”. When Leopold Bloom enters a Dublin pub in order to eat a plate of kidneys, the superimposition of this quotidian occurrence on Homer’s Laestrygonian episode produces an infinite elasticity: by describing banality as though it were an heroic epic, Joyce is disrupting the real by means of language,


as though the most minute human gesture, like a molecule in the particle accelerator of literature, might resonate to infinity. A hundred different styles coalesce in Joyce’s novel, from legalese to slang and from the essay to the sermon: Bloom’s day is narrated in a thousand different ways and from a thousand different standpoints, but the real only allows itself to be lightly touched upon, only to withdraw still further. There is a Joycean compulsion in Gillick’s work, to frame situations with a manic exactitude, situations that seem to turn with an infinitesimal degree of precision. The missing punctuation marks in some wall drawings are reminiscent of the protocol of the interior monologue used by Joyce, applied here to slogans and phrase types. A further parallel: Liam Gillick’s work is the Odyssey of politics, in the age of its dissolution in financialization and the bureaucratic pile of decisionmaking. A project then project to which the artist alludes, and finally summarises, when he states that “the permanent displacement and projection of the critical moment is the political potential of the discursive”.14

III. Respective Positions of Forms and Subjects One cannot emphasise too strongly the extent of the aesthetic damage perpetrated by Michael Fried’s texts during the 1960s; in particular, the text “Art and Objecthood”, in which he rails against the ‘theatricality’ of Minimal Art, and which today still serves to keep Greenbergian dogma artificially alive, even beyond its field of application. This theory is predicated upon an almost obsessive rejection of the anthropomorphic, of which the ultimate fantasy is the radical exclusion of every human trace outside the ‘creative process’, in favour of an aesthetic which might be described as antisituationial. “What lies between the arts is theatre”, writes Fried, is “literal” – and therefore bad. He mocks the concern regarding temporality, in place of which, in his estimation, a “continual and perpetual present” should emerge as the guarantor of “authentic art”.15 The indictments put forward by the likes of George Baker and Claire Bishop against ‘relational aesthetics’ and, in particular, against the work of Rirkrit Tiravanija and Liam Gillick would be unintelligible were it not for reference to this narrow conception of form deriving from Fried’s polemic and Clement Greenberg’s take on Modernism. During the 1990s, the Fried legacy has tried in vain to develop a progressive and activist milieu because ultimately it was characterised by true artistic positions and its alleged good intentions were repeatedly refuted by an aesthetically reactionary substrate. Let us return, however, to the concepts of the debate: “When Bourriaud argues that ‘encounters are more important than the individuals who compose them’”, writes Bishop, “I sense that this question is (for him) unnecessary; all relations that permit ‘dialogue’ are automatically assumed to be democratic and therefore good. But what does ‘democracy’ really mean in this context? If relational art produces human relations, then the next logical question to ask is what types of relations are being produced, for whom, and why?”16 And again: “…the relations set up by relational aesthetics are not intrinsically democratic (…) since they rest too comfortably within an ideal of subjectivity as a whole and of community as immanent togetherness.”17 The accusation in advance: by definition, there is no relationship produced by an artwork without the specific content being visible, whereby the relational aspect is essentially a format, like a painting or a sculpture. The artistic situation delineated in “Relational Aesthetics” is nothing other than the historical moment in which some artists in their artistic practice have applied the principle that Karl Marx formulated in his treatise on Feuerbach, where he states that ‘human nature’ can only be defined as a system of relationships. The human aspect is nothing other than the interpersonal component, that is to say,

17.

And why Would there Be a Title?

a complete ensemble of interactions constructed by humans and implemented by institutions, systems of exchange, or production; the social aspect derives from this, just as art is not predicated upon any kind of ‘nature’ and any ‘ex-ante’ definition, but is ultimately a product of immense and ongoing negotiation, of which the productivity and meanderings in particular are embodied in Liam Gillick’s work. During the 1990s, some critics saw things differently and theoretical opposition was particularly strong in Great Britain, where the spectacular objects produced by the ‘Young British Artists’ threatened to eclipse more sophisticated or simply more discursive practices. Even Claire Bishop – as chief spokesperson for the opposition – seems to belong to that group of observers, who, according to Gillick, are regrettably looking for aesthetic ‘resolution’ within an artwork. Bishop’s critique is based upon a restrictive conception of form, as she clearly articulates in a second text on relational aesthetics in the magazine “Artforum” in February 2006: “Such work seems to derive from a creative misreading of poststructuralist theory: rather than the interpretations of a work of art being open to continual reassessment, the work of art itself is argued to be in perpetual flux. There are many problems with this idea, not least of which is the difficulty of discerning a work whose identity is wilfully unstable.”18 One has to admit that a work with an identity perceived as ‘unstable’ actually resists any labelling and even any form of identification. It is indeed its salient characteristic which, in turn, forms the dividing line between the traditional art conceptions and practices that, in Gillick’s case, are predicated upon negotiation and the refusal of an a priori assignment of statutes and roles, under the aegis of a predictive concept of art. In response to Claire Bishop’s article, published in the same winter edition of the magazine, Gillick underscores the fact that the art criticism in question at no time mentions the texts that specifically accompany the works, and is guilty therefore of consciously mutilating them: “‘(Discussion Island)’ is not a book about open-endedness or compromise; it is a critique of these things, which would be clear if she had once mentioned this book or the other specific writings that occupy a crucial role in my artistic practice… The artwork related to the text Discussion Island formed a backdrop that allowed the book to be developed, hence the ‘Discussion Platforms’ from the late 1990s that projected a specific site for a consideration of the specific ideas involved.”19 We are dealing here with the ongoing presence of a theoretical paradox: the most vehement detractors of Liam Gillick’s art are those very people who come forward in the name of social justice and politically engaged art and they erase who particularly like to exclude visitors from exhibitions on principle – in the name of the holy autonomy of the art object. One might just as well exclude citizens from democracy in the name of the purity of the democratic idea – incidentally, something that has been implemented on several occasions throughout history. Gillick counters by stating that “…my work is like the light in the fridge, it only works when there are people there to open the fridge door. Without people, it’s not art – it’s something else – stuff in a room”.20 Occasionally the artist brings “lots of people” together in this way, who, according to Tiravanija, are all part of his installation and whom he incorporates into the list of materials present in his works. An analysis of the diversity of positions offered to the viewer in the case of Gillick, Tiravanija, Philippe Parreno, or Carsten Höller would have allowed an orientation towards the definition of a genre of the ‘participant’, a concept adopted from the 1950s, which relational aesthetics has just consigned to the past in the same way that pop art historicised Marcel Duchamp’s ready-mades. Needless to say, none of the aforementioned artists has anything to do with the vague and obsolete subgenre of ‘participatory art’ to which Bishop reduces relational practices. A differentiation, as undertaken by Bishop, between “social


collaboration” on the one hand, and the artists’ “conceptual and sculptural practice” on the other, is patently absurd: there isn’t a hiatus in Liam Gillick’s method – just as there isn’t one in the case of the artists mentioned in “Relational Aesthetics” separating the essence of an ‘ethical’ practice beyond form and pure aesthetics. Such a distinction seems to be predicated primarily upon an empirically untested a priori, inasmuch as even a fleeting analysis of Gillick’s practices amply shows that there is no such separation between political engagement and artistic practice. On the contrary, it is impossible to make this distinction. It seems strange when one reads that these practices, which I have called relational because they select the interpersonal sphere as a theoretical and/or practical point of reference, favour morality as opposed to form, generating a purely ‘social’ art, a seemingly ‘angelic’ ethical model, for the simple reason that they conceal real, existing antagonisms within society. This misunderstanding is all the more striking as the book’s thematic focus is the new status of form (new ‘formations’, in order to emphasise the dynamic character of the elements in question, whose area of definition embraces both bodily dispositions and temporality, to which the forms must cohere). In short, the ethical dimension of works by Rirkrit Tiravanija or Liam Gillick is not the one that counts, but rather their ability, proceeding from the interpersonal sphere, to invent innovative methods for exhibition and reflection. In this way, Gillick defines his entire oeuvre to date as “a space for the negotiation of ideas in which individuals actually control the nature of the world in which they operate.”21 Nevertheless, according to Gillick: “The fact is if you don’t stop changing the rules of the game, then nobody will know his own rules, then you end up with a political phenomenon.”22 A less random view of the complexity inherent in Gillick’s thinking might have shown that the artist situates his work in the context of the major influence exerted by Felix González-Torres, who, from the late 1980s onwards, brilliantly reanimated the vocabulary of combative engagement in art. According to Gillick, González-Torres is “very important because he passed through the classic, didactic discourse that surrounded issues of identity and sexuality and created new forms of beauty that were rooted in deep and serious ideas. I learnt something from the way his work plays with the form and the way that you can loosen up to a certain extent”.23 As in Gillick’s case, the work of the Cuban artist was underestimated at first by the critics; for a long time he was viewed merely as the artist who distributed sweets or put go-go dancing boys on the podium. In the meantime, this type of categorical misunderstanding has become paradigmatic: one deduces, from the formal apparatus to which the artist has recourse (in Gillick’s case a conference room, or a bar, a ballroom, or nightclub in that of González-Torres), a certain ‘apoliticism’ in an artist who works with entertainment or a superficially convivial ‘feel-good’ factor (Bishop). One might just as well contend that the preponderance of fruit in Paul Cézanne’s paintings is tantamount to his engagement on behalf of the cause of gardening, but, in the case of Gillick and GonzálezTorres, the viewer doesn’t have the possibility of putting himself or herself objectively in the position of the ‘consumer of ambience’, which these analogies suggest. On the contrary, the relationship built with the viewer is precisely framed and is never sacrificed to improvisation or an ‘entertainment’ principle. According to Gillick, visitors to the exhibition “are able to go through the central bundle of ideas, through the scenarios or texts but also the visual aspect of the work, the formal links – via these different ways, quickly mount a framework so that something happens.”24 In “A Note on Discussion Island: Item A001”, a work comprising a pile of grey glitter, it is clear that “the work designates a fragmented zone where it might be possible to consider the potential of discussion and compromise”. There is no sign, neither here nor anywhere else, of the allegedly atomised and Pavlovian ‘participant’ as Claire Bishop

18.

Nicolas Bourriaud

characterises the integration of the viewer into the dispositive of the exhibition. It greatly disturbs the critical discourse that the political content posited by Liam Gillick’s works radically contradicts other fashionable forms which doubtless would have the advantage of being more explicit: alongside the previously cited ‘dog-art’, other practices are worthy of mention here that – with a variety of scales, but chiefly one to one – are based upon the representation of an economic and political alienation. By contrast, Gillick’s work doesn’t show any signs of repression, control, or ‘biopouvoir’ and doesn’t allude to either the register of anecdote or actuality, but marks the formal framework and processes that allow this repertory of political repression to function. It is a form of withheld critique – a sort of eidopolitics – which accumulates specific formats and markers of a clearly designated practice and subjugates them systematically to a battery of questions, in relation to the inscription of this practice in a global context. A work – apparently geared towards functionality – as a prototype design for “Conference Room” (exhibited in the Frankfurt Kunstverein in 1999) ultimately represents a study of the way in which the constructed environment changes behaviour, an operational model so to speak. “64th Floor Lobby Diagram” (1999) functions in the same way, but integrates additional artistic coefficients into this model that take up the dialogue between minimal art forms and corporate design. And yet the misunderstandings surrounding Liam Gillick’s art can be traced back still further, to the first debate which took place within the Cologne art scene at the beginning of the 1990s. Liam Gillick noted subsequently that “…a tension could be perceived between those artists who advocated transparency within art (Andrea Fraser, Clegg and Guttman, and others associated with the Galerie Christian Nagel) and those who believed that a sequence of veils and meanderings might be necessary, to combat the chaotic ebb and flow of capitalism (Philippe Parreno, Dominique GonzalezFoerster, and others associated with the Galerie Esther Schipper). It is notable that those who were sceptical about the notion of transparency and a straightforward relationship between intentions and results tended to be from a background where a belief in transparency was historically imposed by the dominant culture.”25 It is possible to discern a fault line here that has repercussions still palpable today: on the one hand, the obligatory transparency required in the kind of historical conceptual art from the 1960s; on the other, the recognition of the need to modify its parameters in order to uphold its critical impact – in a society which is far more complex than that of the 1960s. When he wrote “Art after Philosophy”, Joseph Kosuth wanted to substitute criticism with a paradigm of artistic intervention. From the 1990s onwards, it was this critical philosophy itself that needed to be overcome, via the insight that an external critical position is indeed untenable – nobody can view society from the outside, except perhaps a god… The fantasy of transparency, whose complementariness with the glass architecture of corporate buildings, with a controlled society, and with the dominant ideology in general is underscored by Gillick, is nowadays literally nothing more than an adaptation of the conceptual art of a society governed by personification, in which every product zealously states its identity. The problem of conceptual compromise now arises: are not all artists, irrespective of the way in which they engage, bound to participate in the very discourses they are subjecting to critique? The generation of artists who have chosen the ‘veils and meanderings’ in place of postconceptual transparency reacted with an assumed immersion tactic comparable with the ‘establishment line’ as propagated by Robert Linhardt, the head of the French Maoists, after May 1968. Here too, the personal account of immersion represents a political answer: the activist should work in the factories, prepare the revolution from the inside, instead of standing at the gates of the system of production brandishing leaflets. More transparency, but also secrecy and clandestine behaviour; more frontal assault, yet an organ of negotiation within the system.


Far away from the supposed ‘fringes’, where the artist comments upon and judges the system from the other side, a ‘milieu’ represents, at this juncture, a space where the artist can articulate himself or herself. It is here that individual issues can be developed in successive extensions, by means of investments in different areas, and through collaborations with groups of people from heterogeneous disciplines. Liam Gillick has established himself in this space – at the heart of economic dominance – and duly installed his parallel activities here.

Liam Gillick, “The Wood Way”, exh. cat. The Whitechapel Gallery (London, 2002), p. 81. 2 Liam Gillick, “Erasmus Is Late” (London, 1995), p. 39. 3 Liam Gillick, “Five or Six” (New York, 1999), pp. 27–43. 4 Liam Gillick, ‘Contingent Factors: A Response to Claire Bishop’s “Antagonism and Relational Aesthetics”’, “October” 115 (Winter 2006), p. 102. 5 Catherine Strasser, “Le Temps de la Production”, École des Arts Décoratifs de Strasbourg (1997), p. 26. 6 Ibid., p. 17. 7 Liam Gillick in conversation with Eric Troncy, “Documents sur l’art” 11 (1997–98). 8 Liam Gillick, (cf. note 1), p. 18. 9 Liam Gillick in conversation with Hans-Ulrich Obrist, Hans Ulrich Obrist, “Conversations”, vol. 1 (Paris, 2009), p. 283. 10 Cf. Jacques Lacan, “The Seminar: Book XI: The Four Fundamental Concepts of Psychoanalysis”, 1964, trans. Alan Sheridan (London, 1977). 11 Liam Gillick, “Proxemics: Selected Writings” (Zurich, 2007), p. 226. 12 Liam Gillick, (cf. note 4), p. 100. 13 Liam Gillick, (cf. note 1), p. 17. 14 Liam Gillick, “Hermes Lecture” (’s-Hertogenbosch, 2008) p. 28. 15 Michael Fried, ‘Art and Objecthood’, “Artforum” 10 (Summer 1967), p. 12–23. 16 Claire Bishop, ‘Antagonism and Relational Aesthetics’, “October” 110 (Autumn 2004), p. 65. 17 Ibid., p. 66. 18 Ibid., p. 52. 19 Liam Gillick, (cf. note 11), p. 103. 20 Liam Gillick, “Renovation Filter: Recent Past and Near Future”, exh. cat. Arnolfini (Bristol, 2000), p. 16. 21 Conversation with Hans Ulrich Obrist, (cf. note 8), p. 290. 22 Ibid., p. 288. 23 Liam Gillick, (cf. note 1), p. 18. 24 Conversation with Hans Ulrich Obrist, (cf. note 8), p. 290. 25 Liam Gillick, (cf. note 11), p. 106. 1

19.

And why Would there Be a Title?


ISABELLE MOFFAT LIAM GILLICKS VERLOCKUNG ODER „WARUM SAGST DU MIR, DU FÄHRST NACH KRAKAU, DAMIT ICH GLAUBE, DU FÄHRST NACH LWOW, WENN DU WIRKLICH NACH KRAKAU FÄHRST?“

Ich gebe zu, die Eloquenz bildender Künstler ist mir manchmal verdächtig, zumindest, wenn es ihr eigenes Werk betrifft. Nicht, dass ich an ihrer Scharfsichtigkeit, Intelligenz oder Aufrichtigkeit zweifle, aber ich mache mir lieber selber ein Bild. Aber was bedeutet dieses Misstrauen für die Praxis meines Sehens? Wenn ich von den Worten des Künstlers nicht abgelenkt werden will, sollte ich dann vielleicht auch den Gesamtzusammenhang eines Kunstwerks, seine Machart und seinen Titel ignorieren? Und müsste ich dann nicht auch meine früheren Begegnungen mit Arbeiten des Künstlers oder mit anderer Kunst ausblenden? Was würde es bedeuten, ein Objekt ,einfach nur‘ zu betrachten und zu sagen: ,Das ist Kunst’ oder ,Das ist gut’? Vielleicht wären das die Bedingungen der Betrachtungsweise, die Clement Greenberg als ideale definiert hat: Gleichzeitigkeit, Unmittelbarkeit und Selbstreferentialität. Das Kunstwerk, das eine Kritik seiner eigenen technischen Mittel beinhaltet und die Beschränkungen seines Mediums respektiert, wäre zu einem autonomen Ganzen geworden. Selbst wenn in der Praxis der Moment der Betrachtung diachronisch verläuft, so begreift man der ‚formalistischen‘ Theorie zufolge das Kunstwerk auf den ersten Blick – oder gar nicht. In zahlreichen Diskursen ist dieses Modell ästhetischer Erfahrung einer kritischen Analyse unterzogen worden. In ihnen wird davon ausgegangen, dass wir körperliche und sozial konstruierte Wesen sind, die noch dazu Geschlechter- und Klassenrollen unterworfen sind. Unsere Wahrnehmung ist niemals unvoreingenommen oder unbelastet von unseren Erfahrungen, unserem Wissen und Kontext. Ebenso wenig ist das Kunstwerk ein autarkes Gebilde, es bezieht sich auf ein Draußen; es ist zeitabhängig, insofern es in die Tradierungen von Kunst, Macht und Ideologie verflochten und in die systemische Wissensproduktion und vielstimmige Diskurse eingebunden ist. Spezifische materielle Bedingungen bestimmen über sein Entstehen und seine Rezeption. In seiner Analyse der Widersprüche in den zeitgenössischen Diskussionen über bestimmte minimalistische Werke schreibt Georges Didi-Huberman: „Die Verquickung der Diskurse und der Werke (präsentiert) allzu oft eine Lösung, die ebenso falsch wie für die Kunstkritik verführerisch ist. Der Künstler ,sieht‘ oft ,nicht‘ den Unterschied zwischen dem, was er sagt (wovon er sagt, dass man es sehen müsse: ‚what you see is what you see‘ [Frank Stella]), und dem, was er tut. Doch ist dies nicht so schlimm, wenn nur am Ende die Kritik in der Lage ist, zu ,sehen, was gemacht wurde‘, also in der Arbeit in diesem Zwischenbereich zwischen den Diskursen und den Objekten das stets interessante und aussagekräftige, oft auch fruchtbare Auseinanderklaffen der beiden Aspekte auszumachen. Die Widersprüche und Trennungen, die hier am Werk sind, auszumachen, bedeutet oft, die Arbeit der Werke selbst – und ihre Schönheit – ans Licht zu bringen … [Doch allzu oft] zieht der Kritiker der Dialektik das Dilemma vor: er stellt zwar Widersprüche in den (sichtbaren oder theoretischen) Evidenzen heraus, kehrt jedoch dem widersprüchlichen Spiel (dem Spiel ,mit‘ den Widersprüchen) mehr transversaler, latenter – weniger manifester – Parameter der künstlerischen Arbeit den Rücken.“1 Dieses Dazwischen – der Raum zwischen dem Werk und seinem theoretischen Diskurs – ist zweifellos eine entscheidende Grundlage und ein fruchtbarer Boden für eine Analyse, selbst wenn es keine inhärenten Widersprüche zwischen der Stellungnahme des Künstlers und dem Kunstobjekt gibt. Aber wie soll man dem Werk von Liam Gillick begegnen, einem Künstler, der sich vorzugsweise in diesem diskursiven Zwischenraum bewegt und

20.

ihn mit großem Geschick zu nutzen weiß, um den Betrachter zu verwirren und herauszufordern. Bleibt da noch eine analytisch problematisierbare Zone zwischen dem materiellen Werk und der Textproduktion des Künstlers, ohne dass dieser dort bereits mit seiner Vorausschau der Publikumsreaktion auf mich wartet – so wie Grimms Igel, der dem Hasen am Ende einer jeden Runde verkündet: „Ich bin schon da“? Wenn ich den textlichen Teil seiner Arbeit ignoriere, verstehe ich vielleicht nicht, worum es ihm geht. Wenn ich mich hingegen seinem Geleit anvertraue, werde ich womöglich dazu verführt, der Dialektik das Dilemma vorzuziehen, wie Didi-Huberman es nennt, und mich aufs Manifeste konzentrieren – was in diesem speziellen Fall auch die eigenen Reflexionen des Künstlers zur soeben geschilderten Problemlage enthält. Kurz, droht mein Text auf eine Tautologie hinauszulaufen?

OBJEKTE Objekte können sowohl diskret als auch ‚diskret‘ im mathematischen Sinn sein. Beide Aspekte des ,Kunstobjekts‘ waren Hauptstreitpunkte der formalistischen Minimalismuskritik. Michael Fried forderte in seinen Schriften der frühen 1960er Jahre, dass Kunstwerke, für ihn vorzugsweise Gemälde, in sich geschlossen sein und somit die ‚Theatralität‘ minimalistischer Skulpturen, ihren Übergriff auf die Sphäre des Betrachters, vermeiden sollten. Seine Beschreibung einer solchen Präsenz (presence) des minimalistischen Werks verleiht diesem die Fähigkeit, sich auf einen, wenn auch nonverbalen, Dialog einzulassen. Er schreibt: „Man kann einen Raum, in dem sich ein minimalistisches Kunstwerk befindet, nicht betreten, ohne augenblicklich sein Betrachter, sein Publikum zu werden – es ist beinahe so, als ob dieses Kunstwerk auf einen gewartet hätte. Und insofern das minimalistische Kunstwerk vom Betrachter abhängig ist, ist es ohne ihn unvollständig, es ,hat‘ auf ihn gewartet. Und sobald er den Raum betritt, weigert es sich beharrlich, ihn allein zu lassen – das heißt, es hört nicht auf, ihm entgegenzutreten, ihn auf Distanz zu bringen, ihn zu isolieren. (Isolation meint dabei ebenso wenig Abgeschiedenheit wie Begegnung Vereinigung.)“2 Fried sah darin eine geschmacklose, spektakelhafte Zudringlichkeit, die mit seinem Begriff von modernistischer Kunst unvereinbar war. In den meisten modernistischen Modellen künstlerischer Arbeit findet sich eine Dichotomie von Form und Inhalt, eines der vielen vom Modernismus so geschätzten Oppositionspaare, das von zwei Strängen des Minimalismus, dem postformalistischen und dem textbasierten, in gewisser Hinsicht wieder aufgegriffen wurde. Eine vergleichbare Dichotomie lässt sich in Gillicks Werk ausmachen: schön gearbeitete, formvollendete Objekte auf der einen Seite und umfangreiche Schriften über Kunst, Politik und Gesellschaft auf der anderen. Dennoch können die Aufführungen und Texte nicht einfach aufgrund ihrer Textform als ‚Inhalte‘ betrachtet werden. Ein Text an sich konstituiert noch keinen ‚Inhalt‘. Sowohl Objekte als auch Texte können schweigen oder sprechen. Gillicks Kunst weist auf die Redseligkeit der Objekte und die Schweigsamkeit des Textes hin. Schon die ersten Anspielungen auf minimalistische Formen in Gillicks Werk enthielten textliche Komponenten: Auf der dem Betrachter zugewandten Seite von „Quad Rail (Blue)“, zu deutsch: Geländergeviert (Blau), aus dem Jahre 1989 steht eine Auflistung aller Bestandteile und die Installationsanleitung. Während der anschauliche Titel eine Scheinfunktion beschreibt, spielt die Arbeit mit der Beliebigkeit des Objekts, seinem mangelnden Gebrauchswert und intendierten Flüchtigkeit. Seine Machart aus preiswerten, im Baumarkt als Meterware erhältlichen Materialien gibt ihm weder das Aussehen eines Designobjekts, noch besitzt es die eindrucksvolle Präsenz minimalistischer Versionen dieser Art von Ästhetik. Gillick erklärt in einem Katalog von 2000 mit übertriebener Bescheiden-


heit, dass das Objekt „gebaut wurde, um die ansonsten nicht beachteten Bereiche eines ausgewählten Orts zu betonen“.3 Obwohl die theoretischen Diskurse die Begriffe der Authentizität und der Autorschaft problematisiert haben, tauchen diese immer wieder in Gestalt absurder Vorurteile über das gutgemachte Objekt auf. Es ruft kritisches Misstrauen hervor, vor allem dann, wenn es politisch aufgeladen ist. Man nehme beispielsweise die Reihe „Platforms“. Einmal abgesehen von der Ernsthaftigkeit, die hinter dem kritischen Diskurs über bestimmte, lediglich vorgefundene Farbschemata oder über die Einschränkungen von Verfahrensweisen durch das Verfügbare stehen mag, scheinen solche Beschreibungen der Bedingungen des Herstellungsprozesses zuweilen eine entschuldigende Funktion zu erfüllen – als ob durch willkürliche Farbwahl eine größere kritische Distanz erzeugt oder garantiert werden, eine künstlerische Entscheidung vermieden oder zumindest relativiert werden könnte und dadurch so etwas wie eine postmodernistische Authentizität entstünde. Während diese Dynamik der Wiederbelebung des Authentizitätsbegriffs Gillicks Werk – und dies meint beides: der Produktion und ihrer theoretischen Konzeption – den Impuls gegeben haben mag, ist sie für die theoretische Kohärenz seines neueren Schaffens jedoch weniger relevant. Dieses befasst sich und arbeitet weitaus mehr mit dem Vorurteil gegen Schönheit. Manche Kritiker mögen das diskursive Gerüst bevorzugen, das die Begriffe ästhetischer Entscheidung unterminiert, aber Gillick ist schon darüber hinweg. Die verschiedenen ‚Plattformen‘, die er als standortspezifische Arbeiten präsentiert und die Räume des ‚Kompromisses‘, der ‚Moderation‘ oder der ‚Diskussion‘ schaffen sollen, spielen mit der Willkürlichkeit ihrer jeweiligen Bezeichnung. Warum ist der eine ein Ort der ‚Entwicklung‘, der andere einer der ‚Resignation‘? Abgesehen von einem möglichen subjektiven Urteil, das bestimmte Farben oder Dimensionen mit einem Gefühl der ‚Resignation‘ assoziiert und andere mit ‚Kritik‘, gibt es keine Erklärung für diese Titel. Das gilt auch für die Trennwände, die aus verschiedenfarbigen und -formatigen transparenten Folien sowie undurchsichtigen Farbpaneelen zusammengesetzt sind; weder besitzen Farbe und Größenmaß eine inhärente Bedeutung, die ‚Gesetzgebung‘ oder ‚Limitation‘ signifizieren kann, noch erzeugen sie einen phänomenologischen Effekt, den man mit einer solchen Präzision deuten könnte. Das reduziert die Trennwände oder die Plattform nicht darauf, ,bloße‘ Objekte zu sein (was immer das heißen mag) – vielmehr bewirkt es ihre Öffnung und erlaubt ihnen zu sprechen. Darin liegt das Wesen ihrer Beredsamkeit: nicht stumm zu sein und nicht durch ihre ästhetische Kohärenz dazu verdammt, nur flüchtig wahrgenommen zu werden. Gillicks Weigerung, den konventionellen Auffassungen über das, was die Ernsthaftigkeit von Kunst ausmacht, zu folgen, zwingt den Betrachter manchmal, sich mit den eigenen Erwartungen auseinanderzusetzen. Man nehme beispielsweise Gesine Borcherdts Reaktion auf die Wahl Gillicks für den Deutschen Pavillon. Ihre Irritation ist spürbar, wenn sie seine Arbeit als „dekorative Diskurskunst“ kritisiert, die „aalglatt, angepasst und politisch korrekt“ sei: „Gesellschaftliche Utopien aber, für die ein Künstler eigentlich zuständig ist, entstehen nun einmal aus einer sozial unbequemen, subkulturell geprägten Haltung.“4 Dergestalt auf perverse Art und Weise ins Negative verkehrt, enttarnt das formalistische Postulat, dass politisch radikale Kunst den ,Stil‘ von Subkultur und das ,Aussehen‘ einer kritischen Ästhetik anzunehmen habe, die Konventionen des Zulässigen, und offenbart die Regeln, die anscheinend gegen bestimmte Farben, gegen Symmetrie, gegen zu viel Harmonie oder Perfektion sprechen. In der kritischen Hinterfragung der Annahmen, wie politische Kunst auszusehen hat, macht Gillicks Werk keine Zugeständnisse an diese Erwartungen. Die Irritation, die ein gutgemachtes Objekt hervorrufen kann, vor allem wenn es Teil eines größeren gesellschaftlichen oder politischen

21.

Projekts ist, ist insofern aufschlussreich, als sie ein Schlaglicht auf die ‚Narrenfreiheit‘ in der heutigen (Kunst-)Welt wirft. Bei ihr handelt es sich, mit den Worten von John Gray, um ein Symptom für den „Zwang, unser Leben so zu führen, als ob wir frei wären“.5 Während aber Gray sich nur auf unsere Unfähigkeit bezieht, die Zukunft vorauszusehen (und entsprechende Vorkehrungen zu treffen), bestimmt besagter Zwang auch unsere Gegenwart, in der, wie uns ständig mitgeteilt wird, ,alles möglich ist‘. Besonders im Zusammenhang mit der Produktion von Kunst kommt regelmäßig die Klage auf, dass ,alles erlaubt sei‘. Doch die Irritation, die bestimmte Kunstwerke hervorrufen, beweist, dass nicht wirklich alles erlaubt ist. Sprache in Skulptur zu verwandeln, kann ebenfalls zu einer gewissen Irritation führen. Das Objekt lehnt sich dagegen auf, für stumm gehalten zu werden. Aber insoweit die Texte meistens nur als bruchstückhafte Andeutungen sichtbar werden, geben Gillicks Arbeiten sich keine besondere Mühe, verständlich zu sein. Welche Botschaft transportiert ein Würfel, der aus einem unvollständigen Satz besteht, über seine Form hinaus? Es sei denn, man pflichtet den Russischen Suprematisten bei, die mit ihren spitzen Dreiecken, die einen Kreis attackieren, den Vorschlag einer gegenständlichen Analogie zu den revolutionären Kräften und deren Kampf gegen den Status quo unterbreiten, lassen sich Formen außerhalb eines naturwissenschaftlichen Kontextes nicht als wesenhafter Ausdruck komplexer Konzeptionen auffassen. Und genauso wenig lassen sich die Worte in Gillicks Objekten als verbale Kommunikation verstehen. Sie sind überdeterminiert: sie erklären weder das Objekt, noch funktionieren sie als eigenständiger Text. Trotzdem scheint mir, dass in Gillicks Arbeiten der ungefähr letzten zehn Jahre die von Anfang an in seinem Werk präsenten Ideen über die Fähigkeit der Kunst, mit ihrem Publikum zu kommunizieren, produktiv zusammengekommen sind, um die gängigen Mutmaßungen über die Funktion herauszustreichen, die Kunst heutzutage erfüllen soll – Mutmaßungen, welche die Inkommensurabilität von Form und Inhalt sowie das Vorurteil gegen gutes Design, das gut Verarbeitete, das Durchdachte betreffen. Er lenkt unsere Aufmerksamkeit auf eine Art gegenläufiges Elitedenken. So helfen uns Gillicks Arbeiten, die Vorurteile jener Künstler, Kritiker und Betrachter zu durchschauen, die es gerne unkompliziert haben, die ihre Objekte diskret und unaufdringlich mögen und ihre politischen Einlassungen laut und grob.

GESCHICHTE Das extensive Publizieren, das stets ein integrales Element des Gillick’ schen Projekts gewesen ist, macht mehr als deutlich, dass wir es mit einem Künstler zu tun haben, der sich mit der Anhäufung und Aneignung von Informationen befasst. Die Auseinandersetzung mit der Schwierigkeit, den Rezipienten direkt zu adressieren, sei es im Kunstwerk, sei es im Text oder in der Rede, zieht sich wie ein roter Faden durch seine Arbeit. In seinen frühen Arbeiten, beispielsweise in den beiden Pinnwänden von 1992 („Pinboard Prototype #2“, „Pinboard Project [Grey]“), scheint Gillick in Form eines Konvoluts von Bildern und Texten, die er auf das Brett geheftet hat, spezifische Forschungsfelder als solche vermitteln zu wollen – in einem Katalog von 2000 schreibt er dazu: „… eine simple Technik für die Weitergabe und Veränderung von Informationen.“6 Die vorgefundenen Bilder und Texte an der Pinnwand, die eine Art Forschungsprogramm für die Wissensproduktion im Rahmen einer simulierten Zufallsinstallation vorgeben, erinnern an die Ausstellungen der Independent Group (IG), die Bilder aus unzähligen Quellen zusammenführten. Das Hauptziel der IG war, Ergebnisse ihrer Recherchen über die moderne visuelle Kultur den Betrachtern anschaulich darzubieten. Dies gipfelte nach der ersten Ausstellung „Growth and Form“ (1951) und der darauf


folgenden, „Parallel of Life and Art“ (1953), in den Ausstellungsbeiträgen der IG zu „This Is Tomorrow“ (1956), worin ihre Version einer Pinnwand zu sehen war – das sogenannte tackboard (tack = Reißzwecke). Die Künstler, Architekten, Designer und Kritiker, die dieser Gruppe angehörten, teilen mit Gillick zwei Gemeinsamkeiten: Sie hatten einen wissenschaftlichen Anspruch und betrachteten ihre Arbeit als eine Art Forschung, wobei sie anhand systematischer, wissenschaftlicher Methoden Erkenntnisse ermittelten, deren Verständnis sie für den modernen Betrachter als entscheidend erachteten; und sie gingen mit einer gewissen Ernsthaftigkeit ans Werk, die zuweilen von den humorvollen Inhalte mancher späterer Arbeiten von Hamilton und Paolozzi verdeckt wurde. Obgleich die Ironie in Hamiltons Collage „Just what Is it that Makes Today’s Homes so Different, so Appealing“ (1956) deutlich durchscheint, handelt es sich dabei keinesfalls um zynischen Humor. Environments zu kreieren, war auch eine Strategie der Internationalen Situationisten. Obwohl bei ihnen das Gewicht auf der Neuerfindung vorhandener urbaner Räume lag, gab es auch Pläne für eine Ausstellung, die einige Strategien des ‚détournement‘ (= Entfremdung) und des ‚dérive‘ (= schweifendes Erkunden) heranziehen und ein Environment schaffen sollte, für das Teile des Amsterdamer Stedelijk Museums unter Anwendung von illusionistischen Rauminstallationen mit Irrwegen (Sackgassen) und labyrinthähnlichen Strukturen verändert werden sollten.7 Wenngleich dieses Projekt nie verwirklicht wurde, griff Ralph Rumney, der Mitte der 1950er Jahre kurze Zeit Mitglied der IS war, dann als Kurator auf Teile des Plans zurück. Die Ausstellung „Place“ (1959) am ICA in London bestand aus Gemälden dreier Künstler, die nach strikten Format-, Farbund Kompositionsvorgaben produziert worden waren und deren Hängung labyrinthähnlich erfolgte.8 „Place“ war primär als räumliche Installation und als ,Event‘ konzipiert und nicht als Ausstellung einzelner Gemälde. Obwohl sich Rumney und seine Mitkuratoren für Colourfield Painting (Farbfeldmalerei) und CinemaScope interessierten, ging es ihnen vor allem um die Interaktion mit dem Publikum. Rumneys weitergehende Vorschläge für situationistisch inspirierte Ausstellungsergänzungen wie ein spielfeldähnliches Gitter am Boden, die Durchführung von schriftlichen Zuschauerbefragungen und den Einsatz unterschwellig wirkender Zeichen scheiterten ebenso am Veto eines seiner Mitkuratoren, Laurence Alloway, wie die von ihm gewünschte Einrichtung von „Diskussionsgruppen, die es ermöglichten, die Methoden der US-amerikanischen Motivforschung auf die Besucher anzuwenden“.9 Zunächst fallen die erstaunlichen formalen Ähnlichkeiten zwischen „Place“ und Gillicks „Volvo Bar“ auf. Doch während die frühere in ihrer reduzierten Version auschließlich auf die phänomenologische Erfahrung setzte, lockt „Volvo Bar“ und das Schauspiel, das es als ‚Bühne‘ benutzte (wie es in einigen Presseveröffentlichungen hieß), die Besucher hinein in ein narratives Scheinszenario. Das Stück erhebt die Schließung einer Volvo-Fabrik zu einem Symptom der postindustriellen Gesellschaft und versucht, den Zuschauer in einen Dialog zu verwickeln, und zwar nicht mit dem Ort, sondern mit dem Erzählten und seinen Implikationen. Dabei fungiert das Stück als Instrument der Verschiebung und Verwirrung, ganz ähnlich wie der visuelle Irrgarten, der von Gillicks Vorgängern entworfen wurde. Schaut man weiter zurück, auf die vielfältige und problematische Geschichte der didaktischen Kunstausstellungen des 20. Jahrhunderts, stößt man noch auf andere Vorläufer von gesamträumlichen Installationen, die spezifische Informationen übermitteln wollten. Zwei künstlerische Konzepte vor dem Zweiten Weltkrieg, die zugleich formal und konzeptuell die größte Bedeutung für Gillicks Herangehensweise haben, sind die frühen Ausstellungen von El Lissitzky („Pressa“, 1928; „Soviet Pavilion for Photo and Film“, 1929) und die Bauhaus-Ausstellungen – vor allem die Arbeiten von Herbert Bayer, mit Marcel Breuer, Walter Gropius und László Moholy-

22.

Isabelle Moffat

Nagy („Éxposition de la société des artistes décorateurs“, Grand Palais, Paris, 1930; „Baugewerkschafts-Ausstellung“, Berlin, 1931). Man mag einwenden, dass der Einfluss dieser Ausstellungen allgegenwärtig ist, aber die Bezüge bei Gillick sind sehr konkret, sie sind keine pauschalen Adaptionen. So erkennt man in Gillicks Arbeiten eine ähnliche grafische Kraft wie die von El Lissitskys Kombinationen einfacher geometrischer Formen mit Texten, die für die „Pressa“ typischen Fotocollagen findet man dagegen nicht. Und in Gillicks Installationen spürt man die wohldurchdachte Absicht, mit welcher die Besucher dazu ermutigt werden, den vorhandenen Raum für sich in Besitz zu nehmen, was an Bayers „Fundamentals of Exhibition Design“ (Grundlagen der Ausstellungsgestaltung) von 193710 erinnert. Auch greift Gillick die rhythmische Klarheit von Bayers Präsentationen des Bauhaus-Designs auf. Der den Bauhaus-Ausstellungen immanente Forschergeist war Teil eines ganzheitlichen Ansatzes. Das heißt, die Sachlichkeit der Typografien und die Übersichtlichkeit der Installationen, die Designobjekte in Serien als streng gestaffelte Reihen zeigen, waren Bestandteil eines erkenntnistheoretischen Modells, das Klarheit nicht nur in ästhetischer, sondern auch in ideologischer Hinsicht anstrebte. Die nüchterne Präsentation war Teil eines Credos, das die übergeordneten funktionalen Gestaltungsprinzipien zugänglich und durchschaubar machen und zugleich eine egalitäre soziale Agenda verwirklichen wollte. Diese reformerischen Wertvorstellungen des Bauhausdesigns sind für Gillick ein Aspekt des progressiven Modernismus, den es zu retten lohnt.11 Die Spaltung zwischen dem formalen Einfluss der Bauhausschule und ihren politisch fortschrittlichen Ideen geht nicht allein auf die Ablehnung des modernistischen Projekts durch den postmodernen Diskurs zurück, sondern auch auf eine bewusste Missdeutung ihrer Arbeit nach dem Zweiten Weltkrieg. Die Nachkriegsformalisierung des Bauhaus-‚Stils‘ begann mit der Abstreifung der politischen Ideen – einer Grundvoraussetzung für die erfolgreiche Integration der exilierten Künstler, Architekten und Designer in ihre neue Umgebung. Der politische Subtext aus der Vorkriegszeit des Bauhaus wurde fallengelassen, um diesem sein akademisches Überleben in den USA und in gewisser Weise auch in England zu sichern; denn in beiden Ländern waren, insbesondere nach 1945, die politischen Konnotationen der linksgerichteten Ideen des Bauhaus nicht erwünscht. Die utopischen Hoffnungen der Ausstellungen sowohl des Bauhaus als auch der IG, ihr Versuch, die Besucher zu beeinflussen, gründeten auf Kommunikationsmodellen, die sich von der neopositivistischen Idee unmittelbarer Kommunikation herleiteten.12 Der Einfluss neopositivistischer Ideen auf das Bauhaus war gleichzeitig direkt und diffus. Otto Neuraths Theorie einer internationalen Bildsprache ist in diesem Zusammenhang interessant, da Gillicks Verwendung von Text und Formen – beispielsweise in seiner Installation „Literally“ – an Neuraths Werk erinnert. In seinem Aufsatz „Visual Education“ formulierte Neurath die „Demokratisierung von Wissen“ als visuelle Vermittlung von Bildung, die, so folgerte er aus seiner Theorie, weitaus unmittelbarer und neutraler sei als der „sprachliche Unterricht“.13 Neurath suchte nach einer Bildsprache, die weitgehend aus Piktogrammen bestehen sollte, um damit eine ‚ideologiefrei‘ Kommunikation zu etablieren. Dieses Ziel schien ihm besonders erstrebenswert, weil er Worte untrennbar mit politischer Manipulation verkoppelt sah. „Worte trennen – Bilder verbinden“, schrieb er und wurde damit zum Vorboten eines Großteils unserer visuell geprägten Umgebung, wobei ihm freilich die Anerkennung dafür weitestgehend versagt blieb.14 Im Exil wurde er mit der Aufgabe betraut, für die mittelenglische Stadt Bilston ein Bildsystem für die Verkehrsführung zu entwerfen. Vermittels solcher Projekte ist möglicherweise sein Einfluss entscheidend für den Vorsprung, dem die englische Piktografie ihre Dominanz im Design der 1950er und -60er Jahre verdankt.


Einige von Gillicks Arbeiten, wie etwa „Literally“ oder „Övningskörning (Prácticas de conducir)“, 2004, kombinieren die Erkenntnisse, die durch diese Quellen, aber auch durch den all diese Ausstellungskonzepte betreffenden Fehlschlag der präzisen Einflussnahme auf die Wahrnehmung des Betrachters gewonnen wurden. Die Textfragmente, die Gillick in diesen Arbeiten verwendet, sind lesbar, aber nicht immer leicht in einzelne Worte zu zerlegen. Der Leser muss sich die Mühe machen, den ineinander laufenden Text zu trennen, so als ob er eine römische oder ägyptische Stele entzifferte. Einmal erkannt, tauchen die Worte aus dem Text auf, können sich aber ebenso schnell wieder im Gesamtbild auflösen. Vielleicht wider manche Intuition, ist diese Schwierigkeit ein Stimulus, ein ,Irritant‘, der auf die Unmöglichkeit fehlerfreien Kommunizierens weist.

REDE Die Inkommensurabilität von Intention, Darstellung und Rezeption räumt Gillick immer wieder ein, wenn er von seiner Angst vor Transparenz spricht, genauer gesagt, seiner Angst, transparent zu erscheinen. „Wenn meine Positionen klar sind, mischt sich oft mein Misstrauen gegenüber Transparenz ein; der Zweifel daran, ob der gute Künstler und der gute politische Künstler auch immer ein transparenter Künstler ist, der seine Quellen, seine Wünsche und Bedürfnisse öffentlich zeigt.“15 Es ist ihm anzurechnen, dass diese Angst ihn nicht obskur werden ließ. Sie hat vielmehr ein Œuvre hervorgebracht, das auf einem Exzess von Informationen aufbaut. Diese Strategie, sich deutlich sichtbar zu verstecken, ein Übermaß an Informationen zu liefern, wendet er in seiner 2006 verfassten „Note for a Lecture“ an. Vierhundertneununddreißig einzeln aufgeführte Punkte, die jeweils mit den in Klammern gesetzten Worten „Eine Anerkennung von“ beginnen, handeln von Eindeutigem und Kritischem bis hin zu Unsinnigem und Banalem. Alle Punkte werden nur angedeutet statt gründlich ausgeführt – „Klasse und Kapital? Eine Frage des Geschmacks“ (55), „Bescheidenheit?“ (265), „Überdruss an geschlossenen Theorien“ (287), „Künstler wollen von Unbekannten geliebt werden“ (313). Die Liste erlaubt keinerlei Rückschlüsse auf den Autor oder das tatsächliche Thema des Vortrags. Im weiten Spektrum zwischen Banalität und Pathos verbleiben die Deutungsmöglichkeiten in der Schwebe. Sein Interesse am Begriff der ‚Prevision‘ geht auf ähnliche Bedenken gegenüber der Bedingtheit und Instabilität hochspezialisierter Diskurse zurück. Er richtet seinen Blick auf Situationen vor einem Paradigmenwechsel, lenkt die Aufmerksamkeit auf die Instabilität des Wissens und die Abhängigkeit seiner Bedeutung vom Kontext. Als Schauplatz für „Erasmus Is Late“ wird beispielsweise der Tag genannt, „bevor der Pöbel sich in Arbeiter verwandelte“.16 In diesem wie in anderen Texten, etwa „Mc Namara“, dient die Ansammlung von bekannten und weniger bekannten historischen und politischen Figuren sowie anonymen Beteiligten, die aus unterschiedlichen historischen Augenblicken und kulturellen Kontexten zu stammen scheinen, der Destabilisierung temporaler und narrativer Kontinuität – „der allgemeinen, lauernden Linearität des dominierenden Systems ausweichend“.17 Diese Texte konstruieren Begegnungen zwischen fiktiven Charakteren, die eher zueinander als miteinander sprechen; selten bewegen sie sich überhaupt im selben diskursiven Feld. Man gewinnt den Eindruck von Schiffen, die in dichtem Nebel kreuzen. Wenn die Passagiere dann von Bug zu Bug zu kommunizieren versuchen, hallen nur Sprachfetzen durch die Luft. In der heutigen Kunstwelt ist die Künstlerpersönlichkeit zum integralen Teil des Werks geworden, doch sollte diese nicht mit der Person des Künstlers verwechselt werden. Die Beziehung zwischen den beiden ist komplex und für den Künstler selbst sicher nicht immer vollständig durchschaubar – aber sicher auch nicht gänzlich unbeabsichtigt. Zu jedem historischen

23.

Liam Gillicks Verlockung

Zeitpunkt gibt es mehr oder weniger feste Regeln für die Selbstpräsentation von Künstlern. Vielleicht sollte man mit Warhol sagen, jede Zeit bekommt die Künstlerpersönlichkeiten, die sie verdient. Gillicks öffentliches Künstlerimage ist vehement theoretisch orientiert. Es scheint sein Misstrauen gegenüber Transparenz auszuleben, indem es sich auf eine Vielzahl verschiedener künstlerischer Strategien bezieht. Doch handelt es sich dabei nicht um eine Geste postmodernen Samplings, sondern um ein konstruktives Wiederverwerten und Wiederholen, das es vermeidet, sich auf einen lesbaren Modus operandi festzulegen. Diese Diversität einer Praxis, die eine permanente Verschiebung der Kommunikationsarten mit sich zieht, mag einem zuweilen als eine konzentrierte Verneblungstaktik vorkommen. Gillicks Kunst gibt sich wenig Mühe, im konventionellen Sinne verständlich zu sein – sie will als Ganzes begriffen werden, als Geste, als Aufführung, als ein Environment, „wo solch ein Spiel und solche Verhandlungen stattfinden könnten“. Er nennt es einen Ort, „wo eher etwas wird, als dass es um etwas geht“ – mit seinen eigenen Worten: „a site of becomingness rather then aboutness“18. Georges Didi-Huberman, „Was wir sehen blickt uns an: zur Metapsychologie des Bildes“, München 1999, S. 54 (Hervorhebungen im Original) 2 Michael Fried, ‚Art and Objecthood‘, in: „Artforum“, Nr. 5 (Juni 1967), Nachdruck in: „Art and Objecthood: Essays and Reviews“, Chicago 1998, S. 163f. (Hervorhebungen im Original) 3 Susanne Gaensheimer, Nicolaus Schafhausen (Hrsg.), „Liam Gillick“, Köln 2000, S. 19 4 Gesine Borcherdt, ‚Total Daneben‘, in: „Monopol“, Juli/August 2008, S. 26 5 John Gray, ,Gray Dogs‘, S. 110, zit. n. Slavoj Zizek, „First as Tragedy, then as Farce“, New York 2009, S. 63 6 Gaensheimer, Schafhausen (siehe Fußnote 3), S. 26 7 Siehe Isabelle Moffat, ‚The Labyrinth, the Laboratory and the Labyratorium‘, in: „Third Text“, Ausgabe 79, Bd. 20, März 2006 8 Die Künstler waren Richard Smith, Robyn Denny und Ralph Rumney. 9 Ralph Rumney, zit. n. David Mellor, „The Sixties Art Scene in London“, London 1993, S. 65 10 Veröffentlicht in „PM (Production Manager)“, Bd. 6, Nr. 2 (Dezember 1939–Januar 1940) 11 „Ich habe schon immer gesagt, dass mich Anni Albers mehr interessiert als Josef Albers und dabei bleibe ich. Ich interessiere mich mehr für die angewandten Kunstformen des Modernismus, da sie versuchen, im Alltag eine praktische Rolle zu übernehmen. Trotzdem möchte ich weiter im Kunstkontext arbeiten.“ Siehe ‚Recuperating Modernism: Liam Gillick interviewed by John Slyce‘, in: „Art Monthly“, Jg. 3.09, Nr. 324, S. 2 12 Siehe Peter Galison, ‚Aufbau/Bauhaus: Logical Positivism and Architectural Modernism‘, in: „Critical Inquiry“, Nr. 16 (Sommer 1991), S. 709–752 13 Otto Neurath, ‚Visual Education – Humanisation versus Popularisation‘, in: Juha Manninen (Hrsg.), ‚Encyclopedia and Utopia: The Life and Work of Otto Neurath (1882–1945)‘, in: Elisabeth Nemeth und Friedrich Stadler (Hrsg. ), „Vienna Circle Institute Yearbook“, Bd. 4, Dordrecht/Boston/London 1996, S. 255 14 Otto Neurath, „Museums of the Future“ (1933), Neuauflage in: Otto Neurath, „Empiricism and Sociology“, hrsg. v. Marie Neurath, Robert S. Cohen, Dordrecht/ Boston 1973, S. 217 15 Liam Gillick, ‚Practical Considerations: An Interview with Saul Ostrow‘, in: „Art in America“, Juni/Juli 2009, S. 134 16 Liam Gillick, „ALL BOOKS“, London 2009, S. 47 17 Liam Gillick, ‚Utopia Station: For a … Functional Utopia‘, in: „Utopia Station“, Biennale Venedig, 2003, S. 3 18 Ebd., S. 2 und 3 1


ISABELLE MOFFAT LIAM GILLICK’S LURE, OR “WHY DO YOU TELL ME YOU ARE GOING TO CRACOW SO I’LL BELIEVE YOU ARE GOING TO LVOV, WHEN YOU ARE REALLY GOING TO CRACOW?”

I admit to a certain suspicion of the eloquence of artists. At least as concerns their own work. It’s not that I question their perceptiveness, intelligence, or sincerity, but I like to see for myself. But what would that suspicion mean in practice? If I were to ignore what an artist says, would I also ignore the work’s setting, the conditions of its production, and its title? Would I try to disregard my previous encounters with the artist’s work and with other art? What if I ‘simply’ looked at an object and said ‘this is art’ or ‘this is good’? I suppose it would approach the conditions Clement Greenberg defined: simultaneity, immediacy, and self-referentiality. The work, reflecting a critique of its technical means, embracing the limitations of its medium, would have become an autonomous whole. Even though in practice there would be some diachronicity involved in the moment of observation, in ‘formalist’ theory, you get it at once or you don’t. Many discourses have dissected this model of aesthetic experience. From these critical perspectives, we are embodied, socially constructed, gendered, class-based beings. Our perception is never ‘pure’ and unburdened by experience, knowledge, or context. The work of art is not self contained, it refers outside itself, exists in time, within histories of art, power and ideology, systems of knowledge, and multiple discourses. It has specific material conditions that determine its production and reception. In his analysis of the contradictions in the contemporaneous discussions of certain minimalist works, Georges Didi-Huberman writes: “The conflation of discourse and works too often presents a solution that is as wrong as it is seductive for art criticism. The artist often ‘does not see’ the difference between what he says (of what he says, that one must see it: ‘what you see is what you see’ [Frank Stella]), and what he does. But this is okay, if only in the end criticism is able to ‘see what has been done’, that is, to make out by working in the in-between of discourses and objects the always interesting and expressive, often also fertile suture between the two aspects. To recognize the contradictions and separations that are at work often means to bring to light the labor of the works themselves – and their beauty…. [But often] the critic prefers the dilemma over the dialectic: he identifies contradictions in the (visible or theoretical) evidence, but turns his back on the contradictory play (the play ‘with’ contradictions) of more transversal, latent – less manifest – parameter of artistic work.”1 This in-between – the space between the work and its theoretical discourse – is certainly productive, decisive ground, even if there are no inherent contradictions between the artist’s statement and the art object itself. But what of Liam Gillick, an artist who preferably operates in this inbetween discursive space and uses it with great cunning to confuse and challenge the spectator. Is there a problematic space ‘between’ the material and textual work left for me to analyze without meeting the artist there, always anticipating the viewer’s response like Grimm’s hedgehog announcing to the hare at the end of the race, “I am here already”? Ignoring the textual part of his work I might miss the point. On the other hand, following his lead, I might be seduced, as Didi-Huberman suggests, favoring the “dilemma over the dialectic” and concentrating on the manifest, which in this case includes the artist’s own reflection of this problem. In short, might this text end up a tautology?

24.

OBJECTS Objects may be discreet, as well as discrete, and both aspects of the ‘art’ object, were major points of contention in the formalist critique of minimalism. For Michael Fried, writing in the early 1960s, the work, preferably a painting, should keep to itself, avoiding what he called the theatrical quality of minimalist sculpture, namely intruding into the environment inhabited by the spectator. His description of this ‘presence’ of a minimalist piece bestows upon this work the ability to engage in, albeit non-verbal, dialogue. He writes, “Someone has merely to enter the room in which a literalist work has been placed to become that beholder, that audience of one – almost as though the work in question had been waiting for him. And inasmuch as literalist work depends on the beholder, is incomplete without him, it ‘has’ been waiting for him. And once he is in the room the work refuses, obstinately, to let him alone – which is to say, it refuses to stop confronting him, distancing him, isolating him. (Such isolation is not solitude any more than such confrontation is communion.)”2 Fried considered this a vulgar, spectacular imposition incommensurable with the way a modernist work of art should exist. Inherent in most modernist models of artistic production is a dichotomy between form and content, one of several binary oppositions beloved by modernism, one that continued to a certain degree in two strands of minimalist work, the post-formalist and the text-based. One could map a similar dichotomy in Gillick’s oeuvre: beautifully crafted and designed objects on the one side of the divide, voluminous writings about art, politics, and social issues on the other. But the plays and the texts cannot be considered ‘content’ simply on account of their being composed of text. Text does not by itself constitute ‘content’. Both objects and texts can be mute or eloquent. Gillick’s work points to the loquaciousness of objects and the muteness of writing. Even the earliest allusions to minimalist forms in Gillick’s work included text: “Quad Rail (Blue)” (1989) had inscribed on its exterior an account of its components and instructions for its installation. The piece with its descriptive title of mock function plays with the arbitrariness of the object, its non-existing use-value and deliberate haphazardness. Made from flimsy-looking materials available by the yard, it does not have the appearance of a design object, nor does it have the imposing presence of minimalist versions of this aesthetic. In Gillick’s hyperbolically understated description from a catalogue from 2000, the piece was “constructed to emphasize otherwise over-looked areas of a chosen space.”3 Even as theoretical discourses have problematized notions of authenticity and authorship, they sometimes surface as absurd prejudices of the wellmade object. There is a critical suspicion of the well executed, especially if the works in question are presented as politically charged. Consider, for example, the series “Platforms”. Notwithstanding the truthfulness behind the critical discourse surrounding the foundness of certain color schemes, the limitations of format by availability, these descriptions of the conditions of production sometimes seem to function apologetically, as if the arbitrary choice of the colors would somehow generate or guarantee a greater critical distance, remove or at least qualify artistic choice and thereby bestow a kind of postmodernist authenticity. While these dynamics of reintroducing a notion of authenticity may have informed Gillick’s work – both the production and its theoretical conception – the relevance for its theoretical coherence is limited in his more recent work. Rather it incorporates and works with the prejudice against beauty. Some critics may prefer the discursive framework undermining notions of aesthetic choice, but Gillick has moved on. Taking different “Platforms” that are presented as site-specific works, creating spaces of compromise, moderation, or discussion, the pieces play with their arbitrariness. Why


is one a space of development, the other of resignation? Outside of a subjective judgment of associating certain colors or dimensions with a resigned state, others with critical inquiry, there can be no other explanation for these titles. This applies equally to the screens that are constructed from different colored and sized transparent screens and opaque surfaces; color and dimension don’t have an inherent meaning signifiying legislation or limitation, nor do they create a phenemonological effect that could be traced with such specificity. This does not reduce the screens or the platform to ‘mere’ objects (what ever that would mean) – rather it opens them up and allows them to speak. This is the nature of their loquaciousness: They are not mute and their aesthetic coherence need not condemn them to only a cursory view. Gillick’s refusal to conform to the conventions of what connotes seriousness in art, sometimes forces the spectator to confront her own expectations. Take, for example, the response of Gesine Borcherdt to Gillick as choice for the German Pavilion. Her parochialism need not interest us here, when she criticizes his work with palpable irritation as “decorative discourse art” [dekorative Diskurskunst] that is “sleek, conformist and politically correct. But social utopias, for which an artists is in charge after all, come out of a socially uncomfortable, subcultural position.”4 This is almost too perfect a response. The formalist bias, here perversely inverted, that politically radical art has to conform to a ‘style’ of the subcultural and a ‘look’ of critical aesthetics unmasks the conventions of admissibility, exposing apparent rules against certain colors, symmetry, too much harmony, or finish. By challenging assumptions about what political art should, or might, look like, Gillick’s work makes no concession to these expectations. The irritation a well-made object can produce when it is part of a larger social and political project is instructive, since it points toward the ‘fool’s license’ in today’s (art) world. It is, in John Gray’s words, a symptom of being “forced to live as if we were free.”5 While Gray is referring to our inability to know what is to come (and therefore to prepare for the future), it also determines our present since we are continuously told, ‘everything is possible’. Especially in the context of art production, lamentations that ‘anything goes’ continue to surface. But the irritation certain work provokes attests that not quite everything goes. Turning language into sculpture can also provoke a kind of irritation. The object refuses to be taken as mute. But since the texts in most works of Gillick’s are incomplete allusions, they make no special effort to be comprehensible. Does a cube made up of an incomplete sentence convey a message beyond its form? Unless one agrees with the Russian Suprematists who, with their jagged triangles attacking a circle, suggested a representational analogy to the revolutionary forces attacking the status quo, shapes can, in a non-scientific context, not be taken to inherently articulate complex concepts. The words in these pieces of Gillick’s cannot be understood as verbal communication either. They carry excess baggage – neither ‘explaining’ the object itself, nor functioning as text alone. Nonetheless, it seems to me, that in Gillick’s works from the last decade or so the ideas about art’s ability to communicate with the spectator, present in his work from the beginning, have come together to expose common assumptions about the function art is expected to serve today – assumptions about the incommensurability of form and content, about a bias toward the well designed, the well crafted, the thought-through. It is a kind of reverse elitism to which he draws our attention. Gillick’s work then makes us consider the prejudices of some artists, critics, spectators who like to keep things simple, who like their discrete objects discreet and their politics loud and rough.

25.

HISTORY From the extensive publishing activity that has been an integral part of Gillick’s project, it is quite clear that we are dealing with an artist engaged with the accumulation and assimilation of information. The difficulty of direct address both in the work of art, text, and speech is a constant issue. In early work, for example, his two pinboards from 1992 (“Pinboard Prototype #2”, “Pinboard Project [Grey]”), Gillick seemed to want to communicate specific areas of research as a Konvolut of images and texts affixed to a board – as he described it in a catalogue from 2000: “a low technology device for the transfer and modification of information.”6 The found images and texts in the pinboards, which provide a kind of research program for knowledge production in a mock casual installation, recall the exhibitions of the Independent Group (IG) in which they assembled images taken from myriad sources. The larger purpose of the IG was to communicate the result of their research into modern visual culture through exhibitions beginning with “Growth and Form” (1951), “Parallel of Life and Art” (1953) and culminating with the IG contributions to the 1956 “This is Tomorrow”, which included their equivalent of the pinboards: what they called a ‘tackboard’. The artists, architects, designers, and critics associated with this group share two characteristics with Gillick: they considered their work aligned with research, subscribing to a systematic, scientific method of inquiry the result of which they thought important for the modern spectator to grasp and they had a certain sincerity which was sometimes obscured by the humorous content of some of the later work of Hamilton and Paolozzi. While irony is present in Hamilton’s “Just What Is it that Makes Today’s Homes so Different, so Appealing” (1956), the humor is not cynical. Creating environments was also a strategy of the Situationists. Although their emphasis was largely on the reinvention of existing urban spaces, they also had plans for an exhibition that would use some of the strategies of ‘détournement’ and ‘dérive’ and create an environment that was going to incorporate areas of illusionistic space, dislocations (dead-end corridors), and mazelike structures at the Stedelijk Museum in Amsterdam.7 Although this project was not executed, Ralph Rumney, briefly a member of the SI in the mid-1950s, curated a show that adopted parts of the plan. The 1959 “Place” at the ICA in London consisted of paintings by three artists made according to strict size, color, and compositional rules and installed in a mazelike arrangement.8 The show was conceived primarily as an environment and an event, not an exhibition of discrete paintings. Although Rumney and his co-curators were interested in issues concerning Color Field painting and Cinemascope, the question of audience participation was dominant. Rumney’s further proposals for Situationist-inspired additions of a game-like grid, spectator questionnaires, and the use of subliminal cues, as well as “discussion groups that would enable the methodologies of U.S. Motivation Research to be applied to visitors”9 were vetoed by one of his co-curators, Laurence Alloway. At first there are striking formal similarities between “Place” and Gillick’s “Volvo Bar”. But where the former focused, in its reduced version, entirely on the phenomenological experience, “Volvo Bar” and the play that used it as a ‘stage’ (as some press releases wrote), lures the spectator into a mock narrative scenario. Taking the closing of a Volvo factory as a symptom of post-industrial society, the piece seeks to engage the onlooker into a dialogue, not with the space but with the narrative and its implications. But the play acts as an instrument of dislocation and confusion similar to the visual maze constructed by Gillick’s predecessors. Looking further back into the rich and problematic history of didactic exhibitions in the twentieth century, other antecedents of environmental exhibitions seeking to communicate specific information come to mind.


The pre-World War II exhibitions most relevant to Gillick’s practice, both formally and conceptually, are the early exhibitions of El Lissitzky (“Pressa”, 1928; “Soviet Pavilion for Photo and Film”, 1929) and the exhibition work of the Bauhaus – especially those by Herbert Bayer, with Marcel Breuer, Walter Gropius, and László Moholy-Nagy (“Éxposition de la société des artistes décorateurs”, Grand Palais, Paris, 1930; “Baugewerkschafts Ausstellung”, Berlin, 1931). One may argue that the influence of these exhibitions has been ubiquitous but the references are specific, they are not blanket adaptations. Thus one can see in Gillick’s work the graphic force of El Lissitsky’s combinations of simple geometric shapes and texts, but not the photographic assemblages characteristic of the “Pressa”. One can sense the deliberateness with which Gillick’s installations induce the spectator to inhabit a given space, reminiscent of Bayer’s “Fundamentals of Exhibition Design” from 193710 and the rhythmic clarity of that artist’s exhibitions showcasing Bauhaus design. The research spirit inherent in the Bauhaus presentations was part of a holistic approach. That is, the matter-of-factness of typography and the repetition of design objects in gridded rows were part of an epistemological model that considered clarity not only in aesthetic but in ideological terms. To display something simply was part of a credo that sought to make accessible and comprehensible overarching principles of functional design and to promote an egalitarian social agenda. Gillick has referred to these ‘soft’ values in the design work of the Bauhaus as something to recuperate from progressive modernism.11 The rupture between the formal impact of the work of the Bauhaus and their progressive ideas was not just a function of the dismissal of the modernist project by postmodern discourses, but a deliberate misreading of the work after World War II. The postwar formalization of the Bauhaus ‘style’ began with the shedding of politics – a requirement for the successful integration of the exiled artists, architects, and designers in their new settings. The political subtext of the prewar Bauhaus was dropped in the interest of academic survival in the United States and to some degree in England, where the political connotations of the Bauhaus’ left-leaning politics were unwelcome, especially after 1945. The utopian aspirations of the exhibitions, both of the Bauhaus and the IG, their attempt to influence the spectator were based on models of communication derived from logical positivist ideas about the immediacy of communicative exchange.12 The influence of logical positivist ideas on the Bauhaus was both direct ‘and’ diffuse. Otto Neurath’s theory of a visual language is especially interesting in this context, since Gillick’s use of text and shapes – for example in his “Literally” structure – recalls Neurath’s work. In his book “Visual Education”, Neurath spoke of the “democratisation of knowledge” through visual education which, he theorized, would be much more immediate and neutral than “verbal education.”13 Neurath sought a visual language, largely made up of pictograms, in order to establish ‘ideology-free’ communication, a desirable goal because he considered words inextricably linked to political manipulation.14 “Words divide, pictures unite,” he wrote, thus becoming the largely unacknowledged precursor of much of our visual environment. In exile, he was commissioned to design the traffic display system for the Midlands town of Bilston and through such projects his influence perhaps gave English pictography a head start toward dominating design in the 1950s and ’60s. Certain of Gillick’s works, such as “Literally” or “Övningskörning (Prácticas de conducir)” (2004), combine lessons learned from these sources but also from the failures to influence precisely the viewers’ reception, which these exhibition techniques had suffered. Thus the texts Gillick employs in such pieces are legible but not always easily separable into discrete words. The spectator must make an effort to divide the run-in

26.

Isabelle Moffat

text, as if deciphering a Roman or Egyptian stele. Once identified, the words emerge but may also recede again into the visual whole. Perhaps counterintuitively, the difficulty is a stimulus, an irritant that points to the impossibility of communicating fully.

SPEECH The incommensurability between intention, representation, and reception has been repeatedly acknowledged by Gillick when he speaks of his fear of transparency, or rather of his ‘appearing’ transparent: “While I have moments of clear positions, they’re often muddled by this distrust of transparency, distrust that the good artist and the good political artist is always a transparent artist, who will reveal sources, desires and needs.”15 To his credit, this fear has not made him obscure. It has created an oeuvre built on perhaps an ‘excess’ of information. This strategy of hiding in the light – of providing too much information – is used in his 2006 “Note for a Lecture”. Four hundred and thirty-nine itemized points, all beginning with the bracketed phrase “An Acknowledgement of”, vary from the straightforward and the critical to the nonsensical and banal. All points are alluded to rather than fully stated – “Class and Capital? That is what defines taste (55), Humility? (265), Weariness with tied and locked up theory (287), Artists want to be loved by strangers (313).” The list allows no conclusion about its author or about the subject of the lecture. It is suspended between banality and pathos. His interest in the notion of ‘prevision’ arises from similar concerns about the contingent and tenuous quality of specialized discourse. Focusing on moments ‘before’ a paradigm shift, he draws attention to the instability of knowledge, to its dependence on context for meaning. The setting for “Erasmus Is Late”, for instance, is given as “the day before the mob became the workers.”16 In this text, and others, such as “McNamara”, the assemblies of well- and lesser-known historical and political figures and anonymous bystanders from different historical moments and cultural contexts act to destabilize temporal and narrative continuity, “sidestepping the generalized, lurching linearity of the dominant system.”17 These texts construct encounters between fictionalized characters that are speaking at rather than to each other; rarely do they navigate the same discursive space. One gets the impression of ships passing in deep fog – as the passengers try to communicate across the bows only fragments of speech echo through the air. In today’s art world, the artist’s persona has become a part of the work, but that persona should not be confused with the artist himself. The relationship between the two is complicated and not entirely self-conscious – but not entirely unselfconscious either. Each historical moment has strictures about how artists should present themselves. Perhaps one should say, with Warhol, every moment gets the artistic persona it deserves. Gillick’s persona is fiercely theoretical. This persona seems to act out his suspicion of transparency by drawing on a variety of artistic strategies, not as a gesture of postmodern sampling but as a constructive recycling and repetition that avoids being tied to one legible modus operandi. Producing as it does a constant slippage of modes of communication, this diversity of production can sometimes appear to be a concentrated effort at obfuscation. Gillick’s work makes little effort to be comprehensible in conventional terms – it is to be understood as a whole, as a gesture, as an enactment, as an environment “where such play and negotiations might take place.” In his words, a site of “becomingness rather than aboutness.”18

1

Georges Didi-Huberman, “Was wir sehen blickt uns an: zur Metapsychologie des Bildes” (Munich, 1999), p. 54. [author’s emphasis].


Michael Fried, ‘Art and Objecthood’, “Artforum” 5 (June 1967), reprinted in “Art and Objecthood: Essays and Reviews” (Chicago, 1998), pp. 163f. [author’s emphasis]. 3 Susanne Gaensheimer, Nicolaus Schafhausen (eds.), “Liam Gillick” (Cologne, 2000), p. 19. 4 Gesine Borcherdt, ‘Total Daneben’, “Monopol”, July/August 2008, p. 26. 5 John Gray, “Gray Dogs”, p. 110, quoted in Slavoj Zizek, “First as Tragedy, then as Farce, Verso” (New York, 2009), p. 63. 6 Liam Gillick, (cf. note 3.), p. 26. 7 See Isabelle Moffat, ‘The Labyrinth, the Laboratory and the Labyratorium’, “Third Text” 79, Volume 20 (March 2006). 8 The artists were Richard Smith, Robyn Denny and Ralph Rumney. 9 Ralph Rumney, quoted in David Mellor, “The Sixties Art Scene in London” (London, 1993), p. 65. 10 Published in “PM (Production Manager)” 2, vol. 6, (December 1939–January 1940). 11 “I always used to say that I was more interested in Anni Albers than Josef Albers, and this remains true. I am more interested in the applied forms of Modernism, the attempt to have a much more functional role in relation to daily life; but I also want to operate in an art context.” See ‘Recuperating Modernism: Liam Gillick interviewed by John Slyce’, “Art Monthly” 3 (2009), 324, p. 2. 12 See Peter Galison, ‘Aufbau/Bauhaus: Logical Positivism and Architectural Modernism’, “Critical Inquiry” 16 (Summer 1991), pp. 709–752. 13 Otto Neurath, ‘Visual Education – Humanisation versus Popularisation’, in Juha Manninen (ed.), ‘Encyclopedia and Utopia: The Life and Work of Otto Neurath (1882–1945)’, in Elisabeth Nemeth and Friedrich Stadler (eds.), “Vienna Circle Institute Yearbook” 4, (Dordrecht/Boston/London, 1996), p. 255. 14 Otto Neurath, “Museums of the Future” (1933) reprinted in Marie Neurath and Robert S. Cohen (eds.), “Otto Neurath, Empiricism and Sociology”, (Dordrecht/ Boston, 1973), p. 217. 15 ‘Liam Gillick – Practical Considerations: An Interview with Saul Ostrow’, “Art in America” (June/July 2009), p. 134. 16 Liam Gillick, “ALL BOOKS” (London, 2009), p. 47. 17 Liam Gillick, ‘Utopia Station: For a… Functional Utopia’, first published as part of “Utopia Station”, Venice Biennale (2003), p. 3. 18 Ibid., p. 2 and p. 3. 2

27.

Liam Gillick’s Lure


A Piano and Black Snow‌, 2010 Vinylbuchstaben vinyl text on wall MaĂ&#x;e variabel dimensions variable Models of Tomorrow, Moderna Museet, Stockholm, 2010

28.

Liam Gillick


29.

Ein langer Spaziergang... Zwei kurze Stege...*


How Are You Going to Behave? A Kitchen Cat Speaks, 2009 Holz, Lampen, ausgestopfte Katze, Text, Türvorhänge, MP3-Player wood, lamps, stuffed cat, text, door blinds, MP3 player Maße variabel dimensions variable Installationsansichten installation views Deutscher Pavillon, Biennale Venedig 2009

30.

Liam Gillick

Es wird dort eine Katze geben, die sprechen kann. Alle Leute im Ort werden sehr stolz auf ihre sprechende Katze sein. Die Leute werden täglich kommen, um zu hören, was sie zu sagen hat. Sie wird sehr zynisch sein, aber nicht bösartig. Sie wird alles sehen und alles verstehen. Nach einer Weile werden die Leute nur noch am Wochenende kommen oder auf dem Heimweg von der Arbeit oder der Schule vorbeischauen. In ruhigen Zeiten werden sie kommen und der Katze aus der Zeitung vorlesen oder im Internet surfen und gute Geschichten über das Weltgeschehen ausfindig machen, die von Interesse sein könnten. Eines Morgens wird es regnen. Die Dinge in der Welt werden sich sehr ruhig verhalten haben, und die Katze wird nichts zu sagen haben. Man könnte sogar denken, sie sei leicht depressiv. Ein kleiner Junge und ein kleines Mädchen werden kommen, um die Katze auf ihrem Weg zur Schule zu besuchen. Diese Art von Dingen wird die Katze nervös machen. Sie wird sich kultiviert geben, aber ihre Gefühle durch Bewegungen ihres Schwanzes verraten. Die Katze wird auf ein gewisses Maß an Ordnung aus sein. Sie wird das als ,natürliche Ordnung‘ bezeichnen – etwas, das darauf schließen lässt, dass man den Leuten zutrauen kann, das Richtige zu tun. Und die Katze auf dem Weg zur Schule zu besuchen, wird nicht immer das Richtige sein, denn es bedeutet, dass die Kinder zu spät kommen werden. Wie wir jedoch herausfinden werden, wird die Katze leicht depressiv sein, da sie unter Überdruss leidet und sogar von ihrer Rolle als einziger sprechender Katze in der ganzen Welt gelangweilt ist. Die Katze wird wissen wollen, was los ist. Nur wenn sie mit Information gefüttert werden wird, wird sie weise, interessant oder sogar witzig sein. Aber an diesem Tage wird sie keine neuen Geschichten parat haben. Sie wird hoffen, dass die Kinder „Google News“ oder sogar „Le Monde Diplomatique“ lesen und ihr überraschend agiles Gehirn füttern. Aber die Kinder werden nur im Gang rumstehen.


Sie werden ein bisschen Angst haben vor der sprechenden Katze. Irgendetwas an ihr wird sie nervös machen. Irgendetwas in der Tiefe ihrer Seele wird wissen, dass es Böses gibt in dem Gebäude. Doch werden sie es mögen, wenn die Katze hustet. Sie werden es sehr süß finden, wenn die Katze lacht. Aber wenn sie weint, werden sie tagelang Albträume haben – schlimme Albträume, die sie nicht werden kontrollieren können und die zu den ungünstigsten Zeitpunkten auftreten. Albträume, die sie aufwecken werden und sie an Maschinen in der Wüste denken lassen, die schreckliche Dinge tun. Darum werden die Kinder nur im Gang herumstehen. Völlig steif. Und die Katze wird oben auf den Küchenschränken sitzen bleiben. Die Katze wird nicht sprechen. Die Kinder werden nicht sprechen. Die Katze wird in der Küche sein. Und die Kinder werden in der Küche sein. Um aus dieser festgefahrenen Situation herauszukommen, wird die Katze husten und ihren Kopf bewegen. Sie wird sprechen, aber anders als andere Katzen wird sie nicht mehr lächeln. „Na, was macht ihr da?“, wird die Katze sagen. Sie wird ein paar Tage lang nicht gesprochen haben und wann immer das passiert, wird sie ihre klare Aussprache verloren haben, und sie wird beginnen, mit einem Katzenakzent zu sprechen. Die Kinder werden so etwas hören wie: „Naaa, waaas maaacht eeeer daaa?“ Sie werden näher herankommen. In der Hoffnung, sie besser zu verstehen. „Was hat sie gesagt?“, wird das Mädchen zu dem Jungen sagen. „Etwas von Wasser und Gefahr“, wird der Junge sagen. „Ich glaube nicht“, wird das Mädchen sagen. Die Katze wird versuchen zu lächeln, aber sie wird das Gesicht nur zu einer hässlichen Grimasse verziehen. „Ich mag sie nicht“, wird der Junge sagen. „Ich mag sie nicht“, wird das Mädchen sagen. „Ich mag euch nicht“, wird die Katze denken. „Bitte kommt und erzählt mir was“, wird die Katze sagen. Der Junge und das Mädchen werden noch näher kommen. Sie werden neugierig sein,

31.

German Pavilion, Venice Biennale, 2009

wie sich das Fell der Katze anfühlt und herausfinden wollen, ob sie gerne gestreichelt wird. Wenn sie einmal angefangen hat zu sprechen, werden die Leute sie eher respektieren als lieben. Aber sie werden alle aufhören, die Katze anzufassen. Es wird einen Zeitpunkt gegeben haben, als die Leute sie anfassten, liebten und mit ihr spielten. Aber jetzt wollen alle ihre Meinung hören zur Geschichte totalitärer Architektur oder zur Kreditrestriktion im Zusammenhang gescheiterter Globalisierungsmodelle. An diesem Morgen, nach all dem Regen und der leichten Depression, wird die Katze spüren, wie ihr Katzesein zurückkehrt. Sie wird jemanden haben wollen, der ihr vorliest, aber mehr noch wird sie wollen, dass die beiden Kinder mit ihr spielen. Der Junge wird dem Mädchen seine Hand reichen. Sie wird seine Hand ergreifen. Sie werden ganz langsam auf die Katze zugehen. „Guten Morgen, sprechende Katze“, wird das Mädchen sagen, denn sie ist sehr mutig in komplizierten sozialen Situationen. „Morgen“, wird die Katze sagen und sich bemühen, ihre Stimme zurückzugewinnen und so deutlich wie ein Mensch zu sprechen. „Wenn es euch nicht zu viel ausmacht“, wird die Katze sagen, „könntet ihr mich über das Weltgeschehen auf dem Laufenden halten. Ich würde mich freuen, wenn ihr ein paar Nachrichtenaggregatoren für mich im Internet durchseht.“ Die Kinder werden verwirrt aussehen. Sie werden nicht wissen, was ein Nachrichtenaggregator ist. Diese Katze wird mit der Zeit ein wenig prätentiös geworden sein. „Wir hatten gehofft, du würdest uns was erzählen“, wird der Junge sagen. „Wir haben heute schulfrei”, wird das Mädchen lügen. Der Junge wird nervös aussehen. Die Katze wird klug sein und die Schulzeiten kennen. Die Katze wird wissen, dass die Schule in fünf Minuten anfängt und die Kinder auf jeden Fall zu spät kommen werden. Aber ausgerechnet heute wird es ihr nichts ausmachen. Es wird sie nicht kümmern, dass die Kinder ihren Unterricht oder ihre große Pause verpassen. Es wird sie nicht


kümmern, ob sie das Mittagessen oder die freie Zeit in der Bücherei verpassen. Alles, was ihr wichtig ist, ist, dass jemand hier ist an einem dunklen Tag in einem dunklen Gebäude. Sie wird schniefen. Der Atem der Kinder wird nahe sein. Sie wird gelernt haben, dass Menschen wissen, dass Katzen ihren Atem stehlen. Die Katze wird wissen, dass das Blödsinn ist. Es sind Gebäude wie dieses, die den Menschen den Atem stehlen. Sei’s drum. Was ist schon dabei, sich für eine Weile den Atem eines Kindes auszuleihen? Jede Katze weiß, dass er süß riecht und voller Intelligenz ist, Güte und Spaß. Sie wird einen tiefen verstohlenen Zug aus dem Atem der Kinder nehmen und, während sie taumeln und in Ohnmacht fallen, davonschweben und träumen, wird sie beginnen, ihnen eine wahre Geschichte über die Weisheit einer Küchenkatze zu erzählen … Liam Gillick, How Are You Going to Behave? A Kitchen Cat Speaks, 2009

32.

Liam Gillick

There will be a cat that can speak. All the people of the town will be very proud of their speaking cat. People will come every day to hear what it has to say. It will be very cynical but never mean. It will see everything and understand it all. After a while people will only come on the weekends or drop by on the way home from work or school. During quiet times people will come and read all the newspapers to the cat or surf the Internet and find good stories about world affairs that might be of interest. One morning it will rain. Things will have been very quiet in the world and the cat will have nothing to say. You might even think that the cat will be mildly depressed. A young boy and girl will come to see the cat on the way to school. This kind of thing will make the cat nervous. It will be sophisticated but it will betray its feelings through movements of its tail. The cat will like a degree of order. It will call this ‘natural order’ – something that will imply that people can be trusted to do the right thing. And coming to see the cat on the way to school will not always be the right thing to do because it will mean that the children will be late. But as we will find out, the cat will be mildly depressed, suffering from ennui and even bored by its role as the only talking cat in the whole world. The cat will want to know what is going on. Only by feeding it information will it be wise, interesting or even funny. But on this day it will have no new stories. It will hope that the children look on Google News or even Le Monde Diplomatique and feed its surprisingly agile brain. But the children will just stand in the doorway. They will be slightly scared of the talking cat. Something about it will make them nervous. Something deep down in their psyche will know that there is evil in this building. But they will like it when the cat coughs. The will find it very sweet when the cat laughs. But if the cat cries they will have nightmares for days – nasty nightmares that they won’t be able to control and that will come at the worst times. Nightmares that will


wake them up and make them think of machines in deserts doing terrible things. So the children will just stand in the doorway. Not moving. And the cat will stay stuck on the top of the kitchen cabinets. The cat will not speak. The children will not speak. The cat will be in the kitchen. And the children will be in the kitchen. To break the deadlock the cat will cough and shift its head. It will speak but unlike other cats, it will no longer smile. “Well, what are you doing here?” the cat will say. It won’t have spoken for a few days and whenever that happens it will have lost its accent and clarity and will have begun to speak with a cat accent. The children will hear something like, “Wheel waa aaa yew doo eng eer.” They will move closer. Hoping to hear more clearly. “What did it say?” the girl will say to the boy... “Something about wheels and danger” the boy will say. “I don’t think it did”, the girl will say… The cat will try to smile, but it will just screw up its face into an ugly grimace. “I don’t like it”, the boy will say. “I don’t like it”, the girl will say. “I don’t like you”, the cat will think. “Please come and tell me something”, the cat will say. The boy and the girl will move even closer. They will be curious to touch the cat’s fur and find out if it likes to be stroked. Once it starts to speak people will respect it more than love it. But they will all stop touching the cat. There will have been a point when it had been touched and loved and played with. But now all people will want to know is its position on the history of totalitarian architecture or the restriction of credit within the context of failed models of globalization. On this particular morning, after all this rain and all this mild depression the cat will feel its catness flooding back. It will want someone to read to it but more than that it will want these children to play with it. The boy will hold out his hand towards the girl. She will take it in hers. They will walk very slowly up to the cat. “Good morning speaking cat”, the girl will say, because she will be quite brave during complicated social

33.

German Pavilion, Venice Biennale, 2009

situations. “Morning”, the cat will say, trying hard now to win back its voice and speak as clearly as a human. “If it’s not too much trouble”, the cat will say, “You could update me on world affairs. I would love it if you looked through some Internet news aggregators for me.” The children will look confused. They won’t know what an aggregator is. This cat will have become a little pretentious over time. “We were hoping you might tell us something”, the boy will say. “We have no school today”, the girl will lie. The boy will look nervous. The cat will be wise and will know the school schedules. The cat will know that school starts in five minutes and the children will definitely be late. But today of all days, it won’t care. It won’t mind if the children miss out on their lessons or their playtime. It won’t care if they miss lunch or free-time in the library. All it will care about is that someone is here on a dark day in a dark building. It will sniff. The breath of the children will be close. It will have learnt that human’s know that cat’s steal their breath. The cat will know that this is nonsense. It is buildings like this that steal people’s breath. Anyway. What’s wrong with borrowing some child’s breath for a while? All cats know that it smells sweet and is full of intelligence and goodness and fun. It will take a deep surreptitious suck of the children’s breath and as they reel and swoon, glide and dream it will begin to tell them a true story about the wisdom of a kitchen cat… Liam Gillick, How Are You Going to Behave? A Kitchen Cat Speaks, 2009


Mirrored Image: A Volvo Bar, 2008 Lapdog of the Bourgeoisie, 2009 Szenische Lesung, Vinylbuchstaben, Sägemehl Play readings, vinyl text, sawdust MaĂ&#x;e variabel dimensions variable Installatinsansicht installation view Liam Gillick, Two Short Plays, Eastside Projects, Birmingham, 2009

34.

Liam Gillick


Holzspäne auf dem Boden. Während „Lapdog of the Bourgeoisie“, normale Beleuchtung. Während „Mirrored Image: A Volvo Bar“ sind zwei auf dem Boden stehende 500 Watt Halogenlampen auf die Performance gerichtet. Zwei große Anzeigetafeln: Anzeigetafel innen: Ankündigung der Aufführungen. Anzeigetafel außen: noch zu definieren. Eine Handsirene kündigt den Beginn der Aufführung von „Mirrored Image: A Volvo Bar“ an. Sie markiert zudem den Beginn jedes neuen Stückes. Die Akteure sollen vom Skript in ihren Händen ablesen. Die Performance sollte wie eine öffentliche Probe behandelt werden. Die Rollen sollen vor jeder Perfomance rein zufällig verteilt werden. Wenn Akteure das Gefühl haben, jemand lasse etwas aus oder lege eine Rolle zu eng aus, können sie die Regel brechen und bestimmte Teile übernehmen. Ein Akteur kann auch mehr als eine Rolle spielen. Die Performer sollten sich vorstellen, eher für das Radio aufzutreten als live für ein Publikum. Es gibt keine ,Action‘. Keine der Bühnenanweisungen oder gesprochenen Instruktionen sollte ausgeführt werden. Liam Gillick, A Volvo Bar, 2009

35.

A Volvo Bar

Wood shavings on the floor. During “Lapdog of the Bourgeoisie”, lights on as normal. During “Mirrored Image: A Volvo Bar” two 500w floor based halogens pointing towards the performance. Two big billboards: Outside Billboard: Announcement of the plays. Inside Billboard: TBD An airhorn is used to begin the play “Mirrored Image: A Volvo Bar”. This will also mark the beginning of the new play. The actors should read from the script in their hands. The performance should be treated as a public rehearsal. The roles should be distributed randomly before each performance. If actors feel someone is missing out or someone has nailed a role they can break the rule and take a specific part. More than one part can be played by one actor. The performers should imagine that they are performing for radio rather than a live audience. There is no ‘action’. None of the stage instructions or spoken instructions should be acted out. Liam Gillick, A Volvo Bar, 2009


Prototype MAK Production Pavilion (Housed in the Countryside), 2009 farbige MDF-Platten, Holz dyed MDF, wood Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Executive Two Litre GXL, MAK Wien, 2009 Contingent Wall Plate (Housed in the City), 2009 bemaltes Aluminium painted aluminium Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Executive Two Litre GXL, MAK Wien, 2009 Layered Impasse Screen, 1998 eloxiertes Aluminium, Plexiglas, Holz anodised aluminium, Plexiglas, wood 240 x 300 x 30 cm Installationsansicht installation view Liam Gillick, Executive Two Litre GXL, MAK Wien, 2009 Sammlung Geyer, Wien, Leihgabe MAK Museum für Angewandte Kunst, Wien

36.

Liam Gillick


Stets wird suggeriert, dass eine der Hauptschlachten der soziopolitischen Formation des zwanzigsten Jahrhunderts die ideologische Schlacht zwischen Gesellschaften gewesen sei, die auf Planung basierten, und solchen, die auf die Spekulation als den Kern ihres Begriffs von Fortschritt setzten. In den früheren Arbeiten im Umkreis des Buches „Discussion Island – Big Conference Centre“ lag das Augenmerk auf dem Aspekt der Szenarien-Konstruktion, wie sie in der ausgehandelten Zone der sozialen und politischen Prognose betrieben wird. Mit diesem neuen Projekt wird eine Reihe von Erzählungen entwickelt, wie sie in ihrer Serienform vom Fernsehen her bekannt sind; eine Sequenz, die sich eher auf den Bereich der Planung konzentriert. Zweifellos ist die fiktive Spannung zwischen Planung und Spekulation mit den einschlägigen linken wie rechten Ideologien und ihrer historischen Entwicklung verbunden. Doch während zu vermuten ist, dass die Spekulation den Kampf gewonnen hat und wir uns mit der globalen Dominanz des beschleunigten Kapitalismus konfrontiert sehen, bekennt sich die Planung weiterhin offen zu sich selbst, wenngleich in einer immer verhüllteren Gestalt. Die gezeigten Arbeiten wirken im Zwischenraum von Planung und Präsentation. Einige machen Kulissenvorschläge für kommende Serienskripte, andere beziehen sich implizit auf die sich wandelnde Form des Austauschs zwischen Planung und Spekulation. Ein gezielter Blick auf die Ästhetik der Erneuerung und die Komplexität, die dem scheinbar Ausgehandelten einbeschrieben ist. Der Anfang einer Neubewertung des komplett Geplanten. Liam Gillick, When Do We Need more Tractors?, Berlin 1998

37.

A House in the Country

It is suggested that one of the main battles of Twentieth Century socio-political formation has been the ideological battle between societies based upon planning and those which use speculation at the core of their notion of progress. In the earlier works around the book “Discussion Island – Big Conference Centre”, there was a focus upon the issue of scenario construction as manifest in the negotiated zone of social and economic projection. With this new project a series of narratives will be developed in the serial form familiar from television. A sequence that attends more closely to the realm of planning. Of course the notional tension between planning and speculation is tied to the respective ideologies of left and right as they have been historically developed. Yet while it is assumed that speculation won the battle and with it we face the global dominance of dynamic capitalism, planning still manifests itself within ever more veiled guises. The works on show here function in the space between planning and presentation. Some propose backgrounds for the forthcoming serial scripts, others make reference to the mutating form of the exchange between planning and speculation. A focus upon the aesthetic of renovation and the complexity inherent in the seemingly negotiated. The commencement of a reassesment of the heavily planned. Liam Gillick, When Do We Need more Tractors?, Berlin, 1998


Thinking, 2010 Tintenstrahldruck inkjet print 50,8 x 61 cm Edition for Artists Space, New York

38.

Liam Gillick


39.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page Status Following Closure, 2008 pulverbeschichtetes Aluminium, Plexisglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Whatnot, Casey Kaplan, New York, 2008 Collection of the Hirshhorn Museum, Washington D.C. Between Kalmaer and Udevalla, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 40-teilig je 40 elements each 200 x 15 x 3 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Whatnot, Casey Kaplan, New York, 2008

40.

Liam Gillick

GegenĂźberliegende Seite facing page The State itself Becomes a Super Whatnot, Casey Kaplan, New York, 2008 Installationsansicht installation views


Dieses Projekt leitet sich ab von einer brasilianischen Forschungsarbeit über die skandinavische Autoproduktion. Meinen Aufzeichnungen zufolge kehrt eine Gruppe Arbeiter an ihre stillgelegten Arbeitsplätze zurück, um den ökopolitischen Wandel neu zu durchdenken und mit alternativen Produktionsmethoden zu experimentieren. „The State itself Becomes a Super Whatnot“ schlägt ein neues Kapitel der Erzählung auf und macht den Galerieraum zum Ort eines Simultantests zwischen bloßem rethorischem und wirklich möglichem Austausch. In der Ausstellung beziehen sich duale Wandfluchten, Screens und Abgrenzungen auf die architektonische Struktur ihrer Umgebung und werden möglicherweise als das Ergebnis der gemeinschaftlichen, alternativen Produktionsmodelle aufgefasst, die in den Szenarios ersonnen worden sind. Jede Arbeit spiegelt sich in einer anderen, das Plexiglas und die bemalten Aluminiumstrukturen erzeugen konkurrierende farbliche Schemen: ein monochromatisches Rot, das eine Vielzahl politischer und kultureller Symboliken wachruft, gegenüber vielfarbigen Gegenspielern. Gedoppelte Wandtexte, die den Titel und seine Umkehrung verlauten lassen – „The Whatnot itself Becomes a Super State“ –, markieren den Ausstellungsort als eine Erweiterung jener komplexen Prozesse des demokratischen Aufschubs und der endlosen Vergabe von Unterverträgen, die unsere gegenwärtigen Austauschprozesse auszeichnen. Liam Gillick, Notizen, New York 2008

41.

The State itself Becomes a Super Whatnot

The framework for the project derives from Brazilian research into Scandinavian car production. In my notes, a group of workers return to their abandoned workplace in order to rethink eco-political exchange and to experiment with alternative production methods. “The State itself Becomes a Super Whatnot”, is descriptive of the next twist in the narrative and designates the gallery space as a site for the testing of rhetoric and potential exchange simultaneously. In the exhibition, dual wall progressions, screens, and corrals relate to the architectural structure of their surroundings and are potentially regarded as a result of the communal, alternative production models devised in the scenarios. Each work reflected in another, the Plexiglas and painted aluminum structures produce competing color schemes: monochromatic red, evoking many political and cultural symbolisms, versus their multi-colored opponents. Twin wall texts that announce the title and its reverse – “The Whatnot itself Becomes a Super State” – mark the site of the exhibition as an extension of the complex processes of democratic deferral and infinite sub-contracting that underscore our current processes of exchange. Liam Gillick, Notes, New York, 2008


Diese Seite this page Lapsed Reduction, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Whatnot, Casey Kaplan, New York, 2008 Collection of the Museum of Contemporary Art, Chicago, gift of Mary and Earle Ludgin by exchange Projected Retraction, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Collection Michael and Ninah Lynne, New York

42.

Liam Gillick

GegenĂźberliegende Seite facing page Prototype Double Mounted Wall Rail, 1988 Plastik, Stahl plastic, steel 6 x 60 x 6 cm The State itself Becomes a Super Whatnot, Casey Kaplan, New York, 2008 Rescinded Production, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 240 x 240 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Whatnot, Casey Kaplan, New York, 2008 Collection of the Museum of Contemporary Art, Chicago, gift of Mary and Earl Ludgin by exchange


Dieser Text ist einer von vielen Entwürfen für ein mögliches neues Buch, das den provisorischen Titel „Construcción de Uno“ trägt. Das Buch wird die Aktivitäten einer Gruppe Menschen darlegen, die in einer relativ experimentellen Fabrik in den frühen 1970er Jahren in Nordeuropa gearbeitet haben, und folgt ihrer Weiterentwicklung im Anschluss an die vor kurzem vorgenommene Schließung der Fabrik. Während die Hauptaktivität der Fabrik darin bestand, Gegenstände zu produzieren, lag den Produktionsmethoden die Intention zugrunde, jene Auswirkungen der traditionellen Fließbandarbeit auf das Leben zu lindern, die als die zerstörerischsten ausgemacht worden waren. Die folgende Übernahme des Unternehmens und Schließung der Fabrik läßt beinahe alle früheren Beschäftigten ohne Arbeit zurück, insbesondere die älteren. Weil es sich aber um eine relativ progressive Firma handelte, sind sie im Besitz großzügiger Abfindungen und haben etwas Zeit, sich zu überlegen, was als nächstes zu tun sei. Als dann das Geld ausgeht, zeigen sie sich zusehends besorgter darüber, was getan werden soll, und entfremden sich zunehmend von der Dynamik der Gesellschaft, die sie umgibt. Wir schließen uns der Gruppe dann erst einige Zeit später wieder an. Während sich viele weiterentwickelt oder auf unterschiedliche Aktivitäten eingelassen haben, bleibt doch eine große Zahl beschäftigungsloser, über die Stadt verstreuter Leute zurück, die sich alle an ihre Tage in der Fabrik zurückerinnern, wo sie neue Wege der Zusammenarbeit entwickelten. Nach einiger Zeit beginnen sie sich täglich an der verlassenen Werkhalle zu versammeln, angezogen von einem Gefühl für Kollektivität und Zielsetzung. Sie bemerken, dass die Türen zum Verwaltungstrakt offen geblieben sind. Keiner hat das Gebäude gesichert oder gar zerstört. Sie beginnen ihre Zeit an ihrem alten Arbeitsplatz zu verbringen, schauen in die Landschaft durch die großen Fenster. In der Vergangenheit mussten sie mit dem Rücken zu den Fenstern arbeiten, nun

43.

The State itself Becomes a Super Whatnot

haben sie Zeit, dazusitzen und auf die um die Fabrik gelegene Landschaft zu starren, während sie darüber diskutieren, was als nächstes zu tun ist. Ihre Gefühle an diesem Ort sind zwiespältig. Nie würden sie die Gebäude zerstören, aber es macht ihnen Spaß, den Schilderwald zu reorganisieren, einen Teil jeden Tages damit zuzubringen, die alten Zeichen und Informationstafeln des Gebäudes so zu rekonfigurieren, dass sie ein komplexes Spiegelbild ihrer schizophrenen Beziehung zum Ort erzeugten. Die nuancierten Arbeitspraktiken, mit denen sie aufgewachsen sind, haben die Idee absoluter Gleichheit der Arbeitsgeschwindigkeit und -technik heruntergekocht und dafür die Idee der Flexibilität und des interaktiven Teamworks forciert. Dahinter stand die Idee, ein komplexes Zusammenspiel für Arbeitsbeziehungen zu entwerfen, die sich an der jeweiligen Fähigkeit, der jeweiligen Perspektive, an der Reduzierung der Langeweile sowie der Kontrolle der Arbeiter über die in jeder Schicht zu leistende Arbeitszeit ausrichteten. Eine Weile diskutieren sie die Idee, dass solche Abschaffung der Gleichheit zum letztendlichen Scheitern ihres Arbeitsumfeldes geführt hat. Aber es gibt keinen Weg, sich wieder anzupassen oder neue Modelle für die Gemeinschaft zu entdecken, ohne Unterschiedlichkeit und Begehren zu beachten. So entscheiden sie sich dafür, anstatt alle Leute gleich zu behandeln oder so zu tun, als ob sie alle in der gleichen Geschwindigkeit arbeiten und denken könnten, den Versuch zu starten, eine Situation herbeizuführen, wo die Produktion einem Gleichheitsmaßstab unterliegt. Ihre Arbeitsumgebung bleibt nuanciert und komplex, während der Output ohne Zuschlag und Streichung, Schwund oder Überschuss dem Input entspricht. Ein Element Energie, Stoff, Gedanken oder Begehren produziert ein Element Energie, Stoff, Gedanken oder Begehren. Liam Gillick, Vorwort: Construcción de Uno, 2005


Diese Seite this page Status Following Closure, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Whatnot, Casey Kaplan, New York, 2008 Collection Hirschhorn Museum, Washington DC Restricted Practice, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 120 x 120 x 4 cm Collection Laurie and Washington Druker, New York Seeded Production, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 120 x 120 x 4 cm Collection Clarissa and Edgar Bronfman, New York

44.

Liam Gillick

Gegenüberliegende Seite facing page The State itself Becomes a Super Whatnot Vinylbuchstaben vinyl text on wall Maße variabel dimensions variable Colletion Museum of Modern Art, New York The Whatnot itself Becomes a Super State Vinylbuchstaben vinyl text on wall Maße variabel dimensions variable


This text is one of many outlines of a potential new book with the provisional title “Construcción de Uno”. The book will reveal the activities of a group of people who worked in a relatively experimental factory in Northern Europe in the early 1970s and will follow their development following the recent closure of the plant. While the primary activity of the factory was to produce objects, the methods of production were intended to alleviate what had been identified as the most destructive aspects of life on the traditional production line. The subsequent take-over of the company and closure of the factory leaves nearly all of the former employees without work, especially the older ones. Because it was a relatively progressive company they have generous severance payments and some time to consider what to do next. As the money runs out they get increasingly anxious about what to do and increasingly alienated from the dynamic of the society that surrounds them. We rejoin the group some time later. Could be now, but probably better if it is understood to be part of a near future. While many have moved on or found different activities to get involved in, there are still a large number of idle people scattered throughout the city who all remember their days at the factory developing new ways to work together. After some time they start to gather each day at the now abandoned production plant, drawn there by some sense of purpose and collectivism. They notice that the doors to the administration block have been left open. No one has secured the building and no one has wrecked it either. They start to spend their time in their old workplace, looking out at the countryside through the large windows that were installed in order to give them a more beautiful working environment when the factory was built. In the past they had to work with their backs to the windows, they now have time to sit and stare at the countryside surrounding the factory while discussing what to do next. Their

45.

The State itself Becomes a Super Whatnot

feelings about the place are ambiguous. They would never damage the buildings, but they like to reorganise the signage, spending part of each day reconfiguring the former signs and information boards in the building so that they now provide a complex reflection of their schizophrenic relationship to the place. The nuanced working practices that they grew up with de-emphasised the idea of absolute equality of working speed and technique and promoted the idea of flexibility and interactive teamwork, the idea was to create a complex sequence of relationships that were dependent upon ability, focus, the alleviation of boredom and control by the workers over the amount of hours worked in any given shift. For a while they discuss the idea that this suppression of equality lead to the ultimate failure of their working environment. But there is no way that they can readjust or discover new models of community without acknowledging difference and desire. So they decide that instead of making people equal or treating them as if they can all work and think at the same speed that there should be an attempt at developing a situation where there is an equality of production instead. Their working environment will remain nuanced and complex while what goes in will come out with no addition, deletion, waste or surplus. One element of energy, stuff, thinking or desire will produce one element of energy, stuff, thinking or desire. Liam Gillick, Construcción de Uno: Preface, 2005


Diese Seite this page Rendered Rejection, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 28-teilig je 28 elements each 200 x 15 x 3 cm Installationsansicht installation view Liam Gillick, Usines fractionnées dans la neige, Air de Paris, Paris, 2008 Collection Bibi Gritti, Genève Suspended Discussion, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, Usines fractionnées dans la neige, Air de Paris, Paris, 2008

46.

Liam Gillick

Gegenüberliegende Seite facing page Collective Projection, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Installationsansicht installation view Liam Gillick, Usines fractionnées dans la neige, Air de Paris, Paris, 2008 private collection, Paris Resisted Projection, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Installationsansicht installation view Liam Gillick, Usines fractionnées dans la neige, Air de Paris, Paris, 2008 private collection, Paris


Wir haben es also mit einer Gruppe von Leuten zu tun, die in Nordeuropa arbeitet. In diesem Fall produzieren sie alle Autos, könnten aber auch jedes andere Industrieprodukt herstellen. Freilich passt es besser, wenn es sich um ein Konsumprodukt handelt, es also um Objekte geht und nicht um Dienstleistungen. Auch passt es besser, wenn das Produkt nicht das Glied einer exklusiven Hochtechnologieproduktion darstellt. Das beinhaltet, etwas Großes zu schaffen, bei dem der Druck besteht, eine bestimmte Produktqualität zu erreichen, die nicht von vornherein durch die Beschaffenheit der zugehörigen Komponenten garantiert ist, sondern insgesamt davon abhängt, wie diese Komponenten geprüft und zusammengesetzt werden. Während die alte Idee darin bestehen mag, dass sie in der Tat eher Beziehungen als Gegenstände herstellen, ist es für uns besser, davon auszugehen, dass sie die meiste Zeit nur Autos oder Lastwagen produzieren. Sie werden gut bezahlt und gehen an den meisten Tagen zur Arbeit. Die Beziehung zwischen den Managern, Besitzern und Arbeitern ist akzeptabel. Es ist in der Vergangenheit zwar auch einmal gestreikt worden, doch normalerweise können die Dinge geklärt werden, bevor es soweit kommt. Irgendwie hat es sich ergeben, dass die meisten Leute, die in der Fabrik arbeiten, meinen, ihnen gehöre ein Teil des Ortes. Ein großer Teil der Manager stammt aus der Umgebung und kommt von denselben Schulen wie die Arbeiter am Fließband. Indessen herrscht kaum der Eindruck, dass bei der Arbeit eine erdrückende Hierarchie bestünde, sondern lediglich das Gefühl, dass einige Leute besser organisieren können und andere besser mit ihren Händen arbeiten. Die Anzahl der Männer und Frauen ist in etwa gleich und die paar kürzlich hinzugekommenen Immigranten der Gemeinde sind willkommen und entsprechend repräsentiert in der Fabrik. Einige Leute sitzen im Rollstuhl und andere sind blind oder gehörlos. Die Firma ermunterte stets jeden, der dort arbeiten wollte, es zu tun. Ein

47.

Factories in the Snow

Teil schätzt es, sich auch nach dem Verlassen des Arbeitsplatzes noch Gedanken über die Arbeit zu machen, der andere dagegen will nur ankommen, arbeiten und dann wieder nach Hause gehen, ohne groß darüber nachzudenken, was passiert und was als Nächstes kommt. Viele der Manager und Organisatoren haben ursprünglich am Band gearbeitet, sich dann aber für eine Fortbildung entschieden und sind so in eine Kontroll- und Steuerungsposition gerückt. Die Firma produziert ziemlich gute, aber auch entsprechend teure Autos oder vergleichbare Produkte. Viele davon werden exportiert, weil Leute die Präzision, mit der sie produziert worden sind, und ihr gutes Sicherheitszeugnis schätzen. Sie rosten nicht und gehen auch nicht so schnell kaputt, und die Firma unternimmt einige Anstrengungen, alle jene Teile zu recyclen, bei denen dies irgendwie möglich ist. Die Autos stehen für das Präzise, Stabile, das Verantwortung Tragende und Individualistische in der Gesellschaft. Die Fabrik produziert Symbole pragmatischen Interesses. Dass es diese Produkte gibt, liegt an der Akzeptanz und Meinung, dass sich die Leute lieber mit dem Auto fortbewegen, dass aber, wenn dem schon so ist, die Autos wenigstens ökologisch vertretbar sein sollen, lange halten müssen und weder Exzess noch Armut signalisieren dürfen. Mit dem Besitz der Autos aus dieser Fabrik wird eine Anhebung der sozialen Werte verbunden. Es sind Autos, die ebenso von einer hochqualifizierten berufstätigen Person wegen ihrer Verkörperung nachhaltiger Werte ausgewählt werden können, wie sie die erste Wahl für jemanden mit einem kleinen Budget sein mögen, der sein Geld ein- oder zweimal während seines Arbeitslebens für ein Auto ausgeben will, das eine extrem lange Lebenszeit besitzt. Liam Gillick, Vorwort: Construcción de Uno, 2005


Diese Seite this page Structured Projection, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Installationsansicht installation view Liam Gillick, Usines fractionnées dans la neige, Air de Paris, Paris, 2008 private collection, Villeneuve d’Ascq Usines fractionnées dans la neige, Air de Paris, Paris, 2008 Installationsansicht installation view

48.

Liam Gillick

Gegenüberliegende Seite facing page Usines fractionnées dans la neige, Air de Paris, Paris, 2008 Installationsansichten installation views


So we have a group of people working in the north of Europe. In this case they all happen to produce cars, but they could be producing any industrial product. It is better if it is a consumer product. Object based rather than service orientated. It is also better if the product is not exclusively part of high technology production. It involves creating something big, where there are pressures to achieve a certain build quality that are not predetermined by the nature of the components themselves but all to do with how those elements are checked and how they are combined. While the old idea might be that they are really producing relationships rather than objects it is better if we understand that they are just producing cars or trucks most of the time. They are well paid and they attend work most days. The relationship between the managers and owners and workers is reasonable. There have been strikes in the past, but normally it is possible to talk things through before it gets to that. Somehow it has evolved that most of the people working in the factory feel that they have an investment in the place. Many of the managers come from the local area and the same schools as the workers on the production line. However, there is little sense of overwhelming hierarchy at work here, just the feeling that some people are better at organising and some would rather work with their hands. There are an equal number of men and women and the few recent immigrants in the community were also welcomed and well represented at the factory. Some people are in wheelchairs and some cannot see and some cannot hear. The company always encouraged everyone who wanted to work there to come and do so. Some like to work in a way that means they have to worry and think outside the workplace, others like to arrive, work and then go home without reflecting a great deal about what happened and what will come next. Many of the managers and organisers were originally working on the production line, but decided to get new

49.

Factories in the Snow

training and move into a supervisory position. The company produces quite good but quite expensive cars or car-sized products. Many of them are exported as people appreciate the precise way they are built and their good safety record. They don’t rust or decay too quickly and the company makes an effort to recycle parts whenever possible. The cars signify something precise, stable, responsible and individualistic in the society. The factory produces symbols of pragmatic concern. The existence of the products is based on an acceptance that people rather like moving around in cars, but if they have to do so, then at least the cars ought to be reasonably ecologically sound, last quite a long time and not signify excess or poverty. A levelling up of social values is suggested by ownership of the cars that are made in this factory. They are cars that might be chosen by a well qualified professional person for their enduring values but could also be the choice of someone on a low budget who wants to spend some money once or twice in their working life on a car that will last for an extremely long time. Liam Gillick, Construcción de Uno: Preface, 2005


Were People this Dumb Before TV?, 2006 Tintenstrahldruck inkjet print 29,7 x 42 cm Edition for Art Monthly Magazine

50.

Liam Gillick


51.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page Signage for a 35 Floor Social Centre, 2006 rostfreier Stahl stainless steel 300 x 300 cm Collection Irish Museum of Modern Art, Dublin Gran Centro de Conferencias, 2008 Vinylbuchstaben vinyl text Maße variabel dimensions variable Corpus Collection, Mexico D.F.

52.

Liam Gillick

Facing page gegenüberliegende Seite Revision in the Snow, 2007 Textausdrucke printed texts Maße variabel dimensions variable EU Kunsthalle, Köln, 2007


Eine Gruppe zieht von Ort zu Ort. Die Gruppe bleibt zusammen, die Gruppe löst sich öfters auf. Diese Gruppe von Leuten zieht spiralförmig ihre Kreise um die Stadt, wann immer es nichts anderes zu tun gibt. In der Nacht gehen sie in parallelen Linien, folgen einander auf parallelen Straßen. Sie fühlen sich gut, wenn sie hinüber gucken und andere bemerken, die sich in derselben Richtung über die Kreuzung bewegen. Bisweilen halten sie an, setzen sich und reden miteinander. Ein andermal besetzen sie bereits besetzte Gebäude. Sie hatten genug davon, nur das zu erhalten, was zu bekommen war, und wollen endlich an der Seite anderer Leute arbeiten. Eine Fraktion innerhalb der Gruppe hält sich willentlich abseits. Sie sitzen in der Landschaft, ein wenig außerhalb der Stadt. Im Laufe der Zeit wollen einige von ihnen weitergehen. So umkreisen sie die Stadt auf dem Highway. Sie halten sich vom Zentrum fern und wollen sich lediglich weiterbewegen. Eine Gruppe baut Konstruktionen auf dem Dach anderer Gebäude. Sie lassen sich nur betreten, wenn man Leute passiert, die bei der Arbeit sind, oder wenn man auf der Treppe mit Hausbewohnern zusammenstößt. Nach einem oder zwei Jahren ziehen alle in die Keller. Alle kreative Arbeit findet im Untergrund statt. Alles, was sich davon auf Straßenhöhe bemerken lässt, sind aufeinanderfolgende Zeichen und eine extreme Streuung von Flyern. Zu anderen Zeiten sind es die Bars, die zum Ort der Création werden. Nur die Bars sind die Plätze, wo ihre kreative Arbeit zu sehen ist. Dort findet nichts anderes statt als nächtliches Reden und Arbeiten. Nichts anderes als An-Bartischen-Herumsitzen und Papiere-zwischen-den-BesuchernHerumgehenlassen. Liam Gillick, Revision in the Snow, Köln 2007

53.

Discursive Structures

A group wanders from place to place. The group may be joined. The group often dissolves. This set of people walks in a spiralling sequence of loops around the city whenever there is nothing else to do. At night they walk in parallel lines, tracking each other down parallel streets. They feel good when they look across and see others moving in the same direction across the intersection. At times they stop and sit and talk. At other times they occupy already occupied buildings. They have had enough of taking what is available and now want to work alongside other people. There is a faction within the group who want to stay apart. So these sit in the countryside, just outside the city. Over time, some of them want to keep moving. So they circle the city on the highway. They like to keep outside the centre and merely to keep moving. One group build structures on top of other buildings. Each one can only be accessed by walking past people at work or running into residents on the stairs. After a year or two everyone moves to the basements. All creative work takes place underground. All that can be seen at street level is a sequence of signs and an extreme proliferation of flyers. At other times it is the bars that become the site of creation. The bars alone are the places where their creative work may be seen. There is nothing else taking place other than talking and working at night. There is nothing else taking place other than sitting at bar tables and then passing papers between the people who visit. Liam Gillick, Revision in the Snow, Cologne, 2007


Diese Seite this page Weekend in so Show, 2007 Installationsansicht installation view Liam Gillick, Weekend in so Show, The Lab, Belmar, 2007

54.

Liam Gillick

GegenĂźberliegende Seite facing page Reoccupation, Recuperation and Endless Renovation, 2007 Tintenstrahldruck inkjet print MaĂ&#x;e variabel dimensions variable Franchise, VHDG, Assen, 2207


„Komm näher, komm näher. Das ist die Chance deines Lebens. Komm. Komm. Ich bin hier, ich bin hier. Jetzt bin ich da.

“Come close, come close. It’s the chance of your life. Come. Come. I am here, I am here. I have arrived.

Du steckst in einer Flaute. Im Elend. Es ist vorbei. Ich bin hier. Doch bring ich dir nicht nur Chancen. Nein, auch Ruhm.

You are in stagnation. In misery. It’s finished. I am here. Not only will I bring you opportunities. But glory too.

Du suchst nach Arbeit? Ich bring sie dir. Welche Arbeit! Die schönste, die nobelste. Zur größten Ehre deines Patriotismus, deiner Nation.

You search for work? I bring it to you. What work! The most beautiful, the most noble. For the greatest glory of your patriotism, for your nation.

Du wirst Autos bauen!“

You are going to build cars!”

Liam Gillick, Weekend in so Show, Denver 2007

Liam Gillick, Weekend in so Show, Denver, 2007

„Du kannst die stinkende Fabrik haben!“

“You can have the stinking factory!”

„Danke schön, vielleicht können wir sie in einen flexiblen Raum verwandeln?“

“Thank you, maybe we can turn it into a flexible space?” “Maggie! Maggie! Maggie! Out! Out! Out!”

„Maggie! Maggie! Maggie! Weg! Weg! Weg!“ Liam Gillick, Reoccupation, Recuperation and Endless Renovation Assen, 2007

55.

Discursive Structures

Liam Gillick, Reoccupation, Recuperation and Endless Renovation Assen, 2007


Diese Seite this page Övningskörning (Driving Practice), 2004 bemaltes Aluminium painted aluminium 30-teilig je 30 elements each 30 x 240 cm Installationsansicht installation view Milwaukee Art Museum, 2004 A Broadcast from 1887 on the Subject of our Time, 1996 Kurzwellenradiosender, Receiver, Nordatlantische Insel, postutopische Gesellschaft, Text, Anleitungen short wave radio transmitter, receiver, Northern Atlantic Island, post-utopian community, text, instructions Maße variabel dimensions variable Installationsansicht installation view Werkleitz Biennale, 2000

56.

Liam Gillick

Gegenüberliegende Seite facing page Barred, 2001 Tintenstrahldrucke inkjet prints 42 x 29,7 cm Installationsansicht installation view 4Free, Büro Friedrich, Berlin, 2001


Eine von einem Armeeposten übersehene Bar, wo die Leute auf einen Drink hingehen. Wo die Leute entschlossen sind, lange zu bleiben, um Argumente auszutauschen. Sie behaupten hier geschieht etwas, das über die Idee eines Konflikts hinausgeht, dass ihre Anwesenheit eine Demonstration neuer und alter Formen sozialen Verhaltens darstelle; doch handelt es sich genauso um die Demonstration der Möglichkeit eines Aufenthalts in einer Bar – einer Bar, die innen ganz normal wirkt, von außen aber wie ein Betonbunker aussieht. Sie behaupten, dass die Idee einer Bar, die von einem Armeeposten übersehen worden ist, eine wichtige spielerische Demonstration darstellt. Ein schlagender Beweis dafür, dass sich bestimmte Formen sozialer Organisation nicht organisieren lassen. Es bleibt entschieden ruhig in der Bar; keine Musik, keine Schallplatten, nur Gerede. Es ist kein Ort zum Singen, es ist ein Ort, wo man zeigt, dass man noch spielen kann, wenn andere einen im Auge behalten und einem Anordnungen geben. Wenn man eine neue Person in die Bar mitbringt, muss man wiederholt ihren Namen mit sehr lauter Stimme nennen, um den anderen Leuten in der Bar zu verstehen zu geben, dass auch der neue Besuch offen für eine bestimmte Position eintritt, also konsequent an die eine Seite glaubt und nicht an die andere. Auch wenn die Leute in der Bar die Ideen, die sie teilen, nicht verlauten lassen, machen sie sie durch ihre höchstpersönliche Gegenwart deutlich. Liam Gillick, Barred, Berlin 2001

57.

Discursive Structures

A bar is overlooked by an army check-point, it is where people go to have a drink. It is where people are determined to stay late in order to make a point. They say that something is going on here which is beyond an idea of conflict, they say their presence is a demonstration of new and old forms of social behavior, but it is also the demonstration of being in a bar, a bar which is normal on the inside and which looks like a concrete bunker from the outside. They are saying that the idea of a bar overlooked by an army check-point is an essential demonstration of play. It is an essential demonstration that you can’t organize certain forms of social organization. The bar stays resolutely silent; there is no music in this bar, no records, only talking. It is not a place for singing it is a place to demonstrate that you can still play when other people try and organize you. If you take a new person into this bar it is necessary to repeat their name in a very loud voice in order to explain to the other people in the bar that this new arrival is also taking part in a demonstration of a certain position, believing strongly in one side and not another one. Even if the people in this bar are not articulating their shared ideas they are demonstrating them by their very presence in the place. Liam Gillick, Barred, Berlin, 2001


Diese Seite this page Coats of Asbestos Spangled with Mica, 2002 Plexiglas, Sperrholz, digitale Farbdrucke Plexiglas, plywood, digital c-prints Maße variabel dimensions variable Installationsansicht installation view Turner Prize, Tate, London, 2002

Gegenüberliegende Seite facing page www.usdoj.gov/eoir/OcahoMain/publisheddecisions/Hardbound/Volume1/25.pdf, 2003 Ausdrucke printed papers 29,7 x 21 cm Installationsansichten installation view The Air Is Blue, Casa Luis Barragan, Mexico City, 2003 25. Mednarodni graficini biennale, 2003 Siebdruck silk-screen print Maße variabel dimensions variable Straßenansicht street view 25th Graphic Biennale, Ljubiljana, Slovenia

58.

Liam Gillick


Eine Struktur, die das Barragan House eher als Ausgangsbasis denn als Fluchtpunkt benutzt. Ich fasste erneut den Beschluss, dass es notwendig wäre, mein Interesse an generalisierten sozialen Phänomenen und ideologischen Manifestationen hinsichtlich der von ihnen hinterlassenen Spuren in der gebauten Welt zu umschiffen und stattdessen präziser artikulierte Territorien zu betreten. Während ich ein substanzielles Interesse an den formalen Qualitäten von Barragans Arbeit habe, waren zum Zeitpunkt der Ausstellung die kulturellen und politischen Beziehungen zwischen den USA und Mexiko von noch drängenderer Bedeutung, was aus meinem jüngsten Entschluss, mehr Zeit in den USA zu verbringen, und aus meinem Interesse an mexikanischer Kunst und Kultur herrühren mag. Ich entschied mich, unter dem Stichwort Barragan im Internet zu recherchieren, und protokollierte meine Resultate als Such-, Forschungs- und Denkübungen. Ich war sofort von einem konkreten, schon von den ersten aufgerufenen Seiten präsentierten Gerichtsverfahren gefesselt, in dem es um einen mexikanischen Staatsbürger und seinen täglichen Kampf um seine offizielle Anerkennung in den Vereinigten Staaten ging. Zufällig teilt die betreffende Person mit dem gefeierten Architekten denselben Familiennamen. Es gibt keinen anderen impliziten oder intendierten Kontext in der Arbeit als die Übereinstimmung in der Namensgebung. Die Arbeit, der Ausdruck eines Gerichtspapiers aus dem Internet, wurde auf einem Tisch im Barragan House zurückgelassen. Er erinnert jeden Besucher an das gespannte Verhältnis und die wechselseitigen Abhängigkeiten der beiden Nachbarn. In diesem Fall wird das Haus als Platz für Gedanken und Projektionen genutzt. Ein Platz in einer Bibliothek, wo man gewöhnlich frei von den Spannungen der aktuellen politischen Landschaft sitzen, denken und lesen kann. Liam Gillick, Korrespondenz mit Hans Ulrich Obrist, 2003

59.

Discursive Structures

A structure that uses the Barragan House as a site of departure rather than a point of focus. I again decided that it might be necessary to bypass my interest in generalised social phenomena and manifestations of ideology as it leaves traces in the built world and move into a more precisely articulated territory. While I have a substantial interest in the formal quality of Barragan’s work, the relations between the US and Mexico in cultural and political terms was of more pressing interest to me at the time of the exhibition following my recent decision to spend more time in the USA and my ongoing interest in Mexican art and culture. I decided to search for the name Barragan on the Internet and log my findings, not as work, but as an exercise in checking, researching and thinking. I was immediately struck by a specific trial that came up on the first results page concerning a Mexican national involved in the daily struggle for official recognition within the US. The person concerned happens to share the same family name as the celebrated architect. No other connection is implied or intended in the work than the coincidence of naming. The work, a print out of a legal file found on the internet, was left on a desk in the Barragan House. A reminder to any visitor of the tensions and interdependencies between the two neighbours. The house in this case is used as a place for thought and projection rather than a site for addition or comment. A place to sit and think and read in a library usually devoid of the tensions of the contemporary political landscape. Liam Gillick, Correspondence with Hans Ulrich Obrist, 2003


Diese Seite this page Exterior Consultation Diagram, 2003 Farbe paint Maße variabel dimensions variable Installationsansicht installation view Tirana Biennale, 2003 Collection Matthew Brannon and Michelle Elzay, New York

Gegenüberliegende Seite facing page 56th Floor Structure, 2004 pulverbeschichtetes Aluminium powder-coated aluminium 240 x 240 x 240 cm Installationsansicht installation view Singular Forms, Solomon R. Guggenheim Museum, New York, 2004 Collection Bert Lees, Santa Fé Dispersed Discussion Structure, 2006 Whiskey, Silberglimmer whiskey, silver glitter Maße variabel dimensions variable Installationsansicht installation view Grey Flags, Sculpture Center, New York, 2006 private collection, Berlin

60.

Liam Gillick


Der Film „Dear Diary“ enthält eine Szene, in der Nanni Moretti auf seinem Moped um Rom herum fährt und über die verschiedensten Probleme spricht, unter anderem auch die Bauprojekte, die in den Vororten in den 1960er und 1970er Jahren entstanden sind. Er spricht darüber, was für einen schlechten Ruf sie genössen, wie niemand sie wirklich mögen würde, und dann realisiert man, dass er sich auf dem Weg zu ihnen befindet. Als er vor einem besonders riesigen Wohnblock anhält, ist sein Monolog fast zu Ende. Er lässt noch einen Blick über das Gebäude schweifen und schaut dann zurück in die Kamera. Zu unserer Überraschung zuckt er mit den Schultern und sagt, die Sachen sähen gar nicht so schlecht aus, sie könnten schlechter sein, und fährt dann zurück in die Stadt. Liam Gillick, Korrespondenz mit Anri Sala, 2003

61.

Discursive Structures

The film “Dear Diary” has a scene in it where Nanni Moretti is riding around Rome on his moped and he is talking about various problems, including the housing projects that were built on the outskirts of Rome in the 1960s and 1970s. He talks about how they have a bad reputation, how no one really likes them, and then you realise that he is on his way to see them. As he pulls up outside one particularly enormous housing estate he is near the end of his monologue. He glances at the building and then looks back at the camera. To our surprise, he just shrugs, says things don’t look as bad as they could be and then rides back into town. Liam Gillick, Correspondence with Anri Sala, 2003


Diese Seite this page Inverted Research Tool, 2006 (with Edgar Schmitz) bedrucktes Banner, Videos printed banner, videos Maße variabel dimensions variable Installationsansicht installation view Academy, Van Abbemuseum, Eindhoven, 2006

Facing page gegenüberliegende Seite everythingispossibleexceptthatwhichisdeemedimpossiblebythenatureofthings, 2001 Vinylbuchstaben vinyl text Maße variabel dimensions variable Installationsansicht installation view Los Vinilos, El Basilico, Buenos Aires, 2007 In order to Be Able to Draw a Limit to Thought, 2001 10 Fragen in verschiedener Form zur theoretischen Physik wie etwa Wandtexten, Kuchendekorationen, Taxivisitenkarten, Bierdeckeln, Konferenz- und Web-Site 10 questions about theoretical physics in different forms including wall texts, cake decorations, taxi business cards, beer mats, conference and web-site Maße variabel dimensions variable Installationsansicht installation view International Language, Belfast, Ireland

62.

Liam Gillick


sindallemessbarendimensionenwenigerparameterdiedasphysikalische universumalsimprinzipkalkulierbarcharakterisierenodersindeinige nurdeterminiertdurchhistorischeoderquantenmechanischezufälleund unkalkulierbar? wiekannquantengravitationdabeihelfendenursprungdesuniversums zuerklären?

areallthemeasurabledimensionlessparametersthatcharacterisethe physicaluniversecalculableinprincipleoraresomemerelydeterminedby historicalorquantummechanicalaccidentanduncalculatable? howcanquantumgravityhelpexplaintheoriginoftheuniverse? whatisthelifetimeoftheprotonandhowdoweunderstandit?

wielangeistdiezerfallszeiteinesprotonsundwieverstehenwirdas? isnaturesupersymmetricandifsohowissupersymmetrybroken? istdienatursupersymmetrischundwennjawiewirddiesupersymmetrie gebrochen?

whydoestheuniverseappeartohaveonetimeandthreespacedimensions?

warumscheintdasuniversumeinezeitunddreiraumdimensionenaufzu weisen?

whydoesthecosmologicalconstanthavethevaluethatithas?Isitzeroandis itreallyconstant?

warumhatdiekosmischekonstantedenwertdensiehat?istergleichnullund bleibtkonstant?

whatarethefundamentaldegreesoffreedomofm-theoryanddoesthetheo rydescribenature?

worinliegendiefundamentalengradederfreiheitderm-theorieundbe schreibtdietheoriedienatur?

whatistheresolutionoftheblackholeinformationparadox?

wasistdielösungdesschwarzelöcherinformationsparadoxon?

whatphysicsexplainstheenormousdisparitybetweenthegravitationals caleandthetypicalmassscaleofelementaryparticles?

wasfüreinephysikerklärtdenenormenunterschiedzwischendergravitations skalaunddetypischenmassenskaladesperiodensystemsderelemente?

canwequantitativelyunderstandquarkandgluonconfinementinquantum chromodynamicsandtheexistenceofamassgap?

verstehenwirquantitativquarksundgluonkonfinationinderquantenchro modynamikunddieexistenzeinermassendifferenz?

Liam Gillick, International Language, Belfast, 2001

Liam Gillick, International Language, Belfast 2001

63.

Discursive Structures


Diese Seite this page Lapdog of the Bourgeoisie, 2009 Ausdrucke printed papers Maße variabel dimensions variable Installationsansicht installation view Lapdog of the Bourgeoisie, Arnolfini, Bristol, 2009

Museum Board (Luzern) #1, 1994 Jute, Spanplatte, Ausdrucke Gold Hessian, chipboard, printed papers 200 x 300 x 4 cm Installationsansicht installation view Wittgenstein: Family Likenesses, Insitute of Visual Culture, Cambridge

64.

Liam Gillick

Gegenüberliegende Seite facing page Revised Sochaux Structure, 2008 farbige, ultraleichte MDF-Platten painted ultralite MDF jede Einheit each unit 50 x 240 x 240 cm Installationsansicht installation view Ours: Democracy in the Age of Branding, New School, New York, 2008 private collection, New York


Tirdad: Nochmals, ich bin dein Retter der visuellen Kultur. Dank mir brauchen wir nicht länger mit den YBAs (Young British Artists) zu tanzen.

Tirdad: Once again, I am your visual culture saviour. Thanks to me, we are no longer stuck dancing with the YBAs.

Nav: Oh, ich wollte sowieso nicht auf diese Party.

Nav: Oh, I wasn’t going to that party anyway.

Liam: Ich auch nicht.

Liam: Me neither.

Student A: Auf keinen Fall.

Student A: No way.

Student B: Nicht mit mir.

Student B: Not me.

Tirdad: Gut, wir fahren in eine kritische Kultur-Mistery-Ausstellung.

Tirdad: Well I am offering you a ride in a critical culture mystery exhibition.

Liam: Ist das eine von diesen total pathetischen Wer-hat’s-Gemacht?

Liam: Is that one of those totally pathetic who-dun-it’s?

Student A: Wo man immer den Blödmann spielen muss?

Student A: Where everyone has to play a stupid character?

Liam Gillick, Lapdog of the Bourgeoisie, 2009

Liam Gillick, Lapdog of the Bourgeoisie, 2009

65.

Discursive Structures


What if. Art at the Verge of Architecture and Design, 2000 Ausstellung kuratiert von Maria Lind und ,gefiltert‘ von Liam Gillick exhibition curated by Maria Lind and ‘filtered’ by Liam Gillick verschiedene Kunstwerke various artworks Installationsansichten installation view What if. Art at the Verge of Architecture and Design, Moderna Museet, Stockholm, 2000 Arbeiten von rechts nach links von left to right works by Apolonija Sustersic Dominique Gonzalez-Foerster Rita McBride Jorge Pardo

66.

Liam Gillick


„Ich liege auf dem Boden und schaue auf das Heck des Vans, der jetzt von der Straße heruntergezogen und auf die Seite gekippt ist. Das Bild ist klar und scharf, mehr wie ein Schnappschuss als eine Erinnerung. Staub um die Rücklichter des Vans, das Nummernschild und das Heckfenster sind dreckig. Ich registriere diese Gedanken, ohne an mich selbst oder meinen Zustand zu denken … Ich sehe hinunter und entdecke etwas, das ich ganz und gar nicht mag: Mein Schoß scheint seitwärts verschoben zu sein, so als ob mein ganzer Unterkörper in eine halbe Drehung nach rechts gerissen worden wäre.“ Stephen King, The New Yorker, 19. Juni 2000 Details werden immer registriert, unter allen Umständen: sogar in einer komfortableren Umgebung als an einem Straßenrand in Maine, wenn sich die Knochen in deinem linken Bein wie Murmeln in einem Socken anfühlen. Sommer in Stockholm, und eine Gruppe Leute sitzt in einem Raum. Es macht sich ein Gefühl breit, als würden sie gerade von einem der Merkmale ihrer Arbeit überrollt werden. Liegt die endgültige Ironie im Umstand, dass eine Gruppe von Leuten, die, ohne auf Distanz zu achten, auf einen erweiterten Referenzrahmen zurückgegriffen hat, sich auf dem Boden der Tatsachen wiederfindet, weil eine begrenzte Wahrnehmung dieses Territoriums sich als das erste und letzte Definitionsmerkmal ihrer Arbeit erweist? Heißt das, dass die Standards der Architektur und des Designs die Auffassungskraft für die Werte der Kunst übermannen? Und denkt irgendjemand der Ausstellungsbesucher wirklich intensiver über diese Dinge nach als über Macht, Umwelt, Politik, Ideologie oder Vergnügen? Liam Gillick, Essay für What if, 2000

67.

Discursive Structures

“I’m on the ground, looking at the back of the van, which is now pulled off the road and tilted to one side. This image is clear and sharp, more like a snapshot than a memory. There is dust around the van’s tail-lights. The license plates and the back window are dirty. I register these thoughts with no thought of myself or my condition... I look down and see something that I don’t like: my lap appears to be on sideways, as if my whole lower body had been wrenched half a turn to the right.” Stephen King, The New Yorker, June 19, 2000 Details are always registered, whatever the conditions: even in more comfortable environments than the side of a road in Maine, with the bones in your left leg feeling like marbles in a sock. Summer in Stockholm and a group of people are sitting in a room. There is a feeling that they might be about to be run over by just one of the characteristics of their work. Is the final irony the fact that a group of people who resorted to an expanded frame of references without remembering to keep their distance will find that they are brought back down through a limiting perception of that territory as the first and the last defining character of their work? Does this mean that architecture and design value is stronger than the perception of art value? Do any of the people in this exhibition really think about these things more than they think about power, environment, politics, ideology or pleasure? Liam Gillick, Essay for What if, 2000


Rear-guarded, 2006 (with Gareth James) Tintenstrahldruck inkjet print 59,4 x 42 cm

68.

Liam Gillick


69.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page Logo for Frankfurt Kunstverein, 1999 verschiedene Medien various media Applied Resignation Platform, 1999 Plexiglas-Paneele, vorhandene Deckenkonstruktion Plexiglas panels, existing ceiling Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, David, Frankfurter Kunstverein, 1999

70.

Liam Gillick

Gegenüberliegende Seite facing page Prototype Design for a Conference Room (With Joke by Matthew Modine Arranged by Markus Weisbeck), 1999 Spanplatte, Jute, Vinylbuchstaben chipboard, hessian, vinyl text Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, David, Frankfurter Kunstverein, 1999 David (Prototype Sound System), 1999 gebürstetes und geätztes Aluminium brushed and etched aluminium 40 x 40 x 200 cm Installationsansicht installation view Liam Gillick, David, Frankfurter Kunstverein, 1999 private collection, London


„Oh, mein Gott, schau, da drüben, das ist Stanley Kubrick. Können wir ihn nicht kurz anhalten und Hallo sagen?“

“Oh, my God, look, over there, that’s Stanley Kubrick. Couldn’t we just stop him and say hello?”

Und Gabriel zieht Steven zur Seite und sagt:

And Gabriel pulls Steven to the side and says:

„Das ist nicht Stanley Kubrick, das ist Gott – er glaubt nur, er sei Stanley Kubrick.“

“That’s not Stanley Kubrick, that’s God – he just thinks he’s Stanley Kubrick.”

Am Schluss der Geschichte greifen die Leute, die immer noch da sind, auf Davids Erinnerung zurück, um das Appartment zu rekonstruieren, in dem er mit seinen Eltern gelebt hat. Weil seine Erinnerungen subjektiv sind, gerät die Mutter lebendiger als der Vater, das Zimmer seiner Stiefschwester fehlt ganz, es ist nur ein Loch in der Wand. Alles endet damit, dass David für seine Mutter eine Bloody Mary zubereitet, die Flüssigkeit leuchtet in tieferem Rot als im wirklichen Leben. Er hört ihre Stimme und das ist es dann auch. Wir sehen nicht, wie er sich nach ihr umdreht.

At the story’s conclusion, the people who are still around use David’s memory to reconstruct the apartment where he lived with his parents. Because his memories are subjective, the mother is much more vividly realised than the father, and his step-sister’s room is not there at all; it is just a hole in the wall. The whole thing ends with David preparing a Bloody Mary for his mother, the juice is brighter red than in real life. He hears her voice and that’s it. We don’t see him turn to see her.

Liam Gillick, Korrespondenz mit Nicolaus Schafhausen, 1999

71.

Parallel Fictions

Liam Gillick, Correspondence with Nicolaus Schafhausen, 1999


Diese Seite this page David (Soundtracks), 1999 Hi-fi system, MiniDisc, Plexiglas Installationsansicht installation view Liam Gillick, David, Frankfurter Kunstverein, 1999 David (Temporary Location Rig), 1999 eloxiertes Aluminium, indische Baumwolle anodised aluminium, Indian cotton 240 x 400 x 400 cm Installationsansicht installation view Liam Gillick, David, Frankfurter Kunstverein, 1999 David (He Doesn’t Turn to See Her), 1999 großes Glas, Bloody Mary-Cocktail big glass, bloody mary cocktail Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, David, Frankfurter Kunstverein, 1999 Collection Andy and Karen Stillpass, Cincinnati

72.

Liam Gillick

Gegenüberliegende Seite facing page Annlee You Proposes, 2001 bemaltes Aluminium, Licht, Computeranimation painted aluminium, lights, computer animation Maße variabel dimensions variable Installationsansicht installation view Collection Tate, London


Die revidierte Konstruktion. Einiges lässt sich lediglich beschreiben. Ich habe jeden Schritt auf dem Weg auszuhandeln. Muss winzige Schritte machen. Bei jeder Bewegung durch diesen Ort ändert sich die Richtung. Ich funktioniere als Raumidee. Der Garten, er ist ein Produkt meines Denkens, meines einen Denkens, meines vielfältigen Denkens. Mein Denken und Projizieren sind eine Konstruktion, was soll’s? Ich verrückte mich und einige Sachen sind mit mir mitgekommen und werden mitgeschleppt. Vom einen Platz zum anderen hoch und runter, hoch und runter. Die Beschreibung eines Gerüchts. Der andere Platz war wie der. Der andere Platz hatte eine andere Farbe. Zwei kamen dahin und ein paar einfache Möbel. Sie grinsten und nickten mir zu und ich erinnere, dass sie schnell gegangen sind. Später tanzten ein paar auf den Sachen herum. Trampelten darauf herum, hart und schnell. Ich war nicht dort um zuzusehen, ich hatte ja nicht konstruiert. Meine Gedanken und Vorstellungen sind Konstruktion. Einige ziehen an mir vorüber. Ich schlage dir eine neue Identität vor. Ich bin Annlee, das ist sicher. Ich bin Annlee und ich habe erschaffen und bin dann davon gegangen. Ich werde niemals offen, außer durch andere. Liam Gillick, Annlee You Proposes, London 2001

73.

Parallel Fictions

This revised construction. Something can only described. I have negotiated every step the way. Take tiny steps. Every move through this place is turning. I am functioning in space idea. This garden is a product of my thought, my one thought, my many thought. My thought and projection is a construction, but care? I shifted and some thing have moved with me and dragged around. From place to another up down and up down. A description of rumour. There was another place just like. There was another place colour. Two came there and some simple furniture. They smiled and nodded and I remember them going fast. Later some danced on things. Stomping down hard and fast. I was not there to see as I had not constructed. My thoughts and projections are construction. Some are passing me. I you propose a new identity. I am Annlee, but this given. I am Annlee and I have created and then passed on. I will never openly, only through others. Liam Gillick, Annlee You Proposes, London, 2001


Diese Seite this page Signage for a Future Social Centre, 2005 Vinylzeichen vinyl graphic Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Factories in the Snow, Galerie Meyer Kainer, Wien, 2005 Revision Corral, 2005 pulverbeschichtetes Aluminium powder-coated aluminium 70 x 200 x 200 cm Installationsansicht installation view Liam Gillick, Factories in the Snow, Galerie Meyer Kainer, Wien, 2005 private collection, Österreich The Content Constructed within the Factory once it Has Stopped Producing Cars, 2005 pulverbeschichtetes Aluminium powder-coated aluminium 30 x 20 x 200 cm Installationsansicht installation view Liam Gillick, Factories in the Snow, Galerie Meyer Kainer, Wien, 2005 private collection, Österreich

74.

Liam Gillick

Gegenüberliegende Seite facing page The Content Constructed in the Factory once it Has Stopped Producing Cars, 2005 pulverbeschichtetes Aluminium powder-coated aluminium 20 x 20 x 200 cm Installationsansicht installation view Liam Gillick, Factories in the Snow, Galerie Meyer Kainer, Wien, 2005 The Intent Constructed in the Factory once it Has Stopped Producing Cars, 2005 pulverbeschichtetes Aluminium powder-coated aluminium 70 x 20 x 200 cm Installationsansicht installation view Liam Gillick, Factories in the Snow, Galerie Meyer Kainer, Wien, 2005


Wir haben es also mit einer Gruppe von Leuten zu tun, die in Nordeuropa arbeitet. In diesem Fall produzieren sie alle Autos, könnten aber auch jedes andere Industrieprodukt herstellen. Es passt besser, wenn es sich um ein Konsumprodukt handelt. Und eher auf Gegenständlichkeit beruht als dienstleistungsorientiert ist. Auch passt es besser, wenn das Produkt nicht das Glied einer exklusiven Hochtechnologieproduktion darstellt. Das schließt nicht aus, etwas Großes auf die Beine zu stellen, wenn der Druck besteht, eine bestimmte Produktqualität zu erreichen, die nicht von vornherein durch die Beschaffenheit der zugehörigen Komponenten garantiert ist, sondern insgesamt davon abhängt, wie diese Komponenten geprüft und zusammengesetzt werden. Während die alte Idee darin bestehen mag, dass sie in der Tat eher Beziehungen als Gegenstände herstellen, ist es für uns besser, davon auszugehen, dass sie die meiste Zeit nur Autos oder Lastwagen produzieren. Sie werden gut bezahlt und gehen an den meisten Tagen zur Arbeit. Die Beziehung zwischen den Managern, Besitzern und Arbeitern ist akzeptabel. Es ist in der Vergangenheit zwar auch einmal gestreikt worden, doch normalerweise können die Dinge geklärt werden. Irgendwie hat es sich ergeben, dass die meisten Leute, die in der Fabrik arbeiten, meinen, ihnen gehöre ein Teil des Ortes. Ein großer Teil der Manager stammt aus der Umgebung und kommt von denselben Schulen wie die Arbeiter am Fließband. Indessen herrscht kaum der Eindruck, dass bei der Arbeit eine erdrückende Hierarchie bestünde, sondern lediglich das Gefühl, dass einige Leute besser organisieren können und andere besser mit ihren Händen arbeiten. Die Anzahl der Männer und Frauen ist in etwa gleich und die paar hinzugekommenen Immigranten der Gemeinde sind willkommen und entsprechend repräsentiert in der Fabrik. Liam Gillick, Vorwort: Construcción de Uno, 2005

75.

Construcción de Uno

So we have a group of people working in the north of Europe. In this case they all happen to produce cars, but they could be producing any industrial product. It is better if it is a consumer product. Object based rather than service orientated. It is also better if the product is not exclusively part of high technology production. It involves creating something big, where there are pressures to achieve a certain build quality that are not predetermined by the nature of the components themselves but all to do with how those elements are checked and how they are combined. While the old idea might be that they are really producing relationships rather than objects it is better if we understand that they are just producing cars or trucks most of the time. They are well paid and they attend work most days. The relationship between the managers and owners and workers is reasonable. There have been strikes in the past, but normally it is possible to talk things through before it gets to that. Somehow it has evolved that most of the people working in the factory feel that they have an investment in the place. Many of the managers come from the local area and the same schools as the workers on the production line. However, there is little sense of overwhelming hierarchy at work here, just the feeling that some people are better at organising and some would rather work with their hands. There are an equal number of men and women and the few recent immigrants in the community were also welcomed and well represented at the factory. Liam Gillick, Construcción de Uno: Preface, 2005


What’s Cooking?, 2009 Tintenstrahldruck inkjet print 59,4 x 42 cm Unikat unique

76.

Liam Gillick


77.

Ein langer Spaziergang... Zwei kurze Stege...*


The Wood Way?, 2002 Installationsansichten installation views Liam Gillick, The Wood Way, The Whitechapel Gallery, London, 2002

78.

Liam Gillick


„Literally No Place“ ist ,ein‘ Weg zum Verständnis des Wortes Utopie. Nachdem ich damals den Titel gestohlen hatte, richtete sich mein wachsendes Interesse eher auf Konkretes und Funktionales als auf generelle Aussagen über Utopie, weshalb der Untertitel des Buches denn auch „Communes, Bars and Greenrooms“ lautet. Bis zu einem gewissen Punkt bin ich an der Idee einer ‚funktionalen Utopie‘ interessiert, wobei es sich allerdings um eine ebenso negative Angelegenheit handeln mag, wie etwa ein ‚funktionierender Alkoholiker‘ zu sein. Darin liegt das Bekenntnis, dass auch bei vollem Bewusstsein des Problems kein Grund besteht, das Nachdenken darüber einzustellen, wie die Dinge besser sein könnten. Das ist der Versuch, mit bestimmten Arten funktionaler Utopie zu spielen. Es handelt sich um ein Echo der Utopie, in dem flüchtige Eindrücke verstärkt werden. Nehmen wir die Bar, die Kommune und den Konversationsraum als diejenigen Orte, wo der pragmatische Zwang, Ideen zurückzuhalten, so lange wie möglich suspendiert bleibt. Dagegen ließe sich einwenden, die Ausstellung wäre eine Demonstration eines kompromittierten Schemas einer funktionalen Utopie. Man kann ebenso vorschlagen, dass die Kombination aller beteiligten Faktoren, etwa die am Café und am Vortragssaal vorgenommenen Änderungen, die alle originalen Elemente an ihrem Platz belassen, das Potenzial der vorhandenen Räume berücksichtigt und sie aufzuwerten trachtet, ohne zur korrumpierten Sprache der Restaurierung und der kurzfristigen Kontrolle Zuflucht zu nehmen. Obwohl dies unweigerlich zu einem Kollaps des Verständnisses und der Realisierung führen wird, könnte es doch die inhärenten Widersprüche jedes Bestrebens demonstrieren, die Paradoxien unserer neoliberalen Bedingungen aufzulösen. Liam Gillick, Interview mit Anthony Spira, London 2002

79.

The Wood Way

“Literally No Place” is one way of understanding the word utopia. Once I had stolen the title I became more interested in something more concrete and functional than making general points about utopia, which is why the subtitle to the book is ”Communes, Bars and Greenrooms”. To a certain extent, I’m interested in the idea of ‘functional utopia’, which could be a negative thing a little like being a ‘functioning alcoholic’. It is an acknowledgement that while there’s clearly a problem there is no reason to stop thinking about how things might be better. What you end up with is not so much a meditation on utopia but an attempt to play with or expose certain kinds of functional utopias. It’s an echo of utopia, where brief glimpses are heightened. Taking the bar, the commune and the greenroom as places where the pragmatising pressure to hold back ideas is suspended for as long as possible. You could argue that the exhibition is a demonstration of a compromised diagram of a functional utopia. You could suggest that the combination of the factors involved, like the adjustments to the café and lecture theatre which leave the original elements all in place, acknowledge the potential of existing spaces and tries to heighten them without resorting to the corrupted language of renovation and short term control. While this will inevitably lead to collapses of understanding and realisation, it might also demonstrate the contradictions inherent in any contemporary attempts to resolve the paradoxes of our neo-liberal condition. Liam Gillick, Interview by Anthony Spira, London, 2002


Diese Seite this page The Wood Way?, 2002 Installationsansichten installation views Liam Gillick, The Wood Way, Whitechapel Gallery, London, 2002

80.

Liam Gillick

GegenĂźberliegende Seite facing page Prototype Conference Room (Whitechapel Version), 2002 and 2008 onwards dyed canvas (2002) Kvadrat Tonus (2008 onwards) verschiedene MaĂ&#x;e dimensions varied Installationsansicht installation view permanente Installation permanent installation Whitechapel Gallery, London


Ende der 1960er Jahre war es mit den bedeutenden utopischen Projekten des sozialen Wohnungsbaus vorbei. Sie sind in der Tat wichtig gewesen und hatten ihre durchaus schätzbare Blütezeit. Das Projekt der Moderne aber endete nicht mit dem Einsturz von Ronan Point und der Tatsache, dass Immobilien schlecht erhalten und verwaltet werden; vielmehr fand es seine Fortführung in der Welt der Unternehmen. Leute, die an sehr interessanten utopischen Wohnungsbauprojekten gearbeitet haben, sind in die Unternehmenssphäre übergewechselt und haben dort stattdessen gute, moderne Arbeit. Ich bin an der Frage von Spekulation und Planung und all den Widersprüchen und der Grauzone dazwischen sehr interessiert. Wir befinden uns im Moment in einer Situation, in der die Beziehung zwischen beiden hochkomplex ist und sich in sich zurückzieht, nur um neue Schichten von Widersprüchen hervorzubringen, die (normalerweise) sichtbare Spuren auf der urbanen Landkarte hinterlassen. Ich habe diesen Moment durchlebt bis hinein in die Zeit der Restaurierung, wo der Kampf, Platz zurückzuerobern, stets begleitet wird von einem neuen Foyer. Die Ausstellung könnte als Mikrokosmos des Konflikts zwischen diesen beiden Wertesystemen gelesen werden. Man hat eindeutige Souvenirs oder Objekte (Kunstwerke), die insbesondere von der hochentwickelten Welt gesammelt und in die neu geplante Galerienstruktur eingefügt werden; diese wird zu einem halb öffentlichen Raum, der sich das Aussehen eines halb privaten Raums bewahrt. Es kann gut sein, dass ein Gefühl des Nutzens in Kombination mit einem spekulativen Echo Fragen aufwirft, die den relativen Wert von Ideen und Objekten betreffen. Ich bin gespannt, wie es sich auswächst und ob diese Dinge, die du beschrieben hast, tatsächlich lesbar sein werden. Ich bin mir da nicht sicher. Liam Gillick, Interview mit Anthony Spira, London 2002

81.

The Wood Way

Most major utopian public housing projects were over by the end of the 1960s. These were really important and arguably flourished within a more constructive and progressive set of ideologies. But the Modern Project didn’t stop with the collapse of Ronan Point and the fact that estates were badly maintained and managed; instead it continued in the corporate world. People who had been working on very interesting utopian housing projects shifted into the corporate sphere and did good modern work for corporate interests instead. I am very interested in this question of speculation and planning and all the contradictions and grey areas in between. We are now in a situation where the relation between the two is super complex, and folds over into itself to produce new layers of contradiction that are (normally) signified through traces left on the urban landscape. I have lived through that moment and into the time of renovation, where the battle to reclaim space is always accompanied by a new foyer. The show could be read as a microcosm of the conflict between these value systems. You have clear souvenirs or objects (artworks) that are gathered primarily from the developed world and inserted into the new planned gallery structure, which becomes a semi-public space holding evidence of semi-private space. It may well be that a feeling of utility combined with a speculative echo will promote questions about the relative value of ideas and objects. I am genuinely curious about how it is going to come across and whether those things that you have described will actually be readable. I’m not sure. Liam Gillick, Interview by Anthony Spira, London, 2002


Diese Seite this page Stand now on a Ridge, 2003 Vinylbuchstaben vinyl text Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Exterior Days, Casey Kaplan, New York, 2003 Collection Lisa Roumell and Mark Rosenthal, New York Literally this Place, 2003 pulverbeschichtetes Aluminium powder-coated aluminium 152 x 152 x 152 cm Unikat unique Collection Mari and Peter Shaw, Philadelphia Reconciliation Corral, 2003 pulverbeschichtetes Aluminium powder-coated aluminium 152 x 152 x 152 cm Unikat unique Charpenel Collection, Guadalajara Elevation Structure, 2003 pulverbeschichtetes Aluminium powder-coated aluminium 152,4 cm x 152,4 cm x 152,4 cm Unikat unique

82.

Liam Gillick

Exterior, 2003 pulverbeschichtetes Aluminium powder-coated aluminium 150 x 200 x 200 cm Installationsansicht installation view Liam Gillick, Exterior Days, Casey Kaplan, New York, 2003

Gegenüberliegende Seite facing page Literally (Structure), 2003 pulverbeschichtetes Aluminium powder-coated aluminium 240 x 240 x 240 cm Installationsansicht installation view Liam Gillick, Literally, Projects: Museum of Modern Art, New York, 2003 private collection, New York Literally (Diagram), 2003 Wandfarbe paint on wall Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Literally, Projects: Museum of Modern Art, New York, 2003


Sie wandten sich der Schlucht zu und stiegen eine Böschung hinauf, nur um den Platz nochmals zu sehen. Vor drei Tagen gestartet, sind sie ungefähr hundert Kilometer gelaufen. Es fühlte sich wie die Hälfte der Distanz an, hätte aber auch das Doppelte sein können. Einige aus der Gruppe waren zuerst nur widerwillig aufgebrochen und wurden noch beunruhigter, als sie merkten, eine halbe Runde gelaufen zu sein. Es hatte in den letzten Tagen eigentlich kein Endziel gegeben, sie waren einfach nur gelaufen, um eine Weile rauszukommen. Ohne Fokus, aber produktiv hinsichtlich dessen, dass es ihren Arbeitsprozess blockierte und sie auf sich selbst zurückgeworfen waren. Der Wunsch umzukehren war stark, stärker als der Wunsch, weiter und weiter vorzudringen. Ohne miteinander zu sprechen, ohne zusammen etwas zu planen, hatten sie es sich erlaubt, in einen Bogen einzuschwenken. Laufen war ohnedies die einzige Option. Der letzte Wagen war vor einiger Zeit abgefahren, und der einzige verbliebene Lastwagen besaß ein vollkommen ausgelaufenes Getriebe, das wimmerte und kreischte – selbst noch als sie improvisierten und versuchten, für ein wenig Schmierung mit Hilfe hydraulischer Flüssigkeit aus der Selbstproduktion zu sorgen. So hatten sie zu Fuß aufbrechen müssen. Auf heißen Sohlen mit zerfetztem Schuhwerk und gegen Ende ohne Schuhe. Liam Gillick, Literally No Place, London 2002

83.

Literally No Place

They turned in the ravine and climbed to the top of a bank, just to see the place again. Gone for three days, they had walked about one hundred kilometres. It felt like half that distance and could have been double. Some of the group had been reluctant to leave at first and even more disturbed to realise that they had walked a semi-looping trail. There had been no general purpose over the last few days, just walking for the sake of getting out of the place for a while. Lacking in focus but productive in the way it blocked their working process and turned them in on themselves. There was a strong desire to return rather than press on and beyond. Never speaking, never planning together, they had allowed themselves to swing in an arc. Walking had been the only option anyway. The last car had left some time ago and the only remaining truck had a transmission completely drained of fluid that whined and screeched even when they tried to improvise some lubrication with home improved hydraulic fluid. So they had set off on foot. On hot feet held by frayed footwear and towards the end, no shoes at all. Liam Gillick, Literally No Place, London, 2002


Literally Some Place, 2009 Projekt fĂźr project for Bridges and Borders

84.

Liam Gillick


85.

Ein langer Spaziergang... Zwei kurze Stege...*


Telling Histories: An Archive and three Case Studies with Contributions by Mabe Bethonico and Liam Gillick, 2003 Installationsansicht installation view Telling Histories, Kunstverein MĂźnchen, 2003 Sammlung Siemens Kultur, MĂźnchen, und Dr. Giovanni Springmeier, Berlin

86.

Liam Gillick


Das Projekt „Telling Histories: An Archive and three Case Studies with Contributions by Mabe Bethonico and Liam Gillick“ entstand aus dem Interesse, wie Ausstellungen und ganze Institutionsprogramme in der Vergangenheit als Vermittler zeitgenössischer Kunst funktioniert haben, aber auch daran, wie sie heutzutage operieren.

The project “Telling Histories: An Archive and three Case Studies with Contributions by Mabe Bethonico and Liam Gillick” grew out of an interest in the various ways in which exhibitions and whole programmes of institutions have functioned as mediators of contemporary art in the past but also how they operate today.

Die Kuratoren Ana Paula Cohen, Sören Grammel und ich selbst haben zusammen das Projekt in einem kollektiven Prozess entwickelt, in den auch die Künstler Mabe Bethonico (Belo Horizonte) und Liam Gillick (London/New York) eingebunden waren. Wir wussten, dass der Ort, an dem wir arbeiteten – der Kunstverein München –, eine stolze Geschichte mit einer Anzahl legendärer Ausstellungen seit den späten 1960er Jahren aufzuweisen hat. Da die Institution kein aufgearbeitetes Archiv besaß, als wir die Hauptbelange bezüglich der Rolle der Ausstellungen und Programme als Mediatoren zeitgenössischer Kunst ‚im Hause selbst‘ recherchieren wollten, mussten wir auf dem Niveau des Sammelns, Identifizierens und Strukturierens des historischen Materials beginnen. Die Künstler wurden dann dazu eingeladen, als Künstler ‚im Einsatz‘ sich in fachbezogene Aufgabenbereiche einzuarbeiten. Neben der Tatsache, dass sie generell Diskussionspartner waren, hatten wir Mabe Bethonico gebeten, das Archiv zu recherchieren; an Liam Gillick trugen wir die Bitte heran, das Projekt mit einer pragmatischen Benutzeroberfläche auszustatten. „Telling Histories“ ist zu einem Projekt geworden, das eine Reorganisation und die Erweiterung des historischen Materials der Institution zu einem Archiv ebenso wie ein räumliches Set-up umfasste, das dieses Archiv und zahlreiche öffentliche Veranstaltungen beinhaltete.

The curators Ana Paula Cohen, Sören Grammel and myself developed the project together in a collective process which also involved the artists Mabe Bethonico (Belo Horizonte) and Liam Gillick (London/ New York). We knew that the place where we were working – Kunstverein München – has a proud history featuring a number of legendary exhibitions, particularly since the late 1960s. But as the institution did not have an organised archive at a point where we wanted to investigate the issues of exhibitions and programmes as mediators of contemporary art ‘at home’, we had to start on the level of collecting, identifying and structuring the historical material. The artists were then invited as ‘applied’ artists to become involved in specialised tasks. Besides being general discussion partners, Mabe Bethonico was asked to investigate the archive and Liam Gillick was approached to provide the project with a pragmatic user surface. Subsequently “Telling Histories” became a project that encompassed re-organising and extending the institution’s historical material into an archive, as well as a spatial set up which held the archive and a number of public events.

Maria Lind, Telling Histories, 2003

87.

Archives and Episodes

Maria Lind, Telling Histories, 2003


Diese Seite this page Public Information Posters, 2004 Tintenstrahldrucke jeweils inkjet prints each 59,4 x 42 cm Liam Gillick, A Group of People, Air de Paris, 2004 Collection Fond municipal d’art contemporain, Paris Collection Jean-Michel Attal, Paris Flex Floating, 2004 pulverbeschichtetes, wasserstrahlgeschnittenes Aluminium powder-coated water cut aluminium 100 x 200 cm Liam Gillick, A Group of People, Air de Paris, 2004 Collection Nouvion Rey, Monaco

88.

Liam Gillick

Gegenüberliegende Seite facing page Underground (Trailer for a Book), 2004 Brionvega Cuboglas Fernsehgerät, brauner Teppich, Buch Brionvega Cuboglas television, brown carpet, book Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Underground (Fragments of Future Histories), Galerie Micheline Szwajcer, Antwerp, 2004 Collection Museum of Modern Art, New York


Zum Ende des Jahrhunderts, welches wir nun als Teil der Vorgeschichte sehen, ereignete sich eine unerwartete Katastrophe. Das wissen wir alle, weil es den Beginn unseres Zeitalters markiert. Einen Zeitraum, in dem wir die Mehrzahl unserer Leute verloren haben. Einige behaupten jetzt, sie seien verschwunden zum Vorteil derjenigen, die zurückgeblieben sind. Ich muss euch die Geschichte dieses globalen Desasters und der unvorhersehbaren Gesundung erzählen, die sich über mehr als ein oder vielleicht gar zwei Jahrhunderte voller Anstrengungen erstreckte. Selbstverständlich werde ich die Details, die wir alle kennen, nur oberflächlich streifen, und den generellen Faden der Geschichte im Auge behalten. Aber zunächst könnte es sich lohnen, einen kurzen Augenblick des Nachdenkens auf den relativen Fortschritt zu verwenden, der von den Leuten erreicht wurde, solange sie noch auf der Erdoberfläche gelebt haben. Der Gipfel menschlichen Wohlstands schien im trivialsten und frivolsten Sinne des Wortes erreicht. Die vorangegangenen fünfzig Jahre hatten die endgültige Etablierung der Euro-Asiatisch/Amerikanischen Föderation mit sich gebracht. Und deren unumstrittene Vorherrschaft über den Rest der Welt hatte sichergestellt, dass alle Nationen, die im Endeffekt nurmehr als Provinzen fungierten, an die Idee eines universalen und unerschütterlichen Friedens gewöhnt waren. Liam Gillick, Underground, Antwerpen 2003

89.

Archives and Episodes

Towards the end of the century that we now think of as part of prehistory an unexpected catastrophe took place. We all know this as it marked the beginning of our time. A period when we lost the majority of our people. Some now say that they disappeared for the benefit of those left behind. I have to tell you the story of this global disaster and the undreamt of recovery that took place over a century or two of effort. Of course I will skim over the details that we all know and shall stick to the general outline of the story. But first of all it might be worth spending a short time reflecting on the progress that had been attained by people while they were still living on the surface of the earth. The peak of human prosperity seemed to have been reached in the superficial and frivolous sense of the word. The last fifty years had seen the final establishment of the great Euro-Asiatic/American Federation. And its undisputed supremacy over the rest of the world had made sure that all nations, now effectively functioning as provinces, were used to the idea of universal and unshakable peace. Liam Gillick, Underground, Antwerp, 2003


Briannnnnn & Ferryyyyyy (with Philippe Parreno), 2005 Animation in 10 Episoden animation in 10 episodes MaĂ&#x;e variabel dimensions variable Liam Gillick and Philippe Parreno, Rider: Law and Creativity, Konsthall, Lund, 2005

90.

Liam Gillick


Episode 1 Nacht im Innern

Episode 2 Tag draußen

Briannnnnn schläft. Ferryyyyyy schleicht heran, wie ein Ninja.

Ferryyyyyy ist tief in Gedanken versunken und will die Straße überqueren. Als er einen Schritt nach vorn macht, donnert ein Bus vorbei und fährt ihn in Stücke.

Ferryyyyyy knüppelt Briannnnnn flach wie einen Pfannkuchen mit einem Amboss am Kopf eines Hammers.

Seelenstückchen steigen aus jedem einzelnen Teil auf und verbinden sich zum Geist Ferryyyyyy und schweben in den Himmel.

Briannnnnn ist tot.

Abspann Briannnnnn: Sans toi ni loi Ferryyyyyy: Keine Wand kein Gesetz Ferryyyyyy’s Soul: Kein Haus fürs Wohnen Animation: Agnès Varda Musik: Sans Abri Postproduction: Hecha la ley hecha la trampa Regie: Faite la loi, faite la triche Produktion: Ich bin unfähig, ins Englische zu übersetzen Eine Anna Sanders (Benutze das Gesetz selbst zu deinem eigenen Vorteil) Produktion

Briannnnnns Seele schwebt mit kleinen Engeln an der Seite in den Himmel. Ferryyyyyy ist deprimiert. Er glaubte, dass er Briannnnnn niemals töten würde. Abspann Briannnnnn: Gesetzeskraft Ferryyyyyy: Mystisches Fundament der Autorität Briannnnnn’s Seele: Dekonstruktion und Möglichkeit von Gerechtigkeit Animation: Soziale Gerechtigkeit Musik: Politische Implikationen der Wahlmöglichkeiten Postproduction: Überspringe den hartnäckigen Prozess (Moral) der Unentschlossenheit Regie: Kunst und die abstrakte Idee der Macht Produktion: Der Foucaultsche Sinn Eine Anna Sanders (Kunst und Macht als zwei untrennbare Sphären) Produktion

91.

Archives and Episodes

Liam Gillick und Philippe Parreno, Lund 2004


Briannnnnn & Ferryyyyyy (with Philippe Parreno), 2005 Animation in 10 Episoden animation in 10 episodes MaĂ&#x;e variabel dimensions variable Liam Gillick and Philippe Parreno, Rider: Law and Creativity, Konsthall, Lund, 2005

92.

Liam Gillick


Episode 1 Interior Night

Episode 2 Exterior Day

Briannnnnn is asleep.

Ferryyyyyy is deep in thought and is about to cross the road. As he steps out a bus thunders by smashing him into distinct pieces.

Ferryyyyyy approaches, like a ninja. Ferryyyyyy clubs Briannnnnn flat as a pancake with an anvil on the end of a hammer. Briannnnnn is dead. Briannnnnn’s soul floats up to heaven with little angels floating alongside. Ferryyyyyy is depressed. He thought he would never kill Briannnnnn. Credits Briannnnnn: Force of Law Ferryyyyyy: Mystical Foundation of Authority Briannnnnn’s Soul: Deconstruction and the Possibility of Justice Animation by: Social Justice Music by: Political Implications of Choice Post-production: Traverse the Tough Process (Morality) of Indecision Directed by: Art and the Abstract Idea of Power Produced by: The Foucaultian Sense An Anna Sanders (Art and Power as two Inseperable Spheres) Production

93.

Archives and Episodes

Soul elements rise up from each distinct piece and coalesce into a ghost Ferryyyyyy and float up to heaven. Credits Briannnnnn: Sans toi ni loi Ferryyyyyy: No Ceiling no Law Ferryyyyyy’s Soul: No House for Living in Animation by: Agnès Varda Music by: Sans Abri Post-production: Hecha la ley hecha la trampa Directed by: Faite la loi, faite la triche Produced by: I’m Unable to Translate into English An Anna Sanders (Use the Law Itself for your own Purposes) Production Liam Gillick and Philippe Parreno, Lund, 2004


Diese Seite this page McNamara Motel, 2005 Vinylbuchstaben, Sperrholzbänke vinyl text, plywood benches Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, McNamara Motel, CAC, Malaga, 2005 Presentism, 2005 Installationsansicht installation view Liam Gillick, Presentism, Corvi-Mora, London, 2005

94.

Liam Gillick

Gegenüberliegende Seite facing page Edgar Schmitz, 2005 (with Edgar Schmitz) Installationsansicht installation view Liam Gillick and Edgar Schmitz, Edgar Schmitz, ICA, London, 2005


1) Ashford 1978

1) Ashford 1978

2) Rotterdam 1928

2) Rotterdam 1928

3) Erasmus aß zehn Jahre Opium

3) Erasmus aß zehn Jahre Opium

4) Erasmus Darwin kommt

4) Erasmus Darwin kommt

5) Ibuka!

5) Ibuka!

6) Der Mittelgrund

6) The middle ground

7) Großes Konferenzzentrum

7) Big Conference Centre

8) Mein Schritt war leicht, und ich konnte jeden Fußballen spüren, wie er die Erde von mir weg niederdrückte, als ich lief

8) My step was light and I could feel the ball of each foot pushing the earth down from me as I walked

9) Wittes Lese- und Arbeitszimmer

9) Wittes learning and study

10) Ich seh, du bist entschlossen, mich zu verurteilen

10) I see ye are determined to condemn me

Liam Gillick, McNamara Motel, Malaga 2005

Liam Gillick, McNamara Motel, Malaga, 2005

95.

Archives and Episodes


Weekend in so Show, 2007 Tintenstrahldruck inkjet print 29,7 x 21 cm

96.

Liam Gillick


97.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page The Views Imagined by the Workers after they Stopped Producing Cars, 2005 Farbe, pulverbeschichtetes Aluminium paint, powder-coated aluminium Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, As You Approach the Edge of Town the Lights Are no Softer than they Were in the Centre, Casey Kaplan, New York 2005 Quarter Scale Modeo of a Social Structure for a Plaza in Guadalajara, 2005 bemaltes Holz, Lampen painted wood, lights 150 x 240 x 900 cm Installationsansicht installation view Liam Gillick, As You Approach the Edge of Town the Lights Are no Softer than they Were in the Centre, Casey Kaplan, New York 2005

98.

Liam Gillick

Gegenüberliegende Seite facing page Quarter Scale Model of a Social Structure for a Plaza in Guadalajara, 2005 bemaltes Holz, Lampen painted wood, lights 150 x 240 x 900 cm Installationsansicht installation view Liam Gillick, As You Approach the Edge of Town the Lights Are no Softer than they Were in the Centre, Casey Kaplan, New York 2005 Collected Development Structures, 2005 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, As You Approach the Edge of Town the Lights Are no Softer than they Were in the Centre, Casey Kaplan, New York 2005 Sammlung Ringier, Zürich


Die Ausstellung untersucht das Wechselspiel zwischen gebauten Strukturen und theoretischen Konstrukten. Die Strukturen bestehen aus aufgehängten Texten, Bestuhlung, niedrigen Screens, Wandgestaltungen und einem 1:4-Modell für einen neuen sozialen Raum auf einem öffentlichen Platz in Guadalajara, Mexiko. Zusammen betrachtet, kombinieren die Arbeiten Experimentier- und Improvisationsstrukturen mit pragmatischen sozialen Vorschlägen. Durch die Kombination paralleler Formen in einem offenen und noch unbearbeiteten Bezugssystem ermutigt die Arbeit zu aktiver Teilnahme und fließendem Austausch zwischen Galerieraum, Betrachter und Kunstwerk. Die Arbeit bezweckt, die Beziehung des Betrachters zur traditionellen Rolle des Kunstobjekts zu verdichten, und lädt einen dazu ein, sich vom Werk abzuwenden und in dessen theoretische wie öffentliche Funktion einzutauchen. Die Ausstellung antizipiert seine demnächst erscheinende und unter dem provisorischen Titel „Construction of One (Construcción de Uno)“ firmierende Erzählung, die eine neue Serie von Beziehungen zwischen Produktion und Entwicklung in einem postindustriellen Milieu skizziert. Liam Gillick, New York 2005

99.

Construcción de Uno

The exhibition examines the interplay between built structures and theoretical constructs. The structures include hanging texts, seating, low screens, wall designs and a quarter scale model of a new social space for a public plaza in Guadalajara, Mexico. Together the works combine experimental and improvisational structures with pragmatic social proposals. By combining parallel forms in an open framework, the work encourages active participation and fluid exchange between the gallery space, the viewer, and the artwork. The work aims to complicate the viewer’s relation to the traditional role of the art object, inviting you to turn aside from the work and become immersed in theoretical and public projects. This exhibition anticipates the forthcoming narrative, provisionally titled “Construction of One (Construcción de Uno)”, which outlines a new series of relationships between production and development in a post-industrial environment. Liam Gillick, New York, 2005


Diese Seite this page Poster Design, MM Agence, Paris Liam Gillick, A Short Text on the Possibilities of Creating an Economy of Equivalence, Palais de Tokyo, Paris, 2005 The View Constructed by the Factory after it Stopped Producing Cars, 2005 bemalter Stahl painted steel jedes Element 900 cm breit, Höhe variabel, Abstände variabel each element 900 cm wide, height variable, spacing variable Liam Gillick, A Short Text on the Possibilities of Creating an Economy of Equivalence, Palais de Tokyo, Paris, 2005 Collection Fond national d’Art contemporain, Puteaux

100.

Liam Gillick

Gegenüberliegende Seite facing page A Diagram of the Factory once the Former Workers Had Cut Extra Windows in the Walls, 2005 bemalter Stahl painted steel 240 x 900 x 900 cm Liam Gillick, A Short Text on the Possibilities of Creating an Economy of Equivalence, Palais de Tokyo, Paris, 2005 The Hopes and Dreams of the Workers as they Wandered Home from the Bar, 2005 roter Glimmer red glitter Maße variabel dimensions variable Liam Gillick, A Short Text on the Possibilities of Creating an Economy of Equivalence, Palais de Tokyo, Paris, 2005


Das Buch sowie die Ausstellungsstruktur beinhalten Gedanken über ein Verhalten, wenn eine Fabrik geschlossen wird und die Arbeitsbedingungen in einen postproduktiven Stand übergegangen sind. Die Mutmaßung, die hinter dem Projekt steckt, besteht darin, dass sich die ehemaligen ,Produzenten‘ zur Rückkehr an ihren Arbeitsplatz und für die Wiederaufnahme der Konstruktion von Ideen entschieden haben anstatt der Produktion fahrzeuggroßer Gegenstände. Eine Maßnahme ist es, das Gebäude selbst neu zu gestalten und mehr Fenster in die Fassaden zu schneiden. Eine andere besteht darin, eine Gebirgslandschaft zu konstruieren, die von diesen Fenstern aus und auf ihren langen Heimwegen von den Bars zu sehen ist. Das Buch greift die Geschichte jener halb zufriedenen ehemaligen Fabrikarbeiter auf, die ihre Produktivität an ihrem früheren Arbeitsort ausgereizt haben. Ihre Tage vergehen beim Versuch, neue Produktionsmodelle zu entwickeln, die auf eine Ökonomie der Gleichwertigkeit abzielen, in der eine Input-Einheit, sei sie intellektueller oder physikalischer Natur, eine Output-Einheit produziert. Ihre ökonomischen und sozialen Ansätze scheinen sich zu verbessern und immer eleganter zu werden, bis man schließlich realisiert, dass sie, die Produzenten selbst, zum verbrauchten Element in diesem Prozess geworden sind. Ihre Energie und ihr Input in diese Modelle füllen zunehmend die Leerstellen im Herz ihrer Theorien auf. Doch ist hoffentlich klar geworden, dass ihr Verlangen, den Fokus auf die Frage zu richten, wie man die Dinge zusammensetzen, fundamental reorganisieren kann, einen bleibenden Einfluss auf andere haben wird, auch wenn sie selbst diffundieren und sich in ihrer früheren, jetzt nicht wiederzuerkennenden Arbeitsstätte auflösen. Liam Gillick, Paris 2005

101.

Construcción de Uno

The book and the exhibition structure involve thinking about how to behave once a factory has closed and conditions of labour have devolved into a post-productive situation. The assumption behind the project is that the former ‘producers’ choose to return to their place of work and re-start the construction of ideas rather than car-sized-objects. One of their first tasks is to remodel the building itself, cutting more windows in the façades. Another is to construct a mountain landscape to view from those windows and on their long walks home from the bars. The book takes up the story of these semi-contented former factory workers once they have exhausted their productive play in their former site of work. Their days get consumed attempting to evaluate new models of production towards an economy of equivalence, where one unit of input, whether intellectual or physical can produce one unit of output. Their economic and social models seem to improve and become more and more elegant as the book progresses until we realise that it is they who have become the drained element in the process. Their energy and input into the models is increasingly supplementing the absences at the core of their theories. Yet, as may become clear, their desire to turn focus upon the question of how to fundamentally reorganise the way things are put together will have a lasting influence on others even while they eventually dissipate and dissolve into their former, now unrecognisable workplace. Liam Gillick, Paris, 2005


Diese Seite this page The View Constructed by the Factory after it Stopped Producing Cars, 2005 bemalter Stahl painted steel jedes Element 900 cm breit, Höhe variabel, Abstände variabel each element 900 cm wide, height variable, spacing variable Liam Gillick, A Short Text on the Possibilities of Creating an Economy of Equivalence, Palais de Tokyo, Paris, 2005 Collection Fond national d’Art contemporain, Puteaux A Short Text on the Possibilities of Creating an Economy of Equivalence, Palais de Tokyo, Paris, 2005 Lesezone study area

102.

Liam Gillick

Gegenüberliegende Seite facing page The two hundred and twenty second Floor, 2005 Installationsansicht installation view Liam Gillick, The two hundred and twenty second Floor, Eva Presenhuber, Zürich, 2005 Sammlung Thomas und Cristina Bechtler, Schweiz


„Construcción de Uno“ dreht sich um eine Gruppe von Leuten in einem nordeuropäischen Land, die aus Gewohnheit und Langeweile in ihre jüngst geschlossene Fabrik zurückkehren. Sieht man einmal von der Tatsache ab, dass alle Industriezweige verschwunden sind, ist ihr Areal durch keinerlei postindustrielle Verschandelung beeinträchtigt worden; und dennoch sind sich die früheren Angestellten eines ganz spezifischen Verlustes bewusst. Nach einer Periode der Improvisation mit dem Schilderwald und der Ausrüstung, die in der Fabrik zurückgelassen wurden, beginnen sie, sich strukturelle Spiele auszudenken, um ein besseres Modell der Produktion zu entwickeln. Das angekündigte Buch folgt ihrer zunehmenden Fähigkeit, Szenarien zu entwickeln, die zu einer ,Ökonomie der Äquivalenz‘ hinführen könnten, in der eine Ideen-, Stoff- oder Aktionseinheit mit dem geringsten Verlust oder Gewinn wiederum als eine Ideen-, Stoffoder Aktionseinheit herauskäme. Derweil sie ein Stadium perfekter Äquivalenz zu erreichen scheinen, ist nicht zu erkennen, ob sie dabei den Effekt auf ihr eigenes Denken unterschätzt haben. Wir sind verlassen und stehen zusammen an einem neuen Loch, das in die Seite einer einfachen Struktur geschnitten ist, und lassen unseren Blick über die Landschaft gleiten, die vom Sound leiser Diskussionen erfüllt ist, welche an die Stelle von Produktionsmechanismen getreten sind.

“Construcción de Uno” concerns a group of people in a Northern European country who return to their recently closed factory out of habit and boredom. Their area is unaffected by post-industrial blight despite the fact that all industry has disappeared yet the former employees are conscious of a specific loss. Following a period of directionless improvisation with the signage and equipment left behind in the factory they start to develop structural games in order to develop a better model of production. The forthcoming book follows their increasing skill at developing scenarios that might produce an ‘economy of equivalence’ where one unit of ideas, stuff or action might result in one unit of ideas, stuff or action with the smallest possible loss or gain. While they appear to reach a state of perfect equivalence, it is unclear whether or not they have underestimated their own effect on their thinking. The work here refers to the framing conditions of the text prior to the closure of the ‘factory’. Later there will be a manipulation of materials that happen to surround them in order to produce a new series of framing devices around which to commence their thinking. The work also makes a conscious reference to the language of workshop based semi-industrial modernist art production. We are left, standing together by a new hole cut in the side of a simple structure, looking out across the landscape with the sound of quiet discussion replacing the mechanisms of production.

Liam Gillick, Madrid 2005 Liam Gillick, Madrid, 2005

103.

Construcción de Uno


Diese Seite this page The View Constructed by the Factory after it Stopped Producing Cars, 2005 bemalter Stahl painted steel jedes Element 900 cm breit, Höhe variabel, Abstände variabel each element 900 cm wide, height variable, spacing variable Liam Gillick, A Short Text on the Possibilities of Creating an Economy of Equivalence, La Casa Encendida, Madrid, 2005 Collection Fond national d’Art contemporain, Puteaux

104.

Liam Gillick

Gegenüberliegende Seite facing page A Diagram of the Factory once the Former Workers Had Cut Extra Windows in the Walls, 2005 bemalter Stahl, Café, Text painted steel, cafe, text Maße variabel dimensions variable Liam Gillick, A Short Text on the Possibilities of Creating an Economy of Equivalence, La Casa Encendida, Madrid, 2005 private collection, Paris


Ein kurzer Text über die Möglichkeit, eine Ökonomie der Äquivalenz zu schaffen, hängt insbesondere mit der Entwicklung eines neuen Buches zusammen, das den Versuch unternimmt, im Kontext des europäischen Nachkriegssozialmodells – der spezielle Fokus liegt hierbei auf Skandinavien – Wege durch eine spezifisch postindustrielle Krise aufzuzeigen. Das Design der Arbeit war ursprünglich für die großen Flächen des Palais de Tokyo geplant. In Madrid ist es notwendig, die ursprüngliche Erscheinungsform der Arbeit anzupassen und in ihrem Ausmaß und Anspruch so zu korrumpieren, dass sie auch für die bescheideneren Flächen des La Casa Encendida taugt. In Paris hat die Arbeit als autonomes Strukturen-Set funktioniert und eine Landschaft der Ideen innerhalb des Gebäudes entstehen lassen. In Madrid ist die Arbeit neu justiert und wird zu einem untergeordneten Bedeutungsträger. Die Arbeit in Madrid ist rekonfiguriert und wird von der Institution eher mitbenutzt, als dass sie ihr einfach aufgepfropft wäre. Die Struktur „A Diagram of the Factory once the Former Workers Had Cut Extra Windows in the Walls“ stellt jetzt eine Nebenerweiterung der sozialen und informellen Rolle des La Casa Encendida dar. Sie ist entsprechend angepasst und umgearbeitet worden. Ein Bar-/Café-/ Informations-Punkt fungiert als parasitäre und improvisierte Struktur neben und im Werk. Diese Ausstellung formuliert zugleich vor- und rückwärts rund um die Abwesenheit des Textes. Das Werk dient nicht als Führer oder als Illustration der sich entwickelnden Ideen. Vielmehr wurde es in einem Zustand der Zerstreuung errichtet, als die Bedingungen einer zu überarbeitenden sozialen Struktur im Zentrum des Nachdenkens standen. Liam Gillick, Madrid 2005

105.

Construcción de Uno

A short text on the possibility of creating an economy of equivalence relates specifically to the development of a new book that attempts to address ways through a particular post-industrial crisis within a postwar European social model with specific focus upon Scandinavia. The work here was originally designed for the large public spaces of the Palais de Tokyo. In Madrid it is necessary to adapt and corrupt the original manifestation of the work in order for it to fit in the more modest spaces of La Casa Encendida. In Paris the work functioned as autonomous set of structures, creating a landscape of ideas within the building, in Madrid the work is adjusted and becomes a secondary carrier of meaning. The work in Madrid is reconfigured and shared by the institution rather than floated on top of it. The structure “A Diagram of the Factory once the Former Workers Had Cut Extra Windows in the Walls” has now become a secondary extension of the social and informative role of La Casa Encendida. It is adjusted and reworked. A bar/café/information point now functioning as a parasitical and improvised structure alongside and within the work. The exhibition here points both backwards and forwards around the shimmering absence of the text. The work does not function as a guide or illustration of the developing ideas. Rather it has been produced in a state of distraction while thinking about the conditions of a revised social structure. Liam Gillick, Madrid, 2005


Diese Seite this page Culture Is Important in a Free Society (An Exhibition of Things that Don’t Exist yet), 2006 20 Tintenstrahldrucke je 20 inkjet prints each 84,1 x 59,4 cm How to Improve the World, Hayward Gallery, London, 2006

106.

Liam Gillick

Gegenüberliegende Seite facing page Literally Based on H. Z., 2006 MDF, Plexiglas, pulverbeschichtetes Aluminium, wasserstrahlgeschnittenes Aluminium, Holz MDF, Plexiglas, powder-coated aluminium, water cut aluminium, wood Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Literally Based on H. Z., Kerlin Gallery, Dublin, 2006 Collection Irish Museum of Modern Art, Dublin


UNTERWEGS IN EINE RICHTUNG (HAHNENKOPF [COCK’S HEAD]) NEUNZEHNZWEIUNDFÜNFZIG EINE AUSSTELLUNG EINIGER WERKE VON BACON UND FREUD UND …

HEADING IN ONE DIRECTION (COCK’S HEAD) NINETEENFIFTYTWO AN EXHIBITION OF SOME WORKS BY BACON AND FREUD AND...

DAS GLEICHE NUR ANDERS NEUNZEHNACHTZIG WIE IN DER SELBEN ART WIE DAS DING DAS HIER IST. 1940–1980 DIE/EINE SAMMLUNG (ÄHNLICH)

THE SAME BUT DIFFERENT NINETEENEIGHTY SORT OF THE SAME KIND OF THING THAT’S HERE. 1940–1980 THE/A COLLECTION (SIMILAR)

OH. EINIGE DINGE. ELEMENTE NEUNZEHNACHTUNDSIEBZIG EINE AUSSTELLUNG EINIGER DINGE DIE ZUSAMMEN MEHR HERMACHEN ALS JEDES ELEMENT FÜR SICH ALLEIN.

AH. SOME THINGS. ELEMENTS NINETEENSEVENTYEIGHT AN EXHIBITION OF SOME THINGS THAT TOGETHER MAKE UP MORE THAN EACH ELEMENT ALONE.

WAS DU SIEHST/WAS DU SIEHST NEUNZEHNZWEIUNDSIEBZIG EINE AUSSTELLUNG VON DINGEN DIE DEN WEG DOKUMENTIEREN WIE DINGE ZU SEIN SCHEI(IE)NEN

WHAT YOU SEE/WHAT YOU SEE NINETEENSEVENTYTWO AN EXHIBITION OF THINGS THAT DOCUMENT THE WAY THINGS APPEAR(ED) TO BE

107.

Assumed Personas


Speaking Cat Grappa, 2009 Etikettendesign fĂźr Speaking Cat Grappa label design for Speaking Cat Grappa Brigade Commerz, Berlin

108.

Liam Gillick


109.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page Entrance to an Abandoned Facility, 2006 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Commune, Esther Schipper, Berlin, 2006 Alastair Cookson Modelised Retraction Screen, 2006 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Commune, Esther Schipper, Berlin, 2006 private collection, Brussels The State itself Becomes a Super Commune, 2006 Vinylbuchstaben vinyl text Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Commune, Esther Schipper, Berlin, 2006 Alastair Cookson

110.

Liam Gillick

Gegenüberliegende Seite facing page Glanced in the Midst of a Legislated Break, 2006 pulverbeschichtetes Aluminium powder-coated aluminium 40-teilig je 40 elements each 200 x 15 x 3 cm Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Commune, Esther Schipper, Berlin, 2006 Städtische Galerie im Lenbachhaus München, Dauerleihgabe Sammlung KiCo The State itself Becomes a Super Commune, 2006 Installationsansicht installation view Liam Gillick, The State itself Becomes a Super Commune, Esther Schipper, Berlin, 2006


Experimentelle Produktionsmethoden, wie sie in den 1970er Jahren in Schweden entwickelt wurden, sind Teil der Standardrhetorik der Industrie des Westens geworden. Diese Entwicklungen sind indes durch die zunehmende Globalisierung der Produktion und deren Auslagerung in Regionen weit weg vom Ort des Konsums in Frage gestellt worden. Im nie geschriebenen ,Buch‘ „Construcción de Uno“ wird ein Szenario entworfen, in dem Arbeiter einer nordeuropäischen Autofabrik an ihren ehemaligen Arbeitsplatz zurückkehren und die Möglichkeiten eines ökopolitischen Systemwechsels und alternativer Produktionsmodelle diskutieren. Die Ausstellung enthält einen längeren Text, der den Abschluss eines Projektes annonciert, das Neubesinnung mit physischen Strukturen kombiniert. Das lässt sich als einen ersten Schritt betrachten, neue Anwendungsbereiche für das Fabrikumfeld zu finden. Wie bei den meisten meiner neueren Arbeiten werden frühere Erkundungen zu Un-Plätzen, atmosphärische Effekte des angewandten Modernismus, historische Bestrebungen, kommunale Arbeitszusammenhänge zu fördern und dabei klassische kommunistische Modelle zu vermeiden, und die Kluft zwischen den Prozessen, in denen Modernisierung und das kritische Potenzial des Modernismus aufeinandertreffen, in einer Serie von Arbeiten miteinander kombiniert, die parallel zu den Leistungen eines kritischen Textes vorgehen. Liam Gillick, Berlin 2006

111.

The State itself Becomes a Super Commune

Experimental production methods, developed in the 1970s in Sweden, have become part of the standard rhetoric of Western industry. These developments have been challenged, however, by the increasing globalisation of production and outsourcing away from the site of consumption. In the continually deferred ‘book’ “Construcción de Uno” a scenario is created where workers in a northern European car factory return to their former work place and discuss the potential of eco-political exchange systems and alternative production models. The exhibition includes a large text that announces the completion of a project of reconsideration combined with physical structures that might be considered as the first step in finding new uses for the factory environment. As with much of my recent work, earlier investigations into non-place, the ambient effects of applied modernism, historical attempts to encourage communal working environments while avoiding classical models of Communism and the gap between the processes of modernisation versus the critical potential of modernism are combined in a series of works that work in parallel to the potential of a critical text. Liam Gillick, Berlin, 2006


Diese Seite this page The Commune itself Becomes a Super State, 2007 Installationsansicht installation view Liam Gillick, The Commune itself Becomes a Super State, Corvi-Mora, London, 2007 Returning to an Abandoned Plant, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The Commune itself Becomes a Super State, Corvi-Mora, London, 2007 Collection Tate, London

112.

Liam Gillick

GegenĂźberliegende Seite facing page Closed Reopened Closed Again, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 40-teilig je 40 elements each 200 x 15 x 3 cm Installationsansicht installation view Liam Gillick, The Commune itself Becomes a Super State, Corvi-Mora, London, 2007 Sammlung Thomas und Cristina Bechtler, Schweiz The Commune itself Becomes a Super State, 2007 Vinylbuchstaben vinyl text MaĂ&#x;e variabel dimensions variable Installationsansicht installation view Liam Gillick, The Commune itself Becomes a Super State, Corvi-Mora, London, 2007


Mit der Zeit gestalten sie ihren neuen Arbeitsplatz vollkommen um. Sie schreiben auf die Wände und entwerfen auf dem Boden Diagramme, die den Lauf ihrer Gedanken, ihre falschen Anfänge und Weiterentwicklungen verraten. Es werden mehr Fenster eingebaut, um neue Ausblicke zu schaffen und sie näher an den Außenraum heranzuführen. Doch verunsichert dieser sie jetzt so, dass sie ihn nur als Anblick, nicht als Erfahrung konfrontieren wollen. Einige Leute arbeiten die ganze Nacht, und wenn man an der Fabrik vorbeifährt, kann man ihnen durch die Fenster bei ihren langen Diskussionen und ausführlichen Darlegungen ihrer Ideen zusehen. Sie bemühen sich um einen Weg, einen totalen Transfer aller Objekte und Ideen zu initiieren und somit sicherzustellen, dass nichts verbraucht oder vermindert wird, aber sich dennoch alles unterscheidet. Sie sind erschöpft, aber glücklich. Ihre Arbeit greift sie persönlich sehr stark an, doch liefert sie eine neue Matrix für den Austausch. Der Schwerpunkt auf dem Tausch eins zu eins sichert, dass sie selbst das Hauptelement des Verbrauchs darstellen. Mit ihrem Wunsch, eine ,Ökonomie der Äquivalenz‘ zu etablieren, fördern sie ihren eigenen rapiden Niedergang. Sie haben zahlreiche Modelle, Gleichungen und Diagramme aufgestellt, die sicherstellen, dass alles getauscht und gleichzeitig das Gleiche bleiben kann. Ihre Arbeit scheint besser zu werden. Ihre Ökonomie der Äquivalenz wird perfekter. Doch sind es jetzt die ,Autoren‘, die an Substanz verlieren. Sie haben sich selbst nicht in den Prozess der Äquivalenz mit eingerechnet. Am Arbeitsplatz kommt es zu einer permanenten Ausdehnung und Schrumpfung der relativen ,Freiheiten‘ – was die nichtmonetären Anreize erhöht und Techniken zugute kommt, mit denen sich die Langeweile der Arbeit vermindern lässt. Allein, mit der immer größer werdenden Bedeutung des ,Shareholder-value‘ (die Priorität liegt hier auf dem Aktienindex eines Unternehmens) kann

113.

The State itself Becomes a Super Commune

man eine zunehmende Veränderung im Umgang mit den Arbeitern beobachten. Die Plünderung der Pensionsfonds der Unternehmen geht einher mit der Verschiebung der Verantwortlichkeiten der Arbeiter. Natürlich beginnt das Buch an dem Punkt, wo all diese Sachverhalte für die betroffenen Arbeiter keine Rolle mehr spielen. Möglich, dass auch der Gedanke mit hineinspielte, dass in erster Linie ihr anfänglicher Enthusiasmus für flexiblere Arbeitstechniken zum Verlust ihrer Jobs beigetragen hätte, doch ist es keinesfalls klar, ob sie wirklich die Architekten ihrer eigenen Arbeitslosigkeit sind. Die alten Fragen des Klassenkampfes lassen sich anfangs kaum fixieren und bleiben verschwommen, bis sie sich in Dunst auflösen. Das hat zur Folge, dass die Arbeiter die Konditionen des Engagements ändern und die anwendungsorientierte Theoriearbeit heranziehen, um die Produktionsverhältnisse zu überprüfen und erneut in Gang zu setzen, womit dann aber auch deren Antagonismus wieder aufkeimt. Ihr Ziel ist es, die Dinge zu verbessern und unser Weltverhältnis zu ändern. Doch führt ihr Projekt unausweichlich zur Verminderung ihrer eigenen Kapazität, präzise Gedanken zu fassen. Der Erfolg oder Misserfolg ihres Denkens ist nicht evident, weil ihr langsamer Verfall es erschwert festzustellen, wo Momente klaren Urteilsvermögens stattfinden können. Sie haben das starke Verlangen, Begriffe der Flexibilität zu verwerfen oder zu transzendieren, ohne dabei repressiv zu werden oder sich auf bestimmte soziale Beziehungen festzulegen. Infolgedessen versuchen sie weitaus sorgfältiger auf die Beziehungen zwischen den Dingen als auf diejenigen zwischen den Menschen zu achten. Daraus aber ergibt sich ein neuer dringlicher Bedarf, ein Verständnis der Klassenbeziehungen wiederzuerlangen. Liam Gillick, Vorwort: Construcción de Uno, 2005


Diese Seite this page Relieved Wall Structure, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 10-teilig je 10 elements each 200 x 15 x 3 cm Installationsansicht installation view Liam Gillick, The State/Commune itself Becomes a Super State/Commune, Galerie Micheline Szwajcer, Antwerp, 2007 Collection Cal Cego. Contemporary Art Collection, Barcelona Articulated Wall Structure, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 10-teilig je 10 elements each 200 x 15 x 3 cm Installationsansicht installation view Liam Gillick, The State/Commune itself Becomes a Super State/Commune, Galerie Micheline Szwajcer, Antwerp, 2007 Collection Mikkel Astrup, Oslo The State/Commune itself Becomes a Super State/Commune, 2007 Installationsansicht installation view Liam Gillick, The State/Commune itself Becomes a Super State/Commune Galerie Micheline Szwajcer, Antwerp, 2007

114.

Liam Gillick

GegenĂźberliegende Seite facing page Long View towards a Renovated Factory, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The State/Commune itself Becomes a Super State/Commune, Galerie Micheline Szwajcer, Antwerp, 2007 Collection Mr. and Mrs. Delfosse, Belgium Relieved Production Cycle, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Installationsansicht installation view Liam Gillick, The Commune itself Becomes a Super State, Corvi-Mora, London, 2007 Collection Vanmoerkerke, Belgium The State/Commune itself Becomes a Super State/Commune, 2007 Installationsansicht installation view Liam Gillick, The State/Commune itself Becomes a Super State/Commune, Galerie Micheline Szwajcer, Antwerp, 2007


Over time they completely reconfigure the working space of their new work. They write on the walls and create diagrams on the floor that reveal the passage of their thoughts, false starts and developments. More windows are opened up in the space to create new vistas and bring them closer to the exterior spaces that now make them anxious and should be kept as a view not an experience. Some people work all night and if you are driving past the factory you might see them through the windows, involved in long discussions and lengthy expositions of their ideas. They attempt to find a way to create a total transfer of all objects and ideas in such a way as to ensure that nothing is depleted or diminished but everything is different. They are exhausted but happy. Their work is personally destructive but provides a new matrix of exchange. The focus upon one to one exchange ensures that they are the primary element of depletion. Through their desire to create an ‘economy of equivalence’ they ensure their own rapid demise. They have created numerous models, equations and diagrams that will ensure that everything can be exchanged and remain the same simultaneously. Their work appears to improve over time. Their economy of equivalence is increasingly perfect. Yet the ‘authors’ are the ones who are diminishing. They have not factored themselves into the process of equivalence. There is a constant expansion and contraction of relative ‘freedom’ within the workplace – use of non-monetary incentives and techniques to alleviate the boredom of work. Yet with the rise of ‘share-holder value’ (giving priority to the stock-market value of a corporation rather than old-school profit) we see an increasing fluctuation in the treatment of workers. Plundering the pension funds of companies and constantly shifting the responsibilities of the worker. Of course, the book starts from

115.

The State itself Becomes a Super Commune

the point when all these issues are over for the workers concerned. It is possible that a sub-text was the thought that their initial enthusiasm for flexible working techniques maybe contributed to the loss of their jobs in the first place, but it is not clear whether they are the architects of their own unemployment. Old questions of class struggle are initially difficult for them to focus upon and keep blurring, clarifying then shimmering away. As a result they shift the terms of engagement and use their applied theoretical work to try and restart and re-antagonise the relations of production. Their goal is to improve things and change the way we relate to the world. But of course their project leads to a diminution of their own capacity for clear thought. It is not obvious how successful or unsuccessful their thinking actually is, as their slow collapse makes it hard to tell where moments of judgement can take place. They have a strong desire to reject or transcend notions of flexibility without becoming repressive or fixed about social relations, so they try and focus much more carefully on the relation between things rather than people, which leads to a new urgency to reconstitute an understanding of class relations. Liam Gillick, Construcción de Uno: Preface, 2005


Fractional Factories in the Snow (Right Reading), 2008 Vinylbuchstaben vinyl text MaĂ&#x;e variabel dimensions variable

116.

Liam Gillick


117.

Ein langer Spaziergang... Zwei kurze Stege...*


Construcciรณn de Uno (a Prequel), 2006 VW Golf Typ I, Leinwand, Text, Soundtrack, 3 Schauspieler Volkswagen Golf Mark 1, screen, text, soundtrack, 3 actors Maร e variabel dimensions variable Installatinsansicht installation view Tate Triennial, Tate, London, 2006

118.

Liam Gillick


Diese Veranstaltung nimmt den noch nicht publizierten Text „Constucción de Uno“ vorweg, einen skizzenhaften Bericht des Künstlers über neue Beziehungen zwischen Produktion und Entwicklung. Der Text handelt von Arbeitern an einem nordeuropäischen Schauplatz, die sich zur Rückkehr in ihre geschlossene Fabrik entscheiden, um dort, an ihrem früheren Arbeitsplatz, eine Reihe von Eingriffen vorzunehmen. Die wichtigsten der Eingriffe führen zu einem als Prozess zu betrachtenden Versuch der Arbeiter, eine Ökonomie der Äquivalenz zu entwickeln, in der eine Einheit Input eine Einheit Output hervorbringt. Die erkennbare Logik ihrer Arbeit scheint im weiteren Verlauf des Buches anzuwachsen. Aber es scheint eine Illusion zu sein, hervorgerufen durch die Abnahme ihrer mentalen Fähigkeiten, je mehr sie der Eleganz ihres eigenen Systems zum Opfer fallen. Im Verlauf dieser Veranstaltung nähern sich drei Schauspieler einem in der alten Fabrik zurückgelassenen Automobil. Es ist der letzte übriggebliebene Zeuge der Produktion. Der letzte Wagen. Anfangs behandeln sie ihn mit Gleichgültigkeit, dann mit Vorsicht, schließlich mit Verachtung. Zuletzt wird er Ort der Unterhaltung. Warum bin ich zurückgekommen? Und warum du? Hab ich dich doch dabei ertappt zu tun, was ich vorhatte, ohne es mir überlegt zu haben. Ich dachte, du wärst heute Nacht nicht rausgegangen. Aktion: es gibt keine Sitze, das Publikum sucht sich seinen eigenen Platz aus im Raum. Liam Gillick, Korrespondenz mit Beatrix Ruf, London 2006

119.

Construcción de Uno

This event anticipates the forthcoming text “Construcción de Uno”, a narrative by the artist that outlines new relations between production and development. The text concerns a group of workers in a northern European location who chose to return to their closed factory and embark upon a series of interventions on the site. The most important of these leads to a process where they attempt to develop an economy of equivalence where one unit of input produces one unit of output. The apparent logic of their work appears to increase as the book progresses. Yet it may be an illusion caused by the reduction of their mental processes as they become entrapped by the elegance of their system. During this event 3 actors will approach an abandoned car sited in the old factory. It is the last remaining evidence of production. The last car. At first they treat it with indifference then caution and finally distain. In the end it becomes the site of a conversation. Why am I back here? Why have you returned too? Caught you doing what I had decided to do without really thinking it through. I thought you weren’t going out tonight. Action: there is no seating, the audience finds their own place in the space. Liam Gillick, Correspondence with Beatrix Ruf, London, 2006


theanyspacewhatever Signage System, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 50-teilig je ca. 50 elements each approximately 50 x 120 cm Installationsansicht installation view theanyspacewhatever, Guggenheim Museum, New York, 2008

120.

Liam Gillick


derwelcherplatzauchimmer rirkrit film dich selbst geschlechtsneutrale einrichtungen ein piano und schwarzer schnee ein museumsladen die falsche galerie eine fortführung halbwegs halbwegs vollendet vollendet zwischen szenarios kuckuck schutzgebiet mitten in der nacht mitten in der woche brief brief gebrieft tropismus früher bleib manchmal hier phänomenesk singuläre einrichtungen kollektive einrichtungen nieschon bis nochdann getitelt verschickt von jedem vielfältige zulassungen anheben angehoben rampen eins bis sechs rampen sechs bis eins

121.

theanyspacewhatever

münztelefon kabinen kalibrierter bildschirm dorthin dorthin hierher hierher die fortführung kalmar an uddevalla in der Mitte verankert eingeschränkte vorhersage stift nieder schlag fisch oder abgeschnittener köder betrüger beim lunch jetzt nicht dazwischenliegend betrunken vom feuerwehrschlauch meanderthal ausgang multifaulenzer tendenz gebannert gepostert rückwärts rennen kleiner platz kleiner platz mmmmmmmmmmmmm außen verdeck information hier außen information bücher und materialien start von oben herunter start von unten nach oben


Diese Seite this page theanyspacewhatever Signage System, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 50-teilig je ca. 50 elements each approximately 50 x 120 cm Installationsansicht installation view theanyspacewhatever, Guggenheim Museum, New York, 2008

122.

Liam Gillick

GegenĂźberliegende Seite facing page Audioguide Benches (with Philippe Parreno), 2008 farbige MDF-Platte dyed MDF 6-teilig je 6 elements each 50 x 240 x 480 cm Installationsansicht installation view theanyspacewhatever, Guggenheim Museum, New York, 2008


theanyspacewhatever rirkrit film yourself unisex facilities a piano and black snow a museum store the wrong gallery a continuation halfway halfway complete complete between scenarios cuckoo sanctuary in the middle of the night in the middle of the week poster poster posted tropicality sooner stay here sometimes phenomeniche singular facilities collective facilities no yet un still titled posted by everyone varied admissions elevate elevated ramps one to six ramps six to one

123.

theanyspacewhatever

payphone cabins calibrated screen that way that way this way this way the continuation kalmar to uddevalla middle grounded restricted projection pen down strike fish or cut bait deceptionist at lunch disintermediate now drunk from the firehose meanderthal exhibit multislacker tendency bannered postered running backwards small space small space mmmmmmmmmmmmm exterior canopy information here exterior information books and materials start from the top down start from the bottom up


Diese Seite this page Everything Good Goes, 2008 digitales Video „Red One“ digital video “Red One” Maße variabel dimensions variable Videostills video stills

124.

Liam Gillick

Gegenüberliegende Seite facing page Monument to Charles Fourier C, 2006 sandgestrahltes, gefrästes Aluminium, pulverbeschichtetes Aluminium sandblasted milled aluminium, powder-coated aluminium 120 x 120 x 120 cm Collection Musée des Beaux Arts et d’Archéologie, Besançon


Die Kamera schwenkt über den Tisch. Eine Person konstruiert am Computer ein digitales 3D-Model. Das Model ist die Salumi Fabrik aus dem Film „Tout va bien“ von Jean-Luc Godard und Pierre Gorin, fabriziert aus dem Gedächtnis. Stimme aus dem Off hinterlässt eine lange Nachricht auf dem Telefon. Dieser Text ist von der improvisiert gesprochenen Version abgeleitet. Es ist eine Nachricht an diejenigen, die den Film drehen, und deutet die Fragen an, die besprochen werden müssen. „Wir hängen in der Luft, es ist, als ob wir einen Moment einfangen wollen, vielleicht einen früheren Moment, vielleicht den Volvo-Moment, 17. Juni, Jahr 1974, wo der Blick von der Fabrik auf die Bäume fällt und wir intensiv darüber nachdenken, wie wir ein Arbeitsteam bilden können, und wir an unserem Glauben arbeiten, dass die Zukunft nur Gutes bringt, und alles wie eine Geschossbahn nach vorne weist.“ „Vielleicht ist es ein Zeichen von Überfluss, wenn man den Verlockungen von unbegrenzter Flexibilität nachspürt, denn denk daran, wir sind überflüssig an diesem Punkt der Geschichte, wir haben jede Menge Zeit. Die Fabrik, die gesamte Aktivitätsumwandlung hat bereits stattgefunden, erinnerst du dich? Vergangenheit, Gegenwart und Zukunft sind vorübergegangen. Jetzt müssen wir nur noch die Idee hervorheben – und das ist immer noch ein Phantom im Rahmen dieses diskursiven Projekts – wir müssen uns der Tatsache dieses Verlusts widmen, der Reduktion der Freizeit als Versprechen und Fixpunkt. Und jetzt lautet die Frage natürlich immer, wie willst du überhaupt wissen, wieviel Freizeit du hast?“ Liam Gillick, Everything Good Goes, 2008

125.

Godard and Gorin

Camera pans across desk. A person is building a 3D digital model on a computer. The model is the Salumi Factory from the film “Tout va bien” by Jean-Luc Godard and Pierre Gorin, constructed from memory. Voiceover, leaving a long message on the telephone. This text is derived from the improvised spoken version. It is a message to those shooting the film indicating the questions that need to be considered. “We are suspended, like we’re trying catch a moment, maybe an earlier moment, maybe it’s that Volvo moment, 17th of June, 1974, where the view from the factory is of the trees and we are thinking hard about the way to work together as a team, and working on a way to know that the future is going to work out just fine and everything is a trajectory.” “Maybe it’s redundancy following the lure of infinite flexibility, remember we’re redundant at this point in the story, we have got lots of time. The factory, the wholesale transferal of activity has already taken place, remember? Past, present and future have been passed on. Now, we still have to address the idea – and this is still a phantom in the framing of the discursive project – we have to address the fact of this loss, the reduction of leisure as a promise and a marker. And the question now of course is always how do you know how much leisure you are having?” Liam Gillick, Everything Good Goes, 2008


Leave me Alone, 2008 Plakat poster 50 x 40 cm Thoughts on Democracy, Wolfsonian Museum, Miami

126.

Liam Gillick


127.

Ein langer Spaziergang... Zwei kurze Stege...*


Three Perspectives and a Short Scenario, 2008 farbige MDF-Platte, Teppich, Apple Keynote, Vitrine, BĂźcher, Editionen, Plakate, Ausdrucke dyed MDF, carpet, Apple Keynote, vitrine, books, editions, posters, prints Installationsansicht installation view Witte de With, Rotterdam, 2008

128.

Liam Gillick


Jeder Schauplatz weist eine Reihe von Routen auf, eine konzipierte Architektur, die einen Weg durch den Raum vorgibt. Jeder Schauplatz hat einen Raum mit Leinwand. Der Vorführraum ist eine dunkle oder farbige Glasstruktur mit Teppich und einer frei stehenden grauen Projektionsfläche. Jede Passage oder Route bietet einen Blick nach Innen und nach Außen in die verschiedenen Bereiche der Ausstellung. Außerhalb des Vorführraums und der Korridore gelegene Zonen sind Bereiche der Institution, und die darin stattfindenden Aktivitäten oder die darin befindlichen Objekte unterliegen der Bestimmung durch die Institution. Das institutionelle Operationsfeld kann Diskussionsflächen, Bildungsbereiche, exklusive Mitgliederbereiche oder sogar eine Reihe von Ausstellungsplätzen für die Kunstwerke des Künstlers enthalten. Die Ausstellung umfasst demzufolge zwei Zonen, eine, die vom Künstler mit Bezug auf die Institution definiert ist, eine andere, die von der Institution mit Bezug auf den Künstler bespielt wird. Die Zone des Künstlers ist eine ,Route‘ zu einem Videoraum. Die institutionelle Zone ist von der ,Route‘ abgeschirmt und enthält zum Teil eine Reihe von Seminar-, Bildungs- und Arbeitsräumen oder Kunstwerken, die von der Institution in Bezug auf den Künstler ausgewählt wurden und zusammengenommen die Übersichtsfunktion erfüllen sollen. Also zwei Ebenen des Zugangs und der Aktivität, die eine vom Künstler, die andere von der Institution betrieben.

129.

Three Perspectives and a Short Scenario

Zuerst erstellt der Künstler für jede Station einen Plan, wie der Raum aufzuteilen ist. Einen Entwurf für das Korridorsystem, einen Videoraum, eine Dokumentation, die das Werk und Gelegenheitsgrafiken, Plakate, Pläne, Bücher und Projekte für Ausstellungen aufbereitet und auf einem großen Display-Tisch oder in einer Vitrine vorzeigt. Auf dem Weg zum Vorführraum fällt der Blick der Besucher durch bildschirmhaft perforierte Korridorwände hindurch auf den institutionellen Bereich. Für einige Ausstellungsbesucher stellt die Route lediglich einen Übergang von Film zu Film dar. Die Route ist aber auch ein Weg, einen Einblick in den Arbeitsablauf und die Kunstwerkauswahl der Institution zu gewinnen, ohne zwingend daran teilnehmen zu müssen. Die Benutzer der institutionellen Zone können außerdem die perforierten Zwischenwände dazu benutzen, Ausstellungsbesucher auf ihrem Weg zum Videoraum zu beobachten. Liam Gillick, Korrespondenz mit Nicolaus Schafhausen, Beatrix Ruf und Dominic Molon, 2007


Three Perspectives and a Short Scenario, 2008 farbige MDF-Platte, Teppich, Apple Keynote, Vitrine, Bßcher, Editionen, Plakate, Ausdrucke 50% der Ausstellung verschiedene andere kuratierte Institutsausstellungen dyed MDF, carpet, Apple Keynote, vitrine, books, editions, posters, prints various other exhibitions curated in institution’s 50% of the exhibition Installationsansicht installation view Witte de With, Rotterdam, 2008

130.

Liam Gillick


Each venue has a series of routes, a designed architecture that suggests a way through a space.

A documentary that reviews the work and ephemera, posters, plans, books and projects for display in a large display-table/vitrine.

Each venue has one screening space.

On the route to the screening room, visitors can look into the institutional zone through perforated corridor walls in the form of screens. For some exhibition visitors the route is merely a passageway to a film. The route is also a way to view the ongoing work or artwork choices of the institution but not necessarily take part in them. For users of the institutional zone, the perforated screen is also a way to view exhibition visitors on their way to the screening area.

Screening space is a dark or coloured glass structure with carpet and a free-standing grey screening surface. Each passage or route has a way to view into and out from the passage to the different zones of the exhibition. Zones exterior to the screening space and corridors are institutional zones and the activities or objects within are to be determined by the institution. The operation of the institutional zones can include discussion spaces, education spaces, membership spaces or even a series of sites for the display of artworks by the artist. The exhibition therefore comprises two zones, one defined by the artist in relation to the institution, the other determined by the institution in relation to the artist. The artist’s zone is a ‘route’ leading to a screening area. The institutional zone is screened off from the ‘route’ and partially reveals a series of seminar, education and activity rooms or works selected by the institution in relation to the artist in order to make the overview function. Two levels of access and activity, one operated by the artist and the other operated by the institution. Initially the artist provides each venue with a plan of how to designate space. A design for the corridor system; a screening area.

131.

Three Perspectives and a Short Scenario

Liam Gillick, Correspondence with Nicolaus Schafhausen, Beatrix Ruf and Dominic Molon, 2007


Three Perspectives and a Short Scenario, 2008 Mirrored Image: A Volvo Bar, 2008 gefärbte Jute, Holz, Vinylbuchstaben, Skript, Schauspieler dyed hessian, wood, vinyl texts, script, actors Installationsansicht installation view Kunstverein Mßnchen, 2008

132.

Liam Gillick


Der Raum ist eher in einen Ort der Produktion denn der Neubewertung verwandelt worden. Es handelt sich um das „Short Scenario“ des retrospektiven Projekts „Three Perspectives and a Short Scenario“. Die Ausstellung ist der Produktionsprozess eines Stücks, das für München geschrieben und unter dem Titel „Mirrored Image: A Volvo Bar“ inszeniert wurde. Bei der Arbeit mit einer Gruppe junger Schauspieler in einem Set wird ein Basistext entwickelt und in eine Reihe von Performances überführt, die dann während der Ausstellung gezeigt werden. Verschiedenartige Rollen aus den letzten zwanzig Jahren des Werks werden dabei auftauchen und neu entstandene Beziehungen zwischen ihnen sichtbar. Etliche Charaktere treffen sich in einer Bar neben einer Autofabrik. Franck ,Stairs‘, am Tag seiner eigenen Geburt – eine Anzahl Leute, die bekannt, aber aus dem Blickfeld verschwunden sind – eine Krise im Büro des Regisseurs – eine Gruppe, die in einen Gesprächsraum eingeschlossen ist. Ein Kollaps der Identität und ein kontingenter Gebrauch projizierter Selbstbildnisse. Eine präzise Struktur, die neue Absichtserklärungen enthält. Den Ausstellungsort als Bühne nutzend, auf der Phänomene der postindustriellen Gesellschaft auf- und ausgeführt werden, präsentiert die Ausstellung „Three Perspectives and a Short Scenario: Mirrored Image“ einen zentralen Aspekt des Werks: die Verhandlung von Modellen der Gemeinschaftlichkeit. Sie ist die Produktionskomponente eines retrospektiven Projekts. Liam Gillick, Korrespondenz mit Stefan Kalmár, 2008

133.

Three Perspectives and a Short Scenario

The space is turned into a place of production rather than reassessment. It is the “Short Scenario” of the retrospective project “Three Perspectives and a Short Scenario”. The exhibition is the process of producing a play written and directed for Munich titled “Mirrored Image: A Volvo Bar”. Working with a group of young actors within a set a basic text will be developed and reworked into a series of performances that will take place during the exhibition. Various characters from the last twenty years of the work will appear and new relationships will be exposed. A number of characters come together in a bar near to a car factory. Franck ‘Stairs’ – on the day of his own birth – a number of people who are familiar yet out of focus – a crisis in the director’s office – a group of people trapped in a discussion room. A collapse of identity and a contingent use of projected self-image. A precise structure that will contain new statements of intent. Adapting the exhibition space as stage on which phenomena of the post-industrial society are played out, the exhibition “Three Perspectives and a Short Scenario: Mirrored Image” presents a core aspect in the work: negotiating models of communality. It is the production component of a retrospective project. Liam Gillick, Correspondence with Stefan Kalmár, 2008


Three Perspectives and a Short Scenario, 2008 farbige MDF-Platte, Teppich, Apple Keynote, Vitrine, Bücher, Editionen, Plakate, Ausdrucke 50% der Institutsausstellung früherer Arbeiten durch die Kunsthallenmitarbeiter dyed MDF, carpet, Apple Keynote, vitrine, books, editions, posters, prints restaging of early work by Kunsthalle staff in institution’s 50% of the exhibition Installationsansicht installation view Kunsthalle Zürich, 2008

134.

Liam Gillick


Sie gingen einer hinter dem anderen. Es war kälter geworden. Man hatte heute das Gefühl, dass Tauwetter kommt, in der Ferne lag ein großes Gebäude. Licht war zu sehen, das aus Lücken in der Struktur nach außen fiel. Als Fenster konnte man die Lücken nicht bezeichnen. Die vorherige Klarheit der Struktur war durch neue Öffnungen getrübt worden, die in unregelmäßigen Abständen in alle Außenflächen des Gebäudes geschnitten waren. Die wahre Größe der Struktur war nur schwer auszumachen. Bevor man nah an das Gebäude herankommen war, ließ sie sich kaum bestimmen. Die umgebende Landschaft hielt keine Markierungen bereit. Nichts war vorhanden, womit man Umfang oder Höhe hätte bemessen können. Die drei Leute setzten ihren Spaziergang fort. Es gab nichts zu bereden. Wir folgen ihnen. Und mit der Zeit geben sie eine Art Maßstab ab. Die wahre Masse des Gebäudes zeigte sich bald von selbst. Ebenso, dass die Schlitze in den Fassaden störend und überdimensioniert sind. Große Risse und grobe Löcher. Doch die Struktur ist erhalten geblieben. Hastig perforiert. Wie sich jetzt zeigt, bewegen sich im Innern langsam Leute. Keiner reagierte auf das Näherkommen der drei. Jeder war an den Gedanken an neue Besucher gewöhnt. Langsam durch den Schnee gehen. Jetzt im Gebäude. Da sind noch die Reste eines Fließbandes. Die Leute, die sich auf dem Gelände hin und her bewegen, arbeiteten hart. Doch nutzen sie das Gelände weniger als Produktionsort, sondern demontieren alles sehr methodisch. Hübsche Stapel mit Maschinenteilen. Haufen mit Rohrleitungen und Kabelkanälen. Fässer mit Kühlmittel, Schmierstoffen und Maschinenöl. In der Mitte klaffte jetzt eine leer geräumte Fläche. Improvisierte Bestuhlung. An langen Tischen. Und tief hängende Beleuchtung. Um diesen Bereich herum waren große Leinwände aufgebaut. Liam Gillick, aus: Three Perspectives and a Short Scenario, 2008

135.

Three Perspectives and a Short Scenario

They walked one behind the other. It has been colder. Today there was the sense that a thaw was coming, in the distance was a large building. Light could be seen from gaps in the structure. You couldn’t describe the gaps as windows. The prior clarity of the structure had been disturbed by new openings cut at irregular intervals across each face of the building. The true scale of the structure was hard to read. Until you came close, the building was hard to define. The surrounding landscape held no markers. Nothing existed in order to judge scale or size. The three people kept walking. There was nothing to talk about during this long trek. We follow them as they walk. And over time they provide a sense of scale. The true mass of the building soon revealed itself. The size of the cuts in its facade now troubling and excessive. Great tears and raw holes breaking through. Yet the structure remained. Perforated in haste. Revealing now people moving slowly inside. No-one reacting to the approach of the three. Everyone used to the idea of some new arrivals. Walking slowly through the snow. Now inside the building. There are traces of a production line. The people moving around the space are hard at work. Yet rather than using the place as a site of production, they are methodically dismantling everything. Neat piles of machine parts. Stacks of piping and conduit. Barrels of coolant, lubricant and machine oil. In the centre now there was a clear space. Seating had been improvised. Along with large tables. And low slung lighting. Surrounding this area, large screens had been erected. Liam Gillick, from Three Perspectives and a Short Scenario, 2008


Three Perspectives and a Short Scenario, 2008 farbige MDF-Platte, Teppich, Apple Keynote, Vitrine, Bücher, Editionen, Plakate, Ausdrucke 50% der Institutsausstellung früherer Arbeiten durch die Kunsthallenmitarbeiter dyed MDF, carpet, Apple Keynote, vitrine, books, editions, posters, prints restaging of early work by Kunsthalle staff in institution’s 50% of the exhibition Installationsansicht installation view Kunsthalle Zürich, 2008

136.

Liam Gillick


READ TITLE OUT LOUD Significant Places: Abo 1930 1990 BUY BIKER MAGS, SELECT IMAGES AND PIN ON WALL Hog-Bike Corner Wall Piece 1992 Copies of Hog-bike magazine or other sub-culture motorbike magazine and drawing pins. Instruction certificate printed onto Ingres paper. MAKE COCKTAIL Painted Humiliation Cocktail (with Angela Bulloch) 1993 One glass, three parts Irish Whiskey, printed text. FELT TO BE CUT A DAY WITH NO SUN IS NIGHT 2001 (dyed felt, cuts) etc. Liam Gillick, List of works recreated at Kunsthalle Zurich, 2008

137.

Three Perspectives and a Short Scenario


Three Perspectives and a Short Scenario, 2009 farbige MDF-Platte, Teppich, Apple Keynote, Vitrine, Bßcher, Editionen, Plakate, Ausdrucke 50% der Ausstellung Installation der Plexiglasdecke dyed MDF, carpet, Apple Keynote, vitrine, books, editions, posters, prints installation of Plexiglas ceiling in institution’s 50% of the exhibition Installationsansicht installation view Museum of Contemporary Art, Chicago, 2009

138.

Liam Gillick


Textschichten wurden sorgfältig von der Wand entfernt. Jeder Abtrag förderte eine verborgene Schicht zu Tage. Papiere wurden gestapelt und archiviert. Sorgfältig ausgearbeitete Indizes wurden erstellt. Jeder verhielt sich offen und wohlwollend. Die Besucher wurden irgendwann dabei angetroffen, wie sie im Schatten herumstöberten. Anfänglich erzeugte das keine Bedenken. Aber ein oder zwei waren verdächtig. Allerdings ließ sich nicht herausfinden, was sie vorhatten. Nach zwei oder drei Monaten wurde die Arbeit an der Wiederherstellung eines computerkontrollierten Schweißgerätes aufgenommen. Dieses fand dann seinen Platz in der Lackiererei, die einige Wochen vorher fertiggestellt worden war. Auch eine ganze Wand der früheren Fabrik war restauriert worden. Unter großem Einsatz war die Fassade nachgebaut worden. Der Einsatz forderte seine Opfer. Und einige Leute starben vorzeitig. Andere waren geschwächt. Doch der kollektive Wunsch, das fertige Werk vorzuführen, weckte erneut die Kräfte. Eine neue einfache fett- und kohlehydrathaltige Diät wurde eingeführt. Das machte die Arbeiter für eine Weile glücklich. Sie nahmen zu. So wie die Geschwindigkeit der Sanierung. Die Leute fühlten sich jetzt ermutigt, Rechenschaft über ihre Arbeit abzulegen. Komplexe Beziehungen zwischen ihnen gerieten in Vergessenheit. Alles hatte jetzt seinen rationalen Zweck. Der Tod wurde in zunehmendem Maße alltäglich. Die Geschwindigkeit des Wiederaufbaus nahm weiter zu. Das Archiv ging in einem Feuer verloren. Der Diskussionsprozess wurde aufgegeben. Die Arbeit war fast vollendet. Die drei inspizierten das Werk. Sie waren zufrieden mit der instand gesetzten Fabrikanlage. Sauber und klar. Früh am letzten Abend. Der letzte der wenigen. Wir standen vor dem Schmelzer. Und wussten nicht mehr was tun … Rutschten in die Schmelze. Liam Gillick, aus: Three Perspectives and a Short Scenario, 2008

139.

Three Perspectives and a Short Scenario

Layers of text were carefully cleaned from the walls. Each removal revealing a hidden layer beneath. Papers were stacked and archived. Carefully constructed indexes were produced. Everyone was open and generous. The visitors would sometime be found searching through the shadows. Initially this was of no concern. But one or two were suspicious. Yet couldn’t find any focus for their concerns. After two or three months work began on reconstructing a computer controlled welding machine. This now joined the paint shop that had been completed a few weeks earlier. One complete wall of the former factory had also been restored. At great effort the facade had been recreated. The effort took its toll. And people died prematurely. Others were weak. But the collective desire to show the work achieved led to renewed efforts. A new simple high fat and high carbohydrate diet was introduced. Leaving the workers happy for a while. Weight increased. And so did the pace of reconstruction. People were now encouraged to account for their work. Complex relationships were forgotten. Everything now had a rational aim. Death was increasingly common. The rate of reconstruction increased. The archive was lost in a fire. The process of explanation abandoned. The work was nearly complete. The three surveyed the work. They were happy with the reinstated plant. Clean and clear. Early on the last evening. The last of the few. We’re lined up by the smelter. And no longer knowing what to do... Slipped into the melt. Liam Gillick, from Three Perspectives and a Short Scenario, 2008


onehundredandninetytwofeet, 2008 Plakat poster 100 x 60 cm Roundel Centenary Poster London Underground

140.

Liam Gillick


141.

Ein langer Spaziergang... Zwei kurze Stege...*


David (Calender and Location Shoot), 1999 12 Fotografien 12 photographs 6 je/each 21 x 29 cm 6 je/each 29,7 x 42 cm Städtische Galerie im Lenbachhaus Mßnchen

142.

Liam Gillick


Die Publikation dieses Kalenders fällt zusammen mit der Ausstellung von Liam Gillick im Kunsthaus Glarus zwischen dem 27. Juni und 29. August 1999. Die Bilder stammen aus der Arbeit „Pain in a Building/ Schmerz in einem Gebäude/Douleur dans un immeuble“. 80 Dias und 4 Tonspuren von einer Ortsaufnahme für einen möglichen Film, der von Liam Gillick und Thomas Mulcaire noch geschrieben werden muss. Regie in diesem Film wird Philippe Parreno führen, produzieren wird ihn Anna Sanders Films, Paris. Die Bilder sind in Thamesmead South London entstanden, einem Viertel in Londons Südosten. Der Bau von Thamesmead ist in den späten 1960er Jahren begonnen worden und diente als Drehort für den Film „Clockwork Orange“ (Stanley Kubrick, 1971). Der Film wurde nach einer nur kurzen Spielzeit aus dem Leihverkehr in Großbritannien zurückgezogen. Er war beunruhigt, dass die im Film gezeigte Sicht auf Großbritannien, Gewalt und sozialem Unfrieden Vorschub leisten würde. Es ist nach wie vor unmöglich, „Clockwork Orange“ in Großbritannien zu sehen oder als Video zu kaufen. Liam Gillick, Notizen zu: Glarus Calender, London 1999

143.

Specific Locations

This calender is published to coincide with the exhibition of Liam Gillick at the Kunsthaus Glarus between June 27th 1999 and August 29th 1999. The images are taken from the work “Pain in a Building/ Schmerz in einem Gebäude/Douleur dans un immeuble”. 80 slides and 4 soundtracks from a location shoot for a potential movie to be written by Liam Gillick and Thomas Mulcaire. The film will be directed by Philippe Parreno and produced by Anna Sanders Films, Paris. The images were taken at Thamesmead in South London, an overspill town to the south east of London. The construction of Thamesmead began in the late 1960s and formed the location for the film “Clockwork Orange” (Stanley Kubrick, 1971). The film was pulled from distribution in Britain after only a short release period. He was concerned that the vision of Britain that the film portrayed would encourage violence and social unrest. It remains impossible to see Clockwork Orange or buy it on video in Britain. Liam Gillick, Notes for Glarus Calender, London, 1999


Diese Seite this page Es una clase muy pobre de memoria que sólo funciona hacia atrás, 2006 Leuchtkasten lightbox Maße variabel dimensions variable Installationsansicht installation view Berlin 38 Ludlow (with Ethan Breckenridge), 2008 Außenansicht Galerie storefront gallery Ludlow Street, New York, 2008

144.

Liam Gillick

Gegenüberliegende Seite facing page It’s a Poor Sort of Memory that only Runs Backwards, 2006 Iris Druck iris print 101 x 76 cm Shattered Factories in the Snow, 2008 Tintenstrahldruck inkjet print 101 x 76 cm


Gran Centro de Conferencias

Gran Centro de Conferencias

Großes Konferenzzentrum

Big Conference Centre

Es una clase muy pobre de memoria que sólo funciona hacia atrás.

Es una clase muy pobre de memoria que sólo funciona hacia atrás.

Das ist eine armselige Art von Erinnerung, die nur rückwärts läuft

Its a poor sort of memory that only runs backwards

Fragmentos de Historias Futuras

Fragmentos de Historias Futuras

Fragmente zukünftiger Geschichten

Fragments of Future Histories

Las puertas del edificio de administración han quedado abiertas.

Las puertas del edificio de administración han quedado abiertas.

Die Türen zum Verwaltungsgebäude sind offen gelassen worden

The doors to the administration building have been left open

Liam Gillick, New York 2006

Liam Gillick, New York, 2006

145.

Specific Locations


Diese Seite this page Something just Fell from the Sky, 2003 Vinylbuchstaben vinyl text Maße variabel dimensions variable Installationsansicht installation view Sammlung Museum Ludwig, Köln Allocated Table, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 50 x 50 x 50 cm

146.

Liam Gillick

Gegenüberliegende Seite facing page GTI, 2009 bemaltes Metall, Toilettenpapier painted metal, toilet rolls 200 x 20 x 5 cm Guide, 2004 Siebdrucke silk-screen prints 118 x 84 cm Collection Museum of Modern Art, New York


Eine Frau sitzt allein an der Bar auf der anderen Straßenseite. Neben ihr schläft ein Mann, während sein Telefon läutet. Etwas entfernt sitzen drei Leute beieinander, während die Frau den Kopf hängen lässt und immer kleinere Kreise mit ihrem Finger auf den nassen Holztresen malt. Die Leute, die in der Bar arbeiten, müssen nach unten treten, um zu bedienen. Alle anderen sitzen am Tresen. Die Leute, die an der Bar arbeiten, stehen, doch befinden sich ihre Köpfe in derselben Höhe wie die der sitzenden Gäste. Der Boden der Bar ist tiefer gelegen als der Boden des restlichen Raumes. Ja, die Barmänner befinden sich exakt in der richtigen Höhe, um alle zu bedienen, die an der Bar sitzen, in Relation zum ganzen Raum gesehen aber in der falschen. Extrem klein, dafür mit perfekt proportionierten Köpfen. Die Frau, die an der Bar sitzt, ist sternhagelvoll und ihr Kleid ist aus künstlichen Fasern gemacht. Sie dreht sich um, während sie einen halblangen Metalllöffel hochhält, den sie in Richtung der drei Leute schleudert, die auf der anderen Seite des Raums sitzen. Diese spüren den Luftzug, als er an ihnen vorbeifliegt, um hinter ihnen klirrend gegen die hölzerne Verkleidung der Wand zu krachen. Natürlich ist es manchmal besser so zu tun, als fiele etwas vom Himmel.

A woman sits alone at the bar across the street. Close by, a man is sleeping while his telephone rings. Three people sit together some distance away while the woman nods forward and draws increasingly small circles with her finger on the wet wood of the bar. The people working in the bar have to step down to serve you. Everyone else sits at the counter. The people working at the bar are standing yet their heads are at the same height as the seated patrons. The floor area of the bar is lower than the floor area of the rest of the place. Yes, the bar men are situated at exactly the right height to deal with everyone sitting at the bar, but the wrong height when viewed in relation to the room as a whole. Super short, but with perfectly proportioned heads. The woman sitting at the bar is completely and utterly drunk and her dress is made out of artificial fibres. She turns while holding a medium-sized metal spoon which she hurls towards the three people sitting across the room. And they feel the rush as it tumbles past them towards some clanking against the wooden panelling of the wall. Of course sometimes it is better to act as if something just fell from the sky. Liam Gillick, Literally No Place, London, 2002

Liam Gillick, Literally No Place, London 2002

147.

Specific Locations


Diese Seite this page Multiplied Discussion Structure, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 50 x 50 x 200 cm Edition Schellmann Schellmann Shelf, 2008 pulverbeschichtetes Aluminium powder-coated aluminium jedes Teil each element 15 x 100 x 25 cm Edition Schellmann

Swiss Architectural Award, 2008 polierter, rostfreier Stahl polished stainless steel 20 x 10 x 10 cm BSI Art Collection, Lugano

148.

Liam Gillick

Gegenüberliegende Seite facing page unitednationsplaza, 2006 Farbe paint Maße variabel size variable Platz der Vereinten Nationen, Berlin The Day before (You Know what they’ll Call it, they’ll Call it the Tube), 2006 Offsetlithodruck offset lithographic print Standard London Underground Map


Der Punkt wird sein, wie man einen Punkt aussucht und daran festhält. Das Aufkommen inhaltsschwangerer Diskussionen scheint für alle Projekte bezeichnend zu sein, das hat uns viel Zeit verschafft, uns selbst zu entschuldigen, uns zu qualifizieren, uns von einigen konkreten Punkten wegzubewegen. Das hier ist nun der Versuch, das Wagnis einzugehen, zu bestimmten Punkten zu gelangen. Was wir untersuchen müssen, ist die Spannung innerhalb des entfremdeten Status des Erkenntnissuchenden – die sensibilisierte Rolle des mitfühlenden Akkumulatoren, der sich mit den höchstverwickelten, überkreuzenden strukturellen Effekten konfrontiert sieht, die aus der Sorge um ,das Selbst‘ resultieren. Es ist notwendig, auf einige Streitpunkte einzugehen, die die Beziehung von strukturellen Fragen und wirklicher Aktivität betreffen. Doch kommt es immer wieder zu einem Griff nach einem letzten Strohhalm Qualität. Sind wir in Strukturen der jüngsten Vergangenheit gefangen, von denen nie vermutet wurde, dass sie als Modell für irgendetwas taugen? Sind einige der Strukturen, die wir in unserer Eigenschaft als kulturelle Produzenten nutzen, eigentlich Echos einer Vergangenheit, die in Wahrheit Teil eines kontingenten Sets von Handlungssituationen waren, in denen versucht wurde, mit dem Vermächtnis eines Nachkriegssozialprojekts umzugehen?

The point will be to try and stick to a point. The rise of content heavy discussions alongside every project, seems very significant, it has given us a lot of time to excuse ourselves; to qualify ourselves; to move away from some specific points. And this is an attempt to try and get to certain points. What we have to examine is the tension within the alienated position of the knowledge seeker – the sensitized role of the empathetic accumulator facing the excessively implicated cross-structural effects that result from taking care of ‘the self’. It is necessary to look at some issues about structural questions in relation to actual activity. But there’s a certain grasping at straws quality. Are we in thrall to structures of the recent past that were not supposed to be a model for anything? Are some of the structures that we use, as cultural producers, actually echoes of a past, that were actually part of a contingent set of circumstances that were trying to deal with a legacy of a post war social project?

Liam Gillick, 1. Vortragstag: unitednationsplaza, 2006

Liam Gillick, unitednationsplaza, lecture day 1, 2006

149.

Specific Locations

Despite what we are told, and despite what we produce in a certain way, there remain old relationships of production, it’s just we are maybe increasingly alienated from them, that maybe old discussions about certain struggles and ideas, still exist, it’s just they are not right underneath our noses anymore.


Diese Seite this page Stacked Revision Structure, 2005 pulverbeschichtetes Aluminium powder-coated aluminium 360 x 360 x 360 cm Collection Albright-Knox Art Gallery, Buffalo, NY, George B. & Jenny R. Mathews Fund, 2005 Grouped on an Old Production Line, 2007 poliertes Aluminium polished aluminium 60-teilig jeweils 60 elements each 200 x 15 x 3 cm Collection Albright-Knox Art Gallery, Buffalo, NY, Albert H. Tracy Fund, Gift of Mrs. George A. Forman, by exchange and Charles W. Goodyear Fund, 2008

150.

Liam Gillick

GegenĂźberliegende Seite facing page Expanded Production Horizon, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 6-teilig je 6 elements each 150 x 150 x 4 cm Collection Albright Knox Art Gallery, Buffalo


Ein großer frei stehender Kubus, vor etwas platziert, das ursprünglich einmal die Front der Albright-Knox Art Gallery in Buffalo, NY, war. Als Gordon Bunshafts moderner Anbau an das Museum 1962 fertiggestellt wurde, war gleichzeitig der Haupteingangsbereich auf die Stadtseite des Gebäudes verlegt worden, weg von den Parkanlagen, die jetzt durch das Museum abgeschirmt erscheinen. Eine Reihe modern bemalter Metallskulpturen ist vor der ,neuen‘ Front des Museums mit der Vorderseite Richtung Straße platziert worden. Für die Ausstellung „Extreme Abstraction“ wurde eine neue Arbeit in Auftrag gegeben, die sich diesen älteren Arbeiten zugesellen sollte. Es wurde entschieden, sich erneut mit der vormaligen Hauptansicht des Gebäudes auseinanderzusetzen und eine komplex konstruierte Kubenstruktur in die Sichtachse zwischen Originalgebäude und Bunshafts Anbau zu setzen. Der Titel spielt auf eine Überprüfung von nominell der Mitte zugerechneten Streitfragen sozialer und politischer Repräsentation an, und zwar im Hinblick darauf, wie diese innerhalb einer postkonsensualen Kultur kontrolliert werden. Liam Gillick, Factories in the Snow, Zürich 2006

151.

Specific Locations

A large free-standing cube located at what was originally the front of the Albright-Knox Art Gallery in Buffalo, NY. When Gordon Bunshaft’s modernist addition to the museum was completed in 1962 the main entrance was shifted to the city side of the building and away from the parklands, which now seem shielded by the museum. A number of modernist painted metal sculptures are located at the ‘new’ front of the museum, facing the road. For the exhibition “Extreme Abstraction” a new work was commissioned to join these older works. It was decided to re-engage with the former façade of the building and place a complex constructed cube structure in a visual space between the original building and Bunshaft’s addition. The title alludes to an examination of notionally middle-ground issues of social and political representation as they are controlled within a post-consensus culture. Liam Gillick, Factories in the Snow, Zurich, 2006


Discussion Island Placement, 2009 Ausdrucke für Einmalplatzierung printed paper disposable placement 42 x 29,7 cm MAK Museum für Angewandte Kunst, Wien

152.

Liam Gillick


153.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page Closure of a Plant, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Collection Jumex, Mexico Realigned Production, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 40-teilig je 40 elements each 100 x 15 x 3 cm Sammlung Ringier, ZĂźrich

154.

Liam Gillick

GegenĂźberliegende Seite facing page Received Wall Structure, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 10-teilig je 10 elements each 200 x 15 x 3 cm Collection Torello, Spain Reimaged Projection pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm


Wie sehr du es auch immer versuchst, es ist immer schon Morgen. Und jetzt passiert es wieder. Auf der anderen Seite der Stadt hat sich ein Trauma über den persönlichen Austausch gelegt. Irgendetwas Eigenwilliges, Resolutes hatte die Abenddämmerung durchdrungen. Schmerz und Leiden in einem Gebäude. Wir nannten es alle „The Big Conference Centre“. Vermutlich trug es einen anderen Namen zu Ehren von jemandem, auf den man sich mit Mühe geeinigt hatte, doch für uns war es schlicht „The Big Conference Centre“. Und ganz oben war ein Raum. 21. Stock. Groß, luftig und mit einer Scheindecke. Fenster bis zum Boden. Verkleidet mit schallschluckendem Teppich. Hier oben, vorgestern, hat es schließlich jemand getan. Verloren an diesem Platz, gefangen und allein, waren sie wiederholt mit voller Wucht gegen das verstärkte Glas dieses bestgelegenen Raums gerannt. Auf kleinere persönliche Schäden wie Prellungen und abgebrochene Zähne konnte keine Rücksicht genommen werden im unstillbaren Drang nach frischer Luft und dramatischer Abwesenheit. Soweit man feststellen kann, benötigte er schließlich zehn Versuche. Immer schneller bei jedem neuen armrudernden Anlauf. Hart und entschlossen atmend. Und dann, beim 11. Aufprall, gab das Glas den Weg frei. Ein Auseinanderbrechen und Nachgeben, auf das ein brutaler Durchbruch und Momente der Schwerelosigkeit auf dem Weg zum physikalischen Chaos unten folgten. Anfänglich vom wiederholten Aufprall gegen das Fenster noch betäubt, kam unser Crasher auf dem halben Weg nach unten zu einer neuen Form von Bewusstsein. Das Betonpflaster blieb da, wo es war, und bewegte sich nicht nach oben auf ihn zu und auf sein Lächeln. Na gut, sagten sie, es war so etwas wie ein Grinsen, obwohl sich kein Schwein sicher sein kann bei so einem planierten, im Dach eines Toyotas steckenden Gesicht. Liam Gillick, Discussion Island/Big Conference Centre, 1998

155.

Projections and Revisions

However hard you try it’s always tomorrow. And now it’s here again. Across the other side of town trauma had overwhelmed personal exchange. Something self-willed and determined had cut through the dusk. Pain in a building. We all called it “The Big Conference Centre”. It probably had another name in honour of somebody seriously compromised, but to us it was just “The Big Conference Centre”. And up on top there was a room. Twenty-second floor. Big, airy and false ceilinged. Windows down to the floor. Clad in silencing carpet. Up there, the day before yesterday, someone had finally done it. Lost in the place, caught and alone, they had repeatedly run full pelt against the reinforced glass of that best top room. Minor personal damage like bruising and broken teeth must have gone unnoticed in the repetitive drive for fresh air and dramatic absence. As far as anyone can make out he needed at least ten attempts. Moving faster and faster with each flailing run-up. Breathing hard and determined. And then on the eleventh impact, the glass gave way. Crashing open and falling away to allow brutal passage and moments of weightlessness on the way to physical chaos below. Numbed initially from the repeated window impact, our crasher came to a new form of consciousness half way down. The pavement concrete stayed where it was and didn’t move up to meet him and his smile. Well, they said it was like a grin although fuck knows how anyone could be sure with a flattened face buried in the top of a Toyota like that. Liam Gillick, Discussion Island/Big Conference Centre, 1998


Diese Seite this page Reiterated Negotiation, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 10-teilig je 10 elements each 200 x 15 x 3 cm Collection Carreras Mugica, Spain Single Production Line, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Collection Vanwalleghem, Berchem

156.

Liam Gillick

Gegenüberliegende Seite facing page Literally No Place, 2000 Installationsansicht installation view Liam Gillicks Literally No Place, Air de Paris, Paris, 2000 Literally No System, 2000 eingefärbtes Glas, teilweise verkabeltes Hi-Fi-System, antistatische Füße, Holz tinted glass, partly stripped hi-fi system, anti-shock feet, wood Maße variabel dimensions variable private collection, Paris


Wir sind in einer Situation, die irgendwie reduziert und notwendigerweise verwirrend erscheint. Sie sind darauf zurückgekommen, etwas zu versuchen und neu zu schaffen, haben ohne Zögern ihre gewohnten Abläufe wieder angefahren, haben einmal mehr mit irgendeiner Projektion für einen leergefegten Platz oder einen neuen Ort losgelegt. Um der Idee einer Kommune habhaft zu werden, einer funktionalen, rationalistischen Kommune, die wirklich arbeiten und produktiv sein kann. Die zu funktionieren versucht, ohne in gewisse Fallen zu treten. Die eine halb-autonome Beziehung zur Außenwelt beibehält, um eine Aussage darüber treffen zu können, was überhaupt möglich ist. Die ganze Zeit über, in der sie involviert waren, fehlte etwas und war eine Stufe des Spiels vermieden worden. Während der ganzen Zeit war das Testen und Ausprobieren die Wurzel ihres Engagements, jetzt aber wollten sie auch die Momente erfassen, die unter den Teppich gekehrt worden waren. Und nach ein paar Tagen draußen hatten sie sich eine neue Art nüchternen Austauschs angeeignet. Spiele und Stück gewannen Form als zwar wirre, aber geschliffene Diskurse. Jetzt wollten sie zurückgehen und sich revanchieren. Sich selbst einschließen und wenig reden und wenig zuhören. Wieder durch die Tore einziehen, diesmal aber, um einige Tauschmodelle zu offerieren, die über die dynamische Selbstgenügsamkeit des Geländes hinausdrängen. Anschluss finden und Wühlarbeit leisten in ein paar Systemen, die bezwungen worden waren, nur um durch ihren Eifer zu beweisen, dass ihr Parallelsystem funktionieren könnte. Funktion, das war nicht ihr Langzeitproblem. Die Produktion von Ideen erlahmte und ermüdete unter dem Gewicht der Selbstrechtfertigung. Sie waren nicht bereit für die Subkultur, sondern für etwas Komplizierteres, Entspannenderes, Zurückhaltenderes. Liam Gillick, Literally No Place, London 2002

157.

Projections and Revisions

We are in a situation that is somehow reduced and is certainly distracted. They have returned to try and recreate something, jump start their procedures, get going once more with some projection of a rinsed place or new location. To catch the idea of a commune, a functional rationalist commune that can really work and be productive. Trying to function without falling into certain traps. Retaining a semiautonomous relationship to the outside world in order to make a point about what might be possible. For all the time that they had been involved, something had been missed and a degree of play had been avoided. At all times testing and checking had been the root of their involvement, but now they also wanted to catch the moments that had been glossed over. And after a few days outside they had picked up a new form of dry exchange. Games and play taking form as distracted yet sharpened discourse. Now they wanted to go back and return some favours. Lock themselves down with less talk and less listening. Go in through the gates again but this time to offer some models for exchange that slide beyond the dynamic contentment of the compound. Tie up and root around in some systems that had been subjugated by their eagerness to merely prove their parallel system could work. Function was not the long-term problem. The production of ideas was flagging and weakening under the weight of self-justification. They were not ready to be subcultural, but something more complicated, more relaxing, more diffident. Liam Gillick, Literally No Place, London, 2002


Diese Seite this page 1983, 2004 bemaltes und bedrucktes Aluminium painted and printed aluminium 100 x 100 x 100 cm Extended Production Black, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Sammlung Siegfried und Jutta Weishaupt

158.

Liam Gillick

GegenĂźberliegende Seite facing page Resisted Production, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Collection Barbara and Jules Farber, Trets Communal Wall Structure, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Collection Gilles, Belgium


Unsere Gruppe von Leuten hatte sich zusammengefunden, ging und kam zurück, um diese erneuerte Gemeinschaft wieder zu besuchen, und sie alle sind ausschließlich Nachkriegsgeborene. Eines jeden Krieges, ob erklärt oder nicht. Sie sind es seit dem Moment, wo die Leute in Aktion begriffen waren, bevor der Lernprozess eine Chance hatte, Wurzeln zu schlagen. Sie sind Leute, die zurückgekommen sind. Leute, deren Bildung unterbrochen worden ist. Leute, die aus dem einen oder anderen Grund stark involviert waren. Und wir greifen sie auf, bevor sie Zeit zur Reflektion gehabt haben, aber doch in Momenten des kontinuierlichen Wiederaufbaus. Aus diesem Grunde wird die Ernsthaftigkeit ihrer weiteren Aktionen zerbrechen, sobald sie zur Kommune zurückkehren. Das ist eine Gruppe von Leuten, die sich leicht in der Zeit transferieren lässt, wobei sie sich laufend spaltet und wiedervereinigt mit dem Ziel, eine funktionale Beziehung wiederherzustellen. Sie verspüren einen leichten Forschungsdrang. Einen Drang, herbeizukommen und irgendwie einen Ort zu entwerfen, wo sie sowohl kontrolliert als auch frei sein können. Wo ihr Gefühl für Ethik und ihr Gewissen kollektiviert werden kann, wo sie beides: zusammengebracht und sanft voneinander getrennt werden können. Sie wollen in Gemeinschaft leben, ohne kommunistisch zu sein – eine sehr präzise Unterscheidung. Sie wollen das Wesen ihrer Gemeinschaft kennen, ohne sich einer essentialistischen Logik als Vehikel ihrer Komplexität zu bedienen. Liam Gillick, Literally No Place, London 2002

159.

Projections and Revisions

Our group of people had joined together, left and then returned in order to revisit this renewed community and they are absolutely post-war people. Any war, declared or not. They are from the moment when people were involved in action before the learning process had a chance to take root. They are people who have come back. People who have had an interrupted education. They are people who have been deeply involved, for one reason or another, and we are catching them before they have had time to reflect but during moments of continual reconstruction. For that reason the seriousness of their future actions will shatter once they return to the commune. This is a group of people who can easily be transferred in time, continually spinning off and rejoining towards the rebuilding of a functional relationship. They have a soft research necessity. A need to come and somehow project a place where they can be both controlled and free. Where their sense of ethics and conscience can be collectivised, where they can be both pulled together and gently teased apart. They want to be communal without being communistic – a very precise distinction. They want to know the nature of their community without employing an essentialist logic as a carrier of their complexity. Liam Gillick, Literally No Place, London, 2002


Diese Seite this page Refined Collectivity, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Collection of Marilyn and Larry Fields, Chicago

GegenĂźberliegende Seite facing page Filtered Reduction, 2006 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas jedes Teil each element 50 x 120 x 10 cm Collection Rot, Antwerp

Final Reduction, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 28-teilig je 28 elements each 200 x 15 x 3 cm

Mannered Agreement, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas zwei Teile je two elements each 50 x 120 x 10 cm

160.

Liam Gillick


Am großen französischen Fenster, das an der Südseite des Raumes vom Boden bis zur Decke reichte, war das Holz heller, ohne dass ein Grund dafür ersichtlich gewesen wäre. Mag sein, dass dies das Resultat des täglichen Sonnenlichts war, das durch die gewellten Scheiben des Fensters fiel, oder dass es am mangelnden Verkehr in einem kaum betretenen Bereich lag. Aber selbst dann war dieser Platz vor dem vom Boden bis zur Decke reichenden Fenster vielleicht Zeuge von öfterem nervösen Herumstehen geworden als der Rest des Raumes. Vielleicht von heftigerer Bewegung. Vielleicht von weniger heftiger. Die Fenster könnten Zugang auf einen häufig benutzten Balkon gewährt haben. Unwahrscheinlich. Vorausgesetzt, das Haus stand in einer gemäßigten Klimazone, könnte unbeständiges Wetter der öfteren Benutzung eines Balkons, eines Dachgartens oder einer Terrasse entgegengestanden haben. Der Balkon diente dazu, den Anblick des Hauses von außen zu verschönern, war nicht für den wohltätigen Nutzen der Insassen gedacht. Ein vorläufiger Rückschluss? Nein, eine definitive Festlegung. Der hellere Ton des Bodens nahe des Fensters wurde durch die geringe Benutzung verursacht. Eine Situation, in der die Lackierung keine Farbe verlor und deshalb auch nicht nachdunkelte. Kein das übliche Maß überschreitendes Beschreiten. Eine Möglichkeit, dies zu überprüfen, hätte darin bestanden, den Teppich, der vor dem großen violetten Sofa lag, hochzuheben und zurückzuschlagen. Liam Gillick, Discussion Island/Big Conference Centre, 1998

161.

Projections and Revisions

By the large French window that ran from floor to ceiling on the south side of the room, the wood was lighter, the cause of which was not entirely clear. Maybe it was the result of the daily appearance of bright sun through the uneven panes of window glass or it could have been down to the lack of passage through to a rarely accessed area. But then again the space in front of that large floor to ceiling window may have witnessed more nervous standing than the rest of the room. Maybe more movement. Maybe less. The windows might have offered access to a frequently used balcony. Unlikely. Consider this. If the house was located in a temperate climate the inconsistent weather might have discouraged frequent use of any balcony, roof garden or terrace. The balcony was to improve the exterior look of the building, not for the beneficial use of its occupants. A temporary conclusion? No a definitive decision. The lighter floor tone close to the window was caused by lack of use. A situation where varnish could not become discoloured and effectively darkened. No excess of access. One way to prove it might have been to lift and fold back the rug that was centred in front of a large purple sofa. Liam Gillick, Discussion Island/Big Conference Centre, 1998


Diese Seite this page Five Short Texts, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm private collection End of Production Black, 2005 pulverbeschichtetes, wasserstrahlgeschnittenes Aluminium powder-coated, water cut aluminium 100 x 100 x 100 cm Cranford Collection, London

162.

Liam Gillick

GegenĂźberliegende Seite facing page Developmental, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 4-teilig je 4 elements each 30 x 10 x 120 cm Deviated Wall Structure, 2005 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 4-teilig je 4 elements each 50 x 10 x 120 cm Collection of General Dynamics, Virginia


Worüber sie also nachdenken müssen, sind zeitgebundene Abstecher ins Zeitmanagement. Die Tage vorbeistreichen lassen, während sie sich bemühen herauszufinden, wie sie effektiver werden können. Austausch und Kontrolle unterliegen nochmaliger Prüfung. Der Austausch von Ideen und die Produktion ist eng ineinander verschlungen und wird eingehend analysiert. Nachdenken muss man über den Einsatz von Technologie für die Zeitorganisation. Neue Programme formulieren, die innerhalb und um die örtlichen Möglichkeiten herum operieren können. Die Leuchten der Leuchtenfabrik werden für die Filmproduktion genutzt. Die einzige Fabrik, der einzige Platz in dieser unter ihrer Sperrung leidenden Umgebung, wo eine Erinnerung und eine Zukunft für eine Idee produktiver Arbeit bestehen. Wo es einigen Widerhall von früheren Visionen des Besseren geben mag. Diese Fabrik ist die erste Fabrik, die in dieser Gegend jemals zu sehen war, doch handelt es sich um eine Fabrik, die Unikate produziert. Sie produziert niemals eine Sache zweimal, sie stellt Lampen auf Bestellung her, macht spezielle Lampen. Sie ist der erste und letzte Arbeitsplatz in einem Umfeld, das überfrachtet ist mit der Illusion persönlichen Fortkommens. Verglichen mit dem Potential der Kommune, ist es ein Ort des Zusammenbruchs. Aber statt mit einer ganzheitlichen Methode zum Überleben aufzuwarten, hat die Fabrik eine Multi-Vision entwickelt, die völlig festgelegt und äußerst limitiert ist. Liam Gillick, Literally No Place, London 2002

163.

Projections and Revisions

So what they have to think about are time-based excursions into the management of time. Letting days slip by as they attempt to work out how to become more efficient. Exchange and control are under reconsideration. Exchange of ideas and production intertwined and excessively analysed. Think about application of technology to the organisation of time. Formulating new programmes that can operate within and around the potential of the place. The lamp factory lamps are used in the making of films. The only factory, the only place in this bar ridden environment where there is the memory and projection of an idea of productive work. Where there might be some echoes of earlier visions of how to get better. This factory is the first factory that has ever been seen in these parts yet it’s a factory that produces unique things. It never produces the same thing twice, it makes lamps to order, it makes special lamps. It is the first and last working place in an environment laden with the illusion of personal progress. Set up against the potential of the commune it is a collapsed place. But instead of coming up with a holistic method of survival it has developed a multi-vision that is locked down and super limited. Liam Gillick, Literally No Place, London, 2002


Diese Seite this page Implied Ended, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Collection of Roberta and Michael Joseph, Buffalo

GegenĂźberliegende Seite facing page Relieved Distributed, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Collection of Mark Giambrone, Dallas

Propped Discussion Platform, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 300 x 150 x 240 cm Sammlung Ringier, ZĂźrich

Resistance Wall Structure, 2007 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas jedes Teil each element 50 x 10 x 60 cm Collection of Stephen Lerner, New York

164.

Liam Gillick


„Discussion Island“ artikuliert die verschwommenen Beziehungen zwischen Leuten und Effekten, um die Entwicklung eines Konzepts für die Zukunft innerhalb eines post-utopischen Kontexts zu ermöglichen. Eine Vision einer Zukunft durch den Vorschlag einer Serie von Instrumenten, die auf die Umwelt einwirken. Die Erstellung einer Anzahl von Bildern und Objekten, die alle von im Zentrum stattfindenden Prozessen handeln – Diskussion, Verschiebung, Verhandlung, Routine und Einigung. „Discussion Island“ ist eine Entwicklung des zweiten Denkstadiums, die einen Definitionsprozess fortsetzt, der einen Bericht ermöglichen wird, dessen Ausarbeitung nicht notwendig für eine ausschließlich fiktive Textgestaltung optieren muss. Die provisorischen Lösungen, die mitgeliefert werden, gestatten die Erstellung eines facettenreichen Berichts, der einige konkrete Details enthalten kann. Doch existieren die wesenhaften Ideen dieser Präzisierungen schon vor, nicht erst nach dem Prozess der Recherche, der Präsentation und der Schlussfolgerung. Deswegen ist dies auch nicht der letzte Stein eines Denkgebäudes, es ist vielmehr die Präsentation des primären Quellenmaterials zum Zwecke der Produktion von „Discussion Island – A What if? Scenario“, es ist der prophetische Bericht. Liam Gillick, London 1997

165.

Projections and Revisions

“Discussion Island” articulates the blurred relationship between people and effects in order to enable the development of a concept of the future within a post-utopian context. A vision of a future through the proposal of a series of environmental tools. The creation of a number of images and objects that all deal with centre ground processes – discussion, delay, negotiation, routine and conciliation. “Discussion Island” is a second stage development in thinking that continues a defining process that will enable a report to be written without the necessity to opt for textual fiction alone. The provisional solutions provided here permit the creation of a multi-faceted report that can embody some concrete detail. Yet the nature of that precision is existent before, not after, the researching, presenting and concluding process. Therefore it is not the conclusion of a set of thinking, it is the presentation of primary source material towards the production of “Discussion Island – A What if? Scenario”, the predictive report. Liam Gillick, London, 1997


Diese Seite this page Restricted Projection, 2007 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas jedes Teil each element 50 x 10 x 120 cm Collection Clo and Charles Cohen, Los Angeles

GegenĂźberliegende Seite facing page Implied Ended, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Collection of Roberta and Michael Joseph, Buffalo, New York

Shipped Ended, 2007 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Collection of Gerald S. Lippes and Jody B. Ulrich, New York

Relations of Equivalence, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 5 x 240 x 100 cm Collection Carlos Vallejo, Santander

166.

Liam Gillick


Ich bin sehr daran interessiert, Strategien herauszufinden, wie sich Zeit als ein maßgebliches Konzept in die Ideen einfügen lässt, die hinter den Werken stehen. Insofern sehe ich mich unweigerlich mit einer Reihe von Problemen konfrontiert, die aus dem Zusammenbruch des traditionellen Formalismus resultieren. Es ist sehr schwer, über dieses Thema Arbeiten zu machen, ohne auf Zeit rekurrierende Medien zu verwenden – es sei denn, man hätte vor, sich auf die Diskussion über zeitlose Kunst oder über gute Malerei, die unsere Weltwahrnehmung entschleunigen respektive beschleunigen, oder über ähnliche Mythen einzulassen. So muss in jeder Arbeit eine bestimmte Anzahl von Dingen zusammenspielen. Eines davon kann die Geradlinigkeit der Präsentation sein, ein anderes die Erfordernis, zu verweilen oder etwas beim Vorbeigehen aus dem Augenwinkel zu registrieren; etwas, das immer unpräziser wird, je länger man sich mit der Arbeit beschäftigt und desto mehr Zeit man an diesem Ort verbringt. Doch das alles wird von der Tatsache beherrscht, dass es in der Arbeit mindestens so sehr um die Idee der Zeit als solche geht wie um den Versuch, diese Idee zu besetzen und zu verkörpern. Und jeder Aspekt dieser neuen Arbeit weist eine wirklich sehr elementare und fundamentale Verbindung zu dem auf, was ich benötige, um mein Nachdenken über eine parallele Gegenwart und eine mögliche Zukunft anzustoßen. Die Erinnerung einer Zukunft, die nicht stattgefunden hat. Das gibt mir einen gewissen Grad formaler Flexibilität. Jedes Element handelt von einem zwar elementaren, zugleich aber eher der Mitte der Gesellschaft zuzurechnenden Bedürfnis als von einer technologischen Fantasie oder apokalyptischen Vision einer kollabierten relativistischen Gesellschaft, weshalb das Werk so vielfältige Themen wie Diskussion, Isolation, Verhandlung, Kompromiss und Begutachtung behandelt. Liam Gillick, Interview mit William Furlong, London 1996

167.

Projections and Revisions

I am very interested to investigate strategies of how to employ time as a major concept built into the ideas behind the work. Therefore I am inevitably faced by a series of problems that are the result of a collapse of traditional formalism. It is very difficult to make work about this issue without using time-based media unless you want to get into some argument about timeless art or good painting slowing down or speeding up your perception of the world, and other related myths. So there have to be a certain number of things at work in each piece. One of which can be the straightforwardness of presentation, but another being a necessity to linger, or catch something in the corner of your eye as you pass by, something that becomes less precise the more you deal with the work and the more time that you spend in the place. But all of this is underscored by the fact that the work is also about the idea of time as much as attempting to embody an occupation of it. And every aspect of this new work has some very basic, fundamental connection to those things that I would need in order to start thinking about both a parallel present and a potential future. A memory of a future that hasn’t happened. Giving me a degree of formal flexibility. Every element concerns a basic yet simultaneously middle-ground need rather than a technological fantasy or an apocolyptic vision of a collapsed relativistic society, so the work addresses many themes such as discussion, isolation, negotiation, compromise and assessment. Liam Gillick, Interview by William Furlong, London, 1996


Diese Seite this page Benched Discussion, 2009 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas Plattform platform 5 x 200 x 50cm Bank bench 50 x 200 x 50 cm Revised Solution, 2009 pulverbeschichtetes Aluminium powder-coated aluminium 10-teilig je 10 elements each 200 x 15 x 3 cm Collection of Wendy and Scott Kleinman, New York

168.

Liam Gillick

GegenĂźberliegende Seite facing page Retired in Place, 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Sammlung Victor Gisler, ZĂźrich Cubed Revision Screen, 2006 pulverbeschichtetes Aluminium powder-coated aluminium 70 x 200 x 200 cm


Wenn man meine Kunstwerke in Beziehung zum Minimalismus oder späten modernen Formalismus setzt, dann wird einem dieser Prozess klarer. Meine Arbeit teilt nicht deren Schlussfolgerung, dass es der Kunst möglich sei, Autonomie zu demonstrieren gegenüber den anderen Vorkommnissen in der Welt. Meine Arbeit kennt keine fundamentale ,Wahrheit des Materials‘ und kümmert sich selten darum, wofür es am besten geeignet ist. Oft macht sie das, wofür das Material am wenigsten geeignet ist, nämlich zusammengefügt und aufgehängt zu werden. Meine Arbeit gerät in sanften ironischen Widerstreit mit gewissen Ideen von Materialität, weil die physischen Objekte nur ein kleines Segment einer ganzen Matrix von Dingen bilden, die mit der Art und Weise spielen, wie Ideen in Hierarchien Eingang finden. Außerdem gibt es in der Ausstellung Eingriffe des Künstlers, die mit dem Glauben zusammenhängen, dass das Publikum vielfältig ist und man deshalb über verschiedene Wege mit einem unterschiedlichen Publikum gleichzeitig kommunizieren muss. Marshal McLuhan schrieb darüber, dass Ideen verschiedene Temperaturen besäßen, doch trifft das genauso auf das Publikum und dessen Reaktionen zu. Die Leute nehmen laufend visuelle Beurteilungen ihrer Umgebung vor, die beeinflussen, wie sie sich fühlen und benehmen – sie sind niemals nur passive Beobachter. Einerseits ist es sehr wichtig, dass man das Werk relativ schnell einordnen kann; genauso wichtig ist aber andererseits, dass es eine aufgeschobene Wirkung zeitigt, die man erst später bemerkt. Die Arbeit hat ein sehr direktes und manchmal schönes Potenzial, das Leute in andere Ideensphären saugt, sie baut gezielt befristete Beziehungen auf, um sich selbst fortzuschreiben. Der Betrachter vervollständigt die Arbeit nicht, sondern muss mit ihren Implikationen und ihrem Potenzial zurechtkommen. Liam Gillick, Interview mit Anthony Spira, London 2002

169.

Projections and Revisions

When you place my artwork in relation to Minimalism or late modern formalism you can understand this process more clearly. The work doesn’t share the same implication that art might be able to demonstrate an autonomy from other things in the world. My work doesn’t have a fundamental ‘truth to materials’ and doesn’t always do what materials do best. It often does what stuff does least well, which is to be constructed and held in suspension. My work gently pokes at certain ideas about materiality because these physical objects are only one small part of a whole matrix of things that play with the way ideas are placed into hierarchies. There are also authorship implications in the exhibition related to a belief that the audience is multiple so you need to communicate to a number of audiences simultaneously through different routes. Marshall McLuhan wrote about ideas having different temperatures, but so do audiences and responses. People make constant visual judgements about their environment, which affect how they feel and how they behave, they are never passive viewers. On one hand it is very important that the work can be addressed and dealt with relatively quickly; but it’s also important that it can have a delayed action that only snaps into focus later on. The work has a very immediate and sometimes beautiful potential that sucks people into other idea arenas and it relies on the establishment of temporary relationships to sustain itself. The work is not a sequence of endpoints, I am trying to put forward fluctuating moments of connection. The viewer doesn’t complete the work but has to deal with the implications and potential of it. Liam Gillick, Interview by Anthony Spira, London, 2002


Diese Seite this page Racked Projection, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Collection Philippe Steinfeld, Brussels Related Faction, 2008 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas jedes Teil each element 50 x 120 x 10 cm Government Art Collection, London

170.

Liam Gillick

GegenĂźberliegende Seite facing page Revised Projection, 2006 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas jedes Teil each element 50 x 120 x 10 cm Collection Mrs Lucy Tissot-Pereira, Brussels Revision Structure, 2005 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Sammlung HMT, Berlin


Die Konstruktion der Arbeit ist relativ einfach, auch wenn sie Materialien einbezieht, die man aus der Welt der Neuerungen und Präsentationen kennt. Wenn man eine Thunfischdose kauft und den Eindruck gewinnt, die Dose enthalte immer weniger Fisch, liegt es vielleicht daran, dass die Verpackung größer geworden ist. Solche Sachen scheinen nie sehr tiefsinnig zu sein, doch berühren sie uns in der Tat und nagen an unserem Gewissen. Sie sind das sichtbare Ende jener Dynamik der entwickelten Welt, die bestimmt, wer darüber entscheidet, ob du einen Job hast oder nicht, was deine Funktion ist, auf welche Weise du dich durch die Stadt bewegen kannst und wer den öffentlichen Raum kontrolliert. All diese Fragen sind in Ideen verwickelt, die aus dem semiotischen Umfeld der Präsentation stammen, und die Firmen warten auf den Moment, wo der Fisch sein Comeback feiern muss. Ich verspüre eine besondere Loyalität zu bestimmten Ideologien, die sich gegen die Suche richten, wie man die minderwertigste Sache für das meiste Geld an die größtmögliche Zahl von Leuten verkaufen kann. Diese ideologischen Verhandlungen sind in meiner Arbeit stets präsent. Bis zu einem gewissen Grad dient die Präsenz der hölzernen Struktur dazu, die Arbeit in einem konstruierten Beziehungskontext zu verankern, der als Zeichen für die komplexen Umstände fungiert, welche die Herstellung der Arbeit von vornherein begleitet haben. Liam Gillick, Interview mit Anthony Spira, London 2002

171.

Projections and Revisions

The construction of the work is relatively simple, although it does involve materials familiar from the world of renovation and presentation. When you buy a tin of tuna and it feels like there is less and less fish in the can maybe its because the packaging is getting bigger. These things don’t seem very profound but they actually affect us and prick our conscience. They’re the visible end of a dynamic that exists in the developed world which also affects who decides whether you have a job or not, how you can function, how you can move through the city and who controls public spaces. All these questions are bound up in ideas around the semiotics of presentation and corporations are vigilant for the moment when the fish has to make a comeback. I have a specific allegiance to certain ideologies that are against that search for how you can sell the least thing for the most money to the largest number of people. These ideological negotiations are always present in my work. To a certain extent the presence of the wooden structure does function to ground the work in a constructed relational context that functions as a sign for the complex circumstances that surrounded the creation of the work in the first place. Liam Gillick, Interview by Anthony Spira, London, 2002


Diese Seite this page Projected Relapse, 2008 pulverbeschichtetes Aluminium powder-coated aluminium 20-teilig je 20 elements each 200 x 15 x 3 cm Stacked Restricted, 2006 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas jedes Teil each element 50 x 120 x 10 cm Collection Vanmoerkerke, Belgium

172.

Liam Gillick

GegenĂźberliegende Seite facing page Strange Reduction, 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Collection Kestelijn, Antwerp Struck Screen, 2005 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 30 x 120 x 20 cm


Diese Anweisungen beziehen sich auf alle „Discussion Platforms“. Die Arbeit besteht aus einer Rahmenkonstruktion aus Aluminium – eloxiert oder belassen –, in die Querstreben aus Aluminium eingefügt sind, wobei die sich ergebenden Zwischenräume teilweise mit Plexiglas, Holz oder anderen Materialien gefüllt sind. Die ,Platforms‘ sind normalerweise an eine oder mehrere Wände fixiert. In mindestens einem Fall hängt die ,Platform‘ von der Decke, ohne eine Wand zu berühren. Das Gewicht der freihängenden ,Platforms‘ wird entweder durch an der Decke befestigte Kabel oder durch auf dem Boden lastende Stützpfeiler getragen. Es ist extrem wichtig, dass die ganze Zeit eine vorschriftsmäßige Verbindung zwischen der ,Platform‘ und den Stützen besteht. Am besten wird die Arbeit an senkrechten Kabeln aufgehängt, die im Lot von der Decke herabhängen und nicht im Winkel, auf keinen Fall aber je in einem spitzen Winkel zurück an die Wand gespannt werden. Grund dafür ist, dass die vorschriftsmäßige Installation der ,Platform‘ immer ein niedriges Spannungsniveau erzeugt; ist der Kabelverlauf indes winkelförmig, wird die ,Platform‘ in eine sprunghafte Zugspannung versetzt, die eine inwendige Verschiebung, im extremsten Fall einen totalen Zusammenbruch der Arbeit zur Folge haben kann. Glaubt mir, ich habe es versucht. Liam Gillick, Installationsanweisungen, 1998

173.

Projections and Revisions

These instructions relate to all “Discussion Platforms”. The works consist of an aluminium framework, either anodised or plain, filled with cross beams of aluminium with parts of the resulting framework filled with Plexiglas, wood or other panelling. The platforms are usually fixed to one or more walls. In at least one case the platform hangs from the ceiling without touching any walls. The weight of the cantilevered platforms is either stressed through cables running up to the ceiling or through supporting poles running up from the floor. It is extremely important at all times to maintain a standard relationship between the platform and the supports. The best way for the work to hang is with straight cables running directly down from the ceiling, never running at an angle and definitely never running at an acute angle back to the wall. The reason for this is that the standard installation offers a low level of tension to the platform, if the cables run at angles then a sprung tension is established in the platform that can result in distortion of the work and in extreme case total collapse of the work. Trust me, I’ve tried it. Liam Gillick, Installation Instructions, 1998


More Sorrow, 2008 Tintenstrahldruck inkjet print 42 x 29,7 cm

174.

Liam Gillick


175.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page Discussion Island Lobby Commission, 2000 rostfreier Stahl, bemalter Stahl, Holz, Gegensprechanlage stainless steel, painted steel, wood, entryphone system Maße variabel dimensions variable in verschiedenen Lobbies, located in various lobbies, Rue G. Combaz, Brussels

176.

Liam Gillick

Gegenüberliegende Seite facing page Conciens Lobby, 2001 bemaltes Aluminium, Glas painted aluminium, glass Maße variabel dimensions variable Collection Telenor, Oslo You Can’t Organise a Certain Form of Social Organisation, 2002 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 5 x 240 x 190 cm private collection, Dublin


Ein großes rostfreies Stahlblatt umfängt die vorhandene Tür. Der Stahl springt aus der vorhandenen Wand vor. Eine Standard-Gegensprechanlage ist mit Tasten aus der Airbus-Industrie verdrahtet (dieselben werden in den Airbus-Cockpits verwendet). Die ganze Verkleidung verdeckt das System der Gegensprechanlage und die Beleuchtung, die von hinten die Tasten und die ausgestanzte Zahl bestrahlt, die die Hausnummer anzeigt.

A large stainless steel sheet surrounds the existing door. The steel is positioned just forward of the existing wall. A standard entryphone system is wired to buttons from Airbus Industrie (the same as used in Airbus cockpits). The whole panel hides the entry phone system and lighting that provides back-lighting for the buttons and for a cut out number to indicate the block number. Liam Gillick, Brussels, 2000

Liam Gillick, Brüssel 2000

Um mein Gewissen zu erleichtern, bin ich gezwungen, so viel zu reden …

The discharge of my conscience enforceth me to speak so much... Wittes, learning and studie...

Wittes, Lese- und Arbeitszimmer … Liam Gillick (from the Trial of St. Thomas More), Telenor, Oslo, 2000 Liam Gillick (aus dem Prozess gegen Thomas Morus), Telenor, Oslo 2000

177.

Social Structures


Diese Seite this page Wood/Wooden, 2000 Farbe paint Maße variabel dimensions variable Collection Patrick Charponel, Mexico Installationsansicht installation view Bar Americas, Guadalajara Applied Discussion Platform, 2003 pulverbeschichtetes Aluminium powder-coated aluminium 5 x 240 x 240 cm Installation installation Sammlung Dekabank, Frankfurt am Main

178.

Liam Gillick

Gegenüberliegende Seite facing page Reciprocal Passage Work, 2003 Plexiglas Maße variabel dimensions variable Installationsansicht installation view Regent’s Place, London Collection British Land, London donuts/soda/headache/phonecard/stereo, 2003 Plakate posters Maße variabel dimensions variable Installation installation Great Portland Street Undergound Station, London


Person 1 Wir hatten so oft Leber in den letzten Monaten, dass ich …

Person 1 We’ve had liver so many times in the last month that I’m...

Person 2 Du wirst deine Leber jetzt essen.

Person 2 You are going to eat your liver.

Person 1 Negativ. Null Leber kommt in meinen Mund.

Person 1 Negative. Zero liver is going into my mouth.

Person 2 Leber ist gut für dich. Man braucht Leber zum Leben.

Person 2 Liver is good for you. With liver, you can live.

Person 1 Ich werde mein Leben riskieren, wenn ich drei Tage keine Leber esse.

Person 1 I am going to risk my life by not eating liver for three days.

Person 2 Nun ja …

Person 2 Well...

Person 1 Irgendjemand muss in dieser Sache Stellung beziehen. Das werde ich sein, ich bleibe lieber bei meinem Standpunkt, als dass ich sie esse. Ich schaue in den Spiegel, ich sehe Leber. Ich sehe aus wie Leber.

Person 1 Somebody has to take a stand on this thing. And I’m going to, I’d rather stand on it than eat it. I look in the mirror, I see liver. I look like liver.

Liam Gillick, Headache, Frieze Projects, 2003

Liam Gillick, Headache, Frieze Projects, 2003

179.

Social Structures


Diese Seite this page Negotiated Doubled, 2003 bemaltes Aluminium painted aluminium Maße variabel dimensions variable Installationsansicht installation view Bundesschulzentrum, Kirchdorf, Österreich

Gegenüberliegende Seite facing page I Can’t Answer that Question it’s a Question of Conscience, 2003 bemaltes Aluminium painted aluminium 400 x 400 x 400 cm Installationsansicht installation view Alcobendas, Spain Stand now on a Ridge, 2003 polierter, rostfreier Stahl polished stainless steel Maße variabel dimensions variable Collection of Lisa Roumell and Mark Rosenthal, New York

180.

Liam Gillick


Das Kloster von La Tourette in der Nähe von Lyon in Frankreich besitzt ein Thomas-Morus-Zentrum für Forschung. Es soll sich eigentlich um ethische und moralische Fragen und um das Gewissen der Politik kümmern. Um das Gewissen innerhalb der Strategie von gleichsam regierungsamtlichen Organisationen. La Tourette ist ein Gebäude von Le Corbusier. Es ist noch nicht so alt – was Klöster betrifft, ist es sogar irritierend neu. Dennoch beherbergt es ein Thomas-Morus-Zentrum. Der Prozess gegen Thomas Morus führt auf die Ebene der Gewissensfrage, indem er die Teilnahme verweigert und sagt: „Ich kann Ihre Frage nicht beantworten“; das ist ein sehr wichtiger Moment, eine wichtige Geste, die Thomas Morus zum Schutzheiligen der Politiker werden ließ. Er selbst war Politiker, kein Heiliger. Thomas Morus war Politiker innerhalb eines religiösen Kontextes. Er sagte, er könne eine sehr präzise Frage nicht beantworten, weil das eine Gewissensfrage sei. Es handelte sich um eine Frage, die nicht gestellt werden durfte, eine Frage, die Teil des inneren Dialogs bleiben musste. Sich auf das Gewissen zu berufen, dient der Irritationsabwehr. Er wurde getötet, aber zunächst wurde ihm ein dreifacher, brutaler Tod angedroht. Doch handelt es sich auch um eine irritierende Verteidigung, einen irritierenden Weg, um einer Antwort auf eine Frage auszuweichen. Um die Geburtsstunde der Gewissensfrage. Wenn keine Antwort erfolgt, dann bringt ihm einfach einen Stuhl. Unter gewissen sozialen Umständen entsteht das Verlangen, das Zentrum der Macht von einem zum anderen Ort und wieder zurück zu verschieben, wobei jemand immer mindestens zweimal umgebracht wird. Man schickt sie mit dem Taxi nach Hause, sie halten ihre Augäpfel im Schoß, und ihre Familien müssen dann noch die finale Kugel bezahlen. Liam Gillick, Literally No Place, London 2002

181.

Social Structures

The monastery at La Tourette near Lyon in France has a Thomas More Centre for Research. It is supposed to look at ethics and moral constructions and the conscience of politics. Conscience within the strategy of quasi-governmental organisations. La Tourette is a building by Le Courbusier. It’s not so old; in monastery terms it is disturbingly new. Yet it has a Thomas More Centre. The trial of Thomas More leads up to a question of conscience, refusing to take part and saying: “I cannot answer your question”, it’s a very important moment, it’s an important gesture to make Thomas More a patron saint of politicians. He was the politician not the saint. Thomas More was a politician within a religious context. He said he couldn’t answer a very precise question because it was a question of conscience. It was not a question that could be asked, it was a question that had to remain part of an internal dialogue. Invoking conscience is a defence of irritation. He was killed, but first he was threatened with a triple death in brutalised forms. An irritating defence, an irritating way of getting out of answering a question. The creation of the question of conscience. So no reply, just bring him a chair. In certain social circumstances there is a desire to shift the centre of power from one location to the other and back again, while killing someone at least twice. Sending them home in a taxi with their eyeballs in their lap, and making their family pay for the eventual bullet. Liam Gillick, Literally No Place, London, 2002


Gran Centro de Conferencias, 2008 Vinylbuchstaben vinyl text MaĂ&#x;e variabel dimensions variable Corpus Collection, Mexico D.F.

182.

Liam Gillick


415 cm

cm

183.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page nineteenfortysixxisytrofneetenin, 2004 bemaltes Aluminium painted aluminium 400 x 400 x 400 cm Installationsansicht installation view Aspen Art Museum, Colorado Collection of Susan and Larry Marx, Aspen Reference Platform, 2004 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 5 x 240 x 120 cm Collection of Bruce and Barbara Berger, New York

184.

Liam Gillick

GegenĂźberliegende Seite facing page Buffalo Structure, 2005 pulverbeschichtetes Aluminium powder-coated aluminium jedes Teil each element 100 x 360 x 20 cm Collection of Charles Balbach, Orchard Park


Design wird nicht etwa zu Kunst, wenn es teuer und einzigartig ist, es wird nur teuer und einzigartig. Ich verfolge nicht die Absicht, Neuheit in Bezug auf Objekte, sondern in Bezug auf Möglichkeiten und Beziehungen zu erzeugen. Ich interessiere mich für die Semiotik der gebauten Welt. Ich akzeptiere, dass ich innerhalb bereits existierender Strukturen operiere. Dafür muss ich einen Weg finden, innerhalb dieser Strukturen zu irritieren oder zu intervenieren. Die Vorliebe seitens einiger Architekten, eine sogenannte ,interessante Lösung‘ zu kreieren, kann mit der Einberechnung der unausweichbaren Bedingung des Eingriffs in die reale Welt in Konflikt geraten. Kontingentes Schaffen ist von denjenigen unter Beschuss genommen worden, die an eine Autonomie durch Verweigerung glauben: von denjenigen, die glauben, dass die Rolle der Kunst oder Architektur in einer Lehre oder Dokumentation bestünde, die über ihre direkte und höchst subjektive Operation weit hinausreiche. Aber, wie du schon gesagt hast, Architektur ist per definitionem relational, und zwar genau deshalb, weil die Produktion von Architektur auf und über dieselbe Art und Weise erfolgt wie ihr Auftritt als Objekt(e) oder Theorie(n). Der Unterschied ist wichtig. Liam Gillick, Gespräch mit Michael Meredith, 2010

185.

Social Structures

Design does not become art when it is expensive and unique, it just becomes expensive and unique. I do not aim to produce newness in terms of objects, but rather in terms of contingencies and relationships. I am interested in the semiotics of the built world. I accept that I operate within existing structures. Therefore I have to find a way to unsettle or intervene within these structures. This preference on the part of some architects for producing what is called an ‘interesting solution’ can interfere with reckoning with the inescapable condition of intervening in the real world. Contingent work has come under fire from those who believe in an autonomy via refusal: from those who believe that the role of art or architecture is to teach or document above and beyond its direct super-subjective operation. But, as you said, architecture is relational by definition, precisely because of the way in which architecture is produced over and above the way that architecture (as objects and theory) acts. The distinction is important. Liam Gillick, Conversation with Michael Meredith, 2010


Diese Seite this page Revealed Distance Device, 2005 Farbe paint Maße variabel dimensions variable BSI Art Collection, Lugano

Gegenüberliegende Seite facing page Punctuated Revision Network, 2005 Farbe paint Maße variabel dimensions variable BSI Art Collection, Lugano

Wover Discussion Backdrop, 2005 Farbe paint Maße variabel dimensions variable BSI Art Collection, Lugano

Reconciliation Structure, 2005 bemaltes Aluminium painted aluminium 10 Platten jedes Teil 10 plates each element 240 x 30 x 5,3 cm BSI Art Collection, Lugano

186.

Liam Gillick


Eine ‚kreative‘ Sprache über das Spiel mit Materialien und Oberflächen und Lösungen aufzubieten, hat nichts mit Diskurs zu tun; es ist das Gegenteil von Diskurs. Diskurs in einem entwickelten Sinne gibt Rechenschaft über die Sprachen des Diskurses innerhalb der Konversation, was auch einen höchst bewussten Umgang mit Beschreibung einschließt: eine Politik des Beschreibens. Die besten Architekten ändern die Ausdrucksform, mit der man etwas tut. Doch das ‚System‘ schätzt das nicht wirklich, sodass ein starker Druck entsteht, wirkliche Innovationen und konkrete Veränderungen in der Gesellschaft zu absorbieren, indem Begriffe, die materielle Beziehungen beschreiben, von der wirklichen Funktion und dem Potenzial einer Struktur abgezogen werden. Es gibt in der Architektur ein starkes Eigeninteresse an Unvollständigkeit … Das ist der einzige Weg zu überleben. Jedes Bauprojekt hat seine Krisenmomente in Bezug darauf, wie die Dinge eigentlich gebaut werden und wer sie baut, und diese Momente werden dazu genutzt, Raum für die verschiedenen Akteure eines Projekts zu schaffen. Die meisten kommerziell erfolgreichen Architekten sind geschickt darin, inmitten der Atmosphäre eines präzisen Entscheidungsmanagements dem Unentschiedenen Plätze einzuräumen. Dort, in solchen Lücken, stoßen sie dann auf ihr nächstes Projekt. Diese Krise der Unvollständigkeit, welche per definitionem in die architektonische Strategie eingebettet ist, ist viel produktiver als der Kunstkontext. Liam Gillick, Gespräch mit Michael Meredith, 2010

187.

Social Structures

Deploying ‘creative’ language about playing with materials and surfaces and solutions is not discourse; it is the opposite of discourse. Discourse in a developed sense accounts for the languages of discourse within the conversation, including a self-consciousness about description: a politics of describing. The best architects change the language of doing something. But the ‘system’ doesn’t really want this, so there is a strong pressure to absorb real innovation and concrete changes in the society by separating out the terms used to describe material relationships from the actual function and potential of a structure. There is a strong self-interest in architecture to be incomplete… it is the only way to survive. Every built project has its moments of crisis in relation to how things actually get built and who gets to build them, and these moments are used to create space for the different actors in the project. The most successful commercial architects are deft at withholding and leaving spaces of indecision within an ambience of precise decision-making. It is within these gaps that they get to move on to the next project. This crisis of incompletion, which is by definition embedded in architectural strategy, is much more productive than the art context. Liam Gillick, Conversation with Michael Meredith, 2010


Diese Seite this page Home Office London, 2002–2005 Gebäude in der Building in Marsham Street, London Government Art Collection, London

188.

Liam Gillick

Gegenüberliegende Seite facing page Four Levels of Exchange, 2005 pulverbeschichtetes Aluminium powder-coated aluminium 4-teilig je 4 elements each 50 x 460 cm (Durchmesser/diameter) LAC – Lufthansa Aviation Center, Frankfurt am Main


Solange man nur auf die Beziehung zwischen Intention und physischer Funktion achtet, ist die Diskussion zwangsläufig schwer nachzuvollziehen, denn es besteht eine historisch einzigartige Nähe zwischen Kunst und Architektur, die die Gewissheiten transzendiert. Das Wesen ihrer jeweiligen Methoden ist die permanente Verschiebung der Grenze. In dem Moment, wo man denkt, man hätte sie erreicht, hat sie sich bereits anderswohin verlagert. Es gibt einen Dialog, der real ist, aber dieser erfolgt innerhalb einer notwendigen und funktional veränderbaren Grenze. Ohne diese Grenze gäbe es kein dialektisches Potenzial, vom diskursiven einmal ganz abgesehen. Um sich aber darin eine effektive Arbeitsmethode zurechtlegen zu können, ist es vielleicht hilfreich zu beherzigen, was Nanni Morreti irgendwo am Anfang von „Caro Diario“ gesagt hat: „Selbst in einer faireren Gesellschaft als dieser, werde ich mich nur mit einer Minderheit der Leute in Einklang fühlen. Ich glaube an die Menschen, aber nicht an die Mehrheit der Menschen. Ich werde stets nur mit einer Minderheit übereinstimmen. Ein Künstler sagt das leicht, für einen Architekten ist das schwer zu begründen.“ Vielleicht bezeichnet das ungefähr das Feld, wo wir eher auf die wirklichen Antagonismen und Differenzen treffen als auf die herkömmlichen Fragen des Geschmacks und der Umgangsformen. Liam Gillick, Gespräch mit Michael Meredith, 2010

189.

Social Structures

The discussion is necessarily elusive if you merely look at the relationship between intention and physical function because there is a historically unique proximity between art and architecture that transcends certainties. The nature of the respective practices is that the boundary gets moved all the time. Just when you think you have reached it, you will find it has shifted somewhere else. There is a dialogue that is real but it takes place within a necessary and functional mutable boundary. Without this boundary there would be no dialectical potential, let along discursive potential. But in order to find an effective way to work within this you might need to think of what Nanni Morreti says near the beginning of “Caro Diario”: “Even in a society more decent than this one, I will only feel in tune with a minority of people. I believe in people but I just don’t believe in the majority of people. I will always be in tune with a minority of people. This is easy for an artist to say and hard for an architect to justify.” Maybe somewhere here we find a space to actually find real antagonism and difference rather than just questions of taste or manners. Liam Gillick, Conversation with Michael Meredith, 2010


Diese Seite this page Striated Presentation Striated, 2006 pulverbeschichtetes Aluminium powder-coated aluminium MaĂ&#x;e variabel dimensions variable Installationsansicht installation view Maharam Chicago Collection Maharam, Chicago

190.

Liam Gillick

GegenĂźberliegende Seite facing page Full Scale Model of a Social Structure for a Plaza in Anyang, 2007 bemalter Stahl, Holz painted steel, wood 250 x 2000 x 900 cm Installationsansicht installation view City of Anyang, Korea


Die Ansicht, Künstler seien vereinnahmt, besitzt eine lange Geschichte. Sie findet sich in den verschiedenen historischen Bestrebungen wieder, Hochkultur als ein philosophisches Phänomen zu untersuchen, wobei sich der Begriff Kultur nie mit der Projektion Hochkultur deckt. Den Vorwurf zu erheben, wir funktionierten innerhalb eines Milieus, das von einem raubtierhaften Neoliberalismus beherrscht wird, basiert in erster Linie auf einer fadenscheinigen Projektion der Funktion von Hochkultur; fadenscheinig deshalb, weil sie die Spannungen in der Kunst nicht erklären kann, die nach wie vor dem Kampf um Kollektivität in einem auf Anerkennung von Differenz fixierten Kontext geschuldet sind. Theorien über immaterielle Arbeit – die Kenntnis des Informationsaspekts und des kulturellen Gehalts von Gütern – nahmen wesentlichen Einfluss auf den Ausgangspunkt zeitgenössischer Künstler, insofern sie eine von Zweifeln und Bewusstheit gerahmte Kenntnisnahme jenes Vorwurfs ermöglichten – eine Kenntnisnahme, die zur Basis ihrer Arbeit wurde. Infolgedessen ist die Frage, was das Gute an der Arbeit sei, zum eigentlichen Zentrum der Arbeit geworden – sie ist also weder Symptom noch peripherer Zufall. Vielmehr ist sie die Ursache für die vorhandenen Zweifel und Konfusionen, was verständlich macht, warum es innerhalb jeder aktuell bestehenden Kunststruktur zu Momenten des Stresses und des Zusammenbruchs kommen zu müssen scheint. Diese Momente der kritischen Krise sind Ausdruck der Widerständigkeit gegenüber der Struktur – eine permanente Restrukturierung in Reaktion auf den Wunsch, innerhalb eines permanent unbefriedigenden Arbeitsumfelds Arbeit zu vermeiden. Liam Gillick, Why Work?, New York 2010

191.

Social Structures

The notion of artists as implicated figures has a long history, located in varied historical attempts to resolve the desire to examine high culture as a philosophical marker with the unresolvable problem that the notional culture examined is always out of sync with the function of a high cultural projection. Meaning the accusation that we are functioning within a milieu that is dominated by predatory neoliberalism is based on a spurious projection of high cultural function in the first instance that cannot account for the tensions in art that remain the struggle for collectivity within a context that requires a recognition of difference. Theories of immaterial labour – an awareness of the informational aspect of the commodity and the cultural content of the commodity – have been a profound influence on the starting point of current artists, offering an awareness of the accusation framed by doubts and consciousnesses that forms the base of the work. As a result the question “What is the good of work?” is the heart of the work – it is not a symptom or accidental proximity. It accounts for the doubts and confusions that exist and explains why there seem to be moments of stress and collapse within any current art structure. These moments of critical crisis are an expression of resistance to the structure – a constant restructuring in response to the desire to avoid work within a realm of permanently unrewarding work. Liam Gillick, Why Work?, New York, 2010


Diese Seite this page Scale Model of a Social Structure for a Plaza in Guadalajara, 2006 bemalter Stahl, Holz, Beleuchtung painted steel, wood, lighting 250 x 2000 x 900 cm Installationsansicht installation view Guadalajara, Mexico

Gegenüberliegende Seite facing page 24/7 Kiosk, 2009 bemalter Stahl painted steel 400 x 400 x 400 cm Installationsansicht installation view Zeebrugge, Belgium

Lamp Sign Thing, 2009 eloxiertes Aluminium anodised aluminium Maße variabel dimensions variable Installationsansicht installation view Zoetemeer, Netherlands

The Librarian Speaks, 2004–2009 pulverbeschichtetes Aluminium powder-coated aluminium 60 cm x 300 m Installationsansicht installation view Cambridge Public Library, Cambridge MA

192.

Liam Gillick


Was also geschah mit dem Freizeitversprechen? Vielleicht ist es das, was die Kunst uns anbieten kann. Etwas, das man benutzen oder über das man reflektieren kann, in einem Bereich zukünftiger permanenter Freizeit, wobei die ,Künste‘ in Gestalt eines instrumentalisierten Aufgebots zu einer verfeinerten und genauer definierten kapitalisierten Zone werden. Sie ist niemals auf die Künstler alleine ausgerichtet, sondern auf die gesamte Bevölkerung als ein Weg, Innovationen am Arbeitsplatz zu rationalisieren und wegzuerklären, was Teil einer Matrix des Zweifels und der Differenzierung ist. Künstler werden hier als Lieferanten eines Inhalts für die Freizeitzone angesehen und weniger als Vorbilder oder gar in einem kritischen Verhältnis zu ihr – vorübergehend in der Rolle eines Außenseiters, die aber ihrem ganzen Wesen nach exemplarische Lifestyle-Modelle liefern. Doch geht das Vorhandensein eines Freizeitversprechens nicht mit der künstlerischen Produktion konform. Freizeitmodi sind von Künstlern übernommen worden, um einerseits einer Auffassung von Arbeit als einem Ort der Würde und der Innovation offen zu widersprechen, und um andererseits die Auffassung vom Künstlerleben als einem Rollenspiel innerhalb der Freizeitzone zu kritisieren, nachzuäffen oder zu parodieren. Die Aufkündigung von Arbeit oder die Errichtung von Strukturen, in denen Intention und Resultat auseinanderklaffen, sind alles Omen, die das Versprechen einer Post-Arbeitsgesellschaft hinter sich lassen, das sowieso nie etwas anderes gewesen ist als die Projektion eines neurotischen Nichtstaates. Liam Gillick, Why Work?, New York 2010

193.

Social Structures

So what happened to the promise of leisure? Maybe this is what art can offer us now – a thing to use or reflect upon in a zone of permanent future leisure – as the ‘arts’ as an instrumentalised deployment becomes a more refined and defined capitalized zone. Never geared towards artists alone but instead directed towards the population in general as a way of rationalizing and explaining away innovations within the workplace as part of a matrix of doubt and difference. Artists here are viewed as content providers for the leisure zone rather than exemplary of it or in a critical relationship with it – terminally cast as outsiders who are nevertheless providing exemplary lifestyle models by their very nature. Yet the existence of a leisure promise is not synchronized with artistic production. Modes of leisure have been adopted by artists as a way to openly counter notions of labour as sites of dignity and innovation and in order to critique, mock or parody the notion of an artistic life as a role-play within the leisure zone. The withdrawal of labour or the establishment of structures where intentions and results are uneven are all markers that go beyond the promise of post-labour that was always nothing more than the projection of a neurotic non-state. Liam Gillick, Why Work?, New York, 2010


Dynamica Building (with Rodrigo Gomez Villaseùor), 2009 verschiedene Materialien various materials Gebäude in building in Guadalajara, Mexico

194.

Liam Gillick


Eine Antwort in den letzten Jahren war die Gründung von Praxisgemeinschaften, die neue Freizeit- beziehungsweise Arbeitsmodi anwandten. Denn Künstler kreieren oftmals neue Lebensweisen in Opposition zu vorherrschenden Lifestyles. Dabei handelt es sich um eine komplette Reorganisation der Beziehungen, wobei die Beziehungen als solche zum Thema der Arbeit werden können und diskursive Praxismodelle eher als grundlegendes Prinzip denn als Resultat oder Produkt fungieren. Den extremen Gegenpart bilden die bewusste, selbst erzwungene Isolation und der damit einhergehende Mangel an Verantwortlichkeit. Sie finden als strukturelle Spielmarken innerhalb eines Kontextes Verwendung, in dem die Ideengerüste veränderbar und dynamisch sind. Die zwei Hauptvektoren der Gegenwartskunst versuchen, uns unsere Vorwurfshaltung auszutreiben: durch Restrukturierung des Lebens (Wege zur Arbeit) und durch Rückzug vom Leben (Wege zu freier Arbeit). Liam Gillick, Why Work?, New York 2010

195.

Social Structures

One answer over the last years was the formation of communities of practice forming new leisure/work modes. For artists are often creating new life in opposition of life-styles. A complete reorganization of relationships where relationships themselves may become the subject of the work and discursive models of practice become the founding principle rather than a result or product. On the opposite extreme there is deliberate self-enforced isolation and a concurrent lack of accountability, used as a structural game within a context where notional support structures are mutable and dynamic. The two main tangents of current art both attempt to release us from the accusation. Restructuring life (ways to work) and withdrawing from life (ways to free work). Liam Gillick, Why Work?, New York, 2010


Dynamica Building (with Rodrigo Gomez Villaseùor), 2009 verschiedene Materialien various materials Gebäude in building in Guadalajara, Mexico

196.

Liam Gillick


Es kommt zur Ausweisung ethischer Grenzen, wenn Kunst unter den angespannten Umständen von Schuldzuweisungen entsteht. Umstände und Themen kehren als moralische Zombies wieder – als Untote und erbarmungslose Opfer, die von den Künstlern in einem Spannungsverhältnis mit der Errichtung oder Ablehnung ethischer Grenzen entweder zurückgewiesen oder akzeptiert werden. Ethik ist nicht stabil, nicht einfach zu erlangen, zu hegen oder abzutöten. Unter solchen angespannten Verhältnissen lässt sich leicht vermuten, dass Kunst die Erinnerung vorwärts und rückwärts erweitert. Anders gesagt, Kunst ist nicht notwendigerweise an die Gegenwart gekoppelt. Was methodisch mit zeitgenössischen Werken verbunden zu sein scheint, ist eine Illusion. Kunst bedient sich der Flexibilität, um für den moralischen Zombie Rechenschaft abzulegen – sie navigiert auf dem Terrain ethischer Wandelbarkeit. Kunst erweitert und reduziert Erinnerung und benutzt dafür Instrumente, die nur zur Eindämmung der Erinnerung, das heißt zur Kapitalisierung der nächsten Zukunft und der jüngsten Vergangenheit, entwickelt wurden. Wo es keine Grenzen für das Arbeiten gibt, gibt es auch keine für das Nicht-Arbeiten. Die Idee, Künstler fänden immer einen Weg zu arbeiten, ist eine der entscheidenden Charakteristiken der gegenwärtigen Kunst. Allerdings eine, die stets als Kulisse für die Ängste der Post-Arbeitsgesellschaft und für die Schaffung oder Demontage ethischer Grenzen dient. Liam Gillick, Why Work?, New York 2010

197.

Social Structures

The identification of ethical barriers emerges when making art under the stressed circumstances of the accusation. Circumstances and subjects appear as moral zombies – undead and relentless victims – which artists reject or accept in tension with the creation or rejection of ethical barriers. Ethics are not stable, easy to reach, feed or kill off. Under these stressed circumstances there is an assumption that art extends memory forwards and backwards. In other words, art is not necessarily synchronized to the present. What appears to be a methodology linked to present works is an illusion. Art deploys flexibility in order to account for the moral zombie – navigate the terrain of ethical mutability. Art extends and reduces memory using tools that were only developed to shorten memory – i.e. capitalize the near future and recent past. As there are no limits to work there are also no limits to not working. The idea that artists find a way to work is a defining characteristic of current art. But one that always takes place as a setting for postlabour anxieties and the creation and dismantling of ethical barriers. Liam Gillick, Why Work?, New York, 2010


Diese Seite this page The Horizon Produced by a Factory once It Had Stopped Producing Views, 2009 pulverbeschichtetes Aluminium powder-coated aluminium Maße variabel dimensions variable Installationsansicht installation view The Wright Restaurant, Guggenheim, New York

Facing page gegenüberliegende Seite Lauriston School Exterior Color Scheme, 2010 zusammengesetzte Paneele composite panels Maße variabel dimensions variable Gebäude in building in Hackney, London 1968, 2008 bemaltes Aluminium painted aluminium 2 Teile je 2 elements each 30 x 99 cm Unikat unique Collection Hadley Martin Fisher, New York

198.

Liam Gillick


Die gegenwärtige Arbeit untergräbt den Sinn oder die Möglichkeit unbegrenzter Freizeit. Unbegrenzte Freizeit ist nur eine Form der religiös fundierten Utopie. Ein Albtraum voller Jungfrauen und Villen. Gibt es dort Hunde? Ach, ich hoffe doch, dass es dort Hunde gibt. Büroangestellter zu sein, wäre wohl für einige Leute der Himmel auf Erden. Der Zusammenbruch der Grenzen zwischen Arbeit, Leben und Kunst durch direkte Aktion ist eigentlich eine Option, die sich mehr lohnt. Kunst scheint ergebnisorientiert zu sein, ist aber generell auf Aktion und Besetzung aus. Sie ist auf etwas gerichtet. Sie reicht über etwas hinaus. Sie hat nur innerhalb eines Kontextes Bedeutung, und dieser Kontext wird immer bestimmen, was für Aktionen notwendig sind, um den Kontext zu optimieren. So finden wir für alles die Erklärung in einer totalen Kommunikationsangst betreffend die Differenzierung. Kunst, betrachtet als ein generalisiertes Terrain der Kollektivität und Differenz, operiert im Wirklich-keitsfeld einer Angst, das die Vielzahl sich anscheinend widersprechender und simultan meldender Momente der Differenzierung widerspiegelt. Befürchtungsäußerungen über eine zu große Anzahl von Künstlern und Überproduktion, über den Fähigkeitsverlust, Qualität zu definieren – das sind alles ideologisch motivierte Aussagen, die sich einer Reihe geschlagener Autoritäten beugen, die allesamt auf die Erzielung eines neo-utopischen Konsenses, eines marktwirtschaftlichen Konsenses oder zumindest auf die Herrschaft eines anderen großen Konsenses setzen. Innerhalb der Gegenwartskunst wird all dies ständig angegriffen und ständig niedergeschlagen. Ansonsten würden die Dinge hinter der Autorität und Kontrolle zurückbleiben. Die entropische Qualität der strukturellen und kritischen Bahn der Kunst besteht in ihrem Widerstand. Liam Gillick, Why Work?, New York 2010

199.

Social Structures

Current work undermines a sense or possibility of infinite leisure. Infinite leisure is only one form of religiously based utopia. A nightmare full of virgins and mansions. Will there be dogs? Oh I hope there are dogs. To be a clerk would be heaven for some people. A breakdown of the barriers between work, life and art via direct action is a rather more rewarding potential. Art appears to be result based but it is generally action and occupation based. It is towards something. It reaches out. It only has meaning within a context and that context will always determine what activities might be necessary to improve the context. This leaves us explaining everything in a total communication anxiety about differentiation. Art viewed as a generalised terrain of collectivity and difference operates within a real of anxiety that is merely a reflection of multiple apparently contradictory moments of differentiations chiming simultaneously. Anxieties about too many artists, over production, lack of ability to determine quality are all ideologically motivated statements that defer to a defeated series of authorities who would prefer either the attainment of a neo-utopian consensus, a market consensus, or at least the regime of a big other consensus. All of these things are attacked and are permanently defeated within current art. Otherwise things will default towards authority and control. The entropic quality of arts structural and critical trajectory is its resistance. Liam Gillick, Why Work?, New York, 2010


Diese Seite this page Wall Diagrams from the 1990s and early 2000s, 2009 Farbe paint Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Wall Drawings from the 1990s and early 2000s, House of Art, Budweis, 2009

200.

Liam Gillick

Gegenüberliegende Seite facing page Lying on Top of a Building... The Clouds Looked no Nearer than when I Was Lying on the Street..., 2010 rostfreier Stahl stainless steel jeder Textlauf each run of text 60 cm x 18,28 m x 20 cm Installationsansicht installation view Fairmont, Pacific Rim, Vancouver


lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet... lying on top of a building... thecloudslookednonearerthanwhenIwaslyingonthestreet...

201.

Social Structures


Tribute to Nikos Stangos, 2006 Buchseite book page Thames and Hudson, London

202.

Liam Gillick


203.

Ein langer Spaziergang... Zwei kurze Stege...*


Diese Seite this page Adi Dassler, 1987 Acrylfarbe, Holz acrylic paint, wood 35 x 70 cm

GegenĂźberliegende Seite facing page Robert McNamara (Green Version), 1992 Ausdrucke printed paper 30,7 x 22 x 1 cm

Pinboard Project (Grey), 1992 gefärbte Jute (grau), Spanplatte, Ausdrucke dyed hessian (grey), chipboard, printed papers 100 x 100 x 4 cm

84 Diagrams, 1989 Schachtel je each box 31 x 22 x 3 cm 4 Schachteln Ausdrucke 4 boxes of printed paper various private collections

204.

Liam Gillick


Bereits an Architektur interessiert, wurde ich neugierig, dieses Interessensgebiet über Veränderungen und Umbauten hinaus auf feststehende Innenräume zu erweitern. Ich mochte es schon immer, mögliche Gebäude zu entwerfen. Das wurde in den späten 1980er Jahren immer einfacher, nachdem ich begonnen hatte, einen frühen Apple Computer und ein einfaches Grafikprogramm zu benutzen. Die Tatsache, dass ich in der Lage war, an einem Tag 200 Designs zu produzieren, grenzte mein Verlangen, Gebäude zu entwerfen von demjenigen eines Architekten ab, der sie mit bestimmter Absicht in kleinen Mengen und für besondere Plätze zeichnete. Die Zeichnungen sind stets sehr schmal und auf 21 x 30 cm großem farbigen Papier ausgedruckt. Das Papier gab es in 42 verschiedenen Farben, es war das größte Spektrum eines Herstellers, das ich zu jener Zeit finden konnte. Diese Zahl korrespondierte zufällig mit der Anzahl der Diagramme, die man gleichzeitig auf dem Computerschirm aufrufen konnte, weshalb ich die Diagramme auch jeweils als Multiples von 42 bündelte (beispielsweise „84 Diagrams“ oder „168 Diagrams“). Grundsätzlich sehen die Diagramme modernistischer oder internationalistischer Architektur ziemlich ähnlich aus, was freilich damit zusammenhängt, dass nur die Vorderansicht berücksichtigt wird. Die Präsentationsweise war immer geradlinig – Papier, das auf die Wand geklebt oder in Archivboxen aus Pappe zum Gebrauch bereitgehalten war. Eine Edition von „84 Diagrams“ wurde von Karsten Schubert in London aufgelegt. Liam Gillick, Unveröffentlichte Notizen, 1996

205.

Work from the 80s and 90s

Having a certain interest in architecture I was curious to extend it beyond alterations to fixed interiors. I always liked conceiving potential buildings and this became easier in the late Eighties once I started using an early Apple computer and a basic graphic programme. The fact that I might produce 200 designs in a day marked out my desire to propose buildings as different from that of an architect with a specific reason to draw them in small numbers and for particular places. The drawings are always quite small and printed on 21 x 30 cm sheets of coloured paper. The paper was in 42 different colours, the widest range by one manufacturer that I could find at the time. This number happened to correspond with the number of diagrams you could review on the computer screen simultaneously, therefore I would always bundle and box the diagrams in multiples of 42 (e.g. “84 Diagrams” or “168 Diagrams”) Generally the diagrams look quite like modernist or Internationalist architecture yet this is partly due to the fact that only the front elevation is considered. The method of presentation was always straightforward, paper glued straight onto the wall or available for use in cardboard boxes. An edition of “84 Diagrams” was published by Karsten Schubert, London. Liam Gillick, Unpublished Notes, 1996


Diese Seite this page For Liam Gillick Contact…, 1992 Notizbuch notebook 20 x 15 cm Installationsansicht installation view The Significance of this Structure…, 1993 Collage collage 42 x 30 cm Collection Delphine Pastor, Monte Carlo

206.

Liam Gillick

Gegenüberliegende Seite facing page Documents (with Henry Bond), 1990–1993 100 Fotografien in verschiedenen Formaten 100 photographs in various formats Texte texts


Eine Reihe von Arbeiten, die parallel zu den üblichen Medienagenturen wie Tageszeitungen und TV-Nachrichtensendern operieren. Während einer Zeitspanne mehrerer Jahre haben die Künstler exklusive Informationen sowie unveröffentlichtes Material von Organisationen wie zum Beispiel der Press Association erhalten und nahmen an den aufgelisteten Pressekonferenzen teil. Nach einer Periode der Beratschlagung wird die Arbeit in Gestalt schwarz-weißer oder farbiger Bilder formalisiert, diese werden gerahmt und mit einem Text versehen. Die Arbeit fungiert als Weg, parallele Informationsstrukturen in Anspruch zu nehmen. Sie stellt einen Raum für eine Debatte zwischen zwei Künstlern zur Verfügung und eröffnet zugleich die Möglichkeit, bestimmte Sachverhalte der Repräsentation zu hinterfragen – und zwar hinsichtlich unserer Wahrnehmung der Relation von Autorität und ‚Event‘, einem Schlüsselsymbol unseres Verständnisses der Art und Weise, wie soziale Machtstrukturen organisiert sind. Liam Gillick, Unveröffentlichte Notizen, 1996

207.

Work from the 90s

A series of works that operate in parallel to the standard media agencies such as newspapers and television news companies. Over a period of years the artists have obtained prior information and pre-edited material from organisations such as the Press Association and attended the events listed. After a period of negotiation the work is formalised as black and white or colour images, framed and accompanied by a text. The work functions as a way to engage with parallel information structures. It provides a site for debate between the two artists and a way to question certain issues of representation in relation to our perception of authority in relation to ‘the event’ as a key marker for our understanding of the way social power structures are organised. Liam Gillick, Unpublished Notes, 1996


Diese Seite this page Discussion Island Moderation Platform, 1997 Aluminium, Plexiglas aluminium, Plexiglas 5 x 240 x 240 cm Installationsansicht installation view Esther Schipper, Berlin, 1997 Städtische Galerie im Lenbachhaus München, Dauerleihgabe Sammlung KiCo Big Conference Centre Limitation Screen, 1998 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 240 x 300 x 30 cm Installationsansicht installation view Robert Prime Gallery, London, 1998 private collection, London The Continuing Sequence of Events Must Have Started and then Spun off from this Place. Seven-Up Coloured Curtains?, 1998 großes Glas, acht Dosen Seven-Up large glass, eight cans of Seven-Up Maße variabel dimensions variable Installationsansicht installation view Robert Prime Gallery, London, 1998 private collection, Köln

208.

Liam Gillick

Gegenüberliegende Seite facing page Del Charro, 1994 Glühbirnen, Schreibpapier, Stifte, Früchte, Flasche Jim Beam, Flasche Ballentine’s Whisky, Tape, Kartonage, Textausdrucke, Kartons light bulbs, writing paper, pencils, fruit, bottle of Jim Beam, bottle of Ballentine’s Whisky, tape, card-box, printed text, storage boxes Maße variabel dimensions variable Installationsansicht installation view Surface de Reparation, FRAC Bourgogne, 1994 private collection, Italy Big Conference Platform Platform, 1998 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 5 x 240 x 360 cm Installationsansicht installation view Big Conference Centre, Orchard Gallery, Derry, May 1998 Collection Tate, London


Diese Serie basiert auf dem Plan für ein paar Objekte aus einer parallelen Zukunft und hebt an in einer Gegenwart, die neben derjenigen herläuft, von der wir glauben, sie stünde zur Verhandlung. Es handelt sich also um einen rückläufigen Prozess, der es erfordert, zunächst einige Dinge und Effekte zu erzeugen, um ein neues Qualitätsniveau berichtender Vorschau realisieren zu können. Ganz bestimmte klare Quellen sind benutzt worden, und die offensichtlich zutreffenden Teile dieser Texte wurden zugunsten derjenigen Elemente verworfen, von denen es scheint, dass sie sich nicht bewahrheitet haben. Sodann ist ein Plan für die Verhandlung zukünftiger sozialer Beziehungen aufgestellt worden; verhandelt wird dabei von einer Reihe von Startpunkten aus, die eher unmittelbar außerhalb denn in unserer eigenen Zeit angesiedelt sind. Also ein Vorstoß, die Probleme zu umschiffen, die sich aus unserer Bewußtheit des Zusammenbruchs des Ursache-Wirkung-Schemas ergeben. Ist es denn unvernünftig, über eine Zukunft nachzudenken, die auf einer Gegenwart basiert, die nicht stattfindet? In Ausstellungssituationen wird eine Anzahl von Basiselementen für die Entwicklung des Berichts herangezogen. Diese Aspekte beinhalten Diskussion, Abschottung, potenzielle Isolation und eine geschriebene Sprache. Liam Gillick, Unveröffentlichte Notizen, 1996

209.

Work from the 90s

This series is based upon the proposal of a number of objects from a parallel future. Operating from the starting point of a present that runs alongside the one we think we are negotiating. A reverse process where it is necessary to produce some things and some effects in order to begin the realisation of a new level predictive report. Certain transparent sources have been used and the apparently accurate parts of these texts have been discarded in favour of the elements that appear to have not come true. A negotiation of future social relations is then proposed which operates from a series of starting points next to, rather than within our own time. An attempt to get around the problems posed by our awareness of the collapse of cause and effect. Is it any less reasonable to think about a future based on a present that is not taking place? In exhibition situations a number of basic elements are considered in order to develop this report. Those aspects include discussion, insulation, isolation and written language. Liam Gillick, Unpublished Notes, 1996


Diese Seite this page Untitled (Door Pieces) a.k.a. Doors from Dijon, 1997 renovierte Türen, gelbe Farbe renovated doors, yellow paint Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, McNamara Papers, Erasmus and Ibuka! Realisation and The What if? Scenarios, Le Consortium, Dijon, 1997 (The What if? Scenario) Second Stage Discussion Platform and Surface Designs, 1996 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 200 x 60 x 60 cm Installationsansicht installation view Liam Gillick, Erasmus Is Late in Berlin ‘versus’ The What if? Scenario, Schipper & Krome, Berlin, 1996 private collection, Köln

210.

Liam Gillick

Gegenüberliegende Seite facing page Discussion Island Resignation Platform, 1997 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 5 x 240 x 360 cm Installationsansicht installation view documenta X, Kassel, 1997 FER Collection Dr. Robert Buttimore, 1997 Farbdruck c-print 50 x 40 cm Collection Paul Mittleman, Los Angeles


Die fundamentalen Veränderungen, die unsere Empfindung von Entwicklung hervorrufen, hängen mit dem Einsatz von Projektion und Szenarien zusammen. Was passiert mit dir, wenn du realisierst, dass sich der Alltag ändert? Solange die Leute im Allgemeinen noch an Gott oder ein gegebenes System sozialer Strukturen glaubten, blieb der Alltag stets derselbe. Nachdem diese Idee aber in Frage gestellt worden war, wurde eine ausgeklügelte ökonomische Vorausplanung möglich. Wenn diese überhandnimmt, wird der Kapitalismus möglich; denn jetzt kann man entscheiden, na gut, vielleicht gefällt es mir, so wie jetzt nächste Woche zehn Paar Socken zu verkaufen. Sicher, wenn man noch an ältere religiöse Strukturen glaubte, besaß man seinen festen Platz; man verkaufte zehn Paar Socken, nicht zwanzig Paar die Woche, weil einem Gott den einen Platz zugewiesen hatte, und an diesem verkaufte man eben zehn Paar Socken – und hatte Pech, wenn man Hunger litt. Freilich gab es auch Widerspruch zu diesem Modell, aber es hielt sich ganz gut bis zum Beginn der industriellen Revolution. So ist die Frage der Vorausplanung durchaus zentral, zumal der Versuch hinzutritt, so flexibel zu werden wie das dynamischste System innerhalb der Gesellschaft. Während die Strategen mehr und mehr nach Authentizität streben und noch analytischer werden wollen, treiben sie die Entscheidungen über das Morgen voran. Die Idee der Vorausplanung, so wie wir sie anwenden, dient dagegen immer noch als Platzhalter für weit ausgreifende Utopien. Wir erkunden also die Idee der Vorausplanung, um sie einzufordern und sie vor der Abnutzung durch dynamische Gruppierungen zu schützen. Das heißt, wir haben jetzt die Pflicht, einen Großteil unserer Zeit damit zuzubringen, auf die Geschichte und Genealogie der Idee der Projektion und des neuen Tages zu schauen. Liam Gillick, Unveröffentlichte Notizen, 1997

211.

Work from the 90s

The fundamental changes that led to our sense of development are connected to the use of projection and scenarios. What happens to you when you realise that everyday is not the same? Before that, when people generally believed in God or in a given system of social structures, everyday was kind of the same. Once this idea was challenged you got the possibility of sophisticated economic projection. When you get a domination of projection you also get the possibility of capitalism, because you can decide, well, maybe next week I would like to be in this position, I’m currently selling ten pairs of socks a week but I would like to project that in a weeks time I’ll be selling twenty pairs of socks. Of course, if you believe in older religious structures, your place was to sell ten pairs of socks, it was not to sell twenty pairs of socks a week because God had given you your place, and your place was to sell ten pairs of socks and tough shit if you starved. Of course people contradicted this model, but it holds up pretty well until the Industrial Revolution. So this question of projection is central, linked to an attempt to become as flexible as the most dynamic systems in the society. While strategists try to become more and more authentic, and more analytical, they also get on with deciding what it’s going to be like tomorrow. We still use the idea of projection on a day to day basis as the replacement for far reaching utopias. So we investigate the idea of projection in order to claim and keep it from being used by dynamic groupings. We now have an obligation to spend most of our time looking at the history and genealogy of the idea of projection and tomorrowism. Liam Gillick, Unpublished Notes, 1997


Diese Seite this page So Were People this Dumb before Television?, 1998 Vinylbuchstaben vinyl text Maße variabel dimensions variable Installationsaussicht installation view Liam Gillick, John Miller, Joe Scanlan, RAK Wien, Februar 1998

Gegenüberliegende Seite facing page Erasmus aß zehn Jahre Opium #2, 1997 Leuchtanzeige, programmierter Silikonchip lamp technique clock, programmed silicon chip Maße variabel dimensions variable Installationsansicht installation view documenta X, Kassel, 1997

McNamara Papers: towards a Documentary, 1997 Spanplatte, Beleuchtung, Klebestreifen, Kameras, Ausgabe von „Erasmus Is Late“, Ausgabe von „Ibuka!“ chipboard, lights, duct tape, cameras, copy of “Erasmus Is Late”, copy of “Ibuka!” Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Another Shop in Tottenham Court Road, Transmission Gallery, Glasgow, 1997

Erasmus Is Late Complete Prototype Manuscript File, 1995 gelbes Papier, Ausdrucke, Kordel yellow Paper, printed paper, twine 30 x 21 x 25 cm Installationsansicht installation view Liam Gillick, Part 3, Basilico Fine Arts, New York, 1995. Collection Alberto and Maria de la Cruz, Puerto Rico

212.

Liam Gillick


Das Buch „Erasmus Is Late“ handelt von einem Dinner in London, das zwischen 1810 und 1997 hin und her springt. Die Kenntnis, dass dieses Dinner in der Nacht vor der Neudefinition des Mobs als ,die Arbeiter‘ stattfindet, erzeugt die zentrale Spannung. Es ist das letzte Mal, dass sie als loser Haufen betrachtet werden konnten, und ab diesem Augenblick muss jede Position innerhalb der Gesellschaft eher verhandelt als diktiert werden. Von diesem Tag an ist der Alltag ein anderer, die nahe Zukunft ist im Groben vorhersehbar und potenziell veränderbar. Wir sind gewachsen. Moderne Destabilisierung ist in Gang gekommen. Das Buch funktioniert auch als Führer durch London, der Protagonist passiert verschiedene Schauplätze, wo sich freies Denken entfaltete. Eine Reihe von Leuten – alle in einem Zeitsprung begriffen – ist bei diesem Essen anwesend. Jeder Einzelne ließe sich als Parallelindividuum beschreiben. Zwar nicht im Zentrum irgendeiner partikulären Machtstruktur, aber im Entwicklungszentrum der Ideen anderer Leute. Der Gastgeber des Dinners taucht nicht auf, sodass der Abend als halber Fehlschlag und, damit verknüpft, in sanfter Resignation endet. Die Gäste sind sich nicht einig geworden über das Potenzial der Ereignisse dieser Nacht. Doch der Rest von uns wurde Zeuge von etwas sehr Speziellem – einer Debatte über die Debatte; der Bemühung, dem Potenzial quer durch die Zeit eine neue Fassung zu geben. Obwohl die Gelegenheit, eine spezifische Form vormarxistisch-republikanischer Revolution zu fördern, nicht wiederkommt, sind die Bedingungen, die den Aufstieg der Reformlinken und des demokratischen Marktmodells des späten zwanzigsten Jahrhunderts auslösten, offengelegt worden. Liam Gillick, Unveröffentlichte Notizen, 1996

213.

Work from the 90s

The book “Erasmus Is Late” concerns a dinner in London that flashes between 1810 and 1997. A central tension is created with the knowledge that this dinner is taking place on the night before the mob are re-defined as the workers. It is the last time they could be assessed as an incoherent group and from this point on any position in society has to be negotiated rather than given. From now on everyday is not the same, the near future is roughly predictable and potentially changeable. We have growth. Modern de-stabilisation has set in. The book also functions as a guide to London, the central character wandering around various sites for the development of free-thinking. A number of people are present at this meal, all involved in a time slip. Each could be described as a parallel individual. Not at the centre of any particular power structure but central to the development of other people’s ideas. The host of the dinner doesn’t turn up so the evening ends in relative failure combined with a degree of placid resignation. The guests have not come to terms with the potential of that night’s events. Yet the rest of us have witnessed something quite special. A debate about debate. An attempt to reframe potential across time. Although the opportunity to encourage a particular form of pre-Marxist republican revolution has been lost, the conditions that provoked the rise of the soft left and late Twentieth Century democratic market economies have been laid bare. Liam Gillick, Unpublished Notes, 1996


Diese Seite this page Prototype Erasmus Table #2 (Gent), 1994 Spanplatte, Vierkanttischbeine, Hardware, Papier, verschiedene Kunstwerke chipboard, square cut legs, hardware, papers, various art works Maße variabel dimensions variable Installationsansicht installation view On-Line, Gent, Belgium, 1995

Gegenüberliegende Seite facing page Everyday Holiday/La Fête au Quotidien (with Gabriel Kuri), 1998 Aufkleber, Konfetti, Beschilderung, Events Stickers, confetti, signage, events Maße variabel dimensions variable Installationsansicht installation view Liam Gillick and Gabriel Kuri, La Fête au quotidien, Le Magasin, Grenoble, 1996

Prototype Ibuka! Coffee Table/Stage (Act 3), 1995 2 Blatt Birkensperrholz, hölzerne Beine, Bücher („Erasmus Is Late“ und „Ibuka!“), Ausdrucke, 0,5 cm Glasscheibe 2 sheets of birch plywood, wood legs, books (“Erasmus Is Late” and “Ibuka!”), printed paper, 5mm plate glass sheet 240 x 240 x 10 cm Installationsansicht installation view Liam Gillick, Part 3, Basilico Fine Arts, New York, 1995 Fondazione Sandretto Re Rebaudengo, Turin

Floor Mounted Double White Rail, 1988 Plastik, Stahl plastic, steel 10 x 200 x 6 cm Collection Margaret Garlake, London

214.

Liam Gillick


Wir haben einige qualitative Höhepunkte skizziert, die in eine strukturierte Abfolge von Ferien- und Festtagen integriert sind. Vorstellung dabei ist, dass der zentrale Galerieraum von Le Magasin zum Ort verschiedener Gruppen und Einzelpersonen wird, die dort zusammenkommen und den Platz für ihre eigenen Vorhaben nutzen. Es geht um die Erstellung eines parallelen Veranstaltungskalenders, um die Einrichtung spezieller Tage, die eine Neubesinnung darüber gestatten, wie wir gedenken, feiern und kodifizieren. Wir haben einen grundlegendes materielles Rahmenkonzept vorgeschlagen, das eine gesellige Nutzung des Raumes erlauben sollte. Dieses Bezugssystem ist in enger Kooperation mit Le Magasin bereitgestellt worden. Wir haben das Projekt eher beaufsichtigt und produziert als konstruiert. Wie auch immer, der Schlüsselpunkt dieser Arbeit ist die Verteilung der Termine für spezielle ‚Everyday Holidays‘. Um dabei so effektiv als möglich vorzugehen, benötigten wir einige Informationen der Stadt über bereits feststehende Ereignisse, seien es Feiertage oder ganze Wochen, die dafür reserviert worden sind, die eine oder andere Sache zu promoten. Wir nahmen Rücksicht auf diesen Kalender, änderten und ergänzten ihn. Außerdem gibt es den Auftritt in der Galerie, der bestimmte Schlüsselelemente präsentiert. Und ergänzt wird das alles durch ein großes Display, das die verschiedenen besonderen Tage auflistet, und durch einen Platz der Information über das, was ‚heute‘ passiert. Desweiteren werden spezielle Tage, die für Le Magasin spezifisch sind, zelebriert – so z. B. gute Ausstellungen, Geburtstage und Feierlichkeiten. Liam Gillick und Gabriel Kuri, Notizen, 1996

215.

Work from the 80s and 90s

So we have outlined a number of quality moments held within the structure of series of holiday/celebrations. Offering the main central space of Le Magasin as a site for various groups and individuals to come together and use the place for their own purposes. The creation of a parallel calendar of events, special days that allow a reconsideration of how we commemorate, celebrate and codify. We have proposed a basic physical framework, which should allow convivial use of the space. This framework has been provided in close collaboration with Le Magasin. We have supervised and produced the project rather than constructed it. However, the key part of this work is the allocation of the dates involved as special ‘Everyday Holidays’. In order to do this effectively, we needed some information from the city about existing events including Saint’s days and weeks that are set aside to promote one thing or another. We reacted to this calendar, amended and added to it. There is a physical presence in the gallery providing certain key elements, all of this supplemented by a large panel which shows all the different special days and a space for information about what is happening ‘today’. In addition, special days that are specific to Le Magasin will be commemorated, for example, good exhibitions, birthdays and celebrations. Liam Gillick and Gabriel Kuri, Notes, 1996


Diese Seite this page Discussion Island Dialogue Platform, 1997 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 2 Teile je 2 elements each 5 x 120 x 120 cm Esther Schipper We Are Medi(evil) (with Angela Bulloch), 1994 Bohrung, Video, Wiese hole, video, meadow Maße variabel dimensions variable Installationsansicht installation view WM/Karaoke, Portikus, Frankfurt am Main, 1994

216.

Liam Gillick

Gegenüberliegende Seite facing page Stoppage, 1995 kuratiertes Soundprojekt curated sound project Lautsprechersystem speaker system Maße variabel dimensions variable Installationsansicht installation view Stoppage, Villa Arson, Nice, 1995 Inside now, We Walked into a Room with Coca-Cola Coloured Walls, 1998 Farbe paint Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Up on the Twenty Second Floor, Air de Paris, April, 1998 private collection


Als Antwort auf die Einladung, die Möglichkeit breiterer kultureller Belange zu erörten, handele es sich dabei um eine strukturelle Metapher oder um buchstäbliche Aktivitäten wie z. B. Fußball oder Karaoke, wurde eine mittelalterliches Szenario vorgeschlagen; also eine Überprüfung der Positionen einer Vor-Fußball- und Vor-KaraokeZeit. Außerhalb des Portikus wurde ein Loch gegraben und eine Wiese aus Wildblumensaat über das gesamte vorhandene kontrollierte Parkareal gepflanzt, das das Gebäude umgibt. Dazu wurde ein Video produziert, das die beiden Künstler zeigt, wie sie die hinter dieser Arbeit stehenden Gedanken erklären. Leicht verkleidet, nimmt man die Künstler fast als eine Art von Terroristen wahr. Eine Botschaft von einer Zeit zur anderen. Ein Buch, das die Fundstücke aus dem Loch dokumentiert und die Parameter des Projekts absteckt, wurde von einer Gruppe Archäologen geschrieben und vom Portikus produziert. Liam Gillick und Angela Bulloch, Notizen, 1994

217.

Work from the 90s

In response to the invitation to consider the possibility of broader cultural concerns as a structural metaphor as much as literal activity, such as football and Karaoke, a medieval scenario was proposed. A consideration of pre-football and prior Karaoke positions. A hole was dug outside the Portikus and a meadow of wild-flower seeds planted over the existing controlled park area that surrounds the building. In addition a video was produced that features the two artists explaining the thinking behind the work. Somewhat disguised, the artists are seen in a quasi terroristic mode. A message from one time to another. A book was written by a number of archaeologists and produced by the Portikus that documents the findings within the hole and sets out the parameters of the project. Liam Gillick and Angela Bulloch, Notes, 1994


Diese Seite this page Discussion Island Tubular Bells, 1996 verchromter Stahl, verchromte Kette, Splinte, Haken chromed steel, chromed chain, split pins, hooks Maße variabel dimensions variable various private collections Stoppage, 1995 Kuratiertes Soundprojekt curated sound project Buchladen, Sperrholz, farbiges Licht books shop, plywood, colored lights Maße variabel dimensions variable Installationsansicht installation view Stoppage, CCC, Tours, 1995

218.

Liam Gillick

Gegenüberliegende Seite facing page Discussion Island Preparation Zone, 1998 Wodka, Silber- und Goldglimmer, Wasser, Eimer, Mopp Vodka, silver and gold glitter, water, bucket, mop Maße variabel dimensions variable Installationsansicht installation view Kamikaze, Berlin, 1998 Applied Complex Screen, 1999 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 195 x 360 x 5 cm Installationsansicht installation view Hayward Gallery Turnaround Project, 2000 Arts Council Collection, London


Am Beginn der das Projekt betreffenden Diskussionen wurde entschieden, die Räumlichkeit des ehemaligen Buchladens im CCC in Tours, Frankreich, zu bespielen. Das war teilweise akustischen Erwägungen geschuldet, teilweise aber auch der Tatsache, dass es unnötig schien, eine große leere Örtlichkeit für ein Projekt mit Klangarbeiten zu benutzen. Obwohl der Buchladen in seinem früheren Zustand ziemlich erfolgreich war, schien er doch ein wenig beengt und renovierungsbedürftig. Bei der Ankunft in Tours wurden die alten Buchregale, eingebauten Möbel und Ausstellungsvitrinen entfernt und der Raum in Weiß frisch gestrichen. Bis dahin hatten wir also nur einen weiteren weißen Raum geschaffen. Nach weiteren Diskussionen mit den Leuten, die am CCC arbeiteten, schien es interessant zu sein, an diesem frisch geputzten Ort wieder einen Buchladen einzurichten. Ich beschloss, einen niedrigen Tisch aufzustellen, um einige der zuvor schon im Buchladen erhältlichen Bücher zu präsentieren; zugleich sollte auf ihm das Soundsystem platziert werden, mit dem das „Stoppage Project“ übertragen werden sollte. Um dem Gefühl der Beengung zu begegnen, entfernte ich einige der Deckenplatten und änderte die Beleuchtung. Man kann behaupten, dass verschiedene Formen von Kunstprojekten mit offenem Ausgang der Bestätigung bedürfen, dass ein Moment der Zerstreuung den Schlüssel für möglichen Erfolg oder Misserfolg darstellt. Die Idee, einen neuen Buchladen parallel zur Ausstellung von potenziellen und realisierten Arbeiten einer großen Anzahl von Künstlern einzurichten, erlaubt dem Ausstellungsbesucher, an vielfältigen Recherchen teilzunehmen. Das bringt die Fragen voran, die die Zeitbeanspruchung und Parallelformen der Informationsübertragung betreffen. Liam Gillick, Unveröffentlichte Notizen, 1996

219.

Work from the 90s

At the beginning of discussions concerning this project it was decided to use the old bookshop space of the CCC in Tours, France. This was partly due to acoustic considerations and partly due to the fact that it seemed unnecessary to use a large empty space for a project of sound works. Although the bookshop in its earlier state was quite successful, it seemed a little claustrophobic and was in need of renovation. On arrival in Tours the old bookshelves, built-in furniture and display cabinets were removed and the room re-painted in white. At this point we had merely created another empty white space. After further discussions with the people who work at the CCC it appeared interesting to re-build a bookshop in this newly cleaned out place. I decided to make a low table in order to display some of the books previously available in the bookshop and also as a base for the sound-system that relays the “Stoppage Project”. In order to reduce the feeling of claustrophobia I removed some of the roof panels and also altered the lighting. It is arguable that certain types of openended art projects require the recognition that an element of distraction is a key to their potential success or failure. The idea of creating a new bookshop in parallel to an exhibition of potential and realised works by a large number of artists allows for the visitor to the exhibition to participate in form of multiple browsing. Pushing forward questions about the occupation of time and parallel forms of information transferral. Liam Gillick, Unpublished Notes, 1996


Diese Seite this page Discussion Island Big Conference Screen, 1997 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 240 x 360 x 30 cm Installationsansicht installation view Hospital, Galerie Max Hetzler, 1997 private collection, Köln

Gegenüberliegende Seite facing page Ibuka! Announcement #1, 1995 Klebebuchstaben auf Fenster Adhesive letters on window Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Ibuka! (Part 2), Künstlerhaus, Stuttgart, 1995

The Horse Sucked my Hand (with Sarah Morris), 1997 Farbdruck c-print 200 x 100 cm Rubell Family Collection, Miami

Ibuka! Environment, 1995 Sägemehl, Halogenleuchten, farbige Folie (dunkelblau) Sawdust, halogen lights, colored sheets of gel (dark blue) Maße variabel dimensions variable Prototype Ibuka! Coffee Table/Stage (Act 1) Spanplatte, Holz, Ausdrucke, Plexiglas chipboard, wood, printed paper, Plexiglas 20 x 150 x 250 cm

220.

Liam Gillick


Die Produktion eines Musikal-Szenarios, das sich auf eine der Schlüsselfiguren des Buches „Erasmus Is Late“ konzentriert. Eine misslungene Adaption. Dafür müssen ein Bühnenbild eingerichtet und verschiedenste Möglichkeiten entwickelt werden. „Ibuka!“ ist eine musikalische Unterhaltung, die von den Wurzeln unserer aktuellen Situation und dem embryonalen Stadium des Sozialismus sowie des westeuropäischen Kapitalismus zu Beginn des neunzehnten Jahrhunderts handelt. Trotz der Tatsache, dass weder die Worte noch die Musik notiert sind, handelt es sich um ein Lied- und TanzSpektakel. Für eine Reihe von Ausstellungen werden de-formalisierte und provisorische Lösungen entworfen, die als Reaktion auf die möglichen Situationen, wie sie das Buch entwirft, verstanden werden müssen. Auch wurde eine ganze Reihe von „Ibuka!“-Prototyp-Objekten wie etwa Banner, Tische respektive Bühnen und Logos produziert. Liam Gillick, Unveröffentlichte Notizen, 1996

221.

Work from the 90s

The production of a musical scenario that focuses on one of the key characters in the book “Erasmus Is Late”. A corrupted adaptation. So a stage setting must be visualised and various possibilities explored. “Ibuka!” is a musical entertainment that deals with the roots of our current situation and the embryonic status of socialism and Western European capitalism at the beginning of the Nineteenth Century. It’s a song and dance spectacular, despite the fact that none of the words or music have been written. For a number of exhibitions, de-formalised and provisional solutions were proposed as a reaction to the potential situations proposed within this book. A number of “Ibuka!” prototype objects were also produced such as banners, table/stages and logos. Liam Gillick, Unpublished Notes, 1996


Diese Seite this page Ibuka! (Part 2) (Stuttgart), 1995 bemaltes Holz, Gummibänder, Exemplar von „Ibuka!“ painted wood, ribbons, copy of “Ibuka!” Maße variabel dimensions variable Fondazione Sandretto Re Rebaudengo, Turin Instructions (Il mistero dei 100 dollari scomparsi), 1992 kuratiertes Projekt curated project installation view Installationsansicht Gio’ Marconi, Milan, 1995

222.

Liam Gillick

Gegenüberliegende Seite facing page Discussion Island: Item A001, 1996 Silberglimmer silver glitter Maße variabel dimensions variable Installatinsansicht installation view I Feel Explosion, Manchester, 1996 Collection Giorgio Sadotti, London Delay Screen, 1999 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 240 x 360 x 30 cm private collection, New York


Eine Ausstellung in Mailand, wo die Arbeit in der Ausstellung auf Anweisungen der eingeladenen Künstler verfertigt wurde. Diverse Teile, die eine Anzahl verschiedener Produktionsverfahren erforderlich machten. In gewisser Weise bereinigte die Show den Einfluss konzeptueller Strategien in einer Situation, wo über die Klarheit der Intention und des Resultats debattiert werden durfte. Die Ausstellung unterbreitete eine ganze Reihe von Parallelvorschlägen, die es erlaubten, das fragmentierte Wesen der zeitgenössischen Kunstpraxis zu verstehen. Nachträglich ist ein Archiv mit allen dazugehörigen Dokumentationen zusammengestellt worden.

An exhibition in Milan where the work in the show was produced on instructions from the invited artists. Diverse pieces, that involved a number of different production processes. In some ways the show reassessed the impact of conceptual strategies within a situation where the clarity of intention and result was now debatable. The exhibition offered a parallel set of proposals that allowed understanding of the fractured nature of contemporary art practice. An archive has subsequently been compiled with all related documentation from the show. Liam Gillick, Unpublished Notes, 1996

Liam Gillick, Unveröffentlichte Notizen, 1996

223.

Work from the 90s


Diese Seite this page Isolation Platform, 1999 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 3 x 120 x 120 cm Collection of Casey Kaplan, New York Single Leaning Corner Rail (White), 1989 Plastik, Stahl plastic, steel 150 x 3,4 cm Durchmesser (diameter) Collection Nicolas Logsdail, London

224.

Liam Gillick

Gegenüberliegende Seite facing page Discussion Island Retribution Rig, 1997 eloxiertes Aluminium, Beleuchtung anodised aluminium, lights 240 x 50 x 240 cm Installationsansichten installation view Enterprise, ICA Boston, 1997 Ein Rückblick aus dem Jahre 2000–1887 (with Matthew Brannon), 1999 Buch, Plakat book, poster Maße variabel dimensions variable Installationsansicht installation view 1+3 = 4x1, Galerie für Zeitgenössische Kunst, Leipzig, 1999


Das Projekt ist eine Zusammenarbeit zwischen Liam Gillick und Matthew Brannon. Von Susanne Gaensheimer zur Teilnahme an der Ausstellung 1+3 = 4x1 eingeladen, lud Liam Gillick Matthew Brannon ein, an der visuellen Umsetzung von Liam Gillicks Idee einer Wiederveröffentlichung des Buchs „Looking Backwards“ von Edward Bellamy zu arbeiten. Matthews Design stattet das Cover mit einer Matrix von weißen Linien auf einem einfachen farbigen Hintergrund aus. Auch der Text erscheint invertiert in Weiß.

The project is a collaboration between Liam Gillick and Matthew Brannon. Having been invited to participate in 1+3 = 4x1 by Susanne Gaensheimer, Liam Gillick invited Matthew Brannon to work on the visualisation of Liam Gillicks idea to republish the book “Looking Backward” by Edward Bellamy. Matthew’s cover design features a matrix of lines in white on a simple coloured background. The text is also reversed in white. Any information to be carried on the back-cover of the book needs to be decided.

Jede Information auf der Buchrückseite muss entschieden werden. The version of the text that we will use needs to be decided. Die zu verwendende Version des Textes muss entschieden werden. Es soll keine Einleitung zu diesem Buch geben und auch keine Fußnoten, nur eine kurze Anmerkung, die erklärt, dass wir das Buch wiederveröffentlicht haben und wann das geschehen ist.

There should be no introduction to the book, and no footnotes, just a short note explaining that we republished the book and when it took place. We think there should be only 500 copies printed of the book.

Wir brauchen nur 500 Exemplare des Buches zu drucken. Es wird keinen Auftritt innerhalb der Galerie geben, und der uns zugewiesene Platz soll an andere Künstler weitergereicht werden.

There should be no physical presence within the gallery, and the space allocated to us should be given over to other artists. Our representation in the show only exists as a distributed book.

Unsere Teilnahme in der Show besteht einzig in der Form eines vertriebenen Buches. Liam Gillick und Matthew Brannon, Notizen, 1999

225.

Work from the 80s and 90s

Liam Gillick and Matthew Brannon, Notes, 1999


Diese Seite this page Lost Paradise Information Service (Archive), 1994 Basis von Jorge Pardo with base by Jorge Pardo verschiedene Papiere various papers Maße variabel dimensions variable Installationsansicht installation view Lost Paradise, Kunstraum, Wien, 1994 McNamara, 1994 Brionvega Algol TVC 11R, 35 mm-Film umkopiert, Tisch (optional), Kopien verschiedener Entwürfe zum Film „McNamara“ sowie zusätzlich die Kopie des Filmskripts für den Besitzer der Arbeit Brionvega Algol TVC 11R, 35mm film transferred onto appropriate format, table (optional), copies of various drafts of the film “McNamara”, additional copy of film script written for owner of work Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, McNamara, Schipper und Krome, Köln, 1994 Esther Schipper, Michael Trier

226.

Liam Gillick

Gegenüberliegende Seite facing page McNamara Motel, 1997 Neonschrift neon Maße variabel dimensions variable Installationsansicht installation view Dublin debtors prison Le Labyrinth moral (with Philippe Parreno), 1995 kuratiertes Projekt curated project Installationsansicht installation view Le Labyrinth moral, Le Consortium, Dijon, 1995


Das Manuskript dreht sich um die Arbeit von Robert McNamara, dem früheren Verteidigungsminister unter John F. Kennedy. Der Film enthält eine Reihe von Figuren einschließlich J.K. Galbraith, Robert McNamara, Herman Kahn und zwei Typen, deren Codenamen ‚Fiddle‘ und ‚Faddle‘ lauten. Ein Großteil des Films spielt im Tunnelsystem unter dem Weißen Haus in Washington DC. Wir folgen McNamara und seiner stürmischen Beziehung zu Herman Kahn, dem Kopf des RAND Instituts. Es handelt sich um einen Action-Film, der die Figuren aus der unmittelbaren Umgebung des Präsidenten zur Zeit des Anschlags ins Visier nimmt. Es gab kein Verlangen, JFK einzubauen, denn die Entscheidung, den Film um ihn herum zu spinnen, war zum Teil der Absicht geschuldet, einen Zeitraum der jüngsten Geschichte zu fokussieren, über den in einem großen Querschnitt der Gesellschaft ziemlich ausgeklügelte Meinungen vorherrschen. Eine ganze Menge des Recherchematerials für den Film stammt aus einem handschriftlich kommentierten Exemplar einer Biografie von JFK, das von irgendjemandem, der eine Buchbesprechung verfasste, mit Markierungen versehen und in einem Londoner Haus zurückgelassen worden war. Dieses kommentierte Exemplar wurde zur selben Zeit entdeckt, als ich mir überlegte, ein Filmskript zu verfassen, um damit mein Interesse an parallelen Positionen zwischen Kunst und verwandten Szenarien auszuweiten. Das daraus resultierende Projekt wurde zu einer Manipulation der Geschichte, indem es das Potenzial einer Begutachtung von Parallelgeschichten verschiedener Personen der zweiten Reihe heraufbeschwor. Die Manuskripte funktionierten zudem wie ein kondensierter Kern, der die Produktion einer Reihe spezifischer Projekte für verschiedene Ausstellungssituationen gestattete. Liam Gillick, Unveröffentlichte Notizen, 1996

227.

Work from the 90s

The script concerns the work of Robert McNamara, former Secretary of State for Defense under John F. Kennedy. The film features a number of characters including J.K. Galbraith, Robert McNamara, Herman Kahn and two characters code named Fiddle and Faddle. Much of the action takes place in tunnel systems that exist under the White House in Washington, DC. We follow McNamara and his stormy relationship with Herman Kahn, the head of the RAND Institute. This is an action film and concerns characters close to the president at the time of his assassination. There was no desire to include JFK, yet the decision to base the film around him was partly in order to focus on an area of recent history that a large cross section of society has relatively sophisticated opinions about. Much of the research material for the film was based on an annotated copy of a biography of JFK that had been marked by someone who was reviewing the book and left in a London house. This annotated copy was discovered at the same time as I was considering writing a film as an extension of my interest in parallel positions between art and similar set ups. The resulting project became a manipulation of history while provoking the potential of examining the parallel histories of certain secondary individuals. The scripts also functioned as a condensed core that allowed the production of a number of specific projects for different exhibition situations. Liam Gillick, Unpublished Notes, 1996


Diese Seite this page Museum Board, Luzern, 1994 Jute, Spanplatte, Ausschnitte aus Tattoo- und Frauenbasketball-Magazinen gold Hessian, chipboard, cuttings from Tattoo and Women’s basketball magazine 200 x 300 x 5 cm Installationsansicht installation view Backstage, Kunstmuseum Luzern, 1994 Oldnewtown, 1999 kuratiertes Projekt curated project Installationsansicht installation view Oldnewtown, Casey Kaplan, New York, 1999

228.

Liam Gillick

Gegenüberliegende Seite facing page Odradek Wall, 1998 Holz, Halogenlampen, Halterungen, Leitungen wood, halogen lamps, fittings, wiring Maße variabel dimensions variable Installationsansicht installation view Odradek, Bard College, September 1998 Schmerz in einem Gebäude/Pain in a Building/Doleur dans un immeuble, 1999 Halskette, Puppenkleiderstoffe necklace, puppet fabric Maße variabel dimensions variable


Ich bin in die Einrichtung einer Reihe paralleler Strukturen involviert, die alle nebeneinander fungieren. Mich interessiert es, Wege aufzuzeigen, auf denen es möglich sein könnte, den komplexen Kontext zu verstehen, innerhalb dessen Ideen und Visualisierungen von Ideen manifestiert werden, anstatt ständig eine Reihe offensichtlich transgressiver optischer Neuheiten zu verfeinern. Trifft man im Galeriekontext auf eines meiner Stücke, geht es nicht notwendigerweise um die Konsolidierung einer Serie von Ideen, die mit einer Serie von Objekten oder Bildern zusammenpassen sollte; vielmehr ist die Relation zwischen der materiellen und der geschriebenen Arbeit ein Teilaspekt paralleler Strukturierung. Die Worte beschreiben nicht die Arbeiten, und die Arbeiten illustrieren nicht die Worte. Beide operieren nebenaneinander. Kein einzelnes Element liefert ein komplettes Statement. Ich bin nicht daran interessiert, dass Situationen entstehen, in denen man Ursache und Wirkung auch nur grob vorhersehen könnte. Sprachlosigkeit wird unter Künstlern als Tugend geschätzt, was auf die Entwicklung psychologischer Forschung zurückzuführen ist, die ein Stereotyp des Wahnsinns einfach durch ein anderes ersetzte. Komplexität ist darauf keine Antwort an sich, doch hilft sie dem Künstler, nicht in die Falle beiläufiger Aussagen zu geraten. Wieder und wieder der Kult des authentischen Ausdrucks des Selbst. Vernebelung tritt nur dann auf, wenn die falsche Struktur zum Verständnis einer Reihe von Vorschlägen oder Statements angewendet wird. Sobald die Restrukturierung meiner Arbeit verstanden ist, werden sich alle potenziell obskuren Elemente geklärt haben. Liam Gillick, Notizen, 1998

229.

Work from the 90s

I am involved in the establishment of a series of parallel structures all of which work alongside each other. I am interested to set up ways in which it might be possible to understand the complex context within which ideas and visualisations of ideas are made manifest rather than to constantly refine a series of apparently transgressive visual novelties. When you come across one of my pieces in a gallery context it is not necessarily the consolidation of a series of ideas matched up to a series of objects and images, rather the relation between the physical work and the written work is part of parallel structuring. The words do not describe the objects and the objects do not illustrate the words. Both work alongside each other. No single element is a complete statement. I am not interested in setting up situations where cause and effect are roughly predictable. Dumbness is seen as a virtue among artists due to developments in psychological research that replaced one stereotype of mania with another. Complexity is not an answer to this in itself, it does however allow an artist to avoid falling into the trap of sidelined expression. The cult of self-expression again. Obscurantism is only evident when the wrong structure is applied to the understanding of a series of propositions or statements. Once the restructuring of my work is understood then any potentially obscure elements are clarified. Liam Gillick, Notes, 1998


Diese Seite this page Pinboard Prototype #2, 1992 Jute (grün), verschiedene Ausdrucke hessian (green), various printed papers 100 x 100 x 4 cm Installationsansicht installation view Wonderful Life, Lisson Gallery, 1993 private collection, London Discussion Island Border Think Tank, 1997 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 120 x 240 x 120 cm

230.

Liam Gillick

Gegenüberliegende Seite facing page The Trial of Pol Pot (with Philippe Parreno), 1998 Banner, Beleuchtung, Vinylbuchstaben, Plakate, Handpuppe banners, lighting, vinyl text, posters, glove puppet Maße variabel dimensions variable Installationsansicht installation view The Trial of Pol Pot, Le Magasin, Grenoble


„The Trial of Pol Pot“ hat nichts damit zu tun, einen besonderen historischen Moment zu dokumentieren. „The Trial of Pol Pot“ handelt von der Konstruktion einer skrupellosen Identität und der Art und Weise ihrer Vermittlung. Das Projekt bewegt sich in dem Bereich zwischen geradliniger Reportage und der Produktion narrativer Literatur. Als Ausstellung bezieht es die Beschriftung mit Ideen sowie die Konstruktion einer unspielbaren Rolle direkt auf den Wänden von Le Magasin mit ein. „The Trial of Pol Pot“ ist eine Ausstellungsstruktur, die auf einem Forschungsprojekt von Liam Gillick und Philippe Parreno basiert. Die Künstler haben ein Diskussionspapier unter einigen der Aufseher zirkulieren lassen. Ihrer eigenen Forschung und den Vorschlägen der Aufseher folgend, wurde eine Reihe grafischer Lösungen für den gesamten Raum von Le Magasin vorgeschlagen. Es wurde eine Maschine für den Formschnitt der Vinylbuchstaben beschafft und die Layouts für die einzelnen Räume vom Computerbildschirm direkt auf die Wände des Gebäudes übertragen.

“The Trial of Pol Pot” is not concerned to document a specific historical event. “The Trial of Pol Pot” concerns the construction of rogue identity and the way it is mediated. The project occupies the zone between straight reportage and the creation of narrative fictions. As an exhibition it involves the inscription of ideas and the construction of a unplayable characters directly upon the walls of Le Magasin. “The Trial of Pol Pot” is an exhibition structure based on a research project by Liam Gillick and Philippe Parreno. The artists circulated a discussion document to a number of supervisors. Following their own research and the suggestions of the supervisors a number of graphic solutions were proposed for the entire space of Le Magasin. A vinyl cutting machine was aquired and the layouts for the galleries have been translated directly from the computer screen to the walls of the building. Lighting has been adjusted and modifications are still being made to the discursive layouts at the suggestion of the supervisors.

Die Beleuchtung ist angepasst worden und es werden, entsprechend den Vorschlägen der Aufseher, weitere Modifikationen der diskursiven Layouts vorgenommen.

In addition, each supervisor has been invited to propose a singular solution to the gallery space. These ideas will be distributed as free copyright/public domain art works to visitors to the exhibition.

Außerdem wurde jeder Aufseher eingeladen, eine einmalige Lösung für den Galerieraum vorzuschlagen. Diese Ideen werden ohne Copyright als Gemeingut an die Besucher der Ausstellung ausgeteilt.

A puppet show, every Wednesday, will act as a guide for all the exhibition visitors.

Eine Puppenvorstellung, die jeden Mittwoch stattfindet, dient als Anleitung für die Ausstellungsbesucher.

231.

Work from the 90s


Diese Seite this page William H. Danforth (When Purity Was Paramount), 1998 Farbe paint Maße variabel dimensions variable Installationsansicht installation view British Council Gallery, Prague Post Discussion Revision Zone #1– #4 Big Conference Centre 22nd Floor Wall Design, 1998 Farbe, eloxiertes Aluminium, Plexiglas paint, anodised aluminium, Plexiglas Maße variabel dimensions variable Installationsansicht installation view Liam Gillick, Revision, Villa Arson, Nice, 1998 Collection du Musée national d’art et de culture Georges Pompidou, Paris

232.

Liam Gillick

Gegenüberliegende Seite facing page The Continuing Sequence of Events Must Have Started and then Spun off from this Place. Seven-Up Coloured Curtains?, 1998 großes Glas, acht Dosen Seven-Up large glass, eight cans of Seven-Up Maße variabel dimensions variable Installationsansicht installation view Robert Prime Gallery, London, 1998 private collection, Köln What if? Scenario Cantilevered Delay Platform, 1996 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 3 x 120 x 120 cm Collection of Andy and Karen Stillpass, Cincinnati


Jede Arbeit wird ungefähr ein Quadratmeter groß sein. Es gibt neun maßstabsgetreue Zeichnungen. Die Zeichnungen werden als Computerdiscs und Ausdrucke angeboten und können bis zu einem Monat vor dem Ausstellungsdatum geliefert werden. Der Titel der Show bezieht sich auf William H. Danforth, der zusammen mit dem Reformkostverfechter Dr. Ralston 1902 die Ralston Purina Company gründete. Danforth hatte es schon ein paar Jahre zuvor mit der Produktion von Tierfutter versucht. Weizenkeime werden traditionell aus der Maische ausgesondert, und zwar wegen ihrer Tendenz, das Futter schneller ranzig werden zu lassen. Danforth realisierte, dass die unbrauchbaren Weizenkeimlinge zu Frühstücksflocken verarbeitet werden konnten. Im Verlauf seiner Expansion ließ er sich den Slogan ,Wo Reinheit an erster Stelle steht‘ einfallen, und, noch wichtiger, er erfand ein Logo. Das Purina-Logo, das er entwickelte (ein Quadrat mit einem Schachbrettmuster), wird als eines der ersten modernen amerikanischen Corporate Identity-Symbole angesehen. Meine Inanspruchnahme dieser Referenz hebt die überraschend kurze Lebensdauer hervor, die das großartige Firmenlogo von seinen Ursprüngen in der Zeit von Danforth bis hin zu seiner konfusen Botschaft als Symbol des staatlichen Kapitalismus aufzuweisen hat. British Gas British Rail British Leyland British Steel British Telecom

The title of the show refers to William H. Danforth, who founded the Ralston Purina Company with health-food champion Dr. Ralston in 1902. Danforth had started out some years earlier, making animal feed. Wheat germ had traditionally been removed from the mash because of its tendancy to make the feed go rancid. Danforth realised that the waste wheat germ could be made into breakfast cereal. To go along with his expansion he came up with a slogan ‘where purity is paramount’ and most importantly a logo. The Purina logo that he developed (a square with a check pattern) is acknowledged as one the first modern American corporate identity symbols. My use of this reference exposes the surprisingly short life of the grand corporate logo, from its origins around the time of Danforth, to its confused message as a symbol for state capitalism. British Gas British Rail British Leyland British Steel British Telecom Liam Gillick, Prague, 1998

Liam Gillick, Prag 1998

233.

Each work will be approximately 1 metre square. Nine scale drawings. The drawings will be supplied as computer discs and printouts and can be provided up to one month prior to the date of the exhibition.

Work from the 90s


Diese Seite this page Surrogate Catalogue, 1994 Buch, Ausdrucke, Tisch book, printed paper, table Installationsansicht installation view Surface de Reparation 2, FRAC, Bourgogne, 1994 Discussion Island Yellow Think Tank, 1996 gelbes Ripstop, eloxiertes Aluminium yellow rip-stop, anodised aluminium 100 x 240 x 100 cm FER Collection, Deutschland

234.

Liam Gillick

GegenĂźberliegende Seite facing page Discussion Island: Projected Think Tank, 1997 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 120 x 120 x 120 cm Installationsansicht installation view Liam Gillick, Discussion Island, Basilico Fine Arts, New York, 1997 Discussion Island: Assessment Think Tank, 1997 eloxiertes Aluminium, Plexiglas, Kartonage anodised aluminium, Plexiglas, cardboard 120 x 240 x 120 cm Installationsansicht installation view Liam Gillick, Discussion Island, Basilico Fine Arts, New York, 1997


Aber nach der Bewegung der Kunst in den letzten Jahren hin zu kritischeren dokumentarischen Strukturen, macht sich ein Gefühl breit, in dem einige Arbeiten den Mangel präziser Kritik in der zeitgenössischen Kunst erneuern. Meine Kunst hatte immer mit konkreten ideologischen Territorien zu tun – warum hat es in Großbritannien keine Revolution gegeben; was bedeutete der Aufstieg der Thinktanks für die aktuelle politische Strategie; wie wird die nähere Zukunft in einer postutopischen Situation kontrolliert – und so weiter. Diese Fragen führen wie von selbst zu Handlungen innerhalb eines sozialen Bereichs, der durch die zeitgenössischen Medien, den neoliberalen Konsens geglättet wurde. Heutzutage wird ein erheblicher Teil der Regressansprüche und des Geldes dafür aufgewandt, Arbeit im öffentlichen und halböffentlichen Sektor zu schaffen. Alles, was ich in München sagen wollte, ist, dass wir auf diesem Territorium dieselben Fragen stellen und dieselben Spiele spielen sollten, wie wir es womöglich in den anderen der Kunst zur Verfügung gestellten Räumen tun. Liam Gillick, Interview mit Hans Ulrich Obrist, 2006

235.

Work from the 90s

But with the shift in art over the last years towards more critical documentary structures, there is a sense in which some work now replaces a precise critical lack in contemporary culture. My work has always been about concrete ideological territories – why was there no revolution in Britain; what was the effect of the rise of the think-tank on contemporary political strategy; how is the near future controlled in a post-utopian situation and so on. These questions lend themselves to operate within a social realm that has been smoothed out by contemporary media by the neo-liberal consensus. Today, a great deal of recourses and money are devoted to creating work for the public and semi-public sphere. All I was saying in Munich is that we should ask the same questions and play the same games in this territory as we might do in the other spaces for art. Liam Gillick, Interview by Hans Ulrich Obrist, 2006


A Volvo Bar (Fragment), 2010 Tintenstrahldruck inkjet print 114 x 76 cm


LIAM GILLICK Geb./Born 1964, Aylesbury, U.K. Lebt und arbeitet in London und New York Lives and works in London and New York

Literally No Place, Air de Paris, Paris Renovation Filter, Recent Past and Near Future, Arnolfini, Bristol Casey Kaplan, New York 2001

Firststepcousinbarprize, Hauser & Wirth & Presenhuber, Zürich Javier Lopez, Madrid Corvi-Mora, London Annlee You Proposes, Tate Britain, London Dedalic Convention, Salzburger Kunstverein

2002

The Wood Way, The Whitechapel Gallery, London Light Technique, Galerie Meyer Kainer, Wien Rüdiger Schöttle, München

2003

Hills and Trays and …, Schipper & Krome, Berlin … Punctuated Everydays, Max Hetzler, Berlin Por Favor Gracias de Nada (mit/with Gabriel Kuri), Kurimanzutto, México City Exterior Days, Casey Kaplan, New York Communes, Bars and Greenrooms, The Powerplant, Toronto Projects 79: Literally, Museum of Modern Art, New York A Film, a Clip and a Documentary, (mit/with Sean Dack), Corvi-Mora, London

2004

Construccion de Uno, Javier Lopez, Madrid A Group of People, Air de Paris, Paris Aspen Art Museum, Aspen Övningskörning (Driving Practice), Milwaukee Art Museum Underground (Fragments of Future Histories), Galerie Micheline Szwajcer, Antwerp

2005

222nd Floor, Eva Presenhuber, Zürich A Short Essay on the Possibility of an Economy of Equivalence, Palais de Tokyo, Paris Another 2004 Again, Baltimore Museum of Art, Balimore Presentism, Corvi-Mora, London Factories in the Snow, Meyer Kainer, Wien McNamara Motel, CAC, Malaga A Short Essay on the Possibility of an Economy of Equivalence, Casa Encendida, Madrid As You Approach the Edge of Town the Lights Are no Softer than they Were in the Centre, Casey Kaplan, New York

2006

We are Medi(evil), Angela Bulloch und/and Liam Gillick, Cubitt, London Briannnnnn & Ferryyyyyy, Liam Gillick und/and Philippe Parreno, Kunsthalle Zürich Literally Based on HZ, Kerlin Gallery, Dublin The State itself Becomes a Super Commune, Esther Schipper, Berlin

2007

Weekend in so Show, The Lab, Belmar The Commune itself Becomes a Super State, Corvi-Mora, London The State/Commune itself Becomes a Super State/Commune, Micheline Szwajcer, Antwerp

2008

Three Perspectives and a Short Scenario, Witte de With, Rotterdam Three Perspectives and a Short Scenario, Kunsthalle Zürich The State itself Becomes a Super Whatnot, Casey Kaplan, New York Three Perspectives and a Short Scenario, Kunstverein München

2009

How Will You Behave? A Kitchen Cat Speaks, Deutscher Pavillon, Biennale di Venezia, Venice Three Perspectives and a Short Scenario, Museum of Contemporary Art, Chicago Executive 2 Litre GXL, MAK, Wien Wall Diagrams from the 1990s and early 2000s, House of Art, Budweis Two Short Plays, Eastside Projects, Birmingham

2010

Everything Good Goes, Meyer Kainer, Wien Discussion Bench Platforms/A “Volvo” Bar + Everything Good Goes, Casey Kaplan, New York

AUSBILDUNG/EDUCATION 1983/84 Hertfordshire College of Art 1984/87 Goldsmiths College, University of London, B.A. (Hons.) PREISE/AWARDS 1998 Paul Cassirer Kunstpreis, Berlin 2002 Turner Prize Nomination, Tate, London 2008 Vincent Award Nomination, Stedelijk Museum, Amsterdam EINZELAUSSTELLUNGEN/ONE-PERSON EXHIBITIONS 1989 84 Diagrams, Karsten Schubert Ltd, London 1991

Documents (with Henry Bond), Karsten Schubert Ltd, London Documents (with Henry Bond), A.P.A.C., Nevers Documents (with Henry Bond), Gio’ Marconi, Milan

1992

McNamara, Hog Bikes and GRSSPR, Air de Paris, Nice

1993

Documents (with Henry Bond), CCA, Glasgow An Old Song and a New Drink (with Angela Bulloch), Air de Paris, Paris

1994

McNamara, Schipper & Krome, Köln Documents (with Henry Bond), Ars Futura, Zürich Interim Art, London

1995

Ibuka! (Part 1), Air de Paris, Paris Ibuka! (Part 2), Künstlerhaus Stuttgart Ibuka!, Galerie Emi Fontana, Milan Part Three, Basilico Fine Arts, New York Documents (with Henry Bond), Kunstverein Elsterpark, Leipzig

1996

Erasmus Is Late ‘versus’ The What if? Scenario, Schipper & Krome, Berlin Raum Aktueller Kunst, Wien The What if? Scenario, Robert Prime, London Documents (with Henry Bond), Schipper & Krome, Köln

1997

Discussion Island, Basilico Fine Arts, New York Discussion Island – A What if? Scenario Report, Kunstverein Ludwigsburg A House in Long Island, Forde Espace d’art contemporain, L’Usine, Genève Another Shop in Tottenham Court Road, Transmission Gallery, Glasgow McNamara Papers, Erasmus and Ibuka Realisations, The What if? Scenarios, Le Consortium, Dijon Reclutamento!, Emi Fontana, Milan

1998

Kunstverein in Hamburg Up on the twenty-second floor, Air de Paris, Paris When Purity Was Paramount, British Council, Prague Big Conference Center, Orchard Gallery, Derry Robert Prime, London Révision: Liam Gillick, Villa Arson, Nice When Do We Need more Tractors?, Schipper & Krome, Berlin The Trial of Pol Pot (with Philippe Parreno), Le Magasin, Grenoble c/o Atle Gerhardsen, Oslo

1999

Kunsthaus Glarus Rüdiger Schöttle, München “David”, Frankfurter Kunstverein, Frankfurt am Main

2000

Applied Complex Screen, Hayward Gallery, London Galleri Charlotte Lund, Stockholm Liamm Gilllick, Schipper & Krome, Berlin Consultation Filter, Westfälischer Kunstverein, Münster Schmerz in Einem Gebäude, Fig 1, London Woody, CCA Kitakyshu

238.

Liam Gillick


GEMEINSCHAFTSPROJEKTE/COLLABORATIVE PROJECTS 1992 The Speaker Project, ICA, London Instructions, Gio’ Marconi, Milan 1995 Faction, Royal Danish Academy of Arts, Kopenhagen Stoppage, CCC, Tours Stoppage, Villa Arson, Nice 1999 Oldnewtown, Casey Kaplan, New York 2000 itsapoorsortofmemorythatonlyrunsbackwards, Goldsmiths College, Creative Curating, London 2001 Dedalic Convention (mit/with Annette Kosak), MAK, Wien Dedalic Convention/Du und Ich (with Annette Kosak and Gary Webb), Salzburger Kunstverein, Salzburg 2002 Dark Spring (with Nicolaus Schafhausen and Markus Weisbeck), Ursula Blickle Stiftung, Kraichtal 2003 Telling Histories, Kunstverein München 2004 Rider: Law and Creativity Briannnnnn & Ferryyyyyy (mit/with Philippe Parreno), Konsthall, Lund 2005 Briannnnnn & Ferryyyyyy (mit/with Philippe Parreno), Vamiali’s, Athen Edgar Schmitz, ICA, London 2007 unitednationsplaza, Berlin Il Tempo Postino, Manchester Festival 2008 The Night School, The New Museum, New York 2009 The one hundred and sixty-third floor, Liam Gillick curates the collection, MCA Chicago

ÖFFENTLICHE WERKE/PUBLIC PROJECTS 1999 BIC Technologiezentrum, Leipzig 2001 Telenor, Oslo 2002 Dekabank, Frankfurt am Main Alcobendas, Madrid Kirchdorf Schule Mercat, Alicante Olnick Corporation, New Jersey 2003 Fort Lauderdale/Hollywood International Airport Regents Place – British Land, London Headache, Phone Card, Soda, Donuts, Stereo, London Underground/Frieze Art Fair, London 2003– 2005 The Home Office, London 2004 Museum in Progress, Rolling Boards, Wien Swiss Re, London 2005 Dior Homme, Shanghai (with Sean Dack) BSI, Lugano 2006 Maharam, Chicago 2007 Lufthansa, Frankfurt am Main Factory in the Snow, Tierra y ammonia, Guadalajara Full Scale Model of a Social Structure for a Plaza in Anyang, Anyang, Korea 2008 Dynamica Building, Guadalajara 2009 Fairmont Pacific Rim, Vancouver

1999 2002 2004

2006

2007 2008 2009

AUSGEWÄHLTE GRUPPENAUSSTELLUNGEN/ SELECTED GROUP EXHIBITIONS 1990 The Multiple Projects Room, Air de Paris, Nice 1991

No Man’s Time, CNAC, Villa Arson, Nice Air de Paris à Paris, Air de Paris, Paris The Multiple Projects Room, Air de Paris, Nice

1992

Tatoo, Air de Paris/Urbi et Orbi, Paris; Daniel Buchholz, Köln; Andrea Rosen, New York Molteplici Culture (curated by Giorgio Verzotti), Folklore Museum, Rome Lying on top of a building the clouds look no nearer than they had when I was lying in the street, Monika Sprüth, Köln; Esther Schipper, Köln; Le Case d’Arte, Milan Manifesto (curated by Benjamin Weil), Daniel Buchholz, Köln; Castello di Rivara, Turino; Wacoal Arts Centre, Tokyo; Urbi et Orbi, Paris Etats Spécifique, Musée d’art moderne, Le Havre 12 British Artists, Barbara Gladstone/SteinGladstone, New York Group Show, Esther Schipper, Köln ON, Interim Art, London

1993

Territorio Italiano (curated by Giacinto di Pietrantonio), Milan Claire Barclay, Henry Bond, Roderick Buchanan, Liam Gillick, Ross Sinclair, Gesellschaft fur Aktuelle Kunst (curated by Tom Eccles), Bremen Travelogue (curated by Jackie McAllister), Hochschule für Angewandte Kunst, Wien Los Angeles International, Esther Schipper at Christopher Grimes, Los Angeles Wonderful Life, Lisson Gallery, London Group Show, Esther Schipper, Köln The London Photo Race, Friesenwall 120, Köln Futura Book, Air de Paris, Nice Points de Vue, Galerie Pierre Nouvion, Monaco Manifesto (curated by Benjamin Weil), Hohenthal und Bergen, München Backstage (curated by Stephan Schmidt-Wulffen and Barbara Steiner), Kunstverein in Hamburg Two out of four dimensions, Centre 181, London Unplugged (curated by Nicolas Bourriaud), Inter Conti, Köln

1994

Don’t Look Now (curated by Joshua Decter), Thread Waxing Space, New York Backstage, Kunstmuseum Luzern Surface de Réparations (curated by Eric Troncy), FRAC Bourgogne, Dijon Cocktail I, Kunstverein in Hamburg Public Domain (curated by Jorge Ribalta), Centro’ Santa Monica, Barcelona Grand Prix (curated by Axel Huber), Monaco Rue des Marins, Air de Paris, Nice Mechanical Reproduction, (curated by Jack Jaeger), Galerie van Gelder, Amsterdam

TONTRÄGER/RECORDED WORKS 1995 Stoppage, CCC Tours/Villa Arson, Nice 2001 Liam Gillick Meets Scott Olson in Japan, Whatness, Frankfurt am Main 2002 Wood (Part of Void), CCA, Kitakyushu Capital, Semishigure, Kleve Ekkehard Ehlers & Joseph Suchy/Liam Gillick, En/Off, Kleve 2003 Liam Gillick/Rob Mazurek, En/Off, Kleve 2005 Los Angeles, Semishigure, Kleve LIVE EVENTS 2006 Construcción de Uno, Tate, London BÜCHER/BOOKS 1991 Technique Anglaise (with Andrew Renton), London, One-Off Press/ Thames & Hudson 1995 Erasmus is Late, London, Book Works Ibuka!, Künstlerhaus Stuttgart 1997 Discussion Island/Big Conference Centre, Orchard Gallery, Derry/ Kunstverein Ludwigsburg McNamara Papers, Dijon, Le Consortium 1998 Ein Rückblick aus dem Jahre 2000 auf 1997 (with Matthew Brannon),

239.

Biografie/Biography

Galerie für Zeitgenössische Kunst, Leipzig Five or Six, New York, Lukas & Sternberg Liam Gillick, Köln/Colgone, New York, Oktagon/Lukas and Sternberg Literally No Place, London, Book Works Underground (Fragments of Future Histories), Brüssel/Dijon, Les maître des forme contemporain, Les Presses du Réel Anna Sanders Films Identity Spot, Liam Gillick and Sean Dack, Paris, Onestar Press Malaga – An album of Covers, Liam Gillick and M/M, Paris, Brüssel, Two Star Books Le Montrachet, Liam Gillick und/and Heather McGowan, Los Angeles, Rocky Point Press Proxemics: Selected Writing 1988–2006, Zürich, JRP-Ringier Ein Rückblick aus dem Jahre 2000 auf 1997 (with Matthew Brannon), Galerie für Zeitgenössische Kunst, Leipzig Allbooks, London, Book Works Meaning Liam Gillick, Cambridge, MIT Press


WM/Karaoke, (curated by Georg Herold), Portikus, Frankfurt am Main Other Men’s Flowers, (curated by Joshua Compston), Hoxton Square, London Miniatures, The Agency, London Das Archiv, Forum Stadtpark, Graz Lost Paradise, (curated by Barbara Steiner), Kunstraum, Wien Surface de Réparations 2, FRAC Borgougne, Dijon The Institute of Cultural Anxiety (curated by Jeremy Millar), ICA, London 1995

Möbius Strip, Basilico Fine Arts, New York Bad Times (curated by Jonathan Monk), CCA, Glasgow In Search of the Miraculous, Starkmann Library Services, London The Moral Maze, Le Consortium, Dijon Collection fin XXéme, FRAC Poitou Charentes, Angouleme Summer Fling, Basilico Fine Arts, New York Karaoke (curated by Georg Herold), South London Art Gallery Ideal Standard Summertime, Lisson Gallery, London Reserve-Lager-Storage, Oh!, Brussells Filmcuts, neugerriemschneider, Berlin New British Art, Museum Sztuki, Lodz Brilliant, (curated by Richard Flood), Walker Art Center, Minneapolis Trailer, (curated by Barbara Steiner), Mediapark, Köln

1996

Co-operators, Southampton City Art Gallery, Southampton Traffic (curated by Nicolas Bourriaud), CAPC, Bordeaux Kiss This (curated by Jeremy Deller), Focalpoint Gallery, Southend March à l’ombre, Air de Paris, Paris Departure Lounge, The Clocktower, New York Everyday Holiday, Le Magasin, Grenoble Der Umbau Raum, Künstlerhaus Stuttgart Dinner (organised by Giorgio Sadotti), Cubitt Gallery, London Some Drawings From London, Princelet Street, London Nach Weimar (curated by Nicolaus Schafhausen and Klaus Biesenbach), Landesmuseum, Weimar How Will We Behave?, Robert Prime, London Escape Attempts, Globe, Kopenhagen Life/Live, Musée d’Art moderne de la Ville de Paris, Paris Such is Life, Serpentine London; Palais des Beaux Arts, Brussels; Herzliya Museum of Art Itinerant Texts, Camden Arts Centre, London Lost For Words, Coins Coffee Store, London All in One, Schipper & Krome, Köln A Scattering Matrix (curated by Jane Hart), Richard Heller Gallery, Los Angeles Found Footage, Tanja Grunert & Klemens Gasser, Köln Glass Shelf Show, ICA, London Supastore de Luxe, Up & Co., New York Limited Edition Artist’s Books Since 1990, Brooke Alexander, New York

1997

Life/Live, Centro Cultural de Belém, Lisbon Temps de Pose, Temps de Parole, Musée de l’Echevinage, Saintes Des Livres d’Artistes, L’ecole d’art de Grenoble, Grenoble Ajar, Galleri F15, Jeløy Enter: audience, artist, institution, (kuratiert von/curated by Barbara Steiner), Kunstmuseum Luzern Space Oddities, Canary Wharf Window Gallery, London Moment Ginza (co-ordinated by Dominique Gonzalez-Foerster), Le Magasin, Grenoble I Met A Man Who Wasn’t There, Basilico Fine Arts, New York 504, (kuratiert von/curated by John Armleder), Kunsthalle Braunschweig documenta X, Kassel Enterprise, ICA, Boston Group Show, Robert Prime, London Ireland and Europe, Sculptors Society of Ireland, Dublin Group Show, Vaknin Schwartz, Atlanta Heaven – a Private View, PS1, Long Island Hospital, Galerie Max Hetzler, Berlin Kunst … Arbeit, SüdWest LB, Stuttgart Other Men’s Flowers, The British School at Rome, Rome Maxwell’s Demon, Margo Leavin, Los Angeles Work in Progress and or Finished, Ubermain, Los Angeles Group Show, Schipper & Krome, Berlin

240.

Liam Gillick

1998

Liam Gillick, John Miller, Joe Scanlan, Raum Aktueller Kunst, Wien Fast Forward, Kunstverein in Hamburg Artist/Author: Contemporary Artists’ Books, American Federation of Arts touring show: Weatherspoon Art Gallery, Greensboro; The Emerson Gallery, Clinton; The Museum of Contemporary Art, Chicago; Lowe Art Museum, Coral Gables; Western Gallery, Bellingham; University Art Gallery, Amherst Interactive, An Exhibition of Contemporary British Sculpture, Amerada Hess, London A to Z (curated by Matthew Higgs), The Approach, London Construction Drawings (curated by Klaus Biesenbach), PS1, New York ARENA. Sport & Kunst, Galerie im Rathaus, München Inglenook (curated by Evette Brachman), Feigen Contemporary, New York In-significants, Stockholm Kamikaze, Galerie im Marstall, Berlin London Calling, The British School at Rome & Galleria Nazionale d’Arte Moderna, Rome Fuori Uso ‘98, Mercati Ortofrutticoli, Pescara Videostore (organised by Nicolas Trembley and Stéphanie Moisdon), Brick and Kicks, Wien UK – Maximum Diversity, Galerie Krinzinger, Bregenz, Wien The Erotic Sublime, Thaddeaus Ropac, Salzburg Entropy (curated by Wilhelm Schürmann), Ludwigforum, Aachen Places to Stay 4 P(rinted) M(atter), Büro Friedrich, Berlin Weather Everything (curated by Eric Troncy), Galerie für Zeitgenössische Kunst, Leipzig Odradek, (kuratiert von/curated by Thomas Mulcaire), Bard College, New York Mise en Scène, Grazer Kunstverein, Graz Minimal-Maximal, Neues Museum Weserburg, Bremen; Kunsthalle Baden-Baden; CGAC, Santiago de Compostela Ghosts, Le Consortium, Dijon Cluster Bomb, Morrison/Judd, London The Project of the 2nd Dec, Salon 3, London Projections, de Appel, Amsterdam 1+3 = 4 x 1, Galerie für Zeitgenössische Kunst, Leipzig

1999

Konstruktionszeichnungen, Kunst-Werke, Berlin Pl@ytimes, Ecole supérieure d’art de Grenoble Xn, Maison de la culture, Chalon Continued Investigation of the Relevance of Abstraction, Andrea Rosen Gallery, New York Nur Wasser, Neumühlen, Hamburg 12 Artists, 12 Rooms, Galerie Thaddeaus Ropac, Salzburg Air de Paris: works by AND/OR informations about, Grazer Kunstverein, Graz Tang, Turner and Runyon, Dallas Plug-ins, Salon 3, London Etcetera, Spacex Gallery, Exeter Out of Sight – A cross-reference exhibition, Büro Friedrich, Berlin Essential Things (curated by Guy Mannes Abbott), Robert Prime, London Laboratorium, Antwerpen Open, Antwerp In The Midst of Things, University of Central England, Bourneville Le Capitale (curated by Nicolas Bourriaud), Centre régionale d’art contemporain, Sète The Space is Everywhere, Villa Merkel, Esslingen Objecthood OO, Athen Tent, Rotterdam Constructivism: Life into Art, Brisbane Convention and Exhibition Center, Brisbane Shopping, FAT, London Fantasy Heckler (curated by Padraig Timoney), Tracey, Liverpool Bienial Art Lovers (curated by Marcia Fortes), Tracey, Liverpool Bienial Transmute (curated by Joshua Decter), MCA Chicago New York/London, Taché-Levy, Brussels Get Together/Art As Teamwork, Kunsthalle Wien.

1999

East Wing Collection, Courtald Institute of Art, London Jonathan Monk, Casey Kaplan, New York


705 Wings of Freedom (curated by Uwe Wiesner), Berlin Officina Europa, Bologna Une histoire parmi d’autres, collection Michel Poltevin, FRAC Nord-Pas de Calais Space, Schipper & Krome, Berlin 2000

29th International Film Festival, Rotterdam Continuum 001 (curated by Rebecca Gordon Nesbitt) CCA, Glasgow Stortorget i Kalmar, Statens Konstråds Galleri, Kalmar Media City 2000, Seoul Group Show, Casey Kaplan, New York Wider Bild Gegen Wart. Positions to a political discourse, Raum Aktueller Kunst, Wien 14 + 1, Feitchtner & Mizrahi, Wien Decompressing History (curated by Lars Bang Larsen), Galeri Enkehuset, Stockholm Viva Maria III, Galerie Admiralitätstraße, Hamburg British Art Show 5, Touring Exhibition, Edinburgh, Southampton, Cardiff, Birmingham Dire Aids, Art in the Age of Aids, Promotrice delle Belle Arti, Torino Working Title, Stanley Picker Gallery, Kingston University Prefiguration of the Museum of Contemporary Art, Tuscon Collection JRP, Kunsthalle Fribourg What If/Tänk Om, Moderna Museet, Stockholm Interplay, The National Museum of Contemporary Art, Oslo Group Show, Paula Cooper Gallery, New York Intelligence, Tate Britain, London Future Perfect, Centre for Visual Arts, Cardiff Haut de Forme et Bas Fonds, FRAC Poitou-Charentes, Angoulême Vicinato 2, Fig. 1, London Vicinato 2, neugerriemschneider, Berlin Werkleitz Biennale, Tornitz Wilder Bild Gegenwart, Positions to a Political Discourse, Nieuw Internationaal Kultureel Centrum, Antwerp Perfidy, La Tourette, Eveaux Protest and Survive, Whitechapel Gallery, London e-mona, The Museum of New Art, Detroit Außendienst, Kunstverein in Hamburg Indiscipline, Roomade, Brussels Que saurions-nous construire d’autre? (What else could we build?), La Villa Noailles Casa Ideal, Museo Alejandro Otero, Caracas More Shows About Buildings and Food, Lisbon Perfidy, Kettles Yard, Cambridge How do you change an apartment that has been painted brown? Certainly not by painting it white, Institute of Visual Culture, Cambridge Group Show, Corvi-Mora, London Future Perfect, Cornerhouse, Manchester

2001

Century City, Tate Modern, London Demonstration Room: Ideal House, Apex Art, New York Histoire de coeur, Collection Michel Poitevin, Fondation Guerlain, Les Mesnuls There’s gonna be some trouble, a whole house will need rebuilding, Rooseum, Malmö Stop and Go, FRAC, Nord-Pas de Calais, Dunkerque Future Perfect, Orchard Gallery, Derry Minimal-Maximal, City Museum of Art, Chiba; National Museum of Art, Kyoto; City Museum of Art, Fukuoka Nothing, Northern Gallery for Contemporary Art, Sunderland; Contemporary Art Centre, Vilnius; Rooseum, Malmö Contemporary Utopia, Museum of Modern Art, Riga Berlin Biennale, Kunst-Werke, Berlin Collaborations with Parkett: 1984 to now, Museum of Modern Art, New York International Language, Grassy Knoll Productions, verschiedene Orte/various sites, Belfast A New Domestic Landscape, Javier Lopez, Madrid The Wedding Show, Casey Kaplan, New York Geometry and Gesture, Thaddeaus Ropac, Salzburg Biennale de Lyon, Musée d’art contemporain, Lyon A Timely Place, Or, Getting Back to Somewhere, London Print Studio

241.

Biografie/Biography

Strategies against Architecture, Fondazione Teseco, Pisa Stéphane Dafflon/Liam Gillick/Xavier Veilhan, Le Spot, Le Havre The Communications Department, Anthony Wilkinson Gallery Ambiance Magasin, Meymac Centre d’art Contemporain Beautiful Productions: Parkett, Whitechapel Gallery, London Demonstration Room: Ideal House, NICC, Antwerp Yokohama 2001, Yokohama Triennale, Yokohama Everything Can Be Different, Jean Paul Slusser Gallery, University of Michigan School of Art, Ann Arbor Rumor City, Raffinerie, Brussels Animations, PS1, Long Island City Parallel Structures, South Bank Corporation, Brisbane 9e Biennale de l’image en Mouvement, Centre pour l’image contemporaine, Saint-Gervais, Genève Rumour City, TN Probe, Japan En/Of, Schneiderei, Köln Ingenting, Rooseum, Malmö I love Dijon, Le Consortium, Dijon … if a double-decker bus crashes into us to die by your side is such a heavenly way to die and if a ten ton truck kills the both of us to die by your side the pleasure and the privilege is mine... , Air de Paris, Paris Urgent Painting, ARC, Musée d’art moderne de la ville de Paris, Paris Reflexions, Sprüth Magers, München Passenger: The Viewer as Participant, Astrup Fearnley Museum, Oslo Nothing, Mead Gallery, Warwick Minimal Maximal, National Museum of Contemporary Art, Seoul Do It, Museo de Arte Carrillo Gil, San Angel J’en ai pris des coups mais j’en ai donnés aussi, Galerie Chez Valentin, Paris Art & Economy, Deichtorhallen, Hamburg Everything Can Be Different, University of Memphis, Tennesee Void, Rice Gallery, Tokyo; CCA Kitakyushu Annlee You Proposes, Mamco, Genève Startkapital, K21, Düsseldorf Parallel Structures, Gertrude Contemporary Art Spaces, Fitzroy, Victoria Private Views, Printed Space, London The Ink Jetty, Neon Gallery, London Inframince, Cabinet Gallery, London Happy Outsiders from Scotland and London, Zacheta, Warsaw; Katowice City Gallery The Object Sculpture, The Henry Moore Institute, Leeds Without Consent, CAN, Neuchâtel Am Anfang der Bewegung stand ein Skandal, Lenbachhaus, München JRP Editions, Raum Aktueller Kunst, Wien Collected Contemporaries, Moderna Museet, Stockholm Summer Cinema, Casey Kaplan, New York Multiples X, London Print Studio No Ghost Just a Shell, Kunsthalle Zürich Société Perpendiculaire: La Tapisserie, FRAC Provence-Alpes-Côte d’Azur Collections, ZKM, Karlsruhe Strike, Wolverhampton Art Gallery The Unique Phenomena of a Distance, Magnani, London The Galleries Show: Contemporary Art in London, Royal Academy of Arts, London Turner Prize, Tate, London Relational Aesthetics from the 1990s, San Francisco Art Institute, San Francisco This Play 31, La Coleccion Jumex, Mexico L’image habitable - versions B,C,D,E, Mamco, Genève Lap Dissolve, Casey Kaplan, New York It’s Unfair, Museum de Paviljoens, Almere Gleitsicht, Krypta 182, Bergisch-Gladbach No Ghost Just A Shell, Institute of Visual Culture, Cambridge No Ghost Just a Shell, San Francisco Museum of Modern Art 2003

Perfect Timeless Repetition, c/0 Atle Gerhardsen, Berlin No Ghost Just a Shell, Van Abbemuseum, Eindhoven Ill Communication, DCA, Dundee Re-Produktion 2, Georg Kargl, Wien JRP Editions, Galerie Edward Mitterand, Genève


Animations, Kunst-Werke, Berlin Breathing the Water, Galerie Hauser & Wirth & Presenhuber, Zürich This Was Tomorrow, New Art Centre Sculpture Park, Salisbury The Air is Blue, Barragan House, Mexico City JRP Editions, Galería Javier López, Madrid The Moderns/I moderni, Castello di Rivoli, Torino Glamour, British Council, Prague Imperfect Marriages, Galerie Emi Fontana, Milan 20th Anniversary Show, Sprüth Magers, Köln Typofgravy, Cell, London Cool Luster, Collection Lambert, Avignon Form Specific, Moderna Galerija, Ljubljana Tirana Biennale 2, Tirana 3D, Friedrich Petzel, New York Soziale Fassaden, Städtische Galerie im Lenbachhaus München 25th International Biennial of Graphic Arts, Ljubljana Utopia Station, Biennale di Venezia, Venice Honey I rearranged the collection, Greengrassi/Corvi-Mora, London Abstraction Now, Künstlerhaus Wien, Wien How to learn to love the bomb and stop worrying about it, National Chamber of Art Industries, Mexico City Wittgenstein: Family Likenesses, Institute of Visual Culture, Cambridge Die Möglichkeit des Unmöglichen, Frankfurter Kunstverein, Frankfurt am Main A Nova Geometria, Galeria Fortes Vilaça, Saõ Paulo Everything Can Be Different, Maryland Institute College of Art, Baltimore Bad Behaviour: Works from the Arts Council Collection, Yorkshire Sculpture Park 2004

2005

Singular Forms (Sometimes Repeated), Art from 1951 to the Present, Guggenheim Museum, New York Establishing Shot, Artist’s Space, New York 100 Artists See God (curated by John Baldessari & Meg Cranston), The Contemporary Jewish Museum, San Francisco The Drawing Project, Vamiali’s, Athen Before the End (curated by Stéphanie Moisdon and Olivier Mosset), Le Consortium, Dijon How to learn to love the bomb and stop worrying about it, Central de Arte en WTC, Guadalajara Tonight (kuratiert von/curated by Paul O’Neill), Studio Voltaire, London Russian Doll, MOT, London Across the Border, MDD – Museum Dhondt-Dhaenens, Deurle 9 Mütter XX04, Mütter Museum, Philadelphia Drunken Masters, Fortes Vilaca, Saõ Paulo Sadie Hawkins Dance, Southfirst, Brooklyn Artists’ Favourites, ICA, London Emotion Eins, Ursula Blickle Stiftung, Kraichtal; Frankfurter Kunstverein, Frankfurt am Main Em Jogo, CAV, Coimbra Czech Made, Display, Prague Off the Record/Sound Art, ARC Musée d’art moderne de la Ville de Paris Open, Arcadia University Art Gallery, Glenside Marks in Space, Usher Gallery, Lincoln Black Friday: Exercises in Hermetics, Galerie Kamm, Berlin Strike, Basekamp, Philadelphia The Trailer Special Project, Curzon Cinemas, London 100 Artists See God (curated by John Baldessari & Meg Cranston), Laguna Art Museum, Laguna Beach Trailer, Man in the Holocene, London Nothing Compared to This: Ambient, Incidental and New Minimal Tendencies in Current Art, CAC, Cincinnati Utopia Station, Haus der Kunst, München 100 Artists See God (kuratiert von/curated by John Baldessari & Meg Cranston), ICA, London Dicen que finko o miento. La ficción revisada, Central de arte, Guadalajara Poul Kjaerholm, Sean Kelly, New York Exit – Ausstieg aus dem Bild, ZKM, Karlsruhe The Furniture of Poul Kjaerholm and selected artwork, Sean Kelly and R 20th Century, New York New Cohabitats, Galerie Ghislane Hussenot, Paris

242.

Liam Gillick

Goodbye 14th Street, Casey Kaplan, New York Good Titles for Bad Books, Kevin Bruk, Miami The Strange, Familiar and Unforgotten, Galerie Erna Hecey, Brussels Group Exhibition, Air de Paris, Paris Anna Sanders Films, Cinema Svetozor, Prague Supernova, Bunkier Sztuki, Kraków Icestorm, Kunstverein München La La Land, The Project, Dublin Post Notes, Midway Contemporary Art, Minneapolis Bidibidobidiboo, Works from Collezione Sandretto Re Rebaudengo, Torino 100 Artists See God (curated by John Baldessari & Meg Cranston), Contemporary Art Center of Virginia, Virginia Beach I Really Should*, Lisson Gallery, London Go Between, Kunstverein Bregenz Nach Rokytnik, MUMOK, Wien Extreme Abstraction, Albright Knox Art Gallery, Buffalo 100 Artists See God (curated by John Baldessari & Meg Cranston), Albright College Freedman Art Gallery, Reading General Ideas: Rethinking conceptual art 1987–2005, CCA Wattis, San Francisco Etc., Le Consortium, Dijon Passion beyond reason, Wallstreet 1, Berlin En Route: Via another route, Trans-Siberian Railway Snow Black, Yvon Lambert, New York Reception, Büro Friedrich, Berlin Rundlederwelten, Martin Gropius Bau, Berlin Ambiance, K21, Düsseldorf Strictement Confidentiel, CIAP, Ile de Vassiviere Thankyou for the Music, Sprüth Magers, München Im Bild Sein, Galerie der HGB Leipzig The Party, Casey Kaplan, New York Supernova, Contemporary Art Centre, Vilnius Minimalism and after, Daimler Chrysler Collection, Berlin 2006

2007

A person alone in a room with coca-cola coloured walls, Grazer Kunstverein, Graz Cinéma(s), Le Magasin, Grenoble Fondos da Colección CGAC: Entre o proceso e a forma, CGAC, Santiago de Compostela Slow Burn, Galerie Edward Mitterand, Genève Broken Surface, Galerie Sabine Knust, München 100 Artists See God (curated by John Baldessari & Meg Cranston), Cheekwood Museum of Art, Nashville Minimal Illusions, Galerien der Stadt Esslingen Under Construction, European Kunshalle, Köln Ordnung und Verführung, Haus Konstruktiv, Zürich Bühne des Lebens – Rhetorik des Gefühls, Kunstbau München A short history of performance Part 4, Whitechapel Art Gallery, London Classical Modern, Daimler Chrysler Contemporary, Berlin Back and Forth, Stiftung Wilhelm Lehmbruck Museum, Duisburg Supernova, Galerie Jana Koniarka, Trnava Grey Flags, Sculpture Center, New York Thankyou for the Music (London Beat), Sprüth Magers Lee, London Untouchable (The ideal of Transparency), Villa Arson, Nice Undisciplined: Attese Biennale of Ceramic Arts, Attese Crytallizations, Andreas Murkurdis Temporary, München Sprung ins kalte Wasser, Shedhalle, Zürich Turtle, Chelsea Space, London Dirty Words, Galeria Pedro Cera, Lisbon Abstraction Now, Wilhelm-Hack-Museum, Ludwigshafen Modus, Neue Kunsthalle, St. Gallen Faster! Bigger! Better!, ZKM, Karlsruhe Academy, Van Abbemuseum, Eindhoven Projektion, Kunstmuseum, Luzern How to improve the World, Hayward Gallery, London Eye on Europe: Prints, Books and Multiples 1960 to now, MoMA, New York Klinik: Eine Pathologie der Gesten, Hebbel am Ufer, Berlin Saigon: Open City, Saigon All Hawaii Entrées/Lunar Reggae, IMMA, Dublin Drapeaux Gris, CAPC, Bordeaux Lapdogs of the Bourgoisie, Platform Garanti, Istanbul


Active Constellation, Brno House of Art Collateral: When Art Looks at Cinema, Hangar Bicocca, Milan Los Vinilos, El Basilico, Buenos Aires Modelle für Morgen: Köln, European Kunsthalle, Köln Pure, Sean Kelly, New York Airs de Paris, Centre Pompidou, Paris The Redistribution of the Sensible, Galerie Magnus Müller, Berlin The Shapes of Space, Guggenheim Museum, New York Memorial to the Iraq War, ICA, London If Everybody Had an Ocean, Tate, St. Ives Trajectory 4: AKA Institute of Contemporary Art, Old Harbour, Riga How to improve the world, Birmingham Museum and Art Gallery Perspektive 07, Städtische Galerie im Lenbachhaus München Intocable (El ideal de la transparencia), The Museum of Contemporary Art, Valladolid It starts from here, De La Warr Pavillion Edition Schellmann Door Cycle, Friedrich Petzel Gallery, New York All You Desire, PPOW, New York Other Men’s Flowers, Venetia Kapernekas Gallery, New York Franchise, Assen I can’t live without, The Showroom, London L’ottava Tavola: An Etymology of Contemporary Codes, Cortona The Showroom Talks, The Showroom, London Fourier, Centre d’art mobile, Besançon If Everybody Had an Ocean, CAPC, Bordeaux Floating Territories, Various Locations (Venice, Istanbul …) Projektion, Lentos Kunstmuseum Linz Franz West: Soufflé, Kunstraum Innsbruck Tomorrow is Another Day, Artsonje, Seoul Eva Presenhuber/Jubilee Exhibition, Vnà If everybody had an ocean, CAPC, Bordeaux Fusion Now! More light, more power, more people, Rokerby Gallery Winter Palace, de Ateliers, Amsterdam Xmas Hysteria, Galerie Emi Fontana, Milan 2008

2009

Images: A spike magazine project, Forde, Genève Mixed Emotions, Domus Atrium, Salamanca Lapdogs of the Bourgoisie, Tensta Konsthall, Spanga MAXImin, A century of abstraction, Fondacion Juan March, Madrid KW Hommage à Klaus Werner, Galerie für Zeitgenössiche Kunst, Leipzig The Brisbane Sound, Institute of Modern Art, Brisbane Cube Passerby, Passerby, New York Typed, Sadie Coles, London Fantasy, MuKHA, Antwerp Book/Shelf, MoMA, New York This is the gallery and the gallery is many things, Eastside Projects, Birmingham The Store, Tulips and Roses, Vilnius Blasted Allegories: Sammlung Ringier, Kunstmuseum Luzern The Sydney Biennale, Sydney Call it what you like, Art Center Silkeborg Bad No so subtle subtitle, Casey Kaplan, New York Vincent Award, Stedelijk Museum, Amsterdam Private/Corporate V: Daimler Art Collection, Haus Huth, Berlin Mondo e Terra, FRAC Corse Shapes of Space 2, Mário Sequeira Gallery, Braga This is the gallery and the gallery is Many things, Eastside Projects, Birmingham La Petite Histoire, Kunstraum Niederösterreich, Wien La Vitrina, Gudalajara 100 Artists: Art on the Underground, A Foundation Gallery, London Moments and Murals, MD72, Berlin Branding Democracy, New School, New York Edition Schellmann Furniture, Edition Schellmann, München Accessories to an artwork, Paul Stolper Gallery, London Theanyspacewhatever, Guggenheim Museum, New York Made in Munich, Haus der Kunst, München Fifty Percent Solitude, Kerlin Gallery, Dublin Saints and Sinners, Rose Art Museum, Brandeis University Custom Car Commandos, Art in General, New York Just what are the saying, Jonathan Ferrara Gallery, New Orleans The Human Stain, CGAC Santiago de Compostela

243.

Biografie/Biography

Espèces d’Espaces, Yvon Lambert, New York International Photo Festival Knokke-Heist, Knokke Heist Beaufort 03, Oostende Forms of Inquiry, Archizoom, Lausanne Unbuilt Roads, E-flux, New York A Factory, A Machine, A Body … Archaeology and Memory of Industrial Spaces, Centre d’art La Panera, Lleida La Recherche, Air de Paris, Paris Because I say so: Sculpture from the Scholl collection, Frost Art Museum, Miami Lapdogs of the Bourgeoisie, Arnolfini, Bristol Between Metaphor and Object, IMMA, Dublin Take the Money and Run, De Appel, Amsterdam UFO: Grenzgänge zwischen Kunst und Design, NRW-Forum, Düsseldorf The Obstacle is Tautology, Tulips and Roses, Vilnius Il Tempo del Postino, Theater Basel, Basel LEARN TO READ ART: A History of Printed Matter (1976–2009), Badischer Kunstverein, Karlsruhe Watou 2009, Watou Top 10 Allegories, Galerie Francesca Pia, Genève T-tris, B.P.S. 22, Charleroi La Suite, Air de Paris, Paris A Factory, A Machine, A Body …, MUCA, Mexico City We are sun-kissed and Snow Blind, Patrick Seguin, Paris Gagarin: Artists in their own words, SMAK, Gent Queensland Art 2009, Pestorious Sweeney House, Brisbane 2010

Animism, MuKHA/Extra City, Antwerp Interference: Fields for listening and Praxis, The studio at Moderna Museet, Stockholm It is it, Espacio 1414 Puerto Rico Shazam, c/o Gerhardsen Gerner, Berlin Les Ateliers de Rennes, Rennes The Promises of the Past, Centre Pompidou, Paris Humanity is not a completed project, Villa du Parc, Centre d’art Contemporain, Annemasse

AUSGEWÄHLTE ARTIKEL/SELECTED REVIEWS 1991 Rose Jennings, Documents: Karsten Schubert Ltd, City Limits, Feb 7–14 Michael Archer, Documents: Karsten Schubert Ltd, Artforum, March Ian Jeffrey, Bond & Gillick, Art Monthly, March Clifford Myerson, Documents & Details, Art Monthly, April Liam Gillick, The Placebo Effect, Arts, May Carolyn Christov-Bakargiev, Someone Everywhere, Flash Art, Summer Tim Hilton, Composition with Old Hat, Guardian, Aug 14 Frontlines: No Man’s Time, Artscribe, Sept Jean Yves Jouannais, Villa Arson, Art Press 162, Oct Giorgio Verzotti, No Man’s Time, Artforum, Nov Michael Archer, Audio Arts Issues and Debates I, Audio Arts Andrew Wilson, Technique Anglaise, The Art Newspaper, Nov Eric Troncy, No Man’s Time, Flash Art International, Dec Meyer Raphael Rubinstein, Technique Anglaise, Arts, Nov Michael Archer, Technique Anglaise, Artforum, Dec 1992

1993

Giacinto di Pietrantonio, Bond & Gillick, Gio’ Marconi, Flash Art Italia, Feb/March Maureen Paley interviewed by David Brittain, Creative Camera Giacinto di Pietrantonio, Bond & Gillick, Gio’ Marconi, Flash Art, April Henry Bond & Liam Gillick, Press Kitsch, Flash Art International 165, July/Aug Eric Troncy, London Calling, Flash Art International 165, July/Aug Giorgio Verzotti, News From Nowhere, Artforum, July/Aug Elizabeth Lebovici, L’art piege a l’anglaise, Liberation, July 7 Mark Thomson, Etats Specifique, Art Monthly, July/Aug Robert Pinto, Molteplici Culture, Flash Art International, Oct Francesco Bonami, Twelve British Artists, Flash Art International, Nov Peter Schjeldhal, Twelve British Artists, Frieze, Nov/Dec, Issue 7 Amedeo Martegani, Liam Gillick, Flash Art Italia, Jan


David Lillington, ON, Time Out, Jan 13 Jutta Schenk-Sorge, ZwÖlf Junge Britische Künstler, Kunstforum 120 Interview with Liam Gillick, Flash Art International, Jan Frederick Ted Castle, Occurances-NY, Art Monthly, Feb Eric Troncy, Wall Drawings & Murals, Flash Art International, May Nicolas Bourriaud, Modelized Politics, Flash Art, Summer David Lillington, True Brit, Time Out, July 28 Ray McKenzie, Views from the Edge, Scottish Photography Bulletin, Oct. Henry Bond and Liam Gillick, The List, July 2–15 James Odling-Smee, Wonderful Life, Art Monthly, Oct Mat Collings, Art Break, Observer, Oct 17 Liam Gillick, A Guide to Video Conferencing Systems and the Role of the Building Worker in Relation to the Contemporary Art Exhibition (Backstage), Documents, No. 4, Oct 1994

Benjamin Weil, Backstage, Flash Art International, Jan/Feb Liam Gillick/Ken Lum, Global Art, Flash Art International, Jan/Feb Radio Interview, Luzern, Feb Mark James, Freeze, BBC 1, Omnibus, Feb 22 Nathalie Bouley, Les Parcours d’illusions..., Le Bien Public, Feb 23 Roland Topor, Surface de Réparations, Art & Aktoer, Feb, No. 5 Nicolas Bourriaud, Au Moment du Penalty, Globe, 9–15 Feb Nicolas Bourriaud, Surface de Réparations, Art Press, No. 190 Eric Troncy, Suface de Réperations, Omnibus, June Fritz Billeter, Schnörkel und Schleifchen, Tages-Anzeiger, Feb 28 Arte Guerrero, El Pais, March 14 Olga Spiegel, Fotographos de Londres …, La Vanguardia, March 14 Christian Besson, Surface de Réperations, Flash Art International, May–June Helena Papadopoulos, Don’t Look Now, Flash Art International, May–June Simon Grant, World Cup Football Karaoke, Art Monthly, Sept Paradies Verloren, Die Presse, Oct 22 Verdoppelt, durchleuchtet, Kleine Zeitung (Graz), Oct 12 Brigitte Borchhardt-Birnbaumer, Ein neues Ausstellungsmodell, Wiener Zeitung, Oct 14 Wolfgang Zinggl, Teetrinken mit Künstlern, Falter, Oct 28 Schipper & Krome, Neue Bildende Kunst, Nov Mark Currah, Time Out, Dec

1995

Franz Niegelhell, Sammeln und Speichern, PAKT, Jan Michael Hauffen, Das Archiv, Kunstforum, Jan Justin Hoffman, Das Archiv, Artist, Feb-March Zapp Magazine, Möbius Strip, Issue 4 Arno Gisinger, Das Archiv, Eikon, April Liam Gillick, The Institute of Cultural Anxiety, Blueprint Project, (Jake & Dinos Chapman), Art & Text, May Nicolas Bourriaud, Pour une ésthetique relationnelle, Documents, No. 7 Sabine Maida, Sur un air de Darwin, Paris Quotidien, May 15 Philippe Parreno, Une exposition serait-elle un cinéma sans caméra?, Libération, May 27 Liam Gillick, Kunstlerporträts, Neue Bildende Kunst, June–Aug Liam Gillick, When Are You Leaving?, Art & Design, May Eric Troncy, Liam Gillick, Flash Art International, Summer Sabine Krebber, Romantisch und verwundbar, Stuttgarter Nachrichten, July 1 Forget about the ball and get on with the game, (with Rirkrit Tiravanija), Parkett 44, Summer Adrian Searle, Karaoke, Time Out, July 26 Sarah Kent, Ideal Standard Summertime, Time Out, July 26 Philip Sanderson, Ideal Standard Summertime, Art Monthly, Sept, No. 189 Erasmus is Late, La Repubblica, Sept 15 Christoph Blase, Ibuka!, Springer, Issue 4 Martin Maloney, Grunge Corp, Art Forum, Nov Jeffrey Kastner, Brilliant?, Art Monthly, Dec/Jan 1995–96 Lynn McRitchie, Brilliant, Financial Times Karmel, Liam Gillick, New York Times, Dec 8 Stuart Servetan, Liam Gillick, New York Press, Dec 6–18 Anne Doran, Part Three, Time Out, New York, Dec 13–20 Matthew Collings, My Brilliant Repartee, Modern Painters, Winter Peter Herbstreuth, Leipzig: Fotografie im Kunstverein Elsterpark,

244.

Liam Gillick

1996

1997

Kunst Bulletin, 12/95 Iain Gale/Georgina Starr, Where does British Art go from Here?, Independent, 2/1/96 Neal Brown, Ideal Standard Summertime, Frieze 26, Jan/Feb Adrian Dannat, Brilliant, Flash Art, Jan/Feb Simon Ford, Myth Making, Art Monthly, March, 194 Michael Archer, No Politics Please We’re British, Art Monthly, March, 194 John Tozer, Co-operators, Art Monthly, March, 194 Rainald Schumacher, Liam Gillick, Springer, 1/96 Matthew Ritchie, Liam Gillick: Part Three, Performing Arts Journal Georg Schöllhammer, Kuratiert von, Springer, March Brigitte Werneburg, Das Virus heißt Political Correctness, taz, 9/10 March Barbara Steiner, If…If…If… a lot of possibilities, Paletten, No. 223 Philippe Parreno, McNamara – A film by Liam Gillick, Paletten, No. 223 Andreas Spiegl, Traffic – CAPC, Art Press, No. 212, April Hans Knoll, Parallelwelten und frottierte Schilde, Der Standard, April 18 Johanna Hofleitner, Ausgestellt in Wien, Die Presse, April 19 Liam Gillick, Der Standard, May 2 Lynne McRitchie, Brillliant, Art in America, May Simon Ford, Der Mythos vom Young British Artist, Texte zur Kunst, No. 22, May Martin Herbert, Liam Gillick, Time Out, May 15–22 Liam Gillick, The Corruption of Time (Looking Back at Future Art), Flash Art, May/June, No. 188 Godfrey Worsdale, Liam Gilllick, Art Monthly, June, No. 197 Juan Cruz, Some Drawings from London, Art Monthly, July/Aug, No. 198 Lars Bang Larsen, Traffic, Flash Art, Summer, No. 189 Barbara Steiner, Traffic, Springer, Band II, Heft 2 Verena Kuni, Der Umbau-Raum, Springer, Band II, Heft 2 Jennifer Higgie, Liam Gillick, Frieze, Issue 30 Carl Freedman, Some Drawings From London, Frieze, Issue 30 Barbara Steiner, Film as a Method of Thinking and Working, Paletten, No. 224 Marie de Brugerolle, Renaissance du Magasin, Art Press, Oct, No. 217 Elizabeth Lebovici, Grand déballage d’art britanique, Liberation, Oct 10 Jelka Sutej Adamic, Liam Gillick, Delo, Oct 11 Angela Vettese, Giovani Inglesi Aspettano Godot, Il Sole, Oct 13 Michael Krome, Liam Gillick, Kunstzeitung, No. 3, Nov La creme anglasise s’expose à Paris, Le Figaro, Nov 26 Robert Fleck, Die wahren Helden sind die Väter, Art, Dec Pierre Restany, New Orientations in Art, Domus Peter de Jonge, The Rubell’s in Miami, Harper’s Bazaar, Feb Jesse Kornbluth, Is South Beach Big Enough for Two Hotel Kings?, New York Times, Feb 16 Die Zukunft als künstlerisch-humanes Spielkonzept, Ludwigsburger Kreiszeitung, Feb 22 Überliefertes Aufbrechen, Neue Luzerner Zeitung, April 12 “Enter - Audience, Artist, Institution” Ausgestellt, Luzern Heute, April 12 Gregory Volk, Liam Gillick at Basilico Fine Arts, Art in America, June Dominique Nahas, I met a man who wasn’t there, Review, July/August Elizabeth Mangini, I met a man who wasn’t there, The Exhibitionist, Aug/Sept documenta X, The Guardian; The Financial Times; Art Forum; Kunstforum; Art Monthly Zeigam Azizov, Liam Gillick and his Parallel Activities, Omnibus, Oct Nadine Gayet-Descendre, Nouvelle vie pour PS1, L’Oeil, No. 490, Nov Ann Doran, School’s In, Time Out New York, 6–13 Nov Marc-Olivier Wahler, Habiter un lieu d’art, Kunst-Bulletin, Dec Eric Troncy, We’re people this dumb before television: Interview with Liam Gillick, Documents sur l’art, No.11 Christoph Tannert, Zwischen Hospital und Hotel, Berliner Zeitung, Dec 20 Brigitte Werneburg, The Good Beuys, Taz, Dec 20 Tanja Fielder, Auf dem Pappbett endet Sehnsucht, Morgenpost, Dec 16


1998

1999

2000

Schwarzwaldklinik, Ticket, Dec 11 Susanne Gaensheimer, In Search of Discussion Island – About the Book Big Conference Centre, by Liam Gillick, Index, No. 22, Feb Karl Holmquist, Hospital, Flash Art March/April Jade Lindgaard, Le Plexiglas Philosophical, Le Monde; Les Inrockuptibles, 6–12 May David Musgrave, A to Z, Art Monthly, May Jade Lingaard, Le Plexiglas philosophal, Aden, May 6–12 Jörn Ebner, Dickes Make-up, dünnhäutige Kunst, Frankfurter Allgemeine Zeitung, July 11 Laura Moffatt, Liam Gillick, Art Monthly, July/Aug Inglenook, Village Voice, July 21 Ken Johnson, Inglenook, New York Times, July 24 Eric Troncy, Liam Gillick/Villa Arson, Les Inrockruptibles, Summer Christoph Blase, Liam Gillick, Blitz Review Christian Huther, Agiler Krisenmanager, Main-Echo, Sept 9 Christian Huther, Der Krisenmanager, Der Tagesspiegel, Sept 9 Paul Cassirer Kunstpreis, Berlin, Morgenpost, Sept 30 Morning Edition, NPR, New York, Oct 3 Kerstin Braun, Wie bildende Kunst Theater reflektiert, Neue Zeit, Oct 9 Anders Eiebakke & Bjønnulv Evenrud, Liam Gillick, Natt & Dag, Dec/Jan Berit Slattum, Kommuniserende britisk samtidskunst, Klassekampen, Dec 9 Salon 3, Flash Art, Jan/Feb Heinz Schütz, Steirischer Herbst ‘98, Kunstforum, Jan/Feb, No. 143 Holland Cotter, Changes Aside, New York Times, Feb 12 Roberta Smith, Continued Investigation of the Relevance of Abstraction, New York Times, Feb 12 Catsou Roberts, Ouverture de Salon 3, Art Press, No. 243, Feb Thomas Wolff, Na Logo, Frankfurter Rundschau, March 31 Sue Spaid, Conceptual Art as Neurobiological Praxis, Village Voice, April Andrea K. Scott, Conceptual Art as Neurobiological Praxis, Time Out, New York, April Andreas Denk, Nur Wasser lässt sich leichter schneiden, Kunstforum, May/June Silke Hohmann, Transparenz als Prinzip, Journal Frankfurt, June Ronald Jones, A continuing investigation into the relevance of abstraction, Frieze, Issue 47, Summer Brita Polzer, Kunst, Annabelle, June Radio DRS 2, Interview with Liam Gillick, June 29 Claudia Kock Marti, Viereck und Kosmos, Die Südostschweiz/Glarner Nachrichten, July 2 Edith Krebs, Er ist ein Jongleur, Zürcher Tagesanzeiger, July 3 Liam Gillick, Neue Zürcher Zeitung, July 9 Martin Engler, Verspätetes Millennium, Frankfurter Allgemeine Zeitung, July 21 Jonathan Jones, In the Midst of Things, The Guardian, Aug 3 Daniel Kurjako, Szenarien zwischen Gestern und Morgen, Aug 5 Eva Grundl, Erklärt Kunst die Welt, Südkurier, Aug 12 In the Midst of Things, The Big Issue, August 16 Elisabeth Wetterwald, XN, Parachute, July/Aug/Sept. No. 95 Duncan McLaren, Better Than Chocolate, The Independent on Sunday, Sept 5 In Richtung Buchmesse, Hannoveraner Anzeiger, Sept 9 Gabriele Nicol, Kubricks London zeigt seine karge Trostlosigkeit, Offenbach-Post, Sept 17 Kubrick in Himmel, AZ Mainz, Sept 18 Nikolaus Jungwirth, Erzengel Spielberg, Gott Kubrick und eine blutige Maria, Frankfurter Allgemeine Zeitung, Sept 21 Christian Huther, Wenn der liebe Gott glaubt, er sei Kubrick, Mainz Echo, Sept 23 Christian Huther, Raumfantasien rund um Stanley Kubricks Filme, Frankfurter Morgenpost, Sept 23 Liam Gillick macht alles selbst, Rhein-Zeitung, Oct 6 Asprey/Jacques Documentary, Channel 4 Britische Kunst wie fürs Wohnzimmer, Focus, Oct 25 Michael Hierholzer, Ein Gerüst für die Stoffe der Phantasie, Frankfurter Allgemeine Zeitung, Nov 3 What is art today?, Beaux Arts Magazine, Dec 2000 A Colourful Century, Vogue Italia, Jan Ann Donald, Real things from a virtual world, Glasgow Herald, Feb 28 Alex Hetherington, Continuum 001, The List, Feb 17

245.

Biografie/Biography

Elizabeth Mahoney, Terribly PC, Scotland on Sunday, Feb 20 Elizabeth Mahoney, Brief encounters with the shape of things to come, The Scotsman, Feb 23 Sarah Lowndes, Continuum 001, Metro, Feb 25 Michael Hauffen, Liam Gillick: Consultation Filter, Springerin, 2/00 Jonathan Jones, Liam Gillick, The Guardian, March 7 Samantha Ellis, Pain in a building, Evening Standard, March 6 Jörg Heiser, Disco/Discontent, Frieze, March Michael Wilson, Applied Complex Screen, Art Monthly, March Milou Allerholm, Form vävs ihop med politik, Dagens Nyheter, March 21 Petra Noppeney, Mysteriöse Multiplexplatten, Westfälischer Nachrichten, March 25 Liam Gillick, Achtung, diese Stadt wird normal, Frankfurter Allgemeine Zeitung, March 27 Manuel Jennen, Ein Pferd ist ein Pferd ist ein Pferd, Münster Zeitung, March 25 Marcus Lütkemeyer, Ratespiel aus Kunststoff, Münster Beate Naß, Plexiglas in der Decke, Münster Nina Mehta, Continuum 001, Art Monthly, 235, April What If?, Contemporary Visual Arts, Issue 28 Nicolas Siepen, Der Kern zerstreut sich, Frankfurter Allgemeine Zeitung, April 3 François Hers, L’aventure, des nouveaux commanditaires, Beaux Arts, April Daniel Birnbaum, What If?, preview, Artforum, May Robert Garnett, Sheep and Goats, postcard from Paris, Art Monthly 236, May Adrian Searle, Life Through a Lense, The Guardian, May 4 Ingeborg Cienfuegos, Konst pâ gränsen, Aftonbladet, May 5 Erika Josefsson, Konstnärer tar för sig av Arkitektur och Design, Metro Stockholm, May 6 Gilda Williams, Because a fire was in my head, South London Gallery, Art Monthly 235, May Clemens Poellinger, Shopping som konst, Svenska Dagbladet, May 8 Milou Allerholm, Rum med Samplade Känslor, Dagens Nyheter, May 13 Hans Hedberg, Estetiskt vaktombyte utan udd, Svenska Dagbladet, May 13 Peter Cornell, Sköna hem pâ Moderna, Expressen, May 13 Lars Vikström, Utställning med alltför fâ Tanker, Arbetet Ny Tid, May 21 Crispin Ahlström, Tänk Om Är Ingen Fullträff, Göteborgs Posten, May 29 Ronal Berg, Demokratie aus dem Computer, Zitty Magazine, 7 Adrian Searle, Thick and Thin, The Guardian, July 8 Johan Schloemann, Bau mir einen Schuhladen, Frankfurter Allgemeine Zeitung, July 24 Egna Tolkningar, En Svalt Sofistikerad Uppvisning, Norrländska Socialdemokraten, Aug 2 Thomas Olsson, Moderna Museet Tänker Om, Ystads Allehanda, Aug 5 Charlotte Bydler, Man Känner sig Nästan Läcker, Aftonbladet, Aug 5 Thomas Olsson, Moderna Museet Tänker Om, Bohusläningen med Dals Dagblad, Aug 5 Alison Green, Future Perfect, Art Monthly 239, Sept Marianne Silen, Konst, Arkitektur och Design, Byggindustrin, Sept 1 Duncan McLaren, Better than Chocolate, The Independent on Sunday, Sept 5 Gordon Burn, Art imitating Death, The Guardian, Sept 17 Michael Wilson, New British Art: Intelligence, Art Monthly 239, Sept Rachel Withers, Preview, Artforum, Sept Liam Gillick, Architect Builder Contractor and Developer, Sept Amber Cowan, Liam Gillick, The Times, Oct 7 Anna Gunnert, Tänk Om pa Moderna Museet, Konsttidningen, Oct 9 Liam Gillick, Vogue (British), Oct. Ina Blom, What If?, Frieze 54 Liam Gillick, Wallpaper, Oct Liam Gillick, Artclub Magazine, Autumn Liam Gillick, AN Magazine, Nov Rachel Campbell Johnston, Five Best Exhibitions Nationwide, The Times, Nov 4 Andrew Mead, Called into Question, The Architects Journal, Nov 8 Liam Gillick, Flux, Oct/Nov David Musgrave, Liam Gillick, Art Monthly 241, Nov


Amelia Bate, Liam Gillick, Epigram, Nov John Tremblay, Top Ten, Art Forum, Nov Liam Gillick, Tatler, Nov Charlotte Evans, Brum sees the best in British art, Sutton Coldfield Observer, Nov 24 Dean Inkster, Défence de la Lecture, Le Procès de Pol Pot, Art Press, Special No. 21 Jennifer Higgie, Future Perfect. Frieze, Issue 55 David Vincent, Part of a bigger picture, Wolverhampton Express and Star, Dec 2 Michael Wilson, Liam Gillick, Untitled, Dec Nigel Prince, Future Perfect, Untitled, Dec Neil Mulholland & David Musgrave, Intelligence, Untitled, Dec Daniel Birnbaum, What If?, Artforum, Dec Liam Gillick Voice Choices, Village Voice, Dec 1 Ken Johnson, Liam Gillick, New York Times, Dec 8 Tony Godfrey, Liam Gillick, Burlington Magazine, Dec Max Andrews, Liam Gillick, Contemporary Visual Arts, Issue 32 Ingela Lind, Konst i Krock med Kommersen, Dagens Nyheter, Dec 26 2001

Maria Bonacossa, Liam Gillick, Tema Celeste, Jan Roy Exley, Liam Gillick, Art Press, Jan Andris Grinbergs, Musdienu Utopija, Sestdiena, Jan 6 Spekulative Architektur – Liam Gillick, Neue Zürcher Zeitung, Jan 31 Color Ordenado, El Periodico del Arte, Feb Michael Archer, Liam Gillick, Art Forum, March Liam Gillick, Galeria Antiquaria, March Jose Luis Loarce, Liam Gillick, Lapiz, No. 171, March Javier Hontoria, Liam Gillick, El Mundo-El Cultural, March 14 Anda Busevica, Divi no trisdesmit diviem, Diuc, March 23 Liam Gillick, Arte y Parte, March, No. 31 Ieva Rupenheite, Latvijas robeza ar Zabriski, Diuc, March 31 Christophe Domino, Liam Gillick, France Culture, April Elizabeth Kley, Liam Gillick, Art News, April Dan Fox, Fig 1, Frieze, April Musdienu Utopija, Studija, April/May Maira Admine, 46 dienas Riga figures musdienu utopija, Dienar Bizaess, April 5 Ieva Kalnina, Ieraudzit musdienu utopiju, Jauna Anuze, April 5 Paul Clark, Liam Gillick, Evening Standard, April 17 Janis Borgs, Kede gulaszupa, Diena, April 17 Adrian Searle, Empty Promises, The Guardian, April 24 Andrea Carrasco, Exhibition in a Box, April 25 Aeneas Bonner, Quantum murals on Ormeau Road, Irish News, April 28 David Bussel, Liam Gillick, ID, May Louisa Buck, London, The Art Newspaper, May Matin Durrani, Belfast Confused by Mystery Questions, Physics World, June Sassa Trülzsch, Der gerissene Faden: Rhizom, Kunstforum, June/July Anjana Ahuja, Try to answer that, mate, The Times, June 4 Dominic Eichler, Berlin Biennale 2, Frieze, issue 61 Jan Wilhelm Poels, Art Works, Frame, July-Aug Dave Beech, The Communications Department, Art Monthly, issue 249, Sept Stephen Bury, A Timely Place, Art Monthly, issue 249, Sept Annie Fletcher, Verwarring als Primaire Conditie, Metropolis M, Aug/Sept Fisun Günar, Building Concepts, What’s On, Sept 5 to Sept 12 Netzwek als schräges Kunstwerk, Kurier, Sept. 18 Doris Krump, Freejazz in der Grauzone, Der Standard, Sept 26 Johanna Hofleitner, Diskursorientiert, Die Presse, Oct 5 Ernst P. Strobl, Es grünt so grün unter der Sonne, Salzburger Volkszeitung, Oct 18 A Question. Answers from: Frieze, Nov/Dec Raumgefühl, Salzburger Nachrichten Jonas Ekeberg, Bokstavelig talt superkult, Dagens Naeringsliv, Oslo, Nov 3 Lena Lindgren, Skriften på veggen, Dagens Naeringsliv, Nov 23 Auf schrägem Boden, Neue Kronen Zeitung, Salzburg, Nov 23 Arve Rød, Samvittighetens Mellomrom, Billedkunst, No. 6, Dec Karin Pernegger, Dedalic Convention, Camera Austria, No. 76 Jonas Ekeberg, Farvel Utsmykking, Dagens Naeringsliv, Dec 31

246.

Liam Gillick

2002

Strategies Against Architecture, Collezioni Edge, Winter/Spring Kristine Drakeer, Kunst som merkevare, Dagens Naeringsliv, Jan 7 Edgar Schmitz, Liam Gillick: Annlee You Proposes, Kunstforum, Jan–March Roberta Smith, The Armory Show, Grown Up and in Love with Color, New York Times, Feb 22 Annlee et ses vies, Kunst-Bulletin, No. 4 Elizabeth Mahoney, Sea of Dreams, The Guardian, Feb 22 Sue Arnold, Tusa Raises my Highbrows, The Observer, March 10 Philippe Dagen, L’Urgent Painting, avec précipitation, Le Monde, Jan 25 Richard Leydier, Urgent Painting, Art Press, March Angela Vettese, Oltre lo steccato della pittura si o pittura no, Il Sole, Feb 3 Skulptur als Diskursraum, Der Kurier, March 27 Dark Spring, Der Standart, March 22 Claudia Ihlefeld, Der trügerische Glanz von Gewalt im Alltag, Heilbronner Stimme, April 4 Reto Kreuger, In Kraichtal stört Lee Karls Ruhe, Badische Neueste Nachrichten, April 3 Cornelia Gockel, Frühling lässt sein schwarzes Tuch, Süddeutsche Zeitung, March 19 Dunkler Frühling, Stuttgarter Zeitung, April 3 Petra Mostbach, Nichts ist unmöglich, Lift, April 4 Martin Herbert, Liam Gillick, Art Review, May Jan Estep, Negotiating the Built World, New Art Examiner, May/June Liam Gillick/Hélio Oiticica, Teme Celeste, May/June Fisun Güner, If you go down to the woods today, Metro, May 7. Andrew Renton, How to behave in a gallery, Evening Standard, April 30 Sean O’Hagan, This is not an art gallery, The Observer, May 4 John Russell Taylor, Wrapped up in celluloid, The Times, May 8 Nick Hackworth, Will yoga and a little Plexiglas add up to a Turner?, Evening Standard, May 9 Adrian Searle, Road to Nowhere, The Guardian, May 14 Martin Gayford, I’m sorry, I haven’t got clue, The Daily Telegraph, May 15 Rachel Campbell-Johnston, Liam Gillick and Hélio Oiticica, The Times, May 18 Mark Harris, Liam Gillick/Hélio Oiticica, Art Monthly, June Liam Gillick, Literally No Place, Tank, Vol 3, No. 2 Melanie Klier, Lesen im Meer der Liebe, Münchner Merkur, Aug 6 Mike Dawson, Liam Gillick, Flux, Aug/Sept Alex Farquharson, Near Favorite, Artforum, Sept Duncan McLaren, The Artist as Builder, Contemporary, Sept Dustin Ericksen, 100 Reviews, Contemporary, Sept Edgar Schmitz, Hintergrund ist überall, Texte zur Kunst, Sept Catherine Wood, Inframince, Art Text, Oct Beaty Coleman, Hot Florida Style, InCircle Entrée, Fall Caoimhin Mac Giolla Leith, Liam Gillick, Artforum, Oct Literally No Place, Tema Celeste, Sept-Oct Sarah Lyall, Art Show Asks for it, and the Vox Populi Hollers, New York Times, Nov 8 Luis Carlos Emerich, Thisplay, Novedades, Nov 22 Germaine Gomez Haro, La Colección Jumex, La Jornada Semana, Nov 24 Various press on The Turner Prize

2003

Philip Nobel, Sign of the Times, Artforum, Jan Ill Communication, Big Issue Scotland, Jan 16 Knut Ebeling, Bauen, Wohnen, Denken, Der Tagesspiegel, Jan 18 Edgar Schmitz, Interview mit Liam Gillick, Kunstforum, Jan Laura Grant, Communication…, Press and Journal, Jan 25 John Calcutt, Ill Communication, The Guardian, Jan 29 Duncan MacMillan, Pop Goes the Visual, The Scotsman, Jan 28 Andrew Hunt, The Unique Phenomenon of a Distance, Issue 72 Amber Cowan, Ill Communication, The Times, Feb 1 Sebastian Preuss, Design mit Inhalt, Berliner Zeitung, Feb 19 Corinna Daniels, Liam Gillick, Die Welt, Feb 21 Corinna Daniels, Zeitlose Wiederholungen bei Atle Gerhardsen, Die Welt, Feb 21 Brigitte Werneburg, Der Meister der korrektiven Geste, taz, Feb 22 Adrian Searle, This is a stick up, The Guardian, Feb 25 Annlee You Proposes (cover), Contemporary, Issue 47/48 Niru Ratnam, Hang it All, The Observer, March 9


Dal post-moderno ai neo-moderni, Vernissage, March Gillian Lamb, Private Viewing, Self Service, Spring/Summer Martin Herbert, Days like These, Art Monthly, April Alison Green, Utopias and Universals, Art Monthly, April Vincent Pécoil, Brand Art, Art Monthly, April Franco Fanelli, Moderni si …, Il Giornale dell’Arte, April Edgar Alejandro Hernández, Sostien diálogo creativo, Reforma, April 3 Maria Louisa Lopez, Diálogo plástico entre México e Inglaterra, Milenio, April 4 Renato Barill, Come sono “antichi” questi Moderni, l’Unita, April 5 Cloe Piccoli, Contemporanei, no moderni, La Repubblica, April 5 Gabriella Serusi, I Moderni, Segno, March–June Roberto Bosco, Quiénes son los modernos?, El Pais, May 3 Luca Beatrice, I Moderni, Flash Art Italia, June/July Robert Brown, The Shape Shifter, Art Review, April Bar Americas, el Tiempo Celeste, Spring F. Samaniego, 25 artistas internacionales formarán el mayor proyecto de escultura pública, El Pais, April 26 Tony Godfrey, This Was Tomorrow, Burlington Magazine, May Bénédicte Ramade, Question de modernité, L’oeil Andrew Renton, How London took a Big Bite…, Evening Standard, May 13 Joël de Rosnay, L’entretien, L’express, May 15 Lorenza Pignatti, The art of noise, Kult, June Birgit Sonna, Die Farbforscher, Süddeutsche Zeitung, June 12 Margaret Sundell, Exterior Days, Time Out New York, June 19–26 Sarah Milroy, A Mighty Brain Stretch, Globe and Mail, Toronto, Sept 25 Alex Farquharson, I curate, You curate, We curate, Art Monthly, Sept Alex Farquharson, Curator and Artist, Art Monthly, Oct Rose Aiden, Brush with Fame, The Observer, Oct 12 Marc Peschke, Die Schwierigkeit, nein zu sagen, Plan F, Oct 23–29 Birgit Sonna, Alles, was der Fall war, Süddeutsche Zeitung, Oct 13 Karin Lorch, Adorno, Springerin, Winter Jan Verwoert, Waarom Alleen Schilderkunst, Metropolis M, No. 5 Mark Wilsher, Wittgenstein: Family Likeness, Art Monthly, Dec-Jan, No. 272 Hal Foster, Arty Party, London Review of Books, Dec 4 Martin Herbert, Liam Gillick and Sean Dack, Time Out, Dec 3–10 Michael Meredith, Liam Gillick: The Power Plant, Artforum, Dec Jessica Morgan, Tirana, Tate Magazine, Nov/Dec 2004

Nicholas Serota, Journey into Space, The Guardian, Jan 17 Ronald Jones, Adorno: The possibility of the Impossible, Artforum, Jan Les 30 Artistes de L’Année, Beaux Arts, Jan Alicia Miller, Interview with Liam Gillick, Sculpture, Vol. 23, No. 1 Abel H. Pozuelo, Liam Gillick, El Cultural, Feb 26 Britta Scholze, Unerwartete Begegnungen Die Ausstellung „Adorno: Die Möglichkeit des Unmöglichen“, im Frankfurter Kunstverein, Texte zur Kunst, No. 53, March Gregory Elgstrand, Liam Gillick, Canadian Art, Spring Michael Kimmelman, How not much is a whole world, New York Times, April 2 Randy Kennedy, Minimalist oases in a bustling Manhattan, New York Times, April 23 Max Henry, Durable Goods, Mysterious & Brutal, The New York Sun, April 8 Charles Barachon, Liam Gillick, Technikart, May Joseph Masheck, Minimalism: NY, Art Monthly, June Christophe Cherix, Interview, Afterart News, No. 2, Summer Charlotte Higgins, Reprieve for Lost avant-garde masterpiece, The Guardian, Aug 21 New York, Self Service, Sept Claire Bishop. Antagonism and Relational Aesthetics, Oct 110, Fall Jerome Lefevre, Superposition, Archistorm 09, Sept/Oct Carolina Söderholm, Gåtfull lek med katt och råtta, Sydsvenska Dagbladet, Nov 30 Yoam Gourmel, Liam Gillick, Citizen K, Dec The Bulgari Art Conversations, The Art Newspaper, Dec 3 Boel Gerell, Konstnärsfylla, Kvälls Posten, Dec 4 Britte Montigny, Konsten tänjer på gränserna. Skånska Dagbladet, Dec 10 Therese Marklund, Krävande katt-och råttalek prövar tålamodet, SvD, Dec 11

247.

Biografie/Biography

Pontus Kyander, Vitigast 2004, Sydsvenskan, Dec 19 Ulrike Stahre, Vi hejar alltid på rattan, Aftonbladet, Dec 28 Very New Art, Tokyo, 4/2005 2005

Elna Svenle, Konstnärliga regelbrott, Kristianstadtsbladet, Jan 10 Claire Moulène, Tête chercheuse, Les Inrockuptibles, Jan Nicole Duault, Les paillettes de l’utopiste Liam Gillick, Le Journal du Dimanche, Jan 30 Various authors, Emploi travaïe!, Libération, Jan 31 Benjamin Thorel, Never mind the Gillick, Art 21, Jan–Feb Exit Express, Liam Gillick, Feb Claire Bishop, Antagonism and Relational Aesthetics, Oct 11 Gatsby le Mexican, Libération, Feb 1 Élisabeth Lebovici, Liam Gillick, Économie parallèle, Liberation, Feb 17 Mary Louise Schumacher, Artist finds the right words for museum installation, Milwaukee Sentinel Journal, Feb 24 Liam Gillick, Exit, Feb Vincent Pécoil, Une histoire à l’envers (a reverse story), 02, No. 32 Charles Barachon, Volvo, pour la vie, Technikart, Feb Jennifer Allen, Briannnnnn & Ferryyyyyy, Artforum, Feb Philippe Dagen, Liam Gillick ou les limites de l’engagement politique en art, Le Monde, Feb 24 E. Sennewald, Von der Utopie zur Positionierung, Kunst Bulletin, March 1 Nigel Coates, There’s no Place Like The Home Office, Independent on Sunday, March 6 Hugh Pearman, The Government Building that Isn’t, The Times, Feb 20 Philippe Dagan, Liam Gillick ou les limites de l’engagement politique en art, Le Monde, Feb 24 Bénédicte Ramade, Gillick: preparer la visite, L’Œil, March Liam Gillick Sean Dack, Pi Magazine, March Eldon Chim, Liam Gillick Sean Dack, Zipmagazine, March Workshop, Chinese Esquire, March Lottie Moggach, Art Buying for Beginners, Financial Times, March 13 Dior Homme, Ming Pao Weekly, March 12 The Home Office, The Independent, March 16 A.B., Supernova Anglia, Gazeta Wyborcza, April 28 Tracey Fugami, Liam Gillick, Art Papers, March/April Kenneth Powell, Home Office Comforts, Architects Journal, March 10 Elisabeth Kley, Goodbye 14th Street, Art News, May Alex Coles, Liam Gillick and the Kenneth Noland Scenario, Parachute, 4/5/6 Mark Owens, Liam Gillick, The Blowup Magazine, No. 3 Mary Louise Schumacher, Art for my President, Milwaukee Sentinel Journal, May 18 Michael Gibbs, Populism, Art Monthly, June Todd Meyers, Liam Gillick, ArtUS, May/June Ken Johnson, Everywhere’s the same: Nowhere in particular, New York Times, June 2 Alex Farquharson, Is the Pen Still Mightier, Frieze 92 Sophie Elmhirst, Architecture as Background, Guardian Public, May The Picture Page, The Buffalo News, June 16 Treier, Heie, Kôrgmodernism Kolmkümmend aastat hiljem, Areen, Aug 15 Porri, Annell, Briti loogika, Weekly cultural magazine Sirp, Sept 9 Mariano Mayer, Liam Gillick, Neo, Sept J.L. Garcia Gomez, Liam Gillick, Málaga Hoy, Sept 17 J. Zotano, Reflexiones Apalabradas, La Opinión de Málaga, Sept 17 Marina Polonio, Juego en el CAC Málaga, Sur, Sept 17 Liam Gillick and Video Sessions at the Centro de Arte Contemporáneo, Tnews, Essential, Sept Malaga, The Art Newspaper, Num. 161, Sept 2005 Exposiciones en el Centro de Arte Contemporáneo de Málaga (CAC), Malaga y Málaga, Sept, 2005 Malaga, El Giraldillo, Sevilla, Num. 259, p. 64 Javier Hontoria, Liam Gillick, Ferias y bienales libranuna batalla ideologica, El Cultural, Madrid, Oct 20 Liam Gillick, AKTvelle, Málaga, Num. 222, Oct J.P., Liam Gillick, Arte y Parte, Santander, Num. 59, Oct–Nov Málaga, CitizenK España, Madrid, Num. 3, Oct Pepe Bárcenas, Vale ás una imagen que mil palabras? Absolute Málaga, Málaga, Num. 15, Nov Liam Gillick, Casa Viva, Barcelona, Num 102, Nov


Francisco Flores, El CAC apuesta por Gillick, Piensa y Los Carpinteros para la agenda otoñal, Diario Málaga, Viernes, Aug 5 A.J. Avilés Zugasti, Arte para empezar el otoño, Málaga hoy, Miércoles, Aug Liam Gillick diseña obras de texto para el CAC, Málagativa, Sept Liam Gillick, Plástica, Viernes, Sept 9 M.D.M., Liam Gillick trae al Centro de Arte Contemporáneo su último trabajo, Diario Málaga, Sept 12 Inma Escobar, Liam Gillick llega al CAC con su primera exposición en España, El Mundo, Sept 17 Camacho, J.M., Málaga expone la vertiente más conceptual y menos conocida de Gillick, ABC, Sept 17 El artista británico Liam Gillick expone en el CAC ‘McNamara Motel, Málaga Hoy, Domingo, Sept 18 Beatrice Ehrlich, Der Gedanken freier Lauf, Sur Deutsche Ausgabe, Donnerstag, Sept Enrique Castaños Alés, Más allá de una reflexión sobre el concepto de arte, Vivir la Cultura Arte, Sur, Sept 23 Raquel Ruiz, Negro sobre blanco, Tutiplán, Viernes, Sept 23 Iván de la torre Amerighi, Saludando a Gillick desde el duro banco, ABCD, Las artes y las letras, Madrid, Sept 24 Francisco Calvo Serraller, Gillick analiza los cambios socials en un “proyecto de pensamiento”, El Païs, Oct 21 Carlos Jimenez, Obreros atrapados, El Païs Sabado, Nov 12 Javier Hontoria, Liam Gillick, El Cultural, Oct 20 Liam Gillick, How has art changed survey, Frieze 94 Stéphanie Moisdon, Blacklisted, Self Service Fall/Winter Moulène, Claire, Josée et marc Gensollen Inventaire Avant Overture, Zéro duex à Marseille, Autumn Exposition strictement confidentielle, l’écho du centre, Vassivière, Nov 21 Confidentiel et surtout ouvert à tous, la montagne, Nov 23 Bruno Barlier, De nouvelles formes d’expression sur l’île de Vassivière, l’écho du centre, Dec 1 Jessica Lack, Kiosk: Modes of Multiplication/Liam Gillick: Edgar Schmitz, The Guardian, Dec 24 Roberta Smith, Liam Gillick, New York Times, Dec 9 Paul McCann, Join a Swish Bank, Wallpaper, Dec–Jan Jesus Miguel Marcos, Liam Gillick pensando el arte, El Mundo, Nov 15 2006

Sally O’Rielly, Kiosk, Time Out London, Jan 11 Emmanuelle Lequeux, Strictement Confidentiel, beaux-arts magazine, Jan P.S., Confidences immatérielles, Vassivière – Marseille, Connaissance des arts, Jan Marie de Brugerolle, McNamara Motel, Flash Art, Jan–Feb Driving Practice, John Slyce in conversation with Liam Gillick, Interviu, Jan Neringa Cerniauskaité, Modernizmo Superzvaigzdé, Meno Dienos, Jan 6 Simon Rees, Supernova: kita didziojo britu sprogimo teorija, Siaures Atenai, Jan 21 Kathi Hofer, A Person alone in a Room with Coca-Cola-Coloured Walls, Springerin, Feb Multicolor, Neo 2, March Michael Glover, Best of British Lights up the Tate, The Times, Feb 25 Adrian Searle, Foot Fetish, The Guardian, April 3 Ken Johnson, Charting degrees of separation and connection in the art world, New York Times, April 7. Peter Bollen, Artists in Residence, New York Times, April 16 Julia Chaplin, Art Blooms in the California Desert, New York Time, April 21 David Barrett, Tate Triennale, Art Monthly, May Martha Schwendener, Grey Flags, Artforum, May 30 Art What’s in a Name? The New Yorker, June 12 Jerry Saltz, The Sublime is Us, Village Voice, June 29 Andrea Scott, Occluded front, Time Out New York, June 1–7 Roberta Smith, Grey Flags, New York Times, July 14 Hans Ulrich Obrist, A community of solitary souls, Domus, May Dan Fox, Thankyou for the music: London Beat, Frieze 102 Elwyn Palmerton, Grey Flags, The Sculpture Center, Frieze 102 Aiden Dunne, A playful style of innovation, Irish Times, Nov 22

2007

Carol Vogel, Independence at the Hammer, New York Times, Jan 19

248.

Liam Gillick

Alice Rawsthorn, The designer Newson teams up with Gagosian Gallery, International Herald Tribune, Jan 19 Luca Martinazzoli, Collateral: Interview with Andreas Angelidakis, Yoox, Jan 29 Fleur Britten, Magazines in Motion, International Herald Tribune, Feb 12 John Slyce, All Hawaii Entrees/Lunar Reggae, Art Monthy, Feb Carol Vogel, Ablaze in swirls of amber grain, New York Time, March 16 Clare Carolin, Letter from London and Dublin, The Brooklyn Rail, March Jörn Ebner, Farbwerke Superstaat, Frankfurter Allgemeine, April 5 Jennifer Allen, Cologne’s European Kunsthalle Taking Shape, Artforum, April Yoann Van Parys, Passage à l’acte, Flux News 43 Marc Holthof, Liam Gillick, H-Art, May Jennifer Allen, Room with an Overview, Frieze, May Charlotte Cripps, Surf’s up eat at the Tate, The Independent, May 17 JJ Charlesworth, Critics’ Choice: Memorial to the Iraq War, Time Out London, June 1 Christine Lindey, Iraq War: A Vital Theme, Morning Star, June 4 Jerry Salz, Ugh, Venice, New York Magazine, July 2 Adrian Searle, Il Tempo del Postino, The Guardian, July 14 Tim Adams, Il Tempo del Postino, The Observer, July 15 Richard Dorment, Il Tempo del Postino, The Daily Telegraph, July 17 Marcus Verhagen, Conceptual Perspex, New Left Review, July/Aug Il Tempo del Postino, Art Review, Sept Zoe Christodoulides, Art Explosion, Cyprus Mail, July 14 Philippe Rénier, L’art transforme la ville, Le Journal des Arts, Nov Aimar Arriola, Liam Gillick, Mugalari 451, Bilbao Marcus Miessen, Constructed Criticality, Build, issue 6, 2007 2008

Jenny Turner, The Way we Live Now, The Guardian, Jan 2 Liam Gillick, Tema Celeste, Jan–Feb Emily Pethick, Anyang Public Art Project, Frieze, Jan–Feb Lillian Haberer, Liam Gillick, Artforum, Jan Gerhard Mack, Meister der Täuschung, Art, Jan Susannah Frankel, Master Minds, The Independent, Jan 23 Bert Mebius, Interview with Liam Gillick, Groene Amsterdammer, Jan 25 Paulina Szczesniak, Die etwas andere Retrospektive, Tagesanzeiger, Zürich, Jan 27 Paulina Szczesniak, Gegen die Warenförmigkeit von Kunst, Tagesanzeiger, Zürich, Jan 28 Julia Voss, Ein Ausblick auf die Zukunft der Skulptur, Frankfurter Allgemeine, Jan 28 Janneke Wesseling, Dreigende leegte, NRC Handelsblad, Feb 1 Jörg Häntzschel, Der dreckige Charme von Downtown, Süddeutsche Zeitung, Feb 6 Neuer Kunstraum in New York, Allgäuer Zeitung, Feb 5 New York: Goethe Institut eröffnet neuen Kunstraum, Die Zeit, Feb 4 Edith Krebs, Eindeutig uneindeutig, Neue Zürcher Zeitung, Feb 6 Daniel Schreiber, Goethe Reloaded, Die Tageszeitung, Feb 10 Jordan Mejias, Alles so schön grün hier, Frankfurter Allgemeine, Feb 7 Frits de Coninck, Kunst over kunst, FD Persoonlijk, Feb 9 Pieter van Bogaert, Een Onwennige Leegte, <H> Art, Feb 14 Andreas Köhler, Goethe Downtown, Neue Zürcher Zeitung, Feb 15 Liam Gillick: Proxemics, Exit Magazine, Madrid, Feb Ilse van Rijn, Liam Gillick, Metropolis M, no. 2 Sandra Bradvic, Rollenwechsel, artensuite, March Liam Gillick, Artecontexto, March Ina Blom, Die Logik des Trailers, Texte zur Kunst, 69 Sven Lütticken, Leben mit Abstraktion, Texte zur Kunst, 69 Lars Kwakkenbos, Catastrofe in het museum, De Standaard, Mar 14 Janneke Wesseling, Liam Gillick, NRC Handelsblad, Mar 15 Bianca Visser, Liam Gillick, Exit Express, March Ben Lewis, Trapped in Kubrick Land, The Evening Standard, April 25 Katie Kitamua, Liam Gillick, Frieze, April Brett Sokol, Miami Art Machine, New York Magazine, April 27 Liam Gillick, Modern Painters, April Jean-Max Colard, Blanche Neige, Les Inrockuptibles, April 8 Holder Liebs, Drei Perspektiven und ein kurzes Szenario, Süddeutsche Zeitung, May 21 Barbara Basting, Kunstgeschichte und Qualität, Tagesanzeiger, May 21


Wir sind Brite, Neues Deutschland, May 22 Christina Tilmann, Ein Holzweg, Tagesspiegel, May 22 Liam Gillick im deutchen Pavillon 2009, Kölner Stadt-Anzeiger, May 22 Brite Liam Gillick löst Grenzen auf, Neue Presse, May 24 Jerry Salz, Liam Gillick, New York Magazine, June 6 Ken Johnson, Liam Gillick, New York Times, June 6 T. J. Carlin, The State Itself Becomes a Super Whatnot, Time Out NY, Issue 661 Judith Souriau, Factories in the Snow, Cahiers du MNAM, Spring Danny Zuvela, The Brisbane Sound, Art Monthly Australia, July Nicole Scheyerer, Wodka und Glitter für das Volk, Die Presse, Wien, July 2 Adrian Searle, Dazzled by Rings, The Guardian, July 30 Bruce Constantineau, Poetry embraces Vancouver tower hotel, The Vancouver Sun, Aug 28 Art Marks Tube Logo’s Party, BBC News, Sept 3 Tom Lubbock, Tunnel Vision, The Independent, Sept 22 Roberta De Righi, Salz in der globalen Suppe, Abendzeitung, Sept 25 Oliv Freia, Mit Deutschland Arbeiten, Münchner Merkur, Sept 26 Saul Ostrow, Liam Gillick, Art in America, Sept Stefanie Richter, Als würde er einen Laden renovieren, Gala, Oct 9 Rüdiger Heise, Konzeptkunstler oder theatermacher?, Applause, Oct The Power 100, Art Review, Nov Kathryn Shattuck, Shining a Light on a Movement that Maybe Isn’t, New York Times, Oct 26 Roberta Smith, Museum as Romantic Comedy, New York Times, Oct 31 Ours, Azure, Oct Declan Long, Distant Relations, Art Review, Nov The Power 100, Art Review, Nov Exercise in Utility, T Magazine, New York Times, Nov 9 Jerry Saltz, Night at the Museum, New York Magazine, Nov 10 Holger Liebs, Gerpinkelt wird bei den Briten, Süddeutsche Zeitung, Nov. 14 Alexander Kluy, Unser Mann für Venedig: Liam Gillicks Ideen, Die Welt, Nov 13 Cornelia Gockel, Liam Gillick, Kunstforum, Nov/Dec 2009

Konstanze Crüwell, Utopien in der Lagune, Frankfurter Allgemeine Zeitung, Jan 20 Holger Liebs, Bode und Bauhaus, Süddeutsche Zeitung, Jan 20 Benjamin Carlsson, theanyspacewhatever, Frieze, Jan–Feb Brian Scholis, theanyspacewhatever, Afterall, Feb Dave Beech, Recovering Radicalism, Art Monthly, Feb Liam Gillick rekonstruiert … Die Welt, Feb 14 Thomas Wulffen, Berlin: Wer nicht dabei war, gehört nicht dazu, Art Magazine, Feb 16 Nicola Kuhn, Was ist deutsch, Tagesspiegel, Feb 14 Scott Woods, & Liam Gillick, Adam and Eve, March–April Jennie Sorkin, Ours, Frieze, issue 121 John Kelsey, theanyspacewhatever, Art Forum, March Helen Molesworth, Social Problem, Art Forum, March Carrie Lambert-Beatty, theanyspacewhatever, Texte zur Kunst, March John Slyce, Recuperating Modernism, Art Monthly, March Mafred Engeser, Liam Gillick über die Nähe zwischen Künstlern und Lumpensammlern, Wirtschaftswoche, April 19 Christian Tröster, Fasziniert von den Momenten des Scheiterns, Hauser, Issue 3 Laura Allsop, Art and Class: The Arnolfini Priviledge, The Guardian, May 20 The Venice Biennale, L’Uomo Vogue, June Mirja Rosenau, Neue Deutsche Freiheit, Art Magazin, June Matthew Brannon, Liam Gillick, Interview Magazine Nicola Kuhn, Deutscher Pavillon von Gillick Gebaut, Tagesspiegel, May 31 Richard Dorment, Venice Bienale 2009: Behind the Mask, June 8 Adrian Searle, Bodies, Babble and Blood, The Guardian, June 9 Ingo Arend, Küche statt Krieg, Der Freitag, June 7 Taraneh Fazeli, Class Consciousness, Artforum, Summer Saul Orstrow, Practical Considerations, Art in America, Summer Daniel Völzke, Hörbüchern, Monopol, Summer Aidan Dunne, At the heart of a new art world, Irish Times, July 10 Angela Molina, A double agent in the Venice Biennale, El Pais, July 4 Holger Liebs, Drei Mann in einem Ohr, Süddeutsche Zeitung, Aug 4

249.

Biografie/Biography

Michael Hübl, Die Trojanische Katze, Kunstforum, 198 Heinz-Norbert Jocks, Die uneingepasste Küche, Kunstforum, 198 Tom McDonough, Liam’s (not) Home, Texte zur Kunst, Issue 75 Lynne McRitchie, Venice 2009, Art in America, Sept Charlotte Higgins, Hyper-Active Swiss Curator tops artwork power list, The Guardian, Oct 15 Markus Mittringer, Frankfurter Küche, Wiener Verhältnisse, Der Standard, Oct 20 Britischer Künstler Liam Gillick stellt im MAK aus, Kleine Zeitung, Oct 20 Marsha Lederman, Vancouver Public Art on a Grand Scale, The Globe and Mail, Dec 5 Kevin Griffin, Public Art in Vancouver: What’s in a name?, Vancouver Sun, Dec 5


LIAM GILLICK Ein langer Spaziergang... Zwei kurze Stege...* 1. April bis 8. August 2010 in der Kunst- und Ausstellungshalle der Bundesrepublik Deutschland, Bonn

Developmental 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 4 Teile, je 30 x 120 x 10 cm 4 elements, each 30 x 120 x 10 cm Courtesy Casey Kaplan, New York 162–163

*One long walk... Two short piers...

WERKE IN DER AUSSTELLUNG WORKS IN THE EXHIBITION How Are You Going to Behave? A Kitchen Cat Speaks 2009 Holz, Lampen, ausgestopfte Katze, Text, Türvorhänge, MP3-Player wood, lamps, stuffed cat, text, door blinds, MP3 player Maße variabel dimensions variable Courtesy the Artist, Casey Kaplan, New York und Esther Schipper, Berlin 30–33 Volvo Bar 2008 Holz, Spanplatte laminiert, Jutebespannung, Vinylbuchstaben chipboard panels, laminated, covered with hessian, vinyl text Maße variabel dimensions variable Courtesy Esther Schipper, Berlin und Galerie Eva Presenhuber, Zürich 132–133 Mannered Agreement 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 2 Teile, je 50 x 120 x 10 cm 2 elements, each 50 x 120 x 10 cm Courtesy Esther Schipper, Berlin 160–161 Discarded Projection 2008 pulverbeschichtetes Aluminium powder-coated aluminium 20 Teile, je 200 x 15 x 3 cm 20 elements, each 200 x 15 x 3 cm Courtesy Esther Schipper, Berlin Walk Out 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm Collection Antonio Hernandez, Spain Loaded Bay 2008 bemaltes Aluminium painted aluminium 20 Teile, je 200 x 15 x 3 cm 20 elements, each 200 x 15 x 3 cm Courtesy Esther Schipper, Berlin Rendered Collective 2008 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 2 Teile, je 50 x 120 x 10 cm 2 elements, each 50 x 120 x 10 cm Courtesy Casey Kaplan, New York

250.

Liam Gillick

1968 2008 bemaltes Aluminium painted aluminium 2 Teile, je 30 x 99 cm 2 elements, each 30 x 99 cm Collection Hadley Martin Fisher, New York 198–199 Propped Discussion Platform 2007 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 300 x 150 x 240 cm Sammlung Ringier, Schweiz 164 Closed Reopened Closed Again 2007 pulverbeschichtetes Aluminium powder-coated aluminium 40 Teile, je 200 x 15 x 3 cm 40 elements, each 200 x 15 x 3 cm Sammlung Thomas und Cristina Bechtler, Schweiz 112–113 Extended Production Black 2007 Pulverbeschichtetes Aluminium powder-coated aluminium 200 x 300 x 30 cm Sammlung Siegfried und Jutta Weishaupt 158 The Commune itself Becomes a Super State 2007 Vinylbuchstaben Vinyl text Maße variabel dimensions variable Courtesy the Artist 112 Entrance to an Abandoned Facility 2006 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 200 x 300 x 30 cm Alastair Cookson 110 Sochaux in Franche Compte 2006 wasserstrahlgeschnittenes und bemaltes Aluminium water-cut and painted aluminium 179 x 12 x 0,5 cm Courtesy Florence Bonnefous et Edouard Merino, Air de Paris, Paris Leisure Leisure there Will Be so much Leisure 2006 wasserstrahlgeschnittenes und bemaltes Aluminium water-cut and painted aluminium 179 x 7,5 x 0,5 cm Courtesy Florence Bonnefous et Edouard Merino, Air de Paris, Paris


Culture Is Important in a Free Society (An Exhibition of Things that Don’t Exist yet) 2006 20 Tintenstrahldrucke, je 84,1 x 59,4 cm 20 inkjet prints, each 84,1 x 59,4 cm Courtesy Corvi-Mora, London 106 Glanced in the Midst of a Legislated Break 2006 pulverbeschichtetes Aluminium powder-coated aluminium 40 Teile, je 200 x 15 x 3 cm 40 elements, each 200 x 15 x 3 cm Städtische Galerie im Lenbachhaus München, Dauerleihgabe Sammlung KiCo 110–111 Rotterdam 1928 2005 polierter, rostfreier Stahl polished stainless steel 8 x 126,4 cm Christian Wahl Oxford 1974 2005 polierter, rostfreier Stahl polished stainless steel 8 x 113,7 cm CBF Övningskörning (Driving Practice Parts 1–30) 2004 pulverbeschichtetes Aluminium powder-coated aluminium 30 Teile, je 30 x 240 cm 30 elements, each 30 x 240 cm Courtesy Casey Kaplan, New York 56 Volvo Kalmar 2004 pulverbeschichtetes Aluminium powder-coated aluminium 50 x 300 x 20 cm Courtesy Florence Bonnefous et Edouard Merino, Air de Paris, Paris 1983 2004 bemaltes und bedrucktes Aluminium painted and printed aluminium 100 x 100 x 100 cm Courtesy Florence Bonnefous et Edouard Merino, Air de Paris, Paris Compressed Reaction Screen 2004 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 213, 3 x 304, 8 x 30, 4 cm Courtesy Casey Kaplan, New York Domus Prints 2004 Iris Print 6 Drucke, je 59,4 x 42 6 prints, each 59,4 x 42 HMT, Berlin Corral 2003 pulverbeschichtetes Aluminium powder-coated aluminium 150 x 200 x 200 cm Courtesy Esther Schipper, Berlin Mononaturalism 2003 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm private collection, courtesy Galería Javier López, Madrid

251.

Werke in der Ausstellung/Works in the Exhibition

Multinaturalism 2003 pulverbeschichtetes Aluminium, Plexiglas powder-coated aluminium, Plexiglas 100 x 100 x 20 cm private collection, courtesy Galería Javier López, Madrid Plan 2 2002 Eiche, mindestens 6 Dosen Seven-Up oak, at least 6 cans of Seven-Up 5 x 200 x 200 cm Courtesy Esther Schipper, Berlin Flipped Reduction Screen 2001 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 100 x 100 x 20 cm Collection Jean-Michel Attal, Paris Alleviated Think Tank 2001 Aluminium, Plexiglas aluminium, Plexiglas 100 x 200 x 200 cm Sammlung Lafrenz, Hamburg Wittes Learning and Study 2001 pulverbeschichtetes und Laser geschnittenes Aluminium powder-coated and laser cut aluminium verschiedene Maße various Dimensions Courtesy Florence Bonnefous et Edouard Merino, Air de Paris, Paris Screened Reduction 2001 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 200 x 300 x 30 cm Städtische Galerie im Lenbachhaus München, Dauerleihgabe Sammlung KiCo Literally No Place Bar/Floor 2000 eloxiertes Aluminium, Eiche, 4 Gläser, Pepsi anodised aluminium, oak, 4 glasses, Pepsi 9 Teile, je 122 x 122 cm 9 elements, each 122 x 122 cm Installation variabel installation variable Courtesy Casey Kaplan, New York Lobby Signage 2000 pulverbeschichtetes Aluminium powder-coated aluminium verschiedene Maße various dimensions Privatsammlung, Köln David (Calender and Location Shoot) 1999 Farbfotografien colour photographs 12 Fotografien, 6 je 21 x 29 cm, 6 je 29,7 x 42 cm 12 photographs, 6 each 21 x 29 cm, 6 each 29,7 x 42 cm Städtische Galerie im Lenbachhaus München 142–143 David (Prototype Sound System) 1999 gebürstetes und geätztes Aluminium brushed and etched aluminium 40 x 40 x 200 cm private collection, London 70–71


Plan 1998 gehobelte Fichtenleisten, Coca-Cola verschüttet planed pine lengths, Coca-Cola spill 5 x 210 x 210cm Courtesy Esther Schipper, Berlin Inside now, We Walked into a Room with Coca-Cola Coloured Walls 1998 Farbe auf der Wand acrylic paint on the wall Maße variabel dimensions variable private collection 216–217 Twinned Renegotiation Platforms 1998 eloxiertes Aluminium, Fichtenholz, Plexiglas anodized aluminium, pine planking, Plexiglas 2 Teile, je 5 x 300 x 180 cm 2 elements, each 5 x 300 x 180 cm Moderna Museet, Stockholm Discussion Island Rest Rig 1997/2000 eloxiertes Aluminium, 15 Glühbirnen mit Fassungen, Verkabelung anodized aluminum,15 lightbulbs, sockets, wiring 5 x 120 x 240 cm Courtesy Esther Schipper, Berlin Discussion Island Reconciliation Plates 1997 Aluminiumplatten, Schrauben sheets of aluminium plates, screws 4 Teile, je 100 x 200 cm 4 elements, each 100 x 200 cm Courtesy Esther Schipper, Berlin Discussion Island Moderation Platform 1997 Aluminium, Plexiglas aluminium, Plexiglas 5 x 240 x 240 cm Städtische Galerie im Lenbachhaus München, Dauerleihgabe Sammlung KiCo 208 Discussion Island Dialogue Platform 1997 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 2 Teile, je 5 x 120 x 120 cm 2 elements, each 5 x 120 x 120 cm Esther Schipper 216 Discussion Island Reflection Zone 1997 1 Spiegel, 1 MDF-Platte, 6 Halogen-Strahler, 4 Stahlseile, Verkabelung 1 mirror, 1 sheet of MDF/plywood, 6 halogen downlighters, 4 steel cables, wiring and clamps Ø 102 cm Courtesy Esther Schipper, Berlin (The What if? Scenario) Second Stage Discussion Platform and Surface Designs 1996 eloxiertes Aluminium, Plexiglas anodised aluminium, Plexiglas 200 x 60 x 60 cm Privatsammlung, Köln 210 Ibuka! (Part 2) (Stuttgart) 1995 bemaltes Holz, Stoffbänder, Kopie von „Ibuka!“ painted wood, ribbons, copy of “Ibuka!” Maße variabel dimensions variable Fondazione Sandretto Re Rebaudengo, Turin 222

252.

Liam Gillick

McNamara 1994 Brionvega Algol TVC 11R, 35 mm-Film umkopiert, Tisch (optional), Kopien verschiedener Entwürfe zum Film „McNamara“ sowie zusätzlich die Kopie des Filmskripts für den Besitzer der Arbeit Brionvega Algol TVC 11R, 35 mm film transferred onto appropriate format, table (optional), copies of various drafts of the film “McNamara”, additional copy of film script written for owner of work Maße variabel dimensions variable Esther Schipper, Michael Trier 226 Pinboard Project (Grey) 1992 Gefärbte Jute (grau), Spanplatte, Ausdrucke dyed hessian (grey), chipboard, printed papers 100 x 100 x 4 cm Courtesy Esther Schipper, Berlin 204 Pinboard Project (Flight Blue) 1992 Spanplatte, Jute (von B. Brown Farbton ‘flight blue’), Holz, Schrauben, bedrucktes Ingres-Papier, verschiedene Drucksachen, Kopie des 220 Magazins chipboard, hessian (colour “flight blue” supplied by B. Brown), wood, screws, printed Ingres paper, various papers, including a copy of 220 Magazine 100 x 100 x 4 cm Courtesy Esther Schipper, Berlin Robert McNamara (Red, Yellow and Green Version) 1992 3 McNamara Manuskripte, je 30,7 x 22 x 1 cm, Holztisch 74 x 150 cm 3 McNamara manuscripts, each 30,7 x 22 x 1 cm, wooden table 74 x 150 cm Courtesy Florence Bonnefous et Edouard Merino, Air de Paris, Paris 204–205 Prototype Double Mounted Wall Rail 1988 Plastik, Stahl plastic, steel 6 x 60 x 6 cm Courtesy Casey Kaplan, New York 42–43


Fotonachweis Archive Liam Gillick, London/New York: 7, 29, 37 (l), 39, 46 (l), 47–50, 52 (l), 54, 57, 60, 61, 62, 66, 67, 69, 71 (r), 72 (r), 73, 74, 78–81, 86-89, 94 (r), 95, 100 (r), 102–105, 107, 109–112, 114, 115, 118, 119, 125, 127, 128–130, 134–139, 142, 143, 146 (l), 147 (r), 149 (l), 154, 155 (l), 156, 157, 158 (r), 159, 161 (l), 162, 167 (r), 169 (l), 170, 171, 172 (r), 173 (l), 210 (r), 211, 213 (r), 215 (r), 216 (l), 220 (l), 222, 223 (l), 224, 225 (r), 226 (r), 227 (r), 228 (r), 230 (l), 233, 234 (r) Courtesy Air de Paris, Paris: 46 (r), 90–93, 101 (r), 117, 124, 158 (l), 205 (l), 231, 234 (l) Courtesy Air de Paris, Paris and Javier Lopez, Madrid: 101 (l) Courtesy the Artist: 55, 56 (r), 59, 63, 64 (l), 70 (l), 85, 94 (l), 147 (l), 175, 204 (l), 210 (l), 212, 213 (l), 215 (l), 216 (r), 217 (l), 218 (r), 219 (l), 221, 226 (l), 232 (l) Courtesy the Artist and Corvi-Mora, London: 58 Courtesy the Artist and Casey Kaplan, New York: 77, 83 (r), 98, 99 (l), 144 (l), 229 (l), 237 Courtesy the Artist, Casey Kaplan, New York; and Milwaukee Art Museum, Wisconsin: 56 (l) Courtesy the Artist, Casey Kaplan, New York and with thanks to José Noé Suro, Guadalajara, Mexico: 120/121 Courtesy the Artist, Casey Kaplan, New York and Esther Schipper, Berlin: 30–33 Courtesy Arts Council Collection, London: 219 (r) Courtesy British Council Collection and Corvi-Mora, London: 106 Courtesy BSI: Swiss Architectural Award: 148 (r) Courtesy City of Anyang, Korea: 191 Courtesy Collection British Land, London: 179 (l) Courtesy Corvi-Mora, London: 34, 35, 113, 214 (r), 225 (l), 230 (r), 235 Courtesy Cumulus Studios, New York: 146 (r) Courtesy Frieze Projects, London: 179 (r) Courtesy Hirshhorn Museum, Washington DC: 44 (l) Courtesy Casey Kaplan, New York: 52 (r), 65, 82, 97, 99 (r), 123, 144 (r), 145, 140, 151, 160, 163–167 (l), 168 (r), 173 (r), 181 (r), 183–185, 192 (l), 223 (r) Courtesy Casey Kaplan, New York/with thanks to José Noé Suro, Guadalajara, Mexico: 122 Courtesy Casey Kaplan, New York/photo credit: Adam Reich: Cover, 42 (r), 43, 44 (r), 45 Courtesy Casey Kaplan, New York/photo credit: Cary Whittier: 168 (l) Courtesy Casey Kaplan, New York and the Museum of Modern Art, New York: 83 (l) Courtesy Casey Kaplan, New York and Guggenheim Museum, New York/photo credit: David Heald/The Solomon R. Guggenheim Foundation, New York: 198 Courtesy Casey Kaplan, New York and Diego Valenzuela, Mexico: 194–197 Courtesy Casey Kaplan, New York and Westbank and Peterson Investment Group for the City of Vancouver Public Art Program: 201 Courtesy Javier Lopez, Madrid: 169 (r) Courtesy Kerlin Gallery, Dublin: 227 (l) Courtesy MAK Museum für Angewandte Kunst, Wien: 152/153 Courtesy MAK Museum für Angewandte Kunst, Wien and Meyer Kainer, Wien: 36, 37 (r) Courtesy Galerie Meyer Kainer, Wien: 74 (l), 75 Courtesy MM Agence, Paris: 100 (l) Courtesy collection du Musée national d’art et de culture Georges Pompidou, Paris: 232 (r) Courtesy Almine Rech Gallery, Brussels: 62, 155 (r), 193 (l) Courtesy Adam Reich: 41, 42 (l), 44 (r) Courtesy Rubell Family Collection, Miami: 220 (r) Courtesy Edition Schellmann, München: 148 (l) Courtesy Esther Schipper, Berlin: 53, 64 (r), 70 (r), 71 (l), 72 (l), 161 (r), 172 (l), 204 (r), 206 (l), 214 (l), 228 (l) Courtesy Esther Schipper, Berlin and Eva Presenhuber, Zürich: 132/133 Courtesy Rüdiger Schöttle, München: 229 (r) Courtesy Collection Tate, London: 209 (r) Courtesy Thames and Hudson, London: 203 Courtesy Transport for London, London Underground: 141, 149 (r) All works courtesy: Corvi-Mora, Galerie Meyer Kainer, Galerie Esther Schipper, Casey Kaplan, Kerlin Gallery, Maureen Paley, Eva Presenhuber, Micheline Szwajcer

Thank You: Lisa Applebaum & George Haddad, Richard Armstrong, Debbie August, Laurence Belfer, Julie Bernstein, Charles Betlach, Iwona Blaswick, Davide and Sandra Blei, Florence Bonnefous, Marcel Brient, Ellen Bruss and Mark Falcone, George Bucciero, Luca Cerizza, Clo and Charles Cohen, Tommaso Corvi-Mora, Michael Craig-Martin, Maria and Alberto de la Cruz, Rosa and Carlos De La Cruz, Richard Edwards, Anne Ellegood, Barbara Fosco, Susanne Gaensheimer, Mark Giambrone, Al Gillio and Paul Bernstein, Zoe Gray, Giulio Gropello, Louis Grouchos, Madeleine Grynsztejn, Sandra and Jack Guthman, Sandy Heller, Adrian & Elliot Horwitch, Stefan Kalmár, Casey Kaplan, Scott and Wendy Kleinman, Stephen King, Jose Kuri, Rosina and Bert Lies, Maria Lind, Gareth Long, Glenn D. Lowry, Barbara-Brigitte Mak, Paul Marks, Richard Massey, Dominic Molon, Sarah Morris, William Palmer, Philippe Parreno, Lucilo Pena & Lee Cobb, John Phelan, Eva Presenhuber, Loring Randolph, Bob Rennie, Michael Ringier, Judith Ripka & Ronald Berk, Conor Roche, Alison and Neil Rubler, Beatrix Ruf, Michael Sacks, Nicolaus Schafhausen, Danner and Arno Schefler, Esther Schipper, Debra and Dennis Scholl, Carol Schuster, Marilyn Simons, Nancy Spector, Monika Szewczyk, David Teiger, Ann Temkin, Anton Vidokle, Lawrence Weiner, Jack Wendler, Renate Wiehager, Christen and Derek Wilson, Bob Wislow


Diese Publikation erscheint anlässlich der Ausstellung LIAM GILLICK Ein langer Spaziergang... Zwei kurze Stege...* 1. April bis 8. August 2010 in der Kunst- und Ausstellungshalle der Bundesrepublik Deutschland, Bonn *One long walk... Two short piers...

Kunst- und Ausstellungshalle der Bundesrepublik Deutschland Robert Fleck Intendant Bernhard Spies Kaufmännischer Geschäftsführer Rainald Schumacher Kurator Susanne Kleine Ausstellungsleitung

Katalog Die Kunst- und Ausstellungshalle der Bundesrepublik Deutschland, Bonn, wird gefördert vom Beauftragten der Bundesregierung für Kultur und Medien

Herausgeber: Kunst- und Ausstellungshalle der Bundesrepublik Deutschland GmbH, Bonn Übersetzungen aus dem Englischen: Anne Pitz Übersetzungen aus dem Französischen: Karin Ayche Übersetzungen ins Englisch: Tim Connell Werkfotografie: Jean Brasille, Louis Brem, Jorg + Philipp v. Bruchhausen, Koen de Waal, F. Delpech, Michael DiVito, Marc Domage, Carsten Eisfeld, di Gorni, Angelika Hausenblas, Marcus Leith, Gunter Lepkowski, Philippe Magnon, Werner Maschmann, Franco Mattei, Paul Mittleman, Denis Mortell, David Pestorius, Natasa Radovic, John Riddy, Franz Schachinger, Katrin Schilling, Heinz Unger, Perry van Duijnhoven, Peter White, Cary Whittier, Eileen Page Wilson Gesamtherstellung: Kunst- und Ausstellungshalle der Bundesrepublik Deutschland GmbH, Bonn, und Snoeck Verlagsgesellschaft mbH, Köln www.bundeskunsthalle.de

© 2010 Kunst- und Ausstellungshalle der Bundesrepublik Deutschland GmbH, Bonn, Autoren, Fotografen und Snoeck Verlagsgesellschaft mbH, Köln

Snoeck Verlagsgesellschaft mbH, Köln Werderstraße 25 50672 Köln www.snoeck.de ISBN 978-3-940953-40-7 Printed in the EU


6.

VORWORT Robert Fleck

7.

FORWARD Robert Fleck

8.

UND WOZU SOLL EIN TITEL GUT SEIN? DIE DISKURSIVE TOPOLOGIE LIAM GILLICKS Nicolas Bourriaud

14.

AND WHY WOULD THERE BE A TITLE? LIAM GILLlCK'S DISCURSIVE TOPOLOGY Nicolas Bourriaud

20.

LIAM GILLICKS VERLOCKUNG ODER „WARUM SAGST DU MIR, DU FÄHRST NACH KRAKAU, DAMIT ICH GLAUBE, DU FÄHRST NACH LWOW, WENN DU WIRKLICH NACH KRAKAU FÄHRST?“ Isabelle Moffat

24.

LIAM GILLlCK'S LURE, OR “WHY DO YOU TELL ME YOU ARE GOING TO CRACOW SO I'LL BELIEVE YOU ARE GOING TO LVOV, WHEN YOU ARE REALLY GOING TO CRACOW?” Isabelle Moffat

204.

LIAM GILLICK WORKS GERMAN PAVILION A VOLVO BAR A HOUSE IN THE COUNTRY THE STATE ITESELF BECOMES A SUPER WHATNOT FACTORIES IN THE SNOW DISCURSIVE STRUCTURES PARALLEL FICTIONS CONSTRUCCIÓN DE UNO THE WOOD WAY LITERALLY NO PLACE ARCHIVES AND EPISODES CONSTRUCCIÓN DE UNO ASSUMED PERSONAS THE STATE ITSELF BECOMES A SUPER COMMUNE CONSTRUCCIÓN DE UNO THEANYSPACEWHATEVER GODARD AND GORIN THREE PERSPECTIVES AND A SHORT SCENARIO SPECIFIC LOCATIONS PROJECTIONS AND REVISIONS SOCIAL SRTUCTURES WORK FROM THE 80S AND 90S

238.

BIOGRAPHIE/BIOGRAPHY

250.

WERKE IN DER AUSSTELLUNG WORKS IN THE EXHIBITION

30. 34. 36. 40. 46. 52. 70. 74. 78. 82. 86. 98. 106. 110. 118. 120. 124. 128. 142. 154. 176.


Turn static files into dynamic content formats.

Create a flipbook
Liam Gillick, One long walk… Two short piers… by Kerlin Gallery - Issuu