Skip to main content

The Record Newspaper 28 May 1970

Page 1

A 4:1ARuE.L..ilrop.

IA ArCULATION.

No. 3457.

PERTH, THURSDAY, MAY 28, 1970.

NEW ABORTION SCANDAL SHOCKS BRITAIN

Price 8c.

(Registered at the GPO., Perth, for transmission by post as a Newspaper.)

The Willing Helpers

"The general principle of experiments on humans is contained in an international code of medical ethics called the Declaration of Geneva, a modern form of the HipLONDON: Britain has been shocked by reports that live pocratic Oath which says: 'I will maintain the aborted babies have been and are possibly still being sold utmost respect for huexperiments. f or medical man life from the time St. John Stevas is now oi conception.'" This was revealed by to Anglican Bishop John calling Tiarks, of Chelmsford. on the departStevas, From medical comJohn St. orman N The worker's letter ment to revoke the lic- ments published, howCatholic Member of Parliament and leading cam- claimed it was the in- ence of the clinic con- ever, the ethical probpaigner agairst legalised tention of a Mr. X., a cerned and is urging the lem is complicated. Some consultant clinical phys- General Medical Council surgical experts see abortion. He told the press he iologist, to undertake a to investigate the con- nothing wrong in using tissue taken from a fetus had informed Richard new field of research of sultant mentioned. "The thought of what after an abortion for Crossman, Minister of fetuses. research. It Social Services, that the It added: "He will ob- has been going on mak- medical f acts had been verified tain these from a source es me feel physically seems to depend largely on whether a fetus, and that all private abor- in the East End of Lon- sick," he said. which is not legally alive tion clinics had been or- don and plans to keep BMA COMMENTS in Britain until the 28th dered to stop immediate- these in a state of susThe British Medical week, is regarded as a ly any such practice. pended animation on A team of health de-- heart-lung machines un- Association, while refus- viable living organism by investigators til they reach term — ing to comment on the the doctors concerned. partment have started an unpre- 40 weeks' gestation — alleged practice until a Trading in such fetuses cedented drive to insure and then, to use his own full report has been is- in the way disclosed is generally deplored. the practice is stopped, words, 'slaughter them.' sued, said: and, with the co-opera"This research on hution of the police and man embryology is beother authorities, is coning conducted for the tinuing inquiries in Lonheart tissue. The physidon and some large proologist's intention is to vincial cities. do a vein-artery shunt Pope Paul VI has as- cans and Catholics, inAn abortion clinic in and to link the fetus up serted that the much dis- cluding Anglican Archthe London East End with the circulation of a puted canonisation of bishop Michael Ramsey, and a London hospital dog for purposes of im- the 40 English and Welsh of Canterbury, who fearconsultant have been in- munology." martyrs will have a fav- ed the canonisation This scene repeats itself year in and year out, in almost any fun fair or fete volved, according to reStevas said ourable effect on ecu- would stir up ill feeling held by charity organisations. Our hats go off to people like "Mum" here, who John St. ports. which would retard ecu- give up so much of their precious time to help the organisers. he had contacted Cross- menism. These women St. John Stevas de- man who, in an urgent Speaking at a consis- menism. c ome from the various clubs — Catholic Women's League, Majellans, Legion of clared that this was 'the reply, informed him that tory of the College of At a news conference Mary and the like. Without their help, the organisers would find it hard going. most horrible practice one abortion clinic in Cardinals, which approv- before the Pope's speech that has ever taken London had, in fact, ed the canonisation, the the Postulator General then broke into a slow place in Britain." He de- been selling live fetuses Pope said that "we in For the Prospective handclap to show their manded a full public in- to the consultant refer- no way intend to re- S aint s' Canonisation disapproval of the demquiry, and is seeking a red to and that he had awaken these sufferings" Cause, Father Paul Mol- onstrators. statement on the mat "succeeded in putting a of the "period of uneasi- Mari, S.J., and Father ter from Prime Minister stop to it." William Purdy, a memness." Eventually all the demHarold Wilson. On the contrary, the ber of the Vatican Sec- onstrators — none of meetlengthy a After canonisation would of- retariat for Promoting them Church of Scotland WORKER TOLD MP ing, Crossman's depart- fer an excellent oppor Christian Unity, said in members — left the hall. He learned about the ment issued a statement tunity to "humbly recog- a joint statement that practice from a worker saying it was instructing nise the very errors and the fears expressed by that Speaking later In the medical field who all nursing homes licens- to lament them." Archbishop Ramsey was day, the Rt. Rev'd Dr. had also written about ed to perform abortions, He was apparently re- not the feeling of the John T. Carson, moderaIt to Cardinal John Hee- to stop any such prac- plying to the fears ex- majority of Anglicans tor of the Presbyterian nan, of Westminster, and tice. pressed by some Angli- and Catholics. Church of Ireland, said the troubles in Northern Ireland are no comic opera such as they had just seen.

"CANONISATION SHOULD HAVE FAVOURABLE EFFECT" Pope

EXTREMISTS INTERRUPT CHURCH OF SCOTLAND ASSEMBLY

"We are in a situ Ation EDINBURGH, Scotland: in a gallery holding similar to Nigeria and diFor the second year in signs that read: "No Biafra," he said. Protestant Popery." succession, When stewards asked extremists have broken Dr. Carson said the up the general assembly them to leave, shouts work of Catholics and Presbyterian floated from other gal- Presbyterians helping of the Church of Scotland, this leries. each other and trying to The scene was similar take the heat out of the time over a courtesy visit paid by leaders of to last year's events situation, lying down as John Donovan Greek Orthodox when protestors shout- missiles flew over their the ed "No Popery" slogans heads or keeping crowds Church. The Rev'd Jack Glass during the visit to the apart, did not attract of a "splinter" Protest- assembly by an official headlines. Nor did the ant Church in Glasgow— Catholic observer, Fath e xchange of clothes and the Sion Church of Sov- er John Dalrymple (sern. bread between Protestprofessor and ant and Roman Catholic ereign Grace — and 20 inary members of the 20th Christian unity expert). rest centres, he added. As the sign-carrying Century Reform Movemoved ment, were ejected after demonstrators noisy scenes at the as- out, one of them showsembly's opening session ered pamphlets on the ministers and church here. " Cars have been my life for a long time. They interrupted the officials below. My 17 years experience in all phases of the Before he left, Rev'd meeting for over a quarm otor business means I can give you the right Glass flung to the floor ter of an hour. sort of advice about buying a good quality The assembly — the of the hall a petition to O BER AMMERGAU, used car at the price you want to pay. annual conference of the the moderator that he Germany. Despite — been allowed to had not P hone me on 61 6736, or call and see me Church of Scotland, and charges that it is antideliver. Personally." one of the main civic PasThe petition said that Semitic, the famed events of the Scottish sion Play here will be was a "Greek Pope" the year — broke into an upa performed before full of roar when the modera- representative houses throughout the practiced that church tor. the Rt. Rev'd Hugh summer, and a supplecelebrated the idolatry, 0. Douglas, welcomed a season in 1971 mentary and propagated a visiting delegation from Mass is being considered. of Mariology. doctrine Orthodox Greek the USED CAR When the moderator Over a half million perChurch. which included SPECIALISTS Patriarch Nicholas VI, began welcome sons will see the play this his 495 Albany Highway, Victoria Park Tel: 61 6736 of Alexandria and Africa. again, further disturb- year, and over a million Eight men and wom- ances broke out. Church r equests for tickets had John Donovan Peter Atkinson Scotland members to be turned down. en were seen standing of

'Cats arenot Justmybusiness theyaremylife'

Deinovan motors

Play Financial Success

There's 100million more where this dollar is I sted

We've been looking after other people's money for a long time now, more than 107 years, and we must do it very well —that's why our assets now stand at over $100 million. If you want a safe, profitable return on your investment go to P.B.S. that's where thousands have saved S100 million!

NEW RATE

NO FIXED TERM

Interest is calculated on daily balance Paid or compounded April and October.

half

yearly

in

Perth Building Society ESTABLISHED IN 1162 HEAD OFFICE 25 BARRACK STREET PERTH 6000 TELEPHONE 232305

if here thousands hare stared SIDO


Page Two

THE

EDITORIAL

THE RECORD 450 HAY STREET, PERTH.

DEATH OF PROMINENT PERTH CITIZEN The death of Mr. Tom Ahern, Knight of Saint Sylvester and outstanding Perth businessman, marked the passing of one who was revered for generosity and respected for his business acumen. Mr. Ahern came to Australia at the turn of the century with a determination to succeed and a great spirit of faith in the future. These two virtues were to characterise all his efforts, both at spiritual and materials levels throughout his busy, dedicated life in this State. Pope Pius XI acknowledged his enormous generosity and concern for the advancement of the Church's work in its manifold undertakings in W.A. when he dubbed him a Knight of Saint Sylvester in 1927. For the following 40 years, he was a prominent figure at all Church and civic functions. Indeed the Church in Western Australia owes much to Mr. Ahern. His advice was respected by three archbishops, and was eagerly sought by many religious superiors about to embark on projects of development and extension. His generosity, too, helped many in need and was not in any way restricted to creed or colour. His strong character and deep moral rectitude were the products of a faith which meant much to him and which did much to mark him as a committed Christian. The commercial world, too, hails him as one of the great commercial pioneers of the State. He was a valued and respected member of the Perth Chamber of Commerce, who rose from humble beginnings to a position of great prominence in the business world. His interests were many and varied, and all avenues of commercial life in the city benefited by his wisdom and genius. The State is all the poorer by his death. His name will be long remembered by all who had the happiness of meeting him and his generosity is appreciated by all who experienced it.

APARTHEID IN SPORT The decision of the British Cricket Council to call off the South African tour of Britain this summer will find ready response and sympathy in the hearts of true sportsmen. For years we have heard sport heralded as a unifying force in the world. We have heard its many good attributes applauded and, in some more irresponsible places, it was even hinted that it might replace religion as a bond of Unity and a force for good. A sad blow has been dealt to this myth. Today sport is another means of indicating national superiority and enhancing international prestige. Divorcing sport from its true concept of providing challenge, personal development, recreation, dedication and valour, and replacing it by considering it an instrument of political pressure has not done any good for man, but would seem to be but another vehicle for expressing his antagonism and aggressiveness, which mock the very name of sport. With South Africa, sport is inseparable from political aspirations and perpetuates racialist policies. The Council decision has been effective even there by its own prominent sportsmen advocating non-racism in sport. The political overtones of the decision, and the pressure exerted by the Home Secretary, make the cancellation of the tour more susThe Council pect and less spontaneous. procrastinated and felt that the glory of cricket would be enhanced by permitting the tour to proceed. It is difficult to see how this could have happened with the situation developing as it was in Britain. If the Home Secretary's intervention was motivated by the Government's desire to keep order and, at the same time, to repudiate South Africa's desire to bolster racial policies, then again all sportsmen will congratulate them. The decision was thus not a victory for lawlessness or a reward for violence. The same decision will have to be faced by Australia sooner or later. It will have to make a deliberate choice between standing with or against South Africa on the single race issue. Our bet is that it will procrastinate and seek to turn the blind eye to its white" policy, thus further destroyown ing its bona fides abroad on racial matters.

RECORD

Thursday, May 28, 1970

PROBATE AND OFFICIAL DEATH TAXES ENGAGEMENTS

Letters to the Editor:

Catholic families who would like to play a part by helping with accommodation for the threeweek period that the force will be in the West. It is a gross injustice There is still a big need that a family man after May I t is being argued that, because law is difficult for contributions of food having paid taxes all his 31. 2.0 p.m. Address Parents and Friends Anto enforce against abortion, it is therefore right transport and accommo- working life, and saving dation. some assets for his nual General Meeting, that abortion should be legalised. PenteAt this time of widow and children, to South Perth CommunBut, how idiotic and we get reliable informa- cost perhaps we can be know that, on his death, ity Centre. the tion through our Catho- moved by the Holy Spirit the Government steps in would fallacious to make some contribu- and descends immediatesound should lic weekly paper. thesis tion to assist them in ly upon all his assets, of JUNE someone contend that, Without doubt, William their fight to fulfill the whatever nature, for the 3 7.30 p.m. Confirmabecause armed robberies tion Claremont. are already rather preva- Huxley (The Record May Beautitudes enumerated purpose of levying prolent throughout Austra- 14) must have his head above by Tunku Abdul bate duty and death duty on all he owns, including 10 7.30 p.m. Confirmalia, they should there- in the sand or be living Rahman. The first performance the house and its contion Carilla. fore be legalised on the in a dream world. Keep grounds that the law so up the good work Editor. of the play will be at His tents, personal belongTheatre on ings, car, investments, 11 Attend Premier of Majesty's Gilbert Page, far has not been able to the Revue, "Anything Bunbury. June 11, 1970, at 8 p.m. loans, gifts made within cope adequately with to Declare" at His Enquiries for concession three years of his death, them. Yet this is exactly bookings should be made and money in hand. Majesty's Theatre. what the pro-abortionists to Mrs. P. Coote, phone Mr. Negus, of 91 Granare contending in prin21-6676. tham street, ciple. Floreat 17 9.30 a.m. Meeting of Enquiries re accommo- Park, who is singlehanthe Priests' Council. After all, the legalisadation phone 6-2997. dedly—and chiefly at his 7.30 p.m. Confirmation of carefully preparown expense—endeavourTed and Joan Archer, ed and skilled robberies, tion, Cottesloe. East Victoria Park. ing to arouse an apathetSometimes I worry stupid and absurd as it ic public to realise the 21 3.0 p.m. may appear, would not very much lest the Holy Confirmation situation, deserves all the be so objectionable as Rosary should be disat the Cathedral. support and assistance the legalisation of abor- regarded and become a than can be given him tion, because the taking has been devotion among by the people of Austra- 24 7.30 p.m. Confirmaof money from another you. That would be a lia signing a statement of tion at North Beach. tragedy. person, be it ever so spiritual protest. Action, not just wrong, would not be so place the rosary next to Congratulations on wishes, is needed. 28 5.30 p.m. Confirmaunjust and iniquitous as the Mass as a most im"J.B.C." the taking of life from portant factor in our your coverage of the tion at Doubleview. lives. If you learn to re- Abortion Debate, and for another person. the sustained and continIn any sane society, cite the decades with uous exposition and love, fervour and attensurely life has more value paper your leadership tion you will be kept Corpus Christi May 31. than money. close to God and His has given prior to the To those who argue Mother. The rosary will rejection in State Par- 1st Reading: Deuteronomy 8. v. 2-3; 14b-16a. Moses spoke thus to the people. . . that a human person does comfort you even in your liament of the Abortion Theme: You forget the one whom fed you knd not exist in early preg- deepest trouble and pain. Bill. cared for you . . . nancy, the vital fact re- This was proved to me I picked up a copy of mains that they cannot early this very morning The Record at Easter 2nd Reading: 1. Corinthians; 10. 16-17; Brethren the prove their case. chalice we bless. . . on whichI write. A friend from a newsagent's disIf we were out hunting.; whom I can vouch for as play counter. I am not a Theme: One food, one drink for all. and we saw the dim out- being loved by the Lord, Catholic. I found it so 3rd Reading: John 6, 51-58. At that time Jesus line of a distant form and was alone in her home interesting solid and balsaid . . . we were not sure whether when the phone rang. anced in its presentation Theme: My flesh is food indeed. it was a kangaroo or a The voice of a stranger, that I decided to buy man, what should we do? even so a sympathetic The Record weekly. Since 1 Do not such circumstan- voice, told her that her then I have found that ces demand that we give son had been killed in it improved with each the benefit of the doubt? London. He was a young issue. It is not the usual type of Catholic paper, The damnable loss of married man working in but I like it. that great city. He was life through the loosening I am opposed to abor011oiern armacy of the abortion laws is driving a client to the tion and I would appreair-port. All of a sudden reaching far greater proSole Fremantle Agents for INNOXA COSMETICS ciate your allowing me portions than figures for a massive truck skidded. to bring two items to the Cnr. Atwell Arcade & Cantonment St., Phone 5 2786 ran across one of the the Vietnam war. 4.4•004,000,11,04,014,~04 ,41.0 marked-out lanes, crash- notice of your readers. In England alone, dur- ed On a visit to Japan reinto the car driven ing the period 1968-9, by the young man, whom cently, Dr. Barnard said, I NSIST ON some 20,000 abortions I knew and taught as a when asked if he favourwere on unmarried moth- child. He was killed out- ed abortion: "On the one ers. In South Australia, right whilst his compan- hand we allow abortion the new abortion laws ion was seriously in- almost at will. Then, on are producing ugly jured. Twelve thousand the other hand we want "Fit for a King" figures which are indica- miles It away, his broken- to end executions. tive that naturally they not does make sense". hearted mother located LADIES! are on a disastrous down- her husband; on his Dr. Barnard favours abortion hill grade. in certain circumBuy the Best Fresh Meat from OUR arrival home, the two Australia is spending knelt and recited the holy stances as when the life Butchers Shops of mother the is threatmillions in an attempt to rosary. Never more Special Quotations to Schools and Institutions cope with our need for would they see their ened. He says that the only migrants. Why not spend boy: but strength and Locations: more in making better grace flowed to them as way to solve the populaTYLER'S SUPERMARKET provision and greater with Mary. they watched tion problem is by edu911 Beaufort Street, Inglewood. Phone 71-6090 cation through family social welfare for the un- a torn and broken figure B. & P. BUTCHERS married mothers? stagger along the Via planning clinics. Cnr. Orrong Rd., and Oats St., Carlisle A Japanese professor The new abortion laws Dolorosa. Cling to the THE CHEAPER FOOD MART are a return to barbarism rosary, as they did, and of medice. Dr. Watanabe. 2nr. Chapman Rd., & Pitt St., Bentley. Phone 65-1639 and nothing but national you'll meet life's sorrows of Tokyo Medical School decline can be expected with faith and courage. says that Japan is graduonce war is "legally" de- I ask you to pray for ally becoming a nation of clared on the innocent those parents, and for a old people. There were and utterly defenceless young wife who must 700,000 abortions taking learn the agonising pain place annually in Japan. unborn child. Today Japan has one of of loneliness. The situation has bethe lowest birth rates in come grave, so above —sister Margaret Mary the world, and death ( Catholic Weekly) party politics and, above rates have been cut by all, we need statesmen half. and not a team of gutless Across America the politicians. idea of 'Materfamilias' Andrew Tobin. has become the key issue in the continuing battle Bathurst, N.S.W. over abortion laws. Specifically, this is, the asserThis is to draw at tention that every woman tion to readers of "The has a 'right' to an aborRecord" of the coming to tion. The 20th century Australia of the Moral condemns ancient Rome Re Armament force of for the law of 'paterfamYour correspondent 100 people from 21 ilias' by which the Mr. James (The Record, state nations with the Musical granted the father the May 211, deserves praise Review of "Anything To power of life for his defence of the and Declare", death inclusion of a finance over its offThey will come direct spring. Today it wants to page in our Catholic Malaya paper. I think it is the from where transfc,r this to the Forthcuming Retreats at Our Lady of most realistic touch we Tunku Abdul Rahman mother. How stupid it have seen in The Record had agreed to be the all is! the Rosary Retreat House Patron of the Committee for some time. Kemieth Mustzell, of Hosts. He says that Shenton Park. We work and pray as he has June 3-4: St. Brigid's, Lesmurdie known for a long Catholics. We pay our while of the June 6-7: Legion of Mary. taxes and help our being done ingreat work the World Church in all the ways by this June 10-11: St. Mary's, Leederville. force and that we can. We also fight to they bring June 14: Maddington and Lynwood Parishes. "unity" where I was impressed with educate our children as there is division, free- the article "What is June 23-21: Gosnells and Shenton Park Parishes. Catholics. Why shouldn't dom where there is fear, Courtesy?" I think this we make some money to trust 28: Maida Vale and Bassendean Parishes. June where there is an- is a good answer. do all this and do it well tagonism and healing I t is much less than just the same as others. where SOME INDIVIDUAL BOOKINGS ARE AVA;LABLE. there is hatred". courage of hearts or holiThis is part of life. Why Phone Sister in Charge — 6 3459. The cast of the play shouldn't The Record adness, yet it seems to me vise competently, as it is perform entirely without that the Grace of God if-, The Retreat House is also available for Seminars, doing, on matters touch- pay and depend wholly in Courtesy. Schoolgirls' Retreats, Youth Groups, Days of on the Host Nation for ing* tie Stock Exchange. Jane O'Dwyer. Recollection, Ecumenical Groups, Study Groups, etc. We bet moderately on support and sustenance. 40 Maryville. Inquiries welcome hor s and why should My wire and I feel that Grand Promenade. we not do the same when there are many good Dianella. ---.01111111P111111/111111111•1111111iPml"..%,,M11111111i

WE NEED GUTSY STATESMEN NOT GUTLESS POLITICIANS

SPIRITUAL TRAGEDY

HAILS THE RECORD

1

MASS GUIDE

Chemist Mans POLLICKS SMALLGOODS

TO BE COMMENDED

ARE YOU INTERESTED!

IMPRESSED


Thursday, May 28, 1970

THE

Page Three

RECORD

..11=••101•11.eaf

Catholic Bishops Meet With Rhodesian Prime Minister

FIVE NAVY CHAPLAINS VISIT SYDNEY

SALISBURY, Rhodesia Two Catholic bishops and Prime Minister Ian Smith of Rhodesia met here for talks on Land Tenure Act, which has threatened a serious confrontation between the government and the Christian Churches of the country. The prelates, who ures of the Smith regime churches and Christian ernment over the land met with the premier, as oppressive and an ero- institutions, threatened act. the traditional rights of Were Bishop Donal R. sion of human rights. It said that "the new interracial worship and The statement said the of Carm, 0. amont, L republic and Land Ten- religious work. Smith regime was "adUmtali, president of ure Act are the cornerThe statement called ding to the existing tent he Rhodesian Bishops' stone of what has beon all 239 member chur- sion" in Southern Africa Bishop and onference, C an apartheid state." ches of the WCC to sup- and forcing black AfricA lois Haene, S.M.B., of come It said the required re- port the stand taken by ans to "resort to extreme Gwelo.

gistration of private or- church leaders in Rhod- means to assert their No details of the talks ganisations, including esia in defying the gov- human dignity. minprime between the ister and the bishops were made public, but Bishop Lamont describThere were five Cath- ‘4,11,1•04141,1•0011,140.41,0,0SP4,11,"•••••••••######Mill,,,,,~411,4.4,04.011,4•41.4•41 ed the conversations as olic Chaplains from the "very cordial" and said British, Dutch, Portuto agreed that Smith guese, Argentinian and meet representatives of Chilian Navies among all the Churches on the —SOLE AGENTS— the 20 Naval vessels issue. Act Tenure Land which visited Sydney for R. CONNABEER & COMPANY 1 The Catholic bishops the Captain Cook anniwith odds at been ave GLASGOW, Scotland—An ecumenical backlash, in which Christians shy 165 HAY STREET, SUBIACO. PHONE 81-1410 i h versary celebrations rethe Smith regime since away from making further moves towards religious unity, has appeared in cently. . "....0.44.44.#•."...~4.4,pdvm#4,... the adoption of the new During their stay, they republic's white-suprem- this country. were entertained to acy constitution in 1969. angry lunch an infrequently acknowwas the centre of at St. Mary's Cathbe So says a report to led Bishop Lamont submitted this month to ledged aspect of the ecu- scenes when Protestant edral by Cardinal Gilroy the Rhodesian churches' Above (from left) the annual meeting of menical movement, is extremists — not memthe land act, on attack Presbyterian Church, seen as slowly providing bers of the Presbyterian Father Juan Williams of Now have Tickets selling in the which divides the coun- the a source of renewed vis- Church—interrupted the the Chilian schooner try geographically into the country's largest repopular ZODIAC $50,000 First ion and emphasis. official welcome to him. ESMERELDA, Father separate white and black ligious body. Delmar The comments by de the Barrieros of fear people now I t says This year's report pays Prize Lottery (Tickets $3 each, areas. The Catholic bishops that, in making what are Scottish Churches Coun- Father Dalrymple a warm the Portuguese frigate COMMANDANTE cil form part of an over- tribute. ( Full book, $150). JOAO and other Christian lead- called ecumenical apBELLO, Father Antonio might all report from the Presthey ers have threatened to proaches, I t says: "In keeping Prompt return all Moil Orders. byterian Sancez of the ArgentinInter-Church defy the legislation and shatter the rather prewith this new spirit of ian barquentine LIBERRelations Committee. that so quo status carious their institutions. lose This Lottery has 50,000 Tickets c Meanwhile, the General understanding and bro- TAD, Father Ron Brown They claim that the land often can exist between therliness between the only. of the British frigate Assembly of the Presbyact makes it impossible local congregations of Churches, the committee H.M.S. terian Church of ScotBLAKE, His EmI t will be a quick seller. for the churches to func- different denominations." hopes that the General tion because of restric- It is said to be unfor- land may decide to in- Assembly will decide to inence, Monsignor Granttions hampering multi- tunate that local councils vite an official Catholic invite the Roman Cath- ly Lake, 0.B.E., Senior Chaplain of the Royal observer in future years, racial work. of churches are usually without olic Church in Scotland Australian Navy, Father the Assembly The church-state con- unwilling to discuss the having to take an annual to send a visitor in fut- John Bots of the Dutch LOW COST HOME OWNERSHIP flict was aggravated by subjects that kept the vote on the issue. ure years, as in the case Frigate VAN GALEN. Keep your housing ccsts down by securing a reasonably priced building si te. the inclusion in the con- churches apart: instead of other Churches in and Father James Sayers The Inter-Church Restitution of the Land they tend to opt for such lations Committee report Scotland, without the of H.M.A.S. SYDNEY. We offer high lots with levet)/ views at Tenure Act, which be- activities as Christian Aid recalls the first visit of necessity of a special The Dutch ship VAN SPRINGVALE ESTATE — HAMMERSLEY came effective on March "which, while of tremen- a Catholic priest—Father r esolution." GALEN together with a 'ily serviced with deep sewer, water, bitumen roads etc. dous value, can prevent John Dalrymple—to the 1. Ecumenical experts see sister, the VAN SPEIJK for &6000. Four years terms with reducible interest at 7%. `-tociern Homes adjacent. Handy to Beach. IN GENEVA, the World a grappling with the real Assembly last year. this suggestion as a mar- are in port at Fremantle This is tl-e nearest private subdivision to Perth in Council of Churches issues that divide." Father Dalrymple, a ked step forward, and de- this week. Hamersley area. issued a statement conBut the new empasis seminary professor and signed to take the "heat" We also build two or three bedroom Homes in this Suburb demning the racial meas- on mission and renewal, Christian unity specialist, out of this issue. ',-cm $15000 (including land) on low Deposits a -ri

Ecumenical Backlash Reported By Scot Protesants

Dr. Adderley Optimistic Prospects For Reunion New Missions With Orthodox Armenians Director The spiritual leader of some four million

BUNBURY: Fr. Thomas Orthodox Armenians, throughout the world, Vasken I, has been Pope Paul's guest at the O'Neill will retire as MisDirector of the BunVatican and said his four-clay visit turned "a sion bury diocese. new page in the history of the Armenian Church."

1

Renmano Altar Wine DOOGUE'S

payments.

Call or send for Brochure to Sole Agents.

DUDLEY and DWYER LTD. R.E.I.W.A. HOME

BUILDING SOCIETY BUILDING 66 ST. GEORGE'S TERRACE PERTH.

His place will be taken Pope Paul, in turn, Michelangelo's fresco of by Dr. B. Adderley, who • ' threw an optimistic light the Last Judgment. has left London and is on prospects for reunion It was there that Pope expected to return to Armenian Paul spoke of theological Bunbury in early July. the with 41116"" Church headed by his differences between their Fr. O'Neill has submitLOCAL - INTERSTATE - OVERSEAS guest, the Supreme CathTD. two churches. ted a report on the dioArmenthe of all olicos Phone 5-1399 or 5-1777 or 5-2709 223-225 COLLIER ROAD, BAYSWATER "We ardently desire to cese's work for the Misians. leave nothing undone sion Aid Societies over W.A.'s Leading Paving Contractors He spoke of "diver- that could hasten the day the last two years. gent expressions of the when, in a concelebraFor Better Paving Contact Us On a per capita basis, mystery of our tion, we may seal the full Bunbury has been among We specialise in Gravel and Bituminous Paving of Wembley Hotel central faith," as if the 1,500- unity recovered once the top 10 dioceses in Roads, Tennis Courts, Playgrounds, Etc. Excellent Lounge and year-old differences be- again by our churches," Australia for the past We have a most modern plant including tween the Roman Catho- he said. Accommodation three years. Roller, Graders and Mechanical Loaders, etc. lics and the Armenians Phone 87 2418 Figures: were chiefly due to "cul- The Pontiff said he beEstimates Submitted Free Cnr. Cambridge and lieved this was "the first Propagation of Faith: Country Clients please note that we have a StateA lexander Sts., Wembley tural differences and the time in history that a 1968 $9,797.74. difficulty of translating wide Service, and will gladly quote on a'bishop of Rome has had 1969—£8,617.25. terms." requirements. SOAK UP THE SUN BY THE the honour and joy of Holy Childhood/Society Siibiaco Hotel The Catholicos himself SEA AT being able to extend ruling rates Gravel, Metal, Sand. hossupply at of Apostle We also St. Peter the role ChrisThe Ocean Beach , s! Class Accommodation stressed pitality in his own house (combined totals): Prompt Delivery. working played in tianity and Service 1968—$3,971.23. PHONE: 71-1578 — 71-1600 for peace by urging on all to the Catholicos of Hotel DR I VE-IN BOTTLE DEPT. 1969—$3,671.33. men the realisation of Etchmiadzine." FREE HOME DELIVERY Under Personal Supervls;cn of TOM KENNY their brotherhood. Phone 81 1028 Phone 3-1584 Such a realisation, he Irene McHenry, Proprietress asserted, would be "the greatest miracle of hisBayswater Hotel tory." The Railton The Catholicos arrived OPP. STATION Perth's Most Modern Temperance Hotel & from his See of EtchmiaOld Time Music . 5 minutes walk from Friday and dzine in Soviet Armenia Dancing, St. Mary's Cathedral with a party of 12, most B .B. from $7.00 Saturday. of them bishops or patCnr. Pier & Murray Streets LES BARTTLET Prop. Phone: 21-8861 - 21-8861 riarchs. TEL.: 71-1224 •IINONIII • • From his arrival until ArrimieW UMW 411=0 Commercial Hotel Hotel Australia his departure he was ac.11111P companied by the highMURRAY STREET, PERTH Northam est officials of the Holy Excellent Accommodation and ak• Phone Northam 49 See, including Cardinal Dining Service, Lunch $1 Jan Willebrands, presidParking Accommodation E. Murphy, Proprietor ent of the Vatican SecrePHONE 23-1541 tariat for Promoting Enjoy the Best Christian Unity, and CarAccommodation & Hotel Rockingham Service dinal Jean Villot, the Hotel Cottesloe BY THE SEA papal Secretary of State. R IGHT ON THE SEA FRONT He resided in the anFor a Healthy Holiday Phone 3 2155 cient tower of St. John The Best of Fishing R. M. DYMOCK, Licensee FRANK MADDIGAN, Proprietor In the Vatican Gardens, made habitable by the late Pope John XXIII. ACCOMMODATION AT CARLTON HOTEL. The high point of his Room with refrigerator, electric jug, tea, coffee, FOR FREE ADVICE MEASURE AND QUOTE— PHONE 714313, 713486, 716947 morning paper. visit was probably a Excellent breakfast. Parking solemn prayer session OR CALL AND INSPECT DISPLAY AT 874 BEAUFORT ST. INGLEWOOD f acilities. $4.50 per day. with the Pope in the Sis248 HAY STREET EAST. Chapel beneath TELEPHONE 21-4341. tine

F. LISTPTY. iLL SON

Hotel Guide

Make your house a home with blinds, awnings and flyscreening fr •

STAN BOND Pty. Ltd.

1


Page Four

THE

Development Can Cause Headaches To Farmers

Britain Augments Sterilization Church Leaders Want Territorial Services Issue Settled

RECORD

Thursday, May 28, 1970

He said exotic disease threats to Australia stemREPORTING THE WORLD med from close proximity of disease infected countries, intrusion of infected insect vectors by natural means or aircraft, and the illegal introduction of infected livestock or products. With modern technolBONN, Germany.—The Polish hierarchy has PERTH.—The development of new land areas ogy, there was little real LONDON: Male sterilisation by vasectomy will be made publicly urged the Vatican to acknowledge Poland's a vailabie to more husbands than heretofore under in Western Australia over the past 15 years has risk of disease introducsovereignty over the former German Britain's national health service, the government territories it tion by live animals, probrought with it a variety of animal diseases. acquired at the end of World War II, by giving fuu vided they were sensibly announced. status to the leaders of the dioceses in those Dr. H. A. Seddon, a safe stocking rates, the drawn from selected reareas, Richard Crossman, the lic and Jewish spokesAccording to reports reaching here, Cardinl veterinarian in Esper- I incidence and relative gions and tested and Labour a government's men in East London had ance, said this at the Aus- importance of nutritional quarantined in satisfac- Secretary of State (min- made a strong protest Stefan Wyszynski, the Polish primate, emphasised tralian Veterinary Asso- and contagious diseases, tory facilities. ister) for Social Serv- earlier this month when to a pilgrimage throng of 100,000 persons the in. ciation's annual confer- and the most effective Gee Dr. said the goal ices, said in a parliamen- the borough council at portance of such recognition, and his view was later ence held here last week. economic way of hand- of veterinary hygiene tary statement that doc- Hackney decided to reflected in sessions of the Polish Bishops Confer. He said major sheep ling them. and quarantine must be tors had so far been able make male sterilisation ence. diseases were nutritional Fertility problems were to prevent the diseases Both events coincided with 25th anniversary cele. to perform this opera- available through public stresses, particularly also responsible for from entering Australia. tion under the free na- funds. brations in Poland of what the Poles call "the return during the pasture devel- severe economic loss, Father Robert Whit- of the Northern and Western territories." health Prevention service energetic- tional opment stage, internal particularly those assoBy the Potsdam Agreement of 1945, Poland was and external parasites, ciated with clover dis- ally directed towards the only when it was con- ney, Catholic dean of major diseases would co- sidered to be in the Hackney, led a deputa- given administration of lands east of the lamb diseases, trace min- ease. Oder. protect medical interest of the tion to protest to the Neisse river line. eral deficiencies, toxic In contrast to older incidentally against most other council. man He concerned. its told Vatican policy has been to appoint Polish apes. native plants, fertility and established areas of diseases. clover diseases. Western Australia, where tolic administrators to handle the actual super. "I have now informed meeting: "As Catholics, we pro- vision of the various dioceses in these Dr. D. F. Stewart, the representatives of He said lamb losses only a low level of inferterritories, before, during and after tility may occur, on new chairman of the National the medical profession test against this propo- but to leave with German bishops the birth were serious prob- land where, in the init- Brucellosis and Tuber- that I accept that this sal because sterilisation responsibility for their former dioceses. technical lems, this having been ial years of pasture de- culosis Committee issued operation may be per- — male or female — carCardinal Wyszynski said that the Polish episco. the cause of loss of up velopment, clover tended a statement covering the formed on the husband ried out simply as a of cattle in the interests of the contraceptive measure is pate had been explaining to the Vatican what ia to 40 per cent, of the to dominate the sward, eradication total lamb drop on some severe signs of clover Brucellosis and Tubercu- health of either husband against the teachings of needed for normal conduct of pastoral work lo7 properties. our Church. It is an un- the Church in those areas. disease occur and lamb- losis on a national level. or wife," he stated. He stressed that the Polish bishops had handed Lamb losses of up to ing percentages had been a project being implejustified mutilation of "The consent of hus- the body. mented by a co-ordinated three per cent, between as low as 10 per cent. to Pope John XXIII and Pope Paul VI "our memor• marking and weaning, Disease conditions of plan covering all States. band and wife would na"We are merely stew- andum in which we demanded a full implementafollowed up by a further cattle on a hard basis The statement was au- turally be required and ards of our bodies and tion of the reorganisation of the Church in the five to 10 per cent, dur- which have occurred in thorised by Mr. R. M. the decision to perform we must one day render regained territories." ing summer, were not Esperance were heavy Watts. chairman of the the operation and the an account of how we Addressing the bishops conference, the Primate uncommon. worm burdens ,lice, min- Standing Committee on priority accorded to it have used or abused described the conference as a "special testimonial in relation to other deEwe mortality rates, eral deficiencies and dis- Agriculture. them." to the 100-year presence of the Polish nation in the mands for surgical work even in young and mat- ease associated with reThe council's propo- areas adjoining the Oder and Neisse rivers The actual work of and is, of course, a matter ure ewes, may reach five production. sal was doubly offensive the Baltic Sea." eradication in each State per cent, over the lambfor the surgeon concern- since Due to the complexity will be it meant not only carried out under Cardinal Wyszinski said this presence has been ing period, and, in the of the disease problems detailed ed." being asked to acknowarrangements presence of severe clover that occurred in newly made Crossman has shown ledge such operations. documented by the numerous Catholic churches by the local Chief disease, may even rise developed areas, it was Veter himself to be enthusias but because taxpayers in those areas, which "were erected by our foreinary Officer. to 20 per cent. essential that veterinary fathers and reconstructed by the present generaThree distinguished tic for all forms of birth would be forced to sub- tion." Average annual sheep advice be sought early prevention, including sidise them through lolosses on some properties when planning stock in- veterinarians have been Archbishop Boleslav Kominek of Wroclaw —the what is now generally cal levy, Father Whitwere around seven to 12 troductions, so that granted Fellowships to former German Breslau—said the Polish people had euphemistica lly called ney added. per cent. sound preventive meas- the Australian Veterinar"family planning" and progress to these areas and trusted from "brought Speaking from person- ures could be implemen- ian Associations. The borough council, al experience, Dr. Seddon ted. They are: Dr. J. D. abortion. however, agreed over- the beginnings in the Polish past, present, and said one of the difficulNo official Catholic whelmingly to free fin- future of these territories." The chief of the Animal Astil, B.V.Sc.; Dr. A. K. He said that, just as a thousand years ago, the ties in a newly developed Industry Branch of the Sutherland, B.V.Sc., M.S. statement on vasectomy ancial grants for men area was a general lack Northern Territory Ad- and Dr. A. L. Rose, has been made here re- who cannot afford such Church, 25 years ago, again undertook the first step of accumulated informa- ministration, Dr. Gee, B.V.Sc. cently, but both Catho- an operation. of reconstruction in unionism with the Polish tion on the problems of said that in recent years government. animal health and pro- there had been little imduction in the district. provement in the world He had to obtain this situation in animal disknowledge himself by ease exotic to Australia. making an assessment of If anything, the risk to seasonal nutritional this country appeared peaks and inadequacies, higher.

Evacuation Of Israelis From Hungary Again Tightening Grip On The Church Arab Territories Urged

BONN, Germany.—The Communist Hungarian BEIRUT. Lebanon, The World Conference of Christians for Palestine Government has taken steps in recent weeks to ended its four-day meeting here by asking Christians throughout the world tighten its control over the Catholic Church, which had been substantially relaxed following the signt o urge the evacuation of Israeli forces from Arab territories. ing of the Hungary-Vatican agreement in 1964. OPTICIANS OPTOMETRISTS This evacuation of ment of a democratic Plans were announced Once again, officials of diocesan chanceries must Israeli forces, it said, "is state of Palestine that at the conference to esCONTACT LENS CONSULTANTS submit all mail to the government church secrea first and inevitable step would include Arabs, tablish national commistaries. Until 1964 ,these secretaries functioned in PERTH: PICCADILLY ARCADE . sions in countries of the 21 8151 for the preparation of Jews and Christians. chanceries, but since that time work in public the peace." PERTH: 154 WILLIAM STREET ... participants and two per21 5304 I t has been estimated buildings. FREMANTLE: 30 MARKET STREET ... manent committees in 5 2602 The conference's state- that there are close to 1.5 COTTESLOE: 19 NAPOLEON STREET ... Beirut and Paris to fol3 2655 ment also It was reported that the secretaries for church said that there million Arab refugees low up the work of the affairs photocopy or confiscate mail of particular could be no peace in the who left their homes in conference and to report interest to them. Middle East until Zion- a flight from Israeli on what were described ism was eliminated from f orces. About a half milOne result is that the bishops do not receive their as the crimes of Zionism. Palestine. lion of them are the origThe conference also morning mail until late afternoon, and outgoing ( Zionism is the historic inal refugees from the agreed to publish books mail from the chanceries is not forwarded until the movement to create a Arab-Israeli conflict that in all languages on this following day. home for the Jewish ended with Israel becom- and future conferences, Through the years, the Government Office for ing an independent state in addition to books on people in Palestine.) For First Class Plumbing Services Affairs in Budapest has been instruEcclesiastical in 1948. the Palestine situation. The conference, attendhaving posts in the chanceries filled by mental in A periodical will also ed by 400 delegates from Israelis, on the other Steam and 1-;ot Water Installations Peace Priests. pro-government the be published in the name 37 countries, was opened hand, claim that over by President Charles 600,000 Jews were forced o f the conference. Increasing activity by the Peace Priests has bePHONE 28 6955 or 28 6043 Helou, of Lebanon. out of Arab lands without come a disturbing factor among the clergy. Many .6TTENTION ALL! compensation. any of the Peace Priests travel throughout the country I t rejected the claim 211 Newcastle Street, Perth Scho Is, Convents, Col"that Mid-east probArab governments leges, Charitable Organis- with government colleagues for "talks". This has lems can be solved have, in the past, made ations—For your insecurity in the clergy Raffle served to create a sense of through the balance of the repatriation of the priests themselves. suspicion even among the and Tickets see . . power or the interven- refugees a condition for Many priests have complained of the conferences R ECORD PRINT tion of the big powers Mid-east peace talks. In priests' senates in various dioceses. to 450 Hay Street, Perth. or through international 1960, President Gamal solutions that conflict Abdel Nasser, of the with the rights of the United Arab Republic— people of Palestine, es- Egypt—said: "If the repecially the right to re- fugees return to Israel, patriation and self- Israel will cease to determination." exist." Only the people of PalThe Christian conestine, it added, "are science ,the conference ( Brian and Neil Purslowe) authorised to put forth said, could not allow the political solutions which grave injustice on the would establish co-exis- part of Israel against tence among peoples of the Arabs. It urged supdifferent creeds, beliefs port for what it called HEAD OFFICE & SERVICE CHAPEL and ideologies inside a the legitimate struggle of free and democratic Pal- resistance and revolution 15 SCARBOROUGH BEACH ROAD, estine in the heart of the of the Palestinian people. Arab world." It condemned all forms NORTH PERTH — 24 4835 ( One of the aims of Al of anti-Semitism as well V ICTORIA PARK and GUILDFORD Fatah — the Palestinian as all forms of racial disArab commando organi- crimination against the sation—is the establish- Arabs.

ELLIOTT & ELLIOTT PLT Y,

Geo Boucher & Co.

Arthur J. Purslowe and Co.

The Norbertine Fathers

FUNERAL DIRECTORS

Is God calling you to be a Norbertinel

"Prepared for every good work"

More Priests and Brothers needed for apostolate in W.A.

Further particulars:

1

FUNERAL DIRECTORS 61 1158

Mead Son & Co.

PERSONAL SERVICE FULL CATHOLIC RITES MODERN PREMISES PHONE ALL HOURS:

E. W. (WIN) MEAD

-

190 Albany H'way, Victoria Park

-

6 3482

V. Rev. Superior 0.Praem., St. Norbert's Priory, Kerry Downs, York, W.A. 6302


'Thursday, May 28, 1970 INVESTORS FOR

THE

RECORD

Page Five

.

NEW DOCUMENT ON ECUMENISM IN HIGHER EDUCATION

a belated recovery to 25 cents. At that price they are a good punt in any market. So once, again, if you don't need the money next week, try A new ecumenical document sets down the principles of ecumenism to Magnum. Kio Ora is sounder based, but more be introduced to all institutes of advanced learning so that the cause of By Mindu Speck expensive. For several months unity can be advanced. of expanding its activities source of quick profit to The most certain feathere have been persismarinto new present areas, including the the lucky holders. It is tent rumours of the disture of This was the import ciples issued by the sec- graduates would be in uncertainty. mineral exploration. The quite unsatisfactory covery of a large deposit of a Vatican directive retariat to guide implem- positions of influence in ket is its selling, brisk announcement coincided that they should be dis- of low grade lateritic made public in a press entation of the many the world and in society. Stop loss de- with the mining boom, tributed at the whim of nickel at Leonora, which conference on May 15 by ecumenical desires of advance and sharp and its share price rose the underwriting broker. is being cline have followed in beAs such, they should explored by a the president of the Vati- Vatican II. A companion The folly of this sys- consortium of Longreach can Secretariat for Pro- document was issued in be well trained in ecuwildering succession. In to a figure appropriate may to a mini it this -conglomerate. tem was emphasised by Metals, Hawkstone Min- moting Christian Unity, May, 1967, dealing with menism in order to deepthe face of The crunch came when, the recent offer of share describe erals and Cominco. It Cardinal Jan Wille- the use of sacraments, en their own faith, apseem absurd to market as show- in the post boom period, entitlements in the seemed likely that these brands. liturgy and prayer be- preciate the movement the local the company Yet trend. announced Comalco float to federal were the result of pure ing a rising Catholics Entitled "Directors for tween and within the Church tothat flour milling opera- politicians. This was in- speculation, a detailed examination especially Ecumenism in Higher Christians. ward unity and to "see tions were no longer pro- tended as a good will when the Three years in the mak- more clearly what unites area was des- Education," the docuof the behaviour pattern fitable so. and this is that would cease. gesture by the company, cribed somewhat crypti- ment sets down guide- ing, the new directory Christians confirms and what but must be rated as the cally in the last Long- lines and reasons for recognises that college divides them." Since mid-April Austra- THE STOCK most ill-judged public re- reach report as 'promis- action for students and lian share prices have EXCHANGE lations effort in recent faculties of not only thetended to rise when unLawn Mowers, Shears Sharpened and Set The investor who has times. The Prime Minis- ing'. Longreach Metals is ological seminaries, but der the influence of local lost money blames every- ter rightly rejected the rising the but orces, setting up a new office also those who frequent f body but himself. Not offer. in Perth, however, 'and Catholic centres on secutrends have not been infrequently the bulk of Economists have be- early this week the com- lar campuses. CITY COUNCIL AVENUE — 21 4390 strong enough for this market to go it alone. the criticism is directed wailed Australians lack pany advertised for a LOCKSMITHS - GUNSMITHS Cardinal Willebrands at the Stock Exchange. imponof interest in their own geologist or mining enThe three great Lccks, Door Closers and Sages Overl,aJled and Serviced pointed out this that was The Australian Ex- economic derables at the moment development gineer 'to direct a major CAR and ALL TYPES OF KEYS CUT. Immediate Service. the second set of princhange has been taken to for years. The mining exploration are the American econprogramme omy, the Vietnam war task by Members of Par- boom has shown that the for metals throughout and the British election. liament, by representa- time is ripe for change, Western Australia and to PLUMBING MATERIALS Predictions on the re- tives of the London Stock but interest will not be plan and develop a large covery time for the Exchange, and by the maintained unless the open-cast mining proBATHROOM FIXTURES American market vary press. How much of this small investor is given a ject from the stage of 229-233 William St., SEPTIC TANK — DRY WELLS Perth ore reserves studies to from the next few weeks final shipment'. to late 1971. The CamThose The "Plumbing Supply Special ists" Phone 28 8544 bodian involvement is rumours now seem more C HAN! BERLA1N 1 / described alternately as a 170 reliable. major American blunder Announcing the world tour of a lifetime and as a serious setback for the Viet Cong. .. . and it's priced to suit the tightest budget! The British election is 6 about as uncertain as it two a in party be can system. It is difficult for an outsider to discover a significant difference in the economic platforms of the two parties, hut the election result looms large in the minds of British investors, who prefer to keep money In their pockets in the meanwhile. LOCAL PROBLEMS

Down, Up, And Down Again

Harry Armstrong Pty. Ltd.

Roy Galvin & Co.

The1971Catholic World Exploration Tour under the personal direction of Mary Rossi

Trade figures for the March quarter throw an interesting light on local M ayo p roblems, especially in the building sector. West Chamberlain Industries Pty. Ltd. Share price in Australian housing and and weekly turnover in thousands. dollars flat development were respectively 13.3 and 41.2 criticism is valid? chance of reasonable per cent, down on the The Stock Exchange sharing in new enterc orresponding figures for endeavours to ensure prises in boom periods. 1969. that shares are traded in A ballot system should be The decline in local a fair manner as defined introduced as soon as building occurred prior by its rules. It must see possible. to the credit squeeze. that share trading figures The influence on tim- are published to guide MINING NOTES ber and brick and tile investors on the state of The market decline has manufacturing is ob- the market. It must do been completely unselecvious. The problem may what is in its power to tive, and good risk stocks extend through to aluensure that accurate in- with high prospective minium and steel if a formation on company yield such as Great Boulrecession is widespread, activities is provided to der, North Kalgurli and although a decline in one shareholders without de- Westralian Sands are of the less popular states underpriced. lay. It also has a respon- grossly has little effect at a Heavyweights such as sibility protecting for the national level. small investor from large Mt. Isa and Western The depressed condi- scale manipulation of Mining Corporation are tion of the state's agriculwell down when viewed funds. ture is also making itself The Stock Exchange is in terms of earning and felt. The makers of farm expansion potential. machinery are seriously not responsible for proIn the present market tecting investor the from hurt. Chamberlain In- his own stupidity, nor good news is valued at a dustries is a case In does it have control over discount, and with proPoint. The firm has made factors in the economy ducers undervalued there a valuable contribution which affect share prices. seems little point in bothto the development of Much of the criticism ering with the more this State, but it sells on of the Stock Exchange speculative issues. a limited market. Its for- arises from the boom There are exceptions, tunes fluctuate with those period. It is unrealistic to however, and at least one of local agriculture. expect boom trading to is worthy of close attenProgress of is reviewed in its shares be as well controlled as tion. Kia Ora Gold, in the adjoin- transactions in a sedate a recent report, gave deing graph. The price trend market. tails of its profitable Was steadily down durNevertheless the Stock share trading and mining ing the boom, and it has Exchange exercised a exploration activities. continued down. Unfor- close watch on company The report was generally tunately this reflects the reports throughout the impressive, but one of COMPany's prospects in boom. Requests for clari- the choices bits of news the immediate future. fication, and for explana- was an assay of 4.4 per Ultimately its salvation tions of sudden price cent. nickel on its North Must lie in diversifica- movements were an al- Thundelarra lease which tion, so branch of that no one most daily occurrence at is being explored jointly its production the height of the boom. with Consolidated Nickel dominates the Progress. This company's These inevitable "The and Magnum. Regular might pro- directors know of no readers may recall an vide a broad structure on reason. . .' became a by- earlier reference to these Which a big export trade word, but in retrospect operations, in which could be based. this was true in most Magnum has a 49 per Chamberlains cent. interest. have cases. served the State well, When it became ob- It is possible to have and it is regrettable that vious that entrepreneurs surface nickel concentrathe company faces such were serious set on making for- tions, especially within problems. tunes from questionable the ironstone formations It is that interesting to note mining ventures the Ex- known as gossans, which DalgetY and Com- change tightened require- are higher than those in PanY, which has been in- ments for listing. On this the underlying rocks. At volved almost entirely in matter also it has been least as often, however. a gricultural trading for a model of rectitude. the situation is reversed. Many , has started to d My one major criticism Now 4.4 per cent. iversify. Years The not without process of the Exchange is its nickel is good value at its dan- failure to establish a any time. It was enough r sI;In b gers, however, as is more equitable system to have the teleprinter tory of Zathe recent his- for distributing entitle- ask for a repeat when ng Flour. ments to new flotations. the report was transmitthe. c announced its ompany Even in a depressed ted, yet all it did for intention market these can be a Magnum was to produce

You'll sail in the unmatched comfort of the

Lloyd Triestine luxury liners, Galileo and Marconi

MARY ROSSI Tour Director

• You'll sail around the world via the Pacific and visit no less than sixteen fascinating, faraway countries. • Your six-week springtime tour of Europe Includes places of great religious significance (like Lourdes and Fatima) as well as all the top tourist attractions. • You'll spend Easter In Rome . . . and this will be an experience to remember. • The fare covers all accommodation, three meals a day, tips, entrance fees . In fact everything! • The overland section of your tour has been arranged through C.I.T., the largest specialist touring organisation In Europe. See your travel agent today or post coupon

IARY ROSS?. Tour Director rQuartermaine's Travel Service WIIM

NMI

NMI MEM

1 1

3-5 Henry Street Fremantle 6160 Please forward me your brochure on the 1971 Catholic World Exploration Tour.

NAME !ADDRESS POSTCODE TR.28.1 ITELEPHONE No.: ▪ ummi MIMI Mill III= NM NM MIME

1

Have you ever dreamed of realising a lifelong ambition to see the world . . . sailing away on a grand tour where everything is arranged for you and there's just nothing to do but relax and enjoy yourself as you explore exciting, faraway places? Well, that's just the kind of tour we've arranged for you in 1971. It's easy travelling every Inch of the way. No rush. No fuss. You'll sail around the world aboard the magnificent, new luxury liners Galileo and Marconi and you tour the Continent in the comfort of de-luxe roadliner coaches. Your entire 15-week itinerary has been carefully planned to show you the very best in every country you visit_ Make no mistake . . . this is no ordinary tour. Tour price from $1,450 fully inclusive! Believe it or not but that's LESS than $14 a day „. and remember your fare includes everything Including three meals a day! Like more details? Consult your travel agent today for full information or post the coupon. Accommodation is necessarily limited and we strongly suggest you book as early as possible.

Tour departs February 1971. Fifteen unforgettable weeks of discovery from only fully inclusive. 932'W.

$1450


HE

Page Six

RECORD

TOM AHERN A TRIBUTE by Monsignor J. T. McMahon

Thursday, May 28, 1970

C.B.H.S. BOYS DO WELL

It has been written that fel‘ the warmth of a Aherns Ltd. That was the Club. A group of mem- ed the game by asking St. Thomas More was a friend. The day was bles- first great act of faith bers calling themselves the children: "Is daddy's man born for friendship. sed by it. He was won- in his own capability and and Bindulie Club, as a horse going this SaturThe same can with jus- derful to ladies, grasping will to succeed. It was link with Kalgoorlie, met day? Has he a chance? tice be said of the late their hands, holding them suggested that such a to celebrate their birth- On being assured that Thomas Ahern. Nature with twinkling, mischiev- name might prejudice a days each year, and the he would be trying, then blessed him with a noble ous eyes, allowing them business that catered for place of honour was re- the mother had a bob bearing, a dignified figure to talk until some tone a wide public. He stipu- served for Tom. Dick each way. which he retained to the or family references ig- lated in the agreement Allingham, president of Claremont Football end, a welcoming grace, nited the spark of recog- that he would hold the the Wesley Council, al- Club had a staunch supand a winsome smile that nWon within him and major portion of shares ways presided. The porter in Tom as their companionship hence they walked on air so that he could direct Christmas carols, words patron. Karrinyup Golf invited from all, be they V.I.P's that Uncle Tom had re- the whole business. This, supplied, were conducted Club has much to thank or ordinary people. A cognised them. He de- in 1922, began his story by Reg. Forbes of Par- him for while he was smile makes friends; a veloped his groping tech- of a success which this ker and Parker, and one President. I have joyous smile is a foretaste of nique to perfection. remarkable man achieved time amateur Golf Cham- memories of our fourparadise. It emerges like through his own efforts pion of W.A. The huge somes there, John F. a flower from its stem, I met him in 1921, the vithout money or pat ham was carved by Hub Walsh, of Lavan and and when a person smiles year I arrived. I was •onage. He set his idea Elsiner, a Jewish friend, Walsh, and I against at other people he brings t-noressed with his quiet n the motto: "Aherne- with apron and chef's Archbishop Prendiville out all that is best in dignity and unhurried lever disappoint" — an cap. There was everything and Tom for a purse of them. rsonality during the he store under his dedi to drink and to eat, but 3d., 3d., and 6d. He does more. Once He brings the child in "egotiations to take over ‘ation and inspiratior t o me, the 50 lb. dhufish John Walsh put three the growing man to life the management of Rob- 'ved up to it. As h( was the feast. On a re- balls in succession into again, liberating his real inson and Moffats. I met mbled through the stor cent celebration, Tom the lake, and then to the Apart from the Lynn Enzo Biagioni (above) self from the hard shell him frequently as I was vith many praises t( had a crack at me which hilarious merriment of of conformity, freeing his acting secretary for Arch- 7armly greet the shor got a big laugh. He read the caddies he threw his from Christian Brothers. Scholarship, five boys— liberty from all restraint. bishop Chine, who proa telegram from Arch- bag of sticks into the Bedford, has been awar- Peter Creighton, Stewart ded the Lynn Scholarship Cromby, Trevor Kelly, To smile is such a good posed his name to the bishop Appleton wishing water. thing to do; and the habi- Connor-Quinlan family him well and apologising Tom Ahern leaves be- for his pass in the Junior Paul Mangini and Rodney tual smile of Thomas as the best man availfor his absence. The tele- hind him a fragrant mem- Certificate Examination Minchin—won CommonAhern made the path •ble. I remember his wealth Secondary Scholgram was signed "George ory of kindness to the for 1969. through life brighter for 'nsistence on a change arships and two others, Perth". Tom's comment lowly, of sincere fellowEnzo, a prefect, repremany people. With his of name for the store was: "Of course most of ship to his peers and of sented the school in foot Giulio Biagioni (a cousin double handshake you . and that it be named of Enzo) and Gary Hilton you fellows would not a generous and warm athletics and were awarded Commonknow what that means. heart to his family and cricket. wealth Technical ScholBut I have two of my the long line of grandBUYING OR SELLING — TOP VALUE ALWAYS Scholastically, t h e arships. own fellows here, Bishop children who will cherish school did rernarkablN With the exception of HOPKINS M 1GHTY MART McKeon, who was invit- their beloved grandpa. ed and that other lad I visited him frequently well. From the Junior Gary, all boys have con222 BEAUFORT STREET, PERTH ( pointing to me) who during his last illness class of 36, eight boys tinued their studies at Public Auctions — Tuesdays, 10.30 a.m. would come whether he and was fortunate that he were awarded scholar- Christian Brothers' High School, Highgate V, E ARE CASH BUY ERS — PHONE 28 4851 was invited or not". knew me each time. His ships. True to his race. Tom good hand had the firm TOM AHERN was a lover of horses. clasp of a mutual friend)ers, one sensed the dis The horse is the king of ship. He was happy to ipline of the staff whicl the Irish. When a string be attended by the young )usied themselves unde of thoroughbreds pass Irish Sisters who sang 23 Fulham St., Kewdale. Tel. 6 3682 is approving eye. HE through the town of Kil- ditties to him and once was fully involved in dare, all business ceases while present he tried to LICENSED PLUMBER Aherns Ltd.; it was his as everyone comes on to articulate the words of HOT WATER SPECIALIST. SHEET METAL WORK. over-mastering aim in the streets to put ap- Danny Boy with us. SEPTIC TANK INSTALLATIONS. As I gave him a blesslife, and that objective °raising eyes on theii A LL WORK GUARANTEED Tom, a Co-Cork ing and an absolution, filled his days. Like a form. Advt. guest artist striving to man, did not inherit that he held his beads as they express his dream in gift. His horses, begin- were the hand of Mary. painting, sculpture, poet- ning with Cooladerra whom he loved and whom ry and architecture, Tom ( named after his birth. he honoured each day of strove with all he had to place), Cork and Kerry his life with a daily 3 CONNOLLY STREET, WEMBLEY -reate a store that would ( a partnership with Toni R osary. Phone: 3 2406 be worthy of his adopted Cullity), Concullagh (anDeath is a separation All Types of Electrical Work Undertaken land and that his fellow other partnership with from one's loved ones; it eountryman would he Mick Connaughton and leaves a vacant chair in Tom Cullity), and Knock the family circle; it is a proud of. To have enjoyed his adoon, provided a pleas wound that hurts no matHoltand r.7 Venetian Blinds, friendship for 49 years ant and exciting hobby, ter how old that dying Canvas & Aluminium Awnings, has been one of the spe- but few wins. He attend- person may be. To his eial blessings and joys ed the track to see them beloved family and AT GEORGE'S F lyscreens, Tarpaulins. of my life. I have never in training and never grandchildren the only 237 North Beach Road missed his famous birth- missed an Ascot meeting, consolation that matters day parties on December where he was allowed to is the promise of the Tuart Hill 23 each year, held in a drive on to the course Preface of the Requiem Phone 49 2431 A Hrs. 47 1511 286 ALBANY HWY., VIC. PARK, private room of the Perth when his eyesight failed. Mass—"life is not ended ^wommisimimmli The first horse he owned in death: it is but 6 1 1620 61 1539 had to be kept a secret changed". by the family. "Don't tell May that noble, generyour mother," he coun- ous soul of Tom Ahern selled. The mother play- rest in peace.

P. D. LALLY

r

R EMEMBER

HUNGARY

W. H. BRANCH & SON

FLAGS OF All TYPES

L4P.P.O."04,00######ANNININIMMIWAPINIMNINYMNIKINNA W ALLPAPER

Tudor House

SCIENTISTS INVITED TO STUDY F ATIMA APPARITIONS WASHINGTON, N.J., U.S.A. A group of scientists and science editors are being invited to a Miracle Seminar for Scientists this summer at Fatima, Portugal, to study at first hand the circumstances surrounding the apparitions of the Blessed Virgin reported there 52 years ago by three peasant children. The seminar will be sponsored by the Blue Army, a U.S. organisation dedicated to promoting devotion to Our Lady of Fatima. The U.S. office of the Blue Army here, and its international centre at the Fatima shrine, will pay the expenses of most of the scientists who attend the seminar on July 13. At the seminar, the scientists will meet persons who claim they witnessed apparitions of the Blessed Virgin at Fatima between May and October, 1917, first reported by the three Portuguese children. The only living member of the trio of children is Sister Lucy, a Carmelite nun. In a book, "Meet the Witnesses," Blue Army official John Haffert reported interviews with more than 100 persons who claim to have seen the apparitions.

Swan Lager

cilustralia's International beer

Vocations Continue To Rise In Poland WARSAW, Poland.—Vocations to the priesthood continue to rise in Poland. So far this year, 743 students have been enrolled in diocesan seminaries. New enrolments in 1969 totalled 706. Presently, there are 3,327 students of therilogy in the diocesan seminaries and 998 candidates for the priesthood in religious orders. Among the orders, the Salesians show the greatest growth with 102 seminarians. There are 385 seminarians in military service.

Jack GAYNOR offers you unbeatable prices on all electrical appliances — oil heaters — sewing machines and typewriters Contact Jack at his big new modern store at — THE MORLEY SQUARE SHOPPING CENTRE (rear of K. Mart)


Thursday, May 28, 1970

THE

Page Seven

RECORD MAJELLANS

REVIEW OF LIFE

S AY IT NOW

would be like if we were in the same circumstances as the one concerned.

To sum up, Review of Life is to find God's plan for us in the everyday By Rita Murphy. things of our life so we mention some item from is soul interpreted by the Kind of Words: of women, who are and group friends, kind words have a power which seems to Whenever a Music our life; we try to find meet, they inevitably begin to talk about what what God is saying to us be beyond natural causes. has happened to them recently, or probably that in the item. We recall Think of this power, for well from experience are Well, Review of Life is the same, a natural how He acted in a simiday. power always the hardest to set in tp.ith, is there a Sr. M. A group of women who are friends get lar situation and we try PHILOMENA thing. EARLE right, them? equal to will give way in on earth together and talk about their lives and try to t o copy Him and to do B.Sc., Dip. Dietetics, A.T.N.A., A.A.I NI.T. It seems as if they time to kind words. Most find out what God is saying to them through the this we pray, e.g. in the could almost do what in quarrels rest on misundo derstanding alone can and only live God to day events of their daily life. By this, item used above about day r eality A kindhearted person now, the word that they help one another to become clearer as to the elderly lady and her —namely, soften the hard by silence, which, as it garden we can say somewere, stereotypes the is definitely a genial per- pleases, charms and what God does want of them. His Will for them and angry hearts of men. like this: Lord, thing friendships, m isunderstanding. many son; and we know geni- cheers. How and they become happier and holier. that's beaut the way that How often have we ality is power. No-one Say it now or maybe loyal and self-sacrificing, Incidentally, as Majel- old lady is so "alive", so So, one woman might been made was ever corrected by a you'll regret in after r ested at first on no ourselves Clubs are meant to sane, so open and not an happy foundation way to by that, on the kind say words in a sarcasm, crushed per- years—you missed the thicker a manner, and to an ex- haps if the sarcasm were chance of making some- the meeting, she passed be centres where we go locked up in herself as than a kind word. You tent which we are quite clever enough, but drawn one dear to you happy. an old lady doing her to refuel our love for one I so often am. The power of kind unable to were a person who apGod, we and another this sight triggarden; explain? nearer to God—never! Take your opportuniw ords is shown in the And happiness is a Nothing can be done for ties, nice things to say gered off thoughts, such must never let Review of preciated flowers yourprejuof estruction d great power of holiness. God without geniality. A and do. Often unexpec- as: How wise that old Life develop into a cat self when you were on dices. Surely we must all Help me to get C onsequently, kind genial man is both an tedly and, in a way, most person was, not staying session, where people's earth. have experienced this from flowers, in fact neare analysed motives feeling lonely words, nside and by their power of apostle and an evangelist strange—Life take on a i ourselves. For a long time producing gatively. We are searching from all of nature, what perhaps, neglected and happiness, —an apostle because he different pattern. Cirperhaps, we have had have also a power of brings souls to Jesus; an cumstances change—sud- but coming out, forget- together to find the value you wanted me to get. prejudices against a perproducing holiness, and evangelist because he denly, without a warning, ting that she was home of events, etc., to find Help others to get it too, son. They seem to be exforgetting her God who reveals Him- so we may all be happier so winning souls to God. portrays Jesus to souls. there's a broken thread, alone, tremely well founded. We self to us in these events and holier and closer to helpaches in Rev. pains and Father Faber, a Patients, who are ill in and better is the thought certainly have a com- well known if we open our eyes and you. Help me to get my plants and lawn ing her Jesuit, stated hospital, and those we of deeds undone and plete view of the whole above all hearts to Him. children to appreciate that, she is to grow. In that, on the day of Genmeet daily, can never forwords unsaid. How much case in our mind. Then, eral Judgment he would get a kind word spoken kinder we should be to satisfying the creative There is so much of nature so that they may some particular circumfind it harder to answer to them in their suffer- friends and family—if we urge that every woman good around, perhaps it never be narrow and stances bring us into to Gorl. for any unkind ing, which is often men- really grasped the fact has; she is bringing order is wiser to report good "dead". Tonight. Lord, connection with this perwords than for his sins. tal and physical, and of life's uncertainty! . . . out of a possible disorder deeds or if a bad one, let I'll see there are flowers son; kind words are exit be one we personally or at least something There are many diffi- again, they never forget Another chance to make in the garden; she gives pressed and these pre ju• failed in, or one we need living in the kitchen (on pleasure people to who an unkind word in the amends we think time De- culties which we must dices thaw away. others to help us to table for tea perhaps). pass by, perhaps brightfinitely, there was some overcome, but we have same situation. So if we will allow—but all too Help me to =ember, remedy. ening their day by a reason for their depart- got to reach Heaven, so wish to say a kind word often it's too late—so, Lord." let's say the Kind Word dash of colour or some Remember, as Pope ure. There is no logic in we must march on. The —say it now! beautiful symmetrical Paul said when still CarSay the kind word now. the matter, but a power more humble we are, the MORNING flower or a beautiful perdinal — "The secret of which is above logic— more kindly we shall fume. God is interested the apostolate is to COFFEE the simple, unassisted talk: the more kindly we in all these things be- know power of a few kind shall talk, the more humhow to love". And FOR LADIES cause He made us to be as Fr. words. What has been ble we shall grow. Evely said: "Charhappy here and hereThe Ladies Auxiliary of W IN DOW floor to avoid soiling or ity is not blindness but stated of prejudices apWe all realise an air after, and anything we a clearer lucidity". We the Jesuit missions will sagging.) plies equally to quarrels. of superiority is foreign TREATMENTS Cafe curtains are a do to make others happy see faults but we see hold its morning coffee Kind words will set right to the genius of kindness. Window treatments are We more, we see a child of at the usual venue, the practical style for kit- is what He wants. things which have gone Weak, and full of wants a very important part of think, too, of when He Ocean Beach Hotel on intricably wrong. as we our ourselves, we decor and can make or chens as they give priv- was on earth. He used to God; we see our own Wednesday', June 3, at 11 acy yet do not block frailty, and we too, have One rarely meets a must make up our minds break a room. look at flowers and urged a fair idea of what we a.m. Eefore making your light. person with an unforgiv- to do some little good Use plenty of imagin- His followers to do so ing heart. Most people to this poor world while choice, consider the type ation when making your too (Matt. 6, 25-34). He get tired of the justest we are in it: kind words of window, the amount choice of window treat- showed them that, to quarrels, even one-sided are our chief implements of privacy needed and consider how well God also the quantity of light ment, and don't be too looks quarrels, which we know for this work. DIAMOND after birds and quick to choose. Ask for required. animals, should help advice from trained asSPECIALISTS We will discuss the difthem trust Him to look ferent types of window sistants in curtain de- after themselves, who Thirl ogi tot //eaeh partments, or study magtreatments available. azines or films for differ- were so much more valFor a watch to wear, Of Venetian Blinds • ent ideas. You'll be pleas- uable than birds and a watch to give, you These are an excellent flowers, in fact He had ed with the result. will ilium find the media for both privacy Plain-coloured curtains made the birds and perfect model la and diffused light. With look best with flowers just to make patterned Omega's uarivtlled We stock 20 special Herba-Heal Teas for all ill- the newer silicone-finish carpets and vice-versa. them happier. c ollectiou. nesses or complaints which can be relieved by slats, cleaning is much Lighter colours with herbal treatment. These teas are blended from easier than before. darker floors. At each meeting, one White A point on choice of theers go f ormulae which have borne the test of time and a with all colour person contributes somenap long experience. such a -chemes. Luxurious vel- thing she has experiencWe also stock Chamomile— colour —being Peppermint—, Balm, Fennel-Tea and many others. long-lasting item, choose vets and silks go with ed since the last meeting P rice per packet $1.00 at your Chemist. Health- a fairly neutral colour, ormal and shows how it has rooms. Food Shop or direct from our Mail Order Depart- so that if you decide to Material valances are helped her. If she can't change your room colour gain ment. popular and add find any significance in Omega Seamaster scheme later on, they will variety to plain If you are interested in Pure herbal medicines ask for drapes. the event—it need not be .01? Mocels Sf :0 tone in. White and cream our free detailed pamphlets. Matchstick curtaining an event, it can be a are very safe and adapt- u• bamboo blinds can word, phrase or sentence able colours that blend ook attractive for sun heard on the radio, a in with all colour ooms and sleep-outs and book, anywhere—and yet schemes. 74 Campbell Road, Hawthorn. Vic 3123. ombine well with cane this event is sticking in They can be used in any urniture and Tel.: 82-1169. indoor pot her mind. She asks the PLAZA ARCADE decor and do not neces- plants. In Perth also at Mira Louise Health Centre, others to help her find Hay Strtet End PERTH. sarily need curtains THE but JEWELLER 671 Hay St. Next article — Wall- what God is saying to perhaps side drapes if her. papers. desired. Holland Blinds. These are once more gaining popularity and are much improved with a silicone type finish. The new range of patterned ones look particularly effective in kitchens laundries and bathrooms and do not necessarily need curtaining as well. Curtains These can add to the beautification of any room. They can make a room look so luxurious and so homely. Small windows and narrow ones can be made to look larger by extending curtaining either side. Faulty windows can be hidden. Ordinary short or highlight windows can have floor length drapes for a luxurious finish. If you have a `trendy' house, consider the type best suited to that particular style (e.g. frilly criss-cross for Cape-Cod or Colonial stylings.) A plain house can take any POWDERS type of window drape. INIff MIR NIB NS & TABLETS Bear in mind, curtains Square steel tubing frames finished in impact-proof enamel PRICE 12 CENTS Please have your representative call with a must look attractive to 1fu11 details of your Commercial Furniture. I Foam cushioning on heavy ply seats and backs the outside as well as the Backache, rheumatism, P.V.C. covers in a range of colours inside. lumbago — these and other A note on curtain lengths nerve and muscular pains can be most disI AVAILABLE FROM ALL FURNITURE STORESI NAME Curtains can reach the tressing. For swift, sure, soothing relief from I ADDRESS window sill, or to the nerve and muscular pains simply follow the Manufactured by: bottom of the apron beBEX directions. You can depend on BEX. low the window sill or to I JOYCE BROS (W.A.) PTY. LTD. the floor (in the latter BEX IS BETTER WINNERS OF THE EXPORT AWARD I P.0, BOX 395, FREMANTLE case one to one and a 32G half inches above the

HINTS TO HOMEMAKERS

CIRAZtrnm

_IA "HERBA-HEALTEAS

IAN for girt res

OMEGA

MEDO-PHARM Laboratories

Suddenly, a stab of pain-, and you're glad BEX is hand

Artbruni

C MERC 111111111011E

for PUBLIC BUILDINGS, OFFICES, SCHOOLS, HOTELS, ETC.

-EOLDLINE- COMMERCIAL FURNITURE

JOYCE BROS. (W.A.) PTY. LTD.


THE

Page Eight

Thursday, May 28, 1970

RECORD

MISS Y.C.W. TOPIC FOR DISCUSSION QUEST AGAIN

The Generation Gap -Is It Merely A Scapegoat?

THE COLONIAL MUTUAL FIRE INSURANCE COMPANY LIMITED CAN MEET YOUR REQUIREMENTS IN INSURANCE PROTECTION 1 33 ST. GEORGE'S TERRACE, PERTH M. VILES, Manager. Phone 21 6091

111111111111Uffill

ALWAYS INSIST on W.A. made

• HAMS--BACON • COOKED MEATS • SAUSAGES 6 CONTINENTAL SMALLGOODS

B "THE GREATEST NA. P.

111111U111U111M11111111R

IN SMALLGOODS"

C.G.A. SCHOOL PUPILS' INSURANCE A uthorised Insurers for Catholic School Pupils Benefits Payable in addition to H.B.F. YOU OBTAIN THE BEST EXCESS FREE COVER and A SSIST THE FUNDS OF THE SCHOOL and P. & F. FEDERATION Enquire at your School or Direct to—

C.G.A. Fire & Accident Insurance Co. 84 ST. GEORGE'S TERRACE, PERTH — 23 4481

NOONANS BAKERY "If it's NOONAN'S IT'S NICE"

FOR YOUR T.V. SNACK MAY WE SUGGEST OUR Toasting Slice RAISIN LOAF Phone 67 1044, 67 3330 DELIVERIES

TO

ALL

SUBURBS

( Moillook after yourproperty as wellas you would and take all11w worry away?

Traditionally the high point of the Y.C.W. social year is the Miss YCW quest and Jocist Ball. This year we may have trouble reaching the heights that were attained in 1969—this is not so important as ensuring that the quest is a success in the prime way it should be—that is By PROVACO. bringing the movement to young people. Last year, for the first time, To discuss the question of the rebell ion of saw some unfriendly youth it is necessary to get the basic facts in rivalries developing am- their right perspective. Is the failure of comongst branches over date- munication between adults and teenagers merely clashes, and poor attena scapegoat? We know that there is a lack of dances of some funccommunication in every walk of life. Racialism tions. Whilst the money raised from the quest is is an obvious example. Remember the Paris Peace of great importance to Talks! The Protestant versus Catholicism situation in Northern Ireland. Is this lack of comTwenty-one girls made their debute at the Y.C.W. Y.C.W. work it must not munication between parents and their children be regarded as being of recently. Debutante Ball Catholic paramount interest. brought about by the fact that parents can't cope Back row: Dianne Marten, Lynda Doogiebie, Dianne Christ said, "What does with adolescence and that children can't cope Butler, Alison Pritchett, Margaret Lyons, Susan Medica. it profit a man if he gain with growing up? Middle row: Marie Messer, Peggy Ryan, Veronica the whole world, but lose Many teenagers complain bitterly that nobody Dalgety, Deborah Andrijasevich, Marie Pusey, Nerida his immortal soul". If I understands them and that their parents don't Clifford, Helena Akkerveken, Margaret Smith, Patricia might paraphrase this, try. 'Why won't parents give reasons with their "What does it profit the Broughton. answers to our questions?' is another plea. This, YCW if it gains $6,000 Front row: Laraine Von Bergheim, Miriam O'Brien, I feel, is a good question and one that should be Virginia Sibley, Sharon O'Neill, Meredith Bretag, this year, but loses the considered carefully by every parent. The followinterest and support of Carmel Salas. ing letter is from a New Zealand student who its members." Let us keep in mind wrote it in reply to a man who attacked youth that whilst we wish to bitterly in a newspaper letter and signed himself: raise funds, and to find "A 35 year 'oldie'." The Legion of Mary a Miss YCW 1970, the "I have listened to people running down my will conduct a week-end primary aim of the YCW generation for being young since I could underretreat at the Franciscan Peter walked into the is always service to stand Engl ish and I have finally come to the stage Sisters' Retreat House, office. A young man others. You do not serve where I can no longer listen to these pompous, Victoria Park on June 6 about 21. He has been others if there is animos- self-righteous people congratulating themselves and 7. ity between you. The retreat will start living down in the city This year's Jocist Ball on their powers of condemnation. Mr. 35, it was since mid-February, and at 10.00 a.m. on Saturday will be held on Friday, you who called yourself an 'oldie'. Has it ever June 6, but anyone wish- working in a city store. September 25 at Govern- occurred to you that it is not your age that classes ing to could enter on At first, Peter seemed to ment House Ballroom, you as an 'oldie' but your attitude towards Friday evening, providing be just another happy with the Aristocrats have made some of my most valuable advance notice is given fellow — working, living doing the musical hon- others? I with people much older than 35, yet friendships in a flat, being part of to the Sisters for preparours. This year we also I have never thought of them as old. It is how this community. ation of meals. But, after spending have the prospect, for the you feel towards others that defines your age. There are a number of about two hours with first time of country I f you resent the power that we, as youth, know vacancies still to be entrants, both him, I realised he was quest filled ,and bookings may from the Bunbury and we have, that's your worry. be made through Mamie not really happy, but was Geraldton Dioceses. You have it fixed firmly in your mind that we C allaghan (office: one of the fast increasing Branches who have not a re all irresponsible and lost. We know different. section of the community 232055: home' 45 1657). we call the internal mig- already chosen entrants We grew up in a harsh world, a world that was will no doubt wish to do rant. to you but which we take for granted and A CRAZY NIGHT Peter's home is some so soon. Final date for new not believe it, but we look to you for may you receival of entry forms All young people are 250 miles away. He left is July 31. One stipula- leadership and so often we are no more satisfied invited along to a Crazy due to lack of employ- tion which has not been with you than you are with us. MisunderstandNight at the Lithuanian ment and opportunity for previously made — en- ings are often the result of haste or worry, but to further his Hall, corner Bennett and him trants must be YCW more often they are the result of a subconscious Wellington Streets, Perth studies. members who are work- desire not to understand. I can only say that He was a terribly loneon Sunday. May 31, at 8 ing, or taking technical tolerance is the best substitute for understandp.m. Admission 40 cents; ly fellow, missed his or tertiary education; ing." SIGNED: FED-UP STUDENT. friends. home, family and supper provided. He found it difficult to they must not be schoolA significant statement in that letter: "We look girls. There will prohustle and adapt to the R ANDOM NOTES to you for leadership' gives a key to the rebellion bustle of city life. He had bably be many queries in youth. They lack the security they should have of your minds—these are FROM GERALDTON no friends down here and early childhood and which can only be given best addressed to John, from Mrs. W. A. Shirley, sec- he found it hard to mix. at 77, myself or to one by wise parents who teach them disthem to retary at Stella Mans He was ready to give harsh, College, accompanied by up and go home. On his of the committee mem- cipline and respect for authority. Not the I'll bers — Marg Davidson, or say, I as do 'you demands that bullying her two daughters, Carol last trip home, he had Harris, Steve punish you' but a kind guidance. and Helen, have gone to been talking to his parish Marg England for a three- priest, and was told to Smith, Peter MartinoUnfortunately, many members of the older genThey see if the Y.C.W. could vich, Anne Donaldson, month holiday. constantly refer to the 'good old days eration and Doris Calleja. travelled by air and plan help in finding his acto their descriptions, they, in Finally, it according remains for when, to return home by ship. commodation in a private me to wish all branches their adolescent years, were almost perfect! But home. * * * and their entrants luck. t eenagers have always rebelled. In an account Well, Peter is now in Geoff Parkinson, Miss Monica Mazzuch- with a family and of family and school life in Sumer -2000 B.C.— is slowelli, eldest daughter of ly trying Chairman. boys were whipped for talking in class, for defyto adjust himMr. and Mrs. B. B. self to a new way of ing their fathers and on a tablet from ancient Mazzuchelli, of Yuna, was life. Sparta, and which is on show in an American married to Mr. Barry You might say, "Well, Museum, can be read the woes of a father who Dunlop, youngest son of how does this affect me?" could not control his son! Mr. and Mrs. R. C. DunFirstly, to the youth, the lop, Waiuku, Auckland, This article has dealt briefly with one aspect Y.C.W. leaders, we have New Zealand, on May 16 of the so-called generation gap and mainly a tremendous responsibat St. Francis Xavier's The Northern Districts ility to these people, to through the thoughts expressed by a disgruntled Cathedral. get to know them, involve Curia of the Legion of s tudent. Parents, too, have their problems, and Monica, who was tea- them in the various ser- Mary will hold its annual every member of the community faces the fear ching at Allendale school vices of the Y.C.W.— ceremony of members' of senseless vandalism, but this problem can be in Geraldton, went on social, sporting and help re-dedication to Our Lady Maybe if the 'generation gap' had never a holiday to New Zealand them to settle into this on Sunday, May 31, in solved. and over -emphasised by mass invented been St. Mary's Church, Franwhere she met Barry. new way of life. both generations would come closer to The young couple left The most important klin Street, Leederville, media nderstanding and appreciating each other. u Fremantle on May 18 in need at the moment is starting at 3 p.m. Guest speaker will be Fairsky for New Zealand homes. People willing to V ANDALISM—A SOLUTION. where they will reside. take in a boarder and the Rev. Fr. W. J. Foley, UNIVERSITY? A TRADE? A DROP-OUT? give them a 'home' life. and the proceedings will * * * conclude with BenedicIN SCHOOLS OR BY SEX EDUCATION. Married at St. Fran- Any person willing, could tion of the Most Blessed contact the Y.C.W. office P ARENTS? cis Xavier's Cathedral on Sarament. May 16 were Miss Kerry (23-4546) so we can then Afternoon tea will be MOTHERS AND DAUGHTERS. places available May Vaughan, eldest have served at 4.15 p.m. in St. when required. A LESSON IN HONESTY. EVERYONE TAKES daughter of Mrs. L. Mary's Parish Hall. —John Smith. THINGS HOME! Vaughan and the late Mr.

RETREAT

WHAT IS LONELINESS!

ANNUAL CONSECRATION

E. Vaughan, of Geraldton, and Mr. Robert YCW FOOTBALL WEEK AT The lightning football Smithson, eldest son of CARNAR VON Mr. and Mrs. R. Smith- carnival will get under way on Sunday, May 31 son, of Albany. Several YCW members Robert, who is a prin- at Clontarf Oval, Man- went to Carnarvon for ter, has been working in ning Road, at 11 a.m. the weekend to help the When letting your property, there are many several Teams are asked to be Carnarvon Marian Young Geraldton for costly pitfalls awaiting the unwary. People's Club celebrate years. He has taken up there by 10.45 a.m. its fifth birthday. Your worries are over from the start when left a job in Perth and he and People from Geraldton CLINIC his wife will make their to the expert know-how of General Agency's The Family Planning and Perth got together home in Wembley. Property Management Division. See them today! —RM. Clinic (Ovulation Meth- to wish the group many od) will hold its next happy returns and join clinic on Sunday, June 7, in the cabaret dance, genSANDGROPERS at 7.45 p.m. at St. John eral festivities and arFOUNDATION DANCE of God (Maternity Sec- ranged tours. Chairman R.E.I.W.A. (Property Management Division) 3 40 MURRAY STREET. PERTH. on May 31, 8 p.m. "The tion) Subiaco. All en- of the Youth Council, P HONE 23 3021, A/HRS. 86 6050 Aquarius", St. Joachim's quiries at 77 St. George's Dr. Maxwell Keys, OBE, Hall, Victoria Park. Ad- Terrace, Perth, Phone was invited to be present. R.M. 23-4546. did mission $1.00.

We do

THE GENERAL AGENCY CO.

TO LLD'S BRANDY S PECIAL

H OSPIT Al

-I-

MEMORIALS

G. C. SMITH & CO. 75 QUEEN VICTORIA STREET, FREMANTLE Specialising in Altars and Memorial Work. Erected anywhere in W.A. Church Altars planned & executed. Designs and Quotes without obligation. "We have over 60 years experience." Phone 5-1661


THE

Thursday, May 28, 1970

Page Nine

RECORD

NURSES GRADUATE

CONGRATULATIONS!

Stella Mans Club Members, Annette Victoria Bouche of Subiaco and William Robert R ussell of East Perth were married at St. Francis Church, East Perth by Father,,, J. J. Bianchini on April 25th.

General trainees from St. John of God Hospital, Subiaco, recently held their Graduation Ceremony.

• S. Kenward, Sr. M. Patrice, S tanding ( I. to. r.): Nurses L. Gatley, V. Joyce, Sr. M. Irene, Nurses M. Maslen, Nurse C. Foley. Nurses H. Kita, J. Brennan. Seated ( left to right): Nurse P. Desmond, Sr. M. Reynagh,

Mr. and Mrs. Robert John Knox after their marriage at St. Patrick's Cathedral, Bunbury, on Saturday, May 9. The bride, Linda Anne, is the daughter of Terry and Betty Pearson of 98 Beach Road. Bunbury, and the groom the son of Ron and Joan Knox of 4 Salvado Road, Wembley, formerly of Bunbury. Nuptial Mass was celebrated by Rev. Father P. Rooney. Feature of the Mass was t he reading of the First and Second Epistles by the fathers of the bride and groom. The couple will reside in Derby where the groom teaches at a local High School.

Holy Name Society Retreat

LITTLE BOY LOST

A cordial invitation is extended to all Holy Name Society members the from Cottesloe, Claremont. Mosman Park and Swanbourne parishes to attend a St. Mel's at retreat Church, 2 Fraser Street, Swanbourne, on Sunday. June 14. A Redemptorist priest will deliver the sermons. The retreat will commence by the 9.30 a.m. Mass and will conclude with Benediction of the Brennan Family from Maddington attended the graduation ceremony. ( Left to right): Cecilia, Gerald, Mr. Blessed Sacrament at and Mrs. G. Brennan, Margaret and Joan. 12.15 p.m. Morning tea will be This little chap has a millions in finding new served. of complete despair hope. look mother, her were among the subjects she also but he is just one of May is AUSTCARE now living in Wembley is taking. 19 million refugees who APPEAL MONTH, and She hopes to enter the Downs, and her sister DAWA TO MEET are stateless, homeless the people of Australia Teachers, Training Col- and brother-in-law, Mr. The Diabetic Associa- and hapless. This little are asked to show that and Mrs. B. Kelly, who lege next year. of Western Australia fellow in they indeed do care about be could from South tion Present at the Profes- travelled quarterly Nigeria, its will hold China, Indo Naramhuman fellow those sion Ceremony, and given Kumminin, near meeting at the Royal Africa, the Middle East beings less fortunate than occasion. the for been, honour of place special Two West Australians, both former pupils of a Perth Hospital Lecture or one of a dozen coun- themselves. (Wellington tries harboring millions Loreto convent, Nedlands, were finally professed Theatre Donations may be sent in the Pro-Cathedral of the Holy Trinity, New Street entrance) on June of refugees. 4, at 8 p.m. Austcare (Australians to AUSTCARE, P.O. Box Norcia, on Trinity Sunday. DAWA officials hope to Care for Refugees), due 184 West Perth, 6005. or The Lord Abbot, Right She is also one of a a special film, "If to the generosity of the by calling at the AUSTscreen R everend Gregory staff of five engaged in To Be A Cam- Australian people, are CARE Office, "Kingsley", Want You Gomez, 0.S.B., presided. Adult Native Education Terrace. Adelaide will be sent doing their part in help- 237 which per", Sister Michael Allen, classes at New Norcia. ing these unfortunate Perth. America. from eldest daughter of Mrs. Accorded a special • Executive meeting, large as previous years, Olga Allen and the late place of honour at the Mr. W. Allen, gained her ceremony her All Saints Centre, 10 a.m. there was still a good rewere Leaving Certificate at mother and two younger Wednesday, June 3. Gen- presentation. Loreto, the sisters, Katherine and eral meeting commences attended Father Walsh celebratClaremont Primary Tea- Jane Allen, all of Dal- at 1 p.m. ed, with Father Ford • Leederville branch chers' Training College keith. reading the Lessons. The and was the first teacher will meet at the Presbysermon was preached by Gould, Damian Sister appointed by the Educatery, 8 p.m. on Thursday, Father Costello 0.P. Rev. of June 4. The fortnightly tion Department to teach youngest daughter a great insight at the Benedictine Mis- Mrs. G. Gould, and the card party at St. Mary's and gave workings of the the nto i Gould, B. J. Mr. late sion at Kalumburu. Hall will be held on Wed. Every phase of It was here that Sister worked as a typist clerk nesday, June 3, at 8 p.m. League our work was touched Michael saw the work of after her schooling at • South Perth memmust have the Benedictine Mission- Loreto. For 11 years she bers meet in the Parish on, and it enlightening very been ary Sisters and decided studied ballet and was an Hall after Novena De- to many of the congreon Thursday, to join them and devote active member of the votions how gation to hear her life to the Austra- Theatre Guild Dramatic June 4. lian aboriginal apostol- Society of Perth. • Serving of teas after much is carried out by ate. Since entering the con- daily mid-day Mass will the members of C.W.L. A keen basketballer vent at New Norcia, she commence on Tuesday, and tennis player, she has obtained her Leaving June 2. The Applecross The honour of conveying finds her interests a great Certificate and is this branch has been roster- the Gifts to the Altar, for this week. Point. of contact was given to our State with the year attending the Holy ed aboriginal children whom Spirit Sister Formation Although the number President and Secretary, She also teaches in the Institute in Perth. of members attending the primary school at New philosophy annual Mass and Holy Mrs. C. Downey and Mrs. Theology, Norcia. are Communion was not as M. Pollett. psychology and

Two Make Final Profession

Catholic Women's League

You can always rely on


Page Ter;

THE

RECORD

P OLITICAL FORUM "The Record" has made space available to the leaders of the major political Parties to state their views on matters of State importance. These views and policies are the responsibility of the various writers and do not reflect the views or opinions of "The Record."

Australian Labor Party

Liberal Party

The Country Party

Democratic Labor Party

Thursday, May 28, 197Q

KATYN FOREST MASSACRE 30 YEARS IN RETROSPECT By Deam W. Given and Denis Dirscherl, S.J. "The latest German attempt to sow discord between the Allies is a story of the alleged finding of graves of 10,000 Polish officers in a forest near Smolensk. In broadcast accounts, the Germans suggest that these officers, taken prisoner during the invasion of Poland in the winter of 1939-40, had been shot ( by the Russians) in the spring of 1 940." ( N.Y. Times, April 16, 1943).

by the Minister of Industrial Development, by Hon. C. W. COURT, By Senator The Hon. T. by JOHN R. MARTYR. Mr. J. T. TONKIN 0.B.E., M.L.A. Thirty years ago, that list of the missing men. bolster their C. DRAKE-BROCKMAN, conten. State Secretar y small news item was Stalin replied that the tions; instead they in. The leader of the Oppo- D EC., Recent activities which Minister For Air. carried on page four, men had been released plied the contrary. Amer. are to be further devel- sition could hardly have Selectively indignant followed directly by a and had perhaps fled all lean Among the chief planks correspondents ca oped by the holding of a avoided reference to the hearts, singing Cairnsian brief and emphatic de- the way to Manchuria. hand agreed it was a public meeting and which State Government's ach- in the Labor Party's plat- canticles to the Viet Cong The German announce staged affair. nial from Moscow. have arisen out of the ievements in the Great form for the Victorian demand peace at any Over the next five men in 1943 confirmed In 1951, after almost a loan interest rise of up to Southern, when he open- elections is the eventual price in Vietnam . years, Americans heard what the Poles had sus- decade of relative silence 11 per cent, are indica- ed the Labour Party's by- abolition of State Aid for Many thousands will nothing more of the pected and feared. Des- on the Katyn massacre, private schools. election tive of the fact that at campaign. face violent death, and German accusations. pite the consequences, the United States Con. This policy declaration the Eleven years of sure, last many people are apdomino theory will After all, there were the Polish Government gress decided to act. A preciating the seriousness constructive, progress is must emerge as a sober- be proven as small enough problem s ing at requested an interna- special non-partisan con. thought a for difficult any vot- nations fall of the situation which record to sideto commun- home. President Roose- tional investigation. Stal- mittee sought the has resulted from re- step and it is to Mr. Ton- ers who may feel dis- ism with no fighting at velt was intent on keep- in flew into a rage and about the Katyn !ruth cent measures of the kin's credit that he didn't enchantment with the all, if allied Forest troops are ing peace within the severed diplomatic rela- massacre. Federal Government or Commonwealth Govern- attempt to do so. withdrawn precipitately Allied camp while tions, charging the Poles One wagyear, and hundreds The Government's re- their own State Liberal from ment's monetary policy. South Vietnam. ing war against Hitler with harbouring "pro- of witnesses later, the On the fourteenth of cently announced decis- or Liberal-Country Party Those prolonging the The public, therefore, Hitlerite elements" and committee this month in this col- ion to go ahead with the coalition governments. overwhelmwar by demonstrations readily accepte d Mos- collaborating with the ingly concluded that the The Victorian Labor umn I drew attention to port access road has against allied commit- cow's claim Nazis. With this action. Soviet NKVD committe that the acthe probable effect naturally attracted wide Party's announced inten- ment, without also petit- cusations were merely Stalin laid the ground- the mass murders of d tion came as a radical which the increased attention. the ioning Hanoi, and those another Nazi propaga nda work for his puppet gov- Polish officers and inNot so well known, is new policy of the Party's ma rates would have on the rching behind Viet ernment in Poland. t rick. tellectual leaders. housing position in West- the relationship of this executive.

Cong flags, can hardly An investigating com- It The German charge also noted the project as an extension ern Australia. On top of this now cry "charity" if their was comprising "strange psychosis" of propaganda, but not mittee, One needs to go back of the major road build- comes the news last views are attacked. a trick. The mass graves Europe's most .renowned the forties when "militto the period prior to the ing programme that has weekend that the W.A. Australia's capital cities found in the Katyn For- medical specialists, ary necessity required last Federal election to been underway in the State Labor Executiv were e virtually occupied est by advancing German found eight mass graves the sacrifice of find an explanation for Albany district since this will tell rank and loyal file on Moratorium day. Traf- troops contained the filled with 4,100 bodies- - allies and our own printhe action taken by the Government took office members to support ab- fic was completely dis- corpses of 4,183 Polish in some places 12 layers ciples in order to keep Commonwealth Govern- in 1959. A programme ortion and law reform. rupted for long periods. officers. Subsequent in- thick. Some were punc- Soviet Russia ment. from makthat has so far cost more In both the Victorian The police did not really vestigations proved that tured with bayonet ing a separate peace with It was said at the than $18 million. keep and order— Western the morator- the men had been tied wounds. The hands of the Nazis." Australian time that certain strains It is much the same ium marshals did. What up, shot in the back of many were tied behind Today, in Pole . the evident in the economy story when we come to announcements the critical factor is that the de- happens next time, if the the head by Soviet their backs and all had Katyn massacre is a 'of Australia suggested the unspectacular—but mars hals cision are has been made by instructed NKVD (security police) been shot through the hushed-up story. the need for remedial for Albany people, vitally Any otherwise? agents, and pushed into back of the head by small who have dared - o ask action. important—development the Executive. revolvers. huge pits. for the truth have been It seemed that the of water supplies and In other words, the Among CAMBODIA the victims imprisoned. But the supWhile the fact of the private and public feelthen-Treasurer, Mr. Mc- sewerage. Typical reactions war crime has been were doctors, professors, reme sacrifice that their Mahon intended framing Some $1.4 million of ings of individual mema budget which would im- loan funds have been bers and the thousands against allied entry into clearly established, the journalists, and a priest. fathers and brothers paid pose the required checks spent to meet the town's of electors they repre- Cambodia neglect the crime itself has never The committee — citing at Katyn remains in growth of memories. The Katyn on the economy. requirements, sent may have been essential fact that there been officially resolved autopsies, How- w ater consequently is a vast handing-over of and re- newly-planted trees over Massacre still stands for ever, apparently he was which have doubled since ignored. the graves, and other the courage and deteroverridden to the mains unpunished. by Prime 1959. This is a highly dis- responsibility Vietnamese Minister Gorton whose Sewerage facilities have turbing situation on such South in If, indeed, the Russians evidence—concluded that mination of the Polish their battle for liberty. did perform it, why did the Soviet Union was people to become free attitude was being in- been continuously exten- important and controve r- It was essential to pro- Stalin order the murd- guilty. once more. fluenced by the proximity ded at a cost of £100,000 sial issues as State Aid A few months later. ens? Poland was not at of the election. annually. for independent schools tect this operation from 111'11111t1111111111111111IVI 1 1 1 1 gum attacks originating in war with Russia: her when the Red Army reHad the necessary and legalised abortion. New Projects Cambodia from 60,000 only desire was to defeat captured the Katyn Forsteps been taken at the Although more than $9 In the case of changing communist troops with Hitler and restore peace. est area, the Soviet Union time it is probable that the action being taken million of public money the laws regarding abor- vast supply dumps and But those men were conducted its own invesnow with such disastrous has been spent, supply- tion, here is a situation headquarters a few miles Poland's future, or as a tigation. In a document "The Truth former Polish diplomat entitled, effects might have been ing electricity to the that should never be- over the border. whole of the Great Sou- come a Party Executive Cambodia is anxious put it, they were "the about Katyn," it contenaverted. thern from Brookton to situation. It must surely for the communists to be flower of the Polish in- ded that the Poles had Dearer Homes be one of free choice driven out, and has been captured by the Albany —work has alasked telligentsia." It has been pointed out ready started Looking beyond the Germans and murdered on a major. where individual politic- for help. If Cambodia that the average home new, power transmission ians — mirroring the raises the army, to with- war, Stalin was already in the late summer of builder borrowing $9,000 line from Kojonup to views of their constitu- stand vigorous commun- casting covetous eyes on 1941. over 25 years will have Albany, But the Soviets never to up with ents—should vote on a ist aggression and sub- Polish territory. He knew to pay more than $1,000 the recentlylink version, it will deserve that those men, with explained why the men constructed non-Party basis. extra for his home uneer Muja to Kojonup line. The Victorian Labor help from other free their strong anti-commu- were buried in winter CHEMIST t he ruling rates. Money for housing is Executive's announce- Asian nations, including nist beliefs, would have overcoats at a time when temperatures Wembley - 87 3984 It seems that the home always subject to influ- ment has far deeper and Australia. been formidable obstac- seasonal building societies now ences outside the direct sinister implications. les to his plans. Stalin averaged 65-75 degrees. ABORTION operate somewhat simil- control of State Governused the All the other Russian 274 Cambridge St. An overwhelming maj- apparently arly to banks—they bor- ment. But as far as funds It comes at a time ority Forest Katyn massacr e claims clearly failed to in the Legislative row money at short call have allowed, the State when the Federal Liberal- Assem as his first step to an bly ignored the and lend it out at long building programme in Country Party Coalition editoria l demands from nihilate the free Polish W. W. EDMONDSON & SONS and the Federal Opposit erms. nation. Albany has been main- tion are in agreement on W.A.'s largest newspaper, PLUMBERS and SHEET METAL WORKERS Until recent years tb tained at full pressure. the vital needs for State and are probably laughPoland's fate had acCertified West Australia, Hot Water Specia --,--, and Nothing is quite so im- Aid accepted pattern of a ing at its frustrated tually been sealed in to private schools. General Plumbing. All Work Guarante.,building society was for portant to Albany as the trumpeting. The A.L.R.A. August 1939 when GerApart from defining Phones: 28 8714. After H-.--Jrs: 87 2553, 49 2095 long term commitments retention of it's wool subsided with a notice- many and the Soviet by investing members, trade, and as a Govern- sharply that Labor think- able hiss about "select Union agreed to carve 80 JAMES STREET, PERTH plus short term deposits ment. we will not rest ing in the States is often committees", something her up for their own. As based on a ratio of de- until the future of Albany far divorced from that that never occurred to Hitler's army invaded as a wool port has been of the Federal Executive, them when posits to share capital. they were from the west, the Red the Victorian announceconfident •`' The present deplorable satisfactorily resolved. of victory. Army advanced from the ment poses the threat of With this in mind we A.L.R.A. will respirate east. A determined resituation has emphasised what could happen if a with free publicity wind sistance was not enough. OPTOMETRISTS and OPTICIANS the need for government agreed to spend a further radical Labor movement when the next attempt is and Poland soon fell. In intervention to protect S200,000—on top of the came to power. CORNEAL LENS CONSULTANTS made to introduce this the eastern half, Soviet persons buying their own S1.100,000 currently com16 Plaza Arcade, Perth — 21-5344 mitted to Nos. 1 and 3 The threat is there, and degenerate legislation. secret police arrested homes on borrowed berths—on further ex- it is something that every citizens of Most Parliamentarians thousands money. tensions to take the roll- voter should take heed knew that it was outside while the Red Army Already there has been on, roll-off ships we con- of in his or her selection their role to deliberately rounded up the defeated a departure from the fidently expect to be call- of which Party should condemn innocent Polish soldiers and degeneral rate structures to ing at Albany by 1972. govern this country. human life to death at ported them across the provide special help in These are just a few of The Country Party has any stage of its existence. Soviet border. particular areas and pro- the major development Mr. R. Claughton MLC fought hard for the imApproximately 10,000 vision has been made for projects essential to plementation of State Aid ( ALP), also smarting Polish officers were asselective exemption of Albany's future, by nat- because it recognises the from defeat, has called signed to special concenrural borrowers. This ure long-term and in valuable contribution it for dubious reinforce- tration camps south of is very laudable and the most cases well under- is making to the educa- ments. Octogenarian Dr. Moscow. Almost 6,000 idea should be extended way, that Mr. Tonkin tion system of this Hislop could not achieve other soldiers and civilto relieve the hardship chooses to unfairly des- country. political immortality on ians were put in another of home buyers of whom cribe as timely vote An aeroplane to charter? a bulldozer tc hire? I, and my colleagues, abortion: septuagenarian camp in the north. Only there are many thous- catchers. Joe Chambe rlain— with 400 or so survived. Over a site excavated? or a road made . . . then ands in Australia whose We believe the voters will fight just as hard to sufficient claim to re- 4,100 were discovered in expose and thwart any budgeting leaves little or of Albany will contact HOULAHANS SERVICES. They have the cast their moves by Labor reaction- memberance because of the Katyn Forest graves. no margin from which vote on June 6 in the light "know-how' to perform such tasks . . and Split—now The others were never aries to do away with the Great to meet payments involv- of the Brand Governwants a further split in found. this system. so they should, they've been in the business ed in the increased in- ment's good and solid the ALP on abortion, on terest rates. Before the German disperformance listed above since 1927. Remember, what could purely sectarian lines. covery, Polish and Allied It is monstrous that a and not be misled by at- happen in Victoria, could The problem that keeps officials had made restruggling section of the tempts to detract from occur here. the ALP from office in peated demands to the `community should be the facts. In a Party system such Victoria—absolute domiKremlin to know the obliged to carry the main Albany has everything as that exercised by the nation of Parliamentar- whereabouts of the misburden resulting from to gain from a Liberal A T. where the wishes ians by a State Execu- sing men. SERVICES The Russians the failure of the Com- Party Member elected to of members can be over- tive not subject to the continually disavowed monwealth Government support and help the ridden by the Executive, people—looks like com- any knowledge COCKBURN ROAD, SOUTH FREMANTLE. of their to take timely action to State Government further it only needs a handful ing to W.A. if Mr. Cham- fate. The Polish ambasPhone 5 4488. keep the economy in the State and Albany'! of radicals to turn back berlain imposes his will sador even met with c.tieck. / progress. t?- r,‘ lock of achievernen'.. r;r7. the State Conference Stalin and presented a

Phil Keogh

DANNELL & GOLLOP

NEED A LOAD OF SAND OR A MOUNTAIN MOVED!

HOULAHANS


THE

Thursday, May 28, 1970

Page Eleven

RECORD

EXHIBITION SUCCESSFUL • •

•

Ns

..s&

V. „:„.\ N

.‘„

and Keen interest was England, Ireland shown in the W.A. Catho- other countries. There was also a speclic Historical Society's fortnight long exhibition ial section on New Norcia, which proved rather at the ANZ Bank. The exhibition, which interesting. The lay-out of exhibits ended last Friday, attracted a great deal of people, was commendable. There even those only remotely was no overcrowding, of interested in the State's material.. Howe-er, the organishistory. It featured many inter- ers would have done well esting items dealing with to have paid more attenthe early days of the tion to the artistic preChurch in WA. And these sentation of the exhibits. But t en, it was meant included documents, photographs and illustra- to be an exhibition of documents. historical tions. The spotlight was on And, to that end, the orthe coming of the mis- ganisers can claim great sionaries—from France, success.

C ATHOLIC SOCIAL CLUB

p.m. Friday evenings 8-? and all day Sundays. Facilities at the clubrooms include billiards, T.V. Room, chess, reading room, etc. Admission Squash, each Friday is 20c including coffee. evening at the Oxford All members and newSquash Academy, Oxford comers welcomed. Street, commencing 8 Those interested can p.m.-11 p.m., followed by ring Nally Margaret coffee at the clubhouse. (61-5730) after five. Transport from No. 1 William Street, 7.45 p.m. NORTHAMPTON Sunday, M ay 31. Tournament Day at the ClubIDENTITY house, 358 Oxford Street, PASSES ON Leederville. Competitions in billiards, table tennis, Mrs. Sarah Ellen Wiland liams died in St. Katherchess draughts, darts. Fee for entry in ine's Nursing Home in each field 10c. Commen- Nedlands on May 12. Starters ces at 2 p.m. She came from Ireland and spectators welcom- with her parents when ed. only a small child, and Monday, June 1, Bel- arrived in Northampton week. mont. Members meet in 1914. Here she met Some of the A.N.Z. Bank's clients having a lei,urely look at the exhibits last outside the main gates at and married her late hus12.30 to enjoy an after- band while in the emnoon's racing. ploy of Mrs. M. Williams. 6. She was a staunch memJune Saturday, N. Theatre Cabaret at the ber of the RSL Women's Cottesloe Tennis Club, Auxiliary and a devout Napier Street, commenc- Catholic. ing 8 p.m. A film has been Nine daughters survive arranged followed by a Mrs. Williams. They are Cabaret to Purvisonic Mesdames Marjorie PorSound. Transport from ter (Kalamunda), Iris (Doubleview), No. 1 William Street at James 7.30. Girls a plate please 'Mary Mitchell (Northampton), Freda Reynolds and guys the drinks. Friday, June 12. Star of ( Northampton), Maude (Claremont), the Sea Ball. Anyone in- Bowen terested in joining the Joan Hogg (Mt. Yokine), club party for the ball Myrtle Reynolds (Northplease contact Leomie ampton). Wanda Dean Ryan (3-3012) for tickets. ( Tuart Hill) and Cecily Price is $6 a double, sup- Williams (Northampton). There are 41 grandper included. Dress optional. Venue Mosman children, 51 great-grandchildren and one greatReception Centre. 13. great-grandchild. June I Saturday, A sister of the late Mrs. I Catholic Cabaret No. 4. Meagher Williams resides in Perth Thomas , Sir Pavilion, Perry Lakes another in New Zealand in brother Stadium, from 8-1 a.m. and her From left: Columba', Fathers Colin McLean, Dominic ; Watch for further de- Perth. She was predeceased by her husband, Nolan and Mich Schell of Victoria, popped into the !tails later. is Darcy Williams, and her This Clubhouse: A .N.Z. Bank building to have a look at the WA. C atholic Society's Exhibition when they stopped over in , open Tuesday and Thurs- only son Kevin. Some people milling around an exhibit during the historical exhibition. day evenings from 8-11 Perth en route to the Philippines. ,

1

i

IMMIX ALUMINIUM WINDOWS AND SLIDING DOORS GIVE YOU AN OPEN HOUSE Bring your home out into the open. Fit Bristile A luminium Windows and Sliding Doors and you can adjust your living to your mood and the weather. They slide open silently on nylon rollers and lock securely; never need maintenance —no tedious Painting. Put time saved on maintenance into more enjoyable pursuits. Get the right windows for your house —get the size you want and the style—we have them all.

For illustrated literature, contact— H. L. Brisbane and Wunderlich Ltd., Aluminium Window Divn., Scarborough Beach Road, Osborne Park. Tel, 24 4931 Bunbury Branch: 42 Spencer St. Tel. 3251


Page Twelve

THE

RECORD

Thursday, May 28, 1970

sonal appearances with an air of indifference. All hail the pop star! * * * One young man who is STW 9: Sunday, May 31—Current Affairs. by possibly given less credit 10.00 p.m.: Here, Now. With Ken Burslem than he is entitled to, is JOHN and Ray Sinclair. STW 9's Clive Robertson. BRYANT ABC-TV: Sunday, May 31—Religion. His informal preview of 9.25: The Sermon On The Mount. The Christian's the evening's line-up after the news is not only Life. With Professor Wi l liam Barclay. building up a fine repuMonday, June 1—Documentary. tation, but is a novel 8.55: Civilisation. The Light of Experience. break from the normal 'Al l the greatest exponents of civilisation, from programme highlight Dante to Goethe, have been obsessed by light-presentation we are used perhaps one could take it as the supreme symbol to. of civilisation. But in the seventeenth century A "first" for Channel light passed through a crucial stage. The invenPop music enthusiasts had a feast last Wednes- nine. tion of the lens was giving it a new range and * day night with Channel Seven's special, "The Raym*ond * power. Vermeer used the utmost ingenuity to Chandler cremake us feel the movement of light. He loved to ator of the famous detecNovell° Awards." tive, Philip Marlowe, is show it passing over a white wall, and then, as if The awards are pre- including the Beatles, the subject of a dramatto make its progress more comprehensible, passsented to artists, song Peter Sarstedt, Dusty ised autobiography to be ing over a slightly crinkled map. And yet the writers and composers Springfield, Sandie Shaw, seen on ABC-TV at 8.25 scientific approach to experience ends in poetry who have attained merit Blue Mink, and 1970 p.m. on Tuesday , June 2. and I suppose that this is due to an almost mystiin a field of commercial Eurovision Award win"Down These Mean cal rapture in the perception of light — Words music. ner, Dana. Streets A Man Must Go" of Sir Kenneth Clark. The programme was starring Tom Daly, EdSome of the biggest TVW 7: Monday, June 1—Current Affairs. „names in the British taped at London's "Talk ward Judd. Sue Lloyd, 9.20: Close-Up. Will Marriage Survive? A panel scene were featured in Of The Town" restaurant. and Lilian Brosnan, is an Britain's top orchestra authentic self-portrait. discussion on trends in the marital state. the 90-minute programme leader, Les Read, was It was filmed in Los the show's musical direc- Angeles and in ChandFILM REVIEW By John Bryant. tor. ler's own house at La Orchestral reproduction Jolla. was perfect; how much Many of the excerpts PORTRAIT A ttractive 23-year-old Jenny May Clernesha is local variety show are protaken from The Long CORSET SALON ducers have learnt! Goodbye, which is re- Nine's latest acquisition to its ranks of on-camera Fashion Corsets The artists performed garded by many as his personalities. Jenny, who is not altogether a newcomer to Ladies' Surgical C.7 live—no one mimed. best work. Take an old man with Comedy lasts through. Chandler was born in television, will be remembered as Their perform ance, back'the weekend Exclusive Lingerie ed by the Read orchestra, Chicago, and educated in weather girl' for the channel . She now comes to a love for nature, give out the film. Most of it is gold, a partner, and attributable to the simple and Hosiery were so , :iose to the re- England. the viewers as a full-time personality as hostess of him a woman, add music by character of Ben Rum. He published his first the corded material, the difRoom 202, 2nd Floor revamped Channel Niners Club, and is already Frederick Loewe and son and novel, The Big Sleep, in his disdain for ference was negligible. Levinson Building proving extremely popular with the mini viewers. Andre Previn, and you the normitie 1939. This s of life. and subsequ ent 713 Hay St., The Beatles were listed works Prior to coming to Channel 9 on a full-time have the year's best musisold well, and he Perth. to appear. So they did, becam Rumson and Pardner e a screen writer basis, Jenny worked with a large city department cal comedy—"Paint Your on a pre-filmed piece in- in find gold, stake their store for four years as fashion compere and an- Wagon." Hollywood. serted appropriately into Some of Hollywood's claim, and begin mining. He did not like Holly- nouncer for their public address service, and prethe programme. None of wood, talented people No Name City soon deand retired to La viously with a leading model academy. She spent most them bothered to turn up Jolla, California, with his her school days at Bentley Primary School and have combined to present velops on their doorstep. this new full-length featto take the award. Jean Seberg becomes wife Cissy, 19 years his Perth Girls High School. ure based Instead, they sent a senior. on the his 1951 legal wife after he Although television keeps her fully occupied Broadw ay play. messenger-boy! bids successfully for her Characters in his novels most of the day preparing for the evening's proLee Marvin takes the in an auction. Chandler's grammes, Jenny's Tom Jones was also became main interests in her spare leading role as Ben Rumlisted to appear in the mouthpieces for his dis- time are gardenin Contempory arrangeg, cooking, reading and is a son, a man greedy illusionment with life. show. He did not. for ments uplift the musical keen physica l fitness fan, and does not miss a the niceties of life in an numbers ( thirteen of Amonv his admirers The orchestra perform- were Somerset Maug- clay of doing her exercises before arriving at the innocent sort of way. them) to popularise them ed a medley of his num- ham, W. H. Auden, and studio. MONUMENTAL bers instead. Although the script is for a general audience. Jenny, who is married, lives at Gosnells with J. B. Priestley, who pays SPECIALISTS Humper- tribute to him in this her husband, Robert, and Englebert their two-and-a-halfdinck did not appear programme. year-old son, Grant. 4183 Great Eastern either, although, like* * * H'way, Redcliffe wise, he was meant to. "LE MANS" It seems that the "in" Phone 65 3157 TELEVISED thing to do nowadays, if A fter Hours 67 3815 you are a British pop Channel Seven will star, is to shrug off per- again sponsor the annual 6WF: Sunday, May 31—Religion/Current Affairs. 4.4 , 0~~4 ,41414,1,411.4.4.11 #4 ,414,41,1` W.A. car classic, the "Six- 8.00 a.m.: Encounter. Drugs and Organised Religion. The place of L.S.D., narcotics and mariHour Le Mans", this juana, alcohol, nicotine and sleeping pills in year. forming habits of dependence is considered in The event will be held on Monday, June 1, at this discussion between two American experts O PTOMETRI STS the Wanneroo Park Cirand three Australian students. Dr. Stanley 172a Scarborough Beach Road. Phone 24 3543 cuit. Einstein is executive Director for the Institute 230 Hannan Street, Kalgoorlie. Phone K. 795 Forty-two cars have enfor the Study of Drug Addiction, New York. Dr. R. F. WILLIS, W.A.O.A., Optometrist tered the race which is Joel Fort is a social psychiatrist attached to the organised by the W.A. Public Health Department at San Francisco. Sporting Car Club. Issues raised include: Is anything gained by Drivers include Ted Yip Clint Eastwood ( left ) and Lee Marvin in restricting some drugs and not others? Has and Doctor Henry Le "Paint Your Wagon." organised religion worthw a hile from part to play in Hong Kong, who FESTIVAL the drug scene? Can drugs help in apprehend- a break from will drive a Porshe 911S. of the Camerawork with and Eastern States chaming the Divine? The discussion is chaired by he-man type those OF he is used songs is notable, and pion Bob Holden, driving the Rev. Ted Noffs. to, Marvin is authentic helps to cement the lathis twin cam Ford Third network (regionals) —Religion. BR I TA I NS and superb in his role as ter's acceptability. Escort. 9.45 p.m.: The Epilogue. The Choir of the Church a real salt of the earth. It is easy to see that Local drivers include FINEST He is well supported "Paint Your Wagon" was of the Jesuit Fathers, Farm-street. Don O'Sullivan, Howey by Jean Seberg and Clint a Broadway hit. The film 6WN: Sunday, May 31—Religion. Sangster, Stan Starcevich FILMS 11.00 a.m.: Divine Service. A service from Saint Eastwood. has carried a few of the and Peter Briggs. James' Catholic Church, Coorparoo, Brisbane. "Paint Your Wagon" is stage's hall-marks onto Channel Seven will proed of success. It is the screen. The preacher will be Rev. Thomas Hunt, and assur vide a direct telecast of produced by Alan Jay It should be a long seathe celebrant, Father Philip Kehoe. the race at the following Lerner, who also wrote son for "Paint Your times: 9.50 a.m.-11 a.m., Tuesday, June 2—Religion. the screenplay, and lyrics Wagon" in Perth. It is PRESTON ST., COMO noon-1 p.m., 2 p.m.-4.20 10.15 a.m.: Daily Devotional. Father K. Bayada of and directed by Joshua showing at the Theatre p.m. Sydney. Today: 430, 800. — Sat,: 130, 8 00. Logan. Royal.

LOOK

The Novell° Awards

The Elsie Kelly

Talent Assures Success

PERTH MONUMENTAL WORKS

LISTEN

WILLIS and ELLIOTT

CYGNET CINEMA

Patrons Please Note—Concession prices are now available for scl,00ls and party groups. Please contact Mrs. Jardin on 67 1663 or book at PLAYHOUSE — 23 0100

N OW

RSBARAWAWARAWAPAMASSS

W.R. (Ballet Company

SHOWING

L AURENCE OLIVIER R ALPH RICHARDSON

Richard III ( G)

A PERSONAL INVITATION

enclose Cheque/P.O. to the vaiue of $ PLEASE USE BLOCK LETTERS NAME ADDRESS

TO SAVE SI 10 BY OBTAINING NOW YOUR 2 TICKETS FOR A DOUBLE WEEK OF BALLET

PLAYHOUSE THEATRE June 15th-20th-22nd-27th

Aolin

THURSDAY 11th JUNE A Totally New Hamlet NICOL WILLIAMSON TONY RICHARDSON As Hamlet MARIANNE FAITHFUL As Ophella (G) COLOR

POSTCODE TEL Please make cheques payable to— "West Australian Ballet Co." INDICATE PREFERENCE OF PERFORMANCE WITH '1' BUT MARK '2' & '3' TO INDICATE ALTERNA TE BOOKINGS FOR EACH WEEK IF YOUR FIRST SELECTION FOR EACH WEEK IS NOT AVAILABLE. CHANGE OF BALLETS EACH WEEK

‘:

WITH

.Euis 011oreno

rn

Patricia &IL - .eaurence Guest Artist

'HAMLET'

SOLOISTS Dianne Taylor • Ken Whitmore - Eleanor Martin CORPS de BALLET

ADULTS: Single for any one week $2.80 CHILDREN: Single for any one week $1.50

THURSDAY 18th JUNE

IF • • •

PLAYHOUSE THEATRE 1st Week — June 15th - 20th 2nd Week — June 22nd - 27th

RESENTS

" OTHELLO"

Malcolm

'

i ReX iRed

THURSDAY 4th JUNE LAURENCE Maggie Smith OLIVIER Best Actress 1970.

McDowell

WEST AUSTRALIAN BALLET COMPANY Cl- PLAYHOUSE BOX OFFICE 3 PIER STREET, PERTH 6000 TELEPHONE 21 5681 P lease send Seaspn Tickets which consists of one ticket for each week

UNDER THE DIRECTION OF

COLOR

If . . . . your school rebelled which side would you be on?

SEND TO:

tN.N.11

Take advantage of this wonderful offer Book now and don't be disappointed SUPPORT YOUR OWN "STATE" BALLET COMPANY NORMAL PRICE $5.60 YOURS FOR ONLY $4.50

.M AMMV4VAMVAMM*MWIA004-WigKVA

i

PLAYHOUSE THEATRE SEASON FIRST WEEK SECOND WEEK Mon. 15th June at 8 p.m. Mon. 22nd June at 8 p.m. Tues. 16th June at 8 p.m. Tues. 23rd June at 8 p.m. Wed. 17th June at 8 p.m. Wed. 24th June at 8 p.m. Thur. 18th June at 8 p.m. Thur. 25th June at 8 p.m. Fri. 19th June at 8 p.m. Fri. 26th June at 8 p.m. Sat 20th June at 2 p.m. Sat. 27th June at 2 p.m. Sat. 20th June at 8 p.m. Sat. 27th June at 8 p —


Thursday, May 28, 1970

THE

Page Thirteen

RECORD

Birthdays

Children's World

* SUNDAY

New Members'

MAY 31 Terese Moriarty, Floreat Park (12); Andrew Maureen O'Donoghue Barker, Applecross (10); (10), 94 Stanley St., NedDamian Caddell, E. Fre- lands. Loreto Convent. mantle (10); Graeme Swimming and sewing. Geoffrey Louis Hegney Gower, Broome (11); written been have Rory Tanham, (5), 99 Sydenham Rd., Scarwords any M borough (7); Mark Ash- Doubleview. Kindergarunderstanding about spoken a nd man, Dianella (13); Tony ten. Playing cowboys and Swanbourne kindy. c hi ldren. It would do none of you O'Brien, Bernadette Archer (6), (13); Bernadette Stack, a ny harm to sometimes try to under- Mt. 136 Scarborough Beach Lawley (12). parents! s tand your Rd., Scarborough. St. John's. Collecting picSo let's talk about parents. In * MONDAY a tures. for shoes their JUNE 1 into hop let's act, f Gregory Daniel Redmond Archer Knuckey, Mt. l ittle while and see how they feel, Pleasant (12); Julie Swet- (4), 136 Scarborough especially about us—their children. man, Belmont (7); David Beach Rd., Scarborough. Zadel (5), As chi ldren, we are inclined to see Sharrett, Karrinyup (11); 354Christopher / Karrinyup Rd., KarPaul Brophy, S. Perth authority, in people as parents our of Good Lady rinyup. Our (11); Mark Probert, Karas rulers whom we daren't disobey! rinyup (10); Kerry Hal- Council. Football and dane, Collie (10); Kath- baseball. W e are apt to think of them as sure leen Hilary LindA Murphy Croy, Innaloo (14); of protectors ( Banksia littoralis) as of themselves, and Mark Malone, Riverton (10), 268 Robinson Ave., often (13); Colleen Crogan, Cloverdale. Notre Dame us and our well-being. We (7); Felicia Convent. Dancing. they Nungarin them as if of things emand d Colin Harken (8), 90 Rutherford, Bentley (11). w ere our right, and are often unaware Ann: This coffee is very Antares St., Southern Cross. St. Joseph's ConThis week, let's venture into the realm of wild- muddy, Mum? t hat our parents have feel ings just * TUESDAY Mum: Well, it was only vent. Football. JUNE 2 Most of you will already know that flowers. as we do. Smith (8), 10 Western Australia is known throughout the world ground this morning. Goldie, E. HamLinda David Do you know that your parents ilton (14); Mark New- Schofield St., Eden Hill. for the wealth and variety of wildflowers confined * * * Doctor: Why is Mew orry? That they're hurt when you man, E. Victoria Park St. Michael's. Softball. in her borders. Tavish so angry? Ingram, (12); Robert d isobey them? That they hate pun- Broome THE BANKSIA. The banksia farnily is widely Nurse: Because you've Katherine (7); ishing you though they know they O'Neill, Inglewood (14). dispersed over the temperate parts of the South- told him he's better, and medicine hasn't all must? That often they can't afford 1. My initials are J.G.G. ern hemisphere and is found in South Africa as the been used up. * WEDNESDAY well as though Australia. In Western even Australia, about Australian. for, ask you things an am I the * * * JUNE 3 And, at the moment, 480 species have been found, most of them being they would like you to have them are you Why Father: Frisine, Margaret I am probably the in the South-West. clock, that smashing That they often feel tired and upset, Guildford (8); Martinne most important figure The banksia genus themselves are magnificent son? Coolbellup (11); in this country. and that your bad behaviour is the Ludicke, Son: Oh! I was just Elliott, 2. I am a very famous and, perhaps, the most attractive of all the bush Christopher last straw? That they know they Meckering (5 ); Brendan killing time, Dad. woman. I am married plants. Their blooms or flowers consist in the * * * sometimes make mistakes and mis- Eaton, Kalgoorlie (14); to an equally famous main of fine spikes or cones of densely packed I've Doctor: brought MerreTaylor, Deborah judge you? That they sometimes man and we have four spirally arranged flowers. you a Red Cross Nurse. din (12); Terrance Bricka in live hildren. I c The banksia was named for Joseph Banks, who c an't find immediate answers to your wood, Karrinyup (10); Soldier: Take her back. palace in a country in was the Botanist who accompanied Captain Cook Get me a blonde cheerful questions? That they constantly try Gavin Corry, Walebing the Norft ern Hemis- when he discovered Australia. one. (8); Shane Jones, Shotts recently I phere. to be better parents for your sakes, (9). toured the Eastern and that almost everything they do States of Australia almost that and * THURSDAY is for your sakes, with my husband and everything they do is for you? That JUNE 4 t wo of my children. Sean Patrick Togher, they sometimes need a holiday? That Morley (5); Peter Hou- 3. Iam a famous explorer. This year, in Austhey would like to hear you say: 'I wen, E. Victoria Park tralia, my name will Smith, Graeme (13); love you' or 'thanks Mum' just as you be heard very often. Midland (11); Michael celebrations Many like to receive thanks and praise Hutchings, Northam (10); have been and will be f rom them? That when you're not Aaron Edwards, Kukerin held in my honour. about they sometimes feel so bad (8); Susan Mary Cham- 4. I was a president of and Jennifer berlain the United States of that they cry? Mary Chamberlain, SalI was one America. Parents, bel ieve it or not, are ter Point (10); Joseph of the few presidents Dennehy, E. Fremantle human. Help them in their Godwho was a known (7); Marianne Sheehan, My presidCatholic. given task of looking after you. Make Kalgoorlie (14); Graeme ency ended when I it a l ittle easier for them, by your Beaton, Southern Cross was assassinated. I understanding and willingness to ( 13). became famous for a number of reasons, help. And above all be grateful for * FRIDAY particularly for my inhaving loving parents and pray for JUNE 5 terferance in the them. Kerry Smith. Nedlands Cuban situation. (7); Paul Woods, Attawhich many believe God bless you, dale (7); Catherine prevented another Quain. Rivervale (8); war. Also, for my Leanne Maree Kyd, Mt. championing of the BROTHER JUNIPER Lawley (9); Wendy Baxnegro civil rgihts ter, Yoting (9); Caroline cause. Truys, Geraldton (7); 5. I was Secretary-GenRhonda Van Der Mey. eral to the United Damien Clancy: Pas- Queens Park (11); Robert Nations. I was killed senger: "Driver, go Carter, Cuballing (13). in an air crash on my around the block 20 way to the Congo to times." When the taxi * SATURUAY help settle a dispute was on the tenth round, JUNE 6 between central govJonnine Birrell, Willapassenger said: Elizabeth ernment in LeonoldDowling: the Sue: If 40 cups were on "Faster, faster, I'm in a gee (9); Debby Glossop, ville and M. Tsombe. Sandstone (11); Andrew the table and one fell off hurry!" of Katanza province. H opkins, Nollamara (7); how many would be left? I W9 S Posthumously John Thuys, Geraldton Sally: 39. a warded the Nobel How are you getting on (11); Melinda Gleeson, Peace Prize in 1961, Sue: No, three, because at home since your wife White Gum Valley (8); the year of my death. f our tea cups less one, is went away? Catherine Henderson, three. Fine. I've reached the City Beach (12); Kerry •proNsiMUMBH Denise Murphy: What highest point of effic- Whitely, Karrinyup (6); 2t3a 'g !SpattuaN LITIOr iency. I can put my socks are small people who dig Julie Henderson, City luapisaid 't f3fooD SOLUVIr on from either end. holes in caves called? Beach (12); Marie Corry, TIMUIBO MaCtrZna * * * Mini-miners. New Norcia (5); Therese uaanb !uottoo Salo Little Amelia (saying Cottrell, Carlisle (12). Brendan Wood: When utrof :suamsNv her prayers): "Please is a car not a car? When Lord, take care of Mama, it turns into a street. take care of Papa, take Michael Jongehloed: care of Grandma, and Why is your hand like be sure to take care of a hardware store? OUTSTRETCHED IN PROTECTION. Be- yourself or else we r,re cause it carries nails. all sunk!" I f you dwell in the shelter of the

Dear Boys & Girls

SWAMP BANKSA

BANKS1A COCCINEA

Nature Book

JOKES

WHO AM I!

cjttbe 0z..

Are You Quite Ready!

A DAILY PRAYER

My Birthday is I am now._..... Name........

years of age

....

A ddress .................

School..........

Hobby.........

......

....

Meese fill In the couoon above In B LETTERS and send it to Brother Juniper, "The Junior Record," 450 Hay Street, Perth, so that when your birthday comes around he may greet you on this naoe.

Most High, and are at home in the shadow of the A lmighty, you may say to the Lord: "my refuge, my f ortress, my God in whom I trust-. For he it is who will save you from the snares that were set by the f owlers, his wings are outstretched in protection that you may find safety beneath.

"I deliver all who cling to me, raise up whoever may call on my name, respond to each one who invokes me, draw near them in hours of distress; bring them del iverance with honour, grant them long fulness of days and show to each one might in saving: that the Lord is all mighty to save." —Adapted from Psalm 91 (90) by James J. Muirhead,

You've never tasted better chicken. This new breed is plumper, more tender. its succulent white meat just melts in your mouth. Science tells us just when the chicken is at its peak for eating . . .

and that's when they're snap frozen to capture the tasty goodness for you.

VEllyr61 pr.8 4/8 148Et . THE u(8/ FOR YOUR Thilti


Page Fourteen

THE SEMI-CLASSIFIED

JOHN FENNESSY & CO. MEMBER

A.I.S.M.

EXPERT PROPERTY MANAGERS

BUYING! SELLING!

REAL ESTATE Mount Hawthorn Centre 24 4367. Alhrs 45 1145

La Spina - Filippi Pty. Lid. Real Estate Agents 207

WILLIAM STREET, PERTH Phone 285-288 A fter Hrs., Mr. Ross La Sr.,sa 39 2362 Members of R.E.I.W.A.

ERIC DIGGINS & ASSOCIATES REAL ESTATE AGENTS A UCTIONEERS

UPHOLSTERER ( R. & M. Kanaris) Lounge Suites and Kitchen Chairs Repaired and Recovered Antiques a Specialty 9 Miramar Street, Doubleview, 6018

R. E. Diggins, B. Corn. A /Hrs. 30-2841

Auctioneer

OFFICE CLEANING SPECIALIST Don't put up with cheap and inferior work! Get where the action isWE'RE THE BIGGEST, MOST EFFICIENT, WELL EQUIPPED AND THE BEST IN THE BUSINESS. R ING NOW-

BETTER BUILD:NG MAINTENANCE Phone 61-6372

The Society of St. Vincent de Paul

URGENTLY REQUIRE

CLOTHING, FURNITURE (except lounge suits) CROCKERY AND OTHER USEFUL ARTICLES TO ASSIST NEEDY FAMILIES. KINDLY DELIVER TO METROPOLITAN DEPOT48 GORDON STRET, OSBORNE PARK OR SOCIETY STORES AT318 BULWER STREET, PERTH 46 EIGHTH AVENUE, MAYLANDS 24 HELENA STREET, MIDLAND 142 HAMPTON ROAD, BEACONSFIELD 241 NORTH BEACH ROAD TELEPHONE: 24 5041 or After Hours: 45 4380 t o arrange for pick-up In Bunbury please deliver to 28 Victoria Street Phone 21 2951 We also require donations of shop display fixtures show cases etc., for our metropolitan stores. Please Phone 24 5041

The Daughters of Charity are appealing for

Good fashionable Men's Women's & Children's clothing for their

Cliarity gashion (Boutique

at 326 Lord SIR, East Perth

I f you have clothing you have grown tired of, or out of, please donate it before it goes out of fashion. We will attend to hems dry cleaning etc. All proceeds to Soup Kitchen and Ave Maria House Night Shelter for Women. Toasters, small radios, etc. also paper back end comics (not Magazines) also welcome. Clothing also required for needy cases. This is an opportunity for you to help those less fortunate than yourself. Goods will be picked up by'phoning 28 4403 or left at 534 William St., Highgate.

Thursday, May 28, 1970

CLASSIFIED ADVERTISEMENTS MaNINAIMMISOM.

ACCOMMODATION WANTED

FOR SALE

ST. Brigid's, Lesmurdie, COUNTRY girl student, winter uniform and Institute of Technology, 'blazer, 77 Balmoral St., desperately seeks full East Victoria Park. board in peaceful home. Phone 6-2441. SQUASH Racquets from $4.95 to $20.00. Restrings BRICKLAYER and repairs same day Estimates Free All Hours-'none 45 3995 BRICK alteration and service at Wimbledon Sports, 14 Bon Marche renovations, solid work, Arcade, Perth. 23-4219. Conreasonable price. tact Sean Rogers, 97-2859 GUEST HOUSES or 97-2137.

CONCRETE SERVICE CO.

28-32 Kurnall Road Welshpool Phone 68-2992 ( Al l Hours) Makers of Atlas Tanks Troughing, Flooring, Superbins, Swimming Pools, Concrete Slabs and Garden Curbing. Open Sat. mornings.

94 STIRLING H'WAY, NEDLANDS R .E.I.W.A. 86 2445 M.L.B. J. B. Kinnane, J.P. A/Hrs. 31-3174

RECORD

DOES YOUR CHILD HAVE A

BUILDER F. A. BROWNE, Registered Builder and Designer of modern homes; plans drawn, consults tions by appointment. Phone 60-2038. ADDITIONS, repairs, converting asbestos or weatherboard house into brick veneer. Contact John Morskate 6-3166. COACHING

PROPERTY IMPROVEMENT

450 HAY STREET,

P ROPERTY Improvement Service, all types of windows and doors in stalled; back verandahs enclosed: walls and ce:1 ings removed; cement rendering and general repairs. All work guaran teed.-Phone 45 2946.

Phone: 21 2837

PEST CONTROL

STAMP out white ants for good.- Contact MaxGERALDTON: Phone 21 well Robinson and Phelps 2549, St. Francis Guest on 8-4715 for prompt serHouse; B/B $3; all meals vice. Authorised pest exavailable, tray service: termination. no stairs. PUBLIC NOTICE HOSPITALS CLOTHING WANTED. DEVA HOSPITAL Help us to help the less ("C" Class) fortunate by sending un 15 Lawley Crescent, wanted clothing, paper backs and comics (not Mt. Lawley. Superior Home From magazines, please) to the DAUGHTERS OF Home for Mule and CHARITY, Female Patients. 534 WILLIAM STREET. All Medical Attention. HIGHGATE. Fully Qualified Staff For track to call or Personal Supervision 01 further information VI. L. Foley. Ph. 71-1372 ring 28-4403.

PERTH

S UBSCRITPION: $$4.55 per year. $ 2.28 per half year. C LASSIFIED A DVERTISING First two lines ( 10 words) 40c.; additional lines, 15c, D ISPLAY A DVERTISING $1.60 per single column inch.

DEATHS AHERN, Thomas. In memory of a very dear friend. Eileen Doyle. Requiescat in Pace.

CATHOLIC lay teacher COCHRANE. Passed for Leaving English-10 away peacefully on BED WETTING weeks from mid-June May 24, at St. Anne's afternoons). (Saturday PROBLEM? Hospital, Mt. Lawley, EDEN HOSPITAL, 9 Hill REPAIRS Phone 23-4436 for details. Bedelia Mary, dearly View Road, Mt. Lawley DOES THE PRESENT beloved wife of the (C Class) for Ladies. An ALL radio, electrical and COMPANION TREATMENT WORK? late Arthur excellent trained staff at Sunbeam repairs done in John WANTED PHONE ME FOR A Cochrane of 373 Stirall times; your mother our own workshop; est DEMONSTRATION OF GIRL, 21, desires a will be cared for with In Victoria Park since ling St., Perth, loving female companion for kindness and efficiency 1930.-W. R. Phipps Pty THE INSTANT BELL mother of Eileen MEDICAL UNIT. THIS working holiday, U.K. and in a homely atmos- Ltd., 434 Albany Highway, (Mrs. H. Russell), UNIT GIVES A 90°A CURE. and Continent, November phere; Mr:. Win Herbert Victoria Park. Ph. 61-1270 Jack and Bill, fond or December, 1970. Reply personalty supervises the mother in law of ALL ENQUIRIES TREATED Box 6890 this office. Harry, Dorothy and welfare of all patients- SITUATIONS VACANT AS CONFIDENTIAL. Deana, dear GrandPhone 67-2019 or 71-4696 WANTED active lady mother of 14 and EDUCATIONAL bookings waiting and for PHONE 24 1732 pensioner, full board and Great Grandmother of list. remuneration exchange LEARN to speak Italian A /Hours: 49 6671 Claire and Norrelle. for some house duties, at the Italian Cultural Eternal rest grant HOLIDAY RESORTS further particulars Phone Lyceum. - 21-4969, A/H unto he:. 0 Lord. 65 4203. A. C. Pace. MELBOURNE East, 119 47-2742. Her Funeral took Grey St., B,'B $2.85. SpotElaine O'Rourke place in the Catholic MATURE housekeeper. less, w/w carpets. Beau1 Jubilee St., Sth. Perth Cemetery. Karrakatta ELECTRICAL tiful city area, near St. Two children 6 and 9. Phone 67-3481 after Requiem Mass Father shearer. Contact APPELBEE'S Electrical Pat's. 41-6524. Bowra ck O'Dea, FunFather Devlin, Three DRESSMAKER Service, 33 Avery Avenue, eral Directors. Dianella; phone 76-2344; BUSSELT'ON Guest Springs. Specialising in:installations, repairs and House, 125 Adelaide St. BRIDAL WEAR IN MEMORIAM Enjoy a winter holiday, SITUATIONS WANTED maintenance. DEBUTANTE and June, July, August, off LANE ( Christopher EVENING GOWNS DOMESTIC HFT,P season rates Write or FASHION Joseph). Treasured SUITS, FROCKS. I NSTANTLY phone 227. memories of our beBRIDAL specials, headALL SUBURBS. loved husband, father dresses and finger tip LOTTERIES and grandfather, who Ring 45-4231 - 45-1318 veils $6.00, bride's mothdied so suddenly May office hours. ers hat $7.00, bouquet WISHING WELL Lottery 30, 1969. Eternal rest Flying Domestics. SWORN $4.00, distinctive styles Kiosk & Tobacconists. IV, grant unto him 0 Pier St.. Perth. Ph. 23-397P by Merle. 31-2000. Immediate temporary V ALUATIONS Lord, and may Perhelp. Fast and thorough Metropolitan and Counts.) shine petual Light FLORISTS cleaning and general help LEARN TO DRIVE Extensive Experience in upon him. Forever in Night staff to help parthis Field. the hearts and prayTEENY'S Florist, 474 ties. $1 per day booking RITA JONES ers of his family. Fitzgerald Street, North fee, $1.25 per hour. L. J. "Laurie" Perth. We specialise in SCHOOL OF Regular help also artificial fresh and Mackin BIRTH DEA rH and available, $1 per hour MOTORING NOTICES shnuld not w reaths, sheafs and plus fares. 24-3851 .odged by Pe: ec hone Phone: 60 2217 or domes at short notice: 60 4490. free delivery metro area Beginners or Refresher TREE lopping, shapinPh. 28-6508: A/H. 23-2736. Courses on Manual or and removing, all prun FOR HIRE Automatic. Expert int:, cutting back of THANKS Patient and Pre-Permit. sl- rubs, also demolition work; prompt; free PALMER'S HIRE Tuition guaranteed. LEEDERVILLE quotes.-Phone 65-3248. Thanking SERVICE CUSWORTII. B. Class Licence $4.00 ESTATE AGENCY the sisters and staff of For all your party hiring per hour. R .E.I.W A. L.R.M. Industries. Kit of St. John of God. BelCrockery, cutlery, glasschens and bathrooms re- mont, for the loving care ware, etc. 14 Marlow St., Wembley Cabaret tables, chairs. PERSONAL tuition by modelled, general renova- given my late sister, Srs. 8- 1820 all hours trestles, coloured lights, lady instructor, holder tions, repairs and main Molly, especially Lelia. Anunciata, Alphonelec. urns, pie warmers. of National Safety Coun tenance.-49-4700. cil Certificate. Mayfair sus, Porak, O'Loghlen. etc. Driving School. - Phone INFANT school teacher 1250 Albany Highway, BUILDING ADDITIONS permanent A/H: 31-3702, 39-1842 requiring WANTED TO BUY position. Phone 67-2471. and RENOVATIONS Bentley. Ph. 68-2891. Ailsa Jean Bell, Prop.

John Bradley

First Class Work Guaranteed. Quotes without Obligation.

A. R. HARE Phone 71 5125

CONTRAX "Y

Lakeway - Claremont BUILDERS, PLUMBERS, ELECTRICAL CONTRACTORS, MANUFACTURING and RENOVATING CONTRACTORS Phone 31 2805, 31 4703 COMMERCIAL PRINTING Business Cards Letterheads Invoices Statements RING

21 2837 for a Representative to call.

!I111119111111111111111111111111111111111111111111111 MARIST Bros. football jumper, size 30. Phone A TTENTION ALL! 46-1305. F. J. LARNER, pipe orSchools, Convents, Colgan builder, piano tun leges, Charitable OrganisWANTED TO RENT Irtig and repairs.-Phone ationc-For your Raffl. 76-3726, 41 Charnwood Tickets see . . HOME, furnished or un• Street, Morley. 6062. furnished, anywhere, broRECORD PRINT and sister, pensionther WEDDING gowns, 100 for 450 Hay Street, Perth. PAINTING excellent tenurgent, ers, hire, veils, coronets, pet87-1715. ants. Phone AINTING 11111111111111111111111111111111111111111 P 111111111111 1 ties, etc. Ball Deb's Dine Gowns. Orchid Hire Ser- Personalised and indivice, above Don Mens vidual attention given to Store, 132 William St. all your painting requirePhone 21-6989. A/H. ments; prompt and effi79-1163. Enquiries also at cient service.-John C. Annettes Drapery, Guild- Freakley, M.P.D.S.A. Telephone 61-4349. ford 79-1163.

ALL Party Equipment Dance Floors, Catwalks Fashion for Parades, Chairs, Tables, Coloured Lights, etc., Kiddies' Cots & High Chairs.-Devine's Hire Service. Ph. 46-1988

ORGAN BUILDER

Vacancies for Women

MASTER PAINTER for all your painting requirements. George Hickey. Reg. No. 899. M.P.D.S. 24 1707.

RING 71 2107

PIANO TUNING

Deloraine "C" Class Hospital

PIANO Tuning and Repairs. Pianos bought and sold.-Telephone 86-2142, Chas. A. Watson, 38 Ord St., Claremont. (Late Bilhler'F). Quotes Free,

BOWRAadDEA Funeral Directors 68 STIRLING ST., PERTH

ALL HOURS: 28 1299


Thursday, May 28, 1970

THE

Page Fifteen

RECORD

THE NIGHT THE "You don't get a work BOOK REVIEW By Barry Pestana. permit for six months or , GHOST WALKED; Dee a year—you have to fight Heinemann; Sinclair; for one for each performance." S1.60. Italy was the hardest This is the first boot' place to get a work perof the Castledare series mit, despite the fact that written by Dee Sinclair. Australia was taking The multi-blooded FiliDerrick Christopher thousands THE WORD IN THE Italian of pinos have had it tough. (11), arrives at Castleworkers. WORLD 1970; Divine History tells us how. dare Home For Junior He said he knew of one News Service; Australian girl, of Sicil- Word History also tells us Boys. Before long, he is ian parents, who had Norman Ruffling, SVD how their culture and accepted as "one of the Austral ia's overseas image is suffering because we don't lived in Italy for 15 years ( Editor); Price $1.50 lives have been influenc- gang" by the boys of package it—and we don't do enough market —the greater part of her ( ed by the missionaries. Dorm A, on whom the know how to life—and yet she still had bound ); $1 (soft). ndeed, this influence book is centred. I r esearch. difficulty in getting a remains. Brother Griffiths, the 30, On December work permit. of view assures the headmaster, is In The Word "The his T "I think here is a posi- 1 896, in the Luneta dis- World 1970" deals with young Christopher that international A ustral ian tion in which the Austra- trict of Manil la in the the Philippines in detail, there is always something Raymond b ari tone lian Government could been has who yers, Philippines, Dr. Jose although it includes short happening at Castledare. M do something positive for for the missions How true! v isiting Perthconcert in R izal, now a legend, was articles on other Australians. and interests A BC's second Soon, Chris and the "We have been allowed shot by a Spanish firing orchestral of the gang get inrest history of I t studies the t he 1970 to appear as a cultural squad. in a wild ghost volved a whole, Islands as series. the wilderness for too long." And after so long overA well-educated, force- the background of the hunt. Despite living overseas Verdict: A real childseas, what were Mr. ful man, Dr. Rizal was Filipinos, the whole socfor the last six years, he An ideal Myers' impressions of the chief instigator of ial structure, and the ren's book. is still very much an AusAustralia? tralian — enthusiastic the movement against history of the missionary birthday or Christmas future gift for boys and girls "Firstly, the brightness the Spaniards. His death movement. about Australia's It's an ideal book for from 10 to 13. of the women's clothes— inspired his people to and determined to return and and their terrible skin. fight harder for indepen- libraries, schools here to live. "The absolutely terrible dence. mission personnel, and The Sydney born bariMUSIC airline meals. also those who are intone took up singing to Today, the anniversary terested in Asian affairs. "The delightful modern owrcome severe asthma. Puccini: Madam Butterarchitecture. Perhaps be- of his death has become Within a few months could too, Teachers, the fly Highlights HMV holiday in national importa winning cause I'm the son of a he was To his find it a useful supplevocal Australian builder I notice these Philippines. 2453 ant countrymen, he was a ment for history lessons things. competitions. from the taken is This Since going overseas "I do like your archi- patriot, a hero and a dealing with South East full Angel set, which was Asia. martyr. mark he has made his tecture, all your new two about reviewed international the buildings seem so well on R aymond Myers years ago. Recorded in clothed." scene, appearing opposBOOK REVIEW the Rome Opera House ite Joan Sutherland in as a country with a cul- —interested in Australia. with an all-Italian cast, He sang the ture of its own. "Now is the time to London. "THE STORY OF NEW NORCIA", the West Aus- it has John Barbirolli as world in the role eading "So far as Europe is capitalise on it." l tralian Benedictine Mission. Edited by Dom conductor — more than Mr. Myers jabbed a a country premier of "The Servant concerned, a little strange to find a Bernard Rooney, OSB., for the Benedictine Com- British of Two Masters' in the without a cultural back- finger at an ABC window conductor more New ground, without cultural —"We have out there an Centre, Lincoln munity of New Norcia; 44 pages text and illustra- notable on the orchestral York, and has just com- appreciation, is only half aura of being a pioneerplatform than in the pit. tions; 95c. ing country. It excites pleted "Rigoletto" at a country. However, it was a very "Yet, in Sydney, we the imagination of the London's Salder's Wells. This little booklet, pre- appetite of its readers for good set and the choice His criticism of Aus- have the marvellous Aus- rest of the world. "VILLAINY", a com- pared and published by more information about tralia's attitude to its tralian Opera Company, "They like the image parison in Shakespeare's the Benedictine Commu- this unique chapter in of highlights is sound, own overseas image was which is equal to almost of the stock rider, the villains, comes to Patch nity primarily to meet the long history of Bene- including Butterfly's Entrance, the Love Duet, drawn reluctantly from anything anywhere in surf carnivals—and these Theatre on May 30. the many requests for in- dictine monastic, culturhim. the world—and improv- are good for us. The programme pre- formation about the his- al, and missionary ac- One Fine Day, the Flower Duet, the Humming "I have been treated ing all the time. "If it took Joan Suth- sents a comparison be- tory of New Norcia and complishment. Chorus, the Prelude to so marvellously by my "But does the Federal erland seven years, how tween Iago, villain of its institutions, is a brief own country; it has done Government sponsor it long do you think it "Othello", Falstaff, villain but interesting resume of at: New Act III and the Death of Obtainable Butterfly. so much for me that I to go overseas, to tour could take anyone else? of "Henry IV, Pt. 1", and the early Spanish Bene- Norcia, Albert's bookdon't want to be a knock- Europe? "But, with Federal Richard III, villain of dictine pioneers and the Renata Scotto and er," he told a reporter. —The politicians will Government sponsorship the play of the same important role played by shop and Central Catho- Carlo Bergonzi sing the But inevitably, there spend millions on trade this could be reduced." name. leading roles. them, not only in the lic Library. were some facets about commissions and trade How about his criticism Paul De Lano, widely sphere of missionary official and private over- promotion campaigns, of market research? experienced in the pre- and educational work in seas image making that but when it comes to cul"I'll give you one ex- sentation of Shakespeare the Victoria Plains disneeded to be pointed out. tural activities they're ample," he said. "I think plays all three villains. trict, but in the establishOne of the difficulties not prepared to meet it is typical. NIDA-trained actress, ment of the Catholic was pr;moting Australia what they must obvious"I was in an Italian Bobbie Walter, plays the Church in Western Ausly consider extravagant supermarket a few weeks roles of Desdemona, in tralia. costs. ago.I saw Australian jam "Othello", PLANNING A FETE? Mistress The work is attractively "What the politicians on sale. Quickly, in "Henry IV", Choc, Wheel Books. presented and features a don't that we consider is "But ii was in cans. No and Mad Meg in "RichNo'd. 1 - 30 75 tents. number of black-andmust promote an image one buys jam in cans in ard III". P40.d. 1 - 48 SI.00. that includes intellect as Italy—or elsewhere in Miss Walter is making white plates, depicting, in A vailable___ well as brawn. Europe so far as I know. her first appearance on historical sequence, the "That jam will just sit the stage in Perth, after successive stages of New R ECORD PRINT "Everyone is fantastic450 Hay Street, Perth. ally—and I don't know if there on the shelves and arriving from Sydney a Norcia's growth and activity from 1846 down to few weeks ago. fantastic is strong enough gather dust." the present day. One of Mr. Myers' critiThe presentation is cisms was the emphasis linked by narrative, and The Church in W.A. placed on science subthe players will leave an still awaits a definitive jects by Australian edu- informal setting round history of Bishop Salcators to the exclusion of the stage to assume their ved() and his courageous W.A.O.A. the humanities. roles. missionaries who built O PTICIAN and OPTOMET7.IST V.HTN YOU SHOP AT A He said this emphasis up a flourishing Benedic467 ALBANY HIGHWAY, VICTORIA PARK. 61 1880 was `cruelling' Australia's In this way, the audtine monastic mission overseas image when the ience will be involved in R es.: 67 1685 which, over the years; "These are not respon- the presentation, and has deserved so well of sible for any hayseed will be able to gain an both Church and State. image we may have. This "inside view" of the charUntil then, however, "The is due solely to the lack acters. W. F. SAMSON & Co. Story of New Norcia" of promotion of our R .E.I.W.A. Neil Hansen, fresh will do something to fill 5 QUEEN STREET, FREMANTLE artists. from his success as the gap, and co whet the R eal Estate Agents, "In Australia we have Romeo in Patch Theatre's Auctioneers and Sworn Valuators, Rents c ollected, Estates managed, Representing Queensland Insursome very, very good season of "Romeo and ance Co. Ltd., Royal Automobite Club of W.A. ( Inc.) R A.C. Insurance Pty. singers—equal to any- Juliet", plays important Ltd. Bank of N S.W., Savings Bank A gency. thing in the world. Many roles in the series, toE quitable Life and General Insurance Co. Ltd. of them can give a far gether with Tony Joseph, Phones: Office: 5 1316. Private Sir more professional per- John Bissett, Joe Strike, Frederick Samson, F.C.I.V., 5 2553. G. 0. Samson 30 4425. formance than some of John Clune, Geraldine Mrs. D. P. Migro 5 3551. E.J. Ellery, F.C.I.V., 39 3863 their counterparts over- Hart, Teresa Ungvary, seas. and Julie Craggs. "But many will never Two newcomers are leave the country because Brian — PRESENT THEIR — Saunders, who of the difficulties in get- plays "Othello", and ting established. Harold Davidson, who recipients of this educa- has had experience on tion represented us over- the stage in India. under the Artistic Direction of seas. "The interpretive arts IRISH PLAY IN are a part of everyday COLONY ROOM life in Europe, yet when John M. Synge's Irish S TARRING our big businessmen go over there their counter- play, "Playboy of the World", will parts are at a loss as to Western open in the Colony Room how to entertain them. "They're not interested Theatre on June 5. with The story of Irish in the opera or the country folk, and the ballet. "One important over- Playboy who comes in the "Western DIANNE TAYLOR KEN WHITMORE seas representative even from ELEANOR MARTIN WITH FULL CORPS DE BALLET went so far as to have World", the production the piano removed from features Michael O'Halhis house because he loran, as the Playboy, and Nola Bloom, as Pegeen didn't like music." One of the moves Mike, with Paul Tebbs, JUNE 15th - 27th at 8 p.m. Adelma Hills, Hugh Macwhich Mr. Myers believes MATINEES Pherson, and SATS. AT 2 p.m. John Mccould break the cultural barrier would be cultural Mahon. "The Playboy of the agreements between AusADULTS $2.80 CHILDREN $1.50 tralia and other coun- Western World" will play on Friday, enable Saturday Box would and Office Tel. which 21 5681 tries, Australian artists to get Sunday evenings, for a BOOK NOW AND DON'T BE DISAPPOINTED three-week season. work permits.

Entertainment

Libraries Should Stock This

GOVERNMENT SHOULD HELP ARTISTS

"VILLAINY COMES TO PATCH

VIOand the

H. J. LILLEYMAN

Savings (` ) are Great

WEST AUSTRALIAN BALLET COMPANY

the records reviewed on this page are available at

MUSGROVES Record Centre of the West 223 MURRAY STREET

1970 WINTER SEASON Rex Reid

Robin Haig & Luis Moreno

Patricia Sadka & Laurence Bishop PLAYHOUSE THEATRE


Page Sixteen

THE

Them Up, SPORT HangLionel

FOOTBALL

WAiNFL & WAFA Are Still At It

By FERD TIPPETT

Thursday, May 28, 1970 , SPEAKING OUT By Barry Pestana

WORLD o FOOTBALL COMMENTS

RECORD

Downs. It has a real picnic atmosphere. Except for the participants who know they will face probably the most gruelling and dangerous event on the motor racing circuit.

Yes, I agree with those critics who feel Rose should retire from boxing. His

Lionel

knock out loss to the Mexican, Raul Cruz, did nothing to enhance his waning image, or hi,s chances of coming back.

Boxing experts who Rose's physical "defect' The already strained bonds between the Last week was a level- will be required to maintain "they never needs time to heal. Lotg ler for the top sides un- counteract the mighty WANFL and WAFA may have been severed last D2 GRADE HOCKEY come back" are occasof time. If you der wet conditions and, Vics. Farmer will ensure Sunday. Victoria Square ionally proven wrong Ex. member, I advocated a in the match of the day, that the W.A. team will Students (5) beat Perth (as in the case of six-month or more rest By allowing suspended MCWOCV00000000063 Dentals Royals exposed the Bull- take the field knowing (0). Vicente Saldivar reperiod for Rose after Fremantle player dogs' limitations when the big V can stand for East gaining the featherby Bob Roberts the Setelo fight. Blt VIC SQUARE WIN, BUT they won 15-24 to 12-13. vanquished — providing Rick Vidovich to play in MICVOL weight crown), but Rose fought Don Joh). AvooMoo CAN I mov LEARN MORE competitio West the its n The Demons are finding we can reduce them to most of the time that son in March. That was The Victoria Square it difficult to win games reasonable levels in the Australian Football As- and the event promises saying is true. a big mistake. sociation has wrecked the to be the fastest team can learn from this at home and Malcolm key positions. ever Some time ago, through Another thing, show 14. relationsh game, good had it ip even though it won. Atwell is in need of more • The Maroons have conducted. these columns, I said Mess and boxing dot's effort from his experien- provided the venue for tried to establish to reThere have been num- It was the first game Rose had many years mix. If you're a prof. 'Zed players, who seem to the seven other League gain affiliation with the erous attempts to ban played in wet conditions, left in the fistic game. sional boxer, you hare WANFL. and on a very poor have lost their old zest. clubs too long, and the race because of the He had. But he has got to give your "at, associatio The ground. n had high fatality previously Subiaco Oval for 1970's Teamwork, thrown them away. rate. Specfor the game, No he Perth's success formula, Grand Final could see the several meetings with the tators and drivers have From the first half, it Once a boxer loses his measures. WANFL early the in seahas been replaced by end of a long Maroon been constantly killed in appeared that Vic Square concentration, it is Lionel Rose has got te individual football drought. The son and at one stage recent years. spasmodic had forgotten what to do time to quit. make up his mind ore efforts. coach, team and time is seemed certain to rejoin Qualifying times are under these conditions. The former world banway or other: Does ke the league. • With the interstate ripe. The Bunton success However, It gradually creeping hightamweight settled want to be a boxer, q champion ronically the only bar er. This year the game against Victoria story would be enhanced I has lost his concentrafastest down after the first goal a singer? very close, ball-getters considerably with a Mar- rier was over clearances. entrant sped around the was scored. tion and inclination Rose and Rennie have Swans like Billy Walker oon pennant. With ordintrack at a lap speed of box. It is time he quit. been in the game long Vic Square will have will be needed, and East ary luck, in regard to in- C YCLING 167.091 m.p.h. enough to know sing. to brush up on its pass- After his loss in CaliforPerth's new centre-man, juries and concentration, Australia has produced The Indianopolis 500 is ing technique, and be nia, sportswriters here ing tours and training John Burns appeals im- the astute Subiaco coach some outstanding the equivalent of Eng- able to read the wasted no time in telldon't mix. play as mensely. Burns revels in could take out the major cyclists. But there is one land's Derby at Epsom ing Rose to retire. To be, or not to be? That well. the wet, has the ability prize. field hardly touched by is the question. My I have waitrd some time to break into Have Swans and Old them open — motor-paced advice: Quit before while putting my feelspaces and kicks with Easts lost the will to win. events. you're ahead, Lionel. ings down print. in I either foot. or do football teams who Though Tasmanian waited to see the re* * * It's amazing to see lack key players have a Graeme French won the action from various Well, South League players endeav- mere need to pave the world title in 1954 there Africa has quarters first. ouring to mark overhead way for more success has been little scope in been ousted out of the My on a wet day when a with "a three-year build- this country for this type reason for asking Olympic movement. On Saturday, May 30, when Rev. Brother C. C. Rose and his managerchest mark serves a dual ing plan" to raise their of racing. Much to the disgust of members of the St. Pat- O'Donnell opened the trainer, Jack Rennie, to IOC Avery Brundage, purpose. Firstly, it is level to the standard of In Europe motor-paced rick's Old Boys' Associa- College in 1926. think seriously about I bet. safer, secondly, a chest top teams who have, by events are the most ex- tion (Geraldton), will As a fitting climax to retirement does not It only goes to prove a mark keeps your oppon- trial and error, attained citing, spectacular and hold their reunion din- the reunion, members stem from the Setelo ent out (assuming you've success point: politics have beby acquiring dangerous. ner at Park Towers, 517- will attend Mass at the and Cruz defeats alone. made the front berth footballers in demand come more and more Cyclists reach motor 519 Hay Street, Perth, at Redemptorist Monastery, possible). Several factors are inand reliable category"? involved car speeds as they zoom 7 p.m. in InterNorth Perth, on Sunday volved. • With the limitation • The Little League's around national sport. plate shaped Phil Bunter, the secre- morning, May 31. of in-form players this opening games are sure tracks, their wheels only R.M. season, our State side to create immense inter- inches behind speeding tary of the association. could be considered along est, and the public are motor cycles. has received a wonderful 20 Mabel St., lines of selection of dedi- sure to respond to this When the 1970 world response-32 have accep- INT South Perth ERNATIONAL cated club specialists grand novelty with tell- track championships get ted the invitation. PAINTING CONTRACTOR 67 2716 RULES BASKETBALL who can be interchanged ing effect. under way later this year There is ample parkin two or three positions The champions of the it is unlikely that an Aus03 GRADE on the field. A strong fast future will emerge from tralian entrant will cause ing space available as VIC SQUARE LETS guests can drive up to young side with a nice these boys, and football's much excitement. The FOUNTAIN Shop the fourth floor and en- DOWN SUPPORTERS blend of experience will image will be improved But the same rider, ter by that Follow entrance ing a well deFish Ponds, Fountains, Pumps, Waterfalls, Pebbles. not bog down too easily no end by the introduc- Tom Moloney could be a There is only a small served win the previous In the Victorian mud. Garden Lights, Lily Ponds, Underwater Lights. tion of entertainment surprise package. parkin g charge. week, supporters of the • Graham Farmer, who new, novel and crowdPlants, Fertilisers, Peat Moss, Etc. He has been training Victoria Square ex-studheld his own against the pleasing. specifically for this event PHONE 28 6720 Distinguished guests, ents team looked enthusVics best, will be in a My Selections and is confident of a who will 9 Canterbury Court Arcade, Perth attend include iastically forward to furbetter position than preClaremont, Subiaco, forward showing. Rev. Brother F. J. Levan- ther success last Wednesvious State coaches as he Swans and South Freder, Provincial for the day night. But this was will know exactly what mantle. Holy Spirit Provincialate not to be. S ARICH SEE THE LARGE RANGES OF When East Fremantle of South and Western Not having the num12" L.P.'s AT— sacked coach Eric Sarich Australia; Rev. Brother bers to field a team, Vic public feeling was strong- M. P. McAppion, princi- Square forfeited to Port. ly on his side . . . but I pal of St. Patrick's Col- Then, • All Top 40 Hits are available , with a borrowed lege, Ceraldton; wonder how it is now. Rev. player from their opBrother B. T. Murphy, ponents His treatment of West . R. PHIPPS Pty. Ltd. side they, much Perth was just as harsh former principal at St to the chagrin of their 434 Albany Hwy. VICTORIA PARK Phone: 61-1270 as that dealt out to him Patrick's College, Gerald- coaches, proceeded to deton, now on the teaching by East Fremantle. feat Port in a scratch ~•~0444t Nobody disputes the staff at Aquinas College - match. fact that Sarich was fully Rev. Brother J. R. Murentitled to be sure which phy, of C.B.C., Leeder- 1110111MMINIIMINI +NI club he wanted to go ville (also a former teaENGLISH DERBY to. After all people cher at St. Patrick's Col being thrown out into the lege) and Rev. Brother Run at Epsom, June cold are just as likely to N. D. Williams, himself 3 at 10.25 p.m. (W.A. TO SEE THE clutch at the first coat an old boy of St. Patrick's time). College, now in his first offered to them. Record Tip: But they should not year of teaching at C.B.0 Nijins ky: He remains put it on unless they are Bedford Park. unbeaten in seven races fully certain that it will The Geraldton party of to date, setting a record fit. eight will be headed by in winning all seven at If Sarich had any the Association presid- odds-on. Undoubtedly doubts about joining ent, Frank Warr, of a great horse—trained West Perth—which he Yuna. Perth members in- by Vincent O'Brien and must have had as he clude five old boys who ridden by Lester Pigasked East Fremantle to attend ed the College gott. hold up the clearance then he should not have t rained with West Perth PTY. and allowed himself to be selected in the league LTD. from WHITTAKERS team. 11Vibittekars ere W.A.'s Timber Merry specialises sew He certainly didn't win GLOUCESTER PARK Albany Hwy., Cannington creftsseee el wavy yaws seperimme. any friends at West Perth Ittneesi Vflairteicors Timber Aptexoy• Owe. mew mod over his action. 7.15 metarieis CON —QUALIFYING (1). * * * Bangalore, Travis Frosty, Glamour City. R ACING 7.45—SWAN HANDICAP. Well it's on again this Tommy Robert, Prince Daktari, Rocklee Saturday. Again. The world's most controversial and colourful 8.15 —QUALIFYING (2) . motor racing event—the Ringatill, Granite Scott, Blazing Hall. Indianapolis 500. Two Australians, Jack 8 .50—NEDLANDS HANDICAP. Brabhain and Kevin Glanceaway, Cutlass, Gold Bin. Bartlett have qualified 41.1011MINF711111. 9.25—EMERALD HANDICAP. Boona Boy, Miss Dundee, The Hermit.

ST. PATRICK'S COLLEGE OLD BOYS' REUNION

M. G. O'Brien

$2.50

pm•=0...

It's so worthwhile

I

rely on QUALITY

"DIFFERENT"

General Motors Dealers

unber oine

Rossmoyne Tips

KEVIN JAMES oat te so ytad

T YRE WHOLESALERS :(PTrVA) AUTOMOTIVE

ENGINEERS,

126 Adelaide Tce. ( Shell Service Station) PERTH. Phone 23 1953

&

TYRE

SPECIALISTS

D.

1156 Albany Hwy. ( Shell Service Station) BENTLEY. Phone 68 2359

10.00—CITY BEACH HANDICAP.

you did

Capamore. Gay Garrison, Cressello. 10.30—COMO HANDICAP.

Phone 68 1826

No Dill, Jack Ease, Sir Alex. BEST BETS—BOONA BOY, CAPAMORE.

Printed and published by Charles Andrew O'Mal ley 450 Hay Stre•t, Perth, W.A.

• "Record Hoy"'


Turn static files into dynamic content formats.

Create a flipbook