Seven Days, August 16, 2017 by Seven Days

HI, NEIGH-BEAR

PAGE 14

V ER MON Tâ&#x20AC;&#x2122;S INDE P ENDE NT VO IC E AUGUST 16-23, 2017 VOL.22 NO.49 SEVENDAYSVT.COM

Ursine encounters on the rise

the animal issue FURRY FEELS

PAGE 32

Remembering a best friend

TO THE RESCUE

PAGE 40

A K-9 trainee at work, and play

DONKEY DELIVERY

PAGE 46

Hoofing it to market in Montpelier

BBQ BONANZA

AUGUST 20 2017 | 4:00 PM - 9:00 PM

Get Back to the Basics!

USIC M E V I L 4-8pm

find your favorites at any Danform location

Featuring: Hardscrabble The Growlers Rick and the Ramblers WOKO DJ mechanical bull • bouncy house • vendors • lawn games photo booth • bonfire • AND all-you-can-eat BBQ buffet Join us for the 5th annual BBQ Bonanza Festival! A day of great food, music, and fun for adults and children alike.

Tickets at: basinharbor.com/bbq2017 Adults: $40 ($45 at the door) | Kids 5-15: $15 ($20 at the door) Kids 5 and under: complimentary basinharbor.com 802.475.2311 • (800) 622-4000

FOCUSED ON YOU

7/31/17 3:34 PM

•

SHELBURNE

•

ST ALBANS

*Selection varies by store.

Untitled-8 1

8/14/17 10:28 AM

08.16.17-08.23.17

SEVENDAYSVT.COM

4T-basinharbor080217.indd 1

BURLINGTON • COLCHESTER DanformShoesVT.com

WILD SPACES, OPEN SEASONS

SEVEN DAYS

Hunting and Fishing in American Art JUNE 3–AUGUST 27

CALL FOR YOUR APPOINTMENT TODAY.

Dora Sudarsky, O.D.

370 SHELBURNE ROAD BURLINGTON 497-1676 CHROMAOPTICS.COM

4T-chroma080217.indd 1

7/31/17 11:53 AM

shelburnemuseum.org Wild Spaces, Open Seasons: Hunting and Fishing in American Art is generously underwritten by with support from Donna and Marvin Schwartz, the Stiller Family Foundation, and the Oakland Foundation. This exhibition has been organized by Shelburne Museum, Amon Carter Museum of American Art, Dixon Gallery and Gardens, and Joslyn Art Museum, and is supported by an indemnity from the Federal Council on the Arts and the Humanities.

Winslow Homer, A Huntsman and Dogs (detail), 1891. Courtesy of the Philadelphia Museum of Art. The William L. Elkins Collection, 1924.

OKTOBERFESTVERMONT Featured in al, treet Journ The Wall S azette G l ea tr be, Mon lo G n o st o B Pouce and Sur le

SMOKED MEAT

LIBATIONS BREWERY

Daysies Winners 2012-2017

WATERFRONT PARK, BURLINGTON

SEPT. 21-23

IT’S TIME FOR SUMMER ADVENTURES!

PRESENTS

Stop by for hooch before you go.

AN ADULT CARNIVAL WITH 40 BREWERS

Brewery opens every day at 11:30AM for LUNCH + SUPPER

100 beers, 40 Brewers, costume contests, stein lifting, carnival games, inflatables best food in VT, live music, dancing & prizes, Special brews from VT to Germany, Greatest sunset on earth and much more!!

23 South Main Street • Waterbury, Vermont prohibitionpig.com

TIX @ OKTOBERFESTVERMONT.COM 4t-oktoberfest080917.indd 1

8/3/17 4:24 PM

NEW CBD: Gourmet CBD Truffles $15.99 / 4pc.

4T-ProPig080917.indd 1

8/8/17 2:32 PM

SEVENDAYSVT.COM

GROW YOUR OWN HEALTH REVOLUTION

VT’S BEST CBD & INDOOR GROW SUPPLIES

08.16.17-08.23.17

Discover this 100% legal, natural remedy for inﬂammation, stress, pain, anxiety, and more. We’ll help you ﬁnd the right product for you, your grandma or the family pet—or teach you how to grow your own! * Best selection: chocolate, capsule, vape, topical, tincture & more.

SEVEN DAYS

* Lowest price per milligram * Knowledgeable staﬀ: we can answer all your questions. * Convenient: free parking, all major credit cards accepted. 388 Pine Street, Burlington VT Est. 2015

802-540-2097

www.greenstategardener.com 3

Untitled-7 1

8/14/17 10:26 AM

Untitled-14 1

3/30/17 11:35 AM

DO WE SEND A B I R T H D AY C A R D O R A THANK YOU CARD?

SEVENDAYSVT.COM

Nicole Green, LPN BAYADA Nurse since 2015

08.16.17-08.23.17

Mark Baiada, founder of BAYADA Home Health Care, is celebrating his 70th birthday today. But instead of receiving lots of gifts, he’s giving one big one—his company. After 42 years, BAYADA is going nonprofit, so all our good work can continue... well, for good. We have many opportunities for caregivers like you to LOVE what you do, just like me. When you join BAYADA, you’ll find doing good has never been so great.

SEVEN DAYS

Thanks, Mark, and happy birthday! Call 888-409-8550.

bayada.com/apply-nowVermont Untitled-7 1

8/15/17 10:34 AM

THE LAST

emoji that

WEEK IN REVIEW AUGUST 9-16, 2017 COMPILED BY SASHA GOLDSTEIN, MARK DAVIS & ANDREA SUOZZO

VAX TRACKS

HOOD’S OFF: A VERMONTER

IN VIRGINIA

A screen shot from a VICE News clip features Vermonter Ryan Roy

Cox Automotive, which owns Dealer.com, plans to lay off 3 percent of its worldwide workforce — including in Burlington. Hopefully it’s just a speed bump.

SPLISH SPLASH

A Colorado woman completed a 100mile swim around Lake Champlain in 67 hours. She’ll need nearly as long to dry out!

ON A ROLL

Since a spate of traffic deaths, Vermont state police have run and reported on dozens of “saturation patrols” — and have issued many tickets. Stay safe!

1. “What’s Up With That Wild Yard on Shelburne Road?” by Jordan Adams. Seven Days tracked down the owner of the house to ask about his landscaping philosophy. 2. “Fight in Burlington’s City Hall Park Ends in Stabbing” by Sasha Goldstein. One man was jailed after a fight in downtown Burlington last week. 3. “Papers, Please: The Feds Reach Deeper Into Vermont” by John Walters. Border Patrol agents boarded a Greyhound bus in White River Junction earlier this month and demanded identification from nonwhite passengers only. 4. “Policy Wonk Nicole Mace Lands in a Swirling Political Storm” by Terri Hallenbeck. The Winooski lawyer found herself in the center of the most controversial issue during the legislative session that adjourned in May. 5. “No, Neo-Nazi Website the Daily Stormer Is Not Based in Burlington” by Sasha Goldstein. Why does Burlington pop up on the Southern Poverty Law Center’s “hate map?”

tweet of the week: @billmckibben Donald Trump brings to the task of denouncing racism all the passion of a man ordering a cheeseburger through a drive-through microphone FOLLOW US ON TWITTER @SEVENDAYSVT OUR TWEEPLE: SEVENDAYSVT.COM/TWITTER

U.S. since an earthquake devastated their home country in 2010. Their “temporary protected status” was recently extended six months — until January. “We’re going to a beautiful country,” exclaimed a girl who appeared to be about 10 years old, as she hopped out of the taxi — one of several delivering families of immigrants that day. Speaking French, a Haitian man who accompanied her and several other people told a Canadian reporter that the family had travelled from California to Plattsburgh International Airport, where they hired the taxi. At least four families, including one from Syria, crossed on Friday afternoon. They struggled across the border carrying large suitcases, jam-packed duffel bags,

MARK DAVIS

WHAT’S WEIRD IN VERMONT

Refugees wait to cross the Canadian Border in Champlain , N.Y.

Tupperware containers of food, strollers and infants in car seats. Canadian cops told the arrivals to halt and explained that they would be breaking the law if they proceeded into the country.

The people said they understood, and then stepped forward. “It’s a safe place,” a Canadian cop told one of the arrivals, a man who said he was from Syria. “You don’t have to fear Canadian authorities. There’s a process you have to go through, but you can relax, all right?” Vermonters Priscilla Maddocks and Wendy Doane were also on the scene. They had come to hand out water, coffee and snacks. “We want these families to remember an act of kindness before they go into Canada from this country,” Maddocks, a South Hero resident, said. “We don’t want their lasting memory of America to be fear,” said Doane, who is from Westford. “This is not my America.”

LAST SEVEN 5

There’s one reason to take a taxi to the end of Roxham Road in Champlain, N.Y.: the U.S.Canadian border. The remote spot, 30 miles south of Montréal, has become a conduit for people fleeing U.S. immigration crackdowns announced by President Donald Trump. The exodus to Canada started last winter when Trump tried to institute a travel ban on six mainly Muslim countries. But last Friday, most of those seeking refuge were Haitians. The current administration wants to end a program that has allowed them to live in the

JOB SCENE

SEVEN DAYS

OH, CANADA

TOPFIVE

MOST POPULAR ITEMS ON SEVENDAYSVT.COM

08.16.17-08.23.17

? 802much

?? ? ?? ? ??

up ‘white pride’ online, it’s white supremacy. It has negative connotations.” Roy, who grew up in Essex, said his views evolved over time. He used to be a “leftist” before he realized “it didn’t make sense, it was bullshit” and adopted more “libertariantype views.” “I became more conservative as I became more informed, read more — and that’s where I am now,” Roy said. “I’m a person who’s interested in reading, who’s interested in learning, so I’m always refining my opinions and ideas as I learn new information.” Kae Burdo knew him as a teenager. She said he was “angry,” but far from a full-throated white nationalist. “Back then he was just a goth-punk kid, and it never would have occurred to me — it seemed counterintuitive to the crowd we ran with, and especially our close friends.” Seeing Roy in the video “makes my skin crawl,” Burdo said. “We forget that Vermont isn’t immune from this, I think. It’s a moment of the bubble bursting for a lot of folk,” she said. Read about Goldstein’s 25-minute interview with Roy at sevendaysvt.com.

That’s how much grant money northern Vermont communities will receive to fund 10 economic and community development projects. The cash comes from the Northern Border Regional Commission.

SEVENDAYSVT.COM

A Vermonter was among the neo-Nazis and other “Unite the Right” types who shook up Charlottesville, Va., in a march-turned-melée last Saturday. Today’s white supremacists don’t wear hoods, apparently. As soon as their tiki-torch-wielding images went viral, internet vigilantes around the country started naming and shaming them. Locals first recognized 28-year-old Ryan Roy in a VICE News clip. Wearing a backpack and holding a torch, Roy is seen briefly chanting “Whose streets? Our streets!” On Tuesday, deputy news editor Sasha Goldstein tracked down Burlington resident Roy, who admitted to attending the weekend’s events and spoke unabashedly about his “white identitarian” views. “I feel like white people are discriminated against in this country,” Roy said. “You see a lot of stuff in the media and in popular culture portrayed by the left in this country that is, frankly, antiwhite. But that’s not white supremacy. We just want to stand up for our own culture and heritage.” He continued: “If you look up the definitions of ‘black pride’ or ‘Puerto Rican pride’ or ‘Asian pride,’ those will be considered pride in whatever race that is. But if you look

Vermont and federal officials used planes to drop rabies vaccine for nondomestic animals across the state. Apparently it’s the only time feeding the wildlife is allowed.

$2,228,801

ANIMAL PRINTS. Co-owners/founders Pamela Polston & Paula Routly publisher/Coeditor Paula Routly assoCiate publisher/Coeditor Pamela Polston assoCiate publishers/Co-owners

Don Eggert, Cathy Resmer, Colby Roberts NEWS & POLITICS editor Matthew Roy deputy editor Sasha Goldstein politiCal editor Paul Heintz Consulting editor Candace Page politiCal Columnist John Walters staff writers Mark Davis, Alicia Freese,

WE HAVE MOVED!

Terri Hallenbeck, Katie Jickling, Molly Walsh ARTS & LIFE editor Pamela Polston assoCiate editor Margot Harrison assistant editors Dan Bolles, Elizabeth M. Seyler food writer Hannah Palmer Egan musiC editor Jordan Adams Calendar writer Kristen Ravin speCialty publiCations manager Carolyn Fox staff writers Rachel Elizabeth Jones, Ken Picard,

Sally Pollak, Kymelya Sari, Sadie Williams proofreaders Carolyn Fox, Elizabeth M. Seyler D I G I TA L & V I D E O digital editor Andrea Suozzo digital produCtion speCialist Bryan Parmelee senior multimedia produCer Eva Sollberger multimedia journalist James Buck DESIGN Creative direCtor Don Eggert art direCtor Rev. Diane Sullivan produCtion manager John James staff photographer Matthew Thorsen designers Brooke Bousquet, Kirsten Cheney,

We have moved our Granite Group Burlington Branch and Ultimate Bath Store from 180 Flynn Avenue to a new, state-of-the-art home just a few minutes down the road at 20 Gregory Drive (formerly Grainger Supply) in South Burlington, VT

Alex Mauss, Richele Young

SALES & MARKETING direCtor of sales Colby Roberts senior aCCount exeCutive Michael Bradshaw aCCount exeCutives Robyn Birgisson,

Michelle Brown, Kristen Hutter, Logan Pintka marketing & events direCtor Corey Grenier Classifieds & personals Coordinator Ashley Cleare sales & marketing Coordinator Madeleine Ahrens

A D M I N I S T R AT I O N business manager Cheryl Brownell benefits & operations Rick Woods CirCulation manager Matt Weiner CirCulation deputy Jeff Baron mad dog Rufus

CMY

• Plumbing Parts • Tools & Job Site Supplies • Filters & Cartridges • Heating & Oil Burner Parts • Propane Tanks & Supplies • New Baths, Vanities & Fixtures & MUCH, MUCH MORE!

CONTRIBUTING WRITERS Luke Baynes, Justin Boland, Alex Brown, Liz Cantrell, Julia Clancy, Erik Esckilsen, Kevin J. Kelley, Rick Kisonak, Jacqueline Lawler, Amy Lilly, Gary Lee Miller, Bryan Parmelee, Suzanne Podhaizer, Jernigan Pontiac, Robert Resnik, Julia Shipley, Sarah Tuff Dunn, Molly Zapp CONTRIBUTING ARTISTS Harry Bliss, Caleb Kenna, Matt Mignanelli, Marc Nadel, Tim Newcomb, Susan Norton, Oliver Parini, Sarah Priestap, Kim Scafuro, Michael Tonn, Jeb Wallace-Brodeur C I R C U L AT I O N : 3 6 , 0 0 0 Seven Days is published by Da Capo Publishing Inc. every Wednesday. It is distributed free of charge in Greater Burlington, Middlebury, Montpelier, Northeast Kingdom, Stowe, the Mad River Valley, Rutland, St. Albans, St. Johnsbury, White River Junction and Plattsburgh. Seven Days is printed at Upper Valley Press in N. Haverhill, N.H. DELIVERY TECHNICIANS Harry Applegate, Jeff Baron, Joe Bouffard, Pat Bouffard, Caleb Bronz, Colin Clary, Donna Delmoora, Todd Field, Matt Hagen, Bryan Mcnamara, Nat Michael, Bill Mullins, Dan Nesbitt, Ezra Oklan, Brandon Robertson, Dan Thayer, Josh Weinstein With additional circulation support from PP&D.

08.16.17-08.23.17

SEVENDAYSVT.COM

SEVEN DAYS

South Burlington, VT NEW LOCATION 20 Gregory Drive, South Burlington, VT FOR INQUIRIES, PLEASE CONTACT: Tim Palmer Branch Manager (802) 383-4508 tpalmer@thegranitegroup.com

EVERYTHING 6 FEEDBACK

IN: Plumbing, Heating, Cooling, Water & Propane Supplies

Untitled-31 1

SUBSCRIPTIONS 6-month 1st Class: $175. 1-year 1st Class: $275. 6-month 3rd Class: $85. 1-year 3rd Class: $135. Please call 802-864-5684 with your credit card, or mail your check or money order to “Subscriptions” at the address below. Seven Days shall not be held liable to any advertiser for any loss that results from the incorrect publication of its advertisement. If a mistake is ours, and the advertising purpose has been rendered valueless, Seven Days may cancel the charges for the advertisement, or a portion thereof as deemed reasonable by the publisher. Seven Days reserves the right to refuse any advertising, including inserts, at the discretion of the publishers. DISCLOSURE: Seven Days publisher and coeditor Paula Routly is the domestic partner of Vermont Senate President Pro Tempore Tim Ashe. Routly abstains from involvement in the newspaper’s Statehouse and state political coverage. Find our conflict of interest policy here: sevendaysvt.com/disclosure.

P.O. BOX 1164, BURLINGTON, VT 05402-1164 802-864-5684 SEVENDAYSVT.COM FACEBOOK: /SEVENDAYSVT TWITTER: @SEVENDAYSVT

FEEDback READER REACTION TO RECENT ARTICLES

THANKS FROM THE KIBABU FAMILY

Re [“Deaths Prompt Review of Swimming, Safety Programs for New Americans,” July 19]: From the bottom of our hearts, the Kibabu family would like to thank everyone who supported us during the difficult time of the loss of our son and brother Christian Kibabu Poso, who drowned in Lake Champlain on July 10, 2017. We thank you for your love, prayers, lovely cards, expressions of sympathy and for keeping the family in your prayers and contributing in many ways. It will be difficult to include the names of everyone who supported us. Chittenden County and the City of Burlington have once again proven that we are a united community. From old to young, we say thank you. To employees and students, we say thank you. To Vermonters and those who joined us from out of state and other countries, we say thank you. Our special thanks go to: the Burlington Police Department for security provided at our funeral ceremony; Burlington Mayor Miro Weinberger; superintendent of Burlington schools Yaw Obeng; Burlington High School principal Tracy Racicot; the many Burlington students who joined us, and the soccer team; North Avenue Alliance Church for donating their magnificent space for our celebration of Christian’s life; all the people who initiated and supported the

TIM NEWCOMB

GoFundMe campaign, through which we received enough financial support to cover all expenses; All Nations for Jesus Christ worship team and Pastor Joseph Kasongo; the Cathedral Church of St. Paul; and many volunteers. Thank you! The Kibabu Family

BURLINGTON

DISPUTING A DAYSIE

[Re “All the Best,” August 2]: Rusty DeWees is a Vermont icon. He’s very funny, charismatic and points to all our cherished Vermont stereotypes. I love him; Vermont loves him. He is not, however, what I would call a skilled actor. He’s playing the same role he always has, and, presumably, it’s a character that simply accentuates his own characteristics. I question how much rehearsal and preparation this takes. I question how often he changes his material. A talented fellow and a kind man, but is he an actor? Maybe. Is he the best actor in the state? Absolutely not. This year, the Seven Daysies competition was highly contested. Bob Bolyard, aka Amber LeMay, is the genius behind House of LeMay, one of the most celebrated drag shows in the state. If you’ve never met Amber, you have no idea what you’re missing. The shows are hilarious, smart and many times politically poignant. This is art enriching the community. Serena Magnan O’Connell is one of the major divas of Lyric

WEEK IN REVIEW

Theatre Company. She has had countless stellar roles over the years, and her ability to capture an audience is unparalleled. She could belt the stubble off Rusty’s face. Last and certainly not least is Kim Anderson. Also a Lyric actor, her stunning charm and killer voice rock the Flynn stage. She is a philanthropist and works tirelessly for her art. I’m writing on behalf of these three incredible artists, unbeknownst to them, to say: They — not Rusty — should have won. Grady Shea

BURLINGTON

Editor’s Note: DeWees had a long and fruitful acting career before he created his popular “Logger” show. He appeared in numerous Jay Craven films and plays such as David Budbill’s Judevine and a Vermont production of Buried Child, by Sam Shepard.

NO BULL

Dan Cohen

BURLINGTON

It’s hard to take seriously the food critic who calls organ meat “weird” [“Middlebury’s Coriander Aims to Please,” July 25]. MIDDLEBURY

LAWN GONE

Racconto 8 Whole Grain Pasta Spaghetti

$1.99

Back to Nature Gluten Free Granola Cranberry Pecan

$1.99

Look for the green dog logo on the door of participating stores and enjoy shopping with your best friend!

CHEESE SHOP DEALS

www.essexshoppes.com facebook.com/pages/essexvt 21 Essex Way, Essex Junction, VT | 802.878.2851

Stella, Mediterranean Parmesan 8oz

Reg. $8.99ea Sale $3.99ea

west branch gallery

Untitled-6 1

Ile De France Goat Cheese Garlic & Herb or Honey 4oz

Reg. $6.99ea Sale $2.49ea Cinco Lanzas 16 Month Manchego with Wine

Reg $18.99/lb Sale $12.99/lb

8/15/17 10:23 AM

K AT HL EEN K OL B

WINES OF THE WEEK Murdoch James High Block Pinot Noir 2013 91 Points Wine Enthusiast

$19.99

Vin de Savoie Rosé 2016 Bright orange-pink Rosé

$9.99

Blue - Vinho Verde 2016 The perfect summer drink

$5.99

CORRECTION

OUR VT CHEESE SPECIAL OF THE WEEK!

In last week’s “Fair Game” column entitled “Papers, Please,” the quotation “Strict vetting is already done at our borders” should have been attributed to U.S. Sen. Patrick Leahy (D-Vt.).

Von Trapp, Mad River Blue REG $23.49/lb SALE $21.49/lb

GALA AUG 19, 6-8

SAY SOMETHING! Seven Days wants to publish your rants and raves. Your feedback must... • be 250 words or fewer; • respond to Seven Days content; • include your full name, town and a daytime phone number. Seven Days reserves the right to edit for accuracy, length and readability. Your submission options include: • sevendaysvt.com/feedback • feedback@sevendaysvt.com • Seven Days, P.O. Box 1164, Burlington, VT 05402-1164

C HARL I E B LUE T T

1186 Williston Rd. So. Burlington, VT 05403 (Next to the Alpine Shop) 802.863.0143 Open 7 days 10am-7pm cheeseandwinetraders.com

4v-cheesetraders081617.indd 1

FEEDBACK 7

[Re Whiskey Tango Foxtrot: “What’s Up With That Unmowed Yard in Burlington’s South End?” August 2]: There are many reasons why Linus Owens’ decision to let his grass grow makes sense here, anywhere and everywhere. I applaud him and his housemate

DOG

$3.99

SEVEN DAYS

Alyth Hescock

P SWHITO H YOUR

Woodstock Pine Nuts

08.16.17-08.23.17

‘WEIRD’ COMMENT

VERY BEST DEALS OF THE WEEK!

Sharon Kelly

MONTPELIER

SHOPPES

SEVENDAYSVT.COM

Ray Duquette Sr., president of the Rutland County Farm Bureau, wrote to Seven Days that he inspected the farmer’s fence [Feedback: “So Many Tragedies,” August 9]. He is clearly one of many who fail to grasp the important picture related to the farmer-caused fatality [Off Message: “No Prison Time for Man Whose Loose Bull Caused Fatal Wreck,” June 28; “Farmers Riled Over Decision to Charge Bull’s Owner in Fatal Crash,” June 15, 2016]. The motorist’s death had nothing to do with whether the farmer’s fence was intact. The causal factor in the fatal crash was that a passing trucker told the farmer of the escaped bull before the motorist was killed, and the farmer did nothing to ensnare the loose animal. The farmer is guilty of nonfeasance, minimally, and a good bit more. End of story.

Jessica Evans for choosing to save on greenhouse gas emissions, allowing for pollination and biodiversity, increasing the quiet in the neighborhood, and abstaining from toxic chemicals and fertilizers which manicured lawns often rely upon, albeit unnecessarily. It’s time that more property owners follow his lead and vote for the planet by way of eliminating gas-powered mowers, supporting pollinators, and increasing the peace and serenity of our neighborhoods. Many environmentally friendly alternatives to lawns are available with a little bit of planning. One could plant a vegetable or flower garden, native grasses, lowgrowing ground covers, a rock garden, a variety of trees, a meadow, etc. According to Lakis Polycarpou, a freelance writer who blogs for Columbia University’s State of the Planet website, American lawns take up 30 to 40 million acres of land, accounting for approximately 5 percent of air pollution, pesticides and fertilizers causing runoff and water pollution, and 30 to 60 percent of urban freshwater use. It seems highly worthwhile to come up with more sustainable uses for our neighborhood properties, as Owens did. I am happy to support city officials who can offer incentives and new ideas to encourage and support homeowners who want to transform their monoculture lawns into a true “green” biodiverse landscape for themselves, future generations, and for the overall health of the Earth and all of its inhabitants.

8/14/17 1:18 PM

at the flynn

Season Sponsor

17/18 on sale order by September 15 & save up to 15%

john cleese presents Monty Python and the Holy Grail Thursday, September 21 at 7:30 pm (Limited tickets available)

jersey boys

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

Tues.-Wed., October 3-4 at 7:30 pm (Limited tickets available)

jazz at lincoln center orchestra Friday, October 6 at 8 pm (Limited tickets available)

this summer

compagnie herve koubi

fall classes begin sept. 11

Sunday, October 8 at 7 pm

flynnarts.org | 802-652-4537 daniel tigerâ&#x20AC;&#x2122;s neighborhood live! arturo oâ&#x20AC;&#x2122;farrill Wednesday, October 11 at 6 pm

sean dorsey dance The Missing Generation

and Ensemble in Residence Thursday, August 10

Friday, October 20 at 8 pm

www.flynncenter.org P E R F O R M I N G

Untitled-30 1

A R T S

8/4/17 11:01 AM

Untitled-9 1

8/15/17 11:55 AM

contents

LOOKING FORWARD

fresh

AL ISS IM

AUGUST 16-23, 2017 VOL.22 NO.49

NEWS 14

Trouble Bruin: Vermonters Are Reporting More Problems With Bears

BY MOLLY WALSH

Old Dog, New Trick: Vermont Wields Enhanced Animal Cruelty Law

Clearly, life is better with furry friends. Or feathered, or scaly. Pets inspire this annual issue, but so do stories about wildlife (“nuisance” BEARS) and barnyard beasts (an egg-delivering DONKEY — yes, really). In these pages, we learn about two social-media endeavors in Burlington: the RAD GIRLS CLUB, which finds homes for adoptable pups; and marketing firm SNIFF & BARKENS, which creates dog-centric content for clients. We check out HAPPY TAILS PET RESORT AND SPA for the latest in pampering and visit a women’s shelter that takes in pets, too. We tag along for a K-9 SEARCH-AND-RESCUE training session, find out why artist CORRINA THURSTON draws animals, and ask about the theme of this year’s giant corn maze in Danville. (Spoiler: It’s TEDDY BEARS.) Paws what you’re doing and read ’em all!

FEATURES 32

Nurse Shortage Puts Vermont Parents On the Hook for Kids’ Care

Excerpts From Off Message BY SEVEN DAYS STAFF

In Quebec, a Sparkly Forest Offers Fairies and Enchantment

BY MOLLY ZAPP

In Wake of Illness, Artist Finds Her Niche Drawing Animals BY SADIE WILLIAMS

BY SALLY POLLAK

Out Standing in the Field BY RACHEL ELIZABETH JONES

VIDEO SERIES

Hide and Seek

12 26 28 43 67 71 74 80 90

Fair Game POLITICS Work WTF Side Dishes FOOD Soundbites MUSIC Album Reviews Art Review Movie Reviews Ask Athena SEX

straight dope offbeat flick mr. brunelle explains it all deep dark fears this modern world edie everette iona fox red meat jen sorensen harry bliss rachel lives here now free will astrology personals

SECTIONS 11 21 48 63 66 74 80

30 83 84 84 84 84 85 85 86 86 86 87 88

CLASSIFIEDS

The Magnificent 7 Lifelines Calendar Classes Music Art Movies

vehicles housing services buy this stuff homeworks music legals fsbo crossword calcoku/sudoku puzzle answers jobs

Animal Issue: For searchand-rescue canines, finding victims is all in a day’s work – and play

C-2 C-2 C-2 C-2 C-3 C-3 C-3 C-4 C-5 C-7 C-8 C-16

AUG 16 - AUG 29 available while supplies last

1.99

lb SHADOW CREEK FARM

reg. $2.99 lb

Organic Cucumbers

BY JULIA SHIPLEY

Tasty Transition

Food: Vermont Artisan Village bridges farms and greater Burlington BY SALLY POLLAK

Vermont Artist to Record Solar Eclipse BY RACHEL ELIZABETH JONES

Pet Peace of Mind

Animal Issue: Animals and people share shelter in Lamoille County

COLUMNS + REVIEWS FUN STUFF

Hee Haul

6.99

Food: Vermont Compost’s donkey team delivers eggs BY SUZANNE PODHAIZER

lb Tilapia Filet

reg. $9.99 lb

Seeking Angels

Music: How Abraham Lincoln and the Civil War inspired Brian McCarthy’s latest album BY JORDAN ADAMS

SEVENDAYSVT.COM

Tails of Wow!

Animal Issue: A new upscale pet resort and spa coddles creatures BY KEN PICARD

ARTS NEWS 22

Radical Rescue

Animal Issue: Burlington women seek redemption for adoptable dogs BY SADIE WILLIAMS

BY ALICIA FREESE

Animal Issue: On the love and loss of my best friend BY DAN BOLLES

BY MARK DAVIS

A Boy and His Dog

Online Thursday PAGE 14

Ursine encounters on the rise

8.99

lb MCKENZIE Black Forest

reg. $9.99 lb

Ham

Sliced to Order in the Deli

SEVEN DAYS

VERMONT’S INDEPENDENT V OICE AUGUST 16-23, 2017 VOL.22 NO.49 SEVENDAYSVT.COM

08.16.17-08.23.17

HI, NEIGH-BEAR

the animal issue FURRY FEELS

PAGE 32

Remembering a best friend

Sollberger joins a cast of familiar faces for a whirlwind musical adventure celebrating the 500th episode of this award-winning video series.

COVER IMAGE MATTHEW THORSEN COVER DESIGN REV. DIANE SULLIVAN COVER MODEL TANK

PAGE 40

DONKEY DELIVERY

PAGE 46

Hoofing it to market in Montpelier

82 S. Winooski Ave, Burlington, VT Open 7am - 11pm every day (802) 861-9700 www.citymarket.coop Untitled-4 1

CONTENTS 9

Underwritten by:

Stuck in Vermont: Senior multimedia producer Eva

TO THE RESCUE

A K-9 trainee at work, and play

8/14/17 10:17 AM

17-Summer-Sale-BTV_PrintAds_FINAL_x1a.pdf

7/31/17

4:50 PM

join us for

brunch at the great northern

saturday satur a day atur a + sunday ay a ay 716 PINE STREET. BURLINGTON, VT thegreatnorthernvt.com

8/15/17 10:14 AM

Untitled-3 1

8/4/17 3:24 PM

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

Untitled-3 1

Untitled-8 1

8/15/17 10:35 AM

LOOKING FORWARD

the

MAGNIFICENT MAGNI FICENT

FRIDAY 18

Tell It Like It Is

MUST SEE, MUST DO THIS WEEK

Voices from the Green Mountain State’s past resonate in Burlington’s First Unitarian Universalist Society on Friday. The Vermont Media Collective’s 1973 documentary Vermont Speaks for Itself sheds light on challenges faced by the state’s low-income and working population through first-person interviews and narration. Live music, refreshments and a Q&A accompany a screening of the newly digitized project.

C OMPI L E D BY K RISTEN RAVIN

SEE CALENDAR LISTING ON PAGE 54

TUESDAY 22-THURSDAY 24

Game, Set, Match

FRIDAY 18

Top-ranked teen Frances Tiafoe Jr. and former No. 2 player in the world Tommy Haas are just two of the tennis stars to take to the court in the Stowe Mountain Lodge Classic. Professional players aim for aces in this three-day tournament, honing their skills in preparation for this summer’s U.S. Open.

TRUE CRIME

Theater lovers and history buffs find common ground in actor and playwright Oliver Wadsworth’s oneman show The Tarnation of Russell Colvin. Based on the real-life 1812 murder of an eccentric Vermonter, this one-night-only performance features Wadsworth bringing the past to life in multiple roles. The action ensues at the intimate Vermont Coffee Company Playhouse in Middlebury.

SEE CALENDAR LISTING ON PAGE 60

FRIDAY 18

Music History In a special CD-release event at the Highland Center for the Arts, Vermont saxophonist Brian McCarthy presents his take on popular songs of the American Civil War alongside original compositions inspired by the era. The Brian McCarthy Nonet captivate Greensboro-area jazz fans with historically inspired numbers from their release The Better Angels of Our Nature.

SEE CALENDAR LISTING ON PAGE 55

SEE STORY ON PAGE 66

Avian Art WEDNESDAY 23

Main Characters

Oldies But Goodies The ninth summer Lake Champlain Chamber Music Festival is a celebration of tradition. Titled “Lineage,” the nine-day fête features classical musicians reflecting on the genre’s old masters and their enduring influence. In the festival’s Sunday Concert, artistic director Soovin Kim is among the players to honor composers such as Ludwig van Beethoven, Johann Sebastian Bach and Johannes Brahms. SEE CALENDAR LISTING ON PAGE 58

MAGNIFICENT SEVEN 11

PHOTO COURTESY OF RIIKKA

SUNDAY 20 SEVEN DAYS

SEE CALENDAR LISTING ON PAGE 61

SEE REVIEW ON PAGE 74

08.16.17-08.23.17

“This is the book I wish I’d had when I was a teen” author Sarah Prager told the School Library Journal in an interview. She was speaking of her 2017 title Queer, There, and Everywhere: 23 People Who Changed the World, a chronicle of historic LGBTQ figures. The founder of the LGBTQ history app, Quist, discusses her New England Book Award-nominated page-turner at Phoenix Books Burlington.

“What would ornithology be without math?” This question guides “Birding by the Numbers,” a current exhibit at Huntington’s Birds of Vermont Museum. Twenty-three area artists, including Katherine Moran, Colin Talmage and Linda Di Sante, use their talents to explore the connection between winged wonders and numbers. Amy Lilly swoops in with a review of the work.

SEVENDAYSVT.COM

ONGOING

Vase Design Workshop

FAIR GAME

Leahys in Love

n August 25, Sen. Patrick Leahy (D-Vt.) and his wife, Marcelle, We Love will celebrate a milestone that Weddings few people reach: their 55th wedding anniversary. They remain very Bring Your Join us at our much in love, and, although the senator Own Vase Ferrisburg Farm is the one in the spotlight, they consider Saturday • August 26TH • 11AM till 12:30PM themselves equal partners in life. For the past 14 years, however, there’s 991 Middlebrook Rd • 1 mile from Route 7 in Ferrisburg VT been a bit of a shadow overhead. In 2003, Organic Farmstore, too! ph: 802.877.3476 Marcelle Leahy was diagnosed with melanoma, a type of skin cancer that can Visit • flowerpowervt.com to reserve your spot! spread. It was successfully treated, but there’s the constant threat of recurrence. In a joint telephone interview Untitled-24 1 8/3/17 3:34 PM last spring — Marcelle Leahy was at their Virginia home; the senator at his office in Washington, D.C. — they both acknowledged their mutual concern. “We worry about each other, and our kids do, too,” he said. “We try to take care of each other.” “I worry about losing my spouse almost on a daily basis,” she said. It’s the inevitable downside of a lifelong relationship that’s been the bedrock of Sen. Leahy’s political career. “They function as a unit at all times,” says CAROLYN DWYER, Leahy’s campaign manager since 1998. “They just enjoy being together. There is no space between the two of them.” Beltway lobbyist LUKE ALBEE, who served on Leahy’s Senate staff for more than two decades, says the Leahys were considered a team. “Having sat in on hundreds of scheduling meetings, the No. 1 question is: Is Marcelle able to do it with him?” Albee says. “Because if she is, it maximizes the chance that the event is going to be good. To the extent that Conquer your weekend there’s a Patrick Leahy whisperer, it’s Marcelle.” NOW with Notes on MATT GERSON, a former Leahy aidethe Weekend. This turned-lobbyist for the Universal Music e-newsletter maps Group, points to an advertisement for Leahy’s 2016 reelection campaign. It’s out the best weekend set in a school cafeteria, where the events every Thursday. couple are lunching with schoolkids. At the end, he pilfers a piece of food from her plate. They share a laugh, and she Visit sevendaysvt.com/ leans her head into his shoulder. enews to sign up. “It wasn’t scripted,” says Gerson. “You can’t fake that … It’s like they’re high school sweethearts still.” “They are a strong couple, and to me they epitomize the word ‘partnership,’” said longtime Leahy friend Sen. JOHN MCCAIN (R-Ariz.), in an interview before his recent diagnosis with brain cancer. sevendaysvt.com/enews “Pat would be the first person to tell

WEEKEND WARRIOR?

12 FAIR GAME

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

ARE YOU A

6v-HouseNOW060116.indd 1

5/31/16 4:13 PM

OPEN SEASON ON VERMONT POLITICS BY JOHN WALTERS

you his effectiveness as a U.S. senator has been dramatically enhanced by the wonderful relationship that exists between the two of them.” The Leahy-McCain ties go deep. They’ve served together in Congress since the early 1980s. But they also share up-close-and-personal experience with melanoma. McCain has had four melanomas, the first in 1993. He refers to Marcelle Leahy as his “melanoma buddy.” Her health scare began in January 2003 with a routine dermatology appointment that led to the cancer diagnosis. She wasn’t out of the woods until July of that year, but she considers herself lucky. “It went on for a while, but my treatment was surgery,” she noted. “I never had to have chemotherapy or radiation.”

IT’S LIKE THEY’RE

HIGH SCHOOL SWEETHEARTS STILL. M AT T GE RS ON

She still faces a lifetime of medical vigilance. She visits a dermatologist at least once every six months, and almost every time she has to have something removed or tested. “I’ve managed to crop up with all three kinds of skin cancer,” she said. Her husband laughed. “Lucky you!” “I’m just a little factory here,” she replied. The Leahys are strong advocates for cancer research and prevention — but their dedication began long before 2003. “Before Marcelle’s diagnosis there was PAT BARR,” says Dwyer. Barr was a Bennington resident, a longtime Democrat and a Leahy supporter who was diagnosed with terminal breast cancer in 1987 and given five years to live. She survived for 16 years and spent much of her time as a fierce advocate for breast cancer research. “She went to the senator and he became her champion,” says Dwyer. The two of them fought for increased federal

funding to fight breast cancer, and Leahy continues that fight to this day. “I’m not going to have the scientific ability to cure cancer or help somebody with cancer, but I do have the ability to get resources for people with cancer,” he said. “And in whatever remaining years I’m here, I intend to use that.” The Leahys are also active in nongovernmental fundraising. They are staunch supporters of Tracy’s Kids, a nonprofit founded and led by Gerson, a childhood cancer survivor. The group provides art therapy for children with cancer and their siblings. Marcelle Leahy has served on its board of trustees from day one. “I’ve had 19 fundraisers over 19 years,” says Gerson. “They show up every time.” Marcelle Leahy is often called upon to speak in public, which isn’t her forte. “She’s naturally a shy person,” says Albee. “This is one of those issues where she really, really found her voice.” She’s also active in simple ways, like keeping a basket of sunscreen at their front door. “Our children and grandchildren all get the lecture,” said Sen. Leahy. “They all get slathered with sunscreen. It’d be like, ‘Okay, here she comes! Put the sunscreen on!’” “She has this way of getting people to immediately put a note in their appointment book,” says THERESA ALBERGHINI DIPALMA, a former Leahy staffer who’s now senior vice president for marketing and external affairs at the University of Vermont Health Network. DiPalma is dark-skinned and never thought of seeing a dermatologist until Marcelle Leahy insisted. “And oh, my God, I was told I had melanoma. So if it wasn’t for her, I … don’t know if I would have gone,” she says, fighting back tears. Marcelle Leahy said her involvement is only natural. “It seems like cancer is a club that nobody wants to join, but once you’re there you have an understanding,” she said. “You have cancer; I have cancer; we’re survivors. It’s that instant bond.” That’s wonderful, but still, it’s cancer. She will be at risk for the rest of her life. That’s got to occupy some small dark corner of the Leahys’ minds. They’ve been inseparable for their entire adult lives — but time passes, and the ultimate separation looms. “Everybody dies at some point,” says Albee. “And what’s clear for both of them

GOT A TIP FOR JOHN? JOHNWALTERS@SEVENDAYSVT.COM

is, whenever that time comes — we hope it’s not for many, many, many years — there will be a huge void. There’s no question about that.”

Revolving Door Spins Again A longtime fixture of the Statehouse scene has taken a new job. SARA TEACHOUT, who spent 16 years in the legislature’s Joint Fiscal Office, is now head of government, public and media relations for Blue Cross and Blue Shield of Vermont. It’s a big change in a couple of ways. First, JFO staff members generally don’t speak to the press. Now, communicating with reporters is part of Teachout’s job. But it’s not the biggest part. “The primary focus is during the legislative session, tracking bills that affect health care,” she says. Yep, she’s a lobbyist. You may recall that Vermont’s shiny new ethics law bars former lawmakers and executive officers from becoming lobbyists for at least one full year. It was meant to block the “revolving door” between public service and lobbying. But the one-year rule does not apply to legislative staffers or other state employees. Teachout started at Blue Cross on June 19, when the legislature was still trying to close the books on the 2017 session. Not only that, but she agreed to take the new job in March — and continued to serve in the JFO for three full months. She did reach a written agreement with her boss, STEPHEN KLEIN, barring her from any involvement in health care issues for the remainder of the session. “We wanted to avoid any appearance of conflict,” Teachout says. “Steve was very conscientious about conflict when he asked me to stay on.” Klein and Teachout took care to avoid conflict before she left the JFO, but next January she’ll be lobbying the people she used to work with. PAUL BURNS, executive director of the Vermont Public Interest Research Group, presents a case for legislative staff to be included in the one-year rule. “Legislators generally give great deference to the staff at Legislative Council and JFO,” he says. “The revolving door policy should

probably cover JFO and Legislative Council as well.” “Probably,” eh? Teachout understands the concern but doesn’t believe there will be a conflict. “I focused on tax policy [at JFO],” she explains. “I didn’t work on health care issues, so I’m switching areas as well as roles.” Certainly true. But she was a trusted resource for lawmakers for many years. The next time they see her, she’ll be representing a special interest.

Speaking of Ethics Well, the 2018 campaign has spawned its first dirty trick. Last week, we received an email from STAN HARDY announcing jamesehlersforgovernor.com, ostensibly a website for JAMES EHLERS’ Democratic candidacy for governor. But the website is a phony. It’s an allout, mean-spirited attack on Ehlers the person and the political activist. For instance, the site’s motto is “Crazy You Can Believe In.” Its mailing address is 350 Fisher Road in Berlin – the Vermont Psychiatric Care Hospital. Because, you know, mental illness is funny. “Bush league stuff, really,” says Ehlers, who calls the website proof that “Vermont is no longer an island” protected from the harsh realities of national politics. The site is also in violation of state campaign law, according to WILL the secretary of state’s SENNING, elections director. “I believe it constitutes electioneering,” he says. “That includes material that supports or attacks a candidate.” Any such material must name the responsible party and provide contact information. The website’s information is clearly fictitious, but “We don’t check addresses on every election piece that comes out,” says Senning. If a complaint is filed, the secretary of state would refer it to the Office of the Attorney General for investigation. Ehlers won’t be filing. “I’m not going to spend any more time on it,” he says. We won’t either, although we’d love to hear from its creator. Hey, “Stan,” if you’re proud of your contribution to our political culture, step out of the shadows and give us a call. 

ANNIVERSARY SALE EVENT!

Celebrating 40 very comfortable years!

WOW! IS OUT!

THE WORD INCREDIBLE

BUYS!

POLITICS

ONCE IN A LIFETIME PRICING!

STOP IN FOR

BIRTHDAY CAKE DAILY!

30-50% off our entire selection of bedrooms and dining rooms (including Vermont made)

www.townandcountryvt.com

*see store for details.

2V-T&C081617.indd Untitled-17 1 Untitled-7 11

7/24/17 8/14/17 4:59 7/17/17 12:39 1:38 PM PM

FAIR GAME 13

1515 Shelburne Road Burlington, VT 05403 Mon-Sat. 10am-5pm; CLOSED Sunday

SEVEN DAYS

FREE

40% off all our luxurious sofas, loveseats, chairs,sectionals, sleepers (special orders included)

08.16.17-08.23.17

STOREWIDE

SEVENDAYSVT.COM

40%OFF

MAL ISS NI

Trouble Bruin: Vermonters Are Reporting More Problems With Bears

LOCALmatters

B Y M O LLY WA LSH

14 LOCAL MATTERS

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

avid Kachajian was washing dishes at home in Richmond last month when something caused his border collie to wake up from a nap and growl. Kachajian heard a scratching noise at the front door. Maybe it’s the UPS guy, thought Kachajian, a Swanton police officer who is not easily rattled. He walked to the front hall and gazed in shock at an unwelcome visitor on the other side of the glass door: a large black bear standing on its hind legs, doing a full-body press as if to burst through and enter. “I couldn’t believe what I was seeing,” said Kachajian, who estimates the bear weighed around 400 pounds. “He just looked in, straight at me.” Kachajian pulled out his off-duty .40mm handgun but didn’t fire. He wasn’t sure the weapon would have packed enough power to dispatch the bear. Plus, he didn’t want to kill the animal, so he shouted and banged on the doorframe to scare it away. The broad-daylight encounter on July 28 was one of an increasing number of problem-bear incidents across Vermont this summer. Officials are warning residents and visitors, from suburban homes to backcountry campsites, to be bear aware. The Green Mountain State is home to one species of bruin: Ursus americanus, the American black bear, is smaller and less aggressive than its cousin, the brown bear, aka the grizzly. Nonetheless, adult males can weigh more than 500 pounds. Fatal maulings are rare, but as the number of black bears grows nationally, more confrontations have been reported — including some deadly ones. In two separate attacks in Alaska this June, black bears killed a 16-year-old trail runner and a mining contractor. Closer to home: In 2014, a Rutgers University student was killed by a black bear in New Jersey’s Apshawa Preserve while hiking with friends. Black bears have fatally attacked three dogs in Vermont so far this

summer. In separate incidents three weeks apart, bears killed two dogs in Wilmington. One was on a retractable leash in a yard; the other confronted a bear that had ambled onto its front porch. The third mauling happened in Pownal on July 4. A bear startled a family walking their Chihuahua off leash in the woods near their house. “The barking dog ran up to the bear,” which “swatted” and bit the canine, according to Forrest Hammond, a bear biologist with the Vermont Fish & Wildlife Department. Hammond called all three incidents “cases of self defense” on the part of the bears. “There’s a lot of history between bears and dogs that probably goes back to prehistoric times, where wolves and dogs and coyotes were mortal enemies of bears,” said Hammond. Game wardens and wildlife officials recommend dog owners leash their pets. Like moose, bears were largely wiped out in Vermont in the 1800s by

wary rural townspeople who hunted them down and also cleared their forest habitat. Beginning in the 1960s, the bear population began to rebound as some of that land became reforested. About five years ago, the bear population hit an estimated 7,500 — too many to roam without coming in conflict with people, according to state Fish & Wildlife biologists. So the department lengthened the bear-hunting season, which helped reduce the population to an estimated 6,000 today. Still, Hammond said, this summer has generated what seems like a record number of bear complaints. In Cambridge, one of the massive mammals burst through a screen window and ransacked an elderly couple’s kitchen — and then tried to repeat the snack-attack on four subsequent nights. Game wardens hauled in a culvert trap, caught the animal and shot it dead. The U.S. Forest Service, meanwhile, has posted flyers at trailheads and tent

sites in the Green Mountain National Forest warning visitors to properly secure food from bears in search of s’mores and hotdogs. “They are returning for a second and possibly a third helping in some cases,” said Ethan Ready, a Forest Service public affairs officer based in Vermont. Responding to similar complaints, the Green Mountain Club this summer helped to install two new “bear boxes” — secure metal bins with latches that are chained to trees at shelters on the Long Trail. Like the Forest Service, the GMC is reminding people to hang food in trees and out of reach if it can’t be secured in a car or such a bin. Three similar bear boxes were carted up Camel’s Hump in 2015 after a hungry bruin repeatedly rummaged through campsites, searching for food, and rangers had to shut down the sites temporarily. Most of Vermont’s recreation areas don’t have bins because they haven’t been necessary. Until now. Last year, Fish & Wildlife logged a record 866 reports of humanbear conflicts — up from 191 in 2006. They include bears that go into yards and campgrounds for food, eat livestock, and knock down bird feeders. “The incidents are definitely on the rise. They’ve increased every year for the last decade,” said Tom Rogers, a Fish & Wildlife information specialist. “It’s been a very steady upward trajectory.” More bears, too, are dying in what Fish & Wildlife calls “incidental” kills. The 2016 tally includes 159 bears killed by motor vehicles; 33 killed by wardens or citizens who were protecting animals or property; seven bears killed illegally; and four deaths classified as “unknown” or “other.” The total number — 203 — was almost four times the 56 reported 10 years ago. Bears that push their way into houses and tents don’t tend to change their behavior, so it doesn’t make sense

GOT A NEWS TIP? NEWS@SEVENDAYSVT.COM

STORE CLOSING!

HUGE GOING OUT OF BUSINESS SALE

to tranquilize and move them, wildlife officials say. If the threat is deemed significant, game wardens typically opt to euthanize the bear or authorize a property owner to shoot it. At least 10 Vermont bears have been put down that way so far this year, nine by property owners and one — the hungry bear in Cambridge — by a game warden. Attacks on humans in Vermont are extremely rare. The most recent fatal black bear attack happened in 1943, when a hunter in Townsend was apparently mauled to death. A woman on her deck in Cabot survived a bite to the leg in 2011. She’d been feeding bears, even though officials warned her against it, Hammond said. “That’s the only injury to people that we know of that we’ve had in recent times,” he said. Sightings, though, have sparked intense interest in the state. Earlier this month, a Fish & Wildlife talk about bears drew 70 people in Waterbury. Asked if they had experienced recent bear problems, about a third of the people raised their hands, according to Rogers, who gave the talk. “That’s pretty high for an animal that’s generally pretty secretive and tries to stay away from people,” said Rogers, who focused on bears for his master’s degree in wildlife biology. He dispensed the usual advice on keeping bears away: Secure garbage in sheds or latched containers; don’t put meat or cheese in compost piles; and don’t put out a bird feeder between April and November. “We like to call birdfeed the gateway drug,” Rogers said. “That’s what teaches the bear that your backyard is a really great place for food.” What’s going on with the bear behavior? No one’s quite sure, but the animals seem more comfortable around people

than they did before. Burlington had a bear sighting at a University of Vermont dumpster in 2014. “They’ve just begun to adapt to live closer to people than they had in the past,” Hammond said. In some areas, they have no choice. Development in Vermont is pushing into lots that are close to forest, encroaching on bear habitat. The people who live there may not be equipped to shoot problem bears. “I think back when my grandfather had his farm, he would not have called somebody if he was having a problem with a wild animal,” Hammond said. “I think he would have taken care of it, and the animal would have ended up in the cooking pot.” The deep scratches on their deck and shingles remind David Kachajian and his wife, Jennifer, of what he called “too close of an encounter” in Richmond. The couple has taken steps to avoid luring bears to their home, which is on steep, wooded terrain near Bolton Valley ski area. Earlier this summer — before the bear reared up at their front door — a bear or bears repeatedly tipped over their trash and feasted on the spoils. They’ve since secured the bins with cord and placed rocks on the lids. They don’t have a bird feeder and don’t compost. They don’t even leave their ground floor windows open anymore. After the bear’s visit to their deck, the couple called the local game warden, who told them they would be within their rights to shoot the bear should it come banging on the door again. “Would I want to shoot it? No,” said David. “But if it did become a pest, I suppose we would have to do what we have to do.” m

OFF

Sidewalk Sale 1/2 OFF Select Items Saturday 8/19

OR MORE ON EVERYTHING IN THE STORE!

IN CAMBRIDGE, ONE OF THE MASSIVE MAMMALS BURST THROUGH A SCREEN WINDOW AND RANSACKED AN ELDERLY COUPLE’S KITCHEN —

AND THEN TRIED TO REPEAT THE SNACKATTACK ON FOUR SUBSEQUENT NIGHTS.

Last chance to get these prices on North Face gear!

ALL North Face Parkas 1/2 OFF Regular Price!

ALL North Face Shoes 1/2 OFF Regular Price!

ALL North Face Sleeping Bags 1/2 OFF Regular Price!

90 Church Street, Burlington, VT 05401

Sale Hours: Monday-Saturday 10:00-8:00 Sunday 11:00-6:00

Look for the Orange and Yellow Signs!

Last Chance to get these prices on North Face Gear! New sizes and styles coming from warehouse daily.

Contact: molly@sevendaysvt.com Untitled-26 1

8/14/17 2:15 PM

LOCAL MATTERS 15

Sale Terms: Cash Visa / MC Discover American Express All Sales Final

SEVEN DAYS

ALL Accessories 20% OFF Regular Price!

08.16.17-08.23.17

ALL Ski Jackets 20% OFF Regular Price!

SEVENDAYSVT.COM

ALL Fleece 20% OFF Regular Price!

MAL ISS I N

Old Dog, New Trick: Vermont Wields Enhanced Animal Cruelty Law

LOCALmatters

B Y MA R K D AV I S

SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS 16 LOCAL MATTERS

COURTESY OF ASHLEY HUSK

shley Husk was at home in Ferrisburgh, and nine months pregnant, when she heard a distant gunshot on August 8. She stepped outside to see her dog, Keira, running down the street toward her. Husk wasn’t surprised; loud noises had always startled the animal. But once inside, Keira paced nervously and wouldn’t sit down. Husk saw that the dog’s hindquarters were covered in blood. She combed through Keira’s thick fur and realized the animal was bleeding from multiple wounds. Husk rushed Keira to the Vergennes Animal Hospital, where vets pulled more than 40 birdshot pellets from the 10-year-old Great Pyrenees and huskie mix. A neighbor, Michael Roberts, 57, had fired birdshot at Keira from close range after she wandered onto his front yard, authorities say. State police arrested him on a felony charge of aggravated animal cruelty — the first such case since a fortified law went into effect on July 1 allowing harsher penalties for that offense. Roberts is due in Addison Superior Court next month. During a brief interview in his front yard, Roberts said he intends to fight the charge in court and suggested that there is more to the story. “It’s a neighborhood thing,” he said. “It’s not something I wanted to do.” He declined further comment. Husk, 29, seemed genuinely puzzled by her neighbor’s actions. She said neither she nor her husband, Andy, was feuding with him. Roberts lives across Sand Road about 100 yards from her family’s home in a quiet, rural area between Lake Champlain and a patchwork of dairy farms. She said Roberts had never complained — or even mentioned — that Keira was wandering onto his property or causing any problems. “If he had, we would have put an end to it,” Ashley Husk said. In an imaginary interaction with Roberts, she addressed her neighbor: “If you don’t want her on your lawn, that’s fine. But why would you shoot the animal?” She added, “You can’t just get angry and resolve your anger with a firearm. You have to be an

Keira

At the veterinarian’s office

Keira with family

X-ray showing birdshot

adult and talk to people if you have a problem.” Husk said she and her husband aren’t close to Roberts but have enjoyed a cordial relationship with him: They chatted pleasantly at a mutual friend’s wedding in July, she said. Her husband confronted Roberts after the shooting, according to Husk, who said that Roberts invoked Ferrisburgh’s leash ordinance as a justification for

what he did. The town bans dogs from running free and empowers an animalcontrol officer to impound wandering dogs. Husk acknowledged that Keira has free rein of their 20 acres but said the dog rarely leaves the property. Animal-control conflicts are part of life in Vermont. But a recent cruelty case revealed the wanton brutality so many innocent creatures face. In October 2016, a Barre man, Quinton Clayton,

trained his compound bow on a 23-yearold horse named Bunny — and killed her. After he reportedly admitted the deed, he explained, “It wasn’t a big deal. It was just a horse and not a person.” In response, Bunny’s owner, Regan Howard, launched a crusade for tougher sentences in animal cruelty cases, and Clayton was eventually sentenced to six months behind bars. That was noteworthy: Animal rights advocates say it was

GOT A NEWS TIP? NEWS@SEVENDAYSVT.COM

FRESH OFF THE BOAT. Retro chic.

ANIMAL CRUELTY IS A REAL THING IN VERMONT,

Finely tailored.

AND IT’S NOT SOMETHING THAT’S NECESSARILY EASY TO PROSECUTE OR PROVE SOMETIMES.

Amazing design.

Totally cool, affordable sofas! SCANDINAVIAN SOFAS

NOW 25% OFF

Untitled-21 1

8/29/16 1:18 PM

LOCAL MATTERS 17

2915 Shelburne Road 802.985.8487 Mon-Sat 10-5, Sun 12-4 www.moderndesignvt.com

SEVEN DAYS

MODERN DESIGN

08.16.17-08.23.17

YOUR SHIP HAS COME IN!

SEVENDAYSVT.COM

the first time in many years they’d seen northern New York and was living in a someone sent to prison in Vermont for nearby shelter. that particular crime. “When I saw her face, I felt like I had Howard and animal rights activists to have her,” Husk said. “You could just used Bunny’s death to persuade law- see something in her eyes.” makers to enhance the potential penalWhen they picked Keira up, she ties for aggravated animal cruelty, from weighed less than 50 pounds, and her three to five years in prison. The charge ribs were visible. Back in Vermont, Keira is a felony used was skittish around when somebody men, leading Husk to causes serious inconclude that she likely juries to an animal had been abused. But that were intenbefore long, Keira put tional and “withon weight and grew into out just cause.” an energetic, loving dog. For good meaSince adopting her, sure, lawmakers the Husks have taken in also made bestialtwo more pets. They’ve ity a crime, since also had three children state law hadn’t — including a son who specifically adwas born just a week dressed it. after Keira was shot. The law as it’s The dog is devoted, being applied to according to Husk. “If Roberts is exactly my daughter runs out to JESSIC A DANYOW what activists had the end of the driveway in mind when they to get on the school bus lobbied for the in the morning, and I’m cruelty bill, Addison Humane Society trying to get my shoes to catch up with director Jessica Danyow said. her, Keira will run outside and stand “Animal cruelty is a real thing in between my daughter and the road. She Vermont, and it’s not something that’s won’t let anything happen to her.” necessarily easy to prosecute or prove Husk made an appeal on GoFundMe sometimes,” Danyow said. “But in in- for Keira’s veterinary costs, describing stances like this that are egregious, it what had happened, and online donors is nice to have laws that are strong in quickly covered the expense. After two response.” days of surgeries and a regimen of pain Addison County State’s Attorney medication and antibiotics — $2,300 Dennis Wygmans declined to comment worth of care — Keira was back home on the case, saying he had not yet re- and healing last week. Veterinarians viewed the file. expect her to make a full recovery, Husk Husk said she was unaware of the said. recent change to the law. She said she Still, she said that Roberts should just wanted to see Roberts punished be held accountable and “made an exfor targeting Keira, a beloved pet who is ample out of” for a crime that used to part of her family. get swept under the rug. “People need In fact, the dog was her first depen- to be held responsible for any type of dent. When Husk and her husband were animal cruelty,” she said. “Some jail time building their home in 2009, they talked to think about what he did is absolutely about adopting a pet. Husk began casu- necessary.” m ally searching online. She came across a picture of Keira, who had been rescued Contact: mark@sevendaysvt.com, from an American Indian reservation in @Davis7D or 865-1020, ext. 23

LOCALmatters

Nurse Shortage Puts Vermont Parents on the Hook for Kids’ Care B Y ALI CI A FR EESE

SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS 18 LOCAL MATTERS

OLIVER PARINI

atalie Briggs spent the first six months of her life in hospitals. Born at 30 weeks with an extra chromosome, she couldn’t breathe or swallow on her own. She was deaf. Doctors predicted she’d be permanently confined to a hospital bed. Now nearly 8 years old, Natalie has short brown hair and a big grin. She is walking, learning sign language and living at home with her parents in Shelburne, although she still breathes through a tube in her throat. Another tube delivers food and water directly to her stomach. “She has to have eyes on her 24 hours a day to maintain her airway, monitor her for seizures,” explained her mother, Amelia Briggs. Amelia and her husband, Will, rely on nurses to help care for their daughter. The state determined that the family needed 112 hours of home nursing a week — and that Medicaid, the federal insurance program for those with low incomes and disabilities, should pay for it. But the young couple says they receive only 70 hours of care a week. They take turns monitoring their daughter at night, each picking up a four-hour shift. On July 26, Amelia was on duty from 3 a.m. to 10 p.m., while Will, a software engineer, worked. The Briggs’ plight isn’t unique. For the last 20 years, the United States has suffered a nursing shortage, a problem that’s expected to worsen as baby boomers age. The crisis is especially acute for home health agencies that provide nurses for families such as the Briggs, because they compete for employees with higher-paying hospitals and doctors’ offices. “It is challenging to provide that level of service, especially in a climate where there’s a nursing shortage,” said Judy Peterson, president and CEO of the VNA of Chittenden & Grand Isle Counties, but “we’re trying very hard to do just that.” Despite that effort, the dearth of home health nurses is putting Vermont families with medically fragile children in an untenable situation, forcing them to forgo sleep, sacrifice careers and spend more time in hospitals. Advocates argue that neither the home health agencies nor the state has acted with enough urgency.

HEALTH

Erika and David Nestor with their daughter, Zoe, in their house

“The problem is that we’re not compensating home health nurses at a rate that allows there to be enough of them to meet the needs of these kids with high needs, and so there’s a shortage of nursing, particularly in the home and particularly nights and weekends,” said Barbara Prine, an attorney with Vermont Legal Aid’s Disability Law Project. “What that creates for these families who are dealing with really medically complicated kids is a tremendous amount of stress.” Prine was referring to what are called “high-tech” patients, defined by the state as those with “complex medical needs that require continual assessment and intervention by a nurse.” After a doctor concludes that a child qualifies, the Children with Special Health Needs program at the Vermont Health Department performs an assessment to determine how many hours of government-paid home nursing care the family ought to receive. The state Department of Disability, Aging and Independent Living runs a similar program for adult clients.

The problem is finding qualified caregivers. The state tasks private home health organizations with supplying the nurses and figuring out a schedule with families. In the past, children in this program would likely have been sent to group homes or other institutional settings, now generally considered a less effective and more expensive long-term solution. Medical advancements have enabled them to live longer and in the comfort of their homes. “This is the first generation … raising these kids at home,” said Valerie WoodLewis, whose son, Ben, died two years ago at age 15 from complications due to cerebral palsy. Finding nurses was a struggle for her Burlington family from the very beginning. Ben spent 83 days in the Pediatric Intensive Care Unit at what’s now the University of Vermont Medical Center — his stay prolonged in part because the Wood-Lewis family couldn’t find any nurses through the VNA, a prerequisite for his release.

They were approved to receive 84 hours of help a week but rarely did. At times, Wood-Lewis said, “we went months with zero services.” Unexpected cancellations were common. She recalled that VNA dispatchers “would call to say someone had canceled, and I would burst into tears.” She cared for Ben and her three other children full-time. Eventually, the Wood-Lewis family settled for lower-skilled support, hiring personal care attendants and training them to give Ben his daily enema, manage the machine that helped him breathe and handle his feeding tube, intervening if he started to choke. “It was unacceptable to me,” WoodLewis said. For some families, the situation has deteriorated over the last couple of years. “We’re at our lowest level ever,” said Erika Nestor, whose daughter Zoe became profoundly disabled after nearly drowning in their backyard pond when she was 1 and a half years old.

GOT A NEWS TIP? NEWS@SEVENDAYSVT.COM

ALL MATTRESSES

THE CONSEQUENCE OF NOT HAVING SOMEONE ALERT, READY TO TAKE CARE OF THE KIDS, IS REALLY DIRE.

DON’TAY OWVEE’LRL PSAVE!! EY

N YOU MO

SleepQuarters really does sell mattresses for A LOT LESS than anywhere else in Vermont! PLEASE READ THIS! For 30 years SleepQuarters has brought Vermonters the lowest prices on Sealy, Simmons Beautyrest & Serta Mattresses. Our store is the most successful locally owned independent mattress specialty store in Vermont’s history. YOU’LL FIND OUR PRICES

CONSISTENTLY MUCH LESS THAN OTHER NATIONAL CHAINS OR LOCAL STORES.

Please visit us and prepare to be pleasantly surprised!

REALLY LOW MATTRESS PRICES !

1250 Shelburne Road South Burlington, VT (802) 863-7902

Open Monday - Saturday: 10-5 CLOSED Wednesday Sunday: 12-4

» P.21

2v-sleepquarters080917.indd 1

8/8/17 1:20 PM

LOCAL MATTERS 19

All Major Lines

SEVEN DAYS

NURSE SHORTAGE

OVER 40 MODELS TO CHOOSE FROM!

08.16.17-08.23.17

Health Needs program at the Vermont

BY SEALY, SERTA & BEAUTYREST

SEVENDAYSVT.COM

Zoe, now 14, has a breathing tube Department of Health. Asked how and a feeding tube, and experiences fre- frequently families are unable to find quent seizures — eight every half hour, the care they’re authorized to receive, on a good day. She can’t communicate or Poulin said he could not say precisely, move at all. “She truly can’t be left alone adding, “I think any instance of that in a room,” said Erika. “It’s a full-time is too much and is a real concern that requires collaboration and partnership job.” Approved for 56 hours of home with the home health agencies.” Poulin said state agencies regularly nursing a week, Erika and her husband, hold meetings about David, who both work individual children, in administration at trying to patch together UVM, were receiving other services, such as just 17 hours. respite care, to make up “It’s overwhelming,” for the lack of nurses. said David, who’s been Home health orgaworking at home and nizations say they’re taking time off to care doing everything for his daughter. they can to recruit Betsy Grant can employees, given the relate. Her son, Kyle, circumstances. was born with a rare Nicholas McCardle, muscular disease called division director for myotubular myopathy. Bayada Home Health Unable to swallow or Care, which serves breathe on his own, he’s clients statewide, said been tube-fed his entire BARBARA PRINE that for three years his life and has relied on a company has offered breathing tube since he “significant hiring bowas 2. “A cold is frightening, never mind the nuses” and brought in nurses from New flu,” said Grant. “Sometimes we nearly Jersey and Pennsylvania to supplement its Vermont staff. lost him just from a little bit of mucus.” Home health nurses typically make Kyle, now 20, with brown hair and around $25 an hour, according to the delicate features, can zip around their national job site Glassdoor. Addison farmhouse in a power wheel“It’s very difficult to find nurses chair and even plays soccer with the Vermont Chargers, an adaptive sports out there that are willing to work in team. Still, he requires intensive care. He the home health field,” added Tim can’t, for instance, clear his own airways, Brownell, executive and clinical direcwhich means another person must use a tor of Addison County Home Health & Hospice, the local VNA. “Throughout suction device to do it for him. “Our experience has been a gradual the years, people have retired and moved decline of nurses who are willing to on, and now we have limited resources come over the years,” said Grant. The as far was what we can provide in that family is supposed to receive 112 hours area,” he continued. “We are constantly a week and has been getting 34, she said. looking for new nurses.” Brownell said he doesn’t think low Grant, a registered nurse, is content pay is the primary problem, although to care for her son as her full-time job. he conceded nurses could “absolutely” But she and her husband, Scott, who make more in a hospital. He thinks it’s works as an IT specialist, are struggling the home-care setting that can be a to fill the night shifts, which means they must wake every few hours to help Kyle challenge. “It’s a very stressful environclear his airways or simply roll over. ment,” he said, noting that the nurses “We’re lucky if we have two nights cov- often work alone. High-tech cases, which involve paered a week,” Betsy said. tients who depend on medical technolAdam Poulin is the program adminogy, present an even greater challenge. istrator at the Children with Special

EXCERPTS FROM THE BLOG KATIE JICKLING

AN I

L ISSU MA

Bernie Sanders Talks Health Care, Cows During Franklin County Visit

08.16.17-08.23.17 SEVEN DAYS 20 LOCAL MATTERS

So when Linda Davignon, of SaintGeorges-de-Clarenceville, Québec, announced her hometown, Sanders asked her how much she pays for a doctor’s visit. “Nothing,” she said as she shaped her fingers into a zero. Sanders also addressed the weekend’s violence in Charlottesville, Va., calling it a “very sad moment in American history.” He went on to blast President Donald Trump for his lackluster response to the white nationalist rally. “When you have a president who doesn’t have the guts to say what the vast majority of the people understand to be true ... the message he is sending out to racists and neo-Nazis all over the country is, ‘it’s OK’ ...” Sanders said. “Do I think the president bears some responsibility for that? Absolutely, yes.” Sanders’ final stop of the day was to Paul and Linda Stanley’s hillside dairy farm in East Fairfield. The senator snacked on fresh cucumbers and cherry tomatoes at a picnic table and discussed the plight of the state’s dairy farms, which are struggling with low milk prices and environmental regulations. The conversation, though, never strayed far from the topic du jour. During a lull in the discussion about the farmers’ concerns, Sanders asked, “What about health care?”

Sen. Bernie Sanders talks with dairy farmers in East Fairfield.

Kelly Frederick and Toki

Dogs-Gone: Franklin County Animal Rescue Fights to Reopen

ALICIA FREESE

SEVENDAYSVT.COM

Sen. Bernie Sanders (I-Vt.) seemed comfortable Monday during a swing through Franklin County to meet with core constituents, including health care professionals, senior citizens and dairy farmers. At all three stops, Vermont’s junior senator discussed his “Medicare-for-all” proposal — but he refused to address questions about how hard he’ll push Democrats to back the plan. In the morning, Sanders toured the Northern Tier Center for Health clinic in Richford, where he peppered staff with questions about the opiate epidemic and access to dental care. From there, he traveled to the Franklin County Senior Center in St. Albans for a town hall. Sanders pitched his proposed legislation that would allow anyone to receive Medicare, the federal health insurance program currently available only to people over 65 years old. “We’re taking on the whole world to make this happen,” he told a crowd of more than 50 people. Residents dined on strawberry shortcake and listened intently as Sanders decried the “outrageous” cost of prescription drugs. He compared the U.S. health care system unfavorably to Canada’s, which provides universal coverage.

The Franklin County Animal Rescue sat vacant last Friday, save for Toki, an immense white and brown cat who stalked the halls like he owned the place. For now, Toki, three other cats and a brood of six kittens are the only residents in the shelter, which shuttered in April because of financial woes. He meandered past vacant “cat condos” and rubbed affectionately against the legs of Kelly Frederick, who was hired in July to fix the failing organization. Frederick hoped to find a new home for Toki, who’d been adopted once and then returned to the shelter. It’s one item on a long list of challenges she’s faced in her job as transition manager for the cash-strapped St. Albans shelter. There were also phones that broke last week and kittens left — abandoned — in front of the shelter. Frederick shrugged. “I’m the boots on the ground,” she said. Officially, the 30-year-old part-time employee was hired to help resuscitate an organization that had all but flatlined: It has no full-time employees, hardly any income and remains mired in financial difficulties. Also complicated is the shelter’s relationship with the community. The closure reverberated around the county, leaving in its wake angry former staff members, overwhelmed town officials and upset animal lovers. Some locals, though, have rallied around the organization, hoping to pull off a massive fundraising campaign to reopen the shelter by this fall. Frederick and the organization’s all-volunteer board hope to reopen on September 30. That goal gives them two months to raise $100,000, hire seven employees and complete a host of renovations on the dingy building. The money woes began in the last few years. The shelter spent more than $68,000 housing eight dogs seized during a 2015 animal cruelty case. Then in March 2016, the animal rescue organization purchased a building for

a spay-and-neuter clinic. Revenues, though, weren’t as high as they had hoped. Alice Astarita, a financial consultant for nonprofits, joined the board in October 2016. At the time, she said the board was aware of the money issues, but its members had no idea the organization was headed for financial collapse. By the time she ran the numbers during the winter, she discovered that the organization was on track to end the fiscal year with a $65,000 loss. There was little choice, explained Astarita: If the shelter didn’t close, it would go bankrupt. The board gave a one-week notice to its 11 employees, and then closed the shelter. At capacity, the shelter can hold 23 dogs and 30 cats — numbers it often exceeded, according to Frederick. Last year, 766 animals made their way through the shelter. A combination of factors in Franklin County — an agricultural community with high rates of poverty where many animals are not spayed or neutered — creates a need for a shelter, said board chair Karen Taylor Mitchell, who joined after the closure. Funding comes primarily from donations. About 240 people pay the $25 annual fee to serve as a member of the organization. But it’s not enough. The board recently began fundraising in earnest, holding a tattoo-athon where a $100 donation to the shelter bought a paw print tattoo. A GoFundMe campaign raised nearly $14,000. Mitchell estimates the organization will need a budget of $346,000 to operate, plus an additional $50,000 for renovations that began recently: fixes to the ventilation system, making the space more welcoming; and mold remediation. Mitchell admitted that the money woes keep her up at night. “It’s a long uphill climb,” she said.

KATIE JICKLING

Nurse Shortage « P.19 OBITUARIES, VOWS, CELEBRATIONS

OBITUARIES

Russell Walters, III

1928-2017, ST. ALBANS Dr. Russell S. Walters, III, of St. Albans, Vt., died peacefully of heart disease on August 10, 2017, at the St. Albans Health and Rehabilitation Center. He was 88. He was a scientist, woodworker, husband, father, grandfather, great-grandfather and loving partner. Russell was born December 19, 1928, in Clinton, Iowa, to Russell and Irma (Scribner) Walters. During the depression, his family traveled the midwest in a small house trailer as itinerant workers, eventually settling in Michigan where his father worked in support of World War II. His early experiences taught him the value of education and hard work, and these values guided him his entire life.

Russ graduated from Ludington High School in Michigan where he was a gifted athlete and earned the rank of Eagle Scout awarded by the Boy Scouts of America. During high school, Russ attended a lecture on forestry and decided to make it his life’s work. He earned his Bachelor of Forestry degree at Michigan State University, his Master’s degree in Silviculture at Oregon State University, and his Doctorate in Forestry from the College of Environmental Science and Forestry at SUNY in Syracuse. He spent his entire career as a Research Forester with the USDA Forest Service where he published dozens of books and papers furthering the field of forestry management. His co-authored book, A Guide to Medicinal Plants of Appalachia, is still widely used today by herbalists and natural healers.

While his research covered many topics, from Christmas trees to oaks, perhaps his most notable work was done in Vermont where his research enabled the use of tubing for the collection of maple sap, vastly improving and forever changing the production of maple syrup. In the early 1950’s, Russ served in Europe as a corporal in the U.S. Army where he earned the Army of Occupation and National Defense Service medals. Over the years, Russ also served in several community organizations, including the Elks Club, Veterans of Foreign Wars, American Legion, Friends of the Missisquoi National Wildlife Refuge, and as a volunteer firefighter. He is the former Grand Master of the Vermont Masonic Temple. He served on the Vestry of St. Luke’s Episcopal Church in St. Albans. Perhaps the volunteer work that best describes his character is when he co-founded the “Toy Shoppe” in Warren, Pa. Russ organized a group of retirees and trained them in woodworking so that every Christmas, handmade wooden toys were given to needy children. The group is still active today. Russell was predeceased by his mother and father, Irma (Scribner) Walters and Russell S. Walters II of Jensen Beach, Fla.; his first wife, Anita Mary (Baker) Walters, of South Burlington, Vt.; wife Anita (Marquette) Walters of St. Albans, Vt.; son-in-law Michael

Baxter, and grandson Robert Walters. He is survived by his daughter Jane Walters-Baxter of Ferrisburgh, Vt., and her children Shannon Baxter and great-grandchildren Serenity and Michael of Syracuse, N.Y.; Ian Baxter of Portland, Maine, and Ryan Baxter of Swanton, Vt. He is also survived by his son, Thomas, and wife Mary Shannon Walters of Richmond, Vt., and their children Nathan and Luke Walters. In addition, Russ is survived by stepsons Robert Marquette and wife Patricia and their son Steven, and Glenn Marquette, all of St. Albans, Vt. He also leaves grandchildren Casey and Adam Marquette, and Erica Washburn. Additionally, he leaves his special companion of many years, Priscilla Carpenter of St. Albans, Vt. A Celebration of Life for Dr. Russell S. Walters will be held at Holy Trinity Episcopal Church, 38 Grand Ave., Swanton, Vt., on August 19, 2017, at 4 p.m., officiated by The Rev. J. Robert Spainhour, Holy Trinity Episcopal Church, Swanton, and The Rev. James Ballard, Deacon, St. Luke’s Episcopal Church, St. Albans. A reception will follow in the parish hall. The family wishes to thank the staff of St. Albans Health and Rehabilitation Center for their care and compassion for Russell during his illness. In lieu of flowers, donations may be made to: Friends of Northern Lake Champlain, PO Box 58, Swanton, Vt., 05488, northernlakechamplain.org.

Want to memorialize a loved one in Seven Days? Post your remembrance online and in print at lifelines.sevendaysvt.com. Or contact us at lifelines@sevendaysvt.com or 865-1020, ext. 37.

LIFE LINES2121 LOCAL MATTERS

lifelines.sevendaysvt.com

SEVENDAYS DAYS SEVEN

Mark your family’s milestones in lifelines.

08.16.17-08.23.17 08.16.17-08.23.17

Contact: alicia@sevendaysvt.com

lifelines

SEVENDAYSVT.COM SEVENDAYSVT.COM

“We can’t put any nurse in those situations because it’s overwhelming,” Brownell said, explaining that he only uses nurses who have past experience working with such patients. Peterson said the VNA of Chittenden & Grand Isle Counties employs 38 nurses who collectively provide 700 hours of care per week for 16 high-tech clients, at a cost of $1.4 million last year. Most of the nurses work on a per diem basis without benefits. She estimated they fill about 80 percent of clients’ hours. Her organization has “worked very hard to increase our wages,” lobbying the legislature each year for higher Medicaid reimbursement rates, Peterson noted. And recently, she continued, the VNA has had more success finding nurses by employing full-time recruiters, running online ads and offering a one-year residency program to attract nursing school graduates. But home health groups could use more support, Peterson suggested, and she’d like to see the state launch a recruitment campaign. In the meantime, families continue to pick up the slack. “The consequence of not having someone alert, ready to take care of the kids, is really dire,” said Prine of Vermont Legal Aid. “Part of the problem is we have this expectation that parents can go above and beyond. These parents are going above and beyond night after night, week after week, month after month, year after year, and that is a huge toll on them and their families.” The issue is not just about providing relief for overextended parents. “They are saving Vermont money by keeping these kids home,” Prine noted. Laura Noonan of Shelburne can attest to that. Her daughter Nicole, now 17, contracted cytomegalovirus while in the womb, causing cerebral palsy, epilepsy and a severe intellectual disability. Two years ago, Noonan said, there was a “phase when the VNA just wasn’t able to fill our authorized hours.” Nicole made repeated trips to the UVM Medical Center, racking up 64 days in the ICU. “We were fearful that her health was actually on a permanent declining trend,” Noonan said. The family struggled to maintain Nicole’s care regimen and, out of desperation, considered putting her in an institution, which would have meant sending her out of state. Then a new VNA case manager began aggressively pushing to get the family more nurses. Today, the family receives nearly all of their authorized 114 hours. “She hasn’t been admitted to the hospital ever since,” said Noonan. m

PHOTOS: FORESTA LUMINA

CULTURE

Entrance to Foresta Lumina

In Québec, a Sparkly Forest Offers Fairies and Enchantment B Y MO LLY ZA PP

22 STATE OF THE ARTS

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

ava ran down the side of the cliff, and rocks began to crumble into the gorge. Behind the rubble, a glowing hidden chamber revealed itself to the enthralled crowd. Inside it danced a young woman surrounded by fairies. Then the rocks realigned themselves again into a normal cliffside, one among many in the Eastern Townships of Québec. The nighttime crowd moved on, having believed in this digitally projected scene, at least for the moment. No, no one is shooting a new J.K. Rowling film just across the border. Parc de la Gorge in Coaticook, a public park where visitors can hike on trails during the day, transforms at night into Foresta Lumina, an electrified, enchanted fairyland that offers a mystical, interactive wooded experience. The 4-year-old attraction is about 25 miles northeast of the crossing between Derby Line, Vt., and Stanstead, Que., where my friend and I heard from a border agent that the park was magnificent. We arrived early to see what Coaticook, population 9,000, had to offer in the way of food and drink. After an afternoon stroll through downtown, where we saw children hula-hooping and bouncing on an inflatable dragon in the closed-off streets, we began the evening at Microbrasserie Coaticook, a microbrewery down the road from Foresta Lumina.

Portal on bridge at Foresta Lumina

The blond ale brewed with ginger was refreshing on a warm summer evening — not too heavy on the ginger, with a pleasing tartness and bitterness from lime peels. The amber ale, brewed with rye, was medium-bodied and distinct, its subtle clove well balanced with its buckwheat honey flavor. We shared a generous plateau délices à partager, which consisted of two big sausages, mild Coaticook cheddar, onion confit, pita and accoutrements. At $16 — Canadian, of course — it was enough for two.

too gimmicky for me, but not for many of the children who made up a substantial part of the crowd, some wearing pajamas. According to one of Forest Lumina’s managers, Carolane Tremblay, the park receives as many as 3,000 guests per night, but to us it never seemed overcrowded. The two-kilometer trail is fairly easy, except for brief steep sections; it’s not, however, accessible to people with mobility disabilities, or to strollers.

FORESTA LUMINA IS LIKE THE FANTASY FILMS OF THEIR CHILDHOOD

DISTILLED INTO ONE MOVIE-LENGTH, INTERACTIVE EXPERIENCE. We arrived at the park after dusk, around 8:30 p.m. At the entrance of Foresta Lumina hang dozens of lanterns wrapped in what appear to be sticks. Bilingual signs introduce the characters from the fictional narrative that runs through the park: fairies and a forest spirit (good), “the creature” (not good), the thunder, and, in case you were missing the big villain of previous eras, the devil. We were given the opportunity to whisper our wishes to the fairies through a special horn. That was a little

For adults, Foresta Lumina is like the fantasy films of their childhood distilled into one movie-length, interactive experience. Visitors must be willing to be enchanted by the night forest itself, as well as by the projections of light and sound that run on loops on the designated path. That path hosts a series of installations incorporating varied lighting and sound setups, along with digital scenes projected on a cliff and, seemingly, into the air (actually a barely visible netted screen). We walked up a hill to see the

fairies installation. Here hundreds, if not thousands, of small lights nestled and flashed wondrously among the trees, accompanied by the whirly sounds of fairies flying. That was the intended experience, anyway. Distance made the suspension of disbelief easier, the rhythm of the lights nearly transformative from 20 feet away. I walked off the path and up to the lights to see how they worked: small bulbs on plastic sticks, intricately wired and programmed. I realized I would enjoy myself more if I didn’t think too hard about the how behind the wow. We crossed the slightly swaying 554foot suspension bridge, glimpsing small blue and red lights in the gorge below. It was enthralling — until white lights along the bridge glared with excessive wattage, more club-like than mystical. Toward the end of the bridge, white fog emanated from a backlit doorframe. My friend pointed out the genuine spiderwebs in the door’s corners. Like everyone else on the path, I got to watch others disappear into the fog, then walked through this “portal to the unknown” myself. We each had our moment of dramatically crossing a mysterious threshold, as if on our own hero’s journey. The path continued to a projection of the devil attacking the narrative’s heroine, Margaret, who gets rescued by fairies. Other installations were more

n’s consign me m en wo

p ho ts

Intrigue.

SHOP A

unique pieces in gibeon meteorite, 100% recycled gold, diamonds, and other fine gemstones.

T he Exchange

167 Pearl Street • Essex Junction 802-878-3848 theechangevt.com

SHOP

16t-theexchannge071217.indd 1

Jacob Albee

LOCAL

and say you saw it in...

Goldsmith

jacobalbee.com . 802-540-0401 burlington, vt hours by appointment

Cliffside projection at Foresta Lumina

Bruce Conklin, Intervale, Late Summer, 2013 (detail)

Exhibiting Artists Bruce Conklin Jennifer Hubbard Susan Larkin Phil Laughlin Julia Purinton Gallery Hours for May-October: Tuesday, Wednesday & Thursday: 11-5 p.m. Friday & Saturday: 11-8 p.m. Sunday: 11-5 p.m.

Admission: Free Untitled-26 1

@ BURLCITYARTS | 802.865.7166

8/3/17 3:42 PM

STATE OF THE ARTS 23

Foresta Lumina, open through October 8 at Parc de la Gorge de Coaticook, 135 Rue Michaud, Coaticook, Que., 819-849-2331. Admission and schedule vary, see website for details. forestalumina.com

4/24/12 3:56 PM

SEVEN DAYS

INFO

16t-shoplocal-guy.indd 1

08.16.17-08.23.17

I ate a gigantic salad with mesclun mix, local smoked trout and a rich herbal dressing; my friend had panini made with smoked local pastrami and tomato cream. Both dishes were excellent. Though another part of the park offers camping, this and all local lodging options were full, so we stayed the night at a hotel in Sherbrooke. The next morning, we returned to hike the Gorge Trail, parts of which accompany the Foresta Lumina trail. Seeing its entrance in daylight was my moment of opening up the wardrobe to discover not a gateway to Narnia, but hanging clothes and a solid wood backing. We climbed the steps to an observation tower on the Gorge Trail, which offered an expansive natural view of what had been a surreal environment last night. “USA,” I heard a French Canadian say to a group of English speakers, pointing south toward the mountains to orient them. “USSR,” he added with a smile, and pointed in the same direction. I wasn’t sure if we were in the realm of dark satire or creeping dystopia, but my suspension of disbelief was definitely over. m

SEVENDAYSVT.COM

interactive, such as percussive instruments that revelers could play, projecting their sounds into the woods. Foresta Lumina came into being as Caroline Sage, executive director of the nonprofit, town-owned park, sought new sources of revenue. She took her idea for an enchanted forest to Montréal’s Moment Factory. That’s the multimedia entertainment company responsible for last May’s massive, and controversial, light installation on the Jacques Cartier Bridge, part of the celebration of Montréal’s 375th anniversary. Moment Factory has also created installations for everything from retail marquees to Miley Cyrus’ 2014 Bangerz world tour. Regardless of whether memorable times in people’s lives can actually be manufactured — as the company’s name seems to imply — Moment Factory’s work at Foresta Lumina is captivating, entrancing and visually stunning. Not many sound and light installations exhibit those qualities and get more than 150,000 people per year to hike around the woods at night. The children and adults we observed appeared to be happily engaged; I didn’t see a single person using their phone, other than to take an occasional photo. Food and tea at the park’s Coffret de l’Imagination, a cozy bistro with a large terrace, helped us pensively digest the experience of en masse entrancement.

7/7/17 1:28 PM

In Wake of Illness, Artist Finds Her Niche Drawing Animals

MAL ISS I N

B Y S A D I E W I LLI A M S

SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS 24 STATE OF THE ARTS

I’LL NEVER RUN OUT OF THINGS TO DRAW.

C ORRI N A T H U R S TO N

Hermit Crab

Blue-Eyed Kitten

Corrina Thurston

with chronic Lyme disease, Bartonella, Hashimoto’s thyroiditis and two types of pneumonia. She started treatment in 2014. Now able to leave the house on her own, Thurston met this reporter in a noisy café in downtown Burlington, a 50minute drive from her home in Barre. “I don’t have to worry as much about a sudden migraine [popping up] so that I will be completely gone. I’m doing a lot now,” she says. With her freedom restored, she has turned her artistic skill into a business named after initials, C.A.T. STUDIOS. Her detailed drawings of animals have been shown in the

S.P.A.C.E. GALLERY and ART’S ALIVE GALLERY at Main Street Landing’s Union Station in Burlington, among other locations. Thurston takes commissions for animal and family portraits and, on her website, sells prints, mugs and jewelry bearing her drawings. She just published her first book, How to Build Your Art Business with Limited Time or Energy, through Amazon Energy Digital Services. It sounds like a lot of work for someone who says she can be struck with a migraine at any moment, but the artist is doing it her way. When she does commission work, Thurston says, “They can’t put me on a deadline. They know that I’m going to get to it as

soon as I can, but if health stuff comes up, I can’t control that I can’t draw for a month.” This summer, Thurston has temporarily stopped taking commissions to focus on two larger projects. First, she’s experimenting with drawing directly on wood, then varnishing and lacquering the finished product to preserve her efforts. Second, she’s working on a series of black-and-white drawings of endangered species. The first image she completed in that series was a portrait of an African elephant with a stark white background, which won the Artist’s Choice award at this year’s ART’S ALIVE FESTIVAL OF FINE ARTS. “I’ve started my next one, which is the black rhino,” Thurston says. “[The point is] to really bring attention to this enormous animal that isn’t going to be here in 50 years — if we don’t do something.” Why the animal focus? “We’ve always had cats growing up, and wildlife in general fascinates me, and I’m really passionate about wildlife conservation,” Thurston says. “I guess animals are just kind of my thing. I’ll never run out of things to draw.” Contact: sadie@sevendaysvt.com

INFO Corrina Thurston’s work will be on view during September and October at New Moon Café in Burlington. Reception, Friday, September 22, 5 p.m. corrinathurston.com

PHOTOS: COURTESY OF CORRINA THURSTON

ART

SADIE WILLIAMS

n 2008, CORRINA THURSTON got a migraine that never stopped. Loud sounds and bright lights hurt her head. She didn’t sleep, and she could barely walk. Confined to a dark room, she had to drop out of St. Lawrence University in her first year. Prior to her illness, the now 27-yearold Barre native did not consider herself an artist; when the mystery malady struck, she was pursuing a double major in biology and anthropology. Two years into her ordeal, in 2010, Thurston started drawing with colored pencils, propped up in her bed back home in Vermont. Today, she’s using her newfound talent to focus on a subject she loves — animals — while giving a portion of her sales to organizations like the World Wildlife Fund and the Humane Society of the United States. The motivation for taking up art? Thurston says she had to focus on something other than the pain, which she describes as “excruciating.” So, the artist says, “I picked up an old poster board from high school and a No. 2 pencil, and I started sketching.” Looking at her creation, a female nude seated on a lily pad, Thurston felt something was lacking. So she began layering in colored pencil, building up the pigments to create a vibrant scene. Thurston was smitten with the medium. In that first drawing, “I wanted to use as many colors as possible, so she’s purple with orange highlights and orange hair, and she’s on a green lily pad with blue colors all around her for water — although, of course, it didn’t look anything like water,” she says with a smile. “My mom has it hung up on the wall, even though it’s all ripped and torn up.” That scrappy drawing launched Thurston’s career as a colored-pencil artist. She learned at a “very quick” rate, she says, with most of her drawings ending up on display. Soon after her poster-board creation, she was drawing hyperrealistic portraits of animals, all while fighting her stillundiagnosed illness. “Being stuck in bed, this was the only thing I could possibly focus on,” Thurston says, “even if it was for a short amount of time each day — it took energy.” After four years of drawing between bouts of pain, Thurston was diagnosed

Vermont Artist to Record Solar Eclipse in South Carolina B Y RA C HEL ELI ZA B ETH JONES

ART

I LOVE THE IDEA OF THIS EVENT BEING A BINDING AND A SHARING MOMENT.

COURTESY OF MICHAEL ZEBROSKI

MICH AE L Z EB R O WSK I

See more of Michael Zebrowski’s work at upendthis.com.

it won’t spoil the fun. The image included here is only a detail of the big maze. (A smaller “scenic” maze, with directions provided, is also available, as is a non-maze play area for children.) If you’re ready to try solving the corn-maze bear yourself, Boudreau strongly recommends arriving no later than 1 p.m. Because it’s hard. RACHEL ELIZABETH JONES

Contact rachel@sevendaysvt.com

INFO The Great Vermont Corn Maze is open daily, 10 a.m. to 4 p.m. (to 5 p.m. on weekends), weather permitting, through October 15, 1404 Wheelock Road, Danville. $10-15. Find directions and other instructions at vermontcornmaze.com.

STATE OF THE ARTS 25

Nothing says mysterious yet wholesome fun like bears “drawn” in a cornfield, right? Right? Or, perhaps, when you’ve been walking through a corn maze for a couple of hours in the August sun, it doesn’t really matter what that maze looks like. Either way, every summer MIKE BOUDREAU of the Great Vermont Corn Maze in Danville labors with friends and family to inscribe a recognizable shape in — and with — his 24-acre cornfield. For this year’s maze, which opened July 29, Boudreau chose four bears. No, not the hulking kind that might stroll through your backyard in search of bird feeders, but teddy bears.

Animals, real or fantastic, are nothing new for the Vermont Corn Maze. Last year’s design was a minotaur named Mazer. Previous years have featured a falcon, a gorilla, dinosaurs and even aliens. Asked by phone how he arrived at the bear design for this year, his 19th, Boudreau pointed out that “corn is bear food,” after all. Armed with spray paint, a rake and a “giant stick,” Boudreau and his helpers “drew” the teddies back in June, when the corn was still wee. He explained that waiting to see an aerial view of the design can be quite nervewracking, because he’s never sure he and his team got it right. Though Boudreau and co. are careful not to reveal the theme of each Great Vermont Corn Maze in advance, they assure us that knowing

INFO

SEVEN DAYS

Aerial shot of the Great Vermont Corn Maze

OUT STANDING IN THE FIELD

Contact rachel@sevendaysvt.com

08.16.17-08.23.17

OVER AND ABOVE PHOTOGRAPHY

GAMES

will enter its next phase at the Gibbes Museum of Art in Charleston, S.C., as the Earth is cast in shadow. On August 16, Zebrowski will join the leagues of folks packing up their cars to caravan to prime viewing locations along the eclipse’s path, which extends from Oregon to South Carolina. In addition to his wife and small children, Zebrowski will take along several pieces of functional sculpture he calls “surveyors.” Each of these yellow-painted metal tripods — the largest of which is about

SEVENDAYSVT.COM

s August 21 approaches, excitement about the upcoming total solar eclipse is growing steadily across the U.S. As expected, the infrequent celestial event is providing a catalyst for discussions of science and superstition and, yes, politics, among the masses and the media. Morrisville artist and Johnson State College assistant professor MICHAEL ZEBROWSKI is one of those whose wonder has been sparked, and his multi-tendril public artwork “Eclipse S U R V E Y”

10 feet in diameter and seven or eight feet tall — will have a recording task to perform on eclipse day. Zebrowski fabricated his biggest surveyor last year during his residency at Spruce Peak at Stowe, when he used it to record the sun’s movements over an extended period. This time, a telescope and time-lapse camera will be mounted to the surveyor in order to record the hour-and-a-half of the eclipse from the Gibbes’ lush gardens. Another of the smaller surveyors will hold a camera trained on the shadow of a tree. As Zebrowski said by phone, leaves during an eclipse can sometimes act as pinhole cameras, projecting multitudes of tiny reflections of the sun. Other devices will record changes in sound and temperature. Using audiovisual equipment to record the eclipse’s behavior is only one part of this work, however. Last spring, Zebrowski began to distribute pairs of eclipse-viewing glasses dubbed “surveyors” — like the tripod sculptures — through an Indiegogo campaign. At $25 a pop, each pair of laser-cut woodframe glasses came with a paper survey requesting that each observer record specific data about their eclipse experience and mail back their responses. As of last week, Zebrowski had sold some 75 pairs of glasses and was aiming for

100 by eclipse time. (In addition to these limited-edition accessories, the Gibbes commissioned him to make 300 pairs from cardstock and plywood to distribute at its viewing party.) The public engagement component of “Eclipse S U R V E Y” serves as a soft launch for Zebrowski’s art and design studio, UP END THIS, which has been in gestation for more than a decade. Incorporating product design and sales represents a new direction for the artist, who noted that the glasses operate on both a smaller and larger scale than he is used to: small in size, but large in terms of physical reach and exposure. As he wrote for his Indiegogo campaign, “We are the Observers and Surveyors, our memories are the recording devices.” In a recent story for the Atlantic, Ross Andersen writes, “One behavior that distinguishes humans from animals is the considerable energy we devote to observing the sky.” For Zebrowski, this human aspect of the eclipse has an edge of political potential. “The thing that saddens me the most about our political climate right now is that we are so disjointed, and we are so polar,” he said. “I love the idea of this event being a binding and a sharing moment. The survey plays into that exactly — it’s about trying to get people to engage this thing and, at the same time, engage each other.”

VERMONTERS ON THE JOB

AL ISS IM

Aww-some Advertising

WORK

B Y PA MEL A PO LSTON

SEVEN DAYS 08.16.17-08.23.17 SEVENDAYSVT.COM 26 WORK

to heightened positive emotional states.” And here’s the crux: “These positive feelings fuel brand affinity, awareness, engagement and, most importantly, help drive sales.” For example, Sniff & Barkens created an original video on Facebook for Hartz, maker of pet-care products, which “celebrates the outdoor lifestyle and fun we share with our dogs.” “Professional border collie” Rumor frolics with his human, romps in the woods, goes for a swim, rides in the car and generally looks happy AF. While many of the company’s videos are silent, in this case Rumor “talks” about his life via a male voiceover. Only at the end does the Hartz logo briefly appear. Not all Sniff & Barkens’ clients are pet-related. For the online florist 1-800-Flowers, the company ran a Valentine’s Day Instagram contest with pics of cute pups. While enhancing clients’ brands and bottom lines brings in the bacon, the company also supports animal rescue and adoption nonprofits and hosts a number of pet-related stories on its website. A lot of dog lovers out there seem to be paying attention.

SD: How do clients find you? GD: The larger our following, the more requests we get. Our social media following is bigger than all of the major pet brands. AARON BAND: I look at dog content on social media all day, and I ask people if they’re interested in using dogs. We’ve had success because we know they’re interested. GD: Our storytelling process works really well. SD: How many followers are we talking? GD: The follower audience of accounts in our influencer network, which are the accounts we work on for stories and client campaigns, is 6.4 million. With [those] and official brand channels combined, our overall network reach is nine-plus million followers. [All the accounts are linked on Sniff & Barkens’ website.] SD: Where does the content come from? LEAH FISHMAN: Most of our content comes from social media. Most of my day is spent on Instagram and Facebook.

From left: Leah Fishman, Aaron Band, Guy Derry and Douglas Schatz, with Oak

I search [dog-related] hashtags. I reach out to posters and get their stories. Most people are happy to work with us. GD: We source the video, Doug edits it, Leah writes. The challenge is to piece together a narrative. SD: You cite some statistics about native advertising, aka storytelling, on your website — that it “registers 9% higher lift for brand affinity and 18% higher lift for purchase intent than traditional display advertising.” Does that come from national survey data? GD: Yes. The second something comes across as not a pushy ad — if you can get a good story, it’s not as offensive feeling. SD: How do clients measure success? GD: It’s brand awareness, an awareness factor. If you develop a new partnership with Sniff & Barkens, it’s tapping into a new audience who aren’t necessarily already following your brand. AB: Dog people trust dog people. SD: When did the company start? GD: August 2015. Last spring we had a eureka moment, to go direct to social media. AB: The main focus is video. It’s really shareable. You’re just in the story immediately. People see [the videos]

when they’re in between things, scrolling [through social media]. SD: What’s your main demographic? GD: Female, 25 to 55 years old. SD: What about using other animals besides dogs? LF: I don’t shy away from stories with cats, sheep, llamas and kids. “Unlikely friendship” stories are always popular — for example, a dog and a kitten. SD: I noticed the Valentine’s Instagram contest with dogs. Do you do a lot of those? GD: They’re very seasonal, attached to tent-pole holidays like Valentine’s Day, Mother’s Day … We also did a Fall for Adoption campaign and gave away money [to the Bissell Pet Foundation]. SD: Aside from Oak, do you all have dogs? AB: My 15-year-old Wheaton terrier passed this year. DOUG SCHATZ: I don’t own a pet, but I dog-sit for my parents. GD: I’m a cat lover. I have a 12-year-old cat named Sable.  Contact: pamela@sevendaysvt.com

INFO Learn more at sniffandbarkens.com.

MATTHEW THORSEN

Derry, 32, explained that the founder wo things set Sniff & Barkens apart from the numerous other of Sniff & Barkens is family friend Joe marketing agencies based in Pappalardo, a former New York City fraBurlington: The company grance industry executive, children’s adfunctions solely on social media, and vocate and dog lover who’s now retired it does so with dogs. That is, Sniff & in Florida. Two other partners in the Barkens incorporates canines — and the company also live out of state. Derry, a occasional other critter — into its mes- designer and web developer, was tasked saging. The results are not traditional with making the “dog lifestyle brand” sell-this-product advertisconcept a reality. ing, but narrative content To learn more, Seven Days NAME dispersed on Facebook and Sniff & Barkens met up with him, content creInstagram. While brand ator Leah Fishman, 26; social names may not even appear media strategist Aaron Band, JOB in the company’s postings, 24; and video editor Douglas Dog lifestyle they associate brands with brand marketing Schatz, 28, at the coworking space Study Hall in downthe genuine love people have TOWN town Burlington. Fishman’s for their pets. Burlington Great Pyrenees mix, Oak, was “Our goal is to create aualso in attendance. thentic stories, but the brand awareness is there,” says Sniff & Barkens’ SEVEN DAYS: How did the idea for CEO Guy Derry. Aligning one’s brand with dogs isn’t Sniff & Barkens come about? just warm and fuzzy. Market research GUY DERRY: It started with a shared has demonstrated that most people love of dogs. There is a lot of content out have, as the company’s website puts it, there about dogs, but a lot of it is not of “measurable psychological reactions … high quality. We wanted to do it in a way when [they] see dogs, which translates that rose above cheeseball.

Lakeview Assisted Living

Reflections Memory Care collaborating with Harvard Medical School, Brigham & Women’s Hospital and McLean Hospital.

Serving our residents

The workshop fee includes the materials for your creation, a bottle of Switchback beer and dinner from a locally sourced, make-your-own burrito bar. 100% of the profits will be donated to a local non-profit each month. FERMENTATION 8/30 5:30-7:30 $45 Intervale Barn, Burlington, VT

RUSTIC WOODLAND WREATHS 11/8 5:30-7:30 $65 Gardener’s Supply, Williston

KOKEDAMA (STRING PLANTS) 9/24 3:30-5:00 $45 Gardener’s Supply, Williston

TILLANDSIA ORNAMENTS 12/7 5:30-7:30 $50 Gardener’s Supply, Williston

since 1999

SUCCULENT CENTERPIECE 10/19 3:30-5:00 $50 Gardener’s Supply, Williston REGISTER TODAY! Call us at (802) 660-3505 or visit one of our garden centers. Cancellation Policy - Attendees must call 48 hours prior to the workshop in order to be issued a refund. Late cancels will only be issued a refund if their spot can be filled. No shows, will not be refunded.

The Residence at Shelburne Bay combines traditional Vermont beauty and value with an active environment of culture, social engagement, intellectual stimulation and entertainment.

+ 100% Employee-Owned

Enjoy your private apartment home, along with just the right services to make life easy!

128 Intervale Road, Burlington • (802)660-3505 472 Marshall Ave. Williston • (802)658-2433

185 Pine Haven Shores, Shelburne, VT 05482 www.residenceshelburnebay.com

www.GardenersSupplyStore.com Mon–Sat 8am–6pm; Sun 10am–5pm

BBB_81617.indd Untitled-4 1 1

For more information contact Alicia Butson, Tel 802-985-9847 abutson@residenceshelburnebay.com

8/11/17 8/11/17 10:55 8:25 AM

7days_assisted.indd Untitled-14 1 1

HURRY IN FOR INCREDIBLE LABOR DAY MATTRESS SAVINGS!

OR SAVE

SEVENDAYSVT.COM

Free boxspring with purchase of iComfort, iComfort Hybrid or Simmons Hybrid mattress 8/16-9/11/17

Come in today!

INTEREST

Available Now

$70

36 month financing

SEVEN DAYS

Queen Adjustable Sets Starting as low as

08.16.17-08.23.17

FREE BOXSPRING UP TO $800

4/20/17 12:39 4/27/17 11:15 PM AM

2800 Shelburne Rd., Shelburne burlingtonbedrooms.com 802-985-3049 Hours: Monday-Saturday 9-6 Sunday 11-5 27

2H-burlbed080917.indd 1

8/3/17 3:50 PM

WHISKEY TANGO FOXTROT BY KEN PICARD

Why Is It OK to Feed Songbirds But Not Other Wildlife?

SEVEN DAYS 08.16.17-08.23.17 SEVENDAYSVT.COM 28 WTF

feeding habits and diminutive dimen- rule of thumb is that if there’s consistent sions, they’re far less likely than large snow on the ground and temperatures mammals to create hassles or threats to are at or below freezing, feeders are fine. humans and their property. Once the weather warms up AL ISS IM Unlike a bear, a blue jay won’t in spring, however, Buck sugclaw open your kitchen door gests putting the feeders away. at the slightest whiff of suet.

So says John Buck, a wildlife and migratory birds biologist with the Vermont Fish & Wildlife Department. Buck directs the recovery of the state’s threatened and endangered bird species such as the bald eagle, grasshopper sparrow, whip-poor-will, spruce grouse and black tern. He explains that, although songbirds may become habituated to bird feeders, typically they’re feeding elsewhere in their habitat, too. That means they aren’t completely dependent on feeders, and the impact on the landscape isn’t severe. “Bears, turkey and whitetail deer, just because of their size, create a bigger problem to address” when they congregate in large numbers, Buck says. “If you get 10 or 15 deer hanging around a feeding site in your backyard, especially in a neighborhood setting, those deer are also feeding on … everyone’s prize flowers and shrubs.” Buck recommends that Vermonters feed birds only during wintry weather — generally, December 1 until April 15 — in order to avoid attracting bears. A good

ears ago, before becoming a journalist, I worked for the Center for Wildlife Information, a Missoula, Mont.-based nonprofit. The organization’s mission is to reduce human/ wildlife conflicts, many of which require that the “nuisance” animal be relocated or destroyed. Most often, however, the nuisance animals are humans themselves, whose behaviors — such as improperly storing food while camping, approaching too close to wildlife, or attempting to touch, feed or interact with the critters — trigger the conflict. For a time, CWI circulated bumper stickers and posters that read, “A fed bear is a dead bear.” That conservation message still holds true for nearly all forms of wildlife except one: songbirds. For much of the year, Vermonters fill their backyard bird feeders with sunflowers, peanuts, flax and millet in order to attract the cute and colorful chirpers. Feeding wild birds is such a popular pastime — about 40 percent of Americans do it, according to the National Audubon Society — that the $6.3 billion-a-year market for feeders and seeds has its own trade association: the Wild Bird Feeding Industry. No one would ever think of setting out platters of tuna sandwiches to attract raccoons or bowls of chicken nuggets to watch foxes. Similarly, wildlife biologists generally frown upon feeding aquatic birds such as ducks, because it spreads disease, and seagulls, because they become aggressive and leave messes. Likewise, for similar reasons, baiting bear, deer and turkey is illegal in Vermont in order to protect those species. Yet, for some reason, songbirds enjoy a free lunch. Why? In short, it’s all about their behavior and size. Due to songbirds’ natural

Bird enthusiasts shouldn’t feel guilty when they stop feeding feathered friends in spring, he adds. At that time, birds are courting, nesting and rearing their young, and they typically feed on naturally available bounty. When the feeders get put away, he likens it to an apple tree that stops producing fruit. “When the last apple is eaten, it’s gone, and there won’t be any more until next year,” he says. “Animals just move on to another [feeding] location.” However, Buck cautions that feeders aren’t entirely without health risks to songbirds. Because feeders cluster unlikely species together more closely than they otherwise would in nature, they can create an ideal environment for parasites and pathogens to spread. FWD recommends that people clean out their feeders several times each year, and between seasons, with a 10 percent non-chlorinated bleach solution. Hummingbird feeders should be cleaned even more often — about every two or three days. The National Audubon Society offers other advice for keeping songbirds

healthy and safe. The group recommends that people store birdseed in secure metal containers so it doesn’t get damp and ferment, which can sicken birds. Audubon also recommends locating bird feeders at different levels and putting specific seeds, nuts or fruit in separate dispensers in order to keep distinct species apart. Using seedspecific feeders not only decreases interspecies interactions, but also dramatically reduces the amount of wasted seed left on the ground. Bird enthusiasts should also give forethought to birds’ flight paths before putting up feeders. According to the National Audubon Society, approximately 1 billion birds die each year from flying into windows. The Humane Society of the United States recommends placing feeders at least 30 feet away from windows or within three feet of one. A feeder very close to a window prevents birds from building up too much momentum as they approach it, reducing the likelihood of fatal collisions. Far more deadly to Tweety, though, is Sylvester the housecat. Domestic felines kill hundreds of millions of birds annually in the United States alone. The American Bird Conservancy puts that estimate closer to 2.4 billion annually and calculates that outdoor domestic cats have driven at least 33 bird species to extinction worldwide. In short, Buck says, Vermonters should feel fine about enjoying nature’s tweets, provided they do so responsibly. As he puts it, “Feeding birds just provides an attraction and allows us to get a close-up view of them, which is wonderful.” m Contact: ken@sevendaysvt.com

INFO Outraged, or merely curious, about something? Send your burning question to wtf@sevendaysvt.com.

4.75” Untitled-20 1

8/14/17 12:53 PM

This announcement is neither an offer to sell nor a solicitation of an offer to buy any of these securities. The offering is made only by the final Official Statement. The information set forth in this announcement was obtained from sources we believe to be reliable but we do not guarantee its accuracy. All such information is subject to the information in the final Official Statement.

PROPOSED NEW ISSUE

Credit Ratings: Aaa/AA+/AAA (Moody’s/S&P/Fitch)

$32,555,000*

RACE TRAINING

State of Vermont

WEDNESDAYS 6–PM PERKINS PIER ON THE WATERFRONT

08.16.17-08.23.17

• Interest exempt from Federal and State of Vermont income taxes** • Expected maturity range: 2018 through 2037* • $1,000 denominations Contact your financial advisor or one of the firms listed below for further information:

Morgan Stanley 877-937-6739

800-937-0374

Citigroup

Baird

800-863-5434

TD Securities 800-934-4445

855-231-8873

Fidelity Capital Markets

800-792-2473

Oppenheimer & Co. Inc.

J.P. Morgan

855-644-7252

800-460-5848

Raymond James

Rockfleet

877-295-9116

212-257-2235

Wells Fargo Securities 866-287-3221

8/15/17 10:10 AM

Untitled-4 1

*Preliminary, subject to change. **For a complete discussion of tax matters, see the Preliminary Official Statement. Untitled-1 1

SEVEN DAYS

BofA Merrill Lynch

8/15/17 10:17 AM

7.46”

Priority Order Period for Vermont Retail Buyers Monday, August 21, 2017*

SEVENDAYSVT.COM

General Obligation Bonds, 2017 Series A (Vermont Citizen Bonds)

THE STRAIGHT DOPE BY CECIL ADAMS

Dear Cecil,

There seem to be two major concerns with a lack of net neutrality: pricing (want to browse ESPN.com? That’s another five bucks a month) and content (Would internet service providers refuse to transmit certain sites?). How bad could it really get? — Bryan Thurn, Jacksonville

08.16.17-08.23.17

SEVENDAYSVT.COM

reat news: The genuine worst-case scenario you’re wondering about is finally starting to come into focus. It’s about time. The debate about net neutrality is only a decade old but feels like it’s been going on forever — probably because it’s existed mostly within the realm of the hypothetical: What might happen if this happens? What might not happen if that does? At long last, we have something concretely terrible to worry about. For those who’ve been scrolling past this stuff the whole time: The concept of net neutrality refers to the principle that, to crib from the Harvard Business Review, “a broadband internet provider should not block, slow, or otherwise unfairly discriminate against any website or online services.” The examples of what this might look like, as you note, tend to invoke a tiered web, where premium pricing buys you faster, better service; or maybe it costs

summer savings

SEVEN DAYS 30 STRAIGHT DOPE

more to access bandwidthheavy sites like Netflix. Not the most terrifying prospect in itself, maybe, but proponents of net neutrality fear a slippery slope. Say ISPs can charge different rates for different content or even occlude access to certain kinds of content; then, say, the New York Times publishes a damning investigation into Comcast’s corporate practices. The concern is that, absent federal regulation, Comcast could retaliate — block nytimes.com, or slow it to a crawl, or charge a fee to view it, or whatever. The netneutrality folks see this as a First Amendment issue, where the government should intervene preemptively to protect free expression online. This sort of thing hasn’t really happened, at least so far; as I say, the whole thing’s been a bit hypothetical. According to opponents of net-neutrality rules, that’s no coincidence: This is a self-regulating system, they argue, that doesn’t require

government interference. The feds don’t need to make sure Comcast doesn’t mess with your Netflix; fear of consumer discontent will ensure good behavior. Entrusting our civil liberties to the free market may sound like a naïve plan at best, particularly as ISPs tend to face only limited competitive pressure. Still, neutrality opponents may be on to something. They’re particularly het up over a rule issued in 2015 by president Barack Obama’s Federal Communications Commission that reclassified ISPs as “common-carrier utility services,” subject to stiff federal oversight. It isn’t hard to make the case that common carriers of the past — think railroads, or the Ma Bell-era phone system — wound up losing a step innovation-wise, and I suppose it’s not impossible that the internet could go the same way. The ISPs themselves have been on both sides of the question. Some sued to overturn the Obama regulations but have

recently come out in support of “permanent, strong, legally enforceable” rules, per a Comcast statement this year. They want Congress — that famously effective governing body — to take up the issue, though, rather than leave it to the executive branch. One senses that the ISPs are a little sick of the debate, too, and have gotten to the point of just wanting some consistent guidelines. Fat chance. As with everything else these days, Donald Trump’s ascension to the presidency has injected elements of both chaos and menace into the net-neutrality debate. His administration has (naturally) taken steps to reverse Obama’s rule, raising the specter of regulations that simply toggle on and off depending on who’s in power. This, I think, is where your worst-case scenario emerges. We know that, absent regulation, an ISP could theoretically block or slow access to some piece of disapproved content. For the sake of this scenario, let’s imagine that content is an unflattering article about the president. Now, in a hypothetical, unregulated world where

it was technically in that ISP’s power to do such a thing, it’s still difficult to see it happening, assuming pre-2017 Washington rules remain in play: You’d figure that long-functioning systems of political and corporate accountability, the fear of scandal, etc., would restrain president and service provider alike from trying any funny stuff. But now? It’s 2017. We’ve got a president who loves publicly going after corporations, particularly media outlets, who’ve displeased him. We know his Twitter activity can move the stock market. Scandal is meaningless to him; Congress has yet to stand up to him. We’ve already seen ISPs participate in the suppression of internet speech in places like China and Russia. I submit that it’s not that hard to envision a time when an ISP might think carefully about what kind of content it allows to be seen on the web, for fear of poking the orange dragon. No external pressure required — this would simply be the brutal bottom-line logic of capitalism responding to the self-preserving impulses of authoritarianism. Not to put too rosy a spin on it or anything.

INFO

Is there something you need to get straight? Cecil Adams can deliver the Straight Dope on any topic. Send questions to Cecil via straightdope.com or write him c/o Chicago Reader, 350 N. Orleans, Chicago 60654.

crazy clearance markdown

up to 75% off

B AT H S H O W

Like us on

PLACE

www.burlingtontreetours.com WEEKLY TOURS

100 Ave D • Williston • 802-864-9831 blodgettsupply.com • m-f 830-430 • sat 9-noon

Enjoy 5% off

8h-blodgett080316.indd 1

For individual attention appointments are recommended. 7/29/16 12:45 PM

8h-burlingtontreetours062817.indd 1

6/16/17 3:44 PM

1t-stuck500.pdf

7/31/17

4:30 PM

T H E

in vermont Ther no place like it! SEVENDAYSVT.COM SEVEN DAYS

EVA SOLLBERGER • ALISON BECHDEL • RUSTY DEWEES MARIANNE DIMASCIO • WOODY KEPPEL

08.16.17-08.23.17

FRIDAY, AUGUST 18, ON SEVENDAYSVT.COM Starring

Featuring

THE SMITTENS • POLICE CHIEF BRANDON DEL POZO • LOIS TROMBLEY & SWAN DOJO/SPIELPALAST DANCERS SOPHIE QUEST • MARGOT HARRISON • REUBEN JACKSON • OSCAR WILLIAMS • RUFUS 31

A Boy and His Dog

MAL ISS NI

On the love and loss of my best friend

32 FEATURE

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

B Y D AN BOL L ES

first met Buckley 16 years ago. I was in Brooklyn visiting my friend Ben, who had just adopted this spastic, year-old (we thought) puppy from a nearby shelter. He’d been found on the side of the New Jersey Turnpike, so the shelter had given him the rather unimaginative name Jersey, which Ben changed, thankfully. (Buckley, aka Buck, was named after both the late singer Jeff Buckley and an obscure New England Patriots player, Terrell Buckley. And this is why Ben and I are friends.) I didn’t know then how big a role Buck would come to play in my life. But he sure seemed to. My first night in Brooklyn, Buck padded downstairs from Ben’s room while I was sleeping on a futon. I woke up to find a white, furry ball curled up behind my knees, much as I would on countless mornings in the years that followed. Ben had a hectic schedule and, with Buck’s general craziness, it quickly

became obvious that he was not meant to be a city dog. So I adopted him from Ben a few months later, when I moved back to Vermont from Boston. And my life profoundly changed. That first year, I lost about 25 pounds just trying to keep up with him on walks. I got a crash course in patience and unconditional love — and how they work in concert. Buckley wasn’t just my dog or my best friend. He became an inextricable part of my identity. I’m a different and better person because of him. All owners think their pets are special, and they’re right. But I’ve never known a sweeter, more affectionate and loving dog. Because he had been abused and abandoned as a puppy, Buck was a nightmare in his youth — high-strung, impulsive and stubborn, to put it kindly. (Less kindly: He was an asshole.) But he was always a sweetheart. Even at his most manic, you could see how desperately

Buckley wanted to be good and to be loved. And because he was loved by nearly everyone who entered his life, he grew into a truly remarkable creature. His transformation is one of the things of which I’m most proud. I have a million Buckley stories. Here are but a few. For the first several years of his life, he was terrified of water — one of his many quirks. Another was severe separation anxiety, a likely result of having been abandoned. One summer at a friend’s camp on Joe’s Pond in Danville, my then-girlfriend and I exploited one fear to conquer the other. We repeatedly jumped off the dock and tried to lure him into the pond. After about the fourth or fifth or 16th attempt, Buck’s irrepressible need to be close to his people overrode his disdain for being wet, and he executed an awkward and spectacular belly flop. I can still see it. After a few minutes of frantic

splashing, the light went on. Suddenly, Buck loved swimming. For the rest of his life, I could hardly keep him out of the water. The strategy did backfire later that evening, however. When my girlfriend and other friends went out for a sunset cruise in the boat while I helped with dinner, Buck, who I thought was napping on the porch, dove in after her. I had to swim out halfway across the pond, wearing a life jacket, to retrieve him. Dude sure could swim, though. Then there was his “ability” — really, a heartbreaking response to anxiety — to catch his tail and move around a room in circles, tail in mouth, even going up or down stairs. (I used to joke that he was part goldfish because he moved in circles so often in his youth.) And there was the time he jumped from a secondstory window in Charlotte to chase a rabbit. I only know he caught it because he gleefully trotted home two hours later covered in blood that wasn’t his. Buck had a weird thing about people leaving. Anyone could come into our home, and he’d welcome them with open paws and a thigh nuzzle. But as soon as they tried to leave he would circle them and bark, often placing himself between the exiting guest and the door. I sometimes took ironic comfort in knowing that, while a burglar could get in pretty easily, they’d have a hell of a time leaving. I figured this would just remain another of Buck’s many mysteries (like how he could scarf the last bite of my sandwich but somehow spit out the lettuce), until he solved it for me. One fall at another remote Vermont camp, I went outside for a morning coffee and smoke (sorry, Mom). As I groggily opened the door of the cabin, Buck burst past me and made a beeline for the neighboring cow pasture — which happened to be ringed by a barbed electric fence. Somehow, he made it through the fence unharmed and, to my added horror, reached the herd of cattle 20 yards beyond it. I didn’t feel the coffee spill on my pants as his

COURTESY OF BEKKA BURTON

THE WRESTLING HOUR— WRESTLING TALK SHOW TUESDAYS > 10:00 P.M. GET MORE INFO OR WATCH ONLINE AT VERMONTCAM.ORG

Buckley

MOVING SALE

16T-VCAM081617.indd 1 COURTESY OF ALEX HUDSON

8/14/17 11:34 AM

Deep Discounts on ALL rugs including: large selection of scatter tribal, special order like Kalaty Rug, etc. Call Ahead: 802-434-3626 2791 E. Main Street, Richmond, VT orientalrugsvt.com Dan and Buckley the morning he died

Because your pet is a gem of a friend...

16T-FernandezRugs072617.indd 1

EVEN AT HIS MOST MANIC, YOU COULD SEE

Say you saw it in...

SEVEN DAYS

HOW DESPERATELY BUCKLEY WANTED TO BE GOOD AND TO BE LOVED.

was that, for all of the many critters he’d caught over the years, he never got a squirrel — though not for lack of trying. The next night, Jeremy showed up with a six-pack in one hand and a squirrel pelt in the other. He placed the latter in Buck’s paws as he slept. (In case you’re wondering, Jeremy didn’t kill a squirrel to satisfy a dying dog’s last wish. His own dog had caught it years ago, when Jeremy happened to be learning how to tan pelts.) Yes, I have great friends, and I’m sure they stopped by primarily to console me. But I think they also came out of genuine affection for Buck. It was hard not to fall in love with him. And, as more than a elmharris.com | 225-6584 couple of irritated ex-girlfriends might erin@elmharris.com tell you, Buck and I were a package deal — for better or worse, in sickness and in 12v-elmharrisjewelry081617.indd 1 8/4/17 2:07 PM health, ’til death do we part. When death did come, I held Buckley in my arms as he slipped away. And then I held him a while longer. I found beauty and comfort in him leaving the world as sweetly as he had lived in it. But, man, oh man, I really miss him. Sweet dreams, old friend. I love you. m sevendaysvt.com Contact: dan@sevendaysvt.com 08.16.17-08.23.17

FEATURE 33

Last April, after more than 15 years together, I said goodbye to Buck. As heartbreaking as it was, I feel lucky to have had an amazing run with a unique, challenging and wonderful friend and to have shared him with so many of my favorite people along the way. I’m grateful, too, that I had the opportunity to spend his last days, hours and minutes where I’d loved being for so long: right by his side. I stayed home with Buckley in the week leading up to his scheduled passing. Knowing exactly when your best friend is going to die is surreal. It was sort of like sitting shiva before your loved one has actually passed. But there was a good side, too. Over that week, a number of friends — including ones I hadn’t seen in a long time — stopped by to visit. We’d talk a lot about Buck and share old stories, some I’d forgotten. One evening, I joked to my friend Jeremy that Buck’s greatest life regret

7/24/17 1:52 PM

SEVENDAYSVT.COM

life flashed before my eyes. I was in a state of shock, anticipating a stampede of hooves and an explosion of white fur. My blind panic soon turned to awe and wonder. Buck began to circle the cows, nipping at their heels and barking with clear intent. To my knowledge, Buck had never met a cow in his life to that point. But he was herding them like he was born to do it. As it turns out, he was. A little research following the herding adventure uncovered that Buck was likely an Australian cattle dog, also known as a heeler. He was a red heeler, a less common cousin — at least in the Northeast — of the blue heeler. He wouldn’t let people leave the house because he was corralling his flock. I always suspected some other stuff in Buck’s lineage, though I never got around to a DNA test. The paperwork from the Brooklyn shelter listed “Jersey” as a “pit bull/shepherd mix” — a vague and unhelpful description. But, though he was lean and powerful, Buck didn’t have a pit’s blocky head. And his coat and frame bore little resemblance to any shepherds I’d known. If anything, he looked like an overgrown Jack Russell terrier. I used to call him a “Jacked Russell” when curious fellow dog walkers would ask me what he was. Whatever. He was just Buckley. (He was also strikingly handsome and a total chick magnet. I was I-Spied at least twice because of him. Good lookin’ out, li’l wing dog.) I could go on for hours reminiscing about Buck — and sometimes I do. But my best memories of him are much like that first one in Brooklyn: snuggled up together somewhere cozy. As a good friend once put it, Buckley had a way of making any couch more comfortable. Hence my favorite of his roughly 300 nicknames: Little Spoon.

CHANNEL 15

E SU

Radical Rescue

AL NIM IS

Burlington women seek redemption for adoptable dogs B Y SA D I E W I L L IAMS

SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS 34 FEATURE

PHOTOS: ROCKET

y day, Chelsea Edson is a stylist and photography coordinator for April Cornell. Katie Falcone works in sales and marketing for the Radio Vermont Group. But by night — and on weekends — these women use their branding chops to sell prospective pet parents on winsome pit bulls and playful mutts, using tools like their popular Instagram feed. Edson and Falcone are the driving force behind RAD Girls Club, a nonprofit that uses social media and music events to find homes for rescue dogs. Advocating for down-and-out dogs in shelters and foster homes throughout New England, it could be described as a free marketing firm, dog-walking agency and mini grant distributor rolled into one. Edson, 28, and Falcone, 29, met in the summer of 2015 through the dog of a mutual friend. They each volunteered to care for the canine while its owner was on vacation, and in the process realized that they lived two houses apart in Burlington. “It just sort of happened,” Edson says. “It was a quick, super-fast friendship. We started RAD Girls in the winter.” “RAD” is an acronym for “Redemption for Adoptable Dogs.” Most of the pooches Edson and Falcone represent are stigmatized breeds such as pit bulls, elderly dogs or ones with medical issues that require special care. So far, Edson estimates that the group has advocated for more than 100 dogs, of which 15 to 20 have been adopted. And the women are just getting started. RAD Girls received nonprofit status in June. In July, Mihali Savoulidis of Twiddle selected the organization to receive a grant of slightly more than $3,000 from the band’s White Light Foundation. Edson and Falcone plan to put that money to work. Their love of rescue dogs, and the RAD Girl mission, began with their own pets. Falcone adopted her dog, Nala, from a humane society eight years ago while she was attending the University of Colorado Boulder. “I was never a huge dog person, but for some reason I saw Nala and something just clicked inside me,” she recalls. “I had to have her.” Edson adopted her dog, Blue — also from a shelter — two years ago, shortly before meeting Falcone. Both dogs

Chelsea Edson

Chelsea Edson (left) and Katie Falcone

Chelsea and Katie with their dogs

WE REALIZED THAT GOOD DOGS WERE BEING OVERLOOKED BECAUSE THEY WERE SCARED SHITLESS IN THEIR LITTLE CAGE. CHELSEA EDSON

provided emotional support during difficult periods in their owners’ lives. “We spent a lot of hard nights feeling really worthless and alone,” Edson says, “but Nala and Blue are two of the most loyal dogs, and we’re really lucky for that.” That bond encouraged Edson and Falcone to start RAD Girls. “Our dogs saved our lives enough that we wanted other people to have the experience that we have,” Falcone explains. “We just needed a creative outlet.” Around the time they met, the duo began volunteering at All Breed Rescue, a Williston nonprofit. “We were doing it for fun, to fill up our time,” Edson says. “We were both in these weird transition

periods, and it was good to get out and take the [shelter] dogs on day trips, take them hiking, just to get out of town for a little bit.” As they took the dogs on romps in the woods, Edson and Falcone snapped pictures, hoping the shelter might be able to use them in marketing materials. “We realized they needed promotional help,” Edson says. At that time, she notes, most of the photos on All Breed Rescue’s website showed dogs in cages, or under fluorescent lighting in the shelter building. The shelter does its best, she adds. “Those are the only pictures they have. They’re doing a million things a day; it’s constant, 24/7 maintenance to keep the

shelter clean and the dogs happy and not stressed.” Falcone and Edson decided to lend a hand and began publishing the photos on their Instagram account. “Katie’s in marketing,” Edson says, “and I’m in styling. We thought, Maybe we could do this. Get this dirty dog out of the shelter and take a nice photo of him in nature.” A dog’s personality becomes more evident outside the shelter environment, she adds. “It’s really chaotic in there, and we realized that good dogs were being overlooked because they were scared shitless in their little cage,” Edson says. Since then, she and Falcone have added other organizations to their

Less work, MORE play. The 4.0 college pass is a season long education in the value of more winter.

369

4 resorts = 0 blackout days

Price valid through December 15, 2017, price increases to $439 on 12/16/2017. Buy at killington.com/thecollegepass, or call 800-887-3257

Price increases to $399 after 8/31/2017. All season pass sales are non-refundable and subject to 7% applicable state and local taxes. Purchaser must be registered as a full-time student for fall and spring semesters and have valid college ID upon picking up the pass.

Untitled-16 1

8/14/17 11:59 AM

Having someone here helps me care for my dog.

08.16.17-08.23.17

HOMESHARE Bringing Vermonters together to share homes

SEVEN DAYS

Taking pups on day hikes, snapping pretty pictures and posting to Instagram are only part of the equation. Falcone and Edson also raise money for transportation, medical bills and general funds for various shelters. Their first-ever event took place on Valentine’s Day in 2016 at the Skinny Pancake in Burlington, during the restaurant’s Bluegrass Brunch. “The band was into it, so we set up a table with all our info on it, had pictures of the two dogs we were supporting, and did a raffle. We ended up making $1,500,” Edson says. The RAD Girls have hosted similar events at the Monkey House and Nectar’s. “We’re two girls in our late twenties,” Edson explains, “and the music scene is something we’re heavily immersed in. We figured we could combine [it with RAD Girls] and work with bands who supported our cause, all while raising funds for our organization.” Where does the money go? Edson says, “We’ve paid for multiple heartworm treatments, which are usually about $500 per dog.” They’ve donated to Found My Animal, a dog accessory company based in Brooklyn. That business used the funds to support a rescue road trip coordinated by True & Faithful Pet Rescue Mission, a Florida-based organization that finds homes for animals in the Miami-Dade County area. “We try to be multifaceted in where our funding goes, so that we can help whatever the immediate need is,” Edson says. “Most groups — their needs vary on a case-to-case basis. If they have a dog coming in that needs another six months of heartworm treatments, that can be all of their budget.” Soon, the RAD Girls hope to expand their fundraising methods by starting an online retail store. “We want to launch into a lifestyle brand for people and their dogs,” Edson says, “as a way to generate money that we can pump back into our nonprofit.” Dogs like Hobo, a 7-year-old Akita mix, can attest to the good that could do. Left homeless after his Georgia owner passed away, the scruffy senior spent months being fostered by VT Dog Rescue, according to the RAD Girls’ Instagram page. In July, he went home. m

SEVENDAYSVT.COM

Contact: sadie@sevendaysvt.com

INFO Follow @radgirlsclubvt on Instagram and RAD Girls Club on Facebook. radgirlsclubvt.com

863-5625 • HomeShareVermont.org Untitled-1 1

8/11/17 10:09 AM

FEATURE 35

roster: Shelburne’s Passion 4 Paws, Potter’s Angels Rescue in East Randolph, Hinesburg-based VT Dog Rescue, and Susie’s Senior Dogs, operated by Erin O’Sullivan and Humans of New York blogger Brandon Stanton. RAD Girls have other contacts in New York City who sound the call when a foster home is needed for an animal about to be euthanized, or for harder-to-place dogs. Most of the dogs Falcone and Edson represent come from the southern United States, where many rescue operations find the most urgent need. “There’s rampant animal homelessness down there,” Edson says, “and the homeless animals are continually reproducing.” Many of the dogs pictured on their Instagram are pit-bull mixes and older dogs, reflecting their focus on finding homes for dogs that have been in shelters the longest. “Puppies are scooped up first,” Falcone says, “and for some reason there’s still a stigma against pit bulls. It’s racism in the dog community.” Regardless of public perceptions, the RAD Girls take the position that any dog has the capacity to be aggressive, and not all pit bulls are fighting animals. “We’ve worked with pit bulls who are dog-aggressive but sweeter than honey with humans,” Edson observes. “We’ve also worked with pit bulls who would let babies and cats and other dogs crawl all over them without any issue.” Numbers from the American Temperament Test Society back up those anecdotes. The nonprofit performs behavior evaluations focused on shyness, aggressiveness, stability, protectiveness and other traits on dogs in a controlled setting, generally measuring the ability to interact with humans. (This test is not equivalent to the controversial aggression test used by many shelters, as recently reported in the New York Times.) According to ATTS, American pit bulls have an 87.4 percent pass rate. Golden retrievers scored at 85.4 percent; English foxhounds, 66.7 percent. The scores are based on the dogs’ responses to a variety of situations, including an umbrella opening, an amiable stranger approaching, and a threatening person yelling loudly at them. “We really strive to show people that the pit-bull stigma is actually ludicrous,” Edson says, “and that any dog can be aggressive. We love getting people to meet shelter pit bulls because, more often than not, they’re shocked by how gentle and sweet they are.” It doesn’t hurt that the pitty pups the RAD Girls photograph are often exceedingly photogenic.

Tails of Wow! A new upscale pet resort and spa coddles creatures in the lap of luxury B Y KEN PICAR D

SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS 36 FEATURE

emma and Mayhem took a brief a large or XL breed, add a $3 hair respite from their midmorning bow, and you’ve got yourself one dip in the indoor splash pool to happy hound. saunter over to the observation “The ‘pet parents’ are conwindow and watch their human caretak- stantly asking if they can stay ers enjoying a cup of coffee in the retail here. We must get asked that boutique. Neither Jemma (a Cockapoo) three times a week,” said nor Mayhem (a Labradoodle) were Heather Soren, who coscheduled for a dog massage, “pawdi- founded Happy Tails with cure” or the weekly special: a $10 blue- her mother, Donna Little. berry facial. Nevertheless, their owners “Our vision from the very could call in or text these or other beginning has been to propooch-pampering extras at any time of vide our clients with the full day, and spa staff would gladly oblige. package.” The Happy Tails Pet Resort and Spa, a The mother-and-daughter duo from new pet daycare and boarding facility in Shelburne, who previously spent deSouth Burlington, offers many more cades raising beagles and showing jowl-to-tail services. Perhaps horses in Ocala, Fla., designed AL ISS your Corgi or Boston terrier the new 10,000-square-foot M I would enjoy a spa bath and facility from the ground up. grooming, a teeth brushTheir attention to detail ing and breath freshening, a shows. Visitors immediately nail “pawlish,” having an anal notice the abundance of wingland expressed or some hair dows, which let in ample natustenciling. ral light. That last procedure is described Inside, two- and four-legged guests as “a fun way to involve your pet in are greeted at the front desk by smiling, a special occasion or holiday.” Think headset-wearing staffers who provide Rover adorned with red hearts for each new human client with a detailed, Valentine’s Day, orange jack o’ lanterns eight-page questionnaire that docufor Halloween or the New England ments everything staff need to know Patriots’ logo for Super Bowl Sunday. about a hound or kitty: Is your pet miThese are just a few examples of the crochipped? Is it taking any meds? Is lavish love that Happy Tails showers Rufus a couch potato or an elite athlete? upon its guests. The new facility, which Does Bailey chew on his leash, hoard opened January 1, describes itself as a toys, climb trees or eat feces? “one-stop shop” for animal lovers and While enjoying a free cup of coffee their canine or feline family members. beside the lobby’s gas fireplace, pet Though posh pet hotels have long been a parents may then peruse free gourmet thing in large metropolitan areas, Happy pet food samples offered in the bouTails is the first in Chittenden County to tique — kibble flavors available during a embrace the moniker of “upscale resort recent visit included turkey, venison and kangaroo. and spa” for four-legged creatures. “We want people to feel comfortable Perhaps your kitty would enjoy a “brain-teaser activity” ($4) to “keep here. It’s not just a handoff and then you your cat interested and playful,” or the go,” Soren explained. “There’s some real “sanitary trim” of its genital area ($12) to communication [such as], ‘Did your dog “reduce matting and associated odors.” eat anything last night that we should be Think of it as a Brazilian for your puss. aware of?’ We’ve had a few of those ‘If Then there’s the “escort” service — for you see my ear buds, let me know.’” Cat parents boarding their felines are vet visits, of course. For doggies, a standard 4-by-4-foot immediately escorted to the five-bed suite for an evening will run you $55 per cattery, aka “the Catnip Inn,” a room night; or upgrade to the deluxe 4-by-6- that’s segregated from the barking and foot suite for $65. Toss in a $45 massage baying bustle of dog areas. There, the for the small to medium pups or $60 for cattery’s lone guest for the morning, a

A pampered pooch

gray and white feline, was playfully batting a paw under his clear Plexiglas door. “Ashton is in what we call the ‘family suite,’” Little explained about the transparent floor-to-ceiling “atrium” that can accommodate several kitties simultaneously. The family suite provides Ashton with his own cat tree, sleeping hammocks, litter box, food and water bowls, and window with a view. No mention of Netflix or on-demand Animal Planet shows. In the cattery, one is immediately struck by the smell — or, more accurately, the lack thereof. Whatever stink nuggets Ashton had deposited in his litter box that morning had already been dutifully whisked away by Happy Tails’ staff. Aiding in such olfactory efficiency is the cattery’s state-of-the-art ventilation system, one of four such HVAC systems in the building that completely refresh the air every six minutes, flushing away airborne odors and pathogens. The air-exchange system in the cattery is isolated from the rest of the facility, Soren noted, so that felines don’t have to endure the smell of dogs. That said, cats have access to a window for watching the dogs play outside. Pet owners who board both their family cat and dog have the option of scheduling daily interspecies visiting sessions — assuming, of course, they don’t fight like cats and dogs. By necessity, most of the resort and spa is the dogs’ domain. The first of two

large indoor play parks looks more like a preschool daycare center than a kennel, but with walls that can be hosed down and sloped floors and drains for washing away the inevitable fluid messes. The walls are painted bright orange, green and pink, as are large tubes and other play structures for dogs to explore. Five-foot chain-link fences create separate play areas where, Little explained, the pups are divided by age, size, play style and temperament. Sorry, statusconscious dog owners, but there’s no further dividing by pedigree, tax bracket or political affiliation. Next, we entered a gymnasium-size room that houses sleeping kennels, or dog “suites.” Each one has its own raised canvas bed and swivel door for food and water bowls. For an additional $6, parents can order an extra fleece snuggle blanket for afternoon naptimes and overnights, a Frosty Paws ice cream treat ($4) or a peanut-butter- or cheese-filled Kong before bedtime ($4). There’s even a “personal shopping spree” in which “your dog picks out his own toy from our boutique.” “It’s the little things,” Little said. “But we don’t charge for the petting or getting tucked in at night,” Soren clarified. Tucked in? “Well, yeah. All the dogs get tucked in at night,” Soren confirmed. “We’ll tidy up their suite and make a little nest with their blanket and [provide] some fresh water and a nighttime treat.” Dog cookies are put in their dish, not on the pillow to avoid crumbs in bed. Notably, because Happy Tails is staffed 24/7, potty breaks can happen at any hour of the day or night. “If your dog has to go to the bathroom at four in the morning,” Soren said, “someone is always here to take them outside.” Adjacent to the sleeping kennels is a full-service kitchen, where Happy Tails staff provide dogs and cats with whatever meals they’re accustomed to, be they grain- or gluten-free, raw, cooked or vegan. “That could include fresh vegetables on top of their kibble,” Little noted. “Always fresh vegetables,” Soren emphasized. “That’s big.” “Or a dollop of yogurt,” Little added. “That’s what we do here. If it’s that one little thing that makes them comfortable, we’re happy to make that happen.” On the day this reporter visited, most of the action was outdoors, where some two dozen dogs snoozed in the dirt,

chewed on each other’s necks or chased each other around the yard. Soren noted that each employee never supervises more than 15 dogs at a time. Also, the perimeter fencing includes underground wires to prevent any digging dogs from, as Soren put it, “Shawshanking it out of here.” Want to watch what your dog is up to in the yard? For an additional $25 per visit, Happy Tails will outfit Wilbur with a waterproof GoPro camera so you can watch him make his rounds. Sounds

Dogs playing at Happy Tails Pet Resort and Spa

Dog gets a spa bath

PHOTOS COURTESEY OF HAPPY TAILS

Your Best Friend. Our Best Medicine. Call Today. WWW.LONGTRAILVETERINARYCENTER.COM 802-876-7333

WE WANT PEOPLE TO FEEL COMFORTABLE HERE. IT’S NOT JUST A HANDOFF AND THEN YOU GO.

4t-longtrailvet081617.indd 1

8/8/17 4:54 PM

HEATHE R SOREN

BECOME A GIFTED SHOPPER. INSTANTLY.

08.16.17-08.23.17

Famous Bennington Pottery & Homestyle Store

Contact: ken@sevendaysvt.com

Happy Tails Pet Resort and Spa, 1045 Hinesburg Rd., South Burlington, 489-5496. happytailsvermont.com

bennington potters free gift wrapping | we ship anywhere | gift certificates 127 COLLEGE STREET, BURLINGTON M-F 10-9; SAT 10-6; SUN 11-5 * 802 863 2221

127 college burlington | open every | 802.863.2221 FREE GIFTstreet, WRAPPING CERTIFICATES * WE SHIP ANYWHERE * GIFT day Untitled-36 1 BPN_Oct-2015_7Days-2.indd 2

7/31/17 2:10 PM PM 5/6/17 1:29

FEATURE 37

INFO

MUCH MORE

3 FLOORS OF POTTERY & HOME GOODS

SEVEN DAYS

severely abusive household. The dog had a plethora of behavioral and emotional issues to overcome, she said, in-COLORFUL cluding being very shy and standoffish,TABLE LINENS especially around men. After anotherBENNINGTON boarding facility kept Luke confinedPOTTERY in his kennel for three hours at a time,DECORATIVE ACCESSORIES Easton discovered Happy Tails. “I’ve never really seen a center likeGLASSWARE this,” said Easton, who also has twoVT MADE, children with special needs at home andFAIR TRADE brings Luke to Happy Tails several times& RECYCLED a week. Although he initially displayedOPTIONS signs of separation anxiety, “Now, heCANDLES can’t get over there fast enough,” sheGREETING CARDS said. It’s easy to understand why. EastonBAKEWARE routinely treats Luke to the full treat-HOLIDAY ment, including a spa bath, massage,DECORATIONS FUN nail trimming and ear cleaning. “They just baby him,” she added. “HeSTOCKING gets the full nose-to-tail treatment, andSTUFFERS FURNITURE he absolutely loves it.”

SEVENDAYSVT.COM

entertaining — until he starts mounting other spa guests. Perhaps you’re on vacation in the Cayman Islands and need a little FaceTime with your bichon frise. Both Little and Soren give out their cellphone numbers so that pet parents can get regular photo and video updates; parents can even live video conference ($10) with their critters if desired. Soren did so recently with Stella, a pug, whose parents were away in Italy. “That’s not uncommon,” she said. “People consider their dogs [to be] very much a part of their family,” Little agreed. “They’re loved as much as a child.” Though some people may chafe at the notion of pampering pooches with massage, hair chalking and yogurtdolloped dinner, many pet owners see it as a way to lavish their furry best friends with love. That’s especially true for pets that had a rough start in life. Terrie Easton is a regular client of Happy Tails who can’t say enough nice things about how the staff treats her dog, Luke. Easton rescued the 3-yearold beagle about a year ago from a

Pet Peace of Mind

thinking.

Animals and people share shelter in Lamoille County

KIM SCAFURO

BY SALLY P O L L AK

wheeling.

38 FEATURE

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

styling.

4v-free-colors.indd 1

for all.

ore pets than people are living this week at the Clarina Howard Nichols Center in Lamoille County, which provides a home for women and children fleeing domestic or sexual violence. At staff meetings, a pug on the premises hops into people’s laps. “It brings a totally different vibe to the house,” said Ally Scanlon, family and youth advocacy specialist. No children are at the shelter right now, but when kids stay there, they play with the animals all the time, she said. Clarina is one of nine shelters in Vermont for people who have experienced domestic violence, and the only one where residents can stay with their cats and dogs, according to Karen

6/12/12 3:25 PM

Tronsgard-Scott, executive director of the Vermont Network Against Domestic and Sexual Violence. The shelter is currently providing temporary housing to four people, four cats and two dogs, Scanlon said. In the past fiscal year, 10 of the 27 people who stayed there brought their pets, she noted. The center established its Sheltering Animals and Families Together (SAF-T) program three years ago, using grant money to build kennels, fence in the yard, and purchase the equipment and food needed for animal care. The grant was provided by an organization called RedRover, which is working to create at least one pet-friendly shelter per state, according to its website.

At Clarina, staffers were interested in the program because they recognized that pet ownership can make it more difficult for a person to leave an abusive situation, Scanlon said. “We jumped on it because we thought, Wouldn’t it be great if we could have pets here?” Pets are a “paramount consideration” to a person who is thinking about getting out of a violent home, Tronsgard-Scott said. Many people won’t leave without them. “People who are experiencing domestic violence are just like you and I, and they have abusive partners,” TronsgardScott told Seven Days. “They love their pets. I’m sitting here with my two dogs, and they’re like children to us.” Studies indicate that a person who is violent toward an animal is more likely

MAL ISS NI

PETS ARE A LOVING COMFORT

TO PEOPLE WHO EXPERIENCE DOMESTIC VIOLENCE, JUST AS THEY ARE TO YOU AND ME.

Burlington Emergency & Veterinary Specialists

24/7

EMERGENCY CARE INTERNAL MEDICINE ONCOLOGY SURGERY REHABILITATION PAIN MANAGEMENT ACUPUNCTURE 802-863-2387 200 Commerce Street Williston, VT 05495 bevsvt.com

4t-BEVS080917.indd 1

8/8/17 10:44 AM

CCV. Because...

SEVENDAYSVT.COM 08.16.17-08.23.17

I wanted to expand my horizons and stay close to home.

Untitled-23 1

ccv.edu/register 7/24/17 4:02 PM

FEATURE 39

CCV

Will Nally Farm Hand Cabot

SEVEN DAYS

to cause serious or lethal injury to a time of great pain and nonviolent partner, she said. So pets can turmoil. Trauma does be both an indicator of possible violence not take time off. Having and a source of “loving comfort” to 24/7 companionship and comfort with someone experiencing domestic vio- you makes a world of difference for the lence, in Tronsgard-Scott’s view. better. A primary concern for residents When dealing with trauma, having a with pets is that their animals might pet by your side brings immense comfort be harmed if left behind, according to and strength during a time of great pain Scanlon. The animals provide support and struggle. I think you could make and comfort to their owners — and to SAF-T better by spreading the program others, she said. to other shelters as Guests who don’t far and wide and have pets are “upquickly as possible. lifted” by the critIt would help bring ters’ presence. some much-needed “I feel like it relief from pain for brings them a adults, kids and pets little bit more joy,” alike. From someone Scanlon said. “Guests and their pet who who don’t have pets are very grateful will become best friends of people that the program KA RE N TRONSGA RD -SC OT T who do and will help exists, sending out them take care of the a thank-you to the animals.” Clarina Howard In the six years Scanlon has worked Nichols Center for taking a chance at the center, she has seen people return on the program. From mine and my for multiple stays. Women who got pets dog’s point of view, it is well worth it. between stays at Clarina have reported that they remained out of an abusive relationship for a longer interval after Guest No. 2 (49 years old) they had a pet, according to Scanlon. My dog literally saved my life. I adopted “Pet owners know how attuned pets are to what’s going on in our lives,” him from a shelter in 2016. I am disabled Tronsgard-Scott said. “They’re really with a chronic condition, PTSD and attuned to their owners’ trauma. Pets major anxiety disorder. If I did not are a loving comfort to people who ex- have him with me I would be lost … He perience domestic violence, just as they gives me a reason to get out of bed every morning — he needs to be walked, fed are to you and me.” An online list of SAF-T facilities in- and bathed, almost like having a child, a dicates that Clarina is the only shelter “furry” one at that! I was very scared to in New England that accepts people leave my abuser, but [my dog] gave me with their pets. Staff at Clarina say they the strength and courage to finally leave receive inquiries from women outside a very “toxic” situation. Vermont seeking a place to stay. “They When my time comes to leave are specifically trying to come to our [the] shelter, it will be very scary — I shelter because they heard that we have never truly been by myself, so it allow pets,” Scanlon said. will be a new “adventure” to journey A more common practice is for on together. I was fortunate to find a shelters to work with animal rescue shelter that was “dog friendly” — had organizations to arrange foster care for it not been for the staff and shelter, we pets, according to Tronsgard-Scott. She would be sleeping/living in my car. knows of no plans for another animalIn a perfect world, there would be no friendly shelter in Vermont. domestic/sexual assaults — but until Two residents at the shelter wrote for Seven Days about the experience of then, I have been blessed to have my having their dogs with them under the furry companion/therapy dog to help SAF-T program. For their protection, me through what I would otherwise be going through alone. Maybe someday we have not revealed their identities. other shelters will follow their exGuest No. 1 (44 years old) ample and allow pets in shelters across the country! There was such a fast upheaval of mine and my dog’s life that being able to INFO stay together was an immense positive Learn more at clarina.org or alliephillips. emotional help for both of us during a com/saf-tprogram/saf-t-shelters.

Hide and Seek

For search-and-rescue canines, finding victims is all in a day’s work — and play B Y JUL I A SHIPL EY

SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS 40 FEATURE

JULIA SHIPLEY

hen Avery Schneider and her 21-month-old American Labrador retriever, Birdy, go to work, they often head for a big pile of rubble deep inside the Vermont National Guard’s Camp Johnson base in Colchester. The pile looks as if a medium-size box store exploded or a parking garage collapsed: Think smashed cars, broken concrete walls, storage containers stacked like shoeboxes. Created for Vigilant Guard — the 10-day emergency-response exercise held in July 2016 — the chaos was carefully engineered to simulate a sudden disaster. As such, it contains elements of an urban catastrophe, including pockets within the debris where victims might be trapped. That’s why the rubble pile is a great place to train a “live-find” search-andrescue dog. Schneider is a K-9 handler for the Vermont Task Force 1 (VT-TF1) — the state’s urban search-and-rescue team trained by the Federal Emergency Management Agency. Since the rubble site was installed at Camp Johnson, she has brought Birdy to it a dozen times to practice “scent work.” That is, Birdy is being trained to find people buried alive in a disaster site. Schneider, 20, and Emily Fitzpatrick, 27, are two of the four K-9 handlers on VT-TF1. Its 90 members statewide also include doctors, firefighters, structural engineers, police and emergency medical technicians. The force was initiated in 2002 to augment local emergency services in response to major natural or manmade disasters such as hurricanes, floods, conflagrations, explosions, earthquakes or other events of mass destruction. The primary mission of VT-TF1 is to “provide advanced technical search and rescue capabilities to retrieve victims trapped or entombed in structurally damaged buildings,” according to the Vermont Department of Public Safety website. As part of the search team, Schneider and Fitzpatrick are preparing their dogs to pass rigorous national certification in urban search and rescue (both have already been certified at the state level). The women frequently train

KNOWING THAT SHE CAN SAVE SOMEONE’S LIFE

MAKES THE WORK WORTHWHILE FOR

SCHNEIDER; FOR THE DOGS, IT’S THE THRILL OF OBTAINING THEIR TOYS.

Avery Schneider and Birdy

their canines together. Last week, this reporter joined them at Camp Johnson. Inside Schneider’s vehicle, Birdy waited in her crate next to bins containing leashes, collars, harnesses, food, a cooling fan, water, bug spray and, most importantly, a blue rubber Kong ball on a tether — Birdy’s favorite toy. Fitzpatrick’s dog, Remi, a 14-month-old black Lab, is Birdy’s sister from a different litter. Both dogs practice elements of live-find work three to four times per week. Schneider and Fitzpatrick both wore navy-blue shirts emblazoned with their last names, matching pants, rugged boots, and helmets outfitted with earplugs and headlamps. The dogs wore only their collars. Before letting her canine out of the truck, Schneider covered the dog crate with a towel so that Birdy couldn’t cheat by watching Fitzpatrick hide in the rubble pile carrying the blue ball. Schneider then approached the pile carrying a small bottle of baby powder,

which she squeezed. She watched how the puff of powder fell, which conveyed the direction of the wind and thus how Birdy would pick up on the airborne scent of a living human hidden in the rubble — in this case, Fitzpatrick. Finally, she fetched Birdy from her crate, asking, “Ready to go to work?” Schneider has been training Birdy since the dog was eight weeks old, preparing her for everything the live-find job entails: scrambling up treacherous terrain, finding the scent of living humans, following the scent to its point of greatest concentration and, finally, alerting the handler with a series of loud, confident barks. While cadaver dogs can help locate the remains of victims, live-find dogs detect breathing — but possibly unconscious — people hidden under rubble. Michael Cannon, coordinator of Vermont’s urban search-and-rescue program, says the force as a whole has been deployed a dozen times over the

past several years. Of those instances, the K-9 unit has been activated or put on standby at least three times. Those situations included the Amtrak passenger train derailment in Northfield in October 2015, an exploded home in Guilford in July 2016, and, just last month, a house explosion in Bradford. Schneider unsnapped Birdy’s leash and kissed her dog on the head. Then she stood back as Birdy bounded off to “work” the pile. The Lab briskly loped up and down the slabs and chunks of concrete. To prepare Birdy to be nimble and fearless over coarse terrain, Schneider has routinely exposed the dog to “a ton of uncomfortable circumstances — uneven, unstable, rough surfaces,” she explained. For example, Birdy went through a period of eating her kibble while standing on chicken wire. This mix of intense discomfort and the reward of food — and, increasingly, play — is the core of Schneider’s work with Birdy, so that she

2500 Williston Road • South Burlington, VT • (802) 862-5514 2455 Shelburne Road • Shelburne, VT • (802) 985-3302 Monday-Friday: 9-7; Saturday & Sunday: 9-6

wecare@pfwvt.com • www.pfwvt.com

Untitled-3 1

8/11/17 10:53 AM

Untitled-37 1

8/14/17 5:00 PM

08.16.17-08.23.17 SEVEN DAYS

Schneider left high school early for pre-veterinarian training at the State University of New York at Cobleskill and supplemented her studies by riding along on veterinary calls with assistant professor Lynn Geoffroy. Another professor introduced Schneider to working with canines and inspired her to intern at the Penn Vet Working Dog Center at the University of Pennsylvania in Philadelphia. From there, she transferred to Sterling College in Craftsbury Common and simultaneously joined the town volunteer fire department. Schneider was recruited to join VT-TF1 in 2015 when Cannon observed her abilities with Birdy at a school for fire and rescue services in Newport. Last week at the Camp Johnson rubble pile, this reporter waited uncomfortably in a blue barrel for Remi to detect her, and the seriousness of the dog’s work became profoundly apparent. What if someone were pinned under too much rubble, unable to yell, perhaps knocked unconscious? At a disaster site, one’s only chance of survival might depend on a dog with a good nose, trained by a dedicated handler. After five minutes, Remi’s sniffing became audible. She began whimpering and then barking sharply (aka “making an alert”). Then, as instructed, this reporter offered Remi’s favorite toy, a brown tug on a tether, as the reward for her find. Schneider reiterated that her livefind canine training is based on linking the uncomfortable, stressful “find” work with the experience of joyful play. Given the potential severity of the situations for which she and Fitzpatrick prepare their dogs, the reward-based aspect is crucial. Knowing that she can save someone’s life makes the work worthwhile for Schneider; for the dogs, it’s the thrill of obtaining their toys. “We’re training them to get what they want if they try hard enough,” she said. Though the Camp Johnson site is one of the state’s optimal places for K-9 live-find training, Schneider and Fitzpatrick also train at DuBois Construction in Middlesex, the Vermont Police Academy in Pittsford, Colchester Technical Rescue and at any vacant playground where dogs are allowed. “Yeah,” said Fitzpatrick. “You should see Birdy go down the slide.” m

SEVENDAYSVT.COM

INFO

FEATURE 41

has the stamina and drive to find victims in potentially treacherous places. On the back portion of the rubble pile, Birdy approached a piece of plywood abutting a concrete ledge. Sensing the presence of Fitzpatrick’s natural human odor, Birdy began to whine urgently, then issued several authoritative barks. Birdy had successfully found her “victim,” who was concealed in a hole beneath the plywood. In response, Fitzpatrick rewarded Birdy’s discovery by offering her the treasured blue ball and playing a brief bout of tug of war. Schneider has deliberately cultivated extra significance for the ball so that Birdy exerts her best effort, knowing that if she finds a victim, she gets to play with her favorite thing. “Right now, if she had to choose between food and that ball,” Schneider said, “she’d choose the ball.” And Birdy’s highly desired toy is only available when it’s time to work. Schneider believes that toy-based reward is important, because she knows it’s likely that food could be found in any rubble pile. “If you have a dog that works for food, it might not work that hard,” she explained. But no disaster scene is going to have that blue ball. According to FEMA’s 85-page Canine Search Team Certification Evaluation Handbook, Schneider and Birdy need to perform decisively well in five categories: obedience, bark indication, direction and control, agility, and rubble site features. As part of this test, human and canine have 20 minutes to search for victims in an unfamiliar rubble pile, which must “attain a minimum average height of 10 feet and consist of an area of 5,000 to 8,000 square feet … predominantly of concrete or a mixture of materials common to disaster sites.” Schneider seems preternaturally gifted and focused given her age — last summer, at age 19, she was the youngest rescue personnel in the Vigilant Guard exercise. Perhaps it’s because she’s been training herself for a role as a handler since she was a child. She grew up on a farm near Cooperstown, N.Y., where her parents practiced agility training with their dogs. When Schneider was 16, she prepared two goats — a Nigerian Dwarf and an Oberhasli — for a live performance in a local opera production. She pottytrained the animals and monitored when they ate, drank and would need to relieve themselves in order to avoid onstage accidents. Additionally, she acclimated the goats to loud noises, bright lights and other people.

AL ISS IM

Learn more about Vermont Task Force 1 at firesafety.vermont.gov/emergency/usar or follow them on Facebook.

Tasty Transition

food+drink A selection from Douglas Sweets

Vermont Artisan Village bridges farms and greater Burlington B Y SA L LY POL L A K • PHOTOS B Y LE E KROHN

42 FOOD

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

new community is taking shape off Route 7 in Shelburne. On 20 acres, Burlington-based architect Graham Goldsmith is constructing a group of buildings designed to evoke Vermont’s agricultural heritage while supporting contemporary food and beverage enterprises. Goldsmith owns the property located at 120 Graham Way, east of Route 7 and a bit south of Shelburne Museum. The concept connects Burlington and its suburbs with the rural region beyond, he said. “We want to make the transition between businesses in Burlington and farming just south of [it], and we created a space in between where businesses can get a start,” Goldsmith said. “They need a place that has presence … I want it to be a fun place for people to come, and a fun place for people to work.” Goldsmith’s firm has completed hundreds of projects, including the Kilburn & Gates complex occupied in part by Citizen Cider. He previously renovated and established a set of buildings — one of which houses EatingWell magazine — on the north side of the 20-acre property. The new phase of the development is projected to add 12 buildings on the southern portion, Goldsmith said. Of those, three are completed and occupied, and a fourth is scheduled for completion in the fall. The Shelburne project, which Goldsmith prefers to call Shelburne Green, is more commonly known as Vermont Artisan Village. A handful of family-owned food businesses have set up shop there: Douglas Sweets, Vermont Tortilla Company, Bijou Fine Chocolate and Fiddlehead Brewing. A new business, Wild Hart Distillery, is scheduled to open by Labor Day, said distillery co-owners and founders Naomi Clemmons and Craig Stevens.

FOOD LOVER?

GET YOUR FILL ONLINE...

Wild Hart will make gin and vodka, using locally sourced grains from Nitty Gritty Grain Company of Vermont for the latter. It will also have a tasting room with retail sales. Clemmons and Stevens said the site appealed to them for practical purposes — locale, visibility, sales opportunity — but primarily for the community they are joining. “For us, it was really attractive because it’s a community, and the folks there are really interested in being a community,” Clemmons said. “So it’s been fun. And there are opportunities to collaborate. And we think collaboration is where it’s at.” Seven Days spoke with business owners already established at Vermont Artisan Village to learn more about the burgeoning community.

Before leaving, she sold the timberframe house she had built with her father on Bolton Mountain. “My job was to show them the world,” said Townsend, 59. “And that’s what I did.” When the family returned to Vermont, they stayed for a few months with friends in Jonesville. Townsend had no firm plans for the future. “I really didn’t think that far ahead,” Douglas Sweets she said. “I didn’t care. I was just glad for douglassweets.com what we were doing.” While in Jonesville, Townsend baked Debra Townsend, founder and owner shortbread — a traditional Scottish of Douglas Sweets, took a somewhat butter cookie — for her hosts, Diane circuitous route to starting her Mariano and John Cohn. Sharing the shortbread company. It began, sort of, cookies with friends around the table, in 2008, when Townsend and her four teenage kids embarked on a two-year someone suggested Townsend sell backpacking trip around the world. her shortbread at Richmond’s Annual Holiday Arts Festival. “I sold tons,” Townsend recalled. When she moved out of the Mariano-Cohn home into her Bolton Valley condo, Townsend started a little shortbread company in her kitchen. She named it Douglas Sweets for her mother, Joan Douglas, whose shortbread recipe informed Townsend’s. “I took cookies into stores Debra (left) and Hannah Townsend of Douglas Sweets and dropped them off,” she LISTEN IN ON LOCAL FOODIES...

BROWSE READER REVIEWS OF 1,000+ RESTAURANTS AT SEVENDAYSVT.COM/FOOD. REGISTER TO JOIN OUR BITE CLUB. YOU’LL GET FOOD NEWS IN YOUR INBOX EACH TUESDAY.

recalled. Her first retail account was at Healthy Living Market & Café in South Burlington, and many followed, including City Market/Onion River Co-op, Shelburne Supermarket and Hunger Mountain Co-op. Townsend added flavors and icings to the plain biscuits, a variety of which is packaged for sale. Having outgrown the condo kitchen, Douglas Sweets moved last fall to Vermont Artisan Village, where Townsend and her business partner —daughter Hannah, 25 — have a retail bakeshop. Filling the shelves are bags of shortbread, coffee and a lovely array of baked goods, including fruit tarts, galettes and cheesecakes — all of which are made with shortbread dough. Townsend designed and built the interior of the space — the walls, tile work, concrete counter and wooden bar with seating by the window. “I honestly think she wanted a retail shop so she could design and build a retail space,” Hannah said. Her mother, who is considering moving to a larger space at Vermont Artisan Village, concurred. “I love building; I love design,” Townsend said. “I like baking, but designing stuff is my thing. That’s me.” Hannah manages social media, marketing and other administrative aspects of the business. Through a cold call to TASTY TRANSITION

» P.44

LOOK UP RESTAURANTS ON YOUR PHONE:

CONNECT TO M.SEVENDAYSVT.COM ON ANY WEB-ENABLED CELLPHONE AND FIND LOCAL RESTAURANTS BY LOCATION OR CUISINE. FIND NEARBY EVENTS, MOVIES AND MORE.

GOT A FOOD TIP? FOOD@SEVENDAYSVT.COM

SIDEdishes SERVING UP FOOD NEWS

Nuts, Bolts and Beers

IN CABOT, HARRY’S HARDWARE ADDS BEVERAGE SERVICE

Lee Duberman

Breakfast Lunch Dinner Take Out

Church St, Burlington, VT

7/31/17 1:48 PM

Fresh. Filtered. Free.

SEVEN DAYS

Suzanne M. Podhaizer

CONNECT Follow us for the latest food gossip! On Twitter: Hannah Palmer Egan: @ findthathannah; Sally Pollak: @vtpollak. On Instagram: Hannah, Julia Clancy and Suzanne Podhaizer: @7deatsvt.

sevendaysvt.com/daily7 12v-daily7-coffee.indd 1

FOOD 43

Hannah Palmer Egan

ARIEL’S RESTAURANT IS FOR SALE

Almost a year ago, ANDREW LEICHTHAMMER and SCOTT KERNER opened GOOD MEASURE BREWING in the old IGA grocery store building at 17 East Street in Northfield. Kerner also co-owns Montpelier’s THREE PENNY TAPROOM and a coffee biz called CARRIER ROASTING. Now, under the name NORTHFIELD SOCIAL CLUB, with the help of “imaginative banking work,” Kerner and ROSS EVANS, his brother-in-law and partner in Carrier, have purchased the building that houses the brewery. After years of business ownership, Kerner noted, “I’ve finally got some commercial real estate under my belt.” By the holidays, Kerner and Evans plan to move the coffee company under that roof, creating a shared space that will function as a retail outlet, café, tasting room and event space. “You’ll walk in the front door and have the brewery on the right side and the roaster on the left side,” Kerner said. “It’ll be a one-stop liquid shop.” Part of the fun is inviting members of the public to experience the process. “It’s a production space,” Kerner continued. “It’s loud, it’s sometimes hot, it smells like beer … [soon] you’ll be smelling coffee, as well.” The extra space will allow the brewery to undertake 175 new projects, such as adding a barrel-aging room in the basement and cold storage Untitled-26 1 to facilitate the brewing of lagers. The coffee company will grow, too, with a larger roaster and more opportunities for retail sales, both in the NSC space and beyond. “Every small town should have a brewery. Every small town should have a little coffee roaster,” Kerner said. “I’ve been happy and blessed to find a life in Northfield … We’ve been able to create a beautiful brand [here], and I look forward to taking it to the next level.”

08.16.17-08.23.17

Sally Pollak

Adios Ariel’s

NORTHFIELD SOCIAL CLUB TO COMBINE BREWERY AND COFFEE ROASTER

SEVENDAYSVT.COM

ARIEL’S RESTAURANT in Brookfield is for sale, its owners announced Monday morning on Facebook. LEE DUBERMAN and RICHARD FINK have run the restaurant for 21 years out of their 19th-century home on Sunset Lake. The married couple plans to sell the business and move to San Miguel de Allende, Mexico, where they have spent the past three winters. “What we want to do is wrap things up, stay healthy and go to Mexico,” Fink, 63, told Seven Days. “We’ve already had people coming by here and telling us how much we mean to the community. It’s unbelievably joyous, and very painful.” Among the incentives for selling Ariel’s, Fink said, are finances, a desire to move on before “burnout,” and diminished enthusiasm for living in the U.S. under the Trump administration. Duberman, who is the chef, cooks out of a small kitchen in the house, often popping out of that space to greet customers. Her meals use ingredients foraged by Fink and raised on neighboring farms. Her sourdough starter predates her restaurant. Before opening Ariel’s, Duberman and Fink owned a restaurant on State Street in Montpelier, About Thyme Café & Catering. They also ran a barbecue restaurant in that city called Finkerman’s Riverside Bar-B-Q. “I love what I do, and I don’t want to put out a bit of food that I haven’t created and approved and tasted,” said Duberman, 61. “I can’t do it any other way.” But over her 30 years of cooking in central Vermont, including teaching at the NEW ENGLAND CULINARY INSTITUTE, the work has taken a physical toll, she said. In Mexico, Duberman and Fink plan to run a small bed-and-breakfast in a home they are renting, do some “cultural tourism” and host pop-up dinners. “It’s really, really hard thinking of leaving and saying goodbye,” Duberman said. “But there’s a natural ending time.” Ariel’s will be open through September 24.

It’s not unheard of for hardware stores in Vermont to offer food. PLAINFIELD HARDWARE has a deli, and, in Cabot, SARAH’S COUNTRY DINER offers breakfast and lunch at the back of HARRY’S HARDWARE. But a bar? Never seen … until a month ago. “We’re the first [hardware store bar] in Vermont,” said BOBBY SEARLES, who, along with Harry’s Hardware co-owners JOHANNA and RORY THIBAULT, began serving adult beverages at the shop in late July. This weekend, Team Harry’s is throwing a block party to celebrate. The BACK ROAD BBQ truck will roll up with local smoked meats, and HOOKER MOUNTAIN FARM DISTILLERY will pour its farm-distilled whiskey. Five bands will play between 3 and 9 p.m. Now open Wednesday through Sunday, the bar serves Vermont brews on draft, along with bottles and cans and a handful of wines. Most Fridays, you can hear live music and get wings, pulled pork and the like thanks to Sarah’s Diner, which prepares snacks for bartenders to dish in the evening. Searles has owned neighboring CABOT VILLAGE STORE for a decade. He bought the hardware store and its gas station about five years ago. “It [had been] closed for a year,” Searles recalled, “and The Den at Harry’s Hardware the town was a ghost town. Without gas in town, that’s how villages die.” Last year, the Thibaults moved to town. They bought a half-stake in the hardware store and decided that a bar would enhance community life while helping the town capitalize on CABOT CREAMERY tourist traffic. “One of the things we’re absolutely trying to do is create a destination,” Searles said. Of the creamery visitors who wander into the hardware store, he said, “none of them will buy a hammer.” But, he added, “Every one of them will buy a beer.”

Beans and Suds

1/13/14 1:48 PM

food+drink

Tasty Transition « P.42

Fiddlehead Brewing fiddleheadbrewing.com

Whole Foods Market five months ago, she landed an account with the grocery chain and expects Douglas Sweets to be in the chain’s Massachusetts stores in coming months. “I’m so happy Hannah’s with me,” Townsend said. “She came home, and I just love that she’s there. She completes things.”

Vermont Tortilla

Kevin (left) and Laura Toohey of Bijou Fine Chocolate

44 FOOD

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

vttortillaco.com

Next to the shortbread shop is Vermont Tortilla, an organic business that announces itself by the sweet and earthy aroma of corn. Vermont Tortilla started production in June 2016 after April and Azur Moulaert learned to make their whole-grain tortillas in the kitchen of their New North End home in Burlington. The tortillas are made with organic corn grown on the New York side of Lake Champlain at Adirondack Organic Grains. They cook the corn in several-hundred-pound batches in a big tub of water with foodgrade lime for about 12 hours, then grind it with a stone. They then feed the resulting masa, or corn dough, into a machine that cuts, shapes and bakes the tortillas — a process that takes about 30 seconds per tortilla and produces about 1,200 tortillas per hour. “We’re learning as we go,” said Ben Johnson, who works in production. “We seem to have gotten it down.” On two production days each week, they produce about 20,000 tortillas and package them 10 to a bag in two sizes: four or six inches in diameter. The tortillas are sold in area stores and used by local restaurants. Sales are expanding to regional Whole Foods Market stores and Sahadi’s, a Middle Eastern grocery store in New York City, said April Moulaert. The company plans to increase production to five days a week, she added. “We’re learning on the fly,” said Moulaert, 48, an environmental scientist who worked at the Vermont Agency of Natural Resources for almost a decade. She is a wetlands specialist who consults in her field while running the company with her husband and raising two daughters. Being part of a food community at Vermont Artisan Village is “really, really exciting,” she said. “So many times as a food producer I feel like I’m reinventing the wheel,”

Vermont Tortilla

Moulaert continued. “How do you figure out what’s in a pallet? You’re not born knowing this … There’s a lot of synergy that can be had by having people work together in similar lines of work.” As a rookie, she offers this piece of advice: Before going to the Specialty Food Association’s Summer Fancy Food Show in New York City, as she did in June, sign up for the online boot camp to learn the trade-show ropes.

Bijou Fine Chocolate bijoufinechocolate.com

Housed on the north side of Vermont Artisan Village, Bijou Fine Chocolate started production in Shelburne in the spring of 2014 and opened its retail shop a year later. Kevin and Laura Toohey make handcrafted truffles and other confections on-site with assistance from their adult children, Virginia and Rowan. Kevin

Fiddlehead Brewing opened its doors on Route 7 in Shelburne on New Year’s Eve of 2011. Owner Matt Cohen operated out of 3,000 square feet in a building that also houses Folino’s pizza. “I knew it was small at the time, but it was what I could afford,” Cohen said. “And I knew Shelburne would be a great spot to start a business.” That first year, intending to brew 500 barrels of beer, he brewed 1,500. “Right away, we were adding new fermenters,” Cohen continued. “We quickly ran out of space” as production grew to 10,000 barrels a year. Last December, Cohen relocated to a new brewery at Vermont Artisan Village southeast of his original site. The opening drew about 1,500 people to the 10,000-square-foot building whose fit-up, including a canning line, cost $2.5 million. Plans for another expansion are already underway; an addition to the east, to Fiddlehead Brewing be completed in the next few years, will double the size of his brewery, he said. Toohey trained many years ago with Looking ahead five years, Cohen said Swiss chocolatiers André Bollier and René Nussbaum, whose expertise and he expects to brew 50,000 barrels of interest in teaching was on par with beer annually. “As a brewery owner, you have to their culinary skills, he said. At Bijou, attention to detail ranges have a long-term contract on hops,” he from the size of truffles — 22.5 millime- added. “You’ve got to sit down and put ters — to the handmade Japanese paper together a five-year plan.” in which they’re wrapped. Truffles come Though he started small, Cohen anin three broad categories: herbaceous, ticipated a certain level of success. such as lavender, rosemary or mint — “You do it to be successful,” he noted. the last from plants grown and picked “And I’ve always believed in myself and outside the shop; fruit, including passion my ability to make great beer. I put my fruit, raspberry or lemon ginger that is time in, and I learned the business. So freshly juiced; and single-origin chocoI’m really excited with the way it turned lates, or those made from one variety of out. We stayed focused on the future and cocoa harvested in one region. Bijou has several tables for drinking growing the business and, at the same tea or coffee and nibbling on sweets, as time, not growing it too large.” For now, Fiddlehead’s retail sales well as chocolates available for purchase. The “sale is done” for most people remain in the tasting room and shop on when they enter the space, Kevin Route 7, but this aspect of the business Toohey noted. could move one day to the new brewBijou was the first food business to ery, where Cohen plans to host special open at the Shelburne site, and Toohey events. And maybe there’s a restaurant said he is pleased to have a space that down the line. combines production and retail. “If we move back there with our Still, with Burlington set to undergo store, we’ll bring a lot more attention a major mall development, he wonders and draw to [Vermont Artisan Village],” about packing up and moving everything Cohen said. “That’s the hope.” m to the city, he said. “The growth pattern that we are Contact: sally@sevendaysvt.com interested in is where we do our own retail,” Toohey said. “Because then we have the most control over freshness and INFO environment and look and product.” Learn more at vermontartisanvillage.com.

This Summer join us at

TASTY BITS FROM THE CALENDAR AT SEVENDAYSVT.COM

Nightly Food Specials

Food Specials Start at 5 PM | Dine-In Only

Monday

$3 Pierogis (5) • $3 Moscow Mules

Tuesday

$2 Fish Tacos (each) • $3 Margaritas

Wednesday

$2 Pulled Pork Sliders (each) $3 Cuba Libres • (rum & coke w/lime)

Thursday

½ off Wings ($6, 8 wings) $4 draft beer selection

No Farms, No Food

Kingdom Farm & Food’s annual multiday foodie extravaganza officially kicks off this Friday, but you can whet your palate as early as Wednesday, August 16, with a greenhouse supper at Wolcott’s Sandiwood Farm. On Thursday and Friday, catch pasture management and draft animal workshops as well as a farmers market in Hardwick, and hit up Caledonia Spirits for a tasting while you’re in town. On Saturday, Westfield’s Butterworks Farm hosts farm tours — with organic Jerseymilk smoothies — as does Pete’s Greens in Craftsbury, where you can fill up on grilled meats and other eats prepared by New England Culinary Institute staff and students, along with lawn games, wagon rides, and cider and spirits tastings. Curious about seed saving? Tour the fields at High Mowing Organic Seeds in Wolcott on Sunday, or learn about Abenaki cultivars with ethnobotanist Fred Wiseman. Other High Mowing-hosted workshops cover hops cultivation, nut production and plant breeding, with kids activities and lots of vendors on-site, too.

Lovely outdoor patio • Children’s menu Seating is first-come, first-served Casual Dress • Gluten-free options available.

Open for Breakfast, Lunch & Dinner Visit our website or call for hours.

70 Essex Way | Essex Jct, Vt. | EssexResortSpa.com | 802.878.1100 4t-theEssex070517.indd 1

KINGDOM FARM & FOOD DAYS Friday-Sunday, August 19-21, various locations, Northeast Kingdom. Prices vary by event. Info, kingdomfarmandfood.org.

A SUMMER FEAST Guest chef Trenton Endres of Hen of the Wood prepares a five-course meal highlighting the best of summer’s bounty, with wines paired by bar maven Kate Wise. Saturday, August 19, 6-9 p.m., Beau Butchery + Bar, Montpelier. $85 includes wine pairing; preregister. Info, 225-6447.

for adults

Saturday, September 2nd

VERMONT �EER) FOOD ) MUSIC, AND GAMES .

BAR�

<� 1 mb� "'ff'<

NTIDDTi

SEVEN DAYS

A ADDISON COUNTY FIELD DAYS, NEW HAVEN, VT � W Tickets and more information: W WWW.RECESSVT.COM ---------------------------------�----•

08.16.17-08.23.17

VERMONT NANOFEST Sample suds from Good Measure Brewing, Halyard Brewing, Hogback Mountain Brewing and others at a celebration of four-barrel (or smaller) breweries. Bluegrass by Turnip Truck and Red Barn Hayloft; eats by three area food trucks. Saturday, August 19, noon-6 p.m., Tunbridge Fairgrounds, $10; under 21 free. Info, brocklebankvt.com/ vermont-nanofest.

SEVENDAYSVT.COM

TANDEM NIGHT MARKET REDUX Snack on treats from local foodies including Farmhouse Chocolates & Ice Cream; Savouré Soda, Jam and Pickle; and Slowfire Bakery. Peruse local crafts and farmgrown goods, and dance to live tunes. Thursday, August 17, 5-9 p.m., 25 Mountain View St., Bristol. Free. Info, 734-4236.

PETERSON QUALITY MALrs

6/29/17 10:44 AM

\\OhKTO,� YElt\10,�T 05H9

Find out at sevendaysvt.com/foodtrucks.

Disc Golf, Corn Hole, 4 Square, Run the Beer Mile ,' Camping - and more - Come out and play!

'�-----------------------------------------',•

Untitled-10 1

8/7/17 5:14 PM

FOOD 45

Where’s the latest, greatest mobile lunch special?

Hee Haul

In Montpelier, Vermont Compost Company’s donkey team delivers eggs S TO RY A ND PHOT OS BY SU ZAN NE PODHAIZE R

46 FOOD

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

hen it’s time to deliver the eggs from the chickens that scratch and peck among the towering piles of earth at Montpelier’s Vermont Compost, Kaleigh Hamel, 19, and Ruby, 17, do the job together. Hamel is the brains of the operation, making sure the invoice is printed, acting as driver and interacting with staff at the eggs’ destination, Hunger Mountain Co-op. Ruby does the heavy lifting. In the literal sense of the word, they’re a team: Ruby is an American Mammoth donkey, and Hamel is an experienced teamster and trainer. Together, they wend their way down Main Street to the store, Ruby pulling the cart and Hamel holding the reins. The unusual sight elicits strong reactions, Hamel says. Many people wave and smile as they pass the slow-moving cart. A significant number swear and flip the bird at the egg drivers. “You need to keep your composure,” she notes. Why, in the age of mechanical vehicles, does Vermont Compost deliver eggs by donkey cart? Plenty of reasons, says the compost company’s owner, Karl Hammer. There’s the energy efficiency of fueling a delivery vehicle with grass instead of gas; there’s a sense of urgency around the decline of heritage equine breeds; and there’s the pleasure of working with animals instead of machines. “A tractor can never love you,” says Hammer dryly. “There’s something about working with animals that imparts a pleasure I’ve never derived from working with machines.” Back in 1998, Hammer says, his staff collected Montpelier’s compost with a donkey cart and five-gallon buckets. But, as demand for collection increased, it was hard to keep up. “We kind of degenerated to pickup trucks,” he says. Now he’s ramping up his animalpower program. “It occurred to us that we could deliver eggs and pick up food [scraps] around town,” Hammer says. “We think there’s enough density that it could provide pay for the teamster and hay for the donkeys. Pay and hay.” Last year, Hammer began the search for a talented and experienced teamster who could both train the compost company’s donkeys and mules and

Kaleigh Hamel and Ruby

train other staff members to work with the animals. He got a call from Hamel, who grew up in Waitsfield and has been riding horses since she was 5. “I’ve always had the animal-whispery thing going on,” Hamel says. When she was 11, she nursed an ailing barn cat at the neighboring Neill Farm back to health. Afterward, she stuck around and “became one of [owner Elwin Neill Jr.’s] little farm K AL E IGH hands,” she says. When Hamel, then 12, asked Neill “if he had some sort of project to keep me out of his hair,” he offered her a team of 1-day-old oxen. “I went home and looked up what they

were on the internet,” she says, “and ordered myself a book.” At Harwood Union High School, Hamel recalls, she was bullied because she didn’t share other students’ interests — or an inclination to “party and be up late.” After her second year, she transferred to the Randolph Technical Career Center’s program in agricultural technology, where she found her niche. “It was the most influenH AME L tial two years of my life,” she says. By the time she was 17, Hamel’s work with her oxen had caught the attention of people in the animal-power community, and she began to receive invitations

WORK IS DEFINITELY FUN FOR A DONKEY.

IT’S IMPRESSIVE HOW TASK-ORIENTED THEY ARE.

to teach. To date, she has done trainings for Tillers International in Michigan, the Draft Animal-Power Network of Vergennes and Sterling College in Craftsbury Common. “I want to teach people to work with animals … and my business has just been growing and growing and growing,” she says. In addition to the oxen, Hamel owns a team of Percheron horses. She offers education and training, takes wedding guests on sleigh rides, does trick performances “like a little circus act” and has even carried caskets at funerals. She has taught herself to trim equines’ hooves. Now, says Hammer, Hamel has taken a shine to donkeys, which he describes as “more thoughtful than horses. Horses have [a] big lung capacity, and [when threatened] their first instinct is to run. Donkeys are more likely to think about [what to do].” As a result, Hammer continues, “Donkeys are less likely to spook. They’re more stable about unexpected noises.” Along with elephants, “they’re seemingly the most intelligent of our domesticates,” he adds. Some object to working animals on principle, but Hammer and Hamel take a different view. “Slavery is foul, but work is not,” says Hammer. Just as humans are unhappy when they’re sedentary, he says, so are animals. Being useful is psychologically beneficial for both. “Work is definitely fun for a donkey,” Hamel agrees, although she prefers to think of their undertakings as play. “It’s impressive how task-oriented they are. If you make your agenda really clear to them, and you both have the same goal, they become really engaged in wanting to get the job done and [doing] it correctly.” In her work, Hamel stresses, the human and the beast are a symbiotic team, with the teamster requesting that the animal perform tasks and the animal responding. “It’s really important to understand [each animal breed’s] ways of thinking,” she says. “We can utilize [that] to help them understand what we’re asking them to do.” For Ruby, she designed a training program with the assistance of an older mule named Katie. By pairing the two and letting Ruby see how Katie dealt with

Humane

Society of Chittenden County

Sponsored by:

housing »

Miss Kitty AGE/SEX: 1-year-old spayed female

COURTESY OF KELLY SCHULZE/MOUNTAIN DOG PHOTOGRAPHY

ARRIVAL DATE: July 7, 2017 REASON HERE: I was not getting along with the dog in my home. SUMMARY: Miss Kitty is a beautiful girl full of looks and purrrrsonality! She is

equal parts mellow and playful and loves attention. She’s looking for a home where she can be someone’s one-and-only true love! In return, Miss K offers a lifetime supply of devotion and cat hair for your clothes! Do you have the heart to let this gal become part of your family?

SPECIAL CONSIDERATIONS: I am FIV positive, so I should live as an indoor-only cat in my new home. But don't worry, because I've trained HSCC staff to school my adopters on what this means! DOGS/CATS/KIDS: I lived with a dog, and I need a home without one. I lived with

cats in my previous home and hissed at them. I may do OK with a cat with a proper, slow introduction.

APARTMENTS, CONDOS & HOMES

on the road »

DID YOU KNOW?

The Humane Society of Chittenden County offers many resources and educational opportunities to help you maintain the treasured bond that you have with your animal companions. Before you make the decision to give up your pet, consider contacting us for help. If you have to give up a pet, we accept, by appointment, animals brought to us from Chittenden and Grand Isle Counties regardless of health or behavioral issues.

Visit HSCC at 142 Kindness Court, South Burlington, Tuesday through Friday from 1 to 6 p.m., or Saturday from 10 a.m. to 4 p.m. Call 862-0135 for more info.

NEW STUFF ONLINE EVERY DAY! PLACE YOUR ADS 24-7 AT SEVENDAYSVT.COM.

CARS, TRUCKS, MOTORCYCLES

pro services »

CHILDCARE, HEALTH/ WELLNESS, PAINTING

buy this stuff »

APPLIANCES, KID STUFF, ELECTRONICS, FURNITURE

music »

INSTRUCTION, CASTING, INSTRUMENTS FOR SALE

jobs »

NO SCAMS, ALL LOCAL, POSTINGS DAILY

CLASSIFIEDS We Pick Up & Pay For Junk Automobiles!

on the road

CARS/TRUCKS

Route 15, Hardwick

802-472-5100

3842 Dorset Ln., Williston

housing ads: $20 (25 words) legals: 52¢/word buy this stuff: free online services: $12 (25 words) DOWNTOWN BURLINGTON 3-BR, DR, LR, lg. BA w/ marble tiles, porches, big cellar, HDWD floors. Parking. Bus stop. $1,795/mo. incl. heat, hot water, garbage. Avail. Sep. 1. No pets. Sec. dep. Must see. 388-2335.

802-793-9133

PINECREST AT ESSEX 9 Joshua Way, inde1950 FORD FOR SALE/ pendent senior living. TRADE BURLINGTON 1-BR APT. 2-BR, 2-BA avail. Oct. 15. Will trade my 1950 sm-allmetals060811.indd 7/20/15 1 Close to 5:02 PM $900/mo. Bright. $1,380/mo. incl. utils. Ford Custom “Shoebox” colleges, fully furnished, & parking garage. Must Convertible (all large deck. New North be 55+ years. NS/pets. original) for a 1960s End neighborhood near 872-9197 or rrappold@ model convertible, bike path & lake, 3 miles coburnfeeley.com. up or down, or for real from downtown. Electric estate. My Ford is worth incl. No pets. Avail. now. PINECREST AT ESSEX approximately $22,000. Contact thomasbusines9 Joshua Way, 802-917-5460, 802sagency@comcast.net independent senior 733-8018, seagrace@ for online application. living. 1-BR avail. Oct. charter.net. Paula, 864-0838. 15. $1,160/mo. incl. utils. & parking garage. Must 2012 CHEVROLET BURLINGTON be 55+ years. NS/pets. EQUINOX Avail. now. 515 S. Union. 879-9197 or rrappold@ 40K, excellent condiLg. 4-BR house, HDWD coburnfeeley.com. tion. 1-owner, maroon, floors, 2-car garage, auto. Remote starter. laundry, workshop, DR. No SECLUDED $13,900. 802-863-2798, dogs. $2,200/mo. 540 St. FARMHOUSE lv. msg. Paul St. Lg. 3-BR. Storage, 3-BR, garage, pond, laundry, parking. No dogs. hiking trails, washer & $1,650/mo. 862-7467. wi-fi capability. Peaceful setting nestled in the BURLINGTON 2-BR Green Mountains. Lg., sunny apt. 185 N. Located on class 4 road. Willard St. NS/dogs. AWD or 4WD vehicle a $1,550/mo. + utils. must. Open to alternative 658-0621. arrangements. $975/mo. + utils. katmack@gmail. BURLINGTON 2-BR com, 883-2399. AVAIL. Church St. Marketplace. SMALL COUNTRY 2-BR avail. now. $1,325/ COTTAGE mo. NS/pets. W/D Located at Catamount onsite. 1-year lease. in Williston w/ amazing 922-8518. 3-BR BURL CONDO: view from kitchen, dining HEAT/WATER area. Great garden space. $2,400/mo. incl. heat, BURLINGTON, PEARL W/D. NS, no dogs please. hot water. Avail. Aug. 13. ST. Avail. Aug. 15. lucy_mcAvail. now. 3-BR, 2 LRs, 356 Hildred Dr., close cullough@myfairpoint. kitchen, 1-BA. Heat to Medical Center & net. 802-598-4371. incl. $2,200/mo. + sec. UVM. Ample parking, dep. Year lease. NS/ W/D. NS/pets. Sec. pets. References. Guy, dep. 802-355-9804, 863-4085 or 598-6348. 356hildreddrllc@gmail. com. BOLTON CHARMING VICTORIAN Seeking vegetarian LG. 1-BR APT. 3-BR AVAIL. NOW, female housemate to DOWNTOWN HEATED share home w/ active 46 Sherman St. On park 3 apts. 3-BR avail. now, nature-lover in her 50s. & lake, breathtaking $1,500/mo. incl. heat, $500/mo. all incl., plus sunsets, lots of natural prime location on S. help w/ dog-walking. light. Kitchen, full DR, Willard St., Burlington. LR, HDWD floors, private Shared BA & kitchen. 1-BR, $750/mo., tenant No sec. dep. 863-5625, porch, W/D, attached plays utils., Burlington. homesharevermont. 318-8916 cell, 862-9013, garage w/ opener, 1,400 org for application. sq.ft. $1,495/mo. incl. 238-0004 cell. Interview, refs., utils. NS/pets. Text/call background check 793-0767. required. EHO

HOUSING

housing

C-2 CLASSIFIEDS

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

FOR RENT

HOUSEMATES

EQUAL HOUSING OPPORTUNITY All real estate advertising in this newspaper is subject to the Federal Fair Housing Act of 1968 and similar Vermont statutes which make it illegal to advertise any preference, limitations, or discrimination based on race, color, religion, sex, national origin, sexual orientation, age, marital status, handicap, presence of minor children in the family or receipt of public assistance, or an intention to make any such preference, limitation or a discrimination. The newspaper will not knowingly accept any advertising for real estate, which is in violation

display service ads: $25/$45 homeworks: $45 (40 words, photos, logo) fsbos: $45 (2 weeks, 30 words, photo) jobs: michelle@sevendaysvt.com, 865-1020 x21

BURLINGTON Share home w/ an educator in her 70s interested in yoga, travel & art. Seeking female housemate who might like to garden & cook some vegetarian meals together. $425/ mo. all incl. Shared BA & kitchen. 863-5625 or homesharevermont. org for application. Interview, refs., background checks required. EHO BURLINGTON ROOM Stylish, furnished, recently renovated downtown house. Respectful living w/ others. Parking avail. W/D, back deck, BBQ & garden. Wi-Fi, cable TV. Smoking outside only. $500/mo. incl. all utils. $100 sec. dep. Monthly. Avail. immed. 520-203-5487. MILTON HOMESHARE Lg. room, kitchen, laundry, utils. incl. $130/wk. 802-4884839. Please lv. msg. w/ phone number if no answer. ROOM FOR RENT, AVAIL. NOW Monkton farmhouse on 20 acres, all amenities incl., garden space, 13.5 miles to I-89. Start $400/mo. 453-3457.

OFFICE/ COMMERCIAL 207 COLLEGE STREET Retail space avail. Oct. 1. 1,200 sq.ft. w/ office & restroom. Break room & additional storage in lower level. Brick walls, tin ceilings, wood floors. Call Dave at 802-3166452, dave@btvspaces. com.

208 FLYNN: BTVSPACES.COM 1,200 sq.ft. open studio. 2,700 sq.ft. office suite. 3,000 sq.ft. multilevel office. Near bike path, bus route. Great neighbors. Call Dave at 802-316-6452. BURLINGTON Sunny, 2nd floor Church St. office space avail. 300 sq.ft. Full BA. Minimum 1-year lease required. $650/mo. Utils. incl. 922-8518. OFFICE/RETAIL SPACE AT MAIN STREET LANDING on Burlington’s Waterfront. Beautiful, healthy, affordable spaces for your business. Visit mainstreetlanding.com & click on space avail. Melinda, 864-7999.

SERVICES

CLASSIFIEDS KEY Valley Painting

Interior/exterior Painting Sheetrocking & Taping Cathedral Ceilings Custom Carpentry Any Size Job Free Estimates Fully Insured

Call TJ NOW!

355-0392

SERVICES

ALL AREAS FREE ROOMMATE SERVICE At rentmates.com. Find the perfect roommate to complement your personality and lifestyle at rentmates.com! (AAN CAN)

VACATION RENTALS A BAHAMAS CHRISTMAS! Experience Christmas in the Bahamas. Our charming seaside cottage has 3 BRs, 2 BAs & is fully furnished! Located in Governor’s Harbour (GHB), Eleuthera. Close to shopping, restaurants, beaches. Have some fun in the sun or maybe a Bahama Mama on the front porch while enjoying the emerald blue Bahama waters! $1,300/ week, 802-733-8018, seagrace@charter.net.

services

BIZ OPPS PREGNANT? CONSIDERING ADOPTION? Call us first. Living expenses, housing, medical & continued support afterward. Adoptive family of your choice. Call 24/7. 877362-2401. (AAN CAN) PAID IN ADVANCE! Make $1,000 a week mailing brochures from home! No experience required. Helping home workers since 2001! Genuine opportunity. Start immediately. mailingpros. net. (AAN CAN)

CLOTHING ALTERATIONS SOMETHING SEW RIGHT Professional clothing alterations since 1986. Creative, quality work from formal wear to leather repairs. 248 Elm St., 2nd floor, Montpelier. 229-2400, pmorse52@live.com.

Realtor of the Year!

ENTERTAINMENT Robbi Handy Holmes • 802-951-2128 robbihandyholmes@c21jack.com Find me on Making it happen for you!

16t-robbihandyholmes081617.indd 1

appt. appointment apt. apartment BA bathroom BR bedroom DR dining room DW dishwasher HDWD hardwood HW hot water LR living room NS no smoking OBO or best offer refs. references sec. dep. security deposit W/D washer & dryer

lg-valleypainting112614.indd 11/24/14 1 12:11 PM

of the law. Our readers are hereby informed that all dwellings advertised in this newspaper are available on an equal opportunity basis. Any home seeker who feels he or she has encountered discrimination should contact: HUD Office of Fair Housing 10 Causeway St., Boston, MA 02222-1092 (617) 565-5309 — OR — Vermont Human Rights Commission 14-16 Baldwin St. Montpelier, VT 05633-0633 1-800-416-2010 hrc@vermont.gov

print deadline: Mondays at 4:30 p.m. post ads online 24/7 at: sevendaysvt.com/classifieds questions? classifieds@sevendaysvt.com 865-1020 x37

LIVELINKS CHAT LINES Flirt, chat & date! Talk to sexy real singles in your area. Call now! 844-359-5773. (AAN CAN)

8/14/17 5:51 PM

HEALTH/ WELLNESS LOVE LIFE PSYCHIC Call Love Life Psychic Grace in Chicago and get 1 free question if you are a first-time caller: 312-608-7958. 18+ lovelifepsychic. com. Call for a better tomorrow. MAKE THE CALL TO START GETTING CLEAN TODAY Free 24-7 help line for alcohol & drug addiction treatment. Get help! It is time to take your life back. Call now: 855-7324139. (AAN CAN) PSYCHIC COUNSELING Psychic counseling, channeling w/ Bernice Kelman, Underhill. 30+ years’ experience. Also energy healing, chakra balancing, Reiki, rebirthing, other lives, classes, more. 802-899-3542, kelman.b@juno.com.

HOUSE SITTER AVAIL. Mature, responsible woman avail. for longterm house sitting. I’m avail. to care for your home, pets & plants/ garden. Contact Donna: 781-367-5461 or dsharff. lmhc@gmail.com.

PET HORSEBACK-RIDING LESSONS Neverland Farm is a full-service stable in Hinesburg. We offer balanced-seat lessons for those who want to become better horsemen or -women. We offer quality care & boarding, w/ 2 stalls newly avail. We are a supportive community of mostly adults & are committed to having serious fun w/ our horses. Check us out to see if we fit your needs & goals. Some work/ride or board may be avail. neverlandfarmvt.com, suki_flash@yahoo.com.

HOME/GARDEN BUY THIS STUFF THE FRUGAL FRENCHMAN Interior painting. 40 years painting in Vermont. I am a retired professional painter. I work for one customer at a time. Work guaranteed best. 802-825-1788. HONEY-DO HOME MAINTENANCE All jobs lg. or small, home or office, 24-hr. service. A division of Sasso Construction. Call Scott today! Local, reliable, honest. All calls returned. 310-6926

buy this stuff

GARAGE/ESTATE SALES HUGE ESTATE SALE Variety of household goods, furniture, clothing, toys, books, antiques. Elm Hill Peddler, 50 percent off almost everything. 4211 Roosevelt Hwy., Colchester. Sale ongoing. 10 am.-4 p.m. daily.

REAL ESTATE PROFESSIONALS: List your properties here and online for only $45/week. Submit your listings by Mondays at noon to homeworks@sevendaysvt.com or 802-865-1020, x37.

BROWSE THIS WEEK’S OPEN HOUSES: sevendaysvt.com/open-houses OWNED LAND!

LAKEFRONT YEAR-ROUND HOME

ColChester | 98 Goodsell Point | #4625291

Attention water lovers! Looking for a vacation Camp? Look no more! This 4 bedroom Colchester Cabin on Mallets Bay offers plenty of space for family and friends to enjoy the summer life! On owned land with beach and mooring rights. Minutes to I-89 and Burlington. $149,900

Private owned lakefront retreat with approximately 263 feet of frontage perched on a bluff. Beautiful lake views and access by stairs to an area ready for a boat dock or deep mooring plus additional building located close to the water. Wood floors refinished throughout. Priced at $450,000.

Steve Lipkin 846.9575 LipVT.com

SPACIOUS ESSEX TOWNHOME ESSEX JUNCTION | 1 CUSHING DRIVE | #4639361

VT ZEN CRAFT

& YARD SALE Untitled-15 1

SIAMESE KITTENS Purebred seal point. Email mmadrona@

ANTIQUES Furniture, postcards, pottery, cameras, toys, medical tools, lab glass, photographs, slide rules, license plates & silver. Anything unusual or unique. Cash paid. Dave, 859-8966. ANTIQUES WANTED Trusted third-generation Vermont antique dealer specializing in jewelry, watches, silver,

music

INSTRUCTION BASS LESSONS W/ ARAM For all ages, levels & styles. Beginners welcome! Learn songs, theory, technique & more on Pine St. Years of pro performing,

8/14/17 4:37 PM

homeworks List your properties here and online for only $45/ week. Submit your listings by Mondays at noon.

Robbi Handy Holmes Century 21 Jack Associates 802-951-2128 robbihandyholmes@c21jack.com

recording & teaching experience offers experience. First lesson lessons in guitar, music Untitled-26 8/14/17 11:19 AM 1 half off. 598-8861, theory, music arambedrosian.com, technology, ear trainlessons@arambedroing. Individualized, sian.com. step-by-step approach. All ages, styles, levels. BASS, GUITAR, DRUMS, Rick Belford, 864-7195, VOICE LESSONS & MORE! rickb@rickbelford.com. Learn bass, guitar, drums, voice, flute, sax, trumpet, GUITAR INSTRUCTION production and beyond All styles/levels. with some of Vermont’s Emphasis on developing best players and indepen- strong technique, dent instructors in thorough musicianship, beautiful, spacious lesson personal style. Paul studios at the Burlington Asbell (Unknown Blues Music Dojo on Pine St. Band, Kilimanjaro, UVM All levels and styles & Middlebury College are welcome, including faculty). 233-7731, absolute beginners! Gift pasbell@paulasbell.com. certificates available. Come share in the music. burlingtonmusicdojo. com, info@burlingtonmusicdojo.com, 540-0321. GUITAR INSTRUCTION Berklee graduate w/ 30 years’ teaching

Call or email Ashley today to get started: 865-1020 x37, homeworks@sevendaysvt.com

Edge and boundary to adjustments between 6/6/16 4:34 PM three lots. The Project is located on Meadowside Drive in Charlotte, Vermont.

ACT 250 NOTICE MINOR APPLICATION #4C0692-11 10 V.S.A. §§ 6001 - 6093 On July 21, 2017, Clark W. Hinsdale III, 1211 Ethan Allen Highway, Charlotte, VT 05445 and Kiona Baez & Lincoln Burns Heath, 231 Meadowside Drive, Charlotte, VT 05445 filed application #4C0692-11 for a project generally described as the authorization of construction of a single family residence on Lot #1 of Mountain’s

The District #4 Environmental Commission is reviewing this application under Act 250 Rule 51 — Minor Applications. Copies of the application and proposed permit are available for review at the office listed below. The application and a draft permit may also be viewed on the Natural Resources Board’s web site (www.nrb.state. vt.us/lup) by clicking on “Act 250 Database” and entering the project number “4C0692-11”. No hearing will be held and a permit may be

LEGALS »

CLASSIFIEDS C-3

PETS

WANT TO BUY

Burns Real Estate Team 44 Shelburne St., Burlington 802-864-9856/802-373-3506

SEVEN DAYS

OXYGEN Anytime. Anywhere. No tanks to refill. No deliveries. The All-New Inogen One G4 is only 2.8 pounds! FAA approved. Free info kit: 877-6732864 (AAN CAN)

aol.com or text your art, military, antique email for information collectibles, etc. 8/14/17 HW-Holmes081617.indd 11:54 AM 1 & pictures. Burlington. bittnerantiques.com. Morgaine, 338-6827. Brian, 802-272-7527. Consulting/appraisal STAFFORDSHIRE services avail. House calls TERRIER PUP made free of charge. Ready to go. Has shots and health check. Please call 802-4480050. Asking $1,500.

Chuck and Cindi Burns, Brokers

8/14/17 hw-C21-Burns2-081617.indd 12:39 PM 1

COLCHESTER | 100 EDGEWOOD DRIVE | #4652772

This 3-BR home has open floor plan from kitchen into family room with gas fireplace. The first floor features a mudroom with laundry and slider to private back deck. This home is situated on .55 acres, with fully fenced yard and patio. Close to common land walking trails, schools, shopping, Burlington and I89. $390,000.

Flat Fee Real Estate 802-310-3669 erin@flatfeevt.com

MALE ENLARGEMENT PUMP Get stronger & harder erections immediately. Gain 1-3 inches permanently & safely. Guaranteed results. FDA licensed. Free brochure: 1-800354-3944, drjoelkaplan. com. (AAN CAN)

CONTEMPORARY COLONIAL

Over 20 acres of rolling meadows with views and pond. Remodeled farmhouse has the potential for an accessory unit. Subdivision possibilities for one more house. Large, (70x32x2), well-maintained barn with newer roof, 24x32 garage and rough shed 17x60. Priced at $449,900.

08.16.17-08.23.17

Vermont Zen Center Craft, Yard & Bake Sale. Shop for treasures large & small while munching on delicious baked goods, also for sale. This year, the sale will be inside the center, so no need to worry about weather or bugs! Included in the sale: artwork, antiques, pottery, sporting goods, books, clothing, jewelry, electronics, toys, tools, collectibles, household furnishings & much more! Also, original handmade arts & crafts will be on sale for the first time. Sat., Aug. 19, 9 a.m.-3 p.m. No early birds, please. Vermont Zen Center, 480 Thomas Rd., Shelburne. For questions, please call 310-4074.

Burns Real Estate Team 44 Shelburne St., Burlington 802-864-9856/802-373-3506

hw-C21-Burns1-081617.indd 1

Erin Dupuis

MISCELLANEOUS

Chuck and Cindi Burns, Brokers

GENTLEMAN’S FARM FOR SALE

WESTFORD | 1342 OLD STAGE ROAD | #4633899

SEVENDAYSVT.COM

This flowing contemporary floor plan offers an open kitchen with butcher block island, dining area with sliders to the back deck, and an oversized living room with gas fireplace. Added luxuries include a spacious master suite with spacious walk-in closet. Conveniently located off Rt. 15, within a few miles of GlobalFoundries, UVM Medical Center, I-89 and Burlington. $349,000

COLCHESTER | 1183 SUNSET VIEW ROAD | #4628087

fsb

FOR SALE BY OWNER

List your property here for 2 weeks for only $45! Contact Ashley, 864-5684, fsbo@sevendaysvt.com.

KILLINGTON/SUGARBUSH AREA

MINUTES FROM MONTPELIER

Post and beam, 4 bedrooms, 3 baths, 2,970 sq.ft., 36 skiable acres bordering National Forest, VAST/GMT trail access, total school choice, old-house charm with turnkey convenience! $339,000. 802-7469990

SOLAR WINOOSKI HOME

Avoid Montpelier bidding wars. 1350 sq feet, 2 bedroom plus den/office. 1acre, two-bath, porch, open living, radiant heat, garage, gardens, berries, perennials. Quiet Country setting in Worcester, Vt. $261,500. 802-839-8075

Convenient 4 bedroom, 2 bath home. Located at intersection of Route 15 & I-89 makes it convenient to almost anywhere in the Greater Burlington area. $230,000. 2649082

RESTAURANT/COUNTRY GENERAL STORE Unique 18 Seat 8/7/17 Untitled-13 12:47 PM1 Restaurant and Country General Store serving breakfast and lunch. Deli, groceries, beverages and lodging decor. Long history of success. Apartments above store. Owner must sell-Price negotiable. $599,000. 917-696-2962

FSBO-AprilHayden080917.indd 1

FSBO-RobertDiaz080217.indd 1

C-4 CLASSIFIEDS

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

[CONTINUED] issued unless, on or before September 1, 2017, a person notifies the Commission of an issue or issues requiring the presentation of evidence at a hearing or the Commission sets the matter for hearing on its own motion. Any hearing request must be in writing to the address below, must state the criteria or subcriteria at issue, why a hearing is required and what additional evidence will be presented at the hearing. Any hearing request by an adjoining property owner or other interested person must include a petition for party status. Prior to submitting a request for a hearing, please contact the district coordinator at the telephone number listed below for more information. Prior to convening a hearing, the Commission must determine that substantive issues requiring a hearing have been raised. Findings of Fact and Conclusions of Law will not be prepared unless the Commission holds a public hearing. If you feel that any of the District Commission members listed on the attached Certificate of

Service under “For Your Information” may have a conflict of interest, or if there is any other reason a member should be disqualified from sitting on this case, please contact the district coordinator as soon as possible, no later than prior to the response date listed above. Should a hearing be held on this Project and you have a disability for which you are going to need accommodation, please notify us by September 1, 2017. Parties entitled to participate are the Municipality, the Municipal Planning Commission, the Regional Planning Commission, affected state agencies, and adjoining property owners and other persons to the extent they have a particularized interest that may be affected by the proposed project under the 10 criteria. Non-party participants may also be allowed under 10 V.S.A. Section 6085(c)(5). Dated at Essex Junction, Vermont this 10th day of August, 2017. By: /s/ Peter E. Keibel Peter E. Keibel District #4 Coordinator Natural Resources Board 111 West Street Essex Jct., VT 05452 802-879-5658 Peter.Keibel@vermont. gov ACT 250 NOTICE MINOR APPLICATION #4C1303

10 V.S.A. §§ 6001 7/28/17 2:00 PM - 6093 On July 28, 2017, Catamount/Lakeview LLC, 210 College Street, Suite 201, Burlington, VT 05401, filed application #4C1303 for a project generally described as development of a single urban lot with a fourstory residential building of approximately 38,500 square feet, containing 43 apartments, and 33 covered and 11 uncovered parking spaces. The Project is located at 85 North Avenue in Burlington, Vermont. The District #4 Environmental Commission is reviewing this application under Act 250 Rule 51 — Minor Applications. Copies of the application and proposed permit are available for review at the office listed below. The application and a draft permit may also be viewed on the Natural Resources Board’s web site (www.nrb.state. vt.us/lup) by clicking on “Act 250 Database” and entering the project number “4C1303”. No hearing will be held and a permit may be issued unless, on or before September 4, 2017, a person notifies the Commission of an issue or issues requiring the presentation of evidence at a hearing or the Commission sets the matter for hearing on its own motion. Any hearing request must be in writing to the address below, must state the criteria or subcriteria at issue, why a hearing is required and what additional evi-

List your property here for 2 weeks for only $45! Contact Ashley, 864-5684, fsbo@sevendaysvt.com. 8/14/17 FSBO-MelAllen080917.indd 11:28 AM 1

dence will be presented at the hearing. Any hearing request by an adjoining property owner or other interested person must include a petition for party status. Prior to submitting a request for a hearing, please contact the district coordinator at the telephone number listed below for more information. Prior to convening a hearing, the Commission must determine that substantive issues requiring a hearing have been raised. Findings of Fact and Conclusions of Law will not be prepared unless the Commission holds a public hearing.

you have a disability for which you are going to need accommodation, please notify us by September 4, 2017.

If a hearing is requested, and is granted by the Commission, it will be held on September 15, 2017 at 8:30 AM at the Burlington Police Department, Community Room, 1 North Avenue, Burlington, Vermont. If a hearing is held, a site visit will occur at 8:00 AM. We will meet for the site visit at 85 North Avenue in Burlington.

Dated at Essex Junction, Vermont this 9th day of August, 2017.

If you feel that any of the District Commission members listed on the attached Certificate of Service under “For Your Information” may have a conflict of interest, or if there is any other reason a member should be disqualified from sitting on this case, please contact the district coordinator as soon as possible, no later than prior to the response date listed above. Should a hearing be held on this Project and

Parties entitled to participate are the Municipality, the Municipal Planning Commission, the Regional Planning Commission, affected state agencies, and adjoining property owners and other persons to the extent they have a particularized interest that may be affected by the proposed project under the 10 criteria. Non-party participants may also be allowed under 10 V.S.A. Section 6085(c)(5).

By: /s/ Stephanie H. Monaghan Stephanie H. Monaghan District #4 Coordinator Natural Resources Board 111 West Street Essex Jct., VT 05452 802-879-5662 stephanie.monaghan@ vermont.gov ACT 250 NOTICE MINOR APPLICATION #4C1304 10 V.S.A. §§ 6001 - 6093 On July 28, 2017, Brad Gardner, P.O. Box 21, Colchester, VT 05446 filed application #4C1304 for a project generally described as demolition of existing structures and construction of a 1,520 square foot mixed use building and a 2,160 square foot garage on a 0.78 acre parcel. The Project is located at 169

Macrae Road in Colchester, Vermont. The District #4 Environmental Commission is reviewing this application under Act 250 Rule 51 — Minor Applications. Copies of the application and proposed permit are available for review at the office listed below. The application and a draft permit may also be viewed on the Natural Resources Board’s web site (www.nrb.state. vt.us/lup) by clicking on “Act 250 Database” and entering the project number “4C1304”. No hearing will be held and a permit may be issued unless, on or before August 28, 2017, a person notifies the Commission of an issue or issues requiring the presentation of evidence at a hearing or the Commission sets the matter for hearing on its own motion. Any hearing request must be in writing to the address below, must state the criteria or subcriteria at issue, why a hearing is required and what additional evidence will be presented at the hearing. Any hearing request by an adjoining property owner or other interested person must include a petition for party status. Prior to submitting a request for a hearing, please contact the district coordinator at the telephone number listed below for more information. Prior to convening a hearing, the Commission must determine that substantive issues requiring a hearing have been raised.

Findings of Fact and Conclusions of Law will not be prepared unless the Commission holds a public hearing. If you feel that any of the District Commission members listed on the attached Certificate of Service under “For Your Information” may have a conflict of interest, or if there is any other reason a member should be disqualified from sitting on this case, please contact the district coordinator as soon as possible, no later than prior to the response date listed above. Should a hearing be held on this Project and you have a disability for which you are going to need accommodation, please notify us by August 28, 2017. Parties entitled to participate are the Municipality, the Municipal Planning Commission, the Regional Planning Commission, affected state agencies, and adjoining property owners and other persons to the extent they have a particularized interest that may be affected by the proposed project under the 10 criteria. Nonparty participants may also be allowed under 10 V.S.A. Section 6085(c)(5). Dated at Essex Junction, Vermont this 7th day of August, 2017. By: /s/Stephanie H. Monaghan Stephanie H. Monaghan District #4 Coordinator Natural Resources Board 111 West Street Essex Jct., VT 05452

8/7/17 10:15 AM

802-879-5662 stephanie.monaghan@ vermont.gov CITY OF BURLINGTON ORDINANCE 4.34 Sponsor: City Attorney’s Office Rules suspended and placed in all stages of passage: 08/07/17 Action: adopted Date: 08/07/17 Signed by Mayor: 08/09/17 Published: 08/16/17 Effective: 09/06/17 An Ordinance in Relation to HOUSING – Correction of Inadvertent Deletion Accumulation of garbage, trash, abandoned vehicles, appliances and furniture on any property within the city prohibited It is hereby Ordained by the City Council of the City of Burlington as follows: That Chapter 18, Housing, of the Code of Ordinances of the City of Burlington be and hereby is amended by amending Sec. 18-111, Accumulation of garbage, trash, abandoned vehicles, appliances and furniture on any property within the city prohibited, thereof in order to reinsert subsection (h) which was inadvertently deleted from the ordinance adopted on June 5, 2017, to read as follows: Sec. 18-111. - Accumulation of garbage, trash, abandoned vehicles, appliances and furniture

SEVENDAYSVT.COM/CLASSIFIEDS on any property within the city prohibited. (a) - (g) As written. (h) Notwithstanding section 18-31(a)(1), a second or subsequent violation of this section during a twelve (12)-month period shall be deemed to be a civil offense and shall be punishable by a fine of two hundred dollars ($200.00) and a waiver fine of one hundred fifty dollars ($150.00). * Material stricken out deleted. ** Material underlined added. NOTICE OF LEGAL SALE View Date: 8/31/2017 Sale Date: 9/1/2017 Christopher Perkins Unit #228 Dave Daignault Unit #59 Easy Self Storage 46 Swift South Burlington, VT 05403 (802)863-8300 NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the

City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that the real estate taxes assessed by such City for fiscal/tax year(s) 2016 remain either in whole or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit:

Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017.

Owner(s) of Record: Christopher Bragg Property Address: 14 Intervale Avenue Tax Account/Map Lot Number: # 044-3-090000 Deed recorded at: Volume 929 at Page 565. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington;

and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 11:00 a.m., as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved.

____s/n_____________ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont

Owner(s) of Record: Peter J. Brault Property Address: 82 Home Avenue, Burlington VT. Tax Account/Map Lot Number: # 057-2-107000 Deed recorded at: Volume 552 at Page 666. Reference may be had to said deed for a more particular description of said lands and premises,

crossword

Show and tell.

View and post up to 6 photos per ad online.

as the same appears in the Land Records of the City of Burlington; and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 12:30 o’clock in the forenoon, as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. ____s/n___ Robert Rusten Chief Administrative Officer/Treasurer/ Collector of Delinquent Taxes Burlington, Vermont NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that the real estate taxes assessed by such City for fiscal/tax year(s) 2014 remain either in whole

M-T SET ANSWERS ON P. C-9

or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit: Owner(s) of Record: Irene Investment Properties, LLC Property Address: 1230 North Avenue, Burlington VT. Tax Account/Map Lot Number: # 028-4-117000 Deed recorded at: Volume 909 at Page 119. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington; and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 11:30 a.m., as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017.

Open 24/7/365. Post & browse ads at your convenience. ________s/n___ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that the real estate taxes assessed by such City for fiscal/tax year(s) 2016 remain either in whole or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit: Owner(s) of Record: Nelberta A. Brink Property Address: 19 North Street, Burlington VT. Tax Account/Map Lot Number: # 043-3-210000 Deed recorded at: Volume 353 at Page 684. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington; and so much of the lands will be sold at public auc-

tion Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 9:30 a.m., as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. _____s/n_______ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that the real estate taxes assessed by such City for fiscal/tax year(s) 2015 and 2016 remain either in whole or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit: Owner(s) of Record:

Extra! Extra! There’s no limit to ad length online.

Raymond S. Whitten and Tamara J. Whitten and Norman A. Nolan, II and Cheryl A. Nolan Property Address: 310 North Winooski Avenue, Burlington VT. Tax Account/Map Lot Number: # 040-2-140000 Deed recorded at: Volume 387 at Page 160. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington; and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 9:00 a.m., as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. ___s/n______ Robert Rusten Chief Administrative Officer/Treasurer/

LEGALS»

» SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS CLASSIFIEDS C-5

OF BURLINGTON CITYCITY OF BURLINGTON

ORDINANCE 5.04 ORDINANCE 5.04 Sponsor: Planning Department, Sponsor: Planning Department, Planning Commission; Ordinance Planning Commission; Ordinance CommitteeCommittee Public Hearing Dates: ___________

08/07/17 Public Hearing Dates: ___________

In the Year Two Thousand Seventeen

08/07/17

An Ordinance in Relation to

COMPREHENSIVE DEVELOPMENT ORDINANCE – COMPREHENSIVE DEVELOPMENT ORDINANCE – Signage Illumination in ELM ZA #17-13 Signage Illumination in ELM

First reading: 05/15/17 First reading: 05/15/17 Referred to: Ordinance Committee Referred to: Ordinance Committee Second reading: 08/07/17 Second reading: 08/07/17 Action: adopted Action: adopted Date: 08/07/17 Signed by MaPublished: 08/16/17 Date: 08/07/17 Collector of Delinquent Effective: Signed 09/06/17by MaPublished: 08/16/17 Taxes

[CONTINUED]

ZA #17-13 Effective: 09/06/17 It is hereby Ordained by the City Council of the City of Burlington as follows:

Burlington, Vermont

It is hereby Ordained by the City Council of the City of Burlington as follows:

NOTICE OF TAX SALE The resident and nonBurlington be and hereby is amended by Development amending Section Table 7.2.1-1, Regulation Summary, andCity of resident owners, lienThat Appendix A, Comprehensive Ordinance, of theSign Code of Ordinances of the holders and mortgagees Section 7.2.5, Signs Enterprise Districts, to as follows: Lands in the City of Burlington be andin hereby is amended byread amending Section Table 7.2.1-1, Sign Regulation Summary, ofand Burlington, in the County Sec. 7.2.1 Regulation byin District Section 7.2.5, Signs Enterprise Districts, to read as follows: of Chittenden and State of Vermont, are hereby Signs shall be permitted each district as specified in Table 7.2.1-1 below and as further regulated by Sec. 7.2.1 Regulation byinDistrict notified that the real the provisions of this Part. Where other provisions in this Article are more restrictive than Table 7.2.1-1, estate taxes assessed by theSigns more shall restrictive provisionsin shall apply. such City be permitted each district as specified in Table 7.2.1-1 below and as further regulated by for fiscal/tax year(s) 2015 and 2016 Table 7.2.1-1: Sign Regulation the provisions of this Summary Part. Where other provisions in this Article are more restrictive than Table 7.2.1-1, remain either in whole the more restrictive provisions shall apply. or in part, unpaid and 4 Zoning District delinquent on the folTable 7.2.1-1: Sign Regulation Summary lowing described lands Sign Type Dimensional All RCO and All Mixed Use All Enterprise (Reserved) Requirements Residential and Institutional Districts and premises in the City 4 Districts Districts Zoning District of Burlington, to wit:

That Appendix A, Comprehensive Development Ordinance, of the Code of Ordinances of the City of

Parallel Sign Type

Parallel Projecting

Size Dimensional 20-sf All RCO and2-sf1 Requirements Maximum Height 14-ft2 Residential 14-ft2 Illumination

Size Size

4-sf

Districts 20-sf

Maximum Maximum HeightHeight 12-ft2 14-ft Freestanding Projecting

Illumination Illumination

Size Size

20-sf 4-sf

Maximum HeightHeight 6-ft Maximum

12-ft2

Illumination

2-sf All Mixed Use and Institutional 14-ft2 Districts

All Enterprise Districts -

4-sf

2-sf1

4-sf

2-sf1

14-ft

14-ft2

14-ft

14-ft2

Yes

½-sf1

4-sf

14-ft

Yes

Yes3

No Yes

(Reserved)

No Yes

No Yes -

1-sf1

4-sf

14-ft

6-ft

14-ft

Yes

No Yes

No Yes -

1. Size is determined per each linear foot of building frontage allocated 1to the establishment 1 Freestanding Size 20-sf ½-sf 1-sf 2. Or ceiling height of the first floor, whichever is less, except in D, D-T, E-LM and NMU-NAC where the sign may be above 14 feet asMaximum per Sec 7.2.3(a)4, 7.2.4 (c)2D, or Sec. 7.2.4(c)6C. HeightSec. 6-ft 14-ft 6-ft 3. Illuminated freestanding signs are not permitted in NMU district. Yes3 No Yes 4. No signs shall beIllumination permitted in the UrbanNo Reserve District.

Sec. 7.2.2 – 7.2.4 As written. 1. Size is determined per each linear foot of building frontage allocated to the establishment 2.

Sec. 7.2.2 – 7.2.4 As written.

Sec. 7.2.5 Signs in Enterprise Districts Signs in the Enterprise Zoning Districts shall be subject to the restrictions in Sec. 7.2.3 except as modified below: (a) The total area of any parallel sign shall not exceed two (2) square feet for each foot of length of the front building wall or length of that portion of such wall devoted to such establishment, or two hundred (200) square feet, whichever is less; (b) No parallel sign shall be painted on or affixed to the outside windows; (c) Illuminated signs are prohibited; (dc) Freestanding signs shall not exceed six (6) feet in height; (ed)The area of any freestanding sign shall not exceed one half (1/2) square foot per one (1) linear foot of frontage or a total of sixty (60) square feet, whichever is less; and, (fe)No sign shall be located within three (3) feet of any sidewalk or its vertical plane, except where such sign is attached to the face of the building at least eight (8) feet above the sidewalk and is protruding no more than six (6) inches from the face of the building. Sec. 7.2.6 As written. ** ***

Material stricken out deleted. Material underlined added.

2V-CityofBurlingtonZA17-13 083017.indd 1

and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 12:00 p.m., as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. _______s/n_______ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that

C-6 CLASSIFIEDS

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

3. 4.

Or ceiling height of the first floor, whichever is less, except in D, D-T, E-LM and NMU-NAC where the sign may be above 14 feet as per Sec 7.2.3(a)4, Sec. 7.2.4 (c)2D, or Sec. 7.2.4(c)6C. Illuminated freestanding signs are not permitted in NMU district. No signs shall be permitted in the Urban Reserve District.

Owner(s) of Record: John J. Pare and Raymond D. Pare Property Address: 69 Howard Street, Burlington VT. Tax Account/Map Lot Number: # 053-3-075000 Deed recorded at: Volume 927 at Page 303. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington;

8/14/17 10:50 AM

the real estate taxes assessed by such City for fiscal/tax year(s) 2015 remain either in whole or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit: Owner(s) of Record: John and Stacy Katon Property Address: 116 Woodbury Road Tax Account/Map Lot Number: # 028-1-213000 Deed recorded at: Volume 598 at Page 678. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington; and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 10:00 o’clock in the forenoon, as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. ______s/n_______ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that the real estate taxes assessed by such City for fiscal/tax year(s) 2014, 2015 and 2016 remain either in whole or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit: Owner(s) of Record: Charles Higgs Property Address: 37 South Williams Street, Unit #223 Tax Account/Map Lot Number: # 045-2-034223 Deed recorded at: Volume 660 at Page 379. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington; and so much of the lands

will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 1:00 o’clock in the afternoon, as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. ______s/n________ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that the real estate taxes assessed by such City for fiscal/tax year(s) 2013, 2014 and 2015 remain either in whole or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit: Owner(s) of Record: Roger Duclos and Diane Duclos Property Address: 18 Turf Road Tax Account/Map Lot Number: # 023-3-155000 Deed recorded at: Volume 212 at Page 278. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington; and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 10:30 a.m., as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. _______s/n______ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont

NOTICE OF TAX SALE The resident and nonresident owners, lienholders and mortgagees of Lands in the City of Burlington, in the County of Chittenden and State of Vermont, are hereby notified that the real estate taxes assessed by such City for fiscal/tax year(s) 2009, 2010, 2011, 2012, 2013, 2014, 2015 and 2016, remain either in whole or in part, unpaid and delinquent on the following described lands and premises in the City of Burlington, to wit: Owner(s) of Record: Frances and Timothy Muir Property Address: 52 North Cove, Burlington VT. Tax Account/Map Lot Number: # 021-1-031000 Deed recorded at: Volume 638 at Page 495. Reference may be had to said deed for a more particular description of said lands and premises, as the same appears in the Land Records of the City of Burlington; and so much of the lands will be sold at public auction Conference Room 12, City Hall, 149 Church St., Burlington, Vermont 05401 on September 14, 2017 at 8:30 a.m., as shall be requisite to discharge said taxes together with costs and other fees allowed by law, unless the same be previously paid or otherwise resolved. Dated at the City of Burlington in the County of Chittenden and State of Vermont this 14 day of July, 2017. _______s/n________ Robert Rusten Chief Administrative Officer/Treasurer/Collector of Delinquent Taxes Burlington, Vermont NOTICE OF TAX SALE The residents and nonresident owners, lien holders, and mortgagees of lands in the Town of Huntington, County of Chittenden and State of Vermont, are hereby notified that a levy upon the following described parcels of land has been asserted by the Town of Huntington through its Delinquent Tax Collector for taxes unpaid for the 2015-2016 tax year. Included with each description is the tax bill, which has been committed to the collector for collection as relates to the tax against each individual delinquent taxpayer. Said lands will be sold at public auction at

SEVENDAYSVT.COM/CLASSIFIEDS the Town Clerk’s office in the Town of Huntington, on Wednesday, August 30, 2017 at eleven o’clock in the forenoon, as shall be required to discharge such property taxes, with costs and fees, unless previously paid. By virtue of the Tax Warrant and Levy and the tax bills committed to Brent Lamoureux, Delinquent Tax Collector for the Town of Huntington said Delinquent Tax Collector hereby levies against the parcels described below. Dated at Richmond, Vermont this 26th day of July, 2017. S:/BRENT LAMOUREUX, Delinquent Tax Collector for the Town of Huntington, Vermont DESCRIPTION OF PARCELS Parcel #1 Being a parcel of land with dwelling located thereon said to contain 2 acres, more or less, and located at 9471 Main Road, Huntington. Being a portion of the same lands and premises conveyed to Leon Stokes and Colleen Stokes by Warranty Deed of Leon Stokes dated November 24, 2015 and recorded in Volume 108 at Page 737 of the Land

Records of the Town of Huntington. Being Tax Parcel No.: 070320.

UNDER 12 V.S.A. sec 4952 et seq. In accordance with the Judgment Order and Decree of Foreclosure entered January 3, 2017, in the above captioned action brought to foreclose that certain mortgage given by Michael J. Godfrey to Mortgage Electronic Registration Systems, Inc., as nominee for Plaza Home Mortgage, Inc., dated April 30, 2015 and recorded in Book 1265 Page 40 of the land records of the City of South Burlington, of which mortgage the Plaintiff is the present holder, by virtue of an Assignment of Mortgage from Mortgage Electronic Registration Systems, Inc., as nominee for Plaza Home Mortgage, Inc. to Lakeview Loan Servicing, LLC dated January 22, 2016 and recorded in Book 1306 Page 128 of the land records of the City of South Burlington for breach of the conditions of said mortgage and for the purpose of foreclosing the same will be sold at Public Auction at 2403 Brand Farm Drive, Apt. #2403, South Burlington, Vermont on September 13, 2017 at 10:00AM all and singular the premises described in said mortgage,

Parcel #2 Being a parcel of land with dwelling located thereon said to contain 2.20 acres, more or less, and located at 9283 Main Road, Huntington. Being a portion of the same lands and premises conveyed to Leon Stokes and Colleen Stokes by Warranty Deed of Leon Stokes dated November 24, 2015 and recorded in Volume 108 at Page 737 of the Land Records of the Town of Huntington. Being Tax Parcel No.: 070330. STATE OF VERMONT CHITTENDEN UNIT, CIVIL DIVISION VERMONT SUPERIOR COURT DOCKET NO: 400-516 CNCV LAKEVIEW LOAN SERVICING, LLC v. MICHAEL J. GODFREY AND VILLAGE AT DORSET PARK (CLUSTER C) CONDOMINIUM ASSOCIATION OCCUPANTS OF 2403 BRAND FARM DRIVE, APT. #2403, SOUTH BURLINGTON, VT

Calcoku

MORTGAGEE’S NOTICE OF FORECLOSURE SALE OF REAL PROPERTY

Using the enclosed math operations as a guide, fill the grid using the numbers 1 - 6 only once in each row and column.

10+

To wit: Being all and the same lands and premises conveyed to Michael J. Godfrey by Deed of Alexandra Wynkoop of approximate even date herewith and to be recorded in the City of South Burlington Land Records.

16x

Being all and the same lands and premises conveyed to Frank Pichon and Norma Pichon by Warranty Deed of A&G Investments dated November 30, 1995 of record at Book 385, Page 293 of the City of South Burlington Land Records. Reference is hereby made to the Warranty Deed of Frank Pichon and Norma Pichon to Dean M. Pichon, Eric J. Pichon and Marla P. Harding dated October 4, 2007 of record at Book 797, Page 549 of said Land Records.

Apartment No. 2403 of Village at Dorset Park (Cluster C) CondoSaid lands and premises minium, a Condominium Complete the following puzzle by

Sudoku

The owner of the Apartment acknowledges that the room in the within Unit identified as “closet, 11-6 x 21-11”’ (six 9’ x 12’) on the above-referred to Floor Plans is to be used for storage purposes only and is not to be occupied as a bedroom. The owner of the Apartment acknowledges prior receipt and review of a copy of “The Village at Dorset Park, Declaration of Covenants, Conditions and Restrictions for the Community,” using the

2 8

1 8

1 2 3 9

1 No. 493

SUDOKU

Difficulty: Hard

BY JOSH REYNOLDS

DIFFICULTY THIS WEEK: HH

Fill the grid using the numbers 1-6, only once in each row and column. The numbers in each heavily outlined “cage” must combine to produce the target number in the top corner, using the mathematical operation indicated. A onebox cage should be filled in with the target number in the top corner. A number can be repeated within a cage as long as it is not the same row or column.

Place a number in the empty boxes in such a way that each row across, each column down and each 9-box square contains all of the numbers one to nine. The same numbers cannot be repeated in a row or column.

1 8 5 4 7 3 9 6 2 4 3 7 6 2 9 1 5 8 ANSWERS ON P. C-9 6 2 H9H =1CHALLENGING 8 5 4HH3H = HOO, 7 BOY! H = MODERATE 2 5 3 9 4 8 6 7 1 9 7 1 3 5 6 8 2 4

Said lands and premises are known and designated as 2403 Brand Farm Road, South Burlington, Vermont. Reference is hereby made to the above instruments and to their records, and to all deeds and records therein referred with all the privileges and appurtenances thereto, in further aid of this description. Reference is hereby made to the above instruments and to the records and references contained therein in further aid of this description. Terms of sale: Said premises will be sold and conveyed subject to all liens, encumbrances, unpaid taxes, tax titles, municipal liens and assessments, if any, which take precedence over the said mortgage above described. TEN THOUSAND ($10,000.00) Dollars of the purchase price must be paid by a certified check, bank treasurer’s or cashier’s check at the time and place of the sale by the purchaser. The balance of the purchase price shall be paid by a certified check, bank treasurer’s or cashier’s check within sixty (60) days after the date of sale. The mortgagor is entitled to redeem the premises at any time prior to the sale by paying the full amount due under the mortgage, including the costs and expenses of the sale. Other terms to be announced at the sale.

DATED: August 3, 2017 By: /S/Rachel K. Jones, Esq. Rachel K. Jones, Esq. Bendett and McHugh, PC 270 Farmington Ave., Ste. 151 Farmington, CT 06032 STATE OF VERMONT SUPERIOR COURT CHITTENDEN UNIT PROBATE DIVISION DOCKET NO. 62-1-17CNPR In re estate of Christine M. Gordon NOTICE TO CREDITORS To the creditors of Christine M. Gordon late of Milton, VT. I have been appointed to administer this estate. All creditors having claims against the decedent or the estate must present their claims in writing within four (4) months of the first publication of this notice. The claim must be presented to me at the address listed below with a copy sent to the court. The claim may be barred forever if it is not presented within the four (4) month period. Date: 7/25/17 /s/ Chad Gordon Signature of Fiduciary Chad Gordon c/o Kaplan and Kaplan Executor/Administrator: PO Box 405 Burlington, VT 05402 802-651-0013 Name of publication Seven Days Publication Dates: 7/27/2017 Name and Address of Court: Chittenden County Probate Court 175 Main Street Burlington, VT 05401 STATE OF VERMONT SUPERIOR COURT CHITTENDEN UNIT PROBATE DIVISION DOCKET NO. 984-7-17CNPR In re estate of Clara G. Piche. NOTICE TO CREDITORS To the creditors of Clara G. Piche late of Winooski, VT. I have been appointed to administer this estate. All creditors having claims against the decedent or the estate must present their claims in writing within four (4) months of the first publication of this

LEGALS »

CLASSIFIEDS C-7

DIFFICULTY THIS WEEK: HH

Said lands and premises are subject to utility easements of record and to easements, covenants, and conditions set forth in and/ or referred to in the aforementioned Declaration of Condominium and Declaration of Covenants.

There’s no limit to ad length online.

SEVEN DAYS

7 1 2 6 1 7 4 3 5 8

24x

BY JOSH REYNOLDS

Said lands and premises are subject to Land Use Permit #4C0746, dated February 19, 1988 and recorded in Volume 258, Page 310 of said Land Records, as amended and to Subdivision Permit #EC-4-1216 dated January 28, 1988 and recorded in Volume 258, Page 184 of said Land Records, as amended.

Difficulty - Medium

Included is an undivided 3.19 percentage interest in the common areas and facilities as set forth in said Declaration. The owner of the Apartment agrees to be bound by changes to said undivided percentage interest in common areas and facilities as set forth in said Declaration.

dated April 25, 1989, recorded in Volume 278, Page 228 of said Land Records, as amended by Amendments recorded in Volume 279 Page 224, Volume 289, Page 35 and Volume 307, Page 467 of said Land Records and covenants for themselves and their heirs, successors and assigns to be bound by the conditions set forth in said Declaration of Covenants, as amended and by the Bylaws of The Village at Dorset Park Community Association, Inc., as amended.

Extra! Extra!

08.16.17-08.23.17

CALCOKU

9 7

are to be used for residential purposes only.

Post & browse ads at your convenience.

numbers 1-9 only once in each row, column and 3 x 3 box.

7+ 2÷

The Apartment is subject to and has the benefit of covenants and conditions set forth in the aforementioned Declaration of Condominium, the By-Laws of Village at Dorset Park (Cluster C) Condominium Association, Inc. and the rules and regulations promulgated thereunder, as the same may be subsequently amended. The owner of the Apartment acknowledges prior receipt and review of a copy of said Declaration, By-laws and related documents, and covenants for themselves and their heirs, successors and assigns to be bound as set forth in said Declaration.

116+

established and created pursuant to a Declaration of Condominium dated February 4, 1994 and recorded in Volume 359, Pages 300-328 of the City of South Burlington Land Records, as it may be subsequently amended and re-stated. Said lands and premises are commonly known and designated as 2403 Brand Farm Drive. Reference is hereby made to a Site Plan and Floor Plans recorded in Volume 286, Pages 54-55 and 56 respectively of said Land Records.

Being all and the same lands and premises conveyed to Alexandria Wynkoop by Warranty Deed of Frank Pichon and Norma Pichon dated December 12, 2014 of record at Book 1247, Page 111 of the City of South Burlington Land Records.

11+ 108x

Open 24/7/365.

View and post up to 6 photos per ad online.

SEVENDAYSVT.COM

3÷

Show and tell.

SEVENDAYSVT.COM

*****

******

*****

RCO - A

RCO - RG

RCO - C

RL/W

*****

******

*****

***** DW-PT

NACCR

E-AE

*****

BST

NMU

NAC

NACRC

NACCR

E-AE

E-LM

*****

E-LM

*****

Bakery - Retail

CU N

Bakery Wholesale

*****

******

*****

CUY

*****

8, 13

Food & Beverage Processing

*****

******

*****

NCU

*****

NCU

*****

NACRC

*****

MicroBrewery/Winery

*****

******

*****

1. - 13. As Written. 14. Such uses not to exceed ten thousand (10,000) square feet per establishment. 15. - 18. As Written. 19. Cafes not permitted as an accessory use. Retail sales and tasting are permitted as an accessory use. [Reserved]

Legend: As Written.

** ***

Material stricken out deleted. Material underlined added.

C-8 CLASSIFIEDS

20. – 30. As Written.

34v-CityofBurlingtonZA17-08 081617.indd 1

8/14/17 6:31 PM

11+

08.16.17-08.23.17

*****

NAC

the grid using the numbers 1 - 6 only once in each row and column.

SEVEN DAYS

*****

NMU

10+

*****

BST

16x

*****

Enterprise

108x

*****

Neighborhood Mixed Use

3÷

***** NONRESIDENTIAL USES

DW-PT

9 6 2 1 5 5+ 8 14 3 7 6 7 1 8 2 24x4 3 9 5 1 7 8 9 Difficulty - Medium 2 4 3 5 1 6

3 9 5 8 6 2 1 7 4

7 2 8 4 5 1 6 9 3

4 6 1 7+ 9 6+ 3 7 25 8 2

RM/W

8 5 3 7 2 9 5 3 72÷ 1 6 4 4 2 1 6 9 8

RL/W

1 4 6 16+ 2 9 8 3 5 7

RCO - C

RCO - RG

Downtown Mixed Use

RCO - A

Residential

Institutional

USES

Material underlined added. Recreation, Conservation & Open Space

FROM P.C-7

Urban Reserve

FROM P.C-5

** ***

PUZZLE ANSWERS Appendix A-Use Table – All Zoning Districts Material stricken out deleted.

***** Appendix A—Use Table—All Zoning Districts—*See proposed changes on attached table.

Plaintiff v. JOAN SCHEIDER, EXECUTOR OF THE ESTATE OF THOMAS SCHEIDER,

Being a lot of land with all buildings thereon, containing one acre, more or less, and being bounded on the south by Route 314, on the north by lands and premises now or formerly belonging to one John Reid,

***** Winery: A processing plant used for the commercial purpose of processing grapes, other fruit products, or vegetables to produce wine or similar non-distilled spirits. Such commercial use includes wholesale sales, crushing, fermenting, blending, aging, storage, bottling, administrative office functions for winery and warehousing. Retail sales and tasting facilities of wine and related promotional items may be permitted as part of the winery operations.

STATE OF VERMONT SUPERIOR COURT GRAND ISLE UNIT CIVIL DIVISION DOCKET NO. 13-3-17 GICV NEW ENGLAND FEDERAL CREDIT UNION

Microbrewery: A facility for the production and packaging of beer or similar fermented malt beverages containing not less than one percent nor more than eight percent of alcohol by volume at 60 degrees fahrenheit (if such a beverage has an alcohol content of more than six percent and not more than eight percent and has a terminal specific gravity of less than 1.009, it shall be deemed a spirit and not a malt beverage), for distribution, retail, or wholesale, on or off premise, with a capacity of not more than 15,000 barrels per year.

By: Herbert J. Downing, Esq. Kolvoord, Overton & Wilson, PC 6 Joshua Way, Suite B Essex Junction, VT 05452 (802)878-3346

*****

New England Federal Credit Union

Food and Beverage Processing: The preparation and packaging of food and/or beverage (including alcoholic and non-alcoholic) products for distribution and/or wholesale or retail sales, on or off premise, excluding restaurants and cafes except as an accessory use.

Being all and the same lands and premises conveyed to Thomas J. Scheider by Limited Warranty Deed of Vermont Housing Finance Agency dated June 27, 1997 and recorded in Volume 57 at Page 249 of the Town of Grand Isle Land Records and being more particularly described therein as follows:

Name and Address of Court: Chittenden Probate Court PO Box 511 Burlington, VT 05402

Food Processing: The preparation and packaging of food products for sale. Including but not limited to bakeries and dairies.

Dated at Essex Junction, Vermont this _____ day of August, 2017.

Publication Dates: 8/16/2017

*****

Name of publication Seven Days

Distillery: An establishment for distilling (the evaporation and subsequent collection of a liquid by means of condensation), especially for distilling alcoholic liquors.

*****

(a) Retail: An establishment primarily engaged in the retail sale of baked products. The products may be prepared either on or off site. Such use may include incidental food service. (b) Wholesale: A bakery in which there is permitted the production and/or wholesaling of baked goods, but where over-the-counter or other retail dispensing of baked goods shall be limited to an accessory function.

Joan Scheider, Executor of the Estate of Thomas Scheider, her successors or assigns, may redeem the Mortgaged Property at any time prior to the Sale by paying the full amount due under the mortgage, including post-judgment expenses and the costs and expenses of sale.

Rita M. Shangraw Executor/Administrator: 4565 South Atlantic Ave. Unit 5310 Ponce Inlet, FL 32127 410-458-0216 des2shang@aol.com

***** Bakery: An establishment primarily used for the on or off-site preparation and retail sale of bread, cake, cupcakes, confections and other similar baked pastries. Such uses may include incidental food service.

Date: 8/11/17 /s/ Rita M. Shangraw Signature of Fiduciary

Unless defined to the contrary in Section 4303 of the Vermont Planning and Development Act as amended, or defined otherwise in this section, definitions contained in the building code of the City of Burlington, Sections 8-2 and 13-1 of the Code of Ordinances, as amended, incorporating the currently adopted edition of the American Insurance Association's "National Building Code" and the National Fire Protection Association's "National Fire Code" shall prevail.

Definitions.

For the purpose of this ordinance certain terms and words are herein defined as follows:

By virtue of the Judgment and Decree of Foreclosure by Judicial Sale entered on June 30, 2017, and the Power of Sale contained in a mortgage a Mortgage given by Thomas J. Scheider dated March 25, 2002, and recorded on April 2, 2002, in Volume 73, Pages 213-231 of the Town of Grand Isle Land Records, for breach of the conditions of said mortgage and for the purpose of foreclosing the same, the undersigned will cause to be sold at public auction (“Sale”) at 11:00 a.m. on the 11th day of September, 2017, the lands and premises located at 38 Allen Road in the Town of Grand Isle, Vermont (“Mortgaged Property”) described as follows:

Sec. 13.1.2

notice. The claim must be presented to me at the address listed below with a copy sent to the court. The claim may be barred forever if it is not presented within the four (4) month period.

Table – All Zoning Districts thereof to read as follows:

Burlington be and hereby is amended by amending Section 13.1.2, Definitions, and by amending the Use

NOTICE OF JUDICIAL FORECLOSURE SALE

[CONTINUED]

That Appendix A, Comprehensive Development Ordinance, of the Code of Ordinances of the City of

TERMS OF SALE: The sale will be held at the Mortgaged Property. The Mortgaged Property shall be sold AS IS, WITH ALL FAULTS WITH NO REPRESENTATIONS OR WARRANTIES OF ANY KIND subject to all easements, rights of way, covenants, permits, reservations and restrictions of record, title defects, environmental hazards, unpaid real estate taxes (delinquent and current), current and delinquent assessments in favor of homeowners associations, and municipal liens, to the highest bidder for cash. At the Sale, the successful bidder, other than the Mortgagee, shall pay $10,000 of the purchase price in cash or bank treasurer check. The successful bidder shall execute a purchase and sale agreement requiring payment of the balance of the purchase price within ten days of entry of the court order confirming the Sale. Before being permitted to bid at the Sale, bidder shall display to the auctioneer proof of the ability to comply with these requirements. The successful bidder, other than the Mortgagee, must sign a NO CONTINGENCY purchase and sale agreement satisfactory to Mortgagee at the Sale. Title will be transferred by the order confirming judicial sale. The person holding the Sale, may, adjourn the Sale for a period of up to thirty (30) days, from time to time until it is completed, by announcement of the new sale date to those

It is hereby Ordained by the City Council of the City of Burlington as follows:

present at each adjournment, or by posting notice of the adjournment in a conspicuous place at the location of the sale. Notice of the new sale date shall also be sent by first class mail postage prepaid, to the mortgagor at the mortgagor’s last known address at least five days before the new sale date. The public sale may be adjourned for a period of time in excess of 30 days by agreement of the mortgagor and mortgagee or by order of the Court. Other terms to be announced at the Sale, or contact Robert Prozzo at (802)2365628.

An Ordinance in Relation to COMPREHENSIVE DEVELOPMENT ORDINANCE – Food and Beverage Processing ZA #17-08

and on the east and west by lands and premises now or formerly owned by Ralph S. and Lucille Sheldon.

WILMINGTON SAVINGS FUND SOCIETY, FSB D/B/A CHRISTIANA TRUST in its capacity as owner Trustee for WF 19 GRANTOR TRUST Defendants

08/07/17

First reading: 04/17/17 Referred to: Ordinance Committee Second reading: 08/07/17 Action: adopted Date: 08/07/17 Signed by Mayor: 08/09/17 Published: 08/16/17 Effective: 09/06/17

In the Year Two Thousand Seventeen

ORDINANCE 5.02 Sponsor: Planning Department, Planning Commission; Ordinance Committee Public Hearing Dates: ___________

CITY OF BURLINGTON

In the Year Two Thousand Seventeen

An Ordinance in Relation to COMPREHENSIVE DEVELOPMENT ORDINANCE – Technical Corrections ZA #17-12

Sec. 4.5.2 Institutional Core Campus Overlay Districts ORDINANCE 5.03 Sponsor: Planning Department, Planning Commission; Ordinance Committee Public Hearing Dates: ___________

(a) – (b) As Written. (c) District Specific Regulations: University of Vermont Medical Center (ICC-UVMMC); 1. – 4. As written. 5. Building Height No portion of any building within the ICC-UVMMC Height Overlay (as delineated on Map 4.5.23 ICC-UVMMC Height Overlay) shall exceed the elevation of a plane running parallel to the earth at 540-feet above mean sea level. The provisions of Sec. 5.2.56 Building Height Limits shall not be applicable within the ICC-UVMMC Height Overlay.

08/07/17

First reading: 05/15/17 Referred to: Ordinance Committee Second reading: 08/07/17 Action: adopted Date: 08/07/17 Signed by Mayor: 08/09/17 Published: 08/16/17 Effective: 09/06/17

It is hereby Ordained by the City Council of the City of Burlington as follows: That Appendix A, Comprehensive Development Ordinance, of the Code of Ordinances of the City of

6. As Written.

Sec. 4.5.4 Natural Resource Protection Overlay (NR) District (a) – (b) As written. (c)

Burlington be and hereby is amended by amending Section 3.1.2, Zoning Permit Required; Section 4.4.2, Neighborhood Mixed Use Districts, Table 4.4.2-2: Maximum FAR and Building Heights with Bonuses;

District Specific Regulations: Riparian and Littoral Conservation Zone: 1. 2. 3.

Permitted Uses: As written. Prohibited Uses: As written. Conditional Uses Regulated Uses: Except where otherwise noted herein, all uses permitted or conditionally permitted in the respective underlying zoning district, including any construction of buildings or other structures, and roads, parking areas or any other impervious surface, may be approved only within the Riparian and Littoral Conservation Zone and its associated buffer after review and approval pursuant to the Conditional Use review provisions of Article 3 and subject to the requirements and limitations below under Subpart 4.

Requirements: As written.

Section 4.4.5, Residential Districts, Table 4.4.5-1: Minimum Lot Size and Frontage: RL, RL-W, RM and RM-W; Section 4.4.6 Recreation, Conservation, and Open Space Districts; Section 4.5.2, Institutional Core Campus Overlay Districts; Section 4.5.4, Natural Resource Protection Overlay (NR) District; Section 5.2.6, Building Height Limits; Section 5.3.6, Nonconforming Lots; Section 6.1.2, Review Standards, Section 6.2.2, Review Standards; Section 11.1.3, General Requirements and Applicability; Section 13.1.2, Definitions; Appendix A—Use Table—All Zoning Districts and by deleting Appendix B—Dimensional Standards—All Zoning Districts, thereof to read as follows:

(d) District Specific Regulations: Wetland Conservation Zone:

Sec. 3.1.2 Zoning Permit Required Except for that development which is exempt from a permit requirement under Sec. 3.1.2(c) below, no development may be commenced within the city without a zoning permit issued by the administrative officer including but not limited to the following types of exterior and interior work: (a)

Additional Application Requirements: As written. Permitted Uses: As written. Prohibited Uses: As written. Conditional Uses Regulated Uses: Except where noted herein, all uses permitted or conditionally permitted in the respective underlying zoning district, including the list of activities below, may be approved within a wetland and its buffer zone after review and approval pursuant to the Conditional Use Review provisions of Article 3 and subject to the requirements and limitations set forth below under Subpart 6 below.

1. 2. 3. 4.

Exterior Work: As written.

(b) Interior work: As written. (c)

Exemptions: The following shall be exempt from the requirements of this Ordinance and shall not be required to obtain a zoning permit: 1. - 14. As Written.

A. – K. As written. 5. – 6. As written. (e)

15. Per Act 45: Sec. 15c. 24 V.S.A. § 4413(g), notwithstanding any provision of law to the contrary, nothing in this ordinance shall prohibit or have the effect of prohibiting the installation of solar collectors, clotheslines, or other energy devices based on renewable resources. (d) Determination of Non-Applicability: As written.

Sec. 4.4.2 Neighborhood Mixed Use Districts (a) – (d) As written.

A. – M. As written. 5. Criteria for Review: As written. (f)

A. All those permitted open space uses as listed in Section 4.5.4.(f).2 above shall be permitted in the Special Flood Hazard Areas.

(a) – (d) As written.

2. 3.

10,000 The DRB may adjust the frontage requirements for lots fronting on cul-de-sacs, multiple streets, or corner lots reflecting the existing neighborhood pattern on each respective street. There are no minimum lot size or frontage requirements in the RH District. Exception: Larger minimum lot size in RL and WRL larger lot overlay district; refer to Section 4.5.5 & Table 5.5-1.

B. All other uses permitted in the underlying zoning district are permitted only upon the granting of a conditional use review and approval by the DRB as per Article 3 subpart 7 below. 4. – 10. As written.

Sec. 5.2.6 Building Height Limits No structure shall exceed thirty-five (35) feet in height unless otherwise authorized under the district-specific provisions of Article 4: (a) – (b) As written.

(a) – (c) As written.

Clear Sight Triangle 1. Fences placed within a clear sight triangle along driveways and at street intersections, or between an existing building and the front property line, whichever is less, shall be limited to 3-feet in height above the curb in order to provide safe sight distances for pedestrians and vehicles.

(d) District Specific Regulations The following regulations are district-specific exemptions, bonuses, and standards unique to the RCO districts. They are in addition to, or may modify, city-wide standards as provided in Article 5 of this ordinance and district standards as provided above in Tables 4.4.6-1 and 4.4.6-2.

CLASSIFIEDS C-9

1. Lot Coverage Exemption for Agricultural Structures. The maximum allowable coverage may be increased to ten percent (10%) in the RCOAgricultural District for agricultural structures not otherwise exempted from zoning review under V.S.A. 24 Sec. 4413 (d), subject to approval by the DRB. 2. – 4. As written.

3-1t-CityofBurlingtonZA17-12-1-081617.indd 1

SEVEN DAYS

(c)

Sec. 4.4.6 Recreation, Conservation, and Open Space Districts

08.16.17-08.23.17

District Specific Regulations: Special Flood Hazard Area: 1. Additional Application Requirements As written. 2. Permitted Uses in Floodway Areas As written. 3. Permitted and Conditional Uses in Special Flood Hazard Areas (including Floodway areas)

Sec. 4.4.5 Residential Districts

Table 4.4.5-1: Minimum Lot Size and Frontage: RL, RL-W, RM and RM-W2 Lot Frontage1 Lot Size Use (linear feet) (square feet) RL,WRL RM,WRM RL, WRL3 RM, WRM Min: Single detached 6,000 Min: Min: dwelling NA 60’ 30’ Min: Duplex and above

Additional Application Requirements: As written. Permitted Uses: As written. Prohibited Uses: As written. Conditional Uses Regulated Uses: Except where noted herein, all uses permitted or conditionally permitted in the respective underlying zoning district, including the list of activities below, may be approved after review and approval pursuant to the Conditional Use provisions of Article 3 and subject to the requirements and limitations set forth below under subpart 5.

SEVENDAYSVT.COM

Table 4.4.2 -2: Maximum FAR and Building Heights with Bonuses Maximum Maximum FAR Height NAC 3.0 FAR 45 feet NAC-Riverside 3.0 FAR 45 feet NAC-Cambrian Rise 2.5 FAR 75 feet NMU 2.5 FAR 45 feet

District Specific Regulations: Natural Areas Zone: 1. 2. 3. 4.

Sec. 5.3.6 Nonconforming Lots

8/14/17 4:43 PM

Sec. 5.3.6 Nonconforming Lots Development may occur on a non-conforming lot only in the following manner: (a)

Existing Small Lots: See Sec. 5.2.1.

(b) Required Frontage or Access: See Sec. 5.2.2. (c)

Sec. 6.1.2 Review Standards (a) As written. (b) Block Size and Arrangement: The size and arrangement of new blocks shall maintain the size and arrangement of existing neighborhood blocks within the zoning district, and support the pattern of interconnected streets throughout the city. (c) – (d) As written. Connectivity of sidewalks, trails, and natural systems:

The established sidewalk network shall be maintained and extended to the extent possible. Trail networks and uninterrupted corridors of the established street grid should The established sidewalk network shallofbegreenspace maintainedoutside and extended to the extent possible. Trailbe maintained extended wherever All sidewalks in conformance networks and and uninterrupted corridorspossible. of greenspace outside shall of thebeestablished street with grid applicable should be street design construction detailspossible. as provided by the department. of conformance public works, with and shall be maintained and&extended wherever All sidewalks shall be in applicable dedicated city. street designto&the construction details as provided by the department. of public works, and shall be dedicated to the city.

SEVENDAYSVT.COM

Sec. 6.2.2 Review Standards Sec. Review Standards (a)6.2.2 – (l) As written. (a)(m) – (l) As written. Landscaping and Fences:

Any development involving multiple lots, tracts or parcels of land to be developed as a single entity, or seeking to place multiple structures and/or uses on a single lot where not otherwise permitted, may be permitted as a PUD subject to the provisions of this Article. A planned unit development may be permitted subject to minimum project size as follows in the following districts:

(m) Landscaping andbe Fences: Landscaping shall used to beautify the development site and to provide specific functions and benefits to the uses on the These include but to areprovide not limited to stormwater Landscaping shall be and usedbuildings to beautify the site. development site and specific functions and retention anduses erosion winter windbreaks and summer recreational habitat benefits to the andcontrol, buildings on the site. These include butshade, are not limited to and stormwater corridors, buffers and screening of parking areas, and creating privacy for and from adjacent retention and erosion control, winter windbreaks and summer shade, recreational and habitat property. corridors, buffers and screening of parking areas, and creating privacy for and from adjacent Existing trees shall be retained and incorporated into a landscape plan to the extent possible, and property. existing trees to be retained shall be protected during construction in accordance with specifications Existing trees shall be retained and incorporated into a landscape plan to the extent possible, and provided by the city arborist. Contiguous green space, both within the site and with adjacent existing treesshould to be retained shallon beaprotected during construction accordance with specifications properties, be provided site whenever possible and be in designed to provide wildlife travel provided byand thehabitat city arborist. Contiguous green space, both within the site and withspace adjacent corridors preservation, as well as enabling recreational access. If open is intended properties, should be provided on a site whenever possible and be designed to provide wildlife travel to be publicly accessible, it shall be designed to maximize accessibility for all individuals including corridors and habitat preservation, as well as enabling recreational access. If open space is intended the disabled, encourage social interaction, and facilitate ease of maintenance. Along the street edge, to landscaping be publicly accessible, it to shall be designed maximize accessibility for all including shall be used provide a visualto buffer into parking areas from theindividuals public street and thereinforce disabled,the encourage social interaction, and facilitate ease of maintenance. Along the street edge, streetscape. landscaping shall be used to provide a visual buffer into parking areas from the public street and The selection of plant materials and planting sites should create a sustainable landscape, and reinforce the streetscape. consideration shall be given to factors such as hardiness, salt tolerance, disease resistance, The selection ofroot plant materials and planting sites should create a sustainable invasiveness, and canopy spread, underground and overhead utilities, soillandscape, conditions,and and consideration shall beuse given to factors as hardiness, salt tolerance, resistance, microclimates. The of native plantsuch materials is encouraged, and the disease use of plants considered invasiveness, and canopy spread, underground and overhead utilities, soil conditions, and invasive by root VT Agency of Agriculture shall be prohibited. For more information on sustainable microclimates. The use of plant materials encouraged, and theLandscapes: use of plantsAconsidered landscapes, applicants arenative encouraged to consultisPlanting Sustainable Guide for Plan invasive by VT Agency shall be prohibited. more Reviewers prepared foroftheAgriculture Vermont Department of ForestsFor Parks andinformation Recreation on by sustainable the Vermont landscapes, are encouraged to consultArchitects. Planting Sustainable Landscapes: A Guide for Plan Chapter ofapplicants the American Society of Landscape Reviewers prepared for the Vermont Department of Forests Parks and Recreation by the Vermont New or replacement street trees shall be provided consistent with the city’s Street Tree Master Plan. Chapter of the American Landscape Architects. All proposed street treesSociety shall beofselected and planted in accordance with specifications provided by

Districts

Minimum Project Size

RH, RM, RM-W, Downtown and Neighborhood Mixed Use, Institutional1

No minimum project size.

RL, RL-W, RCO-R/G1

2 acres or more

Sec. 13.1.2

Subject to Conditional Use Review pursuant to Art 3, Part 5.

Definitions.

For the purpose of this ordinance certain terms and words are herein defined as follows: Unless defined to the contrary in Section 4303 of the Vermont Planning and Development Act as amended, or defined otherwise in this section, definitions contained in the building code of the City of Burlington, Sections 8-2 and 13-1 of the Code of Ordinances, as amended, incorporating the currently adopted edition of the American Insurance Association's "National Building Code" and the National Fire Protection Association's "National Fire Code" shall prevail. ***** Clear Sight Triangle: An area formed for the purpose of traffic and/or pedestrian safety. See Section 5.2.36(c) for specific provisions.

***** Appendix A—Use Table—All Zoning Districts—*See proposed changes on attached table to delete footnote 8 except where applicable for daycares and small museums.

Appendix B – Dimensional Standards – All Zoning Districts—See proposed changes on attached table to delete Appendix B.

** ***

Material stricken out deleted. Material underlined added.

the or city arborist. street trees shall be provided consistent with the city’s Street Tree Master Plan. New replacement AllFences proposed treeswithin shall be planted in accordance withbut specifications provided by maystreet be placed theselected requiredand setback along a property line, shall be setback thesufficiently city arborist. to provide for the maintenance of both sides of the fence without entering onto the adjacent andwithin shall present a finished sidealong to theaadjoining street. Fences Fences mayproperty be placed the required setback property property line, but and shallpublic be setback placed within a clear for sight shall adhere to sides the standards of Sec. 5.2.6 (c). alongonto driveways sufficiently to provide thetriangle maintenance of both of the fence without entering the and at street intersections, or between an existing building and the property front property line, whichever is adjacent property and shall present a finished side to the adjoining and public street. Fences less, shall bealimited to 3-feet in height above the curbstandards in order to safe(c). sight distances for placed within clear sight triangle shall adhere to the of provide Sec. 5.2.6 along driveways pedestrians and vehicles. or Styles, materials, and dimensions of the fence line, shallwhichever be compatible and at street intersections, between an existing building and the proposed front property is with the be context of to the3-feet neighborhood the the usecurb of theinproperty. less, shall limited in heightand above order to provide safe sight distances for pedestrians and vehicles. Styles, materials, and dimensions of the proposed fence shall be compatible with the context of the neighborhood and the use of the property.

C-10 CLASSIFIEDS

SEVEN DAYS

08.16.17-08.23.17

Sec. 11.1.3 General Requirements and Applicability.

Changes to a Nonconforming Lot: No change shall be permitted to any nonconforming lot which would have the effect of increasing the density at which the property is being used, or increasing the structure located upon such lot, if the dimensional requirements and standards, including parking, of the underlying zoning district are not met as a result thereof. Any changes proposed on a non-conforming lot are subject to conditional use review. Allowance of adaptive reuse and residential conversion bonuses shall be an exception to the foregoing standards. A lot shall be considered nonconforming if there is not sufficient parking, as determined by the standards provided in Article 8. In such cases where a parking waiver or waivers may be or have been legally granted, such a waiver shall not be considered to increase the degree of non-conformity.

(e)

(n) – (p) As written.

Sec. 11.1.3 General Requirements and Applicability. Any development involving multiple lots, tracts or parcels of land to be developed as a single entity, or seeking to place multiple structures and/or uses on a single lot where not otherwise permitted, may be permitted as a PUD subject to the provisions of this Article.

3-1t-CityofBurlingtonZA17-12-1-081617.indd 2

A planned unit development may be permitted subject to minimum project size as follows in the following districts:

8/14/17 4:43 PM

Appendix A-Use Table – All Zoning Districts Urban Reserve USES

Recreation, Conservation & Open Space

RL/W

RM/W

BST

NMU

NAC

RCO – A

RCO - RG

RCO - C

RL/W

RM/W

BST

NMU

NAC

NACRC Y

NAC-CR

Sorority/Fraternity

NON-RESIDENTIAL USES Adult Day Care Agricultural Use

Amusement Arcade Animal Boarding/Kennel/Shelter Animal Grooming Animal Hospitals/Veterinarian Office Appliance Sales/Service

RCO - RG

RCO - C

RL/W

RM/W

DW-PT

BST

NMU

NAC

Y N

NAC-CR NAC-CR

E-LM

N N Y

E-AE

E-LM

N N CU

RCO - A

RCO - RG

RCO - C

RL/W

BST

NMU

NAC

E-AE

E-LM

NACRC Y

NAC-CR

DW-PT

CU Y

Automobile Body Shop

8, 13

N Y

Urban Reserve

Recreation, Conservation & Open Space

Institutional

Residential

RCO - A

RCO - RG

RCO - C

RL/W

RM/W

Automobile/Vehicle Repair

Bank, Credit Union

Bar, Tavern Beauty/ Barber Shop Bicycle Sales/Repair

Billiard Parlor

Boat Repair/Service

N N

BST

NMU

NAC

(See Sec.4.4.1(d) 2)

DW-PT

8, 13

Bowling Alley

Building Material Sales

Camp Ground

8, 13

Cemetery

Cinema

N (See Sec.4.4.1(d) 2) (See Sec.4.4.1(d) 2) N

Y N CU

N 14

Club, Membership

Community Garden

Conference Center

Courthouse

N N

Crematory

Crisis Counseling Center Daycare - Large (Over 20 children) Daycare - Small (7-20 children) (See Sec.5.4.1)

CU CU CU

8, 12

CU CU CU

Y CU

Y Y

3-1t-CityofBurlingtonZA17-12-1-081617.indd 3

8/14/17 4:44 PM p. 2 of 6

CLASSIFIEDS C-11

Composting Contractor Yard Convenience Store (See Sec.5.4.3) Convention Center

SEVEN DAYS

Community Center

08.16.17-08.23.17

Café

12, 14

E-LM

Boat Storage

E-AE

9, 12,

Boat Sales/Rentals

Enterprise

NAC-CR

N (See Sec.4.4.1(d) 2) (See Sec.4.4.1(d) 2) N

Neighborhood Mixed Use NACRC

p. 1 of 6

8, 13

SEVENDAYSVT.COM

USES

Downtown Mixed Use

Automobile & Marine Parts Sales

Appendix A-Use Table – All Zoning Districts

Car Wash

E-AE

Auction House

Bakery - Wholesale

E-LM

Art Gallery/Studio

Automobile Sales – New & Used Bakery - Retail

E-AE

N (See Sec.4.4.1(d) 2) (See Sec.4.4.1(d) 2) N

Aquarium

Enterprise

RCO - A

Group Home Historic Inn (See Sec.5.4.2) Mobile Home Park

Neighborhood Mixed Use

RCO - C

4, 6

Downtown Mixed Use

RESIDENTIAL USES

Bed and Breakfast 6 Boarding House (4 persons or less) 6 Boarding House (5 persons or more) Community House (See Sec.5.4.4) Convalescent /Nursing Home 5 Dormitory

Residential

RCO - RG

RCO - A

Single Detached Dwelling Accessory Dwelling Unit (See Art.5, Sec.5.4.5) Attached Dwellings Duplex Attached Dwellings Multi-Family (3 or more) Attached Dwelling(s) – 26 Mixed-Use RESIDENTIAL SPECIAL USES Assisted Living

Institutional

NACRC NACRC N

Appendix A-Use Table – All Zoning Districts Urban Reserve USES

Recreation, Conservation & Open Space

Institutional

Residential

Downtown Mixed Use NMU

NAC

NACRC

RCO - RG

RCO - C

RL/W

RM/W

Distribution Center

Dry Cleaning Plant

Dry Cleaning Service

N N

DW-PT

Enterprise

BST

RCO - A

Daycare - Home (6 children or less) Dental Lab

Neighborhood Mixed Use DT

NAC-CR

E-AE

E-LM

Film Studio

Fire Station

Food Processing

Fuel Service Station

Health Studio

Hospitals

Hostel

Hotel, Motel

7, 8

Funeral Home Garden Supply Store General Merchandise/Retail – Small <4,000sqft General Merchandise/Retail – Large ≥4,000sqft Grocery Store – Small ≤10,000sqft Grocery Store – Large >10,000sqft Hazardous Waste Collection/Disposal Health Club

8, 13

N 14

CU 24

(See Sec.4.4.1(d) 2)

Y Y

CU CU Y

N (See Sec.4.4.1(d) 2) N

Lumber Yard Machine/Woodworking Shop Manufacturing Manufacturing - Tour Oriented

N N

N (See Sec.4.4.1(d) 2)

Library

N CU

Laundromat

CU CU

Marina

Mental Health Crisis Center

N CU (See §5.4.11)

(See Sec.4.4.1(d) 2) N

Medical Lab

N N

Appendix A-Use Table – All Zoning Districts

SEVENDAYSVT.COM

Urban Reserve

08.16.17-08.23.17 SEVEN DAYS

Institutional

Residential

Downtown Mixed Use

USES

RCO - A

RCO - RG

RCO - C

RL/W

RM/W

Micro-Brewery/Winery Museum–Small < 10,000 sqft Museum-Large >10,000 sqft Office - General

Office - Medical, Dental

Open Air Markets

Operations Center – 9 Taxi/Bus Operations Center 9 Trucking Park Parking Garage Parking Lot

Performing Arts Center Performing Arts Studio

C-12 CLASSIFIEDS

Recreation, Conservation & Open Space

Pet Store

8,13

Pharmacy

Photo Studio

Photography Lab

Police Station - Central

Police Station - Local Post Office – Central Distribution Center Post Office - Local

Printing Plant

Printing Shop

Public Transit Terminal

Public Works 9 Yard/Garage Radio & TV Studio Rail Equip. Storage & Repair Recording Studio Recreational Facility Indoor Recreational Facility Outdoor Commercial Recreational Facility Outdoor

N (See Sec.4.4.1(d) 2)

(See Sec.4.4.1(d) 2) N N (See Sec.4.4.1(d) 2) (See Sec.4.4.1(d) 2) N

E-LM

E-AE CU

N N Y

CU Y Y

CU CU

N N

N (See Sec.4.4.1(d) 2)

N (See Sec.4.4.1(d) 2) N

Y Y

Y N

3-1t-CityofBurlingtonZA17-12-1-081617.indd 4

NAC

NMU

BST

N (See Sec.4.4.1(d) 2) (See Sec.4.4.1(d) 2) N

p. 3 of 6

DW-PT

Enterprise

NAC-CR

Neighborhood Mixed Use NACRC Y

(See Sec.4.4.1(d) 2) (See Sec.4.4.1(d) 2) (See Sec.4.4.1(d) 2)

Y N Y N Y N N CU

p. 4 of 6

8/14/17 4:44 PM

Appendix A-Use Table – All Zoning Districts Urban Reserve USES

UR Urban

Recreational Vehicle Sales Reserve N – New and Used USES Center – UR Recycling N 10 10 Large Center (above 2,000 sf) Recycling – Large 10 N Recycling Center (above 2,000 sf)- Small N (2,000 sf or less) 10

Recycling Center - Small (2,000 sf or less) Research Lab

RCO - A RCO - RG RCO -C Recreation, Conservation & Open Space N

Restaurant Restaurant – Take Out Salon/Spa Restaurant – Take Out School - Post-Secondary Salon/Spa College &Community School School - Post-Secondary - Primary

&Community College School - Secondary School - Primary School, -Trade, or

SchoolProfessional - Secondary Solid Waste Facility School, -Trade, or Incinerator, Landfill, Professional Transfer Station Solid Waste Facility Shop Incinerator, Tailor Landfill, Transfer Station Warehouse Tailor Shop 9 Warehouse, Retail

9 Warehouse Warehouse, Self-Storage

9 9

Wholesale Sales Warehouse, Retail

RCO - A

RCO - RG

RCO - C

Research Lab Restaurant

Worship, Place of Warehouse, Self-Storage

Recreation, Conservation & Open Space

CU N

N N

Appendix A-Use Table – All Zoning Downtown Districts Institutional Residential Mixed Use I

RL/W

RM/W

Institutional I

CU N

RL/W

N N 22

RM/W

N N N

22 22N

22 N N

N N

13 CU CU

N N22

Y N

CU CU

N N22

CU N22

N Y

CU CU

N N

NCU

N N

CU N CU N

N N

CU CU

CU N

Residential

CU N

CU CU

N N N

N N

CU N

N N

NCU

N N

CU N

N N

CUN

CU N

N N

D N

DW N

N N

DW-PT

CU N

CU CU CU

CU CU N N

8, 13 N

NCU N

N CU N N

8, 13

CU Y

CU CU

N N

N N N

BST

NMU

N N CU

N N N

Y 2)

NMU

NAC N

NACN RC

N CU

CU CU

13 CU Y

CU Y

Y CU

YCU

CU Y

CU CU

CU N CU

CU CU N

CU N

CUN

CU N

N Y

(See N Sec.4.4.1(d) 2)N N N N

N N

N Y

NCU

Y 15

15 YN

N 15

N CU

YCU 15

N N

Worship, Place of

Legend: N

Permitted Use in this district

the

SEVENDAYSVT.COM

are

22. 23. 24. 25. 26. 27.

SEVEN DAYS

See Sec. 4.4.5 (d) 6 for specific allowances and restrictions regarding Neighborhood Commercial Uses in Residential districts. Allowed only on properties with frontage on Pine Street. p. 5 of 6 Such uses shall not exceed 4,000 square feet in size. Dormitories are only allowed on properties contiguous to a school existing as of January 1, 2010. The mixed uses shall be limited to those that are either permitted, conditional, or pre-existing nonconforming in the zoning district. Performing arts centers in the ELM zone shall be limited to a total of 5,000 square feet in size and to properties with frontage on Pine Street. Performing arts centers may contain accessory space for preparation and serving food and beverages, including alcohol, provided this accessory space comprises less than 50% of the entire establishment. 28. Grocery Stores up to but not to exceed 30,000 square feet may be permitted subject to conditional use approval by the DRB in that portion of the Enterprise-Light Manufacturing District between Flynn and Home Avenue. 29. Must be fully enclosed within a building.

08.16.17-08.23.17

Residential uses are not permitted except only as an accessory use to an agricultural use. CU Conditional Use in this district Duplexes may be constructed on lots which meet the minimum lot size specified in Table 4.4.5-1. N Legend: Use not permitted in this district Duplexes shall only be allowed as a result of a conversion of an existing single family home. New duplexes are prohibited. Y Permitted Use in this district No more than 5 rooms permitted to be let in any district where bed and breakfast is a conditional use. No more than 3 rooms permitted to be let in the Abbreviation Zoning DistrictUse in this district CU Conditional district. RCO –NA RCO - Agriculture Use not permitted in this district An existing fraternity, sorority, or other institutional use may be converted to dormitory use subject to conditional use approval by the DRB. RCO – RG RCO – Recreation/Greenspace Must be owner-occupied. RCO – C RCO - Conservation Must be located on a major street. Abbreviation Zoning District I Institutional Small daycares in the RCO zones shall be conditional use and shall only be allowed as part of small museums and shall constitute less than 50% of RCOLow - Agriculture RL/W RCO – A Residential Density, Waterfront Residential Low Density gross floor area of the museum. RCOMedium – Recreation/Greenspace RM/W RCO – RG Residential Density, Waterfront Residential Medium Automobile sales not permitted other than as a separate principal use subject to obtaining a separate zoning permit. DensityRCO - Conservation RCO – C Exterior storage and display not permitted. RH I Residential High Density Institutional All repairs must be contained within an enclosed structure. D Downtown RL/W Residential Low Density, Waterfront Residential Low Density No fuel pumps shall be allowed other than as a separate principal use subject to obtaining a separate zoning permit. DW RM/W Downtown Waterfront Residential Medium Density, Waterfront Residential Medium Density Permitted hours of operation 5:30 a.m. to 11:00 p.m. DT Downtown Transition RH Residential High Density Such uses not to exceed ten thousand (10,000) square feet per establishment. BST D Battery Downtown Street Transition Excludes storage of uncured hides, explosives, and oil and gas products. NMU DW Neighborhood Mixed Use Downtown Waterfront See Sec.4.4.1(d) 2 for more explicit language regarding permitted and conditional uses in the Downtown Waterfront – Public Trust District. NAC Neighborhood Activity Center DT Downtown Transition Allowed only as an accessory use. BST Battery Street Transition A permitted use in the Shelburne Rd Plaza and Ethan Allen Shopping Center. NMU Neighborhood Mixed Use Cafes not permitted as an accessory use. Retail sales and tasting are permitted as an accessory use. NAC Neighborhood Activity Center Accepted agricultural and silvicultural practices, including the construction of farm structures, as those practices are defined by the secretary of p. 5 of 6 NAC-RC NAC – Riverside Corridor agriculture, food and markets or the commissioner of forests, parks and recreation, respectively, under 10 VSA §1021(f) and 1259(f) and 6 VSA §4810 E-AE Enterprise – Agricultural Processing and Energy exempt from regulation under local zoning. See Sec. 4.4.7 (c) for specific allowances and restrictions regarding uses in the Urban Reserve District. E-LM Enterprise – Light Manufacturing

Appendix A-Use Table – All Zoning Districts

CU N

21.

9. 10. 11. 12. 13. 14. 15. 16. 17. 18. 19. 20.

Y CU

5. 6. 7. 8.

N CU

1. 2. 3. 4.

Residential uses are not permitted except only as an accessory use to an agricultural use.

N CU

CUN

15 15

Y CU

Wholesale Sales

N N

CU N

N N

E-LM

CU CU

E-AE

N N

CU CU

Enterprise

YY13

Y Y

E-LM

NAC-CR

BST

2)Y

Enterprise

NACNAC-CR NAC E-AE RC Neighborhood Mixed Use N CU CU N

Y Y

N N (See Sec.4.4.1(d) 2) Y N N

CUY

Sec.4.4.1(d) 2) N CU N

Neighborhood Mixed Use

Downtown Mixed Use

N (See Sec.4.4.1(d) 2) (See (See Sec.4.4.1(d) Sec.4.4.1(d) 2) (See (See Y Sec.4.4.1(d) Sec.4.4.1(d) 2) (See N Y

DW-PT

CLASSIFIEDS C-13

3-1t-CityofBurlingtonZA17-12-1-081617.indd 5

8/14/17 4:44 PM

Appendix B - Dimensional Standards – All Zoning Districts1

District

Density/ Intensity

Lot Coverage (%)

Building Height (feet)

Front Setback1 (feet)

Min: 30’ & 3 story Max: 65’ (105’ with bonuses)

Min: 12’ from curb

Side Setbacks (% or feet)

Rear Setback (% or feet)

Lake & River Setback (feet)

Lot Size (sqft)

Street Frontage (feet)

Min: 0’

Min: 0’ (Res. Dist setback: min of 15’)

Min: 0‘ (Res. Dist setback: min of 15’)

Min: 0’ (Res. Dist setback: min of 15’)

Lake NA & River Setback (feet)

LotNA Size (sqft)

Street NA Frontage (feet)

Mixed- Use Downtown Max: FAR 5.5 (FAR 8.5 w/ bonus)

Max: 100%

Max: FAR 4 (FAR 5 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 45’ (55’ with bonuses)

Min: 12’ from curb

• Frontage on south side of Main St. west of S. Winooski Ave

Max: FAR 5.5 (FAR 8.5 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 65’ (105’ with bonuses)

Min: 12’ from curb

• South of Buell

Max: FAR 4 (FAR 5.5 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 45’ (65’ with bonuses)

Min: 12’ from curb

• South of Maple

Max: FAR 2 (FAR 3 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 35’ (45’ with bonuses)

Min: 12’ from curb

A. North of Pearl, east of railroad

Max: FAR 4 (FAR 5.5 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 45’ (65’ with bonuses)

Min: 12’ from curb

B. Pearl to Bank east of Lake St.

Max: FAR 4 (FAR 5.5 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 45’ (65’ with bonuses)

Min: 12’ from curb

C. Pearl to Bank west of Lake St.

Max: FAR 2 (FAR 3 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 35’

Min: 12’ from curb

D. Bank to College east of Lake St.

Max: FAR 3 (FAR 5 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 35’ (55’ with bonuses)

Min: 12’ from curb

E. Bank to College west of Lake St.

Max: FAR 2 (FAR 3 w/ bonus)

Max: 100%

F. South of College

Density/ Intensity (FAR 3 w/ bonus)

• Church Street Marketplace

Min: 30’ & 3 story Max: 38’ w/in 100’ of centerline

Downtown Transition • North of Buell

Downtown Waterfront

08.16.17-08.23.17

SEVENDAYSVT.COM

District

Lot Max: 100% Coverage (%)

Max: 35’

Min: 30’ & 3 story

Building Height Max: 35’ (feet)

min of 15’)

Min: 12’Setback from curb Front

Min: 0’ SideDist Setbacks (Res. setback: minor offeet) 15’) (%

Min: 0’ Rear Setback (Res. Dist setback: minor offeet) 15’) (%

Min: 0’ (Res. Dist setback: min of 15’)

Min: 50’

Min: 0’ (Res. Dist setback: min of 15’)

(feet)

Downtown Waterfront – Public Trust

p. 1 of 5

A. North of Pearl, west of railroad

Max: FAR 2 (FAR 3 w/ bonus)

Max: 100%

Max: 35’

Min: 12’ from curb

B. 200’ from water

Max: FAR 2 (FAR 3 w/ bonus)

Max: 100%

Max: 35’

Min: 12’ from curb

Max: FAR 3 (FAR 4.5 w/ bonus)

Max: 100%

Min: 30’ & 3 story Max: 35’ (55’ with bonuses)

Min: 12’ from curb

Max: FAR 2 (FAR 3 w/ bonus)

Max: 80%

Max: 35’ (45’ with bonuses)

Min: 0’

Min: 0’ (Res. Dist setback: min of 15’)

Max: FAR 2 (FAR 3 w/ bonus)

Max: 80%

Min: 20’ & 2 story Max: 35’ (45’ with bonuses)

Min: 0’

Min: 0’ (Res. Dist setback: min of 15’)

Max: FAR 2 (FAR 3 w/ bonus)

Max: 80%

Min: 20’ & 2 story Max: 35’ (45’ with bonuses)

Min: 0’

Min: 0’ (Res. Dist setback: min of 15’)

Max: FAR 0.75

Max: 60%

Max: 45’

Min: 10

Min: 10’

Min: 100’

Min: 5’

Min: 0’ (Res. Dist setback: 25’ min)

Min: 10% (Res. Dist setback: 25’ min)

Min: 100’

Battery Street Transition NAC

NAC-Riverside Corridor NMU

SEVEN DAYS

Max: FAR 2

1 0’ Min: 0’ Min: Min: 30’ & Appendix B3 -story Dimensional Standards – (Res. All Dist Zoning Districts 3 Min: 12’ from curb setback: (Res. Dist setback:

Enterprise Agricultural Processing & Energy

Max: FAR 2

Max: 80%

Max: 45’

C-14 CLASSIFIEDS

Light Manufacturing

3-1t-CityofBurlingtonZA17-12-1-081617.indd 6

8/14/17 4:44 PM

Appendix B - Dimensional Standards – All Zoning Districts1 District

Density/ Intensity

Lot Coverage (%)

Building Height (feet)

Front Setback1 (feet)

Max: 35’ or height of existing buildings per Sec. 5.2.6(b)1

Min: 15’

Max: 540’ above MSL or per Sec. 4.5.2(c)5

Min: 15’

Max: 140’ or per Sec. 4.5.2(d)5

Min: 15’

Min: 115’ from Colchester Ave.

Min: 5-feet Max: 20-feet

Min: 20-feet Max: 75-feet

(Structures <200sqft are exempt.)

applicable only along perimeter

Side Setbacks (% or feet)

Rear Setback (% or feet)

10% of lot width

25% of lot depth

Min: 5-feet Max: 20-feet

Min: 20-feet Max: 75-feet

Institutional 20 du/acre Institutional Campus

(24 du/acre with inclusionary requirement)

Max: 40% (48% w/ inclusionary requirement)

Lake & River Setback (feet)

Lot Size (sqft)

Street Frontage (feet)

20 du/acre UVMMC Medical Center Core Overlay see Sec. 4.5.2(c)

(24 du/acre w/ inclusionary requirement)

Max: 60-65%

Scott Gus

Deleted: F

NA for dormitories, rooming houses and nonresidential uses per Sec. 4.5.2(c)6. 20 du/acre

UVM Central Campus Core Overlay see Sec. 4.5.2(d)

(24 du/acre w/ inclusionary requirement)

Max: 65-70%

Max: 40% UVM Trinity Campus Core Overlay see Sec. 4.5.2(e)

Lake & River Setback (feet)

Lot Size (sqft)

Street Frontage (feet)

NA p. 3 of 5

NA for dormitories, rooming houses and nonresidential uses per Sec. 4.5.2(d)6. 20 du/acre (24 du/acre w/ inclusionary requirement)

(48% w/ inclusionary requirement)

Max: 35’ or per Sec. 4.5.2(e) and Sec. 5.2.6(b)1.not to exceed 55’

20 du/acre UVM South of Main St. Campus Core Overlay see Sec. 4.5.2(f)

District

Champlain College Core Overlay see Sec. 4.5.2(g)

(24 du/acre w/ inclusionary requirement) NA for dormitories, Density/ Intensity rooming houses and nonresidential uses per Sec. 4.5.2(f)6.

Max: FAR 1.0-1.1 per Sec. 4.5.2(g)4

1 Appendix B - Dimensional Standards Existing building line as of – All Zoning Districts Max: 60%

Max: 80’ or per Sec. 4.5.2(f)5

Lot Coverage (%)

Building Height (feet)

Max: 60%

Max: 35’ or height of existing buildings per Sec. 5.2.6(b)1

January 1, 2008 along the South Prospect Street and Main Street frontages. 1

Front Setback (feet)

Existing building line as of January 1, 1994 along the South Willard Street frontage south of Maple Street.

Side Setbacks (% or feet)

Rear Setback (% or feet)

10% of lot width

25% of lot depth

Min: 5-feet Max: 20-feet

Min: 20-feet Max: 75-feet

or per Sec. 4.5.2(g)2

RCO Recreation / Greenspace

Max: 0

Max: 5%

Max: 35’

Min: 15’

Min: 10%

Min: 25%

Min: 100’

Conservation

Max: 0

Max: 5%

Max: 25’

Min: 15‘

Min: 10%

Min: 25%

Min: 100’

Agriculture

Max: 0

Max: 5%

Max: 35’

Min: 15’

Min: 10%

Min: 25%

Min: 100’

Max: 0

Max: 5%

Max: 35’

Min: 15’

Min: 10%

Min: 25%

Min: 100’

Min: 10% or 5’

Min: 25% or 20’

(Max required no more than 25’)

(Max required no more than 75’)

Min: 10% or 5’

Min: 25% or 20’

(Max required no more than 25’)

(Max required no more than 75’)

Min: 30’

Min: 10% or 5’

Min: 25% or 20’

(Max required no more than 25’)

(Max required no more than 75’) 1

Min: 75’

Min: 30’

Urban Reserve (du/ac) Max: 35’ (45-ft with bonus)

RH • RH Density Overlay: S. Union to Church

Max: 40 du/ac (80 with bonus)

• RH Density Overlay: Church to Pine RM

Max: 35’ (68-ft with bonus)

Max/Min: +/- 5-ft of average of 2 adjoining properties on both sides

Max: 35’ (55-ft with bonus) Max: 20 du/ac (40 with bonus)

Max: 20 du/ac (40 with bonus)

Max: 40% (60% with bonus)

Max: 60% (72% with bonus)

Max: 35’ Max: 35’ w/in 200’ of water and above 180’ elevation Max: 60’ beyond 200’ of water and below 180’ elevation

Max/Min: +/- 5-ft of average of 2 adjoining properties on both sides

Appendix B - Dimensional Standards – All Zoning Districts District

RL-W

Max: 35% Lot (50% with Coverage bonus)

Max: 7 du/ac (20 with bonus)

Max: 35% (50% with bonus)

(%)

Max: 35’ Building Height (feet)

Max: 35’

Max/Min: +/- 5-ft of average of 2 adjoining properties on 1 Front Setback both sides

(feet)

Max/Min: +/- 5-ft of average of 2 adjoining properties on both sides

Min: 10% or 5’

Min: 25% or 20’

(Max required no Side Setbacks more 25’) (% orthan feet)

Rear Setback (Max required no (% orthan feet) more 75’)

Min: 10% or 5’

Min: 25% or 20’

(Max required no more than 25’)

(Max required no more than 75’)

Min: 75’ Lake & River Setback (feet) Min: 75’

Min: 6,000 Lot Size (10,000 Duplex)

(sqft)

Min: 6,000 (10,000 Duplex)

Min: 60’ Street Frontage (feet) Min: 60’

SEVEN DAYS

Max: 7 du/ac (20 withIntensity bonus) Density/

08.16.17-08.23.17

RM-W

Max: 80% (92% with bonus)

SEVENDAYSVT.COM

Urban Reserve

Residential

p. 4 of 5 1.

Any discrepancy between the dimensional standards found in this table and the dimensional standards found in Article 4 shall be made in favor of those standards found in Article 4. Measurement of and exceptions to coverage, setback and height standards are found in Article 5. Except in the Institutional District, use the median front setback of principal structures on lots having the same street frontage within the same block of the subject property. All structures shall be setback 12-feet from the curb on a public street except as otherwise allowed by the DRB for development on Center Street, on both sides of Pine Street between Cherry and Pearl Streets, on the east side of Pine Street between Bank and Main Streets, on the west side of Pine Street between College and Main Streets and on South Winooski Avenue between Bank and College Streets, all structures shall be setback at least twelve feet from the curb on a public street. The DRB may order a wider setback in any case under its review if it should determine that the application cannot be approved under applicable criteria without such additional setback.

3-1t-CityofBurlingtonZA17-12-1-081617.indd 7

8/14/17 4:44 PM

CLASSIFIEDS C-15

2. 3.

C-16 08.16.17-08.23.17

ATTENTION RECRUITERS: POST YOUR JOBS AT: PRINT DEADLINE: FOR RATES & INFO:

SEVENDAYSVT.COM/POSTMYJOB NOON ON MONDAYS (INCLUDING HOLIDAYS) MICHELLE BROWN, 802-865-1020 X21, MICHELLE@SEVENDAYSVT.COM

YOUR TRUSTED LOCAL SOURCE. SEVENDAYSVT.COM/JOBS CA R I N G P E O P L E WA N T E D

SPECIAL OLYMPICS VERMONT IS GROWING!

Join our team as the

Sports Manager

The Sinclair Inn-B&B in Jericho VT is looking for a pt housekeeper. Hourly salary + pooled tips. Send resume or letter of application to sinclairinn@myfairpoint.net

Home Instead Senior Care, a provider of home helper services to seniors in their homes, is seeking friendly and dependable people. CAREGivers assist seniors with companionship, light housekeeping, Washington South 1t-SinclairInnBed&Breakfast081617.indd 1 8/11/17 10:37 AM meal preparation, personal care, Supervisory Union errands, safety presence and more. Part-time, flexible scheduling, Food Service Director including: daytime, evening, weekend and overnight shifts WSSU is seeking applicants currently available. Higher pay for for a Food Service Director weekend shifts. No heavy lifting. position for the 2017-

Request for Proposal for Northgate Residents Ownership Corporation. Northgate Residents Ownership Corporation (NROC) is currently seeking professional services and accepting proposals to research, develop, design and launch a multi-media timeline. Please email Carol Jaramillo to request a copy of the full Request for Proposal at cjaramillo@ maloneyproperties.com.

(full time) or

Administrative Coordinator (full time)

The Sports Manager plans and implements all aspects of Special Olympics Vermont’s year-round sports training and competition. This role is instrumental in ensuring that the program is consistent with the mission, goals and philosophy of Special Olympics. The Administrative Coordinator manages ongoing data entry and administrative tasks in support of Special Olympics Vermont’s network of athletes, families, donors and volunteers.

2018 school year. This Apply online at: See full job descriptions and application information at person would oversee www.homeinstead.com/483 sovt.info/about-us/careers daily operations within our or call us at 802.860.4663 district. Duties Include: The supervision of program 2v-HomeInstead020817.indd 1 1/13/17 2v-MaloneyProperty080917.indd 12:37 PM 1 8/4/174t-SpecialOlympics-Admin&SportManager081617.indd 2:02 PM 1 planning for meal quality, personnel management, program review and financial management. Also familiarity with SFA requirements and USDA (code#17028) standards for school meals. The Vermont Judiciary seeks experienced manager to www.schoolspring.com/ job.cfm?jid=2835181 oversee several counties in the Northeast Kingdom region

REGIONAL ADMINISTRATOR, VERMONT COURTS

2v-WashingtonSouthSU081617.indd 1

8/14/17

and Washington county unit. Units and regions assigned are subject to change. This position oversees a team of 12:04 PM managers, employees and a multi-million-dollar budget.

As a member of the senior management team, the Regional Administrator will be vital to strategic planning, continuous improvement, and execution against operational commitments. Must build public confidence in the courts through high standards of transparency and accountability.

Looking for a Sweet Job? Our new, mobile-friendly job board is buzzing with excitement.

Start applying at jobs.sevendaysvt.com

2v-jobFiller_workerbee.indd 1

The ideal candidate will have eight or more years of proven leadership experience for a public or private entity. At least a bachelor’s degree and solid credentials are desired. Starting pay in upper 80s. Go to https://www.vermontjudiciary.org/employmentopportunities/staff-openings for more details and how to apply (position is listed as Regional Superior Court Clerk). This position is open until filled.

Executive Director of Annual Giving and Donor Relations

Middlebury College seeks an experienced development professional to become the Executive Director of Annual Giving and Donor Relations. This new position will report to the VP for Advancement; set departmental strategy and direction; lead a team of 13; and serve as a senior member of the Advancement staff. This role requires a high level of collaboration, frequent travel, a penchant for building relationships, excellent planning and analytic skills, and a passionate commitment to the value of a liberal arts education. Join our skilled team at this exciting moment in our institution’s history. To view the full job description and apply online, please visit: http://apptrkr.com/1065827 Middlebury College employees enjoy a high quality of life with excellent compensation; competitive health, dental, retirement, and vision benefits; and educational assistance programs.

The Vermont Judiciary is an equal opportunity employer.

2/20/17 5v-OfficeCourtAdministrator081617.indd 6:25 PM 1

8/14/17 2:56 PM

EOE/Minorities/Females/Vet/Disability

8/14/17 Untitled-35 11:58 AM 1

8/14/17 4:59 PM

NEW JOBS POSTED DAILY! SEVENDAYSVT.COM/CLASSIFIEDS

PCA/Med Tech - Kirby House Inc. Kirby House Inc. is seeking staff to join our team of caregivers. Qualified candidates will be dependable, self-motivated, team players that share our enthusiasm and devotion to making a difference in the lives of 30+ residents with various mental health and developmental disabilities. Must be able to communicate effectively and collaboratively with staff and residents to establish a safe and healthy living environment for adults in a residential setting. Responsibilities include medication distribution, personal care, behavior management, assistance with daily living skills, cleaning duties and meal service. Ongoing training and supervision provided. Experience is not necessary but is preferred. Willing to train the right person. Our current opening is for the overnight shift 11pm to 7am. Weekend availability is necessary.

SENIOR DATA ANALYST

C-17 08.16.17-08.23.17

Job Opening with

Reentry Resources Counseling Interventionist Reentry Resources Counseling, is looking to hire a fulltime subcontractor to work for the State of Vermont in the Northwest Correctional Facility. The Interventionist is responsible for managing a caseload of offenders and facilitating curriculum intended to help reduce risk of reoffending with the sex offender population. Looking for both bachelor’s and master’s degree candidates from an accredited institution or equivalent combination of knowledge and experience. Compensation starts between 18 and 20 an hour.

Saint Michael’s College is searching for a staff member to fulfill the Please send resume and questions to: technical and analytical reentryresourcescounseling@gmail.com Applicants should include a cover letter, resume and list of references. Reentry Resources Counseling functions necessary to Please contact Sharon at (802) 244-8998 with any questions. 25 Lowell St, Suite 203 Manchester, NH 03101 enhance the College’s Telephone: 603 623-5052 kirbyhouse3@myfairpoint.net overall institutional effectiveness, by providing internal decision 8/14/174t-ReentryResources081617.indd 3:29 PM 1 8/11/17 support services and 4t-KirbyHouse081617.indd 1 Seven Days coordinating with other Issue: 8/16 campus offices to provide Engaging minds that change the world Due:OPEN 8/14 TO by noon timely and accurate THE PUBLIC Center for Health and Wellbeing external disclosures. Size: 3.83 x 7 Catamount Recovery Program Over 50 Open Positions for This person will play a Program Coordinator Cost: $610 Advanced Manufacturing Operators (LTS) Per Diem Position key role in development of a redesigned program The University of Vermont’s Center for Health and Wellbeing is inviting applications for the position of Program to coordinate external Coordinator for the Catamount Recovery Program. reporting and survey Responsibilities: This position will be responsible for day-to-day program completions, and conduct coordination of the Catamount Recovery Program (CRP). This includes the internal research to development and management of a programming calendar of events (weekprovide insights into ly lunches, monthly social activities, and related UVM and Burlington area events), marketing these events through email and social media, inspiring institution-specific issues. August 30, 2017 at the Double Tree participation and involvement in CRP events, partnering with students and orDepending on experience ganizations, and the planning and preparation of said events. Additionally, the located on Williston Road in Program Coordinator will be involved in public relations/communications/ and qualifications, there marketing of the Catamount Recovery Program, working to raise awareness South Burlington from 3pm - 6pm is opportunity to play an about substance use disorders and recovery, breaking down stigma, and recruiting new members, and general communication. Program Coordinator expanded role in survey will additionally be responsible for assessment, data collection and configudesign and accreditation ration of Catamount Recovery Program students. Interested candidates may apply online at support - providing further Qualifications: Undergraduate degree or equivalent combination of educahttp://www.globalfoundries.com/about-us/careers. contextual intelligence tion and experience required. Knowledgeable about substance use disorders and passionate about recovery support. Organizational and coordination Job Number: 17004412 or apply online at your local related to external skills. Savvy with social media and communications. Knowledgeable or Department of Labor office. trends related to higher willing to learn about assessment, data collection and configuration. Demonstrates a strong commitment to diversity, social justice, and cultural compeeducation and issues of Qualified applicants will be given an opportunity to tence, and the ability to work in a multicultural environment. the broader economic/ participate in an interview. Advanced Manufacturing This position offers up to 20 hours per week. We offer competitive hourly political environment. Operators (LTS) earn $14.50 to $16.31 per hour with wages. Per Diem employment does not include UVM Benefits.

AUGUST JOB FAIR

Benefits include health, dental, vision, life, disability, 401(k), generous paid time off, employee and dependent tuition benefits, and discounted gym membership.

For full job description and to apply online go to: http://smcvt. interviewexchange.com/.

1T-StMichaelsCollege081617.indd 1

University Description: The University of Vermont is a nationally recognized institution of higher education that is home to approximately 12,000 undergraduate, graduate, and medical students. Burlington, Vermont has been consistently rated as a desirable place to live, due to its small size, beautiful environment, excellent schools, and wide variety of cultural and recreational opportunities. Located on the shores of Lake Champlain, surrounded by scenic panoramas of the Green Mountains and the Adirondacks, it is within several hours of Boston and Montreal.

4:11 PM

health benefits and a 401k starting on day one of employment. Applicants must be 18 years old to apply and must successfully complete a post offer background check and drug test to be hired.

To Apply: Email cover letter, resume and contact information for three references to Amy Boyd Austin (amy.boyd.austin@uvm.edu) with CRP Program Coordinator in the subject line. Cover letter should incorporate a brief statement regarding philosophy/commitment to working with issues of diversity and social justice within a University setting. If you have any questions regarding the position, feel free to contact Amy Boyd Austin at 802.656.0236. The University of Vermont is an Equal Opportunity/Affirmative Action Employer. Applications from women and people from diverse racial, ethnic and cultural backgrounds are encouraged.

8/14/17Untitled-3 4:11 PM 1

8/10/176t-GlobalFoundries081617.indd 10:39 AM 1

8/14/17 11:21 AM

ATTENTION RECRUITERS:

C-18

POST YOUR JOBS AT SEVENDAYSVT.COM/JOBS FOR FAST RESULTS, OR CONTACT MICHELLE BROWN: MICHELLE@SEVENDAYSVT.COM

08.16.17-08.23.17

Village Wine & Coffee

Administrative Assistant Part-Time

Seasonal Positions

We have immediate openings in our manufacturing department for long-term, full-time & part-time seasonal employment. We will have other opportunities available throughout our company for days, early evening, and weekend shifts. No experience is necessary; we will train you.

Barista Retail Sales Part Time Barista, Sales Clerk at Village Wine and Coffee. Barista Skills a plus, must be self motivated and work well with others. Enthusiasm, integrity and commitment are most welcome. Be a part of our coffee and wine community.

Manufacturing Customer service reps Warehouse

Apply in person. 8 am to 5 pm 210 East Main Street, Richmond, VT 05477

Send resumes to: kclayton@ villagewineandcoffee.com

Qualified candidates should submit cover letter, résumé and references to: fmiller@gravelshea.com

8/7/17 4t-Harrington'sSEASONAL081617.indd 11:06 AM 1

UVM Dining/Sodexo is hiring:

Join our amazing team and be a part of the farm-to-table movement! Apply directly at WWW.SODEXO.BALANCETRAK.COM SODEXO IS AN EEO/AA/ MINORITY/FEMALE/DISABILITY/ VETERAN EMPLOYER

8/11/17 10:30 AM

INN & HOSPITALITY SERVICES DIRECTOR

Shelburne Farms seeks an Inn & Hospitality Services Director to lead the hospitality and food service team. To view the full job description and to learn how to apply, please visit: Shelburnefarms.org/ about/join-our-team

2v-ShelburneFarms081617.indd 1

1 8/11/174t-GravelShea081617.indd 3:28 PM

8/14/17 10:22 AM

ARCHITECTURAL PRODUCTION DRAFTER/DESIGNER

Cooks, Dishwashers and Catering Personnel

2v-UVMSodexo081617.indd 1

Candidate must have the following skills: strong work ethic; willingness to adapt quickly to challenging assignments; advanced skills using a variety of software applications including Microsoft Office; and excellent typing and communication skills. Prior legal and/or law firm experience a plus. We offer a competitive salary, comprehensive health insurance, 401(k) and profit sharing, and other benefits.

802.985.8922

2v-VillageWineCoffee080917.indd 1

Burlington law firm seeks highly motivated administrative assistant to provide support to our legal staff and assist with a wide variety of office and computer tasks including answering phones. This position is for 30 hours per week with hours from 11:30 am to 5:30 pm.

Connor Mill-Built Homes has an immediate opening for an Architectural Production Designer. Ideal qualifications include Auto Cad proficiency along with a thorough, practical, hands-on framing background enabling the efficient production and engineering of framing and trim plans that will be used both by our production shop and by a field installation crew. Our company has a national reputation for producing exquisite historic architectural replications, so a knowledge of historic architecture is a plus, but can be learned on the job by an interested and motivated candidate. Pay is commensurate with experience and ability. Please visit connormillbuilt.com/careers for a complete job description. Accepting submissions until September 15th, 2017. Please send cover letter and resume to

Jenni Euber-Mongeur, jmongeur@connormillbuilt.com. connorbuilding.com

Connor Mill-Built Homes offers paid holidays, a generous benefit package, and a positive work environment and profit sharing. We believe healthy, happy employees who are valued for their dedication and commitment to providing extraordinary service and are presented with opportunities to grow, contribute directly to our company’s success.

1 8/14/17 6t-ConnorHomesARCH081617.indd 11:29 AM

8/14/17 Untitled-3 12:02 PM 1

8/14/17 10:16 AM

NEW JOBS POSTED DAILY! SEVENDAYSVT.COM/CLASSIFIEDS

C-19 08.16.17-08.23.17

Co-Marketing Coordinator

Join our Team! The Center for an Agricultural Economy is accepting applications for the position of Co-Marketing Coordinator. This position will work as part of our Business Services Team to help provide resources and marketing opportunities to client businesses and work to promote the mission and products of the Vermont Food Venture Center throughout Vermont’s local food system. Please read the full job description and consider applying or share with those who might be good candidates. Send resumes to: daniel@hardwickagriculture.org by August 20.

Goddard College is firmly aligned with a deep collective desire for and an insistence on social and environmental justice. Our education is non-traditional; our employment structures are complex; the ideal candidate will bring leadership in that context. We seek flexibility, curiosity, the ability to address organizational justice, and an open approach to labor relations. Full time; benefit eligible. Position description and application instructions available here:

www.goddard.edu/about-goddard/ employment-opportunities/

2v-CenterforAgriculturalEconomy081617.indd 8/14/17 1 4t-GoddardCollege081617.indd 11:55 AM 1

Administrative Assistant HOPE Works is seeking an organized, detailoriented professional to help achieve our mission of ending sexual violence in Chittenden County. Provide support to annual fundraising program, perform data entry, help to coordinate volunteers, and assist the executive director in administrative tasks.

Education Coordinator HOPE Works is seeking a passionate antioppression educator to help achieve our mission of ending sexual violence in Chittenden County. Provide violence prevention workshops and trainings in middle school, high school, campus, and professional settings, coordinate community events and outreach. See hopeworksvt.org for details, email resume and cover letter to cathleen@hopeworksvt.org EOE.

Paralegal

DIRECTOR OF HUMAN RESOURCES

Downtown Burlington law firm is seeking a Paralegal. Two or more years of paralegal experience is required. Experience preferred in the following areas: Intellectual Property, Energy and Environmental permitting, or Civil Litigation. The ideal candidate will have the ability to prioritize and manage many tasks simultaneously, strong organizational skills, and strong proofreading skills. The candidate should also be proficient with Microsoft Office suite and Adobe Acrobat, and should be comfortable learning new software. The Paralegal will support many attorneys in a growing and fastpaced law office. Competitive benefits and salary. Interested persons please email letter and resume to applications@dunkielsaunders.com by August 30, 2017.

8/11/17 4t-DunkielSaunders081617.indd 11:32 AM 1

8/14/17 12:05 PM

Providing Innovative Mental Health and Educational Services to Vermont’s Children & Families.

“Make a difference in the life of a child!”- NFI Vermont, a leader in specialized trauma and adolescent development, is looking to expand our team of innovators.

Community Integration Specialists WHITE RIVER PROGRAM

Seeking motivated, creative, and skilled people to join our team in providing Mental Health services to children, youth and families in the greater Hartford, Vermont area. The ideal candidate: a skilled communicator, desire to help kids and families, & ability to provide respectful role modeling. Position provides the opportunity to work directly with children & youth who experience emotional & behavioral challenges. Experience working with children and knowledge of the effects of trauma appreciated! Training and supervision will be provided. Positions with flexible hours are available and those at least 30 hours are benefited. Bachelor’s degree is required. Please submit a cover letter and resume to Meganjones@nafi.com or call (802) 295-4600.

Foster Parents & Respite Providers VERMONT Make a difference in the life of a child! NFI is seeking Vermont homes to support children in need. A sense of humor, flexibility & willingness to work as a team are essential. We are also seeking weekend respite providers. If you are a VT home in the Greater Hartford Area or in Chittenden or Franklin counties, please contact Jodie Clarke at 802-658-3924 x 1028 or email jodieclarke@nafi.com

Join Our Team!

Join the Retail Team at Gardener’s Supply Company! We offer strong cultural values, competitive wages and outstanding benefits (including a tremendous discount on plants & product!).

Inventory/Merchandising Lead: Burlington Garden Center (Full-time, Year-Round with benefits) This person will be responsible for the efficient and accurate flow/ placement of product from arrival of delivery truck to the sales floor. Responsibilities also include training and follow-through related to shipping, receiving, store product transfers, and troubleshooting inventory discrepancies. Our ideal candidate will have 2 years inventory related experience; 2 years direct customer service experience; experience with leading a team; POS and inventory management system experience; gardening/ horticultural knowledge; and strong Microsoft excel skills required. We are a 100% employee-owned company and an award winning and nationally recognized socially responsible business. Interested? Please send your cover letter & resume to Gardener’s Supply Company, 128 Intervale Rd., Burlington, VT 05401 or to jobs@gardeners.com.

ATTENTION RECRUITERS:

C-20

POST YOUR JOBS AT SEVENDAYSVT.COM/JOBS FOR FAST RESULTS, OR CONTACT MICHELLE BROWN: MICHELLE@SEVENDAYSVT.COM

08.16.17-08.23.17

Planning and Zoning Manager College Steps Executive Assistant

Sandwich & Salad prep Position We have a full-time sandwich

Manages administrative functions of College Steps. Coordinates schedules of executive staff, manages all human resource functions, serves as the primary interface for third party vendors, develops all operating and personnel documents and related contracts, and manages all organizational policies and procedures. Visit www.collegesteps.org for more information.

College Steps Admissions & Enrollment Director Recruits students to participate in College Steps by promoting College Steps nationally, developing and managing admissions strategies, and maintaining student enrollment at all College Steps locations. Visit www.collegesteps.org for more information.

Our growing City seeks a Planning and Zoning Manager to serve as the Zoning Administrator and oversee Master Planning efforts in the City of Winooski. This role is responsible for the administration and enforcement of zoning and other bylaws adopted under the Vermont Municipal and Regional Planning and Development Act, and the Winooski Unified Land Use and Development Regulations including the Form Based Code. This position leads Master Planning efforts in the City including working closely with the Community and Economic Development Officer, the City Manager, the Leadership Team, the City’s Planning Commission, and other Commissions to develop and promote the City’s Master Plan, implement the Plan, and update zoning and other municipal policies to support the plan goals. For additional information please visit our website at www.winooskivt.org.

and salad prep position for someone with professional kitchen experience. The ideal candidate 8/11/17 4t-CityofWinooski081617.indd 10:59 AM 1 8/14/17 takes pride in making 4t-CollegeSteps081617.indd 1 G A L L A G H E R F LY N N & C O M PA N Y, L L P excellent food, works cleanly and efﬁciently, rating 6 Years! C e le b Gallagher, Flynn & Company, LLP, an both independently and independently owned, widely respected CPA in a team, and thrives in and consulting firm headquartered in South a dynamic atmosphere The Flynn Center for the Performing Arts seeks Burlington, Vermont, is looking for dynamic where they must learn applicants for a part-time position in our Box individuals to join our team (in either our South a wide variety of tasks. Office. This is a great opportunity to become a Burlington or Hanover, NH offices) to support We offer competitive pay part of the exciting world of the performing arts. our growing business. The firm, one of the largest and excellent beneﬁts in Northern New England, provides tax, audit including health coverage and business consulting services to a diverse group of businesses. CUSTOMER SERVICE REPRESENTATIVE and paid time off. GFC is an integral part of RSM US LLP (formerly known as Our part-time Customer Service Representatives McGladrey, LLP), a premier affiliation of independent accounting Please contact Randy by are responsible for telephone and in-person and consulting firms in the United States. GFC has also won the email or at (802) 223-5200 window ticket sales. Requirements include prestigious “Best Places To Work In Vermont” award for the last x12. six years in a row! excellent customer service skills, attention to detail, and accuracy and speed with data entry. This is a part-time position that requires scheduling flexibility, including some evening, weekend, and weekday availability. We are looking for full-

Café Staff!

time cafe staff help in our Middlesex café. Previous food service/cash handling experience necessary. Job requirements include, customer service, making espresso drinks, and making sandwiches to order. This position includes beneﬁts. Please contact Hannah@ 223-5200 x19 or buyer@redhenbaking. com.

EXPERIENCED ACCOUNTANTS

Come join our team responsible for working with clients from young and emerging businesses. You will have the opportunity to build lasting relationships while helping clients grow their businesses. Responsibilities include compilations, reviews and tax. We are seeking individuals with one to four years of applicable public accounting experience who have the ability to handle direct client contacts. We offer a competitive benefits and salary package. Please email your resume to Jennifer Jeffrey at jjeffrey@gfc.com. For more information about Gallagher, Flynn & Company, LLP, please visit our website at www.gfc.com.

For a full job description and how to apply, please visit: http://www.flynncenter.org/about-us/ employment-and-internship-opportunities.html

Please submit cover letter and resume to: Flynn Center Attn: Human Resources 153 Main Street, Burlington, VT 05401 or email: HResources@flynncenter.org No phone calls, please. EOE

1:36 PM

NEW JOBS POSTED DAILY! SEVENDAYSVT.COM/CLASSIFIEDS

C-21 08.16.17-08.23.17

Service Opportunity MAKE A DIFFERENCE IN PEOPLES LIVES!

TOWN ADMINISTRATOR

2 Full time AmeriCorps positions with a National Leader in Affordable Housing Champlain Housing Trust’s HomeOwnership Center, serving the affordable housing needs of Chittenden, Franklin and Grand Isle Counties, is seeking a Home Education Coordinator and Shared Equity Coordinator. These dynamic 11+ month positions require a Bachelors degree or related work experience, proficient computer and writing skills, and a commitment to community service. Experience in housing, teaching, or lending is a plus. Positions start September 11, 2017. Applications will be accepted until the positions are filled.

Building a community where everyone participates and everyone belongs.

Shared Living Provider

The Town of Waitsfield (pop. 1,719) is a vibrant CCS is seeking an individual or couple to provide community located in the residential supports to an individual with an intellectual heart of the Mad River disability in your home. A generous stipend, paid time off Valley, surrounded by (respite), comprehensive training & supports are available. spectacular natural beauty We are currently offering variety of opportunities. and host of year-round Visit www.vhcb.org/americorps for more info and an outdoor amenities and For more information contact Jennifer Wolcott, application. Questions? Contact Barbara or Jaclyn activities. The town is jwolcott@ccs-vt.org or 655-0511 ext. 118. at 862-6244 or Toll-free 877-274-7431. seeking a highly motivated, EQUAL OPPORTUNIT Y EMPLOYER - COMMIT TED TO A DIVERSE WORKPLACE. ccs-vt.org E.O.E. organized, and engaging Town Administrator. This position assists 637CHT-HR_Americorps_7D-2017.indd 1 1 8/3/17 7/6/174t-ChamplainCommServicesSHARED080917.indd 11:31 1:27 PM AM 1 8/4/17 1:53 PM the selectboard with Untitled-18 administration of the town’s operating budget, supervision of six employees, and oversees all FINANCIAL CONTROLLER: other aspects of personnel, finances, and Connor Mill-Built Homes is looking for public works. an experienced controller, preferably with Bachelor’s degree in public manufacturing experience. This position involves administration, business leading the accounting and data gathering management, or a relevant department in the company as well as monitoring growing. rewarding. unique. field required (Master’s and reporting its ongoing financial condition. The preferred). Candidate position is essential and is an integral member of the should have excellent communication skills; CMBH management team. We are a collaborative a working knowledge team of managers and employees working to of municipal finance maintain and enhance the company’s long-held and budgeting; and reputation for superb quality and customer service. good computer skills. The position is a top-tier role in the company with Three years’ municipal commensurate compensation. Salary is negotiable government or business PedsOne is a one of a kind health care company administration experience depending on professional experience and based in Winooski, VT. We provide billing services to desired. demonstrated effectiveness. pediatric medical practices throughout the US. Salary range is $55,000If you are looking for a challenging and rewarding Please visit connormillbuilt.com/careers $65,000 with a competitive career, performance based compensation, benefits package. A full and a competitive salary and benefits package, for a complete job description. job description and ad please contact us. Accepting submissions until September 15th, 2017 are available here: www. waitsfieldvt.us/townPlease send cover letter and resume to administrator-job-posting. Details about this position and other available Jenni Euber-Mongeur, jmongeur@connormillbuilt.com. connorbuilding.com Please submit confidential opportunities are on our website: cover letter, resume, www.pedsone.com Connor Mill-Built Homes offers paid holidays, and three professional a generous benefit package, and a positive work references to municipal. environment and profit sharing. We believe healthy, recrutiment@vlct.org with subject line “Waitsfield.” happy employees who are valued for their dedication and commitment to providing extraordinary service Application deadline: Friday, August 25, 2017. and are presented with opportunities to grow, EOE. contribute directly to our company’s success.

BILLING SPECIALIST

ATTENTION RECRUITERS:

C-22

POST YOUR JOBS AT SEVENDAYSVT.COM/JOBS FOR FAST RESULTS, OR CONTACT MICHELLE BROWN: MICHELLE@SEVENDAYSVT.COM

08.16.17-08.23.17

Alpine Skiing, Snowboarding, and Winter Enthusiasts: Do you like being in the outdoors? Do you enjoy helping a wide range of people find the right outdoor gear, fitness clothing, outerwear, lifestyle clothing for their adventures at home and around the world? Locally owned and operated for 48 years, we dedicate ourselves to supporting our community and helping customers get what they want and need for all seasons. We’re looking for hardworking people who want to contribute to a wellfunctioning team. Expect to be challenged, focused and professional in a fun and fast paced environment. We offer and guarantee world-class products and services for customers of all experience levels. We welcome candidates with retail/ customer technical service experience, enthusiasm and strong people skills. Part-time and full-time seasonal positions available. Strongest candidates will receive a reply. Please send an up to date cover letter and resume to jobs@skirack.com.

OUTREACH COORDINATOR - FULL TIME REDC is a dynamic economic development organization, supporting Rutland County businesses of all sizes and from all sectors to ensure our region is a prosperous and welcoming place to live, work, and play. REDC is seeking a motivated and energetic team member who can provide public relations and brand oversight. The position is responsible for external communications through regular newsletters, REDC website, social media, press releases, and development of marketing materials. The position is responsible for organizing professional functions and workshops, maintaining and growing REDC membership, and supporting business growth with state and regional incentives and opportunities. Candidates for the position must be flexible and collaborative, possess strong communication skills, and be knowledgeable and interested in economic development. Proven experience and proficiencies in marketing and social media strategy, and working knowledge of office systems including Microsoft Office products and WordPress, preferred. Forward a letter of interest and resume to: Lyle Jepson, Executive Director - Lyle@RutlandEconomy.com 5h-RutlandEconomicDevCorp081617.indd 1

8/14/17 4:00 PM

WHERE YOU AND YOUR WORK MATTER...

4t-SkiRack080917.indd 1

8/4/17 1:40 PM

Producer

Vermont Edition

VPR has an exciting opportunity for a producer on its award-winning daily news magazine Vermont Edition. Be part of our mission to explore the whole Vermont story: from politics to the environment, the economy, history, arts, culture and the natural world. Be a key contributor to essential and compelling news conversations and interviews that serve robust broadcast and digital audiences. This position will work with a team to develop segment ideas, research issues and topics, book and pre-interview guests, line produce live broadcasts and engage with audiences on air and online. A commitment to public service and advancing public radio journalism in a changing media environment is essential to this position. Read the full job description on the Careers page at VPR.net. To apply, email your resume, cover letter and completed VPR Job Application to careers@vpr.net; no calls, please.

When you work for the State of Vermont, you and your work matter. A career with the State puts you on a rich and rewarding professional path. You’ll find jobs in dozens of fields – not to mention an outstanding total compensation package.

GRANT PROGRAMS MANAGER – MONTPELIER

Vermont Economic Progress Council seeks an energetic and outgoing self-starter. Position reports to the Executive Director, performs variety of tasks, works closely with municipalities providing technical support and program monitoring. Works independently, with strong analytical and communication skills, and proficient with MS-Excel. Requires in-state travel. Department of Economic Development. For more information, Contact Fred Kenney at fred.kenney@vermont.gov. Job ID: 6214864 Location: Montpelier. Application Deadline: 08/23/2017.

EDEC 063: Child Development Teaching opportunity for Fall semester, 2017, starting August 28, 2017 The College of Education and Social Services at the University of Vermont is seeking a qualified part-time Lecturer to teach Child Development on campus in the fall semester. This introductory child development course meets on: Mondays and Wednesdays from 8:00 - 9:15 a.m.

ASSIS TANT DIRECTOR, DEVELOPMENTAL DISABILITIES SERVICES DIVISION - WATERBURY

The Department of Disabilities, Aging and Independent Living (DAIL) has an exciting opportunity for a proven leader to take on a key managerial position in overseeing the operations of the Developmental Disabilities Services Division (DDSD). DDSD supports a system of person-centered, individualized, community-based services for people with developmental disabilities. We seek a person with professional experience in developmental disabilities services, healthcare or human services, and supervision of professional staff. For more information, contact Clare McFadden

The course will cover child development from the prenatal period through early adolescence, comprehensive of all domains. The course will examine environmental influences on development (such as cultural/linguistic diversity, poverty, and trauma) and aspects of atypical development (as they broadly relate to developmental delay and disability).

at 802-241-0302 or clare.mcfadden@vermont.gov. Job ID: 621879; Status: Full-time; Application Deadline: 08/24/2017.

The class will include 25 - 35 students, mostly early childhood education majors.

EMERGENCY PREPAREDNESS CHIEF – BURLINGTON

Minimum requirements: Master’s in child development or closely related field and successful teaching experience with undergraduates.

Vermont Department of Health seeks a manager for the State’s public health emergency planning and response effort. The position will maintain emergency response capabilities; coordinate local and federal agencies; serve as a command position in the emergency operations center; oversee the strategic national stockpile; the cities readiness initiative; the health alert network and training and exercise programs. Preference will be given to incident command and emergency operations experience. For more information contact Chris Bell at chris.bell@vermont.gov. Job ID:

621816. Status: Full Time. Application Deadline: 09/04/2017.

VPR is an Equal Opportunity Employer.

4v-VPR081617.indd 1

Part-Time Lecturer in Child Development (1 course)

8/11/17 Untitled-34 10:47 AM 1

Learn more at :

careers.vermont.gov

The State of Vermont is an Equal Opportunity Employer

To apply, submit a letter of interest detailing preparation and experience, current CV, teaching evaluations if available, and names and contact information for two professional references. Send all materials electronically to: Lauren (Lawson) MacKillop at Lauren.MacKillop@uvm.edu and Lawrence G. Shelton at Lawrence.Shelton@uvm.edu

8/14/176t-UVMHumanDevelopment081617.indd 4:25 PM 1

8/11/17 1:34 PM

NEW JOBS POSTED DAILY! SEVENDAYSVT.COM/CLASSIFIEDS

C-23 08.16.17-08.23.17

Community and Educational Support Personnel for autistic young adult male in Chittenden County, VT Full time position 8:30am - 4:00pm M-F

Professional Pay: $25/hour. Position will entail accessing daily community and educational events as well as all aspects of personal care. Two individuals will be hired as part of the team. Long-term training and professional development opportunities. Four-year degree required. Perfect opportunity for someone intending to attend graduate school but delaying to gain quality work experience. Skills: Perseverance, punctual, engaging, team player, athletic (must be able to keep up with a highly mobile 21-year-old male. If you are a hiker or runner, excellent!). Must possess a valid driver’s license. Owning your own vehicle is preferred. Send resume and three references with your letter of interest to Program Directors at nbgteamvt@gmail.com. Thank you for your interest in this position.

4v-NBGTeam081617.indd 1

WE LOVE W H AT WE DO

JOIN OUR TEAM! The Assistant Director of Nursing assists in the planning, organizing, developing, and directing of the day-to-day functions of the Nursing Service Department to ensure the highest degree of quality resident care in accordance with all laws, regulations, facility policy, and guidelines established. Our health center is comprised of 5 Skilled Nursing Facility beds and 80 Assisted Living beds. The Assistant Director of Nursing (ADON) reports to the Director of Nursing (DON). Interested candidates can find a more detailed listing of essential functions and general requirements by visiting kah.kendal.org. Kendal at Hanover is a 400 resident Continuing Care Retirement Community that offers an exceptional working environment based on Quaker values with engaged staff and lively, active residents. Full-time staff enjoy outstanding benefits, including robust health insurance options, generous retirement contributions, competitive paid time off and exceptional continuing education and tuition assistance programs.

8/14/17 10:37 AM

We offer competitive wages and benefits including Tuition Assistance. Four easy ways to apply: Visit us at kah.kendal.org, email resume to hr@kah.kendal.org, drop off your resume or complete an application at 80, Lyme Road, Hanover, NH 03755 Kendal at Hanover is an Equal Opportunity Employer, a drug-free workplace and a tobacco-free community.

7t-KendalatHanover081617.indd 1

I F Y O U LOVE WH AT YOU D O, IT MATTE R S W H ERE YO U WOR K. JOIN OU R TEA M! Hospice RN Case Manager – full-time or part-time Why BAYADA Hospice? • Mission over profits; guided by compassion, excellence, and reliability • More than 40 years of national home care leadership • Easily navigated electronic documentation • Recognition programs, scholarships, and tuition reimbursement • We love what we do! With BAYADA Hospice, you can enjoy: • Meaningful one-on-one patient care • Autonomy with expert clinical support • Flexible schedules to fit your lifestyle • Exceptional interdisciplinary care team We offer great earning potential, various growth opportunities, and a talented and dedicated team. Call us today! Contact Maryellen Corliss at 802-448-1610 or mcorliss@bayada.com.

bayada.com/hospice

Engaging minds that change the world Seeking a position with a quality employer? Consider The University of Vermont, a stimulating and diverse workplace. We offer a comprehensive benefit package including tuition remission for on-going, full-time positions. These openings and others are updated daily. Behavioral Health Counselor - Center for Health and Wellbeing - #S1254PO - The University of Vermont is seeking a strong behavioral health counselor to join our dynamic Student Health Services (SHS) team. The successful candidate will be part of the health care team, collaborating with students’ primary campus providers to screen students for high risk behaviors (including, but not limited, to substance misuse) and offering interventions that support risk reduction. Those with mental/behavioral health background and particular interest in AOD work and operating in an integrated medical setting are particularly encouraged to apply. Student Health Services is staffed by a collaborative multidisciplinary team of professionals in 2 clinical locations. SHS is part of the Center for Health and Wellbeing. Responsibilities: Administer and score behavioral health screening tools in primary care medical setting; based on identified risk, provide brief interventions and behaviorally based treatment in medical setting using motivational interviewing techniques; coordinate referrals to appropriate campus or community partners for those at higher risk; document assessments and interventions in electronic medical record; recruit student patients for follow-up risk assessments; participate in ongoing quality improvement to maximize the impact of this integrated program on the wellbeing of our student population. Qualifications: Master’s Degree in Counseling, Social Work, Psychology or related field, licensed to practice in Vermont as a Psychology-Masters, Mental Health Clinician, Licensed Alcohol and Drug Counselor or Clinical Social Worker. Two years’ experience working with issues facing today’s college students, preferably within a university setting. Experience working in a medical setting or in a mental health setting with brief treatment models. Strong interpersonal communication skills, written and verbal. Ability to work with and across various disciplines. Ability to work in a respectful and non-judgmental manner. Demonstrated commitment to social justice and inclusiveness. This is a 10 month term full-time position. Salary is competitive and commensurate with experience, and includes a generous benefit package. Custodians - Custodial Services - #S1119PO, #S1127PO, #S1258PO, #S1260PO, S1239PO - The University of Vermont Custodial Services Department is hiring new front line custodians. These positions perform a variety of custodial cleaning services, in a team setting, to buildings in support of University facilities. Several shifts are available. These positions require active engagement in learning and practicing principles of social justice and inclusion, environmental sustainability, and delivering great customer service. The University is especially interested in candidates who can contribute to the diversity and excellence of the institution. For further information on these positions and others currently available, or to apply online, please visit our website at: www.uvmjobs.com; Job Hotline #802-656-2248; telephone #802-656-3150. Applicants must apply for positions electronically. Paper resumes are not accepted. Job positions are updated daily. The University of Vermont is an Equal Opportunity/Affirmative Action Employer. Applications, from women, veterans, individuals with disabilities and people from diverse racial, ethnic, and cultural backgrounds are encouraged. Untitled-19 1

Untitled-21 1

8/14/17 12:03 PM

8/14/17 1:06 PM

8/14/17 12:52 PM

Sev Issu Due Size Cos

ATTENTION RECRUITERS:

C-24

POST YOUR JOBS AT SEVENDAYSVT.COM/JOBS FOR FAST RESULTS, OR CONTACT MICHELLE BROWN: MICHELLE@SEVENDAYSVT.COM

08.16.17-08.23.17

Bakery & Retail Help We are looking for part time retail and bakery help in our busy Shelburne store. Experience preferred, but willing to train the right candidates. Weekend availability a must.

3h-HarringtonsBAKERYretail081617.indd 1

Stop by our store on Route 7 to apply in person.

SEEKING FOSTER PARENTS

8/11/17 3:33 PM

Howard Center has an ongoing need for foster parents or weekend buddies for children in our program. These children range in age from 7 - 16. Some need caring adults to support them over the weekend, others need a family for a school year, some are looking for adoptive families. On any given day there are over 1,300 children in the Vermont foster care system and over 60 children in need of an adoptive family. You don’t have to be married, rich or own a home. You will be supported every step of the way!

SEEKING SHARED LIVING PROVIDERS The Howard Center’s Shared Living Program creates opportunities for individuals with developmental disabilities to live in the community. The Shared Living Program is currently accepting expressions of interest from experienced caregivers to provide a home, day-to-day assistance, and support tailored to the needs of individuals seeking caregivers. This is a rewarding employment opportunity for individuals who are interested in working from home while making a meaningful difference in someone’s life. We use a careful matching process to ensure that each placement is mutually compatible. A generous tax-free stipend, Room & Board, respite budget, training, and team support are provided.

New England Federal Credit Union, Vermont’s largest Credit Union, is a growing organization committed to excellence in service, convenience, and simplicity. NEFCU offers a stable, supportive, high-standards work environment, where employees are treated as key stakeholders. Please visit our website - www.nefcu.com to learn more about the great opportunities and benefits that exist at NEFCU.

Mortgage Investor Reporting Specialist

To learn more about these exciting opportunities, contact alysiac@howardcenter.org or call (802) 488-6544.

Water Tower Hill, Colchester Hours: Monday-Friday 8:30-5:00

The primary duties of this position are to reconcile monthly mortgage investor and commercial participation remittances and to monitor cash flows to investors. The person in this role will be expected to perform more complex loan transactions within the mortgage servicing system including foreclosures, bankruptcy prepetition and post-petition payments and shortsales. The integrity of the Mortgage Loan Servicing database will be supported through ad hoc reporting and error resolution. The person in this role will also assist the supervisor in identification and resolution of servicing software issues. The ideal candidate will have knowledge of mortgage and commercial loan servicing, FHLMC, VHFA, and FHLB/MPF investor reporting guidelines, as well as in-depth knowledge of Phoenix, FHLMC Service Loans, and VHFA software applications. In-depth loan accounting knowledge, proficiency with Microsoft Word, Excel, and report writing tools will be necessary to be successful.

5v-HowardCenterSLP081617.indd 1

Academic Services Professional Position Summary: Provide academic advising, programmatic coordination and delivery of specialized academic support services for Environmental Program students across units (Rubenstein School, College of Arts and Sciences, and College of Agriculture and Life Sciences). Position comes with an expectation that this person contributes to a positive and collegial work environment and maintains open and clear communications with direct supervisor at all times.

This position, which is part of the Mortgage Loan Servicing Group, also requires excellent analytical and decision making skills. Qualified applicants should visit our website (www.nefcu.com) to complete an online application and submit a completed resume and cover letter illustrating reasons for interest in the position.

Minimum Qualifications: Bachelor’s degree in a specialized or related field and one to three years’ related experience required. Experience working with university-level students desired but not required. Current working knowledge of Microsoft Office software applications. Effective oral and written communication skills, interpersonal skills, and organizational skills. Desirable Qualifications: Also desirable are: familiarity with the UVM administrative systems (PeopleSoft, Banner, myUVM, Registrar, Druple) and interest in environmental issues.

NEFCU enjoys an employer of choice distinction with turnover averaging less than 10%. More than 96% of our 215 staff say NEFCU is a great place to work. (2016 Annual Staff Survey)

nefcu.com 10v-NEFCU081617.indd 1

8/14/17 12:31 PM

https://www.uvmjobs.com/postings/26156

EOE/AA 8/14/17 11:32 AM

5v-UVMEnvironmental081617.indd 1

8/14/17 12:04 PM

Contact Center Operations Manager

Do you have Contact Center experience and a desire to join one of VT’s best places to work? We are seeking a full time, year round Strategic Operations Manager to fill this benefits eligible position in Vergennes, VT.

Connor Mill-Built Homes is looking for an experienced Interior Production Designer, with major emphasis on kitchen design. Must have experience in kitchen design software. The position also includes meeting with clients to discuss and design other interior design elements such as stairs, wainscoting, chair rail and other design features that are based in historic details. A knowledge of historic architecture is valuable but not necessary, as we will teach those skills to a motivated applicant. Salary compensation is negotiable depending on experience and skill. Please visit connormillbuilt.com/careers for a complete job description. Accepting submissions until September 15th, 2017. Please send cover letter and resume to Jenni Euber-Mongeur, jmongeur@connormillbuilt.com.

To apply and view complete details about this opening, visit:

Connor Mill-Built Homes offers paid holidays, a generous connorbuilding.com benefit package, and a positive work environment and profit sharing. We believe healthy, happy employees who are valued for their dedication and commitment to providing extraordinary service and are presented with opportunities to grow, contribute directly to our company’s success.

www.chp.com/careers

8/14/17 5v-ConnorHomesINTERIOR081617.indd 2:37 PM 1

Seven Days Issue: 8/16 Due: 8/14 by noon Size: 3.83 x 5.25 Cost: $510

Engaging minds that change the world

Center for Health and Wellbeing Student Health Services Per Diem Position Licensed Practical Nurse/Medical Assistant

We are looking for a clinical staff team member responsible for patient screening and tasks associated with maintaining efficient patient flow and quality health care in our busy outpatient office. Excellent interpersonal skills, proficiency in basic nursing procedures (i.e., immunizations, office laboratory tests, EKGs), history taking and patient education, a must. Successful candidates will work as part of a strong, supportive, and fun clinical team providing health care for students attending the University of Vermont. Desired qualifications: • Knowledge of developmental issues of adolescents and young adults and experience working with college age population. • Computer skills sufficient to maintain proper medical records and complete clinically-related administrative tasks via our electronic medical records. • Ability to communicate clearly in person, via phone, and in writing with students, families and other student health staff of a variety of disciplines. • Ability to work in a respectful and non-judgmental manner. We are looking for someone to work between 15 and 37.5 hours weekly with occasional Saturday morning hours. We offer competitive hourly wages. Per diem employment does not include the UVM benefits package. For more information about the Center for Health and Wellbeing and Student Health Services, visit www.uvm.edu/health. Applications will be accepted until the position is filled. To apply, send cover letter and resume to Sue Demasi at susan.demasi@uvm.edu with LPN/MA Per Diem position in the subject. The University of Vermont is an Equal Opportunity/Affirmative Action Employer.

Untitled-2 1

C-25

SEVENDAYSVT.COM/CLASSIFIEDS

08.16.17-08.23.17

INTERIOR PRODUCTION DESIGNER:

Are you looking for an opportunity to lead Contact Center strategy, workforce management, training and development, and improve customer experience?

5v-CountryHomeProducts081617.indd 1

NEW JOBS POSTED DAILY!

Make an enormous difference for Vermont teens!

Administrative Director Programs Manager Communications Coordinator The Governor’s Institutes of Vermont is currently hiring 3 talented educationminded professionals to join our Winooski-based HQ team. See full job descriptions and apply at www.giv.org/job.

Graphics & 8/14/17 Map Production

8/14/17 3v-GovInstituteVT081617 12:02 PM BW.indd 1

10:52 AM

Are you fun, dedicated, creative? Established Waitsfield, VT destination mapping company, named #4 best small US franchise by Forbes, seeks friendly, focused candidate for map production & design.

Job Developer Way2Work, a leading developmental services supported employment program, is seeking a creative and outgoing individual to join their dynamic team. The successful candidate will be responsible for supporting individuals in developing career goals, job seeking skills, securing employment, and on the job training. In addition, the candidate will collaborate with businesses to build partnerships for long-term community based employment. Must demonstrate reliability, strong communication skills, and the ability to solve problems effectively and professionally. This full time position offers a comprehensive benefits package, a great work environment, and the opportunity to make a difference in the lives of others. Submit resume and cover letter to Ron Turner, rturner@ccs-vt.org.

• Ideal candidate works well both independently and as part of a team, has exceptional customer service skills, is organized, detail-oriented, and dependable. • Proficiency in Adobe Creative Suite required. Graphic and web design skills a plus. • Position is full time, year round with benefits, SIMPLE IRA, PTO, incl. Powder Clause. Send Resume & Letter of Interest: Susan@DiscoveryMap.com E JOURNEY TH

ccs-vt.org E.O.E.

Building a community where everyone participates and everyone belongs.

5v-ChamplainCommunityServicesWAY2WORK080917.indd 1 8/10/17 4:42 PM

8/4/17Untitled-33 1:54 PM 1

Established 1981

A R TS H E RE

8/14/17 3:43 PM

ATTENTION RECRUITERS:

C-26

POST YOUR JOBS AT SEVENDAYSVT.COM/JOBS FOR FAST RESULTS, OR CONTACT MICHELLE BROWN: MICHELLE@SEVENDAYSVT.COM

08.16.17-08.23.17

OFFICE ASSISTANT

Programs and Marketing Assistant - Part-time job We are currently hiring for the position of Programs and Marketing Assistant. If you have a bachelor’s degree, at least three years’ administrative support experience, are a good multitasker who likes working in a dynamic, services-oriented position, we encourage you to apply.

Fast-paced law firm located in Burlington seeks parttime office assistant. A good candidate will demonstrate the ability to multi-task, take initiative and have excellent computer and communication skills. Attention to detail and an eagerness to learn are essential. Must be able to work independently and as part of a team. Office, filing and legal experience preferred. RESPONSIBILITIES INCLUDE: answering telephones, photocopying, faxing, filing and file management and computer entry.

Please email us a cover letter and resume to info@ vermontwoodworkingschool.com

or visit our Contact Us page for our mailing address. http://www. vermontwoodworkingschool. com/contact-us 148 Main St Cambridge, VT 05444-9644

3v-VTWoodworkingSchool081617.indd 1

Monday through Friday: 25 hours per week; paid hourly; no benefits.

Payroll Processor/

PayData Workforce Solutions is looking for an additional team m ClientService Service Representative join our Client Department as a Payroll Processor/Clien Representative. PayData Workforce Solutions is looking for an additional team

member to join our Client Service Department as a Payroll Processor/ Client Service Representative. If you have a strong worth ethic, with can our clients Our Client Service Representatives work closely workaccurate under deadlines andutilizing enjoy working in aimport team environment payrolls various methods including data (along with worksheets, prior Customerand Service and Payroll experience), Excel time clock imports. Thewe ability to perform wanttasks to hearefficiently from you. Our Service Representatives andClient manage ongoing projectswork is necessary. Att closely withis our detail a clients must. to produce accurate payrolls utilizing various import methods including data entry, Excel worksheets, and time clockCandidates imports. The ability perform efficientlyas well as custo must to have priormultiple payrolltasks experience and manage ongoing projects is necessary. Attention to detail is experience and possess strong communication and organizatio a must. Candidates must have prior payroll experience as well as Candidates should also have proven troubleshooting skills and customer service experience and possess strong communication and adapt to new and changing technology. Our Client Service organizational skills.

Representatives work in a team environment and cubicle office

SEND COVER LETTER AND RESUME TO:

Candidates should also have proven troubleshooting skills and be able Experience to adapt to new and changing technology. Ourtelephone Client Service handling a large volume of calls, as well Representatives work in a team environment and cubicle office strong number skills or prior payroll experience is required; wor setting. Experienceofhandling a large volume of telephone as well knowledge the “Evolution” payroll softwarecalls, is desirable. Exp as having strong number skills or prior payroll experience is required; Windows including Word, Excel, and Outlook is required as wel working knowledge of the “Evolution” payroll software is desirable. keyboarding skills. Experience with Windows including Word, Excel, and Outlook is required as well as strong keyboarding skills.

Jennifer Welsh, Office Manager Lynn, Lynn, Blackman & Manitsky, P.C. 76 St. Paul Street, Suite 400 Burlington, VT 05401

Apply on line at https://paydatapayroll.companycareersite.com/

jwelsh@lynnlawvt.com 3.83”

8/14/17 5v-LynnLynnBlackmanOFFICE051717.indd 12:08 PM 1

Apply online at https://paydatapayroll.companycareersite.com/JobList.aspx

5/12/175v-PayData080917.indd 2:24 PM 1

8/4/17 1:56 PM

an equal opportunity employer

Depending on the amount of text, these font sizes may change

Secretary EOE statement Wanted Futura Medium Oblique 7.5 ptPrisoners’ Rights Office, ( can be changed toSecretarial Montpelier. whatever you’d like)

experience and professional demeanor required; prior legal experience Headline insecretarial arrow: in the criminal LUNCHBOX BOLD stackedfield preferred. Must be highly Headline for positions: organized, detail-oriented, LUNCHBOX BOLD and comfortable answering Dotted lines with a sometimes phones LUNCHBOX REGULAR challenging clientele. Must be able to prioritize workload, and work both independently TEXT: and as part of a legal team. Futura Medium Full-time, State PG17 position 8pt / 9 with benefits. Starting pay: $16.66/hour. EOE. with Futura Heavy keywords

Email resume and cover letter by Sunday, August 27th to: Mary.Deaett@vermont.gov.

3v-OfficeDefenderGeneral080917.indd 1

8/7/17 Untitled-29 12:08 PM 1

Now hiring— Full-time Positions

Retail Sales Associate Tour Guides

Support Secretary

Seeking a passionate chocolate lover to join our dynamic retail team and help us to amaze our customers! Must enjoy working with the public, provide exceptional customer service while sharing our enthusiasm for our chocolate, and have a passion for making hand-crafted, quality beverages. Prior retail and barista experience a plus. Must also enjoy public speaking and conducting daily tours. Year-round, full-time position available at our Pine Street Factory location. Ability to work weekdays, weekends, and holiday hours, a must.

Office of the Public Defender, Burlington. Previous secretarial experience required. Law or human services office experience highly preferred. Serves as5.25” primary receptionist for the office. Full-time, nonclassified PG15 State position with benefits. $15.08/hr. Must be able to work independently and as part of a legal team in a fast-paced office environment. Email resume and cover letter by Sunday, August 27th to:

mary.deaett@vermont.gov EOE

Please visit our website for additional job details: http://www.lakechamplainchocolates.com/about-us/employment

8/14/175v-OfficeDefenderGeneral081617.indd 3:12 PM 1

8/14/17 12:10 PM

NEW JOBS POSTED DAILY!

C-27

SEVENDAYSVT.COM/CLASSIFIEDS

Discover the power of

New World Tortilla is looking for new members to join our team. This is a fast paced counter service restaurant. We have current openings at our Pine Street restaurant as well as our location at the University of Vermont.

what ONE PERSON can do. We’re seeking an energetic, compassionate and deeply committed applicant who seeks to grow their career in

08.16.17-08.23.17

Let’s get to...

Email your resume to mike@newworldtortilla.com or drop it off at either location.

a place they’ll love.

jobs.sevendaysvt.com 2h-NewWorldTortilla081617.indd 1

Opportunity to provide direct administrative support to physician leader of Radiology. Successful candidate will: Function with a high degree of confidentiality.



Manage independent projects and assignments.



Have five years office experience demonstrating outstanding administrative skills and ability to work effectively with senior management. Position: R0004265 UVMHealth.org/MedCenterJobs Equal Opportunity/Affirmative Action employer. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, national origin, disability, or protected veteran status.

Untitled-6 1

8/14/17 10:24 AM

Software Solutions Specialist Software Solutions Specialists work in our customer service center and are eager to learn our EHR solutions and provide extraordinary customer care for our clients. They enjoy helping our clients build their skills and confidence with PCC software solutions. Software Solutions Specialists are assigned PCC clients in a particular region of the country and are responsible for answering their calls, entering and managing their service needs in our help desk software, and helping to solve their questions and problems. They also travel to our client sites to assist with software configuration and training. This position requires technical aptitude and exceptional customer service and communication skills. Prior experience in healthcare technology desired, but not required.

2/27/17 6:30 PM

Customer Service Representative Trainee

Physician Executive Assistant



8/14/171-JobsFiller_work.indd 10:45 AM 1

Explore a career at a nationally recognized Great Place to Work® award-winning company! We’re hiring customer service representative trainees to work in our state-of-the-art call center at our main office in Berlin, Vermont. If you are a fast learner, enjoy helping people and have strong computer skills—we want you to apply. Our paid eight-week training program will introduce you to the role of a customer service representative. You will gain in-depth knowledge about our health care products and services to equip you with the information you’ll need to address our members’ questions and concerns. The hours for this position are 9:30 a.m. to 6 p.m., Monday through Friday. We offer great benefits, competitive salaries and an award-winning worksite wellness program that promotes a culture of health and wellness—all at a vibrant workplace in Berlin, Vermont. Visit us at www.bcbsvt.com/careers to learn more about us and apply online.

As a Benefit Corporation, we place high value on client, employee and community relationships. Our company offers a friendly, informal, and professional work environment. PCC offers competitive benefits as well as some uncommon perks. PCC is located in the Champlain Mill in Winooski, VT. To learn more about PCC, this position, and how to apply, please visit our website at www.pcc.com/careers. The deadline for submitting your application is August 30, 2017. NO PHONE CALLS PLEASE. C S 1 Untitled-2 5v-PCCsoftware081617.indd 1

8/14/17 12:10 PM

/ / 8/14/17 10:14 AMAM

ATTENTION RECRUITERS:

C-28

POST YOUR JOBS AT SEVENDAYSVT.COM/JOBS FOR FAST RESULTS, OR CONTACT MICHELLE BROWN: MICHELLE@SEVENDAYSVT.COM

08.16.17-08.23.17

Appliance Service Technician

Clinician – Substance Abuse – Medicated Assisted Treatment

Looking for an Appliance Tech to work on home appliances (washers, dryers, dishwashers and refrigerators). Must have two to three years experience, valid drivers license and be able to read a schematic and use a multi meter. Part-time or full-time position is available. A van will be provided and tech must supply his or her own tools. Refrigeration and Gas certification a plus, but not required. Wage will depend on experience. Please submit resume to nancy@ electronichospital.com 863-5066

3v-ElectronicsHospital021716.indd 1

2/15/16 4:54 PM

Provide services through Chittenden Clinic’s outpatient opioid treatment program to patients dependent/recovering from dependence on opioids. Services include coordinated individual, group, and family counseling; and comprehensive health home services that address medical and psychosocial needs. Master’s degree in relevant discipline required.

Registered Nurse – Medicated Assisted Treatment Program Seeking a dedicated full-time registered nurse who will be responsible for safely dispensing methadone and buprenorphine products and maintaining all Nursing Dispensary operations at Howard Center’s Chittenden Clinic. Minimum 2 years’ experience in nursing and education based on that required by State of VT for licensure. Must have excellent attention to detail and organizational skills plus strong interpersonal and communication skills.

Residential Counselor – Branches Seeking an energetic and professional individual to provide a safe environment for persons with mental health challenges living in an independent permanent housing environment. Individual will provide supportive counseling, medication management, and crisis intervention as needed and help residents strengthen coping and symptom-management skills. Bachelor’s Degree required. Part time position available. 30 hours/week.

Specialized Service Provider Seeking individual to provide support services for congenitally deaf-blind adults with significant mental health issues. He/she will work in the client home and in the community providing visual and auditory information needed for client to interact with others in the community. Bachelor’s degree required. Parttime 30/hour position.

Sub-Registered Nurse – Medication Assisted Treatment Program Seeking a Registered Nurse to cover vacancies. Our nurses are responsible for safely dispensing methadone and buprenorphine products and maintaining all Nursing Dispensary operations. Must have excellent attention to detail and organizational skills plus strong interpersonal and communication skills.

Supervisor II – First Call for Chittenden County

Looking for a Sweet Job? Our new, mobile-friendly job board is buzzing with excitement.

Job seekers can: • Browse hundreds of current, local positions from Vermont companies. • Search for jobs by keyword, location, category and job type. • Set up job alerts. • Apply for jobs directly through the site.

Start applying at jobs.sevendaysvt.com

Join First Call for Chittenden County, Howard Center’s emergency services program, as a Supervisor. First Call responds to mental health emergencies, with the philosophy that the caller defines the crisis. Duties include internal and external training, direct clinical service, shift coverage, and direct staff supervision. Master’s Degree, licensed/license-eligible and leadership/supervisory experience.

Supervisor – School Services (Part Time) Provide

supervisory support and expertise to Master’s Level School Services Clinicians in South Burlington School District’s elementary and middle schools. Collaborate with school treatment teams using a clinical social work model. Participate as a member of School Services Leadership Team, contributing to program development to ensure best practices are being utilized. Master’s Degree, supervisory experience and clinical license required. Benefit-eligible. Howard Center offers an excellent benefits package including health, dental, and life insurance, as well as generous paid time off for all regular positions scheduled 20+hrs/week.

Please visit our website www.howardcentercareers.org. Enter position title to view details and apply.

Howard Center is an Equal-Opportunity Employer. Applicants needing assistance or an accommodation in completing the online application should feel free to contact Human Resources at 488-6950 or HRHelpDesk@howardcenter.org 14-HowardCenter081617.indd 1

3v-jobFiller_workerbee.indd 1

2/20/17 6:15 PM

8/14/17 2:33 PM

food+drink NORTHEAST SEAFOOD

THE BAR AT BLEU 4 P M D A I LY/ B L E U V T. C O M Untitled-18 1

We may be known for our steaks... but we know seafood!

6/5/17 1:41 PM

FISH • SCALLOPS • SALMON SHRIMP • LOBSTER

Kaleigh Hamel and Ruby delivering eggs

26 Seymour Street | Middlebury | 802.388.7166 | fireandicerestaurant.com 6H-fire&ice052516.indd 1

5/24/16 11:35 AM

e m u l o v e h t Turnip e’re on VPR! —w

FOOD 47

INFO

SEVEN DAYS

n to R CAFÉ and liste Tune into the VP out ab lk ta od writers the Seven Days fo ing ap sh le ns and peop the farms, kitche t si Vi e. t food scen Vermont’s vibran ur local frequency yo VPR.NET or find listen. AT 10:45 A.M. to select SUNDAYS

08.16.17-08.23.17

obtained senior teamster status while most of her peers are living in dorms. “She’s a bit of a prodigy,” Hammer says of her. “She has an extraordinarily upbeat work ethic. She’s not grim about work; she has great joy in it. We’re unaccustomed to people her age with that kind of focus.” Watching Hamel with Ruby, that joy is evident. “Working together is a great way to build a relationship and to build trust,” she explains. As Hamel gets the donkey ready to deliver the eggs — after Ruby is saddled but before she is hitched to the cart — Ruby inclines her head to share a snuggle, and Hamel nuzzles her and kisses her on the nose. Affection, Hamel says, is an important part of their daily routine and eases the twosome into the task at hand. And then they’re off, with eggs in tow, clopping their way down Main Street. m

Fire & Ice

Vermont’s Iconic steakhouse

SEVENDAYSVT.COM

traffic, Hamel helped the donkey become road ready. The din of Main Street isn’t a problem: Animals living at Vermont Compost, which has heavy equipment operating day in and day out, get comfortable around noisy machines. As tractors have replaced draft animals and as a result of “war and desertification,” says Hammer, particular breeds have been dying out; worldwide, the population of donkeys has decreased over the last several decades. Hammer is a member of the Livestock Conservancy, which works to preserve valuable genetic stock. “The safest thing for an endangered livestock species is [to make] money for somebody,” he says. “I deeply believe that this is plausible power for the future of Vermont, but we have to husband the genetics and the skill set.” Hammer and Hamel are working together to consider all the economic possibilities that donkeys and mules can offer. For one thing, they’re moving back toward regular compost pickups, which they hope to begin within a year, “as soon as we can get all of our donkeys in a row,” says Hammer. That means having enough staffers trained to drive the cart, canvas wagon covers in case of rain and marketing efforts to promote the service. Hammer also likes to trifle with the possibility of donkey milk. “I’ve always joked about having a donkey dairy when I retire,” he says. While the donkey milk may or may not materialize, delivering eggs is a regular gig. Today, despite thousands of years of draft animals pulling carts, it’s a novelty. So is Hamel, a 19-year-old who’s

Learn more at vermontcompost.com. 6h-VPRCafe082416.indd 1

8/23/16 2:17 PM

calendar 1 6

WED.16

agriculture

VERMONT OPEN FARM WEEK: Folks come face-toface with food producers in a weeklong fête featuring scavenger hunts, hayrides, tastings and fare for purchase. See diginvt.com for details. Various locations statewide. Prices vary. Info, 434-2000.

art

Find visual art exhibits and events in the art section.

bazaars

JEFFERSONVILLE FARMERS & ARTISAN MARKET: Live music spices up a gathering of more than 30 vendors. 49 Old Main St., Jeffersonville, 4:30-8 p.m. Free. Info, jefffarmersandartisanmarket65@gmail. com.

community

GREENER DRINKS: Supporters of commonsense cannabis reform sip beverages and discuss the culture, industry and politics of the agricultural product. Zenbarn, Waterbury, 6-8 p.m. Free. Info, info@vtcannabisbrands.com.

crafts

KNITTING & MORE: Needleworkers, including beginners, hone their skills. Burnham Memorial Library, Colchester, 6-8 p.m. Free. Info, 264-5660.

dance

DROP-IN HIP-HOP DANCE: Beginners are welcome at a groove session inspired by infectious beats. Swan Dojo, Burlington, 6-7:30 p.m. $15. Info, 540-8300.

08.16.17-08.23.17

SEVENDAYSVT.COM

etc.

GUIDED TOURS: A historic Gothic Revival house opens its doors for hourly excursions. Self-guided explorations of the gardens, exhibits and walking trails are also available. Justin Morrill Homestead, Strafford, 11 a.m.-5 p.m. $6; free for kids 14 and under. Info, 828-3051. HOWARD FRANK MOSHER TRIBUTE TOUR: Filmmaker Jay Craven reflects on his collaborations with the late Vermont writer before showing his 1993 movie Where the Rivers Flow North. Highland Center for the Arts, Greensboro, 6-8 p.m. $5-12. Info, 357-4616.

fairs & festivals

ORLEANS COUNTY FAIR: A historic grandstand hosts harness races, tractor pulls and demolition derbies at a yearly community celebration

2 3 ,

SEVEN DAYS

Corsets and tassels and feathers, oh my! The warm season reaches a boiling point when the Vermont Burlesque Festival raises the curtain on its Hot Summer Showcase at Burlington’s ArtsRiot. Following two dazzling performances at the Orleans County Fair on Thursday and Friday, a luscious lineup of performers serves up its series finale, titled “A Mid Summer’s Tease.” Luke Warm of Las Vegas hosts this eyecatching burlesque and variety show featuring the tantalizing talents of Montpelier’s Bea Trouble, the Green Mountain Cabaret’s Sugar Shakers and headliner Scarlett James of Montréal (pictured), among others. Sorry kids, strong language and partial nudity mean this event is for folks ages 18 and up.

2 0 1 7

complete with agricultural displays, live entertainment, and a beer and wine garden. Orleans County Fairgrounds, Barton, 8:45 a.m. $8-12; free for kids 10 and under; additional cost for rides and grandstand events. Info, orleanscountyfair.net. ST. AMBROSE LAWN PARTY & CHICKEN BARBECUE: Revelers get their fill of savory poultry, fried dough and baked goods at a community cookout complete with a pie contest, a white elephant table and kids’ activities. Bristol Village Green, 5 p.m. Cost of food and drink. Info, 453-2488. VERMONT STATE FAIR: Crowds converge on the midway for carnival amusements, horticultural displays, equine events and live music. Vermont State Fairgrounds, Rutland, 8 a.m.-11 p.m. $5-10; free for kids under 5. Info, 775-5200.

film

See what’s playing at local theaters in the movies section.

VERMONT BURLESQUE FESTIVAL’S HOT SUMMER SHOWCASE

‘BEFORE SUNSET’: A pair of strangers who shared one night of romance reconnect in this sequel to Before Sunrise.. Catamount Arts Center, St. Johnsbury, 7 p.m. Free. Info, 748-2600.

Saturday, August 19, 8:30 p.m., at ArtsRiot in Burlington. $20-25; for ages 18 and up. Info, 540-0406. artsriot.com

‘FLIGHT OF THE BUTTERFLIES’: Monarchs make an extraordinary journey to Mexico’s remote mountain peaks in this 2D and 3D film experience. Northfield Savings Bank Theater: A National Geographic Experience, ECHO Leahy Center for Lake Champlain, Burlington, 11 a.m., 1 & 3 p.m. $3-5 plus regular admission, $13.50-16.50; admission free for members and kids 2 and under. Info, 877-324-6386. JUST-FOR-FUN MOVIES: Film fans keep their eyes glued to the screen for an all-ages flick. Jaquith Public Library, Marshfield, 7 p.m. Free. Info, 426-3581.

AUG.19 & 20 | SPORTS

‘MEERKATS 3D’: Academy Award-nominated actress Emily Watson narrates an immersive film following a family of highly social mammals in the Kalahari Desert. Northfield Savings Bank Theater: A National Geographic Experience, ECHO Leahy Center for Lake Champlain, Burlington, 11:30 a.m., 1:30 & 3:30 p.m. $3-5 plus regular admission, $13.50-16.50; admission free for members and kids 2 and under. Info, 877-324-6386.

Ol’ Dusty Trail

‘THE PRINCESS BRIDE’: “Inconceivable!” A young woman and her true love battle the evils of a mythical kingdom to be reunited in this 1987 fairytale film. Paramount Theatre, Rutland, 7 p.m. Free. Info, 775-0903.

WED.16

48 CALENDAR

Hot Hot Heat

» P.50

List your upcoming event here for free! SUBMISSION DEADLINES: ALL SUBMISSIONS MUST BE RECEIVED BY THURSDAY AT NOON FOR CONSIDERATION IN THE FOLLOWING WEDNESDAY’S NEWSPAPER. FIND OUR CONVENIENT FORM AND GUIDELINES AT SEVENDAYSVT.COM/POSTEVENT. YOU CAN ALSO EMAIL US AT CALENDAR@SEVENDAYSVT.COM. TO BE LISTED, YOU MUST INCLUDE THE NAME OF EVENT, A BRIEF DESCRIPTION, SPECIFIC LOCATION, DATE, TIME, COST AND CONTACT PHONE NUMBER.

CALENDAR EVENTS IN SEVEN DAYS: LISTINGS AND SPOTLIGHTS ARE WRITTEN BY KRISTEN RAVIN. SEVEN DAYS EDITS FOR SPACE AND STYLE. DEPENDING ON COST AND OTHER FACTORS, CLASSES AND WORKSHOPS MAY BE LISTED IN EITHER THE CALENDAR OR THE CLASSES SECTION. WHEN APPROPRIATE, CLASS ORGANIZERS MAY BE ASKED TO PURCHASE A CLASS LISTING.

PHOTO COURTESY OF UNDER ARMOUR MOUNTAIN RUNNING SERIES

A U G U S T

AUG.19 | THEATER

The Under Armour Mountain Running Series offers stunning views, fresh air and heart-pumping exercise, but it’s no walk in the park. With a summer schedule including stops in Oregon, Colorado and Vermont, this inaugural series draws trail-running professionals and newbies alike to Killington Resort this weekend for seven sweat-inducing races. Courses ranging from 5K to 50K take athletes off the beaten path and over varying terrain, including rocky passages, open meadows and scenic downhills. While the distances differ, each route offers participants the chance to test their endurance while taking in the natural wonder of the Green Mountains.

n Monday, Vermonters will have the rare opportunity to witness a partial eclipse of the sun. While there are many viewing opportunities around the state, the Fairbanks Museum & Planetarium, the state’s only public planetarium, makes for an out-of-thisworld locale for experiencing the celestial spectacle. Following a summary of safe observation methods, grown-up and pint-size stargazers can build their own shoebox viewers and pinhole projectors, and even peer through solar telescopes. Indoors, astronomy enthusiasts set their sights on planetarium shows and NASA’s live coverage of the path of totality, or the route of the moon’s shadow during a total solar eclipse. Expert educators and scientists are on hand to answer any burning questions. THE GREAT AMERICAN ECLIPSE

Monday, August 21, 1-4 p.m., at the Fairbanks Museum & Planetarium in St. Johnsbury. Free. Info, 748-2372. fairbanksmuseum.org

AUG.21 | ETC.

SPACING OUT Dance Party

Saturday, August 19, 8 a.m.; and Sunday, August 20, 10 a.m., at Killington Resort. $50-199. Info, support@uamountainrunning.com. uamountainrunning.com

STOWE TANGO MUSIC FESTIVAL Thursday, August 17, 7:30-11 p.m.; Friday, August 18, 11 a.m.-midnight; Saturday, August 19, 11 a.m.; and Sunday, August 20, 11 a.m.-6 p.m., at various Stowe locations. Prices vary. Info, 779-9669. stowetangomusicfestival.com

SEVEN DAYS

UNDER ARMOUR MOUNTAIN RUNNING SERIES

08.16.17-08.23.17

South American steps and sounds make an impression on the Green Mountain State during the Stowe Tango Music Festival. Sponsored by the Argentine Tango Society, this fourth annual event spotlights song and dance through residency programs and four days of cultural activities. Public happenings include an open jam, a social stepping session known as a milonga and a conversation with some of the genre’s trailblazers. A highlight of this year’s schedule is the festival concert held at the Spruce Peak Performing Arts Center. Here, a 30-piece orchestra hits all the right notes while top dancers move across the stage in dramatic performances.

SEVENDAYSVT.COM

AUG.17-20 | FAIRS & FESTIVALS

CALENDAR 49

calendar

BARRE FARMERS MARKET: Crafters, bakers and farmers share their goods. Currier Park, Barre, 3-7:30 p.m. Free. Info, barrefarmersmarket@gmail. com.

SEVENDAYSVT.COM

NEWPORT FARMERS MARKET: Pickles, meats, eggs, fruits, veggies, herbs and baked goods are a small sampling of the seasonal bounty. Causeway, Newport, 9 a.m.-2 p.m. Free. Info, 274-8206. VERMONT FARMERS MARKET: Local products — think veggies, breads, pastries, cheeses, wines, syrups, jewelry, crafts and beauty supplies — draw shoppers to a diversified bazaar. Depot Park, Rutland, 3-6 p.m. Free. Info, 342-4727. WOODSTOCK MARKET ON THE GREEN: Homespun products and farm-fresh eats fill tables. Woodstock Village Green, 3-6 p.m. Free. Info, 457-3555.

SEVEN DAYS

08.16.17-08.23.17

games

BRIDGE CLUB: Strategic players have fun with the popular card game. Burlington Bridge Club, Williston, 9:15 a.m. & 1:30 p.m. $6. Info, 872-5722. CHESS CLUB: Strategy comes into play as competitors try to capture opposing game pieces. Dorothy Alling Memorial Library, Williston, 5:30-7 p.m. Free. Info, 878-4918. DO YOU WANT TO LEARN TO PLAY BRIDGE?: Players of varying experience levels put strategic skills to use. Twin Valley Senior Center, East Montpelier, 10 a.m.-noon. Free; preregister. Info, 223-3322. SCAVENGER HUNT: Lists in hand, community members search Bridge Street bricks for words and phrases. Call for list pick-up locations. Bridge Street, Waitsfield. Free. Info, 496-9416.

50 CALENDAR

health & fitness

BONE BUILDERS: Folks of all ages ward off osteoporosis in this exercise and prevention class. Twin Valley Senior Center, East Montpelier, 7:30-8:30 & 9-10 a.m. Free. Info, 223-3322.

MIDDLEBURY FARMERS MARKET: Crafts, cheeses, breads, veggies and more vie for spots in shoppers’ totes. VFW Post 7823, Middlebury, 9 a.m.-12:30 p.m. Free. Info, middleburyfarmersmkt@yahoo.com.

INTERMEDIATELEVEL SPANISH CLASS: Pupils improve their speaking and grammar mastery. Private residence, Burlington, 6 p.m. $20. Info, 324-1757.

INTERMEDIATE/ADVANCED & ENGLISH LANGUAGE CLASS: | ‘W OP H HE KS RE NIA WITH LINDA: Eclectic music Learners take communication OR IS S GW A M? and movements drawn from healing, ’ PAPER AKIN to the next level. Fletcher Free CU T B OOKM martial and dance arts propel an animated Library, Burlington, 6:30-8 p.m. Free. Info, barefoot workout. South End Studio, Burlington, 865-7211. 8:30-9:30 a.m. $14; free for first-timers. Info, LUNCH IN A FOREIGN LANGUAGE: SPANISH: Hola! 372-1721. Language lovers perfect their fluency. Kellogg.16

FARM-TO-FORK SUNSET DINNER: BUFFET & ENTERTAINMENT NIGHT: A movie complements a spread of farm-grown and locally sourced fare. Sandiwood Farm, Wolcott, 6:30 p.m. $10-45; free for kids 6 and under. Info, 888-2881.

FRENCH WEDNESDAY: SOCIAL HOUR: Francophones finetune their French-language conversation skills over cocktails. Hotel Vermont, Burlington, 5-7 p.m. Free. Info, info@aflcr.org.

COMMUNITY SUPPER: A scrumptious spread connects friends and neighbors. Bring a dessert to share. The Pathways Vermont Community Center, Burlington, 5-5:45 p.m. Free. Info, 888-492-8218, ext. 300.

GINGER’S EXTREME BOOT CAMP: Triathletes, Spartan racers and other fitness fanatics challenge themselves to complete Navy Seal exercises during an intense workout. Come in good shape. Private residence, Middlebury, 7-8 a.m. $8-12; for ages 16 and up. Info, 343-7160.

BEGINNER ENGLISH LANGUAGE CLASS: Students build a foundation in reading, speaking and writing. Fletcher Free Library, Burlington, 6:30-8 p.m. Free. Info, 865-7211.

CHAMPLAIN ISLANDS FARMERS MARKET: Baked items, fresh produce, meats and eggs sustain seekers of local goods. South Hero St. Rose of Lima Church, 3-6 p.m. Free. Info, champlainislandsfarmersmkt@gmail.com.

GENTLE YOGA IN WATERBURY: Individuals with injuries or other challenges feel the benefits of a relaxing and nourishing practice. Zenbarn Studio, Waterbury, 8:30-9:30 a.m. Donations. Info, studio@zenbarnvt.com.

language

IN G

food & drink

GENTLE YOGA IN RICHMOND: Students get their stretch on with Lynn Clauer of Sound & Soul Awakenings. Partial proceeds benefit the Williston Community Food Shelf. Balance Yoga, Richmond, 11 a.m.-noon. $10. Info, 922-0516.

WRITING WORKSHOP & BOOK DISCUSSION: Aspiring wordsmiths pick up their pencils for a writing session with Vermont bard Geof Hewitt and a conversation about Jacqueline Woodson’s Brown Girl Dreaming. Burnham Memorial Library, Colchester, 4:30-5:30 p.m. Free; preregister. Info, 264-5660.

‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: A film follows a herd of large planteating species in Cretaceous Alaska through the seasons and the challenges of growing up. Northfield Savings Bank Theater: A National Geographic Experience, ECHO Leahy Center for Lake Champlain, Burlington, 10:30 a.m., 12:30, 2:30 & 4:30 p.m. $3-5 plus regular admission, $13.5016.50; admission free for members and kids 2 and under. Info, 864-1848.

CHAIR TAI CHI: A fun and unique lesson leads students through low-impact moves. Champlain Senior Center, McClure Multigenerational Center, Burlington, 10:30 a.m. Free. Info, 316-1510.

colorful children’s title for an artistic activity. Henry Sheldon Museum of Vermont History, Middlebury, 9:30-11 a.m. Free; preregister. Info, 388-2117.

‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: Footage of paleontological digs from around the globe tells a compelling story of scientists working as detectives to answer questions about an ancient and mysterious ocean world. Northfield Savings Bank Theater: A National Geographic Experience, ECHO Leahy Center for Lake Champlain, Burlington, noon, 2 & 4 p.m. $3-5 plus regular admission, $13.50-16.50; admission free for members and kids 2 and under. Info, 864-1848.

BUTI YOGA: A fusion of power yoga, tribal dance and deep abdominal toning boosts the flow of energy throughout the body in a class for women. Prenatal Method Studio, Burlington, 6-7 p.m. $10. Info, hayley_williams_21@hotmail.com.

« P.48

WED.16

RECOVERY COMMUNITY YOGA: Folks in recovery and their families enrich mind, body and spirit in an all-levels class. All props are provided; wear loose clothing. Turning Point Center, Burlington, 10:3011:30 a.m. Free. Info, 861-3150. SUNRISE YOGA: Participants of all levels enjoy slowing down, moving mindfully and breathing deeply while building strength and stamina on the mat. Zenbarn Studio, Waterbury, 6-7 a.m. Donations. Info, studio@zenbarnvt.com. WEDNESDAY GUIDED MEDITATION: Individuals learn to relax and let go. Burlington Friends Meeting House, 5:30-6:30 p.m. Free. Info, 318-8605. YOGA ON THE DOCK: Healthy bodies jump-start the day at a serene outdoor practice with lakeside views. Community Sailing Center, Burlington, 7-8 a.m. $15. Info, 864-9642. ZUMBA EXPRESS: A shortened version of this guided beat-driven workout gives students a much-needed midday surge of energy. Marketplace Fitness, Burlington, 11:30 a.m.-noon. $12; free for members and first-timers. Info, 651-8773.

kids

‘BEDKNOBS AND BROOMSTICKS’: Live action meets animation in an adventure flick following a witch, a conman and three children in pursuit of a magic spell. Spaulding Auditorium, Hopkins Center for the Arts, Dartmouth College, Hanover, N.H., 6:30 p.m. Free. Info, 603-646-2422. JUNIOR RANGER ROUNDUP: Little ones nurture a love for nature and become familiar with the park. Nature Center, Little River State Park, Waterbury, 5-6:30 p.m. $2-4; free for kids 3 and under; preregister; call to confirm. Info, 244-7103. SCIENCE LOVES ART: Young’uns work their mental muscles with hands-on experiments exploring bubbles, light, color and sound. ECHO Leahy Center for Lake Champlain, Burlington, 10 a.m.-3 p.m. Regular admission, $13.50-16.50; free for members and kids 2 and under. Info, 877-324-6386. ‘WHERE IS SAM?’ PAPER CUT BOOKMAKING WORKSHOP & BOOK READING: Budding bookworms join the author and illustrator of a

for kids 3 and under; preregister; call to confirm. Info, 244-7103. THE MAGIC OF BIRD MIGRATION: Avian enthusiasts learn how songbirds, shorebirds and other species travel thousands of miles each year with astounding accuracy. Nature Center, Little River State Park, Waterbury, 4 p.m. $2-4; free for children ages 3 and under; preregister; call to confirm. Info, 244-7103. THERE BE DRAGONFLIES HERE: Entomology enthusiasts capture and identify species during this basic introduction to the winged insects. Little River State Park, Waterbury, 7 p.m. $2-4; free for kids 3 and under; preregister; call to confirm. Info, 244-7103.

seminars

AWAKENING THE HEART OF COMPASSION: A MEDITATION PRACTICE & STUDY PROGRAM: Those looking to live with wisdom and courage can join this ongoing facilitated program at any time. Wellspring Mental Health and Wellness Center, Hardwick, 5:30-7 p.m. Donations. Info, wellspringinsight@gmail.com. A COURSE IN MIRACLES: A monthly workshop based on Helen Schucman’s 1975 text delves into the wisdom found at the core of the world’s major religions. Unitarian Universalist Fellowship of Plattsburgh, N.Y., 7:30 p.m. Free. Info, 518-645-1930.

sports

SUNSET TOUR: Cyclists spin their wheels on a scenic roundtrip ride from Jeffersonville to Johnson. Locally sourced snacks keep energy levels high. Lamoille Valley Bike Tours, Jeffersonville, 6:30-8:30 p.m. $40. Info, 730-0161.

Hubbard Library, Montpelier, noon-1 p.m. Free. Info, 223-3338.

WOMEN’S PICKUP BASKETBALL: Players dribble up and down the court during an evening of friendly competition. Appletree Park, Burlington, 7-8:30 p.m. Free; preregister at meetup.com. Info, carmengeorgevt@gmail.com.

music

talks

Find club dates in the music section. THE ACCAFELLA: The Vermont crooner covers Elvis Presley’s gospel numbers. Stowe Community Church, noon-12:30 p.m. Free. Info, 730-5521. CAPITAL CITY BAND: The community ensemble hits all the right notes at a weekly gig on the green. Vermont Statehouse lawn, Montpelier, 7-8 p.m. Free. Info, 456-7054. CITY HALL PARK SUMMER CONCERTS: THE BREVITY THING: Listeners groove to acoustic rock, folk and blues stylings. Burlington City Hall Park, noon. Free. Info, 865-7166. COMMUNITY EVENINGS AT THE FARM: Brett Hughes & the Honky Tonk Crowd entertain picnickers. Shelburne Farms, 6-8 p.m. Free. Info, 985-8686. DUELING PIANOS: Two players tickle the ivories while music lovers sip beverages and sing along to hit after hit. Hotel Vermont, Burlington, 5 & 7:30 p.m. $15. Info, 651-0080. HOOTENANNY: Revelers bring brews, snacks and musical instruments for a good ol’-fashioned jam session. Main Street Museum, White River Junction, 8-11 p.m. Donations. Info, info@mainstreetmuseum.org. SONG CIRCLE: Singers and musicians congregate for an acoustic session of popular folk tunes. Godnick Adult Center, Rutland, 7:15-9:15 p.m. Donations. Info, 775-1182. YANKEE CHANK: The Vermont quartet serenades audience members with Cajun and Zydeco tunes. Proctorsville Green, 5:30-7:30 p.m. Free. Info, 226-7736.

outdoors

THE GOOD, THE BAD AND THE REALLY, REALLY ITCHY: Hikers learn to identify poison ivy, medicinal jewelweed and other local plants. Nature Center, Little River State Park, Waterbury, 2 p.m. $2-4; free

CURRENT EVENTS CONVERSATION: Newsworthy subjects take the spotlight in this informal and open discussion. Dorothy Alling Memorial Library, Williston, 11 a.m.-noon. Free. Info, 878-4918. SVANTE MYRICK: In the third installment of the “Let’s Talk Progress: A Conversation for a Better Burlington” speaker series, the Ithaca, N.Y., mayor describes how his city addresses pressing issues. Union Station, Burlington, 5-7 p.m. Free. Info, info@ letstalkprogressvt.org.

theater

‘BUYER & CELLAR’: A struggling actor learns the cost of fame when he takes a day job in a superstar’s personal mall in this Weston Playhouse OtherStages production. Weston Rod & Gun Club, 7:30 p.m. $15-35. Info, 824-5288. ‘A CHRISTMAS STORY THE MUSICAL’ INFORMATIONAL KICKOFF MEETING: Thespians get the inside scoop on Lyric Theatre Company’s upcoming holiday production. Lyric Theatre Company Office/Warehouse, South Burlington, 7-8:30 p.m. Free. Info, 658-1484. CIRCUS SMIRKUS BIG TOP TOUR: Hold onto your seats! Acrobatic adventures abound when performers rise to new heights in Midnight at the Museum. Montpelier High School, 1-3 & 6-8 p.m. $16-22. Info, 533-2480. ‘THE LEGEND OF GEORGIA MCBRIDE’: When a drag act joins the bill at Casey’s club, the unemployed Elvis impersonator has the chance to trade one sequined outfit for another in this musical comedy staged by Dorset Theatre Festival. Dorset Playhouse, 2-4 & 7:30-9:30 p.m. $39-52. Info, 867-2223. THE METROPOLITAN OPERA LIVE IN HD: ‘FALSTAFF’: A dessert reception and opening remarks pave the way for an onscreen showing of Verdi’s adaptation of Shakespeare’s The Merry Wives of Windsor. Jewish Community of Greater Stowe, 6:30 p.m. Free. Info, 253-1800.

Help Chase Away K9 Cancer

LIST YOUR EVENT FOR FREE AT SEVENDAYSVT.COM/POSTEVENT

‘THE MUSIC MAN’: Traveling salesman Harold Hill’s scheming ways come back to haunt him in this classic comedy, interpreted by the Weston Playhouse Theatre Company. Weston Playhouse, 2 & 7:30 p.m. $15-67. Info, 824-5288.

words

AUTHORS AT THE ALDRICH: James Beard Awardwinning food writer Catherine Donnelly excerpts The Oxford Companion to Cheese. Aldrich Public Library, Barre, 6 p.m. Free. Info, 476-7550. BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: Penmen and -women share their craft in this public event series featuring prestigious writers. See middlebury.edu for details. Bread Loaf Campus, Ripton. Free. Info, 443-5286. CREATIVE WRITING WORKSHOP: Wordsmiths focus on elements of craft while discussing works-inprogress penned by Burlington Writers Workshop members. 110 Main St., Suite 3C, Burlington, 6:30 p.m. Free; preregister at meetup.com; limited space. Info, 383-8104. VETERANS BOOK CLUB: Women who have served in the U.S. military connect over reading materials and a light dinner. White River Junction VA Medical Center, 5-6:30 p.m. Free; preregister. Info, 2959363, ext. 5743.

Burlington Emergency & Veterinary Specialists present The 7th annual VetriScience Laboratories ®

market, 4:30-7:30 p.m.; concert, 5:30-8 p.m. Donations. Info, 234-1645. GUIDED TOURS: See WED.16. JOB HUNT HELP: Community College of Vermont interns assist employment seekers with everything from résumé writing to online applications. St. Johnsbury Athenaeum, 2:30-5:30 p.m. Free. Info, 745-1393.

fairs & festivals

STOWE TANGO MUSIC FESTIVAL: From live music to dancing to history, South American traditions head to the Green Mountains, courtesy of the Argentine Tango Society. See calendar spotlight. Various Stowe locations, 7:30-11 p.m. Prices vary. Info, 779-9669.

film

‘FLIGHT OF THE BUTTERFLIES’: See WED.16.

Find visual art exhibits and events in the art section.

bazaars

ART ON PARK: Local artisans display their wares amid live music and unique eats. Park St., downtown Stowe, 5-8 p.m. Free. Info, 253-7321.

TANDEM’S NIGHT MARKET: Locavores go loco for organic fruits, veggies, prepared foods, cocktails, beer and soda from Addison County purveyors. 25 Mountain Terrace, Bristol, 5-9 p.m. Free. Info, 734-4236.

business

dance

etc.

FEAST & FIELD MARKET: Locally grown produce and the Americana stylings of Haywire are on the menu at a pastoral party. Clark Farm, Barnard,

8/14/17 2:14 PM

Untitled-12 1

4/20/17 2:33 PM

‘BEFORE MIDNIGHT’: Once strangers who shared a night of romance in Before Sunrise, a couple faces a new phase of life and love in this 2013 sequel. Catamount Arts Center, St. Johnsbury, 7 p.m. Free. Info, 748-2600. ‘GIRL RISING’: Tanya Stone, author of Girl Rising: Changing the World One Girl at a Time, leads a talk on her 2017 title, accompanied by a screening of the film of the same name. Film House, Main Street Landing Performing Arts Center, Burlington, 6:30-8 p.m. $10; free for kids 18 and under. Info, 985-3999. ‘MEERKATS 3D’: See WED.16. ‘RIFFTRAX LIVE: DOCTOR WHO: THE FIVE DOCTORS’: Michael J. Nelson, Kevin Murphy and Bill Corbett offer wisecracking commentary on an episode of the BBC’s sci-fi adventure series. Palace 9 Cinemas, South Burlington, 8 p.m. $15. Info, 660-9300. ‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: See WED.16. ‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: See WED.16.

food & drink

BARK & BREW SERIES: Pups romp around the HSCC play yard while snacks and craft beers tempt pet owners’ taste buds. Humane Society of Chittenden County, South Burlington, 5:30-7:30 p.m. $5-20. Info, 862-0135. BURLINGTON EDIBLE HISTORY TOUR: Foodies sample farm-fresh eats on a scrumptious stroll dedicated to Burlington’s culinary past. Awning behind ECHO Leahy Center for Lake Champlain, Burlington, 1-4:15 p.m. $53.50; preregister. Info, 863-5966. JERICHO FARMERS MARKET: Passersby graze through veggies, pasture-raised meats, coffee and handmade crafts. Mills Riverside Park, Jericho, 3-6:30 p.m. Free. Info, jerichofarmersmarket@ gmail.com. KERMIT LYNCH WINE DINNER: European vinos pair perfectly with a six-course tasting menu. The Restaurant at Edson Hill, Stowe, 6:30-8:30 p.m. $110; preregister. Info, 253-7371. MILTON FARMERS MARKET: Fresh finds woo seekers of produce, eggs, meat and maple syrup. Hannaford Supermarket, Milton, 3:30-7 p.m. Free. Info, 893-1009. MONTGOMERY FARMERS MARKET: Those in search of baked goods, pizza, Texas barbecue, fresh flowers, produce and meats find what they desire. Pratt Hall, Montgomery, 9 a.m.-1 p.m. Free. Info, 326-4189. THU.17

CALENDAR 51

DANCE, PAINT, WRITE: DROP-IN: Teens and adults create, connect, heal and grow through self-guided movement and art set to music. Expressive Arts Burlington, 12:30-2:30 p.m. $20; free for firsttimers. Info, 343-8172.

Untitled-25 1

SEVEN DAYS

FOR REAL WOMEN SERIES WITH BELINDA: GIT UR FREAK ON: R&B and calypso-dancehall music is the soundtrack to an empowering sensual dance session aimed at confronting body shaming. Swan Dojo, Burlington, 5:30-7 p.m. $15. Info, bestirredfitness@gmail.com.

peakveterinaryreferralcenter.com

08.16.17-08.23.17

FRANKLIN COUNTY REGIONAL CHAMBER OF COMMERCE MIXER: Friends and colleagues catch up in a relaxed environment with innkeeper Jennifer Bright. The 1906 House & Carriage Barn, Enosburg Falls, 5:30-8 p.m. $5-8; preregister. Info, 524-2444.

Cardiology, Internal Medicine, Dermatology, Oncology, Neurology, Ophthalmology, Surgery, Radiology, Behavior, Physical Rehabilitation

SEVENDAYSVT.COM

NEWBERRY MARKET: Shoppers browse specialty foods, clothing, pottery, décor, collectibles and more at a weekly indoor bazaar. Newberry Market, White River Junction, 2-7 p.m. Free. Info, newberrymarketwrj@gmail.com.

This ad proudly sponsored by:

Compassion • Expertise • Trust

VERMONT STATE FAIR: See WED.16, 8 a.m.-1 p.m.

THU.17 art

SUMMERVALE: Locavores fête farms and farmers at a weekly event centered on food, brews and kids’ activities, with City Market/Onion River Co-op workshops and music by Brett Hughes and His Honky Tonk Crowd. Intervale Center, Burlington, 5:30-8 p.m. Free. Info, eleanor@intervale.org.

See what’s playing at local theaters in the movies section.

VERMONT OPEN FARM WEEK: See WED.16.

s Bib i Your ket to c Ti Your Forward It Wag

October 8 • Champlain Valley Fairgrounds • 9:00 a.m. start

ORLEANS COUNTY FAIR: See WED.16.

WRITING CIRCLE: Words flow when participants explore creative expression in a lowpressure environment. The Pathways Vermont Community Center, Burlington, 4-5 p.m. Free. Info, 888-492-8218.

agriculture

CHASE AWAY

» P.52

calendar

ROYALTON FARMERS MARKET: A cornucopia of farm-fresh fare catches shoppers’ eyes. South Royalton Town Green, 3-6 p.m. Free. Info, 763-8302. VERGENNES FARMERS MARKET: Local food and crafts, live music, and hot eats add flavor to summer evenings. Kennedy Brothers Building, Vergennes, 4-7:30 p.m. Free. Info, 233-9180. WOODBELLY PIZZA POP-UP: Foodies take away wood-fired sourdough slices, farinata and other tasty eats made with local ingredients. Call ahead to order whole pies. Woodbelly Pizza, Montpelier, 11 a.m.-7 p.m. $3-26. Info, 552-3476.

POKÉMON LEAGUE: I choose you, Pikachu! Players of the trading-card game earn weekly and monthly prizes in a fun, friendly environment where newbies can be coached by league leaders. Brap’s Magic, Burlington, 5-8 p.m. Free. Info, 540-0498.

kids

AFTER-HOURS TEEN VOLUNTEER PIZZA PARTY: Summer library helpers chow down at a shindig recognizing their efforts. Brownell Library, Essex Junction, 5-7 p.m. Free. Info, 878-6956. ALL-AGES SPACE STORY TIME: Babies, toddlers and preschoolers participate in finger plays and action rhymes to celebrate the upcoming solar eclipse. Brownell Library, Essex Junction, 2-2:40 p.m. Free. Info, 878-6956. BEST OF AUDUBON: Tots nurture a love for nature by exploring wildlife. Sugarhouse Parking Area. Green Mountain Audubon Center, Huntington, 9-10:30 a.m. $8-10 per adult-child pair; $4 per additional child; preregister. Info, 434-3068.

.17

ESCAPE FROM MR. FAIRFAX’S LYME DISEASE PRESENTATION & N R| LIBRARY: Brainiacs solve puzzles HA ST. T 0 J OH N 8 DISCUSSION: People living with the SBURY PLAYERS to break free from a designated space. tick-borne illness share their stories during Fairfax Community Library, 5:30, 6:15 & 7 p.m. an evening dedicated to prevention and education. Free; preregister. Info, 849-2420. Stowe Free Library, 7-9 p.m. Free. Info, 253-6145. JUNIOR RANGER ROUNDUP: See WED.16. MINDFULNESS MEDITATION: A peaceful, guided LEGO CLUB: Brightly colored interlocking blocks meditation helps participants achieve a sense inspire developing minds. Burnham Memorial of stability and calm. The Pathways Vermont Library, Colchester, 4-5 p.m. Free. Info, 264-5660. Community Center, Burlington, noon-1 p.m. Free. PRESCHOOL MUSIC: Tykes up to age 5 have fun Info, 777-8602. with song and dance. Dorothy Alling Memorial YOGA: A Sangha Studio instructor guides students Library, Williston, 10:30 a.m. Free. Info, 878-4918. who are in recovery toward achieving inner HE

AT E

V NI

UKULELE KIDS: Musical munchkins play instruments and dance to favorite children’s songs. Fletcher Free Library, Burlington, 10:30-11:15 a.m. Free. Info, 865-7216.

language

BEGINNER-LEVEL SPANISH CLASS: Basic communication skills are on the agenda at a guided lesson. Private residence, Burlington, 6 p.m. $20. Info, 324-1757. FRENCH CONVERSATION: Speakers improve their linguistic dexterity in the Romantic tongue. Bradford Public Library, 4 p.m. Free. Info, 222-4536.

music

Find club dates in the music section. CENTRAL VERMONT CHAMBER MUSIC FESTIVAL: A GUIDE TO IMPROVISATION & MUSICIANSHIP: Jazz and non-jazz players ages 8 to 80 hone their skills in a participatory workshop. Chandler Center for the Arts, Randolph, 7 p.m. Free. Info, 728-6464. CHRIS ISAAK: The “Wicked Games” singer serenades listeners with his rockabilly and country music stylings. Paramount Theatre, Rutland, 8 p.m. $66-96. Info, 775-0903. NORTHERN VERMONT SONGWRITERS: Melody makers meet to share ideas and maximize their creativity. Call for details. Catamount Outback Artspace, St. Johnsbury, 6:45 p.m. Free. Info, 467-9859. VICTOR WAINWRIGHT & THE TRAIN: Blues fans boogie to songs from Boom Town at an intimate house concert. Brooklyn Estate, Jericho, 7:30-11 p.m. $20; preregister; limited space. Info, brooklyn.musicinvt@gmail.com.

52 CALENDAR

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

SCAVENGER HUNT: See WED.16.

FORZA: THE SAMURAI SWORD WORKOUT: Students sculpt lean muscles and gain mental focus when using wooden replicas of the weapon. North End Studio A, Burlington, 6-7 p.m. $10. Info, 578-9243.

games

COMMUNITY MINDFULNESS: A 20-minute guided practice with Andrea O’Connor alleviates stress and tension. Tea and a discussion follow. Winooski Senior Center, 6:30-7:30 p.m. Free. Info, 233-1161.

WORCESTER FARMERS MARKET: Food trucks, local produce, bands and kids’ activities bring neighbors together. 52 Elmore Rd., Worcester, 5-8 p.m. Free. Info, 272-3309.

CHAIR YOGA: Yogis limber up with modified poses. Champlain Senior Center, McClure Multigenerational Center, Burlington, 10:30-11:30 a.m. Free. Info, 316-1510.

tranquility. Turning Point Center, Burlington, 5-6 p.m. Free. Info, 448-4262.

REFRIGERATOR PICKLING: Foodies pick up tips on preserving provisions in the fridge. Champlain Senior Center, McClure Multigenerational Center, Burlington, 12:30 p.m. Free. Info, 658-3585.

BEGINNERS TAI CHI CLASS: Students get a feel for the ancient Chinese practice. Twin Valley Senior Center, East Montpelier, 10-11 a.m. Free. Info, 223-3322.

PIZZA SOCIAL: A producer of grass-fed beef and pastured eggs plays host at a wood-fired pizza party followed by a tour of the grounds. Health Hero Farm, South Hero, 5:30-7:30 p.m. $10. Info, 434-4122.

health & fitness

« P.51

THU.17

Untitled-38 1

8/14/17 5:01 PM

FIND FUTURE DATES + UPDATES AT SEVENDAYSVT.COM/EVENTS

outdoors

MUSHROOMS DEMYSTIFIED: Fungi lovers learn about different varieties — fabulous and fearsome alike — found throughout the park. Nature Center, Little River State Park, Waterbury, 11 a.m. $2-4; free for children ages 3 and under; preregister; call to confirm. Info, 244-7103. PUBLIC EDUCATIONAL BOAT TRIP ON LAKE CHAMPLAIN: STORIES OF LAKE CHAMPLAIN: Citizen scientists board a University of Vermont research and education vessel to learn about life underwater. Meet on the south side of the building. Rubenstein Ecosystem Laboratory, Burlington, 9:30-11:30 a.m. $25. Info, 656-8504. RIVER SAFARI: Nature lovers don water shoes and cool off while exploring a shady mountain stream. Nature Center, Little River State Park, Waterbury, 2 p.m. $2-4; free for children ages 3 and under; preregister; call to confirm. Info, 244-7103. SUNSET AQUADVENTURE PADDLE: Stunning scenery welcomes boaters, who explore the Waterbury Reservoir in search of local wildlife. Contact Station, Little River State Park, Waterbury, 6:30 p.m. $2-4; free for kids 3 and under; preregister; call to confirm. Info, 244-7103.

sports

THE VERMONT CHALLENGE: Bikers pedal two-, three- or four-day rides along scenic routes throughout southern and central Vermont. See vtchallenge.com for details. Stratton Mountain Resort, 7:30 a.m.-5 p.m. $199-499. Info, info@ vtchallenge.com.

TECH SUPPORT: Need an email account? Want to enjoy ebooks? Bring your phone, tablet or laptop to a weekly help session. St. Johnsbury Athenaeum, 5:30-7 p.m. Free. Info, 748-8291, ext. 302.

theater

‘BUYER & CELLAR’: See WED.16. ‘THE CHARITY THAT BEGAN AT HOME’: St. John Emile Clavering Hankin’s comedy follows a family whose all-consuming commitment to kindness has awful and amusing consequences. Unadilla Theatre, Marshfield, 7:30 p.m. $10-20. Info, 456-8968.

ELECTRONICS MEETUP: Short skill-building tech talks open the door for makers to exchange ideas on current projects. Generator, Burlington, 6-7 p.m. Free. Info, 540-0761.

TENFEST: Thespians interpret 10-minute plays — ranging from zany to sublime — by 10 local playwrights. Valley Players Theater, Waitsfield, 8 p.m. $10-12. Info, 583-1674.

‘CORACLES, CASTANETS, CADAQUÉS’: Part monologue, part comedy and part history lesson, Katie Gough’s work-in-progress follows what happens when a theater professor makes an appointment with a therapist. FlynnSpace, Burlington, 7:30 p.m. Free. Info, 863-5966.

BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: See WED.16. ‘GROWING UP IN BROOKFIELD’: Storytellers spin tales of local living from the mid-20th century. Brookfield Old Town Hall, 7-8:30 p.m. Donations. Info, 276-3488.

I.1

C|M U SIC I N T H ‘HAPPY DAYS’: Zephyr Teachout reprises her 2007 performance of Samuel Beckett’s play about a half-buried woman. Festival Theatre, Unadilla Theatre, Marshfield, 7:30 p.m. $10-20. Info, 456-8968.

‘THE LEGEND OF GEORGIA MCBRIDE’: See WED.16, 7:30-9:30 p.m. ST. JOHNSBURY PLAYERS 80TH ANNIVERSARY REVUE: A cast of the company’s past and present performers lift their voices to celebrate eight decades of theater. St. Johnsbury School, 7:30 p.m. $8-10. Info, 748-2600.

agriculture

KINGDOM FARM & FOOD DAYS: Locavores revel in the region’s agricultural vitality with farm tours, workshops, demonstrations and garden-fresh fare. See kingdomfarmandfood.org for details. Various Northeast Kingdom locations. Free. Info, kingdomfarmandfood.org. VERMONT OPEN FARM WEEK: See WED.16.

art

words

CIRCUS SMIRKUS BIG TOP TOUR: See WED.16.

‘THE MUSIC MAN’: See WED.16, 7:30 p.m.

tech

‘THE TAFFETAS’: Fifties hits such as “Mr. Sandman” and “Johnny Angel” pepper the Depot Theater’s staging of the story of a girl group vying for a spot on “The Ed Sullivan Show.” Depot Theatre, Westport, N.Y., 5 p.m. $20-32. Info, 518-962-4449.

TOWN HOUSE FORUM: A reading and discussion series hosts fiction writers Robin MacArthur and Melanie Finn. IC S U Strafford Town House, 7-8:30 p.m. NM UR Donations. Info, 765-4037. Y/ T E A LL E

FRI.18 activism

PEACE VIGIL: Friends and neighbors come together, bringing along their signs and their hearts. Top of Church St., Burlington, 5-5:30 p.m. Free. Info, 899-1731.

Find visual art exhibits and events in the art section.

community

FEAST TOGETHER OR FEAST TO GO: Senior citizens and their guests catch up over a shared meal. Montpelier Senior Activity Center, noon-1 p.m. $7-9; preregister. Info, 262-6288.

crafts

CRAFTY CRAP NIGHT: Participants bring supplies or ongoing projects and an adventurous attitude to share creative time with other people in recovery. Turning Point Center, Burlington, 4 p.m. Free. Info, 861-3150.

dance

BALLROOM & LATIN DANCING: Learn new moves with Ballroom Nights, then join others in a dance social featuring the waltz, tango and more. Singles, couples and beginners are welcome. Williston Jazzercise Fitness Center, lesson, 7-8 p.m.; dance social, 8-9:30 p.m. $10-14; $8 for dance only. Info, 862-2269.

FRI.18

» P.54

SEVENDAYSVT.COM

SEPTEMBER 9, 2017 SEPTEMBER 9, 2017 Middlebury College, VT Middlebury College, VT

08.16.17-08.23.17

SEPTEMBER L E 2017 ROUTES 1 0 0 | 5 0 | 2 0 M I9, M I L E R O UVT TES 1 0 0 | 5 0 | 2 0 College, Middlebury

SEVEN DAYS

100 | 50 | 20 M I L E R O U T E S Tag #KellyBrushRide Tag #KellyBrushRide

Tag #KellyBrushRide Untitled-27 1

R I D E | D O N AT E | V O L U N T E E R

kellybrushfoundation.org | 802.846.5298

kellybrushfoundation.org | 802.846.5298 R I D E | D O N AT E | V O L U N T E E R

8/3/17 4:29 PM

CALENDAR 53

/kellybrushfoundation /kellybrushfoundation @kellybrushfdn @kellybrushfdn

calendar FRI.18

« P.53

ECSTATIC DANCE VERMONT: Jubilant motions with the Green Mountain Druid Order inspire divine connections. Christ Episcopal Church, Montpelier, 7-9 p.m. $10. Info, 505-8011.

HARTLAND FARMERS MARKET: Strollers snag scrumptious morsels and eye-catching crafts. Hartland Public Library, 4-7 p.m. Free. Info, hartlandfarmersmarket@gmail.com.

TOP OF THE BLOCK SWING DANCING: Hoofers join See the Rhythm for an open stepping session set to music from the roaring ’20s through the rockabilly ’50s. Top of the Block, Church Street, Burlington, 7-9 p.m. Free. Info, 825-6392.

LYNDON FARMERS MARKET: Vendors proffer a rotation of fresh veggies, meats, cheeses and more. Bandstand Park, Lyndonville, 3-6 p.m. Free. Info, lyndonfarmersmarket@gmail.com.

etc.

RICHMOND FARMERS MARKET: An open-air marketplace connects cultivators and fresh-food browsers. Volunteers Green, Richmond, 3-7 p.m. Free. Info, 391-0806.

BIKE & BREW TOUR: Electric bicycles transport suds lovers to local beer producers via scenic routes. Old Mill Park, Johnson, noon-4 p.m. $75; preregister. Info, 730-0161. GHOST WALK: DARKNESS FALLS: Local historian Thea Lewis treats pedestrians to tales of madmen, smugglers, pub spirits and, of course, ghosts. Arrive 10 minutes early. Democracy sculpture, 199 Main St., Burlington, 8 p.m. $20. Info, 863-5966. GUIDED TOURS: See WED.16. JAMES TAYLOR: Attractions, sideshow banners and oddities from the curator and showman’s personal collection catch eyes. Main Street Museum, White River Junction, 7 p.m. $2-20. Info, 356-2776. REFUGEE OUTREACH CLUB FUNDRAISER: Locals show their support for the program aimed at connecting young adults around the world through education, curiosity and service. ArtsRiot, Burlington, 9 p.m. $15. Info, 540-0406. SUMMER SOIRÉE: ICE CREAM & FLOWERS: Folks assemble blooms in take-home arrangements, then hand-crank — and taste — a frozen dairy dessert. Marsh-Billings-Rockefeller National Historical Park, Woodstock, 5:30-7 p.m. Free. Info, 457-3368, ext. 222.

fairs & festivals

FARMIVAL: A family-friendly agriculture-themed jamboree is packed with games, prizes, food, barn and sugarhouse tours, live demos, and a mini market. Quarry Hill Farm, Jeffersonville, 11 a.m.-8 p.m. Free. Info, 644-5014. ORLEANS COUNTY FAIR: See WED.16. STOWE TANGO MUSIC FESTIVAL: See THU.17, 11-midnight. VERMONT STATE FAIR: See WED.16, 8-midnight.

SEVENDAYSVT.COM

film

See what’s playing at local theaters in the movies section. ‘FLIGHT OF THE BUTTERFLIES’: See WED.16. ‘MEERKATS 3D’: See WED.16. ‘MOANA’: Blankets and chairs in tow, families fix their eyes on Disney’s animated adventure about a girl who answers the ocean’s call. Battery Park, Burlington, 8-10 p.m. Free. Info, 864-0123.

SEVEN DAYS

08.16.17-08.23.17

‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: See WED.16. ‘VERMONT SPEAKS FOR ITSELF’: History buffs look back at the Green Mountain State through this 1973 social justice multimedia documentary. Live music, refreshments and a Q&A round out the evening. First Unitarian Universalist Society, Burlington, 7-9 p.m. Free. Info, jdrew@ucdavis.edu. ‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: See WED.16.

food & drink

BRANDON FARMERS MARKET: More than 50 local famers, specialty food producers and artisans offer up their goods. Central Park, Brandon, 9 a.m.-2 p.m. Free. Info, 273-2655. BURLINGTON EDIBLE HISTORY TOUR: See THU.17.

54 CALENDAR

Park, Bellows Falls, 4-7 p.m. Free. Info, greaterfallsmarket@gmail.com.

CHELSEA FARMERS MARKET: A long-standing town-green tradition supplies shoppers with eggs, cheese, vegetables and fine crafts. North Common, Chelsea, 3-6 p.m. Free. Info, 299-1280. GREATER FALLS FARMERS MARKET: Locals break out their shopping bags for fresh veggies, baked goods, salsa, hot sauce and relish. Hetty Green

MONTGOMERY FARMERS MARKET: See THU.17.

ROCHESTER’S FARMERS MARKET & EXCHANGE: Locals start the weekend right with a diverse offering of produce, eggs, meat, baked goods, crafts and music. Park Row, Rochester, 3-6 p.m. Free. Info, 353-4620. SUN TO CHEESE TOUR: Fromage fanatics go behind the scenes and follow award-winning farmhouse cheddar from raw milk to finished product. Shelburne Farms, 1:45-3:45 p.m. $18 includes a block of cheddar. Info, 985-8686. TRUCK STOP: Mobile kitchens dish out mouthwatering meals and libations. Live music and a full bar add to the fun. ArtsRiot, Burlington, 5-10 p.m. Cost of food and drink. Info, 540-0406.

kids

ACORN CLUB STORY TIME: Little ones up to age 4 gather for read-aloud tales. St. Johnsbury Athenaeum, 10:30-11:30 a.m. Free. Info, 748-8291. THE BIG BLUE TRUNK FINAL READING: Summer readers build a better world through games. Those who kept a log receive a free book and a certificate. Brownell Library, Essex Junction, 2:30-4:30 p.m. Free. Info, 878-6956. FAMILY MOVIE: Parents and tots take their seats for an all-ages flick. Brownell Library, Essex Junction, 6:30-8:30 p.m. Free. Info, 878-6956. FAMILY MUSIC TIME: Kids and caregivers lift their voices for an all-ages sing-along. Fletcher Free Library, Burlington, 10:30-11 a.m. Free. Info, 865-7216. ‘MARY POPPINS’: A drab family gets a visit from a magical nanny in this beloved musical presented by Lost Nation Theater’s elite students ages 12 and up. Montpelier City Hall Auditorium, 7 p.m. $5-15. Info, 229-0492.

SUMMER CARILLON SERIES: Bells ring out across the campus in a performance by George Matthew Jr. highlighting women composers. Mead Memorial Chapel, Middlebury College, 3 p.m. Free. Info, 443-3168.

PLAY GROUP: Crafts and snacks amuse young’uns up to age 5. Doty Memorial Elementary School, Worcester, 9:30-11 a.m. Free. Info, moonsong148@hotmail.com.

outdoors

SONGS & STORIES WITH MATTHEW: Matthew Witten helps children start the day with tunes and tales of adventure. Brownell Library, Essex Junction, 10-10:45 a.m. Free. Info, 878-6956. STORY TIME: Babies, toddlers and preschoolers drop in for books, rhymes, songs and activities. Winooski Memorial Library, 10:30-11:30 a.m. Free. Info, 655-6424.

SCAVENGER HUNT: See WED.16.

health & fitness

VERMONT LAKE MONSTERS: FR ACUDETOX: Attendees in Players from the Green Mountain I.18 F’ EL | FI S recovery undergo acupuncture T I LM State’s minor league baseball team | ‘VER M F OR ON T SPE AKS to the ear to propel detoxification. read stories and sign memorabilia. Burnham Turning Point Center, Burlington, 3 p.m. Free. Memorial Library, Colchester, 11:30 a.m.-noon. Free; Info, 861-3150. preregister. Info, 264-5660.

BUTI YOGA: See WED.16, 10 a.m. & 6-7 p.m. FITNESS FLOW YOGA: All types of athletes can build strength, increase flexibility and prevent injuries with a moderate-to-vigorous vinyasa flow. Colchester Health & Fitness, 5:30-6:30 p.m. $15; free for members. Info, 860-1010. GET OFF YOUR BUTT & HIT THE FLOOR FELDENKRAIS: Slow easy movements leave students feeling relaxed and smiling. The Wellness Collective, Burlington, 12:30-1:30 p.m. $10. Info, 540-0186. RECOVERY COMMUNITY YOGA: See WED.16. REFUGE RECOVERY: A LOVE SUPREME: Buddhist philosophy is the foundation of this mindfulnessbased addiction recovery community. Turning Point Center, Burlington, noon. Free. Info, 861-3150. STRAIGHT TO THE POINT ON LYME DISEASE: Medical professionals present a review of conventional and natural therapies for prevention and management of the tick-borne illness. Health Integrative PLC, South Burlington, 5:30-7 p.m. Free. Info, 233-6392. SUNSET YOGA: Participants at all levels wind down with calming breath work and a slow flow on the studio roof. Sangha Studio North, Burlington, 7-8 p.m. $10-15; free for members. Info, 448-4262. TAI CHI: Instructor Shaina shares the fundamentals of Yang Style, including standing and moving postures. Zenbarn Studio, Waterbury, 9-10 a.m. Donations. Info, studio@zenbarnvt.com. YOGA ON THE DOCK: See WED.16.

PEACHAM ACOUSTIC MUSIC FESTIVAL: Celtic traditions, old-time fiddle tunes, blues and bluegrass intertwine at this bucolic bash featuring a band scramble, jam sessions, workshops and more. Various Peacham locations, 2 p.m. $15-90. Info, 748-2600.

JUNIOR RANGER ROUNDUP: See WED.16.

BRIDGE CLUB: See WED.16, 9:15 a.m.

BONE BUILDERS: See WED.16, 7:30-8:30 a.m.

OLD MOZO DAYS: DEL & DAWG, SONGS & STORIES: Longtime collaborators Del McCoury and David Grisman unleash a unique collection of bluegrass classics on the green behind the lodge. Stowe Mountain Lodge, 7 p.m. $30. Info, 760-4634.

‘THE QUEEN’S DELIGHT: ELIZABETHAN MUSIC FOR VOICE AND RECORDER’: William Byrd’s famous masses are on a vocal and instrumental period program. Unitarian Church of Montpelier, 7:30-9:30 p.m. $20. Info, 223-0687.

games

ADVANCED TAI CHI CLASS: Folks keep active with a sequence of slow, controlled movements. Twin Valley Senior Center, East Montpelier, 1-2 p.m. Free. Info, 223-3322.

music. Axel’s Gallery & Frame Shop, Waterbury, 6-9 p.m. Free. Info, 224-7801.

music

Find club dates in the music section. BLUEGRASS & BARBECUE: Hard Scrabble entertain revelers, who feast on Bluebird Barbecue fare and Fisher Brothers Farm ice cream. Shelburne Vineyard, 6-8 p.m. Cost of food and drink. Info, 985-8222. BOB DEGREE & THE BLUEGRASS STORM: Blazing instrumentals propel original and well-known numbers. No pets, please. Lincoln Peak Vineyard, New Haven, doors open for picnicking, 5:30 p.m.; concert, 6 p.m. Free. Info, 388-7368. BRIAN MCCARTHY NONET: In his nine-piece chamber jazz ensemble, the saxophonist explores popular songs of the American Civil War in the program “The Better Angels of Our Nature.” Highland Center for the Arts, Greensboro, 7 p.m. $10-25. Info, 533-9075. CARTON: The Windsor-based rockers turn up the volume as part of the Exhibitionists Summer Music Series. Amy E. Tarrant Gallery, Burlington, 5 p.m. Free; cash bar. Info, 863-5966. CENTRAL VERMONT CHAMBER MUSIC FESTIVAL: FRIDAY NIGHT IN THE GALLERY: A bow-and-string symposium serves up a Q&A with instrument makers, music by festival artists and a discussion about tools of the trade. Chandler Center for the Arts, Randolph, 7 p.m. Donations. Info, 728-6464. CITY HALL PARK SUMMER CONCERTS: NUTRIA: Collective improvisation drives this instrumental trio. Burlington City Hall Park, noon. Free. Info, 865-7166. FREVO: Four Vermont musicians find common ground in spirited works by Astor Piazzola, the Beatles and others. Grace Episcopal Church, Sheldon, 7:30-9:30 p.m. Donations. Info, 849-6900. MUSIC IN THE ALLEY: TURNMUSIC: Area musicians put a contemporary spin on classical chamber

CLIMATE ADAPTATION IN THE NORTHWOODS DEMONSTRATION FOREST: This tour of a 1,473-acre forest focuses on climate-adapted silviculture and management. Northwoods Stewardship Center, East Charleston, 9:30 a.m.-2:30 p.m. Free; preregister. Info, 723-6551, ext. 302. FROGGER!: Learn to recognize slippery, bumpy amphibians by sight and sound. A-Side Beach parking lot, Little River State Park, Waterbury, 6:30 p.m. $2-4; free for kids 3 and under; preregister. Info, 244-7103. ROCKIN’ THE LITTLE RIVER: TOUR OF THE WATERBURY DAM: Visitors explore a reforested encampment and discover how the Civilian Conservation Corps saved the Winooski Valley from flooded ruin. Meet at the top of the Waterbury Dam, Little River State Park, Waterbury, 11 a.m. $2-4; free for kids 3 and under; preregister; call to confirm. Info, 244-7103.

seminars

MAGICAL PICNIC & WORKSHOP: After lunch, Rob Mermin teaches the young and the young at heart to dazzle friends and family with tricks and stunts. Highland Center for the Arts, Greensboro, 1-3 p.m. $20; free for kids under 10; preregister. Info, 533-9075.

sports

KILLINGTON DIVAS OF DIRT: Female mountain bikers of all ability levels share their passion for the sport at biweekly group rides and happy hours. Killington Bike Park, Killington Resort, 4-6 p.m. $20 for lift ticket; $39 for lift ticket and bike rental. Info, 422-6232. RUN TO REMEMBER FUN RUN: Joggers and walkers make strides for SUNY Plattsburgh’s Third Age Adult Day Center. Plattsburgh City Recreation Center, N.Y., kids’ run/walk, 6:30 p.m.; 5K run, 7 p.m. $5-20. Info, runtoremember10@gmail.com. TIM’S HOUSE GOLF CLASSIC: Players hit the links to benefit emergency shelter and transitional housing for people in Franklin and Grand Isle counties. Steve Gagner, Matt Kehaya and Andrea Gagner of 14th Star Brewing are recognized for their community service during a luncheon. Champlain Country Club, Swanton, 8 a.m.-4 p.m. $100-1,000; $15 for lunch; preregister. Info, 527-0847. THE VERMONT CHALLENGE: See THU.17.

talks

DOUGLAS BROOKS: The speaker launches into “An Apprentice Boat Builder in Japan,” a talk about his experiences constructing vessels. A 5:30 p.m. reception at GreenTARA Gallery precedes the lecture. North Hero Public Library, 7-8:30 p.m. Free. Info, 355-2150. TED TIME: Curious minds watch TED Talk videos, then discuss world issues. Champlain Senior Center, McClure Multigenerational Center, Burlington, 12:40 p.m. Free. Info, 658-3585.

LIST YOUR EVENT FOR FREE AT SEVENDAYSVT.COM/POSTEVENT

‘BASIC BYE-BYE’: Subversive storylines thread through a new show by Bread and Puppet Theater. Bread and Puppet Theater, Glover, 7:30 p.m. $10. Info, 525-3031. ‘BUYER & CELLAR’: See WED.16. ‘THE CHARITY THAT BEGAN AT HOME’: See THU.17. CIRCUS SMIRKUS BIG TOP TOUR: See WED.16. ‘THE GATES OF UNFINISHED LIFE’: Primitive puppets and masked players are the stars of an offbeat performance. Bread and Puppet Theater, Glover, 7:30 p.m. $10. Info, 525-3031. ‘HAPPY DAYS’: See THU.17. ‘THE LEGEND OF GEORGIA MCBRIDE’: See WED.16, 7:30-9:30 p.m. ‘THE MUSIC MAN’: See WED.16, 7:30 p.m. ST. JOHNSBURY PLAYERS 80TH ANNIVERSARY REVUE: See THU.17. ‘THE TAFFETAS’: See THU.17, 8 p.m. ‘THE TARNATION OF RUSSELL COLVIN’: Local history comes alive in actor Oliver Wadsworth’s oneman portrayal of an unsolved Manchester murder from 1812. Vermont Coffee Company Playhouse, Middlebury, 7:30-8:45 p.m. $12. Info, 382-9222. TENFEST: See THU.17. ‘THE TIME OF YOUR LIFE’: The Greensboro Arts Alliance and Residency and the Mirror Repertory Company have audience members in stitches with William Saroyan’s 1938 Pulitzer Prize-winning comedy. Greensboro United Church of Christ, 7:30 p.m. $10-25. Info, 535-9479.

CARS & COFFEE UPPER VALLEY: Auto enthusiasts talk shop over cups of joe while checking out rides ranging from motorcycles to Teslas. Weather permitting. The Tuckerbox, White River Junction, 8-11 a.m. Free. Info, adam@adamchandler.me.

LEGAL CLINIC: Attorneys offer complimentary consultations on a first-come, first-served basis. 274 N. Winooski Ave., Burlington, 10 a.m.-noon. Free. Info, 383-2118. LITTLE WOOF SMALL DOG RESCUE ADOPTION EVENT: Animal lovers learn about volunteer opportunities and meet furry friends looking for forever homes. Orvis, Essex Junction, noon-3 p.m. Free. Info, littlewoofvt@gmail.com. RUSSIANS ARE HERE!: An annual Pan-Slavic celebration includes a visual art show and a feast. Main Street Museum, White River Junction, 6-8 p.m. $2-20. Info, 356-2776.

SAT.19

VERMONT OPEN FARM WEEK: See WED.16.

art

Find visual art exhibits and events in the art section.

bazaars

GARAGE SALE: Bargain hunters bag gently used items for adults and kids. St. Alphonsus Ligouri Church, Pittsford, 8 a.m.-2 p.m. Free. Info, 483-2301.

community

QUEEN CITY MEMORY CAFÉ: People with memory loss accompany their caregivers for coffee, conversation and entertainment. Thayer House, Burlington, 10 a.m.-noon. Free. Info, 656-4220.

COMMUNITY BALLROOM DANCE SOCIAL: Twinkle-toed movers celebrate the art of dance by learning new steps and perfecting their footwork. Shelburne Town Hall, 6:30-11 p.m. $10-15. Info, usadancevt@gmail.com. ‘STOP/SLOW (A FLAGGER’S LAMENT)’: Jean Taylor’s choreography communicates a woman’s boredom, panic and joy on a new job. Phantom Theater, Edgcomb Barn, Warren, 8 p.m. $15. Info, 496-5997.

6h_killington_CITM0819.indd 1

7/20/17 12:06 PM

Earn rewards for Back to School shopping with a NorthCountry Visa!

UVM HISTORIC TOUR: Professor emeritus William Averyt references architectural gems and notable personalities on a walk through campus. Ira Allen statue. University Green, University of Vermont, Burlington, 10 a.m.-noon. Free. Info, 656-8673.

fairs & festivals

ARTS & CRAFT FESTIVAL: Creative folk come together for demonstrations, juried shows, chainsaw carving and kids’ activities with the Society of Vermont Artists and Craftsmen. Fletcher Farm School for the Arts & Crafts, Ludlow, 10 a.m.-4 p.m. Free. Info, 228-8770. BROWNSTOCK OUTDOOR MUSIC FESTIVAL: Merrymakers move and groove to tunes by the likes of Gerry Grimo & the East Bay Jazz Ensemble and Michael Veitch. Field games, food and local libations lend to the fun. Ascutney Trails, West Windsor, 1-6 p.m. $10-25; free for kids 14 and under. Info, 245-4231. FARMIVAL: See FRI.18. ORLEANS COUNTY FAIR: See WED.16, 8:30 a.m. STOWE TANGO MUSIC FESTIVAL: See THU.17, 11 a.m. VERMONT NANOBREWERY FESTIVAL: Suds lovers meet brewers from small-scale operations while enjoying bluegrass bands and food-truck fare. Tunbridge World’s Fairgrounds, noon-6 p.m. $10; additional cost for beer tickets. Info, 685-4838. VERMONT STATE FAIR: See WED.16, 8-midnight. WEIRDO FEST: An eclectic extravaganza offers blindfolded face-painting, random information booths, swimming and off-the-wall activities. Onion River Campground, Plainfield, 3 p.m. Free. Info, 229-2090.

Rates as low as 7.45% apr* Use your NorthCountry Visa for back to school shopping and earn reward points for every dollar you spend! Reward points are redeemable for cash back, gift cards, merchandise, and travel. You’ll also get a rate as low as 7.45% apr,* no annual fee, local service, and online access to your account. *Your actual rate will be determined by your credit qualifications. APR=Annual Percentage Rate. Visa Platinum rates were as low as 7.45% APR at time of print and may have changed. To verify the rate for which you qualify, please call.

film

See what’s playing at local theaters in the movies section. ‘FLIGHT OF THE BUTTERFLIES’: See WED.16. ‘MEERKATS 3D’: See WED.16.

BIKE & BREW TOUR: See FRI.18. SAT.19

» P.56

www.northcountry.org Untitled-1 1

Federally insured by NCUA

(800) 660-3258 8/14/17 10:01 AM

CALENDAR 55

etc.

TOWN OF

SEVEN DAYS

dance

Rain or Shine | DiscoverKillington.com

08.16.17-08.23.17

CATAMOUNT STADIUM TRACK WALK: Race fans motor down memory lane at the former stadium site, where Slippeddisk DJ Services spin tunes from times past. Catamount Dr., Milton, 10 a.m.-2 p.m. Free. Info, 363-2598.

SEVENDAYSVT.COM

FLEA MARKET: Eclectic used items vie for spots in shoppers’ totes. Farr’s Field, Waterbury, 7 a.m.-5 p.m. Free. Info, 882-1919.

Southern Avenue

INDEPENDENT COMMUNITY MEETING PLACE: Brainstorming leads to forming activity groups for hobbies such as flying stunt kites and playing music. Presto Music Store, South Burlington, 10 a.m.-noon. Free. Info, 658-0030.

SOFTBALL TOURNAMENT & BARBECUE: Festivities including live music, sports and mouthwatering eats welcome returning military service members and their families. Maxfield Sports Complex, White River Junction, 9 a.m. Free. Info, 802-295-9363, ext. 5880.

KINGDOM FARM & FOOD DAYS: See FRI.18.

Saturdays, 3:30 pm at Killington Resort's Adventure Center

GUIDED TOURS: See WED.16.

words

agriculture

Concert Series

GHOST WALK: DARKNESS FALLS: See FRI.18.

SAILORBRATION!: Community Sailing Center friends, campers, staff and volunteers paddle and play at an end-of-season sendoff. Community Sailing Center, Burlington, 10 a.m.-3 p.m. Free. Info, 864-2499.

BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: See WED.16.

COOLER IN THE MOUNTAINS

CARS & COFFEE VERMONT: Fueled by petrol, caffeine and passion, automobile aficionados gather to talk cars and make new friends. University Mall, South Burlington, 7-9 a.m. Free. Info, carscoffeevermont@gmail.com.

Aug

theater

FREE

calendar SAT.19

« P.55

SATURDAY NIGHT MOVIE: Film buffs munch on Sisters of Anarchy ice cream and other local fare while taking in a flick. Bring blankets or chairs. Fisher Brothers Farm, Shelburne, food sales begin at 5:30 p.m.; movie, 6:30 p.m. Free. Info, 735-0005. ‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: See WED.16. WALK-IN MOVIES: Film-loving families sprawl out under the stars for an outdoor viewing experience. Bring a blanket! Community Green Space, Rutland, 8:30-10:30 p.m. Free. Info, 438-2303. ‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: See WED.16.

food & drink

BREAKFAST BUFFET: A scrumptious buffet-style spread offers scrambled eggs, vegetable quiche, home fries and onions, baked beans, ham, cornbread, fruit salad, and beverages. Isle of Patmos Masonic Lodge, South Hero, 7:30-11:30 a.m. $5-10; free for kids 2 and under; preregister for takeout. Info, 777-6316. BRUNCH & BOWL: Families hit the lanes to topple pins and nosh from an à la carte menu. A buildyour-own Bloody Mary bar keeps grown-ups in good spirits. Stowe Bowl, 11 a.m.-2 p.m. $9.99-14.99. Info, 253-2494. BURLINGTON EDIBLE HISTORY TOUR: See THU.17. BURLINGTON FARMERS MARKET: Dozens of stands overflow with seasonal produce, flowers, artisan wares and prepared foods. Burlington City Hall Park, 8:30 a.m.-2 p.m. Free. Info, burlingtonfarmersmarket.org@gmail.com. CAPITAL CITY FARMERS MARKET: Meats and cheeses join farm-fresh produce, baked goods, and locally made arts and crafts. 60 State Street, Montpelier, 9 a.m.-1 p.m. Free. Info, 793-8347. CHAMPLAIN ISLANDS FARMERS MARKET: Baked items, fresh produce, meats and eggs sustain seekers of local goods. Grand Isle St. Joseph’s Church, 10 a.m.-2 p.m. Free. Info, champlainislandsfarmersmkt@gmail.com.

56 CALENDAR

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

CHOCOLATE TASTING: With the help of a tasting guide, chocoholics of all ages discover the flavor profiles of four different confections. Lake Champlain Chocolates Factory Store & Café, Burlington, 11 a.m.-4 p.m. Free. Info, 864-1807. CRAFTSBURY FARMERS MARKET: Food, drink, crafts and family-friendly entertainment are on the menu at an emporium of local merchandise. Craftsbury Common, 10 a.m.-1 p.m. Free. Info, 922-1771. ‘DOWNTON ABBEY’-INSPIRED DINNER & ETIQUETTE TALK: Fans of the PBS series nosh on a four-course spread while learning to manage an Edwardian meal from soup to nuts. Governor’s House in Hyde Park, 6:30 p.m. $47.50; preregister. Info, 888-6888. ‘DOWNTON ABBEY’-INSPIRED TEA & ETIQUETTE TALK: Participants nosh on sandwiches, sweets and scones while taking notes on Edwardian manners. Governor’s House in Hyde Park, 3 p.m. $22; preregister. Info, 888-6888. MIDDLEBURY FARMERS MARKET: See WED.16. MONTGOMERY FARMERS MARKET: See THU.17. NEWPORT FARMERS MARKET: See WED.16. NORTHWEST FARMERS MARKET: Locavores stock up on produce, preserves, baked goods, ethnic foods, and arts and crafts. Taylor Park, St. Albans, 9 a.m.-2 p.m. Free. Info, alavista@myfairpoint.net. NORWICH FARMERS MARKET: Neighbors discover fruits, veggies and other riches of the land offered alongside baked goods, crafts and live entertainment. Route 5, Norwich, 9 a.m.-1 p.m. Free. Info, 384-7447. RANDOLPH FARMERS MARKET: Locavores support area purveyors who proffer seasonal foodstuffs and arts and crafts. Gifford Green, Gifford Medical Center, Randolph, 9 a.m.-1 p.m. Free. Info, randfarmmarket@yahoo.com. SHELBURNE FARMERS MARKET: Harvested fruits and greens, artisan cheeses, and local novelties

grace outdoor tables. Shelburne Town Center, 9 a.m.-1 p.m. Free. Info, 482-4279.

Philo Ridge Farm, Charlotte, 9:30-11:30 a.m. $5; preregister. Info, 539-2912.

Performing Arts Center, Stowe Mountain Resort, 8 p.m. $20-35. Info, 760-4634.

ST. JOHNSBURY FARMERS MARKET: Growers and crafters gather weekly at booths centered on local eats. Anthony’s Diner, St. Johnsbury, 9 a.m.-1 p.m. Free. Info, cfmamanager@gmail.com.

SATURDAY DROP-IN STORY TIME: A weekly selection of songs and story lines engages all ages. Burnham Memorial Library, Colchester, 10-10:30 a.m. Free. Info, 264-5660.

THREE DOG NIGHT: Hits such as “Joy to the World” inspire smiles as part of the outdoor Stratton Mountain Music series. Stratton Mountain Resort, 6-7:30 p.m. $25-30. Info, 800-787-2886.

VERMONT FARMERS MARKET: See WED.16, 9 a.m.-2 p.m.

STORY TIME SATURDAY: Tykes sit tight for The Very Berry Counting Book by Jerry Pallotta, then get their fill of themed healthy foods. Phoenix Books, Burlington, 11 a.m.-noon. Free. Info, 861-9753.

outdoors

WAITSFIELD FARMERS MARKET: A bustling bazaar boasts seasonal produce, prepared foods, artisan crafts and live entertainment. Mad River Green, Waitsfield, 9 a.m.-1 p.m. Free. Info, waitsfieldmarketmanager@gmail.com. WINDSOR FARMERS MARKET: Locavores go wild for fruits, veggies, maple syrup, honey, eggs, meats, crafts and more. 51 Main St., Windsor, 11 a.m.-2 p.m. Free. Info, 359-2551.

games

SCAVENGER HUNT: See WED.16.

health & fitness

BACKYARD BOOT CAMP: Ma’am, yes, ma’am! Exercise expert Ginger Lambert guides active bodies in an interval-style workout to build strength and cardiovascular fitness. Private residence, Middlebury, 8-9 a.m. $12. Info, 343-7160.

WHOLE-BOOK APPROACH STORY TIME: Tots learn how words, pictures and book design work together to complete a narrative. Phoenix Books, Essex, 11 a.m. Free. Info, 872-7111.

language

SA T.1 9

| MU

music

seminars

BEN & JANICE LUCE: A multimedia presentation about the New Mexico landscape accompanies excerpts from the duo’s new release The Desert Suite. MAC Center for the Arts, Newport, 5-7 p.m. Free. Info, 334-1966.

OOIE’S JAZZ EN

R.I.P.P.E.D.: Resistance, intervals, power, plyometrics, endurance and diet define this high-intensity physical-fitness program. North End Studio A, Burlington, 9-10 a.m. $10. Info, 578-9243. YIN YOGA: Students hold poses for several minutes to give connective tissues a good stretch. Zenbarn Studio, Waterbury, 8-9:30 a.m. Donations. Info, studio@zenbarnvt.com.

kids

CENTRAL VERMONT CHAMBER MUSIC FESTIVAL: CONCERT FOR KIDS: Mini musicians keep the beat in a steel-drum seminar that culminates with a performance. Chandler Center for the Arts, Randolph, 10:30 a.m. $6; preregister; limited space. Info, 728-6464. ‘A CHRISTMAS STORY: THE MUSICAL’ CHILDREN’S AUDITIONS: Child performers try out for Lyric Theatre’s production of the classic story about a boy growing up in the 1940s whose holiday hopes repeatedly fall short. Call for details. Fusion 802 Dance, South Burlington, 8 a.m.-noon. Free. Info, 658-1484. GRACE EXPLORATION PLACE FOR CHILDREN: A pancake breakfast prepares pupils for Biblethemed stories, songs, crafts and games. Grace United Methodist Church, Essex Junction, 8:3010:30 a.m. Free; preregister. Info, 878-8071. JUNIOR RANGER ROUNDUP: See WED.16. KIDS’ PIRATE FESTIVAL: Costumed tots have a swashbuckling good time with themed activities, shows, sing-alongs and a live stage show. Lake Champlain Maritime Museum, Vergennes, 9 a.m.-5 p.m. $10-15; free for kids 3 and under. Info, 475-2022. ‘MARY POPPINS’: See FRI.18, 3 & 7 p.m. MORNING MUSIC FOR LITTLE FARMERS: Julia Wayne and Katie Trautz of Mayfly strike a chord with youngsters who explore farm animals, vegetables, soil and more through song and play.

WATERFRONT ARCHITECTURE WALKING TOUR: Burlington’s history and building design come alive through guided strolls with Preservation Burlington representatives. ECHO Leahy Center for Lake Champlain, Burlington, 10-11:30 a.m. $10. Info, info@preservationburlington.org. WORCESTER RIDGE HIKE: Outdoor adventurers tackle a difficult hike covering 11 miles of ground and gaining 3,000 miles in elevation. Contact trip leader for details. Free; preregister; limited space. Info, 899-9982.

Find club dates in the music section.

SIC | C

MUSHROOMS DEMYSTIFIED: See THU.17.

DUTCH LANGUAGE CLASSES: Planning a trip to Amsterdam? Learn vocabulary and grammar basics from a native speaker. Fletcher Free Library, Burlington, 10-11:30 a.m. Free. Info, 865-7211.

BENEFIT YOGA CLASS: A hatha flow class for all levels supports the Peace and Justice Center. Laughing River Yoga, Burlington, 2-3:15 p.m. $10. Info, 343-8119. PADDLEBOARD: WINOOSKI RIVER RUN: Experienced guides lead an 8-mile aquatic excursion for families and small groups complete with lunch catered by the Spot. WND&WVS, Burlington, 9:30 a.m.-2:30 p.m. $85. Info, 540-2529.

THE MAGIC OF BIRD MIGRATION: See WED.16.

SE M

BLE

CENTRAL VERMONT CHAMBER MUSIC FESTIVAL: CHAMBER JAZZ: World-class jazz and chamber artists join forces for a concert of music from both genres and a mixture of the two. Chandler Center for the Arts, Randolph, 7:30 p.m. $25 for one concert; $45 for two; free for students. Info, 728-6464.

CIDERSTOCK: Hard cider, tasty fare and hot tunes from the Roots, Pepper, Tribal Seeds and the Welterweights make for a sizzling summer soirée. The Woodchuck Cidery, Middlebury, 2-10 p.m. $35. Info, 388-0700. COOIE’S JAZZ ENSEMBLE: Twentieth-century classics such as “As Time Goes By” and “Unforgettable” find eager ears. Brandon Music, 7:30 p.m. $20; $45 includes package; preregister; BYOB. Info, 247-4295. LAKE CHAMPLAIN CHAMBER MUSIC FESTIVAL: OPENING DAY: The annual musical merriment kicks off with a string masterclass, a conversation, a violin performance and a reception. See lccmf.org for details. Elley-Long Music Center, Saint Michael’s College, Colchester, 10 a.m. $20; free for kids under 18. Info, 863-5966. MUSIC FOR A SUMMER NIGHT: Soprano Victoria Cole and pianist Sergey Marchukov present a concert featuring works by Prokofiev, Schumann and Rimsky-Korsakov. United Community Church South Building, St. Johnsbury, 7:30 p.m. $10; free for kids. Info, 603-728-7022. NORTHEAST FIDDLERS ASSOCIATION MEETING: Lovers of this spirited art form gather to catch up and jam. Private residence, East Randolph, noon-5 p.m. Free; donations of nonperishable food items accepted. Info, 728-5188.

ESSENTIAL OILS 101: The Mindful Oiler, Tara Cariano, covers the healing properties of elixirs and tinctures. Waterbury Public Library, 9:30-11 a.m. Free; preregister. Info, 244-7036. LIGHTEN YOUR LOAD: DECLUTTERING WORKSHOP: Maxine Gautier outlines organizing techniques for tackling daunting messes in the home or office. Fairfax Community Library, 11 a.m.12:30 p.m. Free; preregister. Info, 849-2420. VCAM ORIENTATION: Video-production hounds master basic concepts and nomenclature at an overview of VCAM facilities, policies and procedures. VCAM Studio, Burlington, 11 a.m. Free. Info, 651-9692.

sports

DIAMOND ISLAND REGATTA: Sailors cut across the water to support the Lake Champlain Maritime Museum. A lobster dinner follows. Point Bay Marina, Charlotte, breakfast, 8:30 a.m.; captain’s meeting, 9:30 a.m.; race, 11 a.m. Free; $25-30 for Lobster Fest. Info, kochboats@gmail.com. LEAF PEEPERS HALF-MARATHON TRAINING SERIES: Runners make strides in a 10-week program with an experienced coach. Onion River Sports, Montpelier, 8 a.m. $50; preregister. Info, 229-9409. UNDER ARMOUR MOUNTAIN RUNNING SERIES: Seven race events ranging from 5K to 50K offer athletes from near and far varying courses, challenges and views. See calendar spotlight. Killington Resort, 8 a.m. $50-199. Info, support@uamountainrunning.com. THE VERMONT CHALLENGE: See THU.17.

talks

NANCY BUDD: From fossils and ancient reefs to old forts, the paleontologist digs deep into Champlain Valley history. Crown Point State Historic Site, N.Y., 10 a.m.-12:30 p.m. $10; free for students and kids under 18; preregister. Info, 518-962-2287. NILS SHENHOLM: There’s no hot air during the Vermont sauna designer’s photo-based presentation on the culture and therapeutic value of the Finnish sauna. Warren Public Library, 1 p.m. Free; preregister; limited space. Info, 244 6460.

theater

PEACHAM ACOUSTIC MUSIC FESTIVAL: See FRI.18, 9 a.m.

‘BUYER & CELLAR’: See WED.16, 2 & 7:30 p.m.

‘THE QUEEN’S DELIGHT: ELIZABETHAN MUSIC FOR VOICE AND RECORDER’: See FRI.18, First United Methodist Church, Burlington. $10-20.

‘HAPPY DAYS’: See THU.17.

SOUTHERN AVENUE: A fiery Memphis quintet turns heads with soul, blues and gospel sounds served as part of the Cooler in the Mountains concert series. Snowshed Base Area, Killington Resort, 3:30 p.m. Free. Info, 800-734-9435. STOWE TANGO MUSIC FESTIVAL IN CONCERT: South American traditions enliven the Green Mountain State in this song-and-dance spectacular featuring a 30-piece orchestra. Spruce Peak

‘THE CHARITY THAT BEGAN AT HOME’: See THU.17. ‘THE LEGEND OF GEORGIA MCBRIDE’: See WED.16. ‘THE MUSIC MAN’: See WED.16. NEW YORK THEATRE WORKSHOP: ‘DAR HE: THE LYNCHING OF EMMETT TILL’: Mike Wiley’s play-in-progress chronicles the murder, trial and unbelievable confession of the men accused of lynching a 14-year-old black boy in 1955. Warner Bentley Theater, Hopkins Center for the Arts, Dartmouth College, Hanover, N.H., 4 p.m. $6.50-13. Info, 603-646-2422.

LIST YOUR EVENT FOR FREE AT SEVENDAYSVT.COM/POSTEVENT

NEW YORK THEATRE WORKSHOP: ‘THIS EXQUISITE CORPSE’: A Korean woman struggles to adjust to her new life in New Jersey in a developing work by playwright Mia Chung. Warner Bentley Theater, Hopkins Center for the Arts, Dartmouth College, Hanover, N.H., 7:30 p.m. $6.50-13. Info, 603-646-2422. ST. JOHNSBURY PLAYERS 80TH ANNIVERSARY REVUE: See THU.17, 2 p.m. ‘THE TAFFETAS’: See THU.17, 3 p.m. TENFEST: See THU.17. ‘THE TIME OF YOUR LIFE’: See FRI.18. VERMONT BURLESQUE FESTIVAL’S HOT SUMMER SHOWCASE: Montréal’s Scarlett James is among the titillating performers to strut their stuff during “A Mid Summer’s Tease.” See calendar spotlight. ArtsRiot, Burlington, 8:30 p.m. $20-25; for ages 18 and up. Info, 540-0406.

words

BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: See WED.16. POETRY EXPERIENCE: Rajnii Eddins facilitates a poetry and spoken-word workshop aimed at building confidence and developing a love of writing. Fletcher Free Library, Burlington, 1-3 p.m. Free. Info, 865-7211.

SUN.20

agriculture

HIGH MOWING OPEN FIELD DAY: Friends and neighbors get their fill of workshops, tours, woodfire pizza, music, kids’ activities and Vermont-made products. High Mowing Organic Seeds, Wolcott, noon-6 p.m. Free. Info, 866-735-4454. KINGDOM FARM & FOOD DAYS: See FRI.18. TOUR OF MODERN DAIRY WITH ROBOTIC MILKERS: Get a mooove on! Attendees meet cows and witness equipment in action on an agricultural tour. Lambert Farm, Graniteville, 1-3 p.m. Free; preregister. Info, 262-1222. VERMONT OPEN FARM WEEK: See WED.16.

art

Find visual art exhibits and events in the art section.

FLEA MARKET: See SAT.19.

community

COMMUNITY MINDFULNESS WITH THE CENTER FOR MINDFUL LEARNING: Peaceful people gather for guided meditation and interactive discussions. Burlington Friends Meeting House, 5-7 p.m. $10. Info, assistant@centerformindfullearning.org.

dance etc.

CO-OP SUMMER PARTY: Fun for all includes music, kids’ activities, free chair massages and a wine tasting. See hungermountain.coop for details. Hunger Mountain Co-op, Montpelier, 10 a.m.-6:45 p.m. Free. Info, info@hungermountain.coop. GUIDED TOURS: See WED.16.

fairs & festivals

See what’s playing at local theaters in the movies section. ‘FLIGHT OF THE BUTTERFLIES’: See WED.16.

SINGLE ADULT $99

~ 2 Swimming Pools ~ Club House Café & Bar

‘MEERKATS 3D’: See WED.16. MOVIES IN THE RED BARN: Cinephiles view favorite flicks. A full bar and dinner service are available. Call for film info and reservations. Mary’s Restaurant, Bristol, 7-9 p.m. Free. Info, 902-453-2432.

~ Landscaped setting

‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: See WED.16.

~ Weekly special 6 oz. Burgers $6.95

‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: See WED.16.

~ Poolside 16oz Frozen Margaritas $5.95

ADULT DAY PASS $10 includes a VT BEER OR 9 oz GLASS OF WINE

Sign-up for $99 membership at quarryhillclub.com!

food & drink

The Summer Place, 259 Quarry Hill Road, South Burlington

BRUNCH & BOWL: See SAT.19. CHOCOLATE TASTING: See SAT.19. COMMUNITY DAY: Diners clean their plates to raise coin for the Pride Center of Vermont. Partial proceeds are donated. Leunig’s Bistro & Café, Burlington, 9 a.m.-10 p.m. Cost of food and drink. Info, 863-3759.

6h-quarryhillclub080217.indd 1

8/1/17 11:06 AM

ICE CREAM SOCIAL: CELEBRATING 30 YEARS OF THE MUSEUM: Sweets lovers spoon up frozen dairy treats served alongside door prizes, games and activities. Birds of Vermont Museum, Huntington, 2-4 p.m. Donations. Info, 434-2167. NORTH AMERICAN THREE SISTERS CELEBRATION FARM-TO-TABLE DINNER: Corn, beans and squash are the featured ingredients in a palate-pleasing meal. Ariel’s Restaurant, Brookfield, 5-9 p.m. $68; preregister; limited space. Info, info@floatingbridgefoodandfarms.com. RIVERSIDE GRANGE COMMUNITY FARMERS MARKET: A vibrant group of vendors deals in produce, eggs, cut flowers, handcrafted soap, wool products, baked goods and maple creations. Riverside Grange Hall, West Topsham, 11 a.m.-3 p.m. Free. Info, hgb111@rocketmail.com. STOWE FARMERS MARKET: An appetizing assortment of fresh veggies, meats, milk, berries, herbs, beverages and crafts tempts shoppers. Red Barn Shops Field, Stowe, 10:30 a.m.-3 p.m. Free. Info, 279-3444. VIKING BLACK BREADS DEMO: Budding bakers make hearty loaves with Groennfell Meadery’s Ricky Kline. Fletcher Room, Fletcher Free Library, Burlington, 3 p.m. Free. Info, 865-7211.

EVENTS EVENTS ON ON SALE SALE NOW! NOW THIS WE E K THURS., AUG 17 HEALTH HERO FARM, SOUTH HERO

GAMES PARLOUR: Strategic thinkers bring favorite tabletop competitions to play with others. Champlain Club, Burlington, 2-8 p.m. $5. Info, orsonbradford@gmail.com. POKÉMON LEAGUE: See THU.17, noon-5 p.m. SCAVENGER HUNT: See WED.16.

SAT., AUG 19 ARTSRIOT, BURLINGTON

THIS WE E K Refugee Outreach Club Fundraiser

WINOOSKI FARMERS MARKET: Area growers and bakers offer prepared fare, assorted produce and agricultural products. Champlain Mill Green, Winooski, 10 a.m.-2 p.m. Free. Info, info@downtownwinooski.org.

games

Vermont Burlesque Festival’s Hot Summer Showcase

Pizza Social

FRI., AUG 18 ARTSRIOT, BURLINGTON

THIS WE E K $25 Paint & Sip A Throw Pillow SAT., AUG 19 THE COLCHESTER MEAD HALL

health & fitness

TRADITIONAL YOGA FLOW: Breath accompanies each transition during a vinyasa flow focused on body awareness and self acceptance. Zenbarn Studio, Waterbury, 9-10:15 a.m. Donations. Info, 244-8134.

kids

‘A CHRISTMAS STORY: THE MUSICAL’ CHILDREN’S AUDITIONS: See SAT.19, 8 a.m.-noon & 1-5 p.m. KIDS’ HIP-HOP DANCE CLASS: Young hoofers learn a short sequence to Pharrell’s song “Happy.”

SUN.20

» P.58

Burlington Tree Tours

THIS WE E K

SUN., AUG 20 THE MOUNTED CAT PATIO (OUTSIDE OF HILTON BURLINGTON)

Stowe Food & Wine Classic SUN., AUG 27 TOPNOTCH RESORT MOUNTAIN VIEW PAVILION

SELLING TICKETS?

WE CAN HELP!

• • • • •

• No cost to you • Local support

Fundraisers Festivals Plays Sports Concerts

THIS WE E K

• Built-in promotion • Custom options

MADIE AHRENS 865-1020 ext. 10 tickets@sevendaysvt.com

CALENDAR 57

BARBECUE BONANZA: All-you-can-eat barbecue fare fuels families for an evening of live local music, hayrides, lawn games, kids’ activities, a giant bonfire and a mechanical bull. Basin Harbor, Vergennes, 4-9 p.m. $15-40; free for kids 5 and under. Info, 863-5966.

film

ill

H at Quarry

SEVEN DAYS

MOUNT INDEPENDENCE-HUBBARDTON MILITARY ROAD CAR TOUR: History buffs shift into gear for a driving excursion to explore a section of military road. Hubbardton Battlefield State Historic Site, 12:30-3:30 p.m. $3; free for kids under 15. Info, 273-2282.

STOWE TANGO MUSIC FESTIVAL: See THU.17, 11 a.m.-6 p.m.

l l i h C

08.16.17-08.23.17

‘STOP/SLOW (A FLAGGER’S LAMENT)’: See SAT.19.

ORLEANS COUNTY FAIR: See WED.16, 10 a.m.

SEVENDAYSTICKETS.COM 3v-tickets081617.indd 1

SEVENDAYSVT.COM

bazaars

FARMIVAL: See FRI.18.

8/15/17 3:06 PM

calendar SUN.20

« P.57

Brookfield Old Town Hall, 3-4:30 p.m. Free; preregister. Info, 276-3181. KIDS’ PIRATE FESTIVAL: See SAT.19. ‘MARY POPPINS’: See FRI.18, 11 a.m. & 3 p.m. PEER-LED MINDFULNESS MEET-UP FOR TEENS: South Burlington High School junior Mika Holtz guides adolescents toward increased awareness through music, movement and other techniques. Stillpoint Center, Burlington, 9-10:30 a.m. Donations. Info, 720-427-9340.

language

CHINESE LANGUAGE & CULTURE CLASS: Vocabulary, grammar and cultural lessons lead to lively conversation. Community Room, Fletcher Free Library, Burlington, 4:30-6 p.m. Free. Info, 865-7211. SPANISH GROUP CLASSES: Students roll their Rs while practicing en español. New Moon Café, Burlington, 2:45-4:30 p.m. $20. Info, maigomez1@ hotmail.com.

montréal

PIKNIC ÉLECTRONIK MONTRÉAL: DJ sets and beat-driven music propel a dance party of epic proportions. See piknicelectronik.com for details. Plaine des jeux, Montréal, 2-9:30 p.m. $13.50-116. Info, 514-904-1247.

music

Find club dates in the music section. CENTRAL VERMONT CHAMBER MUSIC FESTIVAL: BREAKFAST WITH BACH/BAROQUE BRUNCH: Music lovers fuel up for a concert in Randolph’s Bethany Church featuring festival artists and Vermont Youth Orchestra players. Esther Mesh Room, Chandler Center for the Arts, Randolph, breakfast, 11 a.m.; concert, 12:30 p.m. $10; donations for concert. Info, 728-6464. COLIN HAY: The Men at Work frontman fortifies his indie credibility with tunes from 2017’s Fierce Mercy. Paramount Theatre, Rutland, 7:30 p.m. $30-50. Info, 775-0903.

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

A CONCERT CELEBRATING 100 YEARS OF CREATIVITY & ART: Barbecue fare fuels a joyful evening of live music and movement by flutist Otis Cleveland, harpist Regina Christianson and others. Grand Isle Lake House, 5:30-8 p.m. $15-20; additional cost for food. Info, 372-8889. LAKE CHAMPLAIN CHAMBER MUSIC FESTIVAL: SUNDAY CONCERT: A program traces a line through Germanic tradition from Bach through Beethoven to American composer Leon Kirchner. Elley-Long Music Center, Saint Michael’s College, Colchester, preconcert talk, 2:15 p.m.; concert, 3 p.m. $15-35. Info, 863-5966. THE LEGENDARY COUNT BASIE ORCHESTRA: Scotty Barnhart directs the 20-member ensemble in a performance reflective of William James “Count” Basie’s spirited approach to jazz and the blues. Trapp Family Lodge Concert Meadow, Stowe, 7-9 p.m. $12-30. Info, 253-7792.

LITTLE RIVER RAMBLE: Hikers step off the beaten path for a guided tour of the Little River Settlement archaeological ruins. Little River State Park, Waterbury, 2 p.m. $2-4; free for kids 3 and under; preregister; call to confirm. Info, 244-7103. ROCKIN’ THE LITTLE RIVER: TOUR OF THE WATERBURY DAM: See FRI.18, 11:30 a.m. WAR OF THE WEEDS! & JUNIOR RANGER ROUNDUP & SERVICE PROJECT: Adults remove invasive plant species while kiddos lend a hand to finish their Junior Ranger requirements. Nature Center, Little River State Park, Waterbury, 10 a.m. $2-4; free for children ages 3 and under; preregister; call to confirm. Info, 244-7103.

sports

UNDER ARMOUR MOUNTAIN RUNNING SERIES: See SAT.19, 10 a.m. WOMEN’S PICKUP BASKETBALL: Players dribble up and down the court during an evening of friendly competition. Robert Miller Community & Recreation Center, Burlington, 7-8:30 p.m. $3; preregister at meetup.com. Info, carmengeorgevt@gmail. com.

BEGINNER-FRIENDLY ENGLISH COUNTRY DANCE CLASS: Casually dressed teens and adults learn steps popular in the time of Jane Austen. Richmond Free Library, 7-9 p.m. $3-5. Info, 899-2378. CONTACT IMPROV DANCE: Movers engage in weight sharing, play and meditation when exploring this style influenced by aikido and other somatic practices. Aikido of Champlain Valley, Burlington, 7:30-9:30 p.m. $4. Info, 864-7306. SALSA MONDAYS: Dancers learn the techniques and patterns of salsa, merengue, bachata and chacha. North End Studio A, Burlington, fundamentals, 7 p.m.; intermediate, 8 p.m. $12. Info, 227-2572.

talks

MARK TIMNEY: Taking aim at firearm mythology, the speaker sounds off in “Off Target: What Hollywood, Journalists and Shooters Get Wrong About Guns.” American Precision Museum, Windsor, 2-4 p.m. Free. Info, 674-5781.

SA T.19

| MU

theater

‘BUYER & CELLAR’: See WED.16, 3 p.m. CIRCUS SMIRKUS BIG TOP TOUR: See WED.16, Circus Smirkus Barn, Greensboro. ‘THE DOMESTIC INSURRECTION CIRCUS AND PAGEANT’: Social and political themes thread through this new Bread and Puppet Theater production. Bread and Puppet Theater, Glover, museum tour, 1 p.m.; show, 3 p.m. Donations. Info, 525-3031. NATIONAL THEATRE LIVE: ‘ANGELS IN AMERICA: PART TWO: PERESTROIKA’: New Yorkers grapple with life, death, love and sex in the midst of the AIDS crisis in a broadcast production of Tony Kushner’s Tony Award-winning play. Loew Auditorium, Hopkins Center for the Arts, Dartmouth College, Hanover, N.H., 4 p.m. $23. Info, 603-646-2422. ‘THE TAFFETAS’: See THU.17. TENFEST: See THU.17, 2 p.m.

BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: See WED.16.

MON.21 art

Find visual art exhibits and events in the art section.

E FIRST-TIME KINDERGARTENERS: Soon-to-be students and their parents get together for stories, activities and sharing. Burnham Memorial Library, Colchester, 10:30-11 a.m. Free; preregister. Info, 264-5660.

SIC | BEN & JANICE

WILLARD STERNE RANDALL: Nonfiction fans perk up their ears for key points from Unshackling America: How the War of 1812 Truly Ended the American Revolution. Ethan Allen Homestead Museum, Burlington, 2-4 p.m. Donations. Info, 865-4556.

FOX HUNTING DEMONSTRATION: Green Mountain Hounds dogs follow scented rags at impressive speeds. Sportsmen and -women can stick around

dance

CAMPUS TOUR: Potential students ages 16 through 24 check out a facility offering free housing, meals, career technical training, high school diplomas, driver’s licenses and job placement. Northlands Job Corps Center, Vergennes, 9:45 a.m.-noon. Free; preregister. Info, 877-0121.

NO LEFT TURN: Concertgoers bring chairs to an ear-catching rock-and-blues performance. Westford Common, 7-8 p.m. Free. Info, mpk802vt@ gmail.com.

BURLINGTON TREE TOURS: Outdoors lovers learn to identify common species on a moderately paced walking tour of the Queen CIty’s urban forest. Hilton Burlington, 10-11:15 a.m. & 7-8:15 p.m. $11.91-13; free for kids 10 and under. Info, 343-1773.

BRAND COMPOSITION 101: Paige Johnson of Insights Marketing guides entrepreneurs toward staying on-message. Waterbury Public Library, 3-4 p.m. Free; preregister. Info, 244-7036.

education

words

‘THE QUEEN’S DELIGHT: ELIZABETHAN MUSIC FOR VOICE AND RECORDER’: See FRI.18, Seven Stars Arts Center, Sharon, 4-6 p.m.

business

WEST AFRICAN DANCE: Live djembe and dundun drumming drive a family-friendly class with teacher Seny Daffe of Guinea. Dropins are welcome. Zenbarn Studio, Waterbury, 5:30-7 p.m. $10-16. Info, studio@zenbarnvt.com.

THE VERMONT CHALLENGE: See THU.17.

MARK SHELTON & FRIENDS: The Vermont songster entertains the crowd with an open-air concert. Highgate Municipal Park, 7-9:30 p.m. Free. Info, summersounds@allarts.org.

outdoors 58 CALENDAR

to meet the animals and learn from the riders. Shelburne Museum, 10 a.m.-noon. Regular admission, $7-24; free for members, active military and kids under 5. Info, 985-3346.

LUC

etc.

THE GREAT AMERICAN ECLIPSE: Solar telescopes, models and planetarium presentations top off a viewing event with a world-class team of educators. See calendar spotlight. Fairbanks Museum & Planetarium, St. Johnsbury, 1-4 p.m. Free. Info, 748-2372. HOWARD FRANK MOSHER TRIBUTE TOUR: See WED.16, Haskell Free Library & Opera House, Derby Line, 7 p.m. JOB HUNT HELP: See THU.17, 10 a.m.-1 p.m. SOLAR ECLIPSE DAY: Space enthusiasts and astronomy educators don sun-safe eyewear before gazing skyward. Themed activities are on hand. Montshire Museum of Science, Norwich, noon-4 p.m. Regular admission, $3-17 free for members and kids under 2. Info, 649-2200. SOLAR ECLIPSE EXTRAVAGANZA: Space sciencethemed activities and a live feed of the solar eclipse make for an out-of-this-world viewing experience. ECHO Leahy Center for Lake Champlain, Burlington, 10 a.m.-5 p.m. Regular admission, $13.50-16.50; free for members and kids 2 and under. Info, 864-1848. SOLAR ECLIPSE VIEWING PARTY: Folks don provided glasses to witness a celestial phenomenon. Fairfax Community Library, 1-3 p.m. Free. Info, 8492420. Dorothy Alling Memorial Library, Williston, 1:30-4 p.m. Info, 878-4918. Brownell Library, Essex Junction, 1:30-3:30 p.m. Info, 878-6955. Highgate Public Library, 1:30-4 p.m. Info, 868-3970.

film

See what’s playing at local theaters in the movies section. ‘FLIGHT OF THE BUTTERFLIES’: See WED.16. ‘MEERKATS 3D’: See WED.16. ‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: See WED.16.

‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: See WED.16.

food & drink

PIE & ICE CREAM SOCIAL: Sweets lovers indulge in summer’s sweetest treat, served à la mode to the tune of the Vergennes City Band. Proceeds benefit the Champlain Valley Christian School. Vergennes City Park, 6-8 p.m. $6. Info, 349-0229.

games

BRIDGE CLUB: See WED.16, 6:30 p.m. DO YOU WANT TO LEARN TO PLAY BRIDGE?: See WED.16. MAGIC: THE GATHERING — MONDAY NIGHT MODERN: Tarmogoyf-slinging madness ensues when competitors battle for prizes in a weekly game. Brap’s Magic, Burlington, 6:30-10 p.m. $8. Info, 540-0498. SCAVENGER HUNT: See WED.16.

health & fitness

ADVANCED TAI CHI CLASS: See FRI.18. AM BOOT CAMP: Rise and shine! Energizing exercise stations are easily adapted to any fitness level. Brookfield Old Town Hall, 7:30 a.m. Donations. Info, brookfieldoth@gmail.com. ASHTANGA YOGA: An athletic flow combines strength, flexibility and stamina in a specific sequence of asanas linking breath and movement. Zenbarn Studio, Waterbury, 7:15-8:30 p.m. Donations. Info, studio@zenbarnvt.com. BONE BUILDERS: See WED.16. BUTI YOGA: See WED.16. RECOVERY COMMUNITY YOGA: See WED.16. ROOFTOP FLOW: Seasoned practitioners and newbies alike link breath with movement during a series of strengthening and lengthening poses. Sangha Studio — North, Burlington, 7-8 p.m. $10-15. Info, 448-4262. SEATED TAI CHI: Movements are modified for those with arthritis and other chronic conditions. Winooski Senior Center, 11 a.m.-noon. Free. Info, 735-5467. TAI CHI, SUN-STYLE LONG-FORM: Elements of qigong thread through the youngest version of the Chinese martial art. Winooski Senior Center, 10-11 a.m. Free. Info, 735-5467. VERMONT CENTER FOR INTEGRATIVE HERBALISM STUDENT HERBAL CLINIC: Third-year interns evaluate individual constitutions and health conditions. Burlington Herb Clinic, 4-8 p.m. $10-30; preregister. Info, info@vtherbcenter.org. YOGA ON THE DOCK: See WED.16.

kids

OPEN GYM PLAY GROUP: Parents can socialize while tykes stay active with movement-centered recreation. River Arts, Morrisville, 9:30-11 a.m. Free. Info, 888-1261. PRESCHOOL MUSIC: See THU.17, 11 a.m. PRESCHOOL MUSIC: Melody makers ages 3 through 5 sing and dance into the afternoon. Burnham Memorial Library, Colchester, 11:30 a.m.noon. Free. Info, 264-5660. SUMMER STORIES WITH THERESA: Kiddos listen to works of children’s literature read by a library volunteer. Brownell Library, Essex Junction, 10-11 a.m. Free. Info, 878-6956.

language

ADVANCED-LEVEL SPANISH CLASS: Language learners perfect their pronunciation with guest speakers. Private residence, Burlington, 4:30-6 p.m. $20. Info, 324-1757. LUNCH IN A FOREIGN LANGUAGE: AMERICAN SIGN LANGUAGE: Bring a bag lunch to practice the system of communication using visual gestures. Kellogg-Hubbard Library, Montpelier, noon-1 p.m. Free. Info, 223-3338.

music

Find club dates in the music section.

LIST YOUR EVENT FOR FREE AT SEVENDAYSVT.COM/POSTEVENT

CASPIAN MONDAY MUSIC ORCHESTRA CONCERT: Classical connoisseurs revel in serenades and arias. East Hardwick Grange, 8-10 p.m. $10-18; free for kids under 18. Info, 533-9259. LAKE CHAMPLAIN CHAMBER MUSIC FESTIVAL: MONDAY: Leon Fleisher’s masterclass with the Kafka Quartet gives way to a discussion of historical piano recordings. All Souls Interfaith Gathering, Shelburne, 1 p.m. $20; free for kids under 18. Info, 863-5966.

tech

TECH HELP WITH CLIF: Electronics novices develop skill sets applicable to smartphones, tablets and other gadgets. Brownell Library, Essex Junction, noon & 1 p.m. Free; preregister. Info, 878-6955.

theater

‘A CHRISTMAS STORY: THE MUSICAL’ ADULT AUDITIONS: Actors, singers and dancers throw their hats in the ring for roles in Lyric Theatre’s holiday production. Fusion 802 Dance, South Burlington, 5:45-10 p.m. Free. Info, 658-1484.

words

BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: See WED.16. OPEN-GENRE WORKSHOP: Penmen and -women zero in on elements of craft in works of fiction, nonfiction and poetry submitted by Burlington Writers Workshop Members. 110 Main St., Suite 3C, Burlington, 6:30 p.m. Free; preregister at meetup. com; limited space. Info, 383-8104.

TUE.22 activism

TOXIC WHITENESS DISCUSSION GROUP: Peace & Justice Center representatives facilitate a conversation on the harmful effects of white supremacy on communities and individuals. Peace & Justice Center, Burlington, noon-1 p.m. Free. Info, 8632345, ext. 2. WOMEN’S EQUALITY DAY PROCLAMATION: Governor Phil Scott formally declares a day of celebration commemorating the certification of the 19th Amendment, which gave American women the right to vote. Vermont Statehouse, Montpelier, 10-11 a.m. Free. Info, grassrootsvt@ppnne.org.

Find visual art exhibits and events in the art section.

community

FEAST TOGETHER OR FEAST TO GO: See FRI.18.

RUTLAND YOUNG PROFESSIONALS AUGUST MIX: Community members and area business people learn about fire safety. A station tour, barbecue bites and door prizes sweeten the deal. Rutland City Fire Department, 6-8 p.m. Free. Info, 773-9147.

crafts

OPEN CRAFT NIGHT: Creative sparks fly in the studio as attendees whip out woven wall hangings and crochet, knitting and sewing projects. Nido Fabric & Yarn, Burlington, 6-8 p.m. Free. Info, 881-0068.

etc.

HOWARD FRANK MOSHER TRIBUTE TOUR: See WED.16, The Savoy Theater, Montpelier, 6:30 p.m. SEARCH FOR MEANING DISCUSSION GROUP: Individuals come together in pursuit of truth and personal growth. Unitarian Universalist Fellowship of Plattsburgh, N.Y., 7 p.m. Free. Info, 518-561-6920.

film

See what’s playing at local theaters in the movies section. ‘FLIGHT OF THE BUTTERFLIES’: See WED.16. KNIGHTS OF THE MYSTIC MOVIE CLUB: Cinema hounds view campy features at this ode to offbeat productions. Main Street Museum, White River Junction, 8:30 p.m. Free. Info, 356-2776. ‘MEERKATS 3D’: See WED.16. ‘A PLACE IN THE SUN’: Montgomery Clift stars alongside Elizabeth Taylor and Shelley Winters in a 1951 romance about a man torn between two women. Catamount Arts Center, St. Johnsbury, 1:30 p.m. Free. Info, 748-2600. ‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: See WED.16. ‘STAND BY ME’: A 1986 adventure drama follows a group of young friends on their quest to find the body of a missing boy. Film House, Main Street Landing Performing Arts Center, Burlington, 7-10 p.m. Free. Info, 540-3018. ‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: See WED.16.

food & drink

NORTHFIELD FARMERS MARKET: A gathering place for local farmers, producers and artisans offers fresh produce, crafts and locally prepared foods. Depot Square, Northfield, 3-6 p.m. Free. Info, northfieldfarmersmarketvt@gmail.com. OLD NORTH END FARMERS MARKET: Locavores snatch up breads, juices, ethnic foods and more from neighborhood vendors. Dewey Park, Burlington, 3-6:30 p.m. Free. Info, oldnorthendfarmersmarket@gmail.com. TIKI TUESDAYS: Imbibers sip tropical cocktails mixed with Stonecutter Spirits liquor and topped with tiny umbrellas. Hotel Vermont, Burlington, 4-11 p.m. Free. Info, sas@stonecutterspirits.com.

games

BRIDGE CLUB: See WED.16, 7 p.m. SCAVENGER HUNT: See WED.16. TOSS ‘EM TUESDAY: Players nosh on wood-fired pizza and draft beer, then take their best shot in a friendly cornhole tournament. Lincoln Peak Courtyard, Sugarbush Resort, Warren, registration and open play, 5-6:30 p.m.; tournament, 6:30 p.m.Free. Info, 800-537-8427.

health & fitness

ALL-LEVELS YOGA: Experts and neophytes alike do the downward-facing dog. Brookfield Old Town Hall, 7 p.m. $5; free for kids under 18. Info, brookfieldoth@gmail.com.

BEGINNER WEST COAST SWING & FUSION DANCING: Pupils get schooled in the fundamentals TUE.22

COME CONNECT WITH YOUR FRIENDS, FAMILY, NEIGHBORS AND VERMONT’S AGRICULTURAL HISTORY. ALL AT THE STATE’S BIGGEST FAIR. SAVE UP TO 25% ON ADVANCE DISCOUNT ADMISSION TICKETS & UNLIMITED RIDE BRACELETS AT PRICE CHOPPER STORES NOW! BUT MAKE SURE TO GET THEM BEFORE THE FAIR, THEY’RE ONLY AVAILABLE UNTIL AUGUST 24TH

» P.60 Untitled-12 1

8/14/17 11:24 AM

CALENDAR 59

dance

‘ZERO HOUR’: An interdisciplinary meditation on the role of identity and social engagement in artistic endeavors draws on traditions of audience participation. Phantom Theater, Edgcomb Barn, Warren, 8 p.m. $15. Info, 496-5997.

SEVEN DAYS

TUESDAY VOLUNTEER NIGHTS: Helping hands pitch in around the shop by organizing parts, moving bikes and tackling other projects. Children under 12 must be accompanied by an adult. Bike Recycle Vermont, Burlington, 5-8 p.m. Free. Info, 264-9687.

SWING DANCING: Quick-footed participants experiment with different forms, including the Lindy hop, Charleston and balboa. Beginners are welcome. Champlain Club, Burlington, 7:30-9:30 p.m. $5. Info, 448-2930.

08.16.17-08.23.17

PUBLIC HEARING: Citizens weigh in on proposed amendments to Williston’s comprehensive plan containing goals and objectives for the town. Williston Police Station, 7:30 p.m. Free. Info, 878-6704.

INTERMEDIATE & ADVANCED WEST COAST SWING: Fun-loving folks learn the smooth, sexy stylings of modern swing dance. North End Studio A, Burlington, 7-9 p.m. $11-16. Info, burlingtonwestie@gmail.com.

SEVENDAYSVT.COM

art

of partner dance. North End Studio B, Burlington, 8-9 p.m. $11-16. Info, burlingtonwestie@gmail.com.

1O Best Days of Summer!

calendar

PEACEFUL WARRIOR KARATE: Martial-arts training promotes healthy living for those in recovery. Turning Point Center, Burlington, 1 p.m. Free. Info, 861-3150. R.I.P.P.E.D.: See SAT.19, 6-7 p.m. TAI CHI, LEVEL I: Beginners are introduced to sequences of slow, controlled movements. South Burlington Recreation & Parks Department, 11 a.m.noon. Free. Info, 735-5467. ZUMBA: A high-energy instructor and a wide array of music keep students going strong as they dance their way to health. Marketplace Fitness, Burlington, 4:30-5:15 p.m. $12; free for members and first-timers. Info, 651-8773.

Stowe Tango Music Festival Concert

08.16.17-08.23.17

SEVENDAYSVT.COM

Saturday, August 19, 8 pm Join us on an emotional journey, from utmost tenderness to fiery passion. The concert features tango legends directly from Buenos Aires, top tango dancers, and a unique 30 piece orchestra comprised of world-renowned tango musicians.

Tango! With Counterpoint, 8 Cuerdas & Cassotto Duo

SEVEN DAYS

Saturday, August 26, 8 pm Three of Vermont’s finest ensembles combine to perform the many aspects of Tango, the passionate Argentine dance music.

Mellow Yellow: Summer of Love 50th Anniversary Tour

60 CALENDAR

Saturday, September 2, 8 pm

SprucePeakArts.org 802-760-4634 122 Hourglass Drive, Stowe

4V-sppac081717.indd 1

kids

EXORDIUM PRESENTS: A SUMMER FIELD — A 100-INCH SAFARI: Mr. K reveals the intricate world that resides within a small patch of field. Fairfax Community Library, 10-11 a.m. Free; preregister. Info, 849-2420. JUNIOR CHAMP KART RACING SERIES: Race fans root for drivers ages 6 through 14 as they take laps around an oval track. Thunder Road Speed Bowl, Barre, 6 p.m. Free; $15 for pit entry. Info, crism6@ comcast.net.

KNITTING & MORE: See WED.16.

OPEN JAM: Instrumentalists band together for a free-flowing musical hour. Borrow an instrument or bring your own. The Pathways Vermont Community Center, Burlington, 3-4 p.m. Free. Info, 888-4928218, ext. 300.

environment

SHAPE NOTE SING: Locals lend their voices to four-part harmonies at this weekly sing-along of early American music in the “fa-sol-la-mi” tradition. Bread and Puppet Theater, Glover, 7:30 p.m. Free. Info, 525-3031.

seminars

MEDICARE & YOU: AN INTRODUCTION TO MEDICARE: Members of the Central Vermont Council on Aging clear up confusion about the application process and plan options. Central Vermont Council on Aging, Barre, 3-5 p.m. Free; preregister. Info, 479-0531.

sports

STOWE MOUNTAIN LODGE CLASSIC: Rackets in hand, top-notch players face off in a professional tennis tournament. Spruce Peak at Stowe, 1-7 p.m. $45-1,000. Info, 549-4658.

READ TO WILLY WONKA THE VOLUNTEER THERAPY DOG: Kiddos cozy up for story time with the library’s furry friend. Burnham Memorial Library, Colchester, 4:15-4:45 p.m. Free; preregister. Info, 264-5660.

theater

‘LA CAUSERIE’ FRENCH CONVERSATION: Native speakers are welcome to pipe up at an unstructured conversational practice. El Gato Cantina, Burlington, 4:30-6 p.m. Free. Info, 540-0195. LUNCH IN A FOREIGN LANGUAGE: ITALIAN: Speakers hone their skills in the Romance language over a bag lunch. Kellogg-Hubbard Library, Montpelier, noon-1 p.m. Free. Info, 223-3338. PAUSE-CAFÉ FRENCH CONVERSATION: Frenchlanguage fanatics meet pour parler la belle langue. Gather on the terrace in fair weather. Burlington Bay Market & Café, 6:30-8:30 p.m. Free. Info, 363-2431.

8/15/17 1:13 PM

bazaars

JEFFERSONVILLE FARMERS & ARTISAN MARKET: See WED.16.

LAKE CHAMPLAIN CHAMBER MUSIC FESTIVAL: TUESDAY: David Ludwig’s presentation “Inside Pitch: ‘La Grande Ligne’” leads to a reading and discussion of new works. Elley-Long Music Center, Saint Michael’s College, Colchester, 2:30 p.m. $20; free for kids under 18. Info, 863-5966.

talks

language

Find visual art exhibits and events in the art section.

M DRUNK & IN THE WOODS: ES CO TI community ’| CI Locals groove to the JohnsonNT NS EA UR G A R GREENER DRINKS: See WED.16. based ensemble’s brand of soul, blues P EC TI O N CIRCUS AND and funk. Legion Field, Johnson, 6-8:30 p.m. Free. Info, 635-7826. crafts

NESTLINGS FIND NATURE: Books, crafts, nature walks and outdoor activities give preschoolers a look at how songbirds develop and grow. Birds of Vermont Museum, Huntington, 10:30-11:30 a.m. Regular admission, $3.50-7; free for members and kids under 3. Info, 434-2167.

TODDLER STORY TIME: Good listeners up to 3 years old have fun with music, rhymes, snacks and captivating tales. Burnham Memorial Library, Colchester, 10:30-11 a.m. Free; preregister. Info, 264-5660.

DO M A RC H DO

Friday, August 18, 7 pm Outdoor concert with Del McCoury and David Grisman! These legendary musicians celebrate their nearly 50-year bluegrass friendship in one great night of music under the stars.

HATHA FLOW YOGA: A balanced combination of sustained and flowing poses promotes mindfulness. Zenbarn Studio, Waterbury, 5:30-6:45 p.m. Donations. Info, studio@zenbarnvt.com.

Del & Dawg, Songs & Stories

| ‘T

GENTLE DROP-IN YOGA: Yogis bring their own mats for a hatha class led by Betty Molnar. Burnham Memorial Library, Colchester, 4:30-5:30 p.m. Free. Info, 264-5660.

FITNESS FLOW YOGA: See FRI.18, 6:30-7:30 p.m.

art

EAT

FITNESS AT ANY AGE: Strength, agility, coordination and heart-healthy exercises are modified for folks of all ability levels. Charlotte Senior Center, 9:15-10 a.m. $10. Info, 343-7160.

PRODUCE SAFETY: BEST PRACTICES FROM FIELD TO CONSUMER: A workshop geared toward small- to medium-size growers demystifies the Food Safety Modernization Act. Root 5 Farm, Fairlee, 3-6 p.m. Free. Info, 434-4122.

SU N .21 | T H

DE-STRESS YOGA: A relaxing and challenging class lets healthy bodies unplug and unwind. Balance Yoga, Richmond, 5:45-7 p.m. $14. Info, 434-8401.

DAVINA & THE VAGABONDS: Influences ranging from Aretha Franklin to Tom Waits weave through a high-energy presentation of original numbers and American classics. ArtsRiot, Burlington, 8:30 p.m. $12-15. Info, 540-0406.

agriculture

NAR

COMMUNITY YOGA: All ages and all levels are welcome to limber up in this vinyasa class. Brookfield Old Town Hall, 6:30-7:30 p.m. $5. Info, 276-3181.

ADAM BOYCE & MARK STRUHSACKER: Two Vermont players band together for a fiddle-and-guitar concert. Steele Room, Waterbury Municipal Building, 7-8:30 p.m. Free. Info, 244-7036.

L EO

with an outdoor concert under the stars on the Green in the Spruce Peak Village Center!

BRANDON FITNESS BOOT CAMP: Hop to it! Get fit with strength, endurance, agility and coordination exercises. Otter Valley North Campus Gym, Brandon, 5-6 p.m. $12. Info, 343-7160.

Find club dates in the music section.

WED.23

CELEBRATE OLD MOZO DAYS THIS SUMMER

BEGINNERS TAI CHI CLASS: See THU.17.

music

St., Suite 3C, Burlington, 6:30 p.m. Free; preregister at meetup.com; limited space. Info, 383-8104.

AWARENESS THROUGH MOVEMENT LESSON: From reducing pain to improving mobility, this physical practice reveals new ways to live with the body. Come with comfy clothes and an open mind. The Wellness Collective, Burlington, 5:30-6:30 p.m. $10. Info, 504-0846.

SOCIAL GATHERING: Those who are deaf or hard of hearing or want to learn American Sign Language get together to break down communication barriers. The North Branch Café, Montpelier, 4-6 p.m. Cost of food and drink. Info, 595-4001.

« P.59

TUE.22

AMANDA GUSTIN: Movie clips add color to the talk “Vermont Versus Hollywood: 100 Years of Vermont in Film.” Woodstock Town Hall Theatre, 7 p.m. Donations. Info, 457-1822.

‘BUYER & CELLAR’: See WED.16. ‘A CHRISTMAS STORY: THE MUSICAL’ ADULT AUDITIONS: See MON.21. ‘THE SCHOOL FOR SCANDAL’: Town Hall Theater’s Young Company elicits laughs with a comedy that takes shots at high society. Town Hall Theater, Middlebury, 7 p.m. $5-10. Info, 382-9222.

words

BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: See WED.16. CREATIVE NONFICTION WORKSHOP: Folks give feedback on essays, poetry and journalism written by Burlington Writers Workshop members. 110 Main St., Suite 3C, Burlington, 10:30 a.m. Free; preregister at meetup.com; limited space. Info, 383-8104. A ‘ULYSSES’ SUMMER: SUMMER LITERATURE READING GROUP: Ambitious readers discuss selected pages from James Joyce’s Ulysses. 110 Main

dance

DROP-IN HIP-HOP DANCE: See WED.16. ‘ZERO HOUR’: See TUE.22.

KINGDOM COMMUNITY WIND TOUR: Attendees are blown away by a tour of energy-producing turbines. Kingdom Community Wind, Lowell, 1011:30 a.m. Free; preregister. Info, nicole.pidala@ greenmountainpower.com.

etc.

DOG DAY AT THE POOL: Pups splash around to raise money for the Central Vermont Humane Society. Montpelier Public Pool, 5-6:30 p.m. Donations. Info, 476-3811, ext. 110. GUIDED TOURS: See WED.16. NURSING BEYOND A YEAR MEET-UP: Breastfeeding parents connect over toddler topics such as weaning and healthy eating habits. Aikido of Champlain Valley, 9:30 a.m. Free. Info, 985-8228. RUTLAND DEATH CAFÉ: Men and women discuss issues related to the end of life. Pyramid Holistic Wellness Center, Rutland, 7-9 p.m. Free; donations accepted. Info, 353-6991.

fairs & festivals

CALEDONIA COUNTY FAIR: Vermont’s oldest fair celebrates the state’s rural roots with amusement rides, a children’s barnyard, agricultural shows, exhibits and musical acts. Caledonia County Fair Grounds, Lyndonville, 4 p.m. $12-30. Info, 626-8101.

film

See what’s playing at local theaters in the movies section. ‘BOY’: Set in New Zealand, this 2010 comedic drama tells the story of an 11-year-old child who reconnects with his criminal father. Catamount Arts Center, St. Johnsbury, 7 p.m. Free. Info, 748-2600. ‘FLIGHT OF THE BUTTERFLIES’: See WED.16. ‘MEERKATS 3D’: See WED.16. ‘MOONLIGHT’: Nominated for eight Academy Awards, this 2016 drama follows a young black man from childhood to adulthood in a rough Miami neighborhood. Snacks are provided. Dorothy Alling Memorial Library, Williston, 5:30 p.m. Free. Info, 878-4918. MOVIES IN THE PARK: ‘SUPERMAN’: Christopher Reeve dons his cape as the original superhero in this 1978 action movie. Back lawn, Woodstock History Center, 8:30-10:45 p.m. Free. Info, 457-3981. ‘SEA MONSTERS 3D: A PREHISTORIC ADVENTURE’: See WED.16.

LIST YOUR EVENT FOR FREE AT SEVENDAYSVT.COM/POSTEVENT

‘THIS BEAUTIFUL FANTASTIC’: Jessica Brown Findlay stars as an aspiring children’s author who finds a friend in a wealthy widower. Highland Center for the Arts, Greensboro, 6-8 p.m. $5. Info, 533-9075. ‘THE VIETNAM WAR’: A community conversation complements segments of a new documentary by filmmakers Ken Burns and Lynn Novick. Vermont History Center, Barre, 6 p.m. Free. Info, 479-8500. ‘WALKING WITH DINOSAURS: PREHISTORIC PLANET 3D’: See WED.16.

food & drink

BARRE FARMERS MARKET: See WED.16. CHAMPLAIN ISLANDS FARMERS MARKET: See WED.16. COMMUNITY SUPPER: See WED.16. LEDDY PARK BEACH BITES: Lakeside picnickers enjoy food-truck fare, a beer garden, kids’ activities and live entertainment. Attendees on two wheels make use of free bike valet service. No dogs, please. Leddy Park, Burlington, 5:30-8:30 p.m. Free. Info, 864-0123. MIDDLEBURY FARMERS MARKET: See WED.16.

COMMUNITY EVENINGS AT THE FARM: The Irregulars, a group of young traditional musicians, entertain picnickers. Shelburne Farms, 6-8 p.m. Free. Info, 985-8686.

LAKE CHAMPLAIN CHAMBER MUSIC FESTIVAL: WEDNESDAY MORNING: Composers Marc Neikrug and Augusta Read Thomas let listeners in on their musical influences during a conversation with David Ludwig. Elley-Long Music Center, Saint Michael’s College, Colchester, 10:30 a.m. Free. Info, 863-5966.

outdoors

games

seminars

health & fitness

WOMEN’S PICKUP BASKETBALL: See WED.16.

CHAIR TAI CHI: See WED.16.

talks

NIA WITH LINDA: See WED.16. RECOVERY COMMUNITY YOGA: See WED.16. SOUND HEALING: Using voice, crystal singing bowls, medicine drums, tuning forks and more, musician Melinda Kinzie guides attendees on a path to wholeness. Carpenter-Carse Library, Hinesburg, 7-8:30 p.m. Free; preregister; limited space. Info, 482-2878. WEDNESDAY GUIDED MEDITATION: See WED.16. YOGA ON THE DOCK: See WED.16. ZUMBA EXPRESS: See WED.16.

kids

JUNIOR RANGER ROUNDUP: See WED.16. SCIENCE LOVES ART: See WED.16.

language

BEGINNER ENGLISH LANGUAGE CLASS: See WED.16. INTERMEDIATE-LEVEL SPANISH CLASS: See WED.16.

LUNCH IN A FOREIGN LANGUAGE: SPANISH: See WED.16.

lgbtq

SARAH PRAGER: The Quist founder chronicles LGBTQ figures from the Roman Empire to the present in her teen title Queer, There and Everywhere: 23 People Who Changed the World. Phoenix Books, Burlington, 7 p.m. $3. Info, 448-3350.

Find club dates in the music section. CITY HALL PARK SUMMER CONCERTS: VT BLUEGRASS PIONEERS: Seasoned players pick and

WE SHOW YOU WHERE

TEDX BROWNELL LIBRARY: Curious minds watch TED Talk videos centered on the theme “Things Building a Better World.” Brownell Library, Essex Junction, 7-8:30 p.m. Free. Info, 878-6955.

tech

Daysies Winner 2017

TECH HELP WITH CLIF: See MON.21.

theater

‘THE ADDAMS FAMILY’: Witchy Wednesday Addams falls in love with a so-called normal boy in this macabre musical staged by Stowe Theatre Guild. Stowe Town Hall Theatre, 7:30-10:30 p.m. $14-20. Info, 253-3961.

PAY FOR 4 MONTHS PAY FOR 6 MONTHS PAY FOR 9 MONTHS PAY FOR 12 MONTHS

‘BUYER & CELLAR’: See WED.16. ‘A CHRISTMAS STORY: THE MUSICAL’ ADULT AUDITIONS: See MON.21.

GET 1 MONTH FOR FREE GET 2 MONTHS FOR FREE GET 4 MONTHS FOR FREE GET 6 MONTHS FOR FREE Expires 8/15/17

‘THE RITE OF INTERVENTION’: Depot Theatre’s page2stage reading series introduces audience members to Erin Nicole Harrington’s developing work about an individual who becomes addicted to therapy. Depot Theatre, Westport, N.Y., 8 p.m. Free. Info, 518-962-4449.

So, what are you waiting for?

‘THE SCHOOL FOR SCANDAL’: See TUE.22.

words

BEST OF EXTEMPO 2012: The top raconteurs from five years ago retell their finest stories for audience members who vote with donation dollars. Brookfield Old Town Hall, 8 p.m. Free. Info, 276-3535.

SPORTS & FITNESS • PHYSICAL THERAPY • KIDS & FITNESS

BREAD LOAF WRITERS’ CONFERENCE LECTURES & READINGS: See WED.16. CREATIVE WRITING WORKSHOP: See WED.16. SLAM! SPOKEN WORD POETRY: An open mic paves the way for a juried set at this word fest featuring youth and community poets. ArtsRiot, Burlington, 6-8 p.m. $3. Info, 540-0406. WRITING CIRCLE: See WED.16. m

ESSEX: 802-879-7734 SOUTH BURLINGTON: 802-658-0002 or 0001 WILLISTON: 802-860-3343 3v-edge080917.indd 1

edgevt.com info@edgevt.com

7/31/17 3:51 PM

CALENDAR 61

music

PANEL DISCUSSION: ‘HOPES FOR HAITI’: Moise St. Louis of Saint Michael’s College leads a discussion on Haitian politics, followed by a party at artist and activist Robin Lloyd’s home with Haitian roots band Lakou Mizik. Champlain College Art Gallery, Burlington, 5:30-7:30 p.m. Free. Info, cthompson@ champlain.edu.

SEVEN DAYS

INTERMEDIATE/ADVANCED ENGLISH LANGUAGE CLASS: See WED.16.

RAW MATERIAL TO CHISEL YOU SUPPLY THE

08.16.17-08.23.17

YOGA FOR KIDS: Yogis ages 2 through 5 strike a pose to explore breathing exercises and relaxation techniques. Fletcher Free Library, Burlington, 1111:30 a.m. Free. Info, 865-7216.

8/15/17 10:12 AM

DEDICATED TO IMPROVING LIVES

SEVENDAYSVT.COM

SUNRISE YOGA: See WED.16.

Untitled-2 1

STOWE MOUNTAIN LODGE CLASSIC: See TUE.22.

BUTI YOGA: See WED.16.

GINGER’S EXTREME BOOT CAMP: See WED.16.

highlandartsvt.org 802.533.2000 2875 Hardwick Street, Greensboro VT

sports

SUNSET TOUR: See WED.16.

GENTLE YOGA IN WATERBURY: See WED.16.

Adults: $25 Students: $10 EBT cardholders: $5

AWAKENING THE HEART OF COMPASSION: A MEDITATION PRACTICE & STUDY PROGRAM: See WED.16.

BONE BUILDERS: See WED.16.

GENTLE YOGA IN RICHMOND: See WED.16.

Beautiful Night

SATURDAY, AUGUST 26, 7PM

THE MAGIC OF BIRD MIGRATION: See WED.16.

THERE BE DRAGONFLIES HERE: See WED.16.

SCAVENGER HUNT: See WED.16.

Le Vent Du Nord

FRIDAY, AUGUST 25, 7PM

THE GOOD, THE BAD AND THE REALLY, REALLY ITCHY: See WED.16.

WOODSTOCK MARKET ON THE GREEN: See WED.16.

DO YOU WANT TO LEARN TO PLAY BRIDGE?: See WED.16.

Don’t miss our end-of-August events!

LAKE CHAMPLAIN CHAMBER MUSIC FESTIVAL: WEDNESDAY CONCERT: Works by American composers Marc Neikrug and Augusta Read Thomas are paired with influential pieces by Mahler and Bach. FlynnSpace, Burlington, 7:30 p.m. $15-35. Info, 863-5966.

VERMONT FARMERS MARKET: See WED.16.

BRIDGE CLUB: See WED.16.

at the Highland Center for the Arts Tuesday–Thursday 11am–8pm Friday and Saturday 10am–9pm Sunday 10am–3pm

grin during an al-fresco recital. Burlington City Hall Park, noon. Free. Info, 865-7166.

PUBLIC EDUCATIONAL BOAT TRIP ON LAKE CHAMPLAIN: STORIES OF LAKE CHAMPLAIN: See THU.17, 5:30-7:30 p.m.

NEWPORT FARMERS MARKET: See WED.16.

Hardwick Street Café

Christy Patt & Robert "Boomer" Juzek present

The Legendary Count Basie Orchestra August 20, 2017, 7:00 p.m.

DIRECTED BY SCOTTY BARNHART, WITH VOCALIST CARMEN BRADFORD Continuing the excellent standards in swinging and shouting the blues with precision. Still “The Most Explosive Force In Jazz.” CO-PRESENTERS Pall Spera Company Realtors, Patterson & Smith Construction, The Rasberrys - W. Clinton "Bubba" Rasberry, Jr., Kathy & Clinton HOSPITALITY SPONSORS Stowe Motel & Snowdrift, Stoweflake Mountain Resort & Spa MEDIA SPONSORS Radio Vermont Group, The Stowe Reporter TECHNICAL SPONSORS Christy Patt & Robert "Boomer" Juzek ADDITIONAL SUPPORT Vermont Tent

StowePerformingArts.com Christy Patt & Robert "Boomer" Juzek

Gates Open at 5:00 p.m. For Picnicking

The Rasberrys – Bubba, Kathy & Clinton

Untitled-12 1

GO HIRE. Ready to recruit some new talent? Our readers are planning their next career moves. Employers get results with Seven Days Jobs — our brand-new, mobile-friendly, online job board at jobs.sevendaysvt.com.

SAME GREAT CE SERVI

Job Recruiters: • Post jobs using a form that includes key info about your company and open positions (location, application deadlines, video, images, etc.). • Accept applications and manage the hiring process via our new applicant tracking tool.

8/3/17 11:08 AM

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

• Easily manage your open job listings from your recruiter dashboard.

EW ALL-N TE I S B WE

Job Seekers: • Search for jobs by keyword, location, category and job type. • Set up job alert emails using custom search criteria. • Save jobs to a custom list with your own notes on the positions. • Apply for jobs directly through the site.

Asthma Study

• Share jobs on social media channels.

Seeking clinical research participants You may qualify if you: • Are 12-75 years old Have moderate to severe asthma

Reasonable travel expenses may be reimbursed

For more information contact Emily Kimball: 802-865-6100 or kimball@tlaaa.com

4t-timberlaneallergy071217.indd 1

7/7/17 2:11 PM

Launch your recruitment campaign today on jobs.sevendaysvt.com! Get a quote when you post online or contact Michelle Brown: 865-1020, ext. 21, michelle@sevendaysvt.com.

2v-jobsgohire052417.indd 1

5/23/17 5:21 PM

CLASS PHOTOS + MORE INFO ONLINE SEVENDAYSVT.COM/CLASSES

classes THE FOLLOWING CLASS LISTINGS ARE PAID ADVERTISEMENTS. ANNOUNCE YOUR CLASS FOR AS LITTLE AS $13.75/WEEK (INCLUDES SIX PHOTOS AND UNLIMITED DESCRIPTION ONLINE). SUBMIT YOUR CLASS AD AT SEVENDAYSVT.COM/POSTCLASS.

art

Call 865-7166 for info or register online at burlingtoncityarts.org. Teacher bios are also available online.

DOCUMENTARY STORYTELLING: Learn how to tell a compelling story with your photographs! This class will introduce participants to the process of documentary storytelling and include discussions of subject matter, composition, editing and story structure. Group discussion and critiques as well as shooting assignments, readings and writing exercises will give participants the opportunity to begin a new photographic project or refine works in progress. Film or digital photography acceptable. Prerequisite: Basic camera knowledge. Wed., Oct. 4-Nov. 8, 6:30-8:30 p.m. Cost: $180/ person; $162/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org. DRAWING: Learn a variety of drawing techniques including basic perspective, compositional layout and use of dramatic light and shadow. Students will work mostly from observation and will be encouraged to work with a variety of media including pencil, pen and ink, ink wash, and charcoal. No experience necessary. Price includes all basic drawing materials. Wed., Sep. 20-Oct.

EARRINGS: Come check out the jewelry and fine metals studio by making your own silver earrings. Open to all skill levels. Class includes copper and brass, silver ear wire, and all basic tools. Silver can be purchased separately. Instructor: Sarah Sprague. Thu., Nov. 9, 6:30-9 p.m. Cost: $37/person; $33.30/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org. EXPERIMENTAL DRAWING: Expand your drawing vocabulary while you discover the possibilities of abstract drawing styles and compositions. Starting with direct observation of familiar objects and natural forms, learn how to use both traditional and experimental techniques to create drawings that have a strong visual impact and wealth of personal meaning. A variety of drawing mediums and sizes will be explored, with plenty of flexibility to incorporate individual visions. Some drawing experience is recommended. Wed., Sep. 20-Oct. 25, 6-8:30 p.m. Cost: $180/person; $162/BCA members. Location: Burlington City Arts Studios, 405 Pine St.,

JEWELRY: Learn the basics of creating metal jewelry. Techniques covered will include sawing, piercing, filing, annealing, soldering, texturing, cold connections, basic hollow construction, ring sizing and more, so that students can create at least two completed pieces. Students will also be encouraged to explore different styles of contemporary and historical jewelry, design process, and the use of alternative materials through the studio library, the internet and on their own. Wed., Sep. 27-Nov. 1, 6:30-8:30 p.m. Cost: $204/ person; $183.60/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org. LINOCUT: In this threeweek class, students will have the opportunity to create small designs with the relief technique of linoleum block printing. We will print these one-color blocks by hand or with the printing press, and then add color by experimenting with watercolor paints. This class is a fun opportunity to make cards, holiday gift tags or art to share, since we will have the chance to print multiples once you make your block. Please bring ideas or sketches (8” x 10” or smaller) to the first class so we can get started right away! Thu., Nov. 2-16, 6-8:30 p.m. Cost: $114/ person; $102.60/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org. MIXED-LEVEL DARKROOM: Refine your analog darkroom skills and receive feedback on your work in this supportive, project-based class. Guided sessions to help you improve your printing and film-processing techniques and discussion of the technical, aesthetic and conceptual aspects of your work will be included. Bring a portfolio of recent images to the first class. Prerequisite: Black & White Darkroom or equivalent experience. Thu., Sep. 21-Nov. 9, 6-9 p.m. Cost: $330/person;

MIXED-LEVEL JEWELRY: This is a less-structured, fine-metals jewelry class for students who would like to work on a specific project, brush up on their techniques or learn some new techniques with the aid of an instructor there to coach them. Open to all skill levels, but some experience is helpful for this open-style class. Instructor: Sarah Sprague. Wed., Nov. 15-Dec. 13, 6:30-8:30 p.m. No class Nov. 22. Cost: $136/ person; $122.40/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org. MIXED-LEVEL WHEEL THROWING: Mixed-Level Wheel supports students across a range of skill and experience levels who have thrown on the wheel. This course is rooted in fundamentals and encourages individual projects. Demonstrations and instruction will cover centering, throwing, trimming and glazing, as well as forms and techniques determined by students. Class price includes your first bag of clay and open studio access during the weeks of your class. Additional clay is sold separately. Wheel throwing experience required. Wed., Sep. 20-Nov. 8. Option 1: 9:30 a.m.-noon. Option 2: 1:30-4 p.m. Cost: $340/ person; $306/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org. OIL PAINTING: Learn how to paint with nontoxic watersoluble oils. With an emphasis on studio work, this class will begin with fun exercises. Using direct observational skills, we’ll work on still life and referencing photographs. We’ll also explore landscape. Discover a variety of painting techniques and learn how to apply composition, linear aspects, form and color theory to your work. Beginners are welcome. Students are responsible for some materials (see materials list online). Tue., Sep. 26-Nov. 14, 6-8:30 p.m. Cost: $300/ person; $270/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org. POTTERY DECALS: This onenight workshop will introduce students to the use of waterslide decals to add surface decoration to their ceramic art. Topics covered will include the history of ceramic decals, sourcing commercially printed decals, printing your own iron-rich decals, application of decals to pottery, firing and food safety. All decals and tools provided by BCA. Students are responsible for bringing their own glazed and fired pottery. Basic knowledge of working with clay is recommended. Nov. 29, 6-8 p.m. Cost: $25/person; ART

» P.64

CLASSES 63

CONTEMPORARY FIGURE PAINTING: Intermediate and advanced painters, revitalize your painting practices with a contemporary approach to the figure. Turn the page on traditional representation, using fresh color and dynamic composition to strengthen your personal expression. Work from live models each week, explore a variety of contemporary techniques with nontoxic water-soluble oils and get supportive feedback in a small group environment. Figure drawing experience is

DIGITAL SLR CAMERA: Explore the basic workings of the digital SLR camera and learn how to take the photographs you envision. Demystify f-stops, shutter speeds, sensitivity ratings and exposure, and analyze the basics of composition. Bring your camera and owner’s manual to the first class. Pair with Adobe Lightroom to learn how to edit and print your images. No experience necessary. Instructor: Dan Lovell. Mon., Sep. 18-Oct. 30, 6:30-8:30 p.m. No class Oct. 9. Cost: $180/person; $162/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

FAMILY WHEEL DROP-IN: Explore BCA’s clay studio while hanging out with the family. Try the pottery wheel or create amazing clay sculptures while our staff gives demonstrations. There is a $5 additional fee per clay piece to be kept, fired and glazed. No registration necessary, but access to wheels is limited. Groups larger than six people are encouraged to set up a private workshop. All ages. Instructors: Alex Costantino, Alissa White & Kate McKernan. Fri., Sep. 22-Dec. 15, 5-7 p.m. No class Nov. 10 & Nov. 24. Cost: $10/person; $9/BCA members; purchase drop-in card & get 6th visit free! Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

$297/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 8657157, burlingtoncityarts.org.

SEVEN DAYS

ADULT WHEEL DROP-IN: Curious about the pottery wheel? Spend a Friday night with our pottery instructors learning the basics of wheel throwing with clay. This is a great introduction to our studio for those who don’t have time for an eight-week class or who just want to have fun with other beginner potters. There is a $5 additional fee per clay piece to be kept, fired and glazed. No registration necessary, but space is limited. First come, first served.

COLOR FILM PROJECTS: Learn how to scan, edit and print your color film and receive feedback on your work in this introduction to working with color film in a digital workflow. Film scanning basics, editing techniques and printing on our large-format Epson archival color printers will be covered. This class will also explore ideas in contemporary photography through special readings, and we will discuss the technical, aesthetic and conceptual aspects of your work in supportive critique sessions. Tue., Oct. 17-Dec. 12, 6-9 p.m. No class Nov. 21. Cost: $360/person; $324/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington, Info: 865-7157, burlingtoncityarts.org.

DRAWING DROP-IN: Spend the evening with other local artists drawing a still-life or one of our experienced models. Figure model nights will be on the first and third Friday of the month; the remaining nights will feature a unique still-life set up to practice your drawing skills. Please bring your own drawing materials and paper. No registration necessary. Ages 18+. Instructor: Carolyn Zuaro. Fri., Sep. 22-Dec. 15, 7:30-9 p.m. No class Nov. 10 or 24. Cost: $10/person; $9/BCA members. Purchase drop-in card & get the 6th visit free! Location: Burlington City Arts Studios, 405 Pine St., Burlington, Info: 865-7157, burlingtoncityarts.org.

Burlington. Info: 865-7157, burlingtoncityarts.org.

08.16.17-08.23.17

ADOBE LIGHTROOM: Learn how to easily upload, organize, edit and print your digital photographs using Adobe Lightroom. RAW file management, exposure/white balance corrections and printing high-quality archival inkjet prints on our Epson printers will be covered. Bring a Mac-compatible portable drive with your images to the first class. No experience necessary. Instructor: Dan Lovell. Mon., Nov. 6-Dec. 11, 6-9 p.m. Cost: $275/ person; $247.50/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

BLACK & WHITE DARKROOM: Explore the analog darkroom and learn how to properly expose black and white film, process film into negatives, and make silver gelatin prints. Class price includes film, paper and darkroom access during open-lab hours for the duration of the class. Bring your manual 35mm or medium-format film camera to the first class. No experience necessary. Instructor: Rebecca Babbitt. Mon., Oct. 16-Dec. 11, 6:30-8:30 p.m. No class Nov. 20. Cost: $285/person; $256.50/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

DIY HALLOWEEN COSTUMES: Students will create one-of-akind Halloween costumes that will blow away those storebought costumes and impress their friends. Cut, sew and craft your way to the best Halloween ever! Basic materials are provided; please bring two ideas of what you want to dress up as and any material or old clothes to help create your costume. Students must also bring a bag lunch and snacks. Parents are invited to a costume parade at 3 p.m. Registration required. Ages 6-12. Fri., Oct. 20, 8-3 p.m. Cost: $88/person; $79.20/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

25, 6-8:30 p.m. Cost: $225/ person; $202.50/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

SEVENDAYSVT.COM

ABSTRACT PAINTING: Explore the many exciting possibilities of abstract painting through a variety of fun demonstrations and exercises designed to help you open up and work intuitively. Experiment with paint of your choice (water-soluble oils, acrylics or watercolor) and a variety of other mixed media. Learn from fellow students and discuss techniques and ideas in a supportive setting. Beginners are welcome. Students are responsible for some materials (see materials list online). Thu., Nov. 2-Dec. 14, 6-8:30 a.m. No class Nov. 23. Cost: $225/ person; $202.50/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

Groups larger than six people are encouraged to set up a private workshop. Ages 18+. Instructors: Alex Costantino, Alissa White & Kate McKernan. Fri., Sep. 22-Dec. 15, 7:30-9 p.m. No class Nov. 10 or 24. Cost: $10/person; $9/BCA members. Purchase drop-in card & get 6th visit for free! Location: Burlington City Arts Studios, 405 Pine St., Burlington, Info: 865-7157, burlingtoncityarts.org.

recommended. Students are responsible for some materials (see materials list online). Wed., Sep. 20-Nov. 8, 1:30-4:30 p.m. Cost: $360/person; $324/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

classes ART

« P.63

$22.50/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 8657157, burlingtoncityarts.org. PRINTMAKING: This introductory class will show you a whole range of printing techniques that can be used on their own or in combination to create unique artwork. Over six weeks, you’ll be introduced to the studio’s equipment and materials and learn techniques such as block printing with linoleum, collograph (a low-relief intaglio technique) and monoprinting. Class price includes basic supplies and open studio access during the weeks of your class. Thu., Sep. 21-Oct. 26, 6-8:30 p.m. Cost: $255/ person; $229.50/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

64 CLASSES

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

SILKSCREEN: Expert screen printer, Aaron David, will introduce you to silkscreening and show you how to design and print t-shirts, posters, fine art and more! Students will learn a variety of techniques for transferring and printing images using hand-drawn, photographic or borrowed imagery. Students will learn how to apply photo emulsion, how to use a silkscreen exposure unit and how to print on a variety of surfaces. Students can bring their own screens or purchase one through the studio. No experience necessary! Wed., Sep. 20-Nov. 8, 6-8:30 p.m. Cost: $340/person; $306/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 8657157, burlingtoncityarts.org. THROWING SETS: In this fourweek class, students will be guided through the process of creating wheel-thrown sets. Topics will include making multiples of the same piece, stacking mugs and nesting bowls, and serving sets specific to a type of food or beverage, such as a sake bottle with matching cups or a coffee cup with saucer. This intermediate-level course is intended for students with proficiency in centering, throwing cups and throwing bowls. Thu., Nov. 16-Dec. 14, 6-8:30 p.m. No class Nov. 23. Cost: $170/person; $153/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 8657157, burlingtoncityarts.org. WHEEL THROWING: This class is an introduction to clay, pottery and the ceramics studio. Students will work primarily on the potter’s wheel, learning basic throwing and forming techniques while creating functional pieces such as mugs, cups and bowls. Students will also be guided through the various finishing techniques using the studio’s house slips and glazes. Class price includes your first bag of clay and open studio access during the weeks of your class. Additional clay is sold separately. Option 1: Wed., Sep. 20-Nov. 8, 6-8:30 p.m. Option 2:

Thu., Sep. 21-Nov. 9, 6-8:30 p.m. Cost: $340/person; $306/BCA members. Location: Burlington City Arts Studios, 405 Pine St., Burlington. Info: 865-7157, burlingtoncityarts.org.

craft

theshelburnecraftschool.org

985-3648

ADULT: BEGINNER CLAY: Instructor: Rik Rolla. Learn how to throw clay on the wheel. Explore centering, throwing, trimming and glazing. Gain confidence with hands-on demonstrations and one-on-one time with the instructor. Leave with several finished pieces. Gas reduction kiln and electric oxidation kiln are available for firing. Fri., Sep. 8-Oct. 20, 10 a.m.-noon Cost: $300/person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd, Shelburne. Info: 9853648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: CLAY ALTERNATIVE FIRING: Instructor: Rik Rolla. Explore clay on the wheel in a creative, mixed-level, supportive environment. Examine properties of form, function, color and glazes. Fire finished pieces in the primitive pit, the Raku kiln, with the option to explore other firing techniques. Gas reduction kiln and electric kilns are also available. Mon., Sep. 11-Oct. 23, 6 -8 p.m Cost: $300/person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd, Shelburne. Info: 9853648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: MIXED LEVEL WHEEL: Instructor: Rik Rolla. Develop the fundamentals of wheel-throwing. Explore techniques through demonstrations and hands-on assistance. You set the pace and gain experience through guided, individualized practice. Gas reduction kiln and electric oxidation kiln are available for firing, including an option to explore other firing methods. Tue., Sep. 5-Oct. 24, 10 a.m.-noon Cost: $335/ person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd, Shelburne. Info: 985-3648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: MIXED LEVEL WHEEL: Instructor: Munemitsu Taguchi. Develop the fundamentals of wheel-throwing. Explore techniques through demonstrations and hands-on assistance. You set the pace and gain experience

through guided individualized practice. Gas reduction kiln and electric oxidation kiln are available for firing, including an option to explore other firing methods. Session 1, Tue., Sep. 5-Oct. 24, 6 -8 p.m Cost: $335/ person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd, Shelburne. Info: 985-3648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: PAINTING PRACTICE: Instructor: Neil Berger. Together we will explore painting as performance: a series of gestures more like a dance than a marathon. We will look at pictures as holistic arrangements of shapes and colors instead of ‘subject matter’ and learn to trust the intimate, awkward and natural encounter with paint. Level 1, Tue. Sep. 12-Oct. 24, 10 a.m.-noon Cost: $217/person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd., Shelburne. Info: 9853648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: SHAKER HALL TABLE: Instructor: Ryan Cocina. Learn a comprehensive introduction to woodworking. This course explores basic principles of lumber selection, hand-tool and machinery usage, milling, joinery and finishing. You will build a Shaker-style hall table, taking the project from blueprint through completion, while gaining familiarity with the woodshop environment. Wed., Sep. 13-Nov. 15, 6 -9 p.m Cost: $565/ person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd., Shelburne. Info: 985-3648, info@ theshelburnecraftschool.org, theshelburnecraftschool. org. ADULT: COLOR THEORY: Instructor: Dana Heffern. Explore advanced color theory using Munsil’s Color Theory Workbook. Gain an understanding of ambiance, atmosphere, clash, vibration and other color perceptions through guided experiments and lively class discussions. Then develop your own style with how color can create environment, mood and a sense of aesthetics. This class requires a textbook. Level 1, Fri., Sep. 8-Oct. 20, 10 a.m.-noon Cost: $217/ person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd., Shelburne. Info: 985-3648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: DRAWING: Instructor: Clark Derbes. Explore the foundation of drawing. Learn to depict objects, people, space and emotion. Using mediums such as graphite, charcoal, conte and ink, students will develop and expand drawing skills through demonstrations and one-on-one instruction. Instructor will also tailor classes based on student interest. Materials not included. Level 1, Tue., Sep. 12-Oct. 24, 6 -8 p.m Cost: $217/person; member discount avail. Location: The

Shelburne Craft School, 64 Harbor Rd., Shelburne. Info: 9853648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: INTERMEDIATE OIL: Instructor: Dana Heffern. This course is perfect for those looking to build on their basic knowledge of oil painting. Techniques will be learned through theory and practice. Subject matter may include still life, drapery, landscape and the human figure. Level 1, Fri., Sep. 8-Oct. 20, 1 -3 p.m. Cost: $217/ person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd., Shelburne. Info: 985-3648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org. ADULT: OIL PAINTING: Instructor: Brooke Monte. Develop confidence in composition, color, layering and mixing using oil paint. Designed for beginners, this class teaches how to use still-life setups to explore techniques ranging from layout and surface preparation to a variety of brush work, including wet into wet, scrubs and glazing. Materials not included. Level 1, Thu., Sep. 7-Oct. 19, 6 -8 p.m Cost: $217/person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd., Shelburne. Info: 9853648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org.

dance

empowerment

DANCE STUDIO SALSALINA: Salsa classes, nightclub-style, group and private, four levels. Beginner walk-in classes, Wed., 6 p.m. $15/person for one-hour class. No dance experience, partner or preregistration required, just the desire to have fun! Drop in any time and prepare for an enjoyable workout. Location: 266 Pine St., Burlington. Info: Victoria, 598-1077, info@ salsalina.com.

OPPORTUNITIES AND CHALLENGES: A JUNGIAN PERSPECTIVE ON OUR TIME AND OUR FUTURE: This fivepart lecture series considers four questions we’re currently confronting: What’s going on? (Oct. 9) How might we cope? (Oct. 21) What’s coming? (Nov. 18) How might we thrive? (Dec. 16) Includes an experiential session (Oct. 22) on effective ways to reduce stress. Led by Sue Mehrtens and Susan Ackerman. Sep. 9, Oct. 21 & 22, Nov. 18, Dec. 16; 1-3 p.m. Cost: $75. Location: Jungian Center for the Spiritual Sciences, 55 Clover Ln., Waterbury. Info: Sue Mehrtens, 244-7909.

DSANTOS VT SALSA: Experience the fun and excitement of Burlington’s eclectic dance community by learning salsa. Trained by world famous dancer Manuel Dos Santos, we teach you how to dance to the music and how to have a great time on the dance floor! There is no better time to start than now! Mon. evenings: beginner class, 7-8 p.m.; intermediate, 8:15-9:15 p.m. Cost: $12/1-hour class. Location: North End Studios, 294 N. Winooski Ave., Burlington. Info: Jon Bacon, 355-1818, crandalltyler@hotmail. com, dsantosvt.com. IRISH/MODERN/TAP/JAZZ/ BALLET: Fiadhnait Moser School of Dance is accepting students for Irish, contemporary, jazz, tap and FMSD Company classes. We accept dancers at total beginner and advanced levels, as well as adults and children of all ages. Learn the art and joy of dance from champion and internationally qualified dancer, Fia Moser. See website for schedule of daily classes. Cost: $300/10 weekly 1-hour classes; scholarships possible. Location: Endeavor Middle School, 4066 Shelburne Rd., Shelburne. Info: The Fiadhnait Moser School of Dance, Fiadhnait Moser, 774-270-4564, fiadhnaitmoser@gmail.com, fiamoserdance.weebly.com.

design/build TINY-HOUSE WORKSHOP: A crew of beginners will help instructor Peter King frame and sheath a 16-foot x 20-foot tiny house in Williston Sep. 2-3. Plenty of hands-on experience. Tools provided; safety glasses required. On-site camping avail. Sep. 2-3. Cost: $250/workshop. Info: Peter King, 933-6103, vermonttinyhouses.com.

drumming ADULT: WATERCOLOR 1: Instructor: Ginny Joyner. Learn the basics: what brushes to use, kinds of paper and paint, color mixing, creating washes, working wet-on-wet, layering and learning that the water is in charge! A very ZEN approach to painting in watercolor, this class will work from images of landscapes and floras. Mon., Sep. 11-Oct 23, 10 a.m.-noon. Cost: $217/person; member discount avail. Location: The Shelburne Craft School, 64 Harbor Rd., Shelburne. Info: 985-3648, info@ theshelburnecraftschool.org, theshelburnecraftschool.org.

DJEMBE & TAIKO: Classes in Burlington, Hyde Park and Montpelier. Drums provided. Classes for adults (also for kids with parents) Mon., Tue. & Wed. in Burlington. Wed. a.m. or Friday a.m. in Hyde Park. Thu. in Montpelier. Most classes are in the evenings or after school. Conga classes, too! Visit our schedule and register online. Location: Taiko Space, 208 Flynn Ave., Suite 3G, Burlington; Capital City Grange, 6612 Rte. 12, Berlin; Moonlight Studios, 1670 Cleveland Corners Rd., Hyde Park. Info: 999-4255, burlingtontaiko.org.

language ANNOUNCING SPANISH CLASSES: Join us for adult Spanish classes this fall. Learn from a native speaker via small classes, individual instruction or student tutoring. You’ll always be participating and speaking. Lesson packages for travelers. Also lessons for young children; they love it! Our 11th year. See our website or contact us for details. Starts week of September 11; 10 weeks. Cost: $225. Location: Spanish in Waterbury Center, Waterbury Center. Info: 585-1025, spanishparavos@ gmail.com, spanishwaterburycenter.com. ALLIANCE FRANCAISE: FALL SESSION: Eleven-week French classes for adults starting on Sep. 11. Morning, afternoon and evening classes available in Burlington and evening classes only in Colchester and Montpelier. We also offer 6 or 7-week literature classes in Burlington and French for Travelers in Montpelier. We serve the entire range of students from the true beginners to those already comfortable conversing in French. See website for schedule. Location: Alliance Francaise of the Lake Champlain Region, 43 King St., Burlington. Info: Micheline Tremblay, 881-8826, michelineatremblay@gmail.com, aflcr.org.

martial arts ACHIEVE YOUR POTENTIAL: Come to Wu Xing Chinese Martial Arts. Join other thoughtful, intelligent adults to learn and practice tai chi, kung fu, meditation and dynamic physical exercises. Maximize your mental tranquility and clarity, physical health and fitness, and self-confidence. For people who never thought this would be for them. Fri., 6-7 p.m. & 7-8 p.m.; Sat., 11 a.m.noon & noon-1 p.m.; Tue., 6-7:30 p.m. Cost: $12/1-hour class; $40/ mo. (incl. all classes offered); $5/ trial class. Location: 303 Flynn Ave., Burlington. Info: 355-1301, info@wxcma.com, wxcma.com. MARTIAL WAY: Colchester and Milton locations. Classes in self-defense, Karate, Kung Fu, Jiu Jitsu and Tai Chi. We have 14

CLASS PHOTOS + MORE INFO ONLINE SEVENDAYSVT.COM/CLASSES

Sally Olson, managing director at sallyolson@ billreedvoicestudio.com. Location: Bill Reed Voice Studio, South Burlington, billreedvoicestudio.com.

different age and experience levels, so the training is always ageand skill-appropriate. Beginner or experienced, fit or not yet, young or not anymore, we have a class for you! Days and evenings; see website for schedule and fees. Location: Martial Way Self Defense Center, 73 Prim Rd., Colchester. Info: David Quinlan, 893-8893, info@martialwayvt. com, martialwayvt.com. VERMONT BRAZILIAN JIUJITSU: Brazilian Jiu-Jitsu is a martial arts combat style based entirely on leverage and technique. Brazilian Jiu-Jitsu self-defense curriculum is taught to Navy SEALs, CIA, FBI, military police and special forces. No training experience required. Easy-to-learn techniques that could save your life! Classes for men, women and children. Students will learn realistic bully-proofing and self-defense life skills to avoid them becoming victims and help them feel safe and secure. Our sole purpose is to help empower people by giving them realistic martial arts training practices they can carry with them throughout life. IBJJF & CBJJ certified black belt 6th-degree Instructor under Carlson Gracie Sr.: teaching in Vermont, born and raised in Rio de Janeiro, Brasil. A five-time Brazilian National Champion; International World Masters Champion and IBJJF World Masters Champion. Accept no Iimitations! Location: Vermont Brazilian Jiu-Jitsu, 55 Leroy Rd., Williston. Info: 598-2839, julio@ bjjusa.com, vermontbjj.com.

meditation

sympathy toward yourself. The Burlington Shambhala Center offers meditation as a path to discovering gentleness and wisdom. Shambhala Cafe (meditation and discussions) meets the first Saturday of each month, 9 a.m.noon. An open house (intro to the center, short dharma talk and socializing) is held on the third Sunday of each month, noon-2 p.m. Instruction: Sun. mornings, 9 a.m.-noon, or by appt. Sessions: Tue. & Thu., noon-1 p.m., & Mon.-Thu., 6-7 p.m. Location: Burlington Shambhala Center, 187 S. Winooski Ave., Burlington. Info: 658-6795, burlingtonshambhalactr.org.

performing arts BILL REED VOICE STUDIO: Bill Reed Voice Studio is currently auditioning news students for the fall semester. We offer private voice lessons, workshops, master classes and more. For more information and to schedule an audition, please contact

ALLIANCE OF THE WILLING: CITIZEN ENGAGEMENT FOR CIVIC HYGIENE, A THREE-PART COURSE: Part I: Internalizing the Three Loci of Control, Authority and Security. Learn the basics for personal and civic hygiene in this course that builds on Jung’s concepts of internal loci. This course is a prerequisite for Part II on how to become an effective agent of change. Led by Sue Mehrtens. Wed., Sep. 6, 13 & 20; 7-9 p.m. Cost: $45. Location: Jungian Center for the Spiritual Sciences, 55 Clover Ln., Waterbury. Info: Sue Mehrtens, 244-7909.

tai chi BEGINNER TAI CHI IN MONTPELIER: We practice Cheng Man-ch’ing’s “simplified” 37-posture Yang-style form. The course will be taught by Patrick Cavanaugh, longtime student and assistant to Wolfe Lowenthal, student of Cheng Man-ch’ing and founder of Long River Tai Chi Circle. Patrick is a senior instructor at LRTTC in Vermont and New Hampshire. Starts Tue., Sep. 5, 7-8 p.m. Cost: $65/mo. Location: Bethany Church, 115 Main St., Montpelier. Info: Long River Tai Chi Circle, Patrick Cavanaugh, 490-6405, patrick@longrivertaichi.org, longrivertaichi.org.

well-being

yoga EVOLUTION YOGA: Evolution Yoga and Physical Therapy offers yoga classes for everyone from beginner to expert. Choose from a wide variety of drop-in classes, series and workshops in Vinyasa, Kripalu, Core, Gentle, Vigorous, Yoga on the Lake, Yoga Wall, Therapeutics and Alignment. Become part of our yoga community. You are welcome here. Cost: $15/class; $140/10-class card; $5-10/community classes. Location: Evolution Yoga, 20 Kilburn St., Burlington. Info: 8649642, evolutionvt.com.

YOGA & RECOVERY GROUP FOR FOLKS LIVING W/ LYME DISEASE: Join as we practice gentle restorative poses suitable for all levels. Afterward, join the discussion as we share and support one another on the often confusing and isolating journey to wellness while living with Lyme disease. Wear comfortable clothing. Sign up or find more information at Laughingriveryoga. com. Aug. 27, 2-3:30 p.m. By donation. Location: Laughing River Yoga, The Chase Mill, 1 Mill St., Burlington. Info: laughingriveryoga.com.

women BIOGRAPHIES OF WOMEN IN WESTERN HISTORY: Get to know nine remarkable women ranging from 12th century Eleanor of Aquitaine to 21st century Sonia Sotomayor in this reading/discussion group. Get a discount on the nine books at Bridgeside Bookstore in Waterbury. Led by Sue Mehrtens. Sep. 7, Oct. 5, Nov. 2, Dec. 7, Jan. 3, Feb. 1, Mar. 1, Apr. 5 & May 3; 7-9 p.m. Cost: $90. Location: Jungian Center for the Spiritual Sciences, 55 Clover Ln., Waterbury. Info: Sue Mehrtens, 244-7909.

HONEST YOGA: Honest yoga offers practices for all levels. We just expanded to have two practice spaces! Your children can practice in one room while you practice in the other. No need for childcare. Yoga and dance classes ages 3 and up. Brand-new beginners’ course: This includes two specialty classes per week for four weeks plus unlimited access to all classes. We have daily heated and alignment classes, and kids’ classes in yoga and dance. We hold yoga teacher trainings at

the 200- and 500-hour levels, as well as children and dance teacher training courses. Check out our website for dance classes and yoga summer camps! Daily classes & workshops. $50/new student (1 month unlimited); $18/ class; $140/10-class card; $15/ class for student or senior; or $110/10-class punch card; $135/ mo. adult memberships; $99/ mo. kid memberships. Location: Honest Yoga Center, 150 Dorset St., Blue Mall, next to Hana, South Burlington. Info: 497-0136, honestyogastudio@gmail.com, honestyogacenter.com. RAILYARD YOGA STUDIO: Railyard Studio welcomes you to classical yoga, meditation and healing offerings. Kundalini Yoga: Sukhpran, Thu., 9:30-11 a.m. and Sun 5:30-7 p.m. Mansukh: Thu., 7-8:30 p.m. Dharma Yoga: Tue., 5:30-7 p.m. Healings by appointment, see website for details. See website for schedule. Location: Railyard Yoga Studio, 270 Battery St., Burlington. Info: 318-6050, railyardyoga@ gmail.com, railyardapothecary.com. SANGHA STUDIO | NONPROFIT, DONATION-BASED YOGA: Sangha Studio builds an empowered community through the shared practice of yoga. Free yoga service initiatives and outreach programs are offered at 17 local organizations working with all ages. Join Sangha in both downtown Burlington and the Old North End for one of their roughly 60 weekly classes and workshops. Become a Sustaining Member for $60/month and practice as often as you like! Daily. Location: Sangha Studio, 120 Pine St. and 237 North Winooski Ave., Burlington. Info: 448-4262. Info@ sanghastudio.org. SEVENDAYSVT.COM

LEARN TO MEDITATE: Through the practice of sitting still and following your breath as it goes out and dissolves, you are connecting with your heart. By simply letting yourself be, as you are, you develop genuine

psychology

SNAKE-STYLE TAI CHI CHUAN: The Yang Snake Style is a dynamic tai chi method that mobilizes the spine while stretching and strengthening the core body muscles. Practicing this ancient martial art increases strength, flexibility, vitality, peace of mind and martial skill. Beginner classes Sat. mornings & Wed. evenings. Call to view a class. Location: Bao Tak Fai Tai Chi Institute, 100 Church St., Burlington. Info: 864-7902, ipfamilytaichi.org.

08.16.17-08.23.17 SEVEN DAYS CLASSES 65

Untitled-5 1

8/10/17 10:45 AM

music

Brian McCarthy

08.16.17-08.23.17 SEVEN DAYS 66 MUSIC

Seeking Angels

How Abraham Lincoln and the Civil War inspired Brian McCarthy’s latest album B Y J O R D AN AD AMS

exact. His upcoming performance is a returned to Vermont in 2007. He’s triumphant homecoming and speaks to since taught a variety of jazz-related how far both he and his childhood home subjects — including composition, ear have come. training, pedagogy and jazz history — at “Things like [the Highland Center] several Vermont colleges and universiaren’t supposed to exist where I grew ties. In 2011, saxophone maker Selmer up,” he said. “I used Paris gave him an to ride my bike past endorsement. the open field [that] In late 2014, it used to be. Any city the Vermont Arts should be envious of Council awarded this place.” McCarthy a grant to In his youth, create what would McCarthy knew that become Better BR IAN MC C AR TH Y he would pursue a Angels — though, at career in jazz. After the time, it hadn’t a brief, unsuccessful stint with trumpet, yet taken shape. While he was in the his connection with the saxophone was planning and head-clearing stages, he nearly instantaneous. revisited one of his favorite works of After graduating from Hazen Union nonfiction: Ken Burns’ epic miniseries School, he pursued undergraduate “The Civil War,” in which narrator Sam and graduate degrees in jazz studies Waterston recites Lincoln’s famous and composition at William Paterson speech. For McCarthy, it was a lightUniversity in New Jersey. McCarthy bulb moment.

WE’RE CREATING FOR THE SAKE OF CREATIVITY.

THAT’S WHY WE DO IT.

MATTHEW THORSEN

SEVENDAYSVT.COM

n the final moments of his first inaugural address, President Abraham Lincoln said, “In your hands, my dissatisfied fellow countrymen, and not in mine, is the momentous issue of civil war.” He closed the impassioned speech with a plea to what he called “the better angels of our nature,” an artful way of imploring Americans to muster their innate goodness and to let it guide them in the turbulent days he knew were coming. It was this section of the famed oration that led Colchester-based saxophonist Brian McCarthy, 36, to develop a large-scale, modern jazz project called The Better Angels of Our Nature. He and his nonet released a crowdfunded recording of the project in June. The ninesong suite, which McCarthy originally debuted at the FlynnSpace in November 2015, reimagines popular music of the Civil War era as a complexly arranged, imaginative odyssey. He draws a parallel between the creation of jazz, a celebrated genre born out of the suffering of black slaves, and Lincoln’s “better angels.” “[I find that] some of the better angels of our nature is the creative side of humanity,” McCarthy explained to Vermont Public Radio’s Reuben Jackson during a listening event in July. “And, for me, being in the realm of jazz — it just connected with Lincoln’s better angels.” “It’s very important to [understand] where jazz comes from and [what] makes it so important as an art form,” he later added during an interview with Seven Days at a downtown Burlington café. “We’re creating for the sake of creativity. That’s why we do it. What are we capable of in a positive way?” The Brian McCarthy Nonet performs The Better Angels of Our Nature for the second time on Friday, August 18, at the Highland Center for the Arts in Greensboro. “Even though it’s not the largest group I’ve written and arranged for, the project itself is by far the most massive thing I’ve taken on,” said the bespectacled musician, who’s given to frequent smiles. McCarthy grew up in Vermont’s Northeast Kingdom — Hardwick, to be

“[‘Better Angels’] was the first idea I had,” he said. “That last paragraph is so beautiful. Every word has purpose.” As evidenced in the album’s liner notes, the project is meticulously researched. “We spent as much time on the liner notes as the music,” McCarthy said. “We” includes his wife, manager and the album’s executive producer, Linda Little. Most of Better Angels’ songs are based on popular music of the era with enduring historical significance. For instance, as explained in the liner notes, “Battle Hymn of the Republic” is also known as “Glory, Glory Hallelujah.” But it originally began as “John Brown’s Body,” the Union’s marching song that told the tale of the eponymous radical abolitionist. McCarthy spins it into a breezy, syncopated number, with his brass section taking on the instantly recognizable melody. The title track is one of two completely original compositions. It’s essentially a musical impression of Lincoln’s address. Based on the flowery language used in its final paragraph, McCarthy assumed what preceded it would be just as stunning overall. But when he examined the other 45 minutes of the speech, he found it not as lyrical as the “better angels” section. “It’s really dry [and] straightforward,” he says. “I thought, Oh, God, people already know what I’m calling this project. What am I going to do?” But as he listened to recorded versions of the speech, three distinct personalities emerged: that of a lawyer, a president and simply a man. McCarthy presents these identities in three clearly defined sections. The first suggests Lincoln as lawyer. The fast-paced opening section features a scintillating flugelhorn solo from trumpeter Bill Mobley, which mimics the verbose language of legalese. Next, we meet Lincoln as president, in which the horns and piano jockey for dominance, much like the North and South at the beginning of his first term. The third section, markedly slower and contemplative, gives us Lincoln as a person. SEEKING ANGELS

» P.68

GOT MUSIC NEWS? JORDAN@SEVENDAYSVT.COM

Sabouyouma

S UNDbites

News and views on the local music scene BY J O R D A N A D A MS

FRI 8.18

104.7 The Point welcomes

G. Love & Special Sauce

LUKE AWTRY PHOTOGRAPHY

Hackensaw Boys

R.O.C. Out

BiteTorrent

» P.69

SUN 8.20

99.9 The Buzz welcomes

WED 8.23

Stick Men

THU 8.24

Bonobo

SAT 8.26

The London Souls, Con Brio

FRI 9.01

In The Valley Below Flagship

feat. Members of King Crimson

99.9 The Buzz welcomes

Badfish: A Tribute to Sublime Seamus the Great

FRI 9.01

Burlington Blackout:

SAT 9.02

WOKO welcomes

WED 9.06

Reign One, Abstractivve, Kastaway, DJVU

Adam Wakefield Joe McGinness

Perpetual Groove

JUST ANNOUNCED: 9/12 9/30 10/29 2/10

Big Boi Cabinet Dopapod & The Motet Winter is a Drag Ball

1214 Williston Road, South Burlington 802-652-0777 @higherground @highergroundmusic

4V-HG081617.indd 1

MUSIC 67

SOUNDBITES

Gavin DeGraw

SEVEN DAYS

The Turning Point Center of Chittenden County hosts the Abbey Road to Recovery on Saturday, August 19, at Club Metronome in Burlington. Turning Point is a nonprofit organization that offers support and services to those who struggle with addiction. Though not affiliated with any particular 12-step program, it aims to “offer a variety of opportunities and supports to help create an encompassing path to recovery for each individual.” Those offerings include

SUN 8.20

08.16.17-08.23.17

to create and implement women’s empowerment and reproductive health programs. “We’re [starting] a Vermont health care program, as well,” she said, explaining that R.O.C. will work to provide free dental care for all refugees in Vermont. “We’re [also] working on relationships with a bunch of major technology companies,” Meyer added. So, to sum up, Meyer is one of the most inspiring, accomplished and allaround badass people I’ve encountered lately. Her organization is doing exactly what we should all be doing: building bridges and supporting vulnerable people in our community and beyond. For more information about R.O.C., visit refugeeoutreachclub.org.

Valley Queen

SEVENDAYSVT.COM

Hello, friends. I’m at a loss for words after the (unfortunately) all-toobelievable bullshit that went down in Charlottesville, Va., last weekend. Feeling tongue-tied is shitty for a writer. But you know what’s even shittier than that? Hatred, bigotry, ignorance and intolerance. But, since this is a music column and not a political one, I’ll segue out of what could become an incensed rant and instead focus on a pretty cool benefit concert happening this week. Refugee Outreach Club, a Chittenden County organization, is hosting its firstever public benefit concert on Friday, August 18, at ArtsRiot in Burlington. Burlington-based West African funkfusion band SABOUYOUMA provide entertainment. If you haven’t laid your eyes and ears on their energetic blend of traditional polyrhythms and reggaeinfused jams, this is an especially worthwhile time to do so. “We know firsthand the incredible education and experience that culture exchange can provide,” writes Sabouyouma drummer and manager JESSE ROSENFIELD in an email to Seven Days. Given the club’s mission, it seems like a perfect match. R.O.C. began in the spring of 2015 as a student-led club at Champlain Valley Union High School and has since become a thriving, fully licensed

501(c)(3) nonprofit. Its founder and executive director, 18-year-old NATALIE MEYER, started the organization as a school club during her sophomore year. She’d spent time abroad in Ghana with Global Leadership Adventures, which connects teenagers with volunteer opportunities all over the world. Seven Days rec ently caught up with Meyer by phone. “I wanted to get high school kids involved in the international community,” she said. But she had no idea how quickly the club would expand. “In the fall of 2015, we had two more chapters,” Meyer explained. The current roster includes five high schools and one college: CVU, Mount Mansfield Union High School, South Burlington High School, Rice Memorial High School, Stowe High School and Middlebury College. “I did not see any of this happening when I started the club,” Meyer added. R.O.C. currently operates the Heritage Learning Program through which tutors teach refugee students in the languages of their home countries. It also provides a cultural exchange program through which R.O.C. chapters connect with African students via Skype in an effort to build international relationships. Earlier this year, Meyer returned to Ghana and worked with the aid organization Village Exchange Ghana

WED 8.16

8/15/17 5:40 PM

music

CLUB DATES NA: NOT AVAILABLE. AA: ALL AGES.

WED.16

outside vermont

CITIZEN CIDER: Brett Hughes (country), 6 p.m., free.

NAKED TURTLE: Jay Lesage and Craig Hurwitz (rock), 6 p.m., free.

MONOPOLE: Open Mic with Lucid, 10 p.m., free.

burlington

THE DAILY PLANET: Seth Yacovone (blues), 8 p.m., free.

THU.17

JP’S PUB: Karaoke, 10 p.m., free. JUNIPER: Salsa with Son De Los Montes (jazz), 8:30 p.m., free.

burlington

THE DAILY PLANET: The Hot Pickin’ Party (bluegrass), 8 p.m., free.

LEUNIG’S BISTRO & CAFÉ: Cody Sargent Trio (jazz), 7 p.m., free. LIGHT CLUB LAMP SHOP: Irish Sessions (traditional), 7 p.m., free. Melodious Zach (pop, soul), 9 p.m., free.

LEUNIG’S BISTRO & CAFÉ: George Petit Trio (jazz), 7 p.m., free.

NECTAR’S: Vinyl Night with DJ Disco Phantom (eclectic), 6 p.m., free. Electric Love Machine, Zach Rhoads Band (electronica, funk), 9 p.m., free/$5. 18+.

LIGHT CLUB LAMP SHOP: Sammich (jam), 10 p.m., $5.

RADIO BEAN: Rob Jennings (rock), 6 p.m., free. Dan Ryan Express (jazz), 7:30 p.m., free. Les Frères Bandini (Americana), 10 p.m., free. Adventure Dog (rock), midnight, free.

SEVENDAYSVT.COM

NECTAR’S: Trivia Mania, 7 p.m., free. Dr. No, Balkun Brothers (funk, rock), 9 p.m., free/$5. 18+.

Garbage Island Punk, avant-garde, metal, hardcore and anti-music:

All of these descriptors have been applied to Louisville, Ky., outfit TROPICAL TRASH, and all are accurate. Whether creating warped, blistering soundscapes or monolithic, wall-

PHO NGUYEN: Karaoke with DJ Walker, 8 p.m., free. RADIO BEAN: Nutria (jazz), 7:30 p.m., free. James Harvey Trio (jazz), 8:30 p.m., free. Intrepid Travelers (jam), 11 p.m., $5.

of-sound bangers, the quartet concocts a stylistic hodgepodge, leaving little space for anything other than unadulterated wrath. Their latest EP, Decisions’ Empty Nest, is a

RED SQUARE: Ira Friendman Trio (jazz), 7 p.m., free. D Jay Baron (mashup, hip-hop), 11 p.m., free.

THE SKINNY PANCAKE (BURLINGTON): Ed Set (eclectic), 7 p.m., free.

piercing exercise in chaos and vitriol. In just under eight minutes, it launches a sonic

RED SQUARE BLUE ROOM: DJ Cre8 (hip-hop), 10 p.m., free.

VERMONT COMEDY CLUB: Standup Open Mic, 7 p.m., free. Hump Night! (improv), 9 p.m., free.

on Friday, August 18, at the Monkey House in Winooski. Local folk experimentalist WREN

HIGHER GROUND SHOWCASE LOUNGE: Valley Queen (folk, rock), 8 p.m., $10/12.

08.16.17-08.23.17

FRI.18 // TROPICAL TRASH [PUNK, EXPERIMENTAL]

MANHATTAN PIZZA & PUB: Air Looms (progressive electrofunk), 10 p.m., free.

RED SQUARE: Roughhead Blenny (rock), 7 p.m., free. DJ Cre8 (hip-hop), 11 p.m., free.

chittenden county

SEVEN DAYS

JP’S PUB: Karaoke, 10 p.m., free.

MANHATTAN PIZZA & PUB: Open Mic with Andy Lugo, 9 p.m., free.

RÍ RÁ THE IRISH LOCAL & WHISKEY ROOM: Reagh Greeneaf Jr. and Gypsy Reel (folk), 7:30 p.m., free.

68 MUSIC

DRINK: BLiNDoG Records Acoustic Sessions, 5 p.m., free.

MONKEY HOUSE: Intrepid Travelers (jam), 8:30 p.m., $3/8. 18+. STONE CORRAL BREWERY: Bluegrass Session, 7 p.m., free.

assault with heaping portions of distortion and overdrive. Rock out with Tropical Trash KITZ opens.

barre/montpelier

BAGITOS BAGEL AND BURRITO CAFÉ: Siena Facciolo (singersongwriter), 6 p.m., free. SWEET MELISSA’S: D. Davis (acoustic), 5:30 p.m., donation. John Lackard Blues Jam, 8 p.m., donation. WHAMMY BAR: Open Mic, 7 p.m., free.

Seeking Angels « P.66 Justin Kauflin’s sorrowful piano work represents Honest Abe’s turmoil as he prepared to take office in a divided nation. McCarthy is honest about the era’s racially charged music. One of the project’s notable inclusions is a reworking of “I Wish I Was in Dixie’s Land,” or “Dixie,” as it’s most commonly known. The song is inextricably linked to minstrelsy and is generally considered to be one of the most racist songs in the American canon. While it might have been easy to simply ignore the infamous ditty, McCarthy chose to examine its history. “It’s essentially an anthem that attaches itself to the Confederacy,” he said. “In a lot of ways, it would be a big omission to not approach this song.” McCarthy did so respectfully. The liner notes

stowe/smuggs

MOOGS PLACE: The Accafella does Elvis (a cappella, Elvis Presley tribute), 6:30 p.m., free. Lesley Grant (Americana), 8 p.m., free.

middlebury area CITY LIMITS NIGHT CLUB: Karaoke, 9 p.m., free.

TWO BROTHERS TAVERN: Trivia Night, 7 p.m., free. Open Mic Night, 9 p.m., free.

champlain islands/northwest

BAYSIDE PAVILION: The Starline Rhythm Boys (honky-tonk, rockabilly), 6 p.m., free. NORTH HERO HOUSE INN & RESTAURANT: Bob Gagnon Duet (jazz), 6:30 p.m., free.

northeast kingdom PARKER PIE CO.: Trivia Night, 7 p.m., free.

acknowledge the song’s racist connotations but also point out the song’s murky origins. Its credited author, Daniel Emmett, didn’t intend for it to become the anthem of the Confederacy. The notes also mention that an African American minstrel band may have, in fact, penned the song as a cheeky and subversive comment on slave life. “We need reminders every now and then of that history, and it’s OK to talk about it in an honest way,” said McCarthy. His reinventions, particularly “Dixie,” aren’t an attempt to rewrite history but rather to create something new and beautiful out of the music of a particularly turbulent time. On Better Angels, he succeeds. “What I like about [McCarthy’s] interpretation — I think it can and does pertain to what art can do,” Jackson told Seven Days in a phone interview. “[McCarthy’s]

SIDEBAR: Ugly Sun, the Hydes, Gestalt (indie), 10 p.m., free. THE SKINNY PANCAKE (BURLINGTON): Les Frères Bandini (country), 7 p.m., free. THE SPOT ON THE DOCK: Summer Breeze with DJ Craig Mitchell (hits), 5:30 p.m., free. VERMONT COMEDY CLUB: Steve Lemme (standup), 7:30 p.m., $15-27. The Daily Grind: Jer Coons (improv), 9 p.m., $5.

chittenden county BACKSTAGE PUB: Trivia, 9:30 p.m., free.

ON TAP BAR & GRILL: Jenni Johnson & the Jazz Junketeers, 7 p.m., free.

STONE CORRAL BREWERY: Devon McGarry (singersongwriter), 7 p.m., free.

barre/montpelier

CHARLIE-O’S WORLD FAMOUS: Grant Jones (Americana), 9 p.m., free. SWEET MELISSA’S: David Langevin (ragtime), 6 p.m., donation. Erin Cassels-Brown (indie folk), 8 p.m., donation.

stowe/smuggs

MARTELL’S AT THE RED FOX: Open Mic & Jam Session, 9 p.m., free. MOOGS PLACE: Open Mic with Allen Church, 8:30 p.m., free. STOWE BOWL: Comedy Night featuring Al Park (standup), 7:30 p.m., $25.

mad river valley/ waterbury ZENBARN: Matt Townshend (indie rock), 8 p.m., free.

middlebury area CITY LIMITS NIGHT CLUB: Aliendog (rock), 8 p.m., free.

TWO BROTHERS TAVERN: Summer Salsa Series with DJ Hector, 9 p.m., free.

champlain islands/northwest TWIGGS — AN AMERICAN GASTROPUB: Sergio Torres (covers), 7 p.m., free.

outside vermont

MONOPOLE: Shane Cariffe and Fertile Soil (folk-rock), 9 p.m., free. OLIVE RIDLEY’S: Karaoke with DJ Jon Berry & DJ Coco, 9 p.m., free.

FRI.18

burlington

ARTSRIOT: Refugee Outreach Club Fundraiser featuring Sabouyouma (West African fusion), 9 p.m., $15. FRI.18

» P.70

relationship to that quote as an American and as someone who’s endeavoring to interpret music from a [historical] period — he came up with a brilliant and substantive take on what Lincoln was saying.” “I think humans are capable of really wonderful things and really terrible things,” said McCarthy. “The human mind [should be] put toward the betterment of humanity — not for the sake of personal gain but for the sake of moving our evolution forward. That’s the message I take from Lincoln.”  Contact: jordan@sevendaysvt.com

INFO The Brian McCarthy Nonet presents The Better Angels of Our Nature on Friday, August 18, 7 p.m., at the Highland Center for the Arts in Greensboro. $25/10. AA. highlandartsvt.org

GOT MUSIC NEWS? JORDAN@SEVENDAYSVT.COM

The Roots

JFAM MTN. JAM MUSIC SERIES 49 Old Main St., Jeffersonville 5:30pm - 8pm

8/16: The Stragglers 8/23: Duncan MacLeod 8/30: John Lackard Blues Band Sponsored by Cambridge Arts Council, Great Big Graphics, N.A. Manosh, G.W. Tatro Construction, Rock Art Brewery, JFAM, Inc., Kingdom Creamery of VT

LEARN LAUGH

16t-jeffersonvillefarmersmarket081617.indd 1

8/14/17 10:27 AM

LOUNGE

THIS WEEK

UNDbites

THU 17 | FRI 18 | SAT 19

STEVE

C O NT I NU E D F RO M PA G E 6 7

THU 24 | FRI 25 | SAT 26

RACHEL

FEINSTEIN THE DAILY GRIND 8/17 FT. MADAILA’S JER COONS

ORDER YOUR TICKETS TODAY! (802) 859-0100 | WWW.VTCOMEDY.COM 101 main street, BurlingtoN

Listening In If I were a superhero, my superpower would be the ability to get songs stuck in other people’s heads. Here are five songs that have been stuck in my head this week. May they also get stuck in yours. Follow sevendaysvt on Spotify for weekly playlists with tunes by artists featured in the music section. THE POLICE, “King of Pain” CHERRY GLAZERR, “Told You I’d Be With

the Guys” FRIDGE AND THE SPIN$, “Bom Dizzy” MIIKE SNOW, “I Feel the Weight” SHEER MAG, “Can’t Stop Fighting”

Untitled-10 1

obsessed?

8/14/17 10:41 AM

Find, fix and feather with Nest Notes — an e-newsletter filled with home design, Vermont real estate tips and DIY decorating inspirations.

MUSIC 69

The Peacham Acoustic Music Festival returns for its seventh consecutive year. Nestled between the Groton State Forest and Danville in Vermont’s Northeast Kingdom, Peacham is a darling little slice of rural Vermont and an all-too-perfect place for a festival that focuses on old-time music, dance and culture. The festival starts on Friday afternoon, August 18, and runs through Saturday evening at various locations around Peacham’s town center. You’ll definitely want to scour the itinerary, because there’s a heck of a lot to see and do. You can take a crash course in contra dancing, get your

NEXT WEEK

SEVEN DAYS

Woodchuck Cider has been one of the area’s top purveyors of tasty, fermented libations since the early ’90s — long before the 21st-century cider craze. And for the past few summers, the cidery has hosted Ciderstock, a single-day music festival at its Middlebury facility. This year’s “ciderbration” is on Saturday, August 19. In summers past, the fest has packed in some seriously huge talent, such as CAGE THE ELEPHANT, DIRTY HEADS and SUBLIME WITH ROME. But this year’s headliner is probably its most badass entry to date: the ROOTS. As one of the most visible currently active hip-hop

hands on some new music makers in the annual “instrument petting zoo” and, as always, see a ton of music. Highlights include Nashville picker MEAN MARY, Brattleboro vocal folk trio LOW LILY and eclectic Burlington roots trio PETE’S POSSE. And speaking of Pete’s Posse, be on the lookout for a review of their new album, The Conversation, in next week’s paper. Be sure to check out pamfest.com for more info and a full schedule of events.

08.16.17-08.23.17

groups — they’re the house band on “The Tonight Show Starring JIMMY FALLON” — it’s an impressive get. How do you like them apples? Core members BLACK THOUGHT and QUESTLOVE have been innovative voices in hip-hop since the band’s inception in the late ’80s, and a new record is allegedly on its way sometime later this year. Maybe they’ll grace us with some new music? Rounding out the other top slots are two sundrenched, Californiabased projects: rasta-rockers PEPPER, and the more traditional reggae band TRIBAL SEEDS. Opening duties fall to Burlington alt-country supergroup the WELTERWEIGHTS. Visit woodchuck.com/ciderstock for more info.

SEVENDAYSVT.COM

athletics, open mic nights, art shows, access to technology and, of course, music events. The alcohol-free, sober event features STUDIO TWO, the Boston area’s premier BEATLES tribute act. This particular Fab Four focuses on the band’s earlier, pre-Sgt. Pepper’s Lonely Hearts Club Band era — which is probably a good fit for this shindig, since the Beatles’ later years are sometimes defined by their dalliances into certain mind-altering substances. Methinks “Lucy in the Sky With Diamonds” would not be a great choice for the center’s target audience, even if that song isn’t really about what most people think it is. Visit turningpointcentervt.org for more information.

LEMME

11/19/15 11:05 AM

music

CLUB DATES NA: NOT AVAILABLE. AA: ALL AGES.

SUN.20, MON.21 // TINDERBOX CIRCUS SIDESHOW [CABARET]

THE ROOTS PEPPER TRIBAL SEEDS THE WELTERWEIGHTS Cold Cider! FoOd Trucks! Games! Fireworks! Gates open @ 2PM, Music starts @ 3PM

Freaked Out With a flair for the dark and twisted,

AUG. 19, 2017

The WoOdchuck Cidery MidDlebury, VERMONT

TINDERBOX CIRCUS

SIDESHOW provide all of the whimsy and spectacle of a circus sideshow with a subversive,

countercultural edge. Pierced and tattooed troupe members perform grotesque acts of amusements. Captain Darron von Awesome brazenly enacts the “human blockhead,” in

Get tickets at woOdchuck.com/ciderstock or at the Cidery located at 1321 Exchange St, MidDlebury, VT

which he drives nails, spikes and an electric power drill directly into his nasal cavity, while Trashique performs feats of strength using only her teeth. With elements of burlesque and vaudeville, it’s a cheeky dive into a gruesome and eccentric form of performance art. If you dare, check out Tinderbox Circus Sideshow on Sunday, August 20, at Radio Bean

Untitled-5 1

7/13/17 12:09 PM

in Burlington, and Monday, August 21, at Sweet Melissa’s in Montpelier. FRI.18

« P.68

CLUB METRONOME: A Very Special Edition of Mi Yard Reggae Night featuring DJs Big Dog and Jahson, 9 p.m., $5. JP’S PUB: Karaoke, 10 p.m., free.

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

JUNIPER: Eric George (country), 9 p.m., free. LIGHT CLUB LAMP SHOP: Avery Cooper Quartet (jazz, funk), 7 p.m., free. Eric Sommer (country), 9 p.m., free. Taka (vinyl DJ), 11 p.m., $5. MANHATTAN PIZZA & PUB: Anaday (rock, blues), 10 p.m., free. NECTAR’S: Seth Yacovone (solo acoustic blues), 7 p.m., free. The Edd, Swimmer (jam), 9 p.m., $5.

SELLING TICKETS FOR YOUR NEXT EVENT? Fundraisers • Festivals • Plays • Sports • Concerts WE CAN HELP!

No cost to you • Local support • Low customer fees Built-in promotion • Custom options

70 MUSIC

865-1020, ext. 37 or tickets@sevendaysvt.com sevendaystickets.com

RÍ RÁ THE IRISH LOCAL & WHISKEY ROOM: Supersounds DJ (top 40), 10 p.m., free. RADIO BEAN: Friday Morning Sing-Along with Linda Bassick & Friends (kids’ music), 11 a.m., free. Lindsay Foote (folk, roots), 7 p.m., free. David Lyden (rock, pop), 8:30 p.m., free. The Mangroves (rock, funk), 10 p.m., $5. People Like You (indie rock), 11:30 p.m., $5. RED SQUARE: Sweet William and Sugar Cone Rose (swing), 4 p.m., free. Josh Panda (rock, soul), 7 p.m., $5. DJ Craig Mitchell (house, hits), 11 p.m., $5. RED SQUARE BLUE ROOM: DJ KermiTT (hits), 10 p.m., $5. SIDEBAR: DJ Cre8 and DJ Big Dog (hip-hop), 10 p.m., free.

4t-tickets-generic.indd 1

4/12/16 3:49 PM

THE SKINNY PANCAKE (BURLINGTON): Phantom Airwave (progressive funk-rock), 8 p.m., free. THE SPOT ON THE DOCK: T.G.I.F. with DJ Fattie B (hits), 5:30 p.m., free. THE TAP ROOM AT SWITCHBACK BREWING: Coon Hill John (Americana), 6 p.m., free. VERMONT COMEDY CLUB: Back of the Class (improv), 6:30 p.m., free. Steve Lemme (standup), 7:30 & 9:30 p.m., $15-27.

chittenden county

BACKSTAGE PUB: Karaoke with Jenny Red, 9 p.m., free. HIGHER GROUND BALLROOM: G. Love & Special Sauce, Hackensaw Boys (hip-hop, blues), 8:30 p.m., $25/30. JERICHO CAFÉ & TAVERN: Rushmore (rock), 7 p.m., free. MONKEY HOUSE: Dark Star Project (Grateful Dead tribute), 5 p.m., free. Tropical Trash, Wren Kitz (punk, experimental), 9 p.m., $3/8. 18+. ON TAP BAR & GRILL: Leno, Cheney & Young (rock), 5 p.m., free. Roy & the Wrecks (rock), 9 p.m., free. STONE CORRAL BREWERY: Mike Brewster (blues, rock), 7 p.m., free. WATERWORKS FOOD + DRINK: DJ Disco Phantom (eclectic dance), 9 p.m., free.

barre/montpelier

BAGITOS BAGEL AND BURRITO CAFÉ: Dave Loughran (acoustic rock), 6 p.m., free. CHARLIE-O’S WORLD FAMOUS: Lesli Sanders (acoustic rock), 6 p.m., free. Lightcrusher, Hellascope (metal), 9 p.m., free. DEMENA’S: Joe Moore (jazz), 6 p.m., free. POSITIVE PIE (MONTPELIER): Binger (jam), 10 p.m., $5. SWEET MELISSA’S: Honky Tonk Happy Hour with Mark LeGrand, 5:30 p.m., donation. The Starline Rhythm Boys (rockabilly), 9 p.m., $5.

stowe/smuggs

MOOGS PLACE: Chris Lyon (solo acoustic), 6 p.m., free. Gary Wade (blues, rock), 9 p.m., free.

middlebury area

CITY LIMITS NIGHT CLUB: DJ Ryan Donnelly (hits), 9:30 p.m., free. TWO BROTHERS TAVERN: One For the Road (classic rock), 9 p.m., $3.

champlain islands/northwest TWIGGS — AN AMERICAN GASTROPUB: Cooper & Lavoie (blues), 7 p.m., free.

outside vermont

MONOPOLE: Intrepid Travelers (jam), 10 p.m., free.

GOT MUSIC NEWS? JORDAN@SEVENDAYSVT.COM

MONOPOLE DOWNSTAIRS: Happy Hour Tunes & Trivia with Gary Peacock, 5 p.m., free. NAKED TURTLE: Bruce and Bill (rock), 6:30 p.m., free. NightHawk (rock), 10 p.m., free. OLIVE RIDLEY’S: All Request Night with DJ Skippy (hits), 10 p.m., free. THE SKINNY PANCAKE (HANOVER): Flipside (blues, soul), 8:30 p.m., free.

SAT.19

burlington

ARTSRIOT: Vermont Burlesque Festival’s Hot Summer Showcase, 8:30 p.m., $20/35. BLEU NORTHEAST SEAFOOD: Paul Asbell (jazz), 8:30 p.m., free. CLUB METRONOME: Turning Point Center of Chittenden County Presents: The Abbey Road to Recovery featuring Studio Two - the Beatles Tribute, the Adams Band, 6:30 p.m., $15/18. Retronome With DJ Fattie B (’80s dance party), 9 p.m., free/$5. JP’S PUB: Karaoke, 10 p.m., free. LIGHT CLUB LAMP SHOP: Taka (vinyl DJ), 11 p.m., $5. MANHATTAN PIZZA & PUB: The Decoys (rock), 10 p.m., free. NECTAR’S: Justin LaPoint (singer-songwriter), 7 p.m., free. RÍ RÁ THE IRISH LOCAL & WHISKEY ROOM: DJ Dodg3r (EDM, hits), 10 p.m., free.

RED SQUARE: The Jeff Salisbury Band (blues), 3 p.m., free. The Full Cleveland (yacht rock), 7 p.m., $5. Mashtodon (hip-hop), 11 p.m., $5. RED SQUARE BLUE ROOM: DJ Raul (hits), 6 p.m., $5. DJ Reign One (EDM), 11 p.m., $5.

THE SKINNY PANCAKE (BURLINGTON): Maple Street Six (jazz), 8 p.m., free. SMITTY’S PUB: The Hubcats (rock), 8 p.m., free.

VERMONT COMEDY CLUB: Steve Lemme (standup), 7:30 & 9:30 p.m., $15-27.

chittenden county BACKSTAGE PUB: incaHOOTS (rock), 9 p.m., free.

JERICHO CAFÉ & TAVERN: Old Tone String Band (bluegrass), 7 p.m., free.

» P.72

The Edd, I’m With Bob (SELF-RELEASED, CD, DIGITAL DOWNLOAD)

I don’t smoke weed anymore. And I haven’t touched hallucinogens for the better part of a decade. I’m by no means a teetotaler; it’s just that at some point the mind-bending effects of those particular substances simply lost their appeal. But as I delved into the disorienting grooves of the Edd’s debut fulllength, I’m With Bob, I was struck by a long-dormant compulsion to get twistedly high. Actually, even listening stone-cold sober left me feeling dazed and confused — though not in a bad way. Before the “Just Say No” crowd gets its pleated khakis in a bunch, no, I’m not advocating drug use. And before the prickly jam crowd doth protest too much that one need not be fucked up to enjoy multigenre hybrid bands, I’m not saying that, either. (But also: Bahahahahaha!) Rather, it’s that the Burlington quartet

specializes in a deeply heady brand of largely instrumental rock that induces a sort of psychological delirium, whether you’re straight or not. It’s a neat trick. The Edd’s compositions rely heavily on repetition. Often, as on the fittingly titled opener “Spastic Tactics,” this involves bassist Greg Domina and drummer Dominic Metcalfe forging an insistent, hypnotic groove. But the shit really kicks in when the synths and guitar show up. Here, guitarist Win Haas doubles Domina’s ominous bass line, which allows John Nummy to get cosmic with cascading blooms of dizzying keyboard sounds. The effect is something like the sonic equivalent of a lava lamp — alluring and weirdly soothing. It’s a feint. Midway through the song, the band explodes with those aforementioned tactics, shattering the calm with a battalion of aggressively angular lines. Tangible melodies, while present, are often woven into the Edd’s kaleidoscopic

arrangements. The band’s atmospheric soundscapes affect the listener more in mood and scope than with memorable lines. Think Ennio Morricone spaghetti-Western soundtracks for sci-fi video games. “Stapler in the Sky,” for example, sounds like it was conceived following a late-night Mega Man marathon on Nintendo. Illusory shenanigans aside, the Edd do showcase a strong range and diversity of styles, as well as admirable chops. The 12-minute “Alien Cats” vacillates fluidly between Zappa-inspired riffs and a woozy Tejano vibe. “Notebook,” one of the few tunes with vocals, veers into polymetric math-rock territory. “Jungle Rot” is a gleefully dark and schizophrenic prog-rock romp. I’m With Bob is a psychedelic musical rabbit hole. Fortunately, the Edd’s mindaltering charms should work on fans both temperate and otherwise. I’m With Bob by the Edd is available at theedd.bandcamp.com. The band plays on Friday, August 18, at Nectar’s in Burlington, with Swimmer.

CHRIS FARNSWORTH

DAN BOLLES

YOU A VT ARTIST OR BAND? SEND US YOUR MUSIC! DIGITAL: MUSIC@SEVENDAYSVT.COM; GET YOUR MUSIC REVIEWED: ARE SNAIL MAIL: MUSIC C/O SEVEN DAYS 255 S. CHAMPLAIN ST., SUITE 5, BURLINGTON, VT 05401

MUSIC 71

SAT.19

Authenticity and punk rock are strange bedfellows. I don’t know what “real” punk is anymore — if I ever did. I know just enough not to believe anyone who tells me what it is, unless they can prove it. More than any other genre, punk has to feel like itself. Feels Like a Thousand Years, the new release from Comrade Nixon, absolutely feels like a punk record in every sense of the word. It’s abrasive, political, raw and, occasionally, just straight-up sloppy — the last of which somehow comes across as charming. Fronted by vocalist and guitarist Andrew Wilson — who also runs Rat Pâté Records, which released the album — the Plattsburgh-based band is all energy and froth. Matt Hall, of fellow Lake City punks Marco Polio, handles most of the drums. There’s no bass guitar, just Wilson playing

lends power and urgency to his songs. He sometimes eschews melody for bombast, but rarely to the music’s detriment. Perhaps the following statement could be considered a brand of recency bias, but listening to this record while Charlottesville, Va., descended into chaos and the president was tweeting about nuclear weapons as one might discuss lunch options gives Feels Like a Thousand Years an added layer of primacy. A thick crust of dread, of impending violence, hangs over the songs. That’s not to say the record isn’t fun — it’s just a sort of nihilistic abandonment kind of fun. Comrade Nixon haven’t changed much since last year’s full-length debut, Wine and Circuses; the bullet points are generally the same. A tad more surf punk slips in, as evinced by the frenetic “Kaputt.” But, by and large, the band is all about blistering, seething speed and barely controlled bursts of fury. Feels Like a Thousand Years by Comrade Nixon is available at comradenixon. bandcamp.com. Check out the band next on September 14 at the Monopole in Plattsburgh, with Hill Haints.

SEVEN DAYS

THE SPOT ON THE DOCK: Reggae Brunch with DJs Big Dog and Jahson, 11 a.m., free.

(RAT PÂTÉ RECORDS, DIGITAL DOWNLOAD)

like someone slipped Dick Dale acid and told him that there is no God. Hall viciously pummels his kit throughout, pushing the tempo right to the red line. The pace doesn’t let up once Sam Egan takes over on the skins for the last four tracks. Feels Like a Thousand Years is essentially a live record, tracked in a single day at Robot Dog Studio. Producer Ryan Cohen treats the material the way one should. The record is so warts-andall that after the song “Great Satan” wraps, Hall can be heard admitting, “That was shoddy in some spaces, we’re gonna re-do it.” They don’t, and that’s perfect. Thirteen tracks fly by in a half hour. With no letup in pace, some songs sort of smoosh together like marshmallows — but there are plenty of high points. “Andrew’s Black Book” has a sinister, Fugazi-esque drive. Wilson sounds positively deranged as he screams, “Burn the witch, burn the witch, cast your spell upon the world!” He sings with a breathless desperation that

08.16.17-08.23.17

SIDEBAR: Noise Ordinance presents J Bengoy, Julia Cesar, Tar Iguana (indie), 10 p.m., free.

Comrade Nixon, Feels Like a Thousand Years

SEVENDAYSVT.COM

RADIO BEAN: AM Radio (Americana), noon, free. Ben Guihan (folk), 7 p.m., free. Rick from Pile with Footings, ouzkxqlzn (ambient, experimental), 8 p.m., $5. Son Lightning (psychedelic blues), 10 p.m., $5. Voodoo Visionary (jam), 11:30 p.m., $5.

REVIEW this

music SAT.18

CLUB DATES NA: NOT AVAILABLE. AA: ALL AGES.

« P.71

ON TAP BAR & GRILL: Jeff & Jess (rock), 5 p.m., free. Third Shift (rock), 9 p.m., free.

MANHATTAN PIZZA & PUB: Open Mic with Andy Lugo, 9 p.m., free. NECTAR’S: Vinyl Night with DJ Disco Phantom (eclectic), 6 p.m., free. Peace in the Valley (jam), 9 p.m., free/$5. 18+.

TUE.22, WED.23 // DAVINA AND THE VAGABONDS [JAZZ, BLUES]

STONE CORRAL BREWERY: Southtown Bluegrass, 7 p.m., free.

RÍ RÁ THE IRISH LOCAL & WHISKEY ROOM: Reagh Greeneaf Jr. and Gypsy Reel (folk), 7:30 p.m., free.

barre/montpelier

BAGITOS BAGEL AND BURRITO CAFÉ: Irish Session, 2 p.m., donation. Sophia Mueller and Anais Dutton (Americana, jazz), 6 p.m., free.

RADIO BEAN: Stolen Moments (jazz), 7 p.m., free. Joe Kranz (folk, blues), 9 p.m., free. The Basement Cats (indie rock), 10:30 p.m., free. RED SQUARE: Gneiss (jam), 7 p.m., free. DJ Cre8 (hip-hop), 11 p.m., free.

CHARLIE-O’S WORLD FAMOUS: The Jeff Salisbury Band (blues), 9 p.m., free.

SIDEBAR: Happy Folk (folk), 7 p.m., free. Fatty Shay (house), 10 p.m., free.

SWEET MELISSA’S: Andy Pitt (blues, folk), 6 p.m., donation. DUROC (’80s covers), 9 p.m., donation.

THE SKINNY PANCAKE (BURLINGTON): Ed Set (eclectic), 7 p.m., free.

stowe/smuggs

VERMONT COMEDY CLUB: Standup Open Mic, 7 p.m., free. Hump Night! (improv), 9 p.m., free.

MOOGS PLACE: Blue Fox (blues), 9 p.m., free.

middlebury area

TWO BROTHERS TAVERN: Fiddle Witch (bluegrass), 6 p.m., free. Karaoke with DJ Chauncey, 9 p.m., free.

champlain islands/ northwest

woman Davina Lozier keeps things bright and bubbly as she flips from singing to scatting with effortless panache.

Hanover, N.H.

THE SKINNY PANCAKE (HANOVER): River Glen with members of the Blackberry Bushes (folk, pop), 9 p.m., free. SEVENDAYSVT.COM

Twin Cities, the band’s sound comes straight out of New Orleans with sassy brass and thumping upright bass. Front

northeast kingdom

MONOPOLE: Theta (metal), 10 p.m., free.

08.16.17-08.23.17

VAGABONDS transport their audiences to the crowded, smoke-filled clubs of yesteryear. Though hailing from Minnesota’s

She can be both vulnerable and robust as she quivers, coos and belts in controlled, powerful bursts. Davina and the

outside vermont

SEVEN DAYS

DAVINA AND THE

TWIGGS — AN AMERICAN GASTROPUB: AmerikanaBlue (blues), 7 p.m., free.

PARKER PIE CO.: Session Americana (Americana, folk), 8 p.m., $15/20.

72 MUSIC

Minnesota Mavens Calling on a classic era of rhythm and blues, soul and jazz,

chittenden county

SUN.20 burlington

LIGHT CLUB LAMP SHOP: Game Night, 8 p.m., free. NECTAR’S: Mi Yard Reggae Night with DJs Big Dog and Jahson, 9:30 p.m., free/$3. 18+. RADIO BEAN: Pete Sutherland and Tim Stickle’s Old Time Session (traditional), 1 p.m., free. That Virginia (alternative), 7 p.m., free. Tinderbox Circus Sideshow (cabaret), 8 p.m., free. Joe Mansman & the Midnight Revival (rock), 10:30 p.m., free. RED SQUARE: Zach Rhoads Trio (funk), 7 p.m., free. DJ David Chief (dance), 11 p.m., free. THE SKINNY PANCAKE (BURLINGTON): Bluegrass Brunch, noon, $5-10 donation. VT Bluegrass Pioneers, noon, free. VERMONT COMEDY CLUB: Good Clean Fun! (family-friendly improv), 5:30 p.m., $5. Character Flaws: An Evening of Solo Comedy (sketch comedy), 7:30 p.m., $5. Mix Tape (improv), 8:30 p.m., free.

Vagabonds play on Tuesday, August 22, at ArtsRiot in Burlington, and Wednesday, August 23, at the Skinny Pancake in

chittenden county

HIGHER GROUND BALLROOM: Gavin DeGraw (soul, rock), 8 p.m., $25/38/110. HIGHER GROUND SHOWCASE LOUNGE: In the Valley Below, Flagship (alternative), 8 p.m., $12/15. MONKEY HOUSE: DMM Presents the Hydes, Cicero & the Orations, the Specs (indie), 8:30 p.m., $5.

barre/montpelier

NECTAR’S: Mr. Doubtfire, Humble Hero, Grand (punk), 9 p.m., free/$5. 18+. RADIO BEAN: AliT (singersongwriter), 7 p.m., free. VT Jazz Quartet (jazz), 8:30 p.m., free. Pandafan (alt-folk), 10 p.m., free. RED SQUARE: DJ KermiTT (hits), 10 p.m., free. RED SQUARE BLUE ROOM: DJ Robbie J (dance), 7 p.m., free. SIDEBAR: Family Night (open jam), 9 p.m., free.

BAGITOS BAGEL AND BURRITO CAFÉ: Bleecker & MacDougal (folk), 11 a.m., free.

THE SKINNY PANCAKE (BURLINGTON): Comedy & Crêpes (standup), 8 p.m., free.

SWEET MELISSA’S: Live Band Karaoke, 8 p.m., donation.

chittenden county

stowe/smuggs

BACKSTAGE PUB: Open Mic, 9:30 p.m., free.

MOOGS PLACE: Dan Hetheway (pop, rock), 6 p.m., free.

MONKEY HOUSE: Erin CasselsBrown (indie folk), 6 p.m., free.

outside vermont

barre/montpelier

THE SKINNY PANCAKE (HANOVER): Pickin’ Party with Dave Clark (bluegrass), 3 p.m., free.

MON.21 burlington

SWEET MELISSA’S: Tinderbox Circus Sideshow (cabaret), 8 p.m., donation.

stowe/smuggs

MOOGS PLACE: Seth Yacovone (solo acoustic blues), 7 p.m., free.

LIGHT CLUB LAMP SHOP: Lamp Shop Lit Club (open reading), 8 p.m., free. HNRY FLWR, Ziemba (pop, psychedelic), 10 p.m., free.

TUE.22

MANHATTAN PIZZA & PUB: Karaoke, 9:30 p.m., free.

ARTSRIOT: Davina and the Vagabonds (jazz, blues), 8:30 p.m., $12/15.

burlington

THE GRYPHON: P’tit Trio (jazz), 8 p.m., free.

LEUNIG’S BISTRO & CAFÉ: Will Patton (jazz), 7 p.m., free. LIGHT CLUB LAMP SHOP: Stephen Callahan Trio (jazz), 7 p.m., free. New Spine, Strange Loops (Americana, folk), 9:30 p.m., free. MANHATTAN PIZZA & PUB: Erin Cassels-Brown (country), 9:30 p.m., free. NECTAR’S: Troy Millette and Friends (rock), 7:30 p.m., free. ZAch Nugent’s Dead Disco (Grateful Dead tribute), 10 p.m., $10. RADIO BEAN: Honky Tonk Tuesday with Jukebox George & the Last Dimes, 10 p.m., $5. RED SQUARE: DJ A-RA$ (dance), 10 p.m., free. RED SQUARE BLUE ROOM: SVPPLY (hip-hop), 7 p.m., free. SIDEBAR: Seth Yacovone (blues), 7 p.m., free. Blackout Barbie & SVPPLY (hip-hop), 10 p.m., free.

chittenden county

ON TAP BAR & GRILL: Trivia with Top Hat Entertainment, 7 p.m., free. WATERWORKS FOOD + DRINK: Trivia Night, 7 p.m., free.

barre/montpelier

CHARLIE-O’S WORLD FAMOUS: DJ Jessbro Karaoke, 9 p.m., free. SWEET MELISSA’S: Michael T (folk), 7 p.m., donation. Open Mic, 7 p.m., donation.

stowe/smuggs

TRAPP FAMILY LODGE: Cooie Sings (Americana), 6 p.m., free.

mad river valley/ waterbury

ZENBARN: Comedy Night featuring Mike Lemme, Drew Dunn, Hilary Boone and Bitsy Biron (standup), 8 p.m., free.

middlebury area

HATCH 31: Erin Cassels-Brown (indie folk), 6 p.m., free. Kelly Ravin and Lowell Thompson (country), 7 p.m., free. TWO BROTHERS TAVERN: Karaoke with Roots Entertainment, 9 p.m., free.

outside vermont

OLIVE RIDLEY’S: Trivia Night, 7 p.m., free. THE SKINNY PANCAKE (HANOVER): Trivia Night, 7 p.m., free.

HIGHER GROUND SHOWCASE LOUNGE: Stick Men featuring King Crimson’s Tony Levin and Pat Mastellotto with Markus Reuter (progressive rock), 8 p.m., $25/27. WATERWORKS FOOD + DRINK: Caribbean Night with DJ C-LOW (reggae), 5 p.m., free.

barre/montpelier

SWEET MELISSA’S: D. Davis (acoustic), 5:30 p.m., donation. Robert Morgan (pirate chanties), 8 p.m., donation. WHAMMY BAR: Open Mic, 7 p.m., free.

stowe/smuggs

MOOGS PLACE: Christine Malcolm (folk), 8 p.m., free.

middlebury area CITY LIMITS NIGHT CLUB: Karaoke, 9 p.m., free.

TWO BROTHERS TAVERN: Trivia Night, 7 p.m., free. Open Mic Night, 9 p.m., free.

champlain islands/ northwest BAYSIDE PAVILION: The Starline Rhythm Boys (honky-tonk, rockabilly), 6 p.m., free. NORTH HERO HOUSE INN & RESTAURANT: Cooie & Skip (Americana), 6:30 p.m., free.

WED.23

northeast kingdom

CITIZEN CIDER: Brett Hughes (country), 6 p.m., free.

outside vermont

burlington

THE DAILY PLANET: Tom Pearo (ambient jazz), 8 p.m., free. JP’S PUB: Karaoke, 10 p.m., free. JUNIPER: The Ray Vega Jazz Quartet (jazz), 8:30 p.m., free. LEUNIG’S BISTRO & CAFÉ: Paul Asbell Trio (jazz), 7 p.m., free. LIGHT CLUB LAMP SHOP: Irish Sessions (traditional), 7 p.m., free. Sarah Potenza (roots, rock), 9:30 p.m., $10.

PARKER PIE CO.: Trivia Night, 7 p.m., free.

MONOPOLE: Open Mic with Lucid, 10 p.m., free. NAKED TURTLE: Jay Lesage and Craig Hurwitz (rock), 6 p.m., free. OLIVE RIDLEY’S: Completely Stranded (improv), 7:30 p.m., free. THE SKINNY PANCAKE (HANOVER): Davina and the Vagabonds (jazz, blues), 8 p.m., $18/20. 

VENUES.411 BURLINGTON

AMERICAN FLATBREAD, 115 St. Paul St., Burlington, 861-2999 ARTSRIOT, 400 Pine St., Burlington, 540 0406 AUGUST FIRST, 149 S. Champlain St., Burlington, 540-0060 BARRIO BAKERY & PIZZA BARRIO, 203 N. Winooski Ave., Burlington, 863-8278 BENTO, 197 College St., Burlington, 497-2494 BLEU NORTHEAST SEAFOOD, 25 Cherry St., Burlington, 854-4700 BRENNAN’S PUB & BISTRO, UVM Davis Center, 590 Main St., Burlington, 656-1204 CITIZEN CIDER, 316 Pine St., Burlington, 497-1987 CLUB METRONOME, 188 Main St., Burlington, 865-4563 THE DAILY PLANET, 15 Center St., Burlington, 862-9647 DOBRÁ TEA, 80 Church St., Burlington, 951-2424 DRINK, 133 St. Paul St., Burlington, 951-9463 ETHAN ALLEN PUB/PHO NGUYEN, 1130 North Ave., Burlington, 6584148 THE FARMHOUSE TAP & GRILL, 160 Bank St., Burlington, 859-0888 FINNIGAN’S PUB, 205 College St., Burlington, 864-8209 FOAM BREWERS, 112 Lake St., Burlington, 399-2511 THE GRYPHON, 131 Main St., Burlington, 489-5699 JP’S PUB, 139 Main St., Burlington, 658-6389 JUNIPER, 41 Cherry St., Burlington, 658-0251 LEUNIG’S BISTRO & CAFÉ, 115 Church St., Burlington, 863-3759

LIGHT CLUB LAMP SHOP, 12 N. Winooski Ave., Burlington, 6609346 MAGLIANERO CAFÉ, 47 Maple St., Burlington, 861-3155 MANHATTAN PIZZA & PUB, 167 Main St., Burlington, 864-6776 MUDDY WATERS, 184 Main St., Burlington, 658-0466 NECTAR’S, 188 Main St., Burlington, 658-4771 RADIO BEAN, 8 N. Winooski Ave., Burlington, 660-9346 RASPUTIN’S, 163 Church St., Burlington, 864-9324 RED SQUARE, 136 Church St., Burlington, 859-8909 RÍ RÁ THE IRISH LOCAL & WHISKEY ROOM, 123 Church St., Burlington, 860-9401 RUBEN JAMES, 159 Main St., Burlington, 864-0744 SIGNAL KITCHEN, 71 Main St., Burlington, 399-2337 SIDEBAR, 202 Main St., Burlington, 864-0072 THE SKINNY PANCAKE, 60 Lake St., Burlington, 540-0188 SOCIAL CLUB & LOUNGE, 165 Church St., Burlington SPEAKING VOLUMES, 377 Pine St., Burlington, 540-0107 SPEAKING VOLUMES, VOL. 2, 7 Marble Ave., Burlington, 540-0107 THE SP0T ON THE DOCK, 1 King St., Burlington, 540-1778 THE TAP ROOM AT SWITCHBACK BREWING, 160 Flynn Ave., Burlington, 651-4114 VERMONT COMEDY CLUB, 101 Main St., Burlington, 859-0100 THE VERMONT PUB & BREWERY, 144 College St., Burlington, 865-0500

CHITTENDEN COUNTY

BACKSTAGE PUB, 60 Pearl St., Essex Jct., 878-5494 GOOD TIMES CAFÉ, Rt. 116, Hinesburg, 482-4444 HIGHER GROUND, 1214 Williston Rd., S. Burlington, 652-0777 HINESBURGH PUBLIC HOUSE, 10516 Vt., 116 #6A, Hinesburg, 482-5500 JAMES MOORE TAVERN, 4302 Bolton Access Rd. Bolton Valley, Jericho, 434-6826 JERICHO CAFÉ & TAVERN, 30 Rte., 15, Jericho, 899-2223 MONKEY HOUSE, 30 Main St., Winooski, 655-4563 ON TAP BAR & GRILL, 4 Park St., Essex Jct., 878-3309 PARK PLACE TAVERN, 38 Park St., Essex Jct. 878-3015 ROZZI’S LAKESHORE TAVERN, 1022 W. Lakeshore Dr., Colchester, 863-2342 STONE CORRAL BREWERY, 83 Huntington Rd., Richmond, 434-5767 WATERWORKS FOOD + DRINK, 20 Winooski Falls Way, Winooski, 497-3525

BARRE/MONTPELIER

BAGITOS BAGEL AND BURRITO CAFÉ, 28 Main St., Montpelier, 229-9212 CAPITAL GROUNDS CAFÉ, 27 State St., Montpelier, 223-7800 CHARLIE-O’S WORLD FAMOUS, 70 Main St., Montpelier, 223-6820 DEMENA’S, 44 Main St., Montpelier, 613-3172 ESPRESSO BUENO, 248 N. Main St., Barre, 479-0896 GUSTO’S, 28 Prospect St., Barre, 476-7919 KISMET, 52 State St., Montpelier, 223-8646

MULLIGAN’S IRISH PUB, 9 Maple Ave., Barre, 479-5545 NORTH BRANCH CAFÉ, 41 State St., Montpelier, 552-8105 POSITIVE PIE, 20 State St., Montpelier, 229-0453 RED HEN BAKERY + CAFÉ, 961 US Route 2, Middlesex, 223-5200 THE SKINNY PANCAKE, 89 Main St., Montpelier, 262-2253 SWEET MELISSA’S, 4 Langdon St., Montpelier, 225-6012 THREE BEAN CAFÉ, 22 Pleasant St., Randolph, 728-3533 WHAMMY BAR, 31 W. County Rd., Calais, 229-4329

GREEN MOUNTAIN LOUNGE AT MOUNT ELLEN, 102 Forest Pl., Warren, 583-6300 HOSTEL TEVERE, 203 Powderhound Rd., Warren, 496-9222 SHEPHERDS PUB, Rt. 100, Waitsfield, 496-3422 THE RESERVOIR RESTAURANT & TAP ROOM, 1 S. Main St., Waterbury, 244-7827 SLIDE BROOK LODGE & TAVERN, 3180 German Flats Rd., Warren, 583-2202 ZENBARN, 179 Guptil Rd., Waterbury Center, 244-8134

STOWE/SMUGGS AREA

51 MAIN AT THE BRIDGE, 51 Main St., Middlebury, 388-8209 BAR ANTIDOTE, 35C Green St., Vergennes, 877-2555 CITY LIMITS, 14 Greene St., Vergennes, 877-6919 HATCH 31, 31 Main St., Bristol, 4532774 TOURTERELLE, 3629 Ethan Allen Hwy., New Haven, 453-6309 TWO BROTHERS TAVERN LOUNGE & STAGE, 86 Main St., Middlebury, 388-0002

CORK WINE BAR & MARKET OF STOWE, 35 School St., Stowe, 760-6143 MARTELL’S AT THE RED FOX, 87 Edwards Rd., Jeffersonville, 6445060 MATTERHORN, 4969 Mountain Rd., Stowe, 253-8198 MOOGS PLACE, Portland St., Morrisville, 851-8225 PIECASSO PIZZERIA & LOUNGE, 899 Mountain Rd., Stowe, 253-4411 RIMROCKS MOUNTAIN TAVERN, 394 Mountain Rd., Stowe, 253-9593 THE RUSTY NAIL, 1190 Mountain Rd., Stowe, 253-6245 STOWEHOF INN, 434 Edson Hill Rd., Stowe, 253-9722 SUSHI YOSHI, 1128 Mountain Rd., Stowe, 253-4135

MAD RIVER VALLEY/WATERBURY BIG PICTURE THEATER & CAFÉ, 48 Carroll Rd., Waitsfield, 496-8994 CORK WINE BAR & MARKET, 40 Foundry St., Waterbury, 882-8227

MIDDLEBURY AREA

RUTLAND AREA

HOP’N MOOSE BREWERY CO., 41 Center St., Rutland, 775-7063 PICKLE BARREL NIGHTCLUB, Killington Rd., Killington, 422-3035

CHAMPLAIN ISLANDS/ NORTHWEST

TWIGGS — AN AMERICAN GASTROPUB, 28 N. Main St., St. Albans, 524-1405

UPPER VALLEY

WINDSOR STATION RESTAURANT & BARROOM, 26 Depot Ave., Windsor, 674-4180

NORTHEAST KINGDOM

BIG JAY TAVERN, 3709 Mountain Rd., Montgomery, 326-6688 COLATINA EXIT, 164 Main St., Bradford, 222-9008 JASPER’S TAVERN, 71 Seymour La., Newport, 334-2224 MUSIC BOX, 147 Creek Rd., Craftsbury, 586-7533 PARKER PIE CO., 161 County Rd., West Glover, 525-3366 THE PUB OUT BACK, 482 Vt. 114, East Burke, 626-1188 TAMARACK GRILL, 223 Shelburne Lodge Rd., East Burke, 626-7390

OUTSIDE VERMONT

MONOPOLE, 7 Protection Ave., Plattsburgh, N.Y., 518-563-2222 NAKED TURTLE, 1 Dock St., Plattsburgh, N.Y., 518-566-6200. OLIVE RIDLEY’S, 37 Court St., Plattsburgh, N.Y., 518-324-2200 PALMER ST. COFFEE HOUSE, 4 Palmer St., Plattsburgh, N.Y. 518-561-6920 THE SKINNY PANCAKE, 3 Lebanon St., Hanover, N.H., 603-277-9115

BAYSIDE PAVILION, 15 Georgia Shore Rd., St. Albans, 524-0909 SNOW SHOE LODGE & PUB, 13 Main St., Montgomery Center, 326-4456

Festival Passes & tickets available through the Flynn box oFFice • www.flynntix.org • 802-86-Flyn n

Sat. auguSt 19– Sun. auguSt 27, 2017

SEVEN DAYS

Gloria Chien and Soovin Kim artiStic DirectorS

David Ludwig

reSiDent compoSer Untitled-13 1

Locations in and around BurLington

www.lccmf.org 802.846.2175

MUSIC 73

original Photo by Jerome Milks

08.16.17-08.23.17

This August, LINEAGE will bring musicians, audiences, and students together for both great music and a rich and rewarding dialogue for all. LCCMF is offering a wide range of events including masterclasses, a Free bach-in-church recital, fascinating seminars, new composition readings, meet-the-artist discussions, and of course world-class concerts (and delicious receptions!) with some of the world’s greatest chamber musicians. See our website for details.

SEVENDAYSVT.COM

lineage

So much more than a concert series...

8/3/17 11:10 AM

AL ISS IM

Art on the Wing “Birding by the Numbers,” Birds of Vermont Museum BY AM Y L I L LY

ost art shows can be viewed without particular attention to their settings, but “Birding by the Numbers” is inseparable from its locale. The Birds of Vermont Museum in Huntington organized the community art exhibit to celebrate its 30th anniversary. The show’s avian depictions, whether sewn, painted, photographed or sculpted, sit comfortably amid the museum’s permanent collection of carved-wood birds, not far from the live versions crowding well-stocked feeders outside. “Birding by the Numbers” honors two main attributes of this small but extraordinary museum. The first is the artistic skill evident in the life-size carvings that founder Bob Spear painstakingly created, etching each feather with a fine-tipped wood burner. The second is the sheer number of them — 497 — that Spear completed before his death in 2014 at the age of 94. Most of these sculptures are mating pairs of individual species. That means Spear, a self-taught carver, familiarized himself with the habits and postures of approximately 250 avian species that live in or pass through Vermont. Numbers are key to ornithology, notes Kir Talmage, the museum’s outreach and IT coordinator, who devised the theme of this year’s exhibit with museum educator Allison Gergely. (Previous shows include “Birds of a Fiber” and “In Layers: The Art of the Egg.”) In their call to artists, the women cited some significant numbers in birding, such as the fact that barred owls rarely roam more than six miles from their nests, or the nursery-rhyme assertion that it takes “four and 20 blackbirds” to make a pie fit for a king. The artists’ responses to this intersection of ideas range from literal to literary. South Burlington fabric artist Carol McDowell created a small quilt showing hands cupping a heart-shaped gathering of 30 different species of birds in silhouette. She sewed its rosy-hued

08.16.17-08.23.17 SEVEN DAYS

PHOTOS BY AMY LILLY

SEVENDAYSVT.COM

REVIEW

74 ART

art

"Mt. Philo" by Jackie Mangione

INFO “Birding by the Numbers,” through October 31 at Birds of Vermont Museum in Huntington. birdsofvermont.org

background with their names in cursive, including osprey, cardinal and loon. Carol Talmage, Kir’s stepmother, contributed “Thirteen Ways of Looking at a Blackbird,” which consists of three small watercolors interpreting the first three stanzas of Wallace Stevens’ highly visual 1954 poem of the same title. The exhibit also contains a pleasing ink-on-paper work by Colin Talmage, Kir’s brother, depicting a bevy of flying

birds, their wings uplifted, arranged in an abstract flow. Kir notes that, though she and the museum’s executive director, her sister Erin Talmage, were involved in choosing works for the show, both abstained when it came to family members’ submissions. In a suggestively narrative installation by Katherine Guttman, titled “Crow. Counting.,” four black crows made from felt perch on or hover over

an antique typewriter. They appear to show a minatory curiosity about the sheet of paper rolled in it, on which a variation on the traditional children’s rhyme about magpies (or crows) has been printed in caps. In this case, the familiar words “One for sorrow, two for mirth” are followed by four crows for “death” and “ten for the devil’s own self.” One bird grasps the edge of the paper in its claws, seemingly ready to fly off with it. Several artists responded with abstract gestures toward numbers. In Carol MacDonald’s square-format linoleum-block print “Wholeness,” a black crow with one end of an infinity symbol in its beak perches atop its mirror image in white. The white bird’s beak holds the other end of the symbol. The Colchester artist began using bird imagery in 1999. While it’s not clear when she made this print, in an edition of 100, the image has a powerful resonance in today’s atmosphere of racial tension. Meg Walker, a conceptual sculptor who lives in Charlotte, has two works in the show, both loosely figurative. “Twenty-Five Birds You Have Known” is a wall installation of wire plant hangers shaped into birds in various attitudes and postures. (Walker could fit only 15 of the original 25 forms from this 1994 work on the wall.) With the rounded hooks representing heads, one sculpture looks remarkably like a heron in flight, another like an owl headed straight toward the viewer. Though flat, the work evokes Alexander Calder’s three-dimensional wire circus animals in its ability to capture the essence of a form using minimal material. Walker’s other contribution, “Two Birds Sitting on a Line” (1993), features two rough bird forms balanced on a steel frame and dates from the beginning of her “bird phase.” According to Walker’s website, that piece resulted from a combination of artist’s block and a looming exhibition deadline. She was playing with balled-up newspaper and drafting tape when the two bird forms emerged. The contrast between this avian pair and Spear’s birds couldn’t be greater, yet

ART SHOWS

“25 Birds You Have Known” by Meg Walker

"Love Is a Thing With Wings" by Carol McDowell

THE SHOW’S AVIAN DEPICTIONS SIT COMFORTABLY AMID THE MUSEUM’S CARVED-WOOD BIRDS. each represents a valid approach to art making. As for numbers, the museum has been growing its own. The venue now contains 510 carved birds, with a handful of other artists adding to Spear’s collection. More carved species are in the pipeline; two-dimensional placeholders created by artist Libby Davidson indicate their destined positions in a diorama graced by her painted backdrop.

Birds of Vermont has also installed a brand-new entrance bridge — the original was swept away in a 2013 flood — as well as pollinator gardens and a walk-in treehouse overlooking a stream. If you’ve been meaning to check out this museum, “Birding by the Numbers” makes a visit doubly worthwhile. Contact: lilly@sevendaysvt.com

“Crow. Counting.” by Katherine Guttman

CALL TO ARTISTS

CHAMPLAIN MINI MAKER FAIRE: The sixth annual maker fair invites participants and presenters for this year’s event, to be held September 23 and 24. For details and to submit, visit champlainmakerfaire.com. Deadline: August 31. McClure Education Center, Shelburne Farms. Info, 863-5956.

IPHONE IMAGERY: Welcoming submissions of images shot and (possibly) manipulated exclusively with a mobile device for an exhibit to be juried by Karen Divine. For details and to submit, visit photoplacegallery.com. Deadline: August 21. PhotoPlace Gallery, Middlebury. Up to five photos for $35; $6 for each additional. Info, 388-4500.

PENTANGLE LIGHT GARDEN: Pentangle invites individual artists and small groups from the community to create sculptures incorporating light, which will line the footpaths of the town green. This year’s event will take place September 22 and 23. Space is limited. For more info and to register, email Serena Nelson at info@ pentanglearts.org. Deadline: September 5. Woodstock Village Green. Info, 457-3981. PLAINFIELD KIOSK ART: Seeking art of all kinds to be featured in upcoming monthlong exhibitions through this unique format. For details and to submit, email jennibeearr@gmail.com. Deadline is rolling. Plainfield Art Kiosk. Info, jennibeearr@gmail.com. PLEIN AIR PAINT THE COMMON: Enjoy mingling with fellow artists while creating your version of the stunning scenery of the Craftsbury Common town green. The farmers market will be in progress. All

‘ROCK SOLID XVII’: This annual show at SPA, September 19 to November 4, showcases stone sculptures and assemblages by area artisans. The emphasis is on sculptural works made from stone as a primary material. Deadline: August 17. More info at studioplacearts. com. Studio Place Arts, Barre. Info, 479-7069. SPA STUDIO RESIDENCY PROGRAM: Studio Place Arts invites proposals from emerging local artists for an 11-month studio residency program that runs December 1, 2017, to October 31, 2018. Selected artist will receive a small private studio on the second floor of the visual arts center to build a new body of work for exhibition in the fall of 2018. For details and to submit, visit studioplacearts.com. Deadline: August 31. Studio Place Arts, Barre. Info, 479-7069. STEAMFEST: Seeking artists, artisans and makers working in all mediums to exhibit at indoor and outdoor venues in conjunction with this inaugural arts festival, September 29 and 30. Traditional and nontraditional artwork that explores or is influenced by science, engineering, technology and/or math, and that considers the relationship of aesthetics and experience in the 21st century will be considered. For details and to apply, visit steamfestvt.com. Deadline: September 1. Village of Essex Junction. $35; $15 for 18 and under. Info, steamfestvt@gmail.com. SWANTON ARTS SPECTACULAR: The Swanton Arts Council invites local artists and artisans to participate in the September 9 community arts festival. For more info and to sign up for a space, contact darcibenoit@yahoo.com. Deadline is rolling. Swanton Village Park. Info, 233-6864. NEW THIS WEEK

» P.76

ART 75

LABELS FOR LIBATIONS: Vermont artists 21 years of age and older are invited to submit beer-inspired artwork for this annual competi-

MILKHAUS ART FESTIVAL: Submissions welcome to the open artists’ competition at the fifth annual art festival on August 26. Guests will vote on the winner for the cash prize. To submit, email name, title, medium and delivery date to designtotable@gmail. com. Deadline: August 25. Milkhaus Studios, Ferrisburgh. $8. Info, designtotable@gmail.com.

‘QUILTING IN THE LAND OF MILK AND HONEY’: The Milk & Honey Quilters Guild invites submissions of quilts for their upcoming unjuried fall show, October 7 and 8. Details and application form at milkandhoneyquilters.com. Deadline: August 22. Middlebury Recreation Facility. Info, milkandhoneyquilt@yahoo.com.

SEVEN DAYS

INTERNATIONAL MAIL ART EXHIBIT: Inviting mail-art submissions with the theme “welcome to college” for a fall exhibition at Vermont Technical College. Artists may submit an unlimited number of original works, postcards preferred. Send to: Hartness Library Mail Art, Vermont Tech, PO Box 500, Randolph Center, VT 05061. Deadline: September 15. Hartness Gallery, Vermont Technical College, Randolph Center. Info, 728-1237.

‘MIDDLEBURY THROUGH THE LENS’: Edgewater at the Falls hosts this photo shoot on September 23. The day will open with a talk from former National Geographic photographer James Blair. The winning photographer, to be announced September 27, will be awarded a $500 gift certificate to Edgewater Gallery. Photographers interested in participating must register by September 21. For details, visit edgewatergallery.com. Edgewater Gallery at Middlebury Falls. Info, 458-0098.

artists, whether professional, amateur or student, are welcome. Craftsbury Common, Through August 18. Free. Info, 922-1771.

08.16.17-08.23.17

‘DOORS & WINDOWS: OPEN & CLOSED’: Accepting submissions for upcoming exhibition to be curated by Rebecca L. Lawrence, former director of New Hampshire State Arts Council. Artists may submit up to three works in any medium and will be eligible for one of three awards of $200 each. For details and to submit, visit avagallery. org. Deadline: September 8, 11:59 p.m. AVA Gallery and Art Center, Lebanon N.H. $20. Info, 603-448-3117.

tion sponsored by Magic Hat Brewery and the South End Arts and Business Association. Five finalists’ designs will be selected and then voted on by Art Hoppers. The winning design will be featured on a limited run of Magic Hat brews, accompanied by a $1,500 award and a two-month exhibition at the Artifactory. For details and to submit, visit magichat.com/seaba. Deadline: August 21. Magic Hat Artifactory, South Burlington. Info, info@seaba.com.

SEVENDAYSVT.COM

BRANDON ARTISTS GUILD EXHIBITING MEMBER JURY: The Guild welcomes submissions from artists interested in joining its community of 40-plus Vermont fine artists and artisans. The gallery exhibits an ongoing selection of work from member artists and offers rotating solo and themed group shows. For details and to apply, visit brandonartistsguild.org. Deadline: August 26, for jury review on September 9. Brandon Artists Guild. $25. Info, brandonartistsguildvt@gmail.com.

art « P.75 NEW THIS WEEK

‘Portals’ “I tend to isolate subject matter and look for complexity

stowe/smuggs

opportunity for telling a story in which all is not what it appears to

CALL TO ARTISTS

in simple images,” says photographer Aline Smithson, “providing an

f CHARLIE BLUETT: “Elements,” abstract-expressionist paintings by the Westfield artist. Reception: Saturday, August 19, 6-8 p.m. f KATHLEEN KOLB: “Thin Places, Long Light,” paintings of Ireland and Vermont by the Lincoln artist. Reception: Saturday, August 19, 6-8 p.m. August 19-October 15. Info, 253-8943. West Branch Gallery & Sculpture Park in Stowe.

be.” And what better simple metaphor for complexity than the portal?

mad river valley/waterbury

selected, by Middlesex-based Michael Levine. Others are not so literal:

Smithson, who is based in Los Angeles, juried the newest exhibition at PhotoPlace Gallery in Middlebury, which features dozens of images riffing on the theme of the portal as threshold. The vast majority of her selections are architectural — including the sole Vermont submission

f ‘TRANSITIONS: REALISM TO ABSTRACT’: An exhibition featuring a wide range of works by Valley Arts artists. Reception: Saturday, August 19, 5-7 p.m. August 19-October 21. Info, 496-6682. Vermont Festival of the Arts Gallery in Waitsfield.

Robert Calafiore’s Technicolor digital manipulation, for example, or

middlebury area

Great Wall” by Levine.

Janet Matthews’ “Plunge,” in which a miniature doll dives headlong into a tiny wooden trunk. Through September 9. Pictured: “Spring Opening,

f ‘ATTENTION TO DETAIL’: Representational paintings by four Addison County artists: Gayl Braisted, Mike Mayone, Catherine M. Palmer and Reed A. Prescott. Reception: Friday, August 18, 5-7 p.m. August 18-October 1. Info, 382-9222. Jackson Gallery, Town Hall Theater in Middlebury. ‘PORTALS’: An exhibition of photographs juried by Aline Smithson. August 16-September 9. Info, 388-4500. PhotoPlace Gallery in Middlebury.

rutland/killington

f ‘PASSAGES & MOORINGS’: Works by Vermont artists Lily Hinrichsen, Karla Van Vliet and Susan Wilson. Reception: Friday, August 25, 6-8 p.m. August 19-September 30. Info, 282-2396. Castleton University Bank Gallery in Rutland. f PERSI NARVAEZ: “Afinidad/Affinity,” colorful paintings by the Peruvian artist. Reception: Friday, August 25, 6-8 p.m. August 19-September 30. Info, 282-2396. Castleton Downtown Gallery in Rutland.

manchester/bennington

f AL HIRSCHFELD: A selection of drawings and

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

prints by the late artist and pop-culture caricaturist. Reception: Friday, August 18, 5-7 p.m. August 18-October 31. Info, 362-7200. Art Manchester.

ART EVENTS ARTIST’S TALK: ELENA SARACINO: The Italy-based artist-in-residence speaks about her work and process. The Carving Studio & Sculpture Center, West Rutland, Wednesday, August 16, 7 p.m. Info, 438-2097. BCA SUMMER ARTIST MARKET: Shop handmade works by Vermont artists and artisans, in conjunction with the Burlington Farmers Market. Burlington City Hall Park, Saturdays, 9 a.m.-3 p.m. . Info, 865-7166. BLUEBIRD FAIRIES: Emily Anderson offers readings using her singular oracle deck, as well as cards and other artworks. ArtsRiot, Burlington, Fridays, 5-10 p.m. Info, emily@bluebirdfairies.com. BREAD & PUPPET CHEAP ART AUCTION: The radical puppet theater auctions off posters, prints, paintings and other art objects to raise funds for building repairs. Bread and Puppet Theater, Glover, Saturday, August 19, 7 p.m. Info, 525-3031. GREEN MOUNTAIN WOODCARVERS SHOW & SALE: The 44th annual event featuring displays and carving demonstrations for children and adults. Rusty Parker Memorial Park, Waterbury, Saturday, August 19, 9 a.m.-3 p.m. Info, rlindemann@pfshift.com.

76 ART

JAMES KEENAN POP-UP: Screen-printed shirts, paintings and sculptures by the Burlington artist. Penny Cluse Café, Burlington, Thursday, August 17, 6-8 p.m. Info, jameskeenanart@gmail.com. MORRISVILLE ART WALK: The first inaugural third Thursday community art event. Various Morrisville locations, Thursday, August 17, 4-7 p.m.

OPEN STUDIO: Friends new and old convene for a creative session. Expressive Arts Burlington, Mondays, 3-5 p.m. $15. Info, 343-8172.

Rosamond Orford and Sue Schiller. Through September 23. Info, 603-448-3117. Pompanoosuc Mills in Burlington.

PAINT & SIP: Brittny Mee leads participants in exploring abstract painting techniques on an 18-inch-square throw-pillow cover. Four mead samples are included in event cost. Register in advance at sevendaystickets.com. Colchester’s Mead Hall, Saturday, August 19, 5-6 p.m. $25.

‘BLACK DAWN TO MEDUSA’: A retrospective of the experimental film works, art and ephemera made by Doreen Kraft and Robin Lloyd in the 1970s, curated by Margaret Coleman. Through September 9. Info, 865-8980. Champlain College Art Gallery in Burlington.

PHOTO CO-OP: Lensmen and -women gather to share their experience and knowledge of their craft. Gallery at River Arts, Morrisville, third Thursday of every month, 6-8 p.m. $5. Info, 888-1261.

BOOKWORKS FROM THE BOOK ARTS GUILD OF VERMONT: A group show by members that addresses the concept of correspondence in the modern world. Through August 31. Info, 859-9222. SEABA Center in Burlington.

PINT NIGHT & ART WALK: Enjoy pints and art during the first inaugural third Thursday Morrisville Art Walk. Rock Art Brewery, Morrisville, Thursday, August 17, 4-7 p.m. Info, 888-9400. RECEPTION: H. KEITH WAGNER: A new oxidized, welded-steel sculpture by the Burlington-based artist and landscape architect is unveiled in the college courtyard, which his firm recently redesigned. RSVP by August 14 to artgalleryRSVP@champlain. edu. Champlain College Art Gallery, Burlington, Thursday, August 17, 5:30 p.m. Info, 860-2785. SOUTH END ART PARK GRAND RE-OPENING: Celebrate the re-opening of this art park with a ribbon-cutting ceremony, some words and the opportunity to view the new permanent sculpture by Ken Mills and Tyler Vendituoli. Great Harvest Bread Co., Burlington, Wednesday, August 16, 4 p.m. Info, 859-9222. SUMMER SKETCHING OUTDOORS: Penny Cunningham and Lisa Liotta lead this evening session of sketching and painting en plein air. All levels welcome. Burnham Memorial Library, Colchester, Monday, August 21, 6-7:30 p.m. Info, 264-5660. WEDNESDAY NIGHT LIVE: ART TENT: River Arts presents creative activities for the community, including making paper flowers, beaded bubble wands, foam prints and more. Oxbow Park, Morrisville, Wednesdays, 5:30-7:30 p.m. Free. Info, 888-1261.

ONGOING SHOWS burlington

ANNE CADY: “Held by the Mountains,” colorsaturated landscape paintings by the New Haven artist. Through September 30. Info, 652-4500. Amy E. Tarrant Gallery in Burlington. ‘AVA & POMPANOOSUC MILLS: A CELEBRATION OF UPPER VALLEY ARTISTS’: Works by Joe Carton, Penny Koburger, Judy Laliberte, Elizabeth Mayor,

‘BUTTERFLIES’: This exhibit of live butterflies explores one of Earth’s most beautiful and unique creatures. Discover their fascinating life cycle and how we can protect their place in the natural environment. Through September 4. Regular museum admission: $13.50-16.50. Info, 877-324-6386. ECHO Leahy Center for Lake Champlain in Burlington. CHRIS MAHONSKI: Overnight Projects presents “Spurious Brood,” a public installation by the Virginia-based artist that features Timex Ironman wristwatches on tree branches to create a digital chorus. More info at overnightprojects.com. Through September 1. Info, abbey@overnightprojects.com. Burlington City Hall Park. DAVE KENNEDY: “A Stranger Stands Here,” large-scale collaged constructions that question perception and the line between image and object. Through October 8. Info, 865-7166. BCA Center in Burlington. DIANA AL-HADID: An exhibition featuring the Syrian American artist’s monumental sculpture “Phantom Limb,” accompanied by large-scale wall works and Mylar drawings. Through October 8. Info, 865-7166. Burlington City Arts. ‘FROM OUR HEARTS & MINDS’: An exhibition of works by 14 local artists in the collective From Our Hearts and Minds. Through August 31. Info, 863-3403. Fletcher Room, Fletcher Free Library in Burlington. ‘THE GIFT OF BEAUTY’: Photographs through the seasons in Vermont, Montana, Europe and beyond by Mem. Through August 31. Info, 803-343-9646. New Moon Café in Burlington. HILARY ANN LOVE GLASS: Works by the Burlington illustrator, printmaker, tattoo artist and winner of Magic Hat’s 2017 Art Hop Ale label competition. Through August 31. Info, 658-6016. Speeder & Earl’s Coffee in Burlington.

INNOVATION CENTER GROUP SHOW: First floor: Austin Abbot, Kristen Watson, Pete Boardman, Rae Harrell, Robert Gold and Susie Guran; second floor: Amanda Vella, Janet Bonneau, John Metruk and Marilyn Barry; third floor: Donna Bister, Gaal Shepherd, Nicole Colella, SRMPhotography and Terry L. Mercy. Rotating shows curated by SEABA. Through August 31. Info, 859-9222. The Innovation Center of Vermont in Burlington. ‘INTERPOSE’: A group exhibition curated by Susan Smereka featuring works by Kate Donnelly, Wylie Sofia Garcia, Molly Greene, Lucy Leith and Estefania Puerta. Through October 24. Info, joseph@ newcitygalerie.org. Info, 355-5440. New City Galerie in Burlington. NORTHERN VERMONT ARTS ASSOCIATION MEMBER EXHIBITION: An annual group exhibition featuring works by members of the artist collective, which was founded in Burlington in 1931. Through August 26. Info, 578-2512. The S.P.A.C.E. Gallery in Burlington. RAE HARRELL: “Still Out of My Mind,” fabric art, painting and sculpture. Through August 31. Info, 859-9222. The Gallery at Main Street Landing in Burlington. REID CROSBY: “Moments,” photographs by the Vermont artist. Through September 30. Info, 864-2088. The Men’s Room in Burlington. SEABA ‘MEMBERS ONLY’ SHOW: A juried exhibition of works by members of the South End Arts and Business Association. Through August 31. Info, 6519692. RETN & VCAM Media Factory in Burlington. ‘SYRIAN EXPERIENCE AS ART’: A group exhibition of post-Arab Spring artworks by 12 Syrian artists. Through September 1. Info, 363-4746. Flynndog in Burlington. ‘TWO LENSES’: Photography by Matthew Peterson and Vaune Trachtman, which explores the artists’ desire to study their surroundings and hit the pause button for moments of in-between. Through September 4. Info, 516-263-7335. Karma Bird House Gallery in Burlington. ‘VERMONT LANDSCAPE & WATER’: Paintings by Vermont artists Sean Dye, Phil Laughlin, Sandra Reese and Ken Russack. Through August 31. Info, 860-4972. Black Horse Gallery in Burlington. ‘VIBRANT VERMONT’: Paintings of the Vermont landscape by Bruce Conklin, Jennifer Hubbard, Susan Larkin, Phil Laughlin and Julia Purinton. Through October 8. Info, 865-7166. Vermont Metro Gallery, BCA Center in Burlington.

Lake Champlain Sunset Kayak Tours

ART SHOWS

chittenden county

‘BIRDING BY THE NUMBERS’: Twenty-four artworks by 23 area artists consider the relationship between ornithology and math. Through October 31. Info, 434-2167. Birds of Vermont Museum in Huntington. ‘CHICKENS!’: A group exhibition of chicken-themed works by local artists. Through August 31. Info, ealexander22@yahoo.com. Jericho Town Hall. DAVID SMITH: “Points of Departure,” oil paintings by the Peacham artist. Through September 9. Info, 985-3848. Furchgott Sourdiffe Gallery in Shelburne. DEAN & LINDA MORAN: “The Art of Marble Fabric,” textile art by the Essex Junction artists. Through August 31. Info, 878-4918. Dorothy Alling Memorial Library in Williston. ‘FLOWER POWER!’: A group exhibition of works by seniors and older adults that address the beauty and complexity of flowers. Through August 31. Info, 244-1234. Winooski Senior Center. ‘THE HISTORY OF RACING IN MILTON’: An exhibition about the town’s role as a Chittenden County stock-car-racing hot spot. Through October 31. Info, 363-2598. Milton Historical Society. ‘PIECED TRADITIONS: JEAN LOVELL COLLECTS’: Historic bedcovers gathered by the Californiabased collector and longtime friend of the Shelburne Museum. Through October 31. ‘WILD SPACES, OPEN SEASONS: HUNTING AND FISHING IN AMERICAN ART’: An exhibition exploring the visual culture of hunting and fishing in painting and sculpture from the early 19th century to World War II. Through August 23. Info, 985-3346. Shelburne Museum. PHILIP HERBISON: “Compositions,” painted wood pieces mounted on wood panel. Through August 31. Info, 985-8222. Shelburne Vineyard.

barre/montpelier

‘TEN’: A group show of artworks inspired by the various objects described in the old counting nursery rhyme, “One, two, buckle my shoe.” AARON STEIN: “Road Trip: Life Through the Windshield,” assemblages and constructions inspired by and made with American automobilia. GRACE AMBER: “Trash Mounds,” installations by the Vermont-born artist. Through August 24. Info, 479-7069. Studio Place Arts in Barre.

HUNTER EDDY: “Bridging Worlds,” a solo exhibition of paintings in staged portraiture and still life, cre-

WWW.LLBEAN.COM/BTC.

Notice of NoNdiscrimiNatory policy as to studeNts

‘MIXING PRIMARIES’: Works by members of the Art Resource Association, including Michael Badamo, Annie Christopher, Cindy Griffith, Marcia Hill, Maggie Neale, Phillip Robertson, Jack Sabon, Joy Spontak, Frank Woods and others. Through September 8. Info, twwoodgallery@gmail.com. SUMMER JURIED EXHIBIT: A group exhibition featuring works by 23 artists, including Jan Brough, Frank DeAngelis, Linda Di Sante, Craig Line, Maggie Neale, Susan Riley and James Secor. Juried by August Burns, Ellis Jacobson and David Schutz. Through September 8. Info, 262-6035. T.W. Wood Gallery in Montpelier. ‘SHOW 19’: An exhibition showcasing the latest works by the gallery’s 17 Vermont-based contemporary artists. Through August 26. Info, 272-0908. The Front in Montpelier. ‘SOCIAL JUSTICE IN RACE, GENDER, IMMIGRATION AND THE ENVIRONMENT’: Twenty-one Vermont artists exhibit works addressing these themes in clay, paper, painting, stone, assemblage, metal and drawing, along with photographs by Terry J. Allen of recent marches, vigils and demonstrations plus posters, banners and signs from those events. Through October 9. Info, janetvanfleet@fairpoint. net. TERRY ALLEN: “Taking It to the Street,” color photographs of protest demonstrations in New York City, Washington, D.C., and Vermont. Sales to benefit Migrant Justice and Planned Parenthood. Through October 10. Info, tallen@igc.org. Eliot D. Pratt Library, Goddard College in Plainfield.

Trinity Children’s Center admits students of any race, color, national and ethnic origins to all the rights, privileges, programs, and activities generally accorded or made available to students at the school. It does not discriminate on the basis of race, color, national and ethnic origin in administration of its educational policies, admissions policies, scholarship and loan programs, and athletic and other school-administered programs. 12h-trinitychildschool081110.indd 1

8/5/10 1:03:22 PM

THE UNIVERSITY OF VERMONT

Van Cliburn Bronze Medalist,

piano: An Evening in Vienna . . . . . . . . . . . . . 9 29

/ / Cyro Baptista: Banquet of the Spirits . . . . . . . 10 / 20 Nobuntu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 / 27 St. Lawrence String Quartet . . . . . . . . . . . . . . . 11 / 3 Semer Ensemble: Rescued Treasure . . . . . . . . . 11 / 13

Joan Soriano, Bachata . . . . . . . . . . . . . . . . . . . . 10 7

Ensemble 4.1, windtet . . . . . . . . . . . . . . . . . . . . 10 13

2 0 1 7 –2 0 18

Van Cliburn Silver Medalist,

Kenneth Broberg (Age 23, United States) . . 11 17

stowe/smuggs

A Holiday Concert with Cantus:

‘BEST OF THE NORTHEAST MASTERS OF FINE ARTS EXHIBITION’: Fourth biennial exhibition featuring the “best of” recent or current MFA students from New England and New York, curated by Gabriel Sosa. Through August 26. Info, mail@ helenday.com. Info, 253-8358. Helen Day Art Center in Stowe.

Three Tales of Christmas . . . . . . . . . . . . . . . . 12 8 An Irish Christmas with Lúnasa 11 03

and Ashley Davis, vocals . . . . . . . . . . . . . . . . 12 15

ST. L AWRENCE STRING QUARTET

Rob Schwimmer, theremin, piano,

Haken Continuum . . . . . . . . . . . . . . . . . . . . . .1 26

Sierra Hull Trio, bluegrass . . . . . . . . . . . . . . . . . 2 2

‘BITTER CANDY’: A group exhibition curated by Shiva Aliabadi featuring works that present a bright, dynamic surface impression but are imbued with deeper commentary on society, psychology, relationships and more. Through August 20. Info, 635-2727. Gallery II, Vermont Studio Center in Johnson. BONNIE ACKER: “Summertime,” new landscape oil paintings by the Burlington-based artist. Through September 4. Info, 253-1818. Green Mountain Fine Art Gallery in Stowe.

Daniel Hsu (Age 19, United States) . . . . . . . 9 22 Jolente de Maeyer, violin, and Nikolaas Kende,

Sérgio & Odair Assad, duo guitar,

and Avi Avital, classical mandolin . . . . . . . . . . 2 9

Tierney Sutton: The Sting Variations . . . . . . . . .2 16 Van Cliburn Gold Medalist, 10 27

Yekwon Sunwoo (Age 28, South Korea) . . . . 2 23 NOBUNTU

/ /

Robbie Fulks Band, Americana . . . . . . . . . . . . . 3 2 Calidore String Quartet . . . . . . . . . . . . . . . . . . . 3 9

. . . . . . . . . . . . . 3 17

ELISE WHITTEMORE: “Specimens,” woodblock prints inspired by the artist’s time drawing dried algae in the Pringle Herbarium at the University of Vermont. Through August 18. Info, 888-1261. River Arts in Morrisville.

St. Patrick’s Day with Altan

‘EXPOSED’: The 26th annual multi-site exhibition of outdoor public sculpture, curated by Rachel Moore. Through October 21. Info, mail@helenday. com. Various Stowe locations.

Trio Da Kali and Derek Gripper, guitar . . . . . . . 4 6

‘FRANK MASON IN VERMONT’: An exhibition featuring 22 paintings by the late classical realist painter and 60 paintings by students he taught in Vermont. Through September 4. ‘GENERATIONS’: A group exhibition of oil paintings by Dianne Panarelli Miller and nine of her students. Through September 4. ‘LEGACY COLLECTION 2017’: Works by 19 living and 14 deceased artists whose art continues the legacy of Alden and Mary Bryan. Through December 23. Info, 644-5100. Bryan Memorial Gallery in Jeffersonville.

STOWE/SMUGGS

» P.78

Late Night with Leonard Bernstein with Jamie Bernstein, Michael Boriskin,

Amy Burton, & John Musto . . . . . . . . . . . . . 3 23

02 02

/ /

Fara . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 4 SIERRA HULL TRIO, BLUEGRASS

15th Van Cliburn International Piano Competion Medalist Performance Lane Series/Flynn Center co-presentation

B E L O W : C Y R O B A P T I S T A , 9 / 15

ORDER NOW & SAVE UP TO Season Subscription Deadline: 9 / 15

802.656.4455

TICKETS OR

LAN.198.17 7D 2017–2018 Pre-Season Ad: 1/3 vertical: 4.75" x 7.46" Untitled-20 1

ARTIST INFO

EVENTS

BROCHURE:

UVM.EDU/LANESERIES

7/18/17 7:30 PM

ART 77

‘FREAKS, RADICALS & HIPPIES: COUNTERCULTURE IN 1970S VERMONT’: An exhibition that explores the influx of people and countercultural ideas to the state, from communes to organic agriculture, progressive politics to health care reform, alternative energy to women’s and gay rights. Through December 31. Info, 479-8500. Vermont Heritage Galleries in Barre.

KELLY HUNTER: “Planetary Gods and Goddesses,” poster-size images of many of the solar system’s newly identified planetoids, named for indigenous creator deities. Color your own and add it to the show. Through August 31. Info, kellhunter@ earthlink.net. Info, 476-8188. Barre Opera House.

SEVEN DAYS

ED EPSTEIN AND GEORGE KURJANOWICZ: “A Path Well Traveled,” portraiture, landscapes and organic sculptural forms by the multidisciplinary artists. Photo ID required for entry. Through September 29. Info, 828-0749. Governor’s Gallery in Montpelier.

JENNI BELOTSERKOVSKY: Paintings by the Vermont artist. Through August 31. Info, 426-3581. Jaquith Public Library in Marshfield.

08.16.17-08.23.17

f ‘CONNECTION: THE ART OF COMING TOGETHER’: An exhibition curated by Ric Kasini Kadour, publisher of Vermont Art Guide, featuring works in a variety of mediums by 17 artists who were selected through their relationships to other Vermont artists. Closing reception: Friday, October 6, 4-8 p.m. Through October 6. Info, ric@ kasinihouse.com. Info, 828-3291. Spotlight Gallery in Montpelier.

COME WATCH THE SUNSET OVER THE ADIRONDACKS

SEVENDAYSVT.COM

‘BREAD & PUPPET: AN EMERGENT MOSAIC’: The sixth annual exhibit featuring works by Bread & Puppet and non-Bread & Puppet company members. Among these are portraits by Heidi Broner and paintings by Cynthia Ross, as well as photographs from participants’ archives, photos of current B&P work by Mark Dannenhauer, and a display of puppets from the touring show “The Story of the Mountain Man From Chile.” Through September 5. Info, ninots@crocker.com. Info, 454-8579. Plainfield Community Center.

ated between 2010 and 2017. Through September 29. Info, 828-0749. Vermont Supreme Court Gallery in Montpelier.

art STOWE/SMUGGS

« P.77

FRED SWAN: The 24th annual exhibition of realist landscapes by the U.S. Naval Academy graduate. Through September 30. Info, 253-7282. Robert Paul Galleries in Stowe. KATIE LOESEL: “Geology in the Anthropocene,” drawings and monoprints that explore ideas of geological history, microscopic surfaces and rocky formations. Through August 18. Info, 888-1261. Gallery at River Arts in Morrisville. SUMMER CAMP EXHIBIT: Exhibition featuring works created by children participants of River Arts summer arts programming. Through September 5. Info, 888-1261. Morrisville Post Office.

mad river valley/waterbury

‘BIG RED BARN ART SHOW’: The 20th annual community-sourced exhibition of works by area artists. Through September 3. Info, 496-6682. Big Red Barn Gallery at Lareau Farm in Waitsfield. HOPE BURGOYNE: “Dispositions,” abstract landscapes by the Vermont artist. Through August 26. Info, 244-7801. Axel’s Gallery & Frame Shop in Waterbury. JOHNNY SWING: Sculpture, furniture and lighting in steel, including the artist’s latest work, “Wedding Gift,” an abstract, knotted form of stainless-steel rods and toasters. Through September 10. Info, 583-5832. Bundy Modern in Waitsfield. PHOTO SHOW: The 28th annual communitysourced show featuring works by amateur and professional photographers. Through September 4. Info, 496-7722. Inn at the Round Barn Farm in Waitsfield.

middlebury area

ANNE CADY: “See You at the Lake,” a solo exhibition of new works by the New Haven painter. Through August 27. Info, 877-2173. Northern Daughters in Vergennes. BRENDA HALL WOOD DESIGN: Works in wood by the Goshen artist and maker. Through August 29. Info, 860-480-1021. Ripton Community Church.

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

‘THE DAMES’: Oral history recordings and photographic portraits featuring 13 members of the National Society of Colonial Dames of America in Vermont. Through August 19. Info, 388-4964. Vermont Folklife Center in Middlebury. DEBORAH HOLMES: “Coming Home,” new paintings by the Addison County artist. Through September 10. Info, 238-6607. Art on Main in Bristol. ‘DRAW ME A STORY, TELL ME A TALE’: Paintings, illustrations, photographs and completed books by 18 contemporary Vermont children’s book authors and artists. Through October 15. Info, 388-2117. Henry Sheldon Museum of Vermont History in Middlebury. ‘OLD FRIENDS & NEW FACES’: A group exhibition of six artists, split between the gallery’s two Middlebury locations: Kim Alemian, Philip Frey, Timothy Horn, William B. Hoyt, Woody Jackson and Homer Wells. Through August 31. Info, 458-0098. Edgewater Gallery at Middlebury Falls. PETER BROOKE: “Land, Sea & Sky,” oil paintings on panel and canvas. Through September 10. Info, 349-0979. BigTown Gallery Vergennes. ‘YOURS IN THE CAUSE: FACES OF RADICAL ABOLITION’: Rarely seen historic photographs depicting 14 pre-Civil War-era abolitionists, chosen for their ties to the Robinson family as documented in letters, account books and broadsides, which are also on view. Through October 29. Info, 877-3406. Rokeby Museum in Ferrisburgh.

rutland/killington

78 ART

BILL RAMAGE: “The Self,” a solo exhibition of large-scale drawing and sculptures by the artist

VISUAL ART IN SEVEN DAYS:

Charlie Bluett Stowe’s West Branch Gallery

molecules or creatures that are coalescing into something else.

& Sculpture Park welcomes “Elements,” a solo exhibition of

like gently torn, impossibly delicate sheets of translucent paper

paintings by the London-born, Northeast Kingdom-based

are really decisions made in pigment. A reception is Saturday,

artist. Bluett’s watery, layered shapes evoke organic life forms,

August 19, 6-8 p.m. Pictured: “A Walk Amongst the Crowds.”

and Castleton State College professor emeritus. Through August 19. Info, 247-4295. Compass Music and Arts Center in Brandon. GEORGE BOURET: An exhibition of original photography featuring portraits, architecture and panoramic landscapes. Through September 2. Info, elschmidt1@vermontel.net. Info, 884-4100. Stone Valley Arts in Poultney. HOLLY WONG: “Biology of Thought,” a mixed-media installation by the San Francisco-based artist that speaks to the nature of being alive and attempts to reconnect what has been fragmented. Through August 20. Info, 438-2097. The Carving Studio & Sculpture Center in West Rutland. WARREN KIMBLE: New works by the folk Americana artist and BAG cofounder. Through August 29, 5-7 p.m. Info, 247-4956. Brandon Artists Guild.

champlain islands/northwest

‘FLEETING NATURE’: Photographs of Lake Champlain by Mary Zompetti, the historic 1940s “river boat” from Charlie Auer and Christine Hebert’s Auer Family Boathouse, and a 2015 replica built by University of Vermont students. Through August 21. Info, 355-2150. GreenTARA Space in North Hero.

upper valley

‘ART ON THE FARM’: An outdoor exhibition of sculpture curated by Edythe Wright, featuring works by Michael Barsanti, Ria Blaas, Rachel Gross, Lisa Kippen, Anne Mapplebeck, Murray Ngoima and Brenna Colt, Otto Pierce and Daniel Weiner. Through October 7. Info, info@fablefarm.org. Fable Farm in Barnard. BUNNY HARVEY: “Lost & Found,” a self-portrait of the artist told with found objects, photos, art and other miscellany. Through August 31. Info, info@ mainstreetmuseum.org. Info, 356-2776. Main Street Museum in White River Junction.

ART LISTINGS AND SPOTLIGHTS ARE WRITTEN BY RACHEL ELIZABETH JONES. LISTINGS ARE RESTRICTED TO ART SHOWS IN TRULY PUBLIC PLACES.

They also appear as deliberate, if deceptive, collages; what looks

‘CREATE & INSPIRE’: A group exhibition of works made by veterans and their community. Through September 1. Info, 295-9363. White River Junction VA Medical Center. DAVID CRANDALL & JIM MAAS: Fine jewelry and painted bird carvings, respectively, by the local artisans. JIM MAAS: Vermont Institute of Natural Sciences presents the meticulously detailed bird carvings of the retired orthopedic surgeon. Through September 30. Info, 359-5001. Collective — the Art of Craft in Woodstock. ‘THE FRUITS OF TIME: HEIRLOOM APPLES, THEN AND NOW’: Using photographs, illustrations, historical interpretation and compelling narratives, this exhibit explores the story of heirloom apples and shows how to bring old trees back into production. Through October 15. Free with $6 admission. Info, 765-4288. Justin Morrill Homestead in Strafford. ‘MAKING MUSIC: THE SCIENCE OF MUSICAL INSTRUMENTS’: An exhibition that explores the science behind making rhythms and harmonies heard. Through September 17. Info, 649-2200. Montshire Museum of Science in Norwich. MARTHA STEVENSON: Folk art paintings by the Londonderry artist. Through August 31. Info, 295-4567. Long River Gallery & Gifts in White River Junction.

f NORI PEPE: Recent prints that reinterpret photographs. Reception: Friday, September 1, 6-8 p.m. Through September 30. Info, 295-5901. Two Rivers Printmaking Studio in White River Junction. ‘THE PUBLIC, PERSONAL, PRIVATE & PROFESSIONAL’: A retrospective featuring more than 20 years of works by Main Street Museum’s David F. Ford and Mark E. Merrill. Through August 25. Info, 603-508-8528. Barrette Center for the Arts in White River Junction. QUILT EXHIBITION: The 31st annual event featuring textile art made by Windsor County quilters.

GET YOUR ART SHOW LISTED HERE!

IF YOU’RE PROMOTING AN ART EXHIBIT, LET US KNOW BY POSTING INFO AND IMAGES BY THURSDAYS AT NOON ON OUR FORM AT SEVENDAYSVT.COM/POSTEVENT OR GALLERIES@SEVENDAYSVT.COM.

Through September 17. Info, 457-2355. Billings Farm & Museum in Woodstock. STACY HOPKINS JEWELRY: The White River Junction designer created a special collection from talons, skulls and feet of raptors; sales benefit the rehabilitation and protection work at VINS. Through August 31. Info, 295-0808. Vermont Institute of Natural Science Nature Center in Quechee. ‘TOGETHER, CAPTURED MOMENTS IN REALISM’: Paintings by married artists Andrew Williams and Sue Lawrence, curated by Kristin Stein Saroyan. Through August 26. Info, laura.dipiazza@goddard. edu. Info, 649-1184. Norwich Public Library. ‘UNBOUND VOL. VII’: The seventh annual juried exhibit of northeastern artists who explore the book as concept, form and object. Through August 26. Info, 457-3500. ArtisTree Community Arts Center & Gallery in Woodstock.

northeast kingdom

‘BELLS & WHISTLES’: An exhibition exploring the myriad forms and associations connected to these ordinary objects. Through May 1, 2018. Info, 626-4409. The Museum of Everyday Life in Glover. ‘CROSSING TO SAFETY’: A group exhibition of works celebrating Greensboro’s storied past and present as well as investigating the long, complex history of human migration. Through September 4. Info, 533-2045. Miller’s Thumb Gallery in Greensboro. ‘ESCAPE’: A collaborative exhibition by Ezra and Jennifer Ranz featuring works in ceramic, oil painting and more. Through August 20. Info, 533-9281. Greensboro Barn. GLORIA BERARD ROWELL: “Vermont Visions,” an exhibit of paintings by the Walden artist. Through August 27. Info, 563-2037. White Water Gallery in East Hardwick.

f JENNY GREEN: “Arid Lands,” watercolors of desert landscapes by the Danville artist. Reception: Friday, August 18, 5-7 p.m. Through September 23. Info, 748-0158. Northeast Kingdom Artisans Guild Backroom Gallery in St. Johnsbury.

ART SHOWS

JULIA TALCOTT: “Big Print,” works by the artist, teacher and coordinator of Big Print steamrollerprint events. Through August 20. Info, 748-2600. Catamount Arts Center in St. Johnsbury. KAREN GOWAN: “F-Stops Along the Way,” photographs of local farm animals and landscapes. Through September 5. Info, 525-3366. Parker Pie Co. in West Glover. LUCIEN B. DAY: “A Life in Art,” a retrospective of paintings by the late Vermont artist. Through September 24. Info, 533-2045. Highland Center for the Arts in Greensboro. ‘MEMPHREMAGOG WATERSHED ASSOCIATION: PRESERVING THE BEAUTY OF OUR WATERS’: A collaborative exhibition in honor of the 10th anniversary of the association and the art center. MAC members present a variety of new works inspired by the lake and environment. Through September 5. Info, 334-1966. MAC Center for the Arts in Newport.

brattleboro/okemo valley

‘HOPE AND HAZARD: A COMEDY OF EROS’: A group exhibition curated by American artist Eric Fischl featuring some 65 artists and more than 80 paintings, photographs, works on paper and sculptures. Artists include Tracy Emin, Nicole Eisenman, Yves Klein, Jeff Koons, Robert Mapplethorpe, Francis Picabia, Man Ray, Jason Rhoades, Hannah Wilke and many more. ‘READY. FIRE! AIM.’ AT HALL ART FOUNDATION: Joint exhibition curated by former BCA curator DJ Hellerman, inspired by Andy and Christine Hall’s art-collecting philosophy. DAVID SHRIGLEY: A solo exhibition of roughly 25 works by the British artist, including drawings, animations, paintings and sculpture. Through November 26. Info, 952-1056. Hall Art Foundation in Reading. MARGARET SHIPMAN: ”Botanical Essence,” an exhibition of mixed-media works by the southern Vermont artist. Through August 31. Info, 875-8900. DaVallia Art & Accents in Chester. SIX NEW EXHIBITS: Mary Admasian, “Boundaries, Balance and Confinement,” mixed-media works and sculpture; Wolf Kahn, “Density & Transparency,” paintings; Nathalie Miebach: Lost Porches,” 3D woven sculptures; Barbara Garber, “Free Fall,” mixed-media installation; William Chambers, “Spaceship of Dreams,” interactive public art project; and Timothy Greenfield-Sanders, “The Boomer List,” photographs. Through October 8. Info, 257-0124. Brattleboro Museum & Art Center.

manchester/bennington

‘I CHOOSE FILM’: A survey of film-based works, ranging from antique and specialized processes to hybrid “figital” (film combined with digital) innovations. Curated by Stephen Schaub. Through August 27. Info, 362-1405. Elizabeth de C. Wilson Museum, Southern Vermont Arts Center in Manchester.

SUMMER ARTIST MEMBER SHOW: A group exhibition featuring a variety of styles and mediums. Through September 10. Info, 362-1405. Yester House Galleries, Southern Vermont Arts Center in Manchester.

HANNAH DENNISON: “Moving Paint, Moving Bodies,” paintings and photographs of dances by the choreographer and director of Cradle to Grave Arts. Through August 31. Info, 685-2188. Chelsea Public Library. LINDSEY COLE: Works in a variety of mediums by the South Royalton native. Through September 29. Info, 763-7094. Royalton Memorial Library in South Royalton. PATRICK DUNFEY: Large paintings on hot-press watercolor paper with tempera and pigmented gesso. Some works measure longer than five feet. Through September 30. Info, 498-8438. White River Gallery @ BALE in South Royalton. ‘SCALE: MODELS TO MONUMENTS’: An exhibition curated by sculptor Jim Sardonis that looks at how artists create their visions for public art, shown with maquettes created by New England sculptors. Through September 2. Info, 728-6464. Chandler Gallery in Randolph.

outside vermont

ELLSWORTH KELLY: Two exhibits, “Slow Curve” and “Fruits & Flowers,” feature 70 prints that examine the artist’s experimentation with curved fields of color, and 26 lithographs of non-rectilinear forms, respectively. The works are from the private collection of Jordan D. Schnitzer and family foundation. Through September 17. Info, 518-792-1761. The Hyde Collection in Glens Falls, N.Y. JULIE BLACKMON: “The Everyday Fantastic,” an exhibition of photos from the artist’s “Homegrown” series of carefully choreographed scenes in her hometown of Springfield, Mo. Through August 27. Info, 603-646-2426. Hood Downtown in Hanover, N.H. KIRA’S GARDEN: An outdoor juried exhibition of sculpture. Through August 23, 2018. POP-UP EXHIBITION: Works by AVA interns Laura Borchert, Stefanie DeSimone, Jennifer Lay, Andy Ostler and Kristiana Ploss. Through August 25. SUMMER JURIED EXHIBITION: A group exhibition of 103 works by 81 regional artists juried by John Stomberg, director of the Hood Museum of Art at Dartmouth College. Through August 23. Info, 603-448-3117. AVA Gallery and Art Center in Lebanon, N.H. ‘MNEMOSYNE’: An exhibition pairing ancient and modern European works with contemporary art by Canadian artists. Through May 20, 2018. Info, 514-285-2000. ‘REVOLUTION’: An immersive exhibition that retraces the optimism, ideals and aspirations of the late 1960s, as expressed in music, film, fashion, design and activism. Through October 9. Info, 514-285-2000. Montréal Museum of Fine Arts in Montreal, QC.

SEVEN DAYS

NORTH BENNINGTON OUTDOOR SCULPTURE SHOW: The 20th annual outdoor sculpture exhibition, featuring works by more than 30 area artists. Through October 29. Info, alexandra.s.smith@ gmail.com. Info, 442-5549. Vermont Arts Exchange at Sage Street Mill in North Bennington.

ERIK BAIER: “Commune,” black-and-white photographs of commune structures. Through September 9. HUGH TOWNLEY: “Sculpture, Reliefs & Prints” by the late Vermont artist. Through September 10. Info, 767-9670. BigTown Gallery in Rochester.

08.16.17-08.23.17

‘GRANDMA MOSES: AMERICAN MODERN’: An exhibition that reconsiders the work and legacy of Anna Mary Robertson “Grandma” Moses within the framework of the artist’s contemporaries and cultural milieu. Through November 5. Info, 447-1571. Bennington Museum.

‘CONNECTING FIBERS’: An exhibition of textile art by Susan Cain, Judy Cayer, Louise Clark, Carrie Cooker, Christina Duffy, Betty LaWhite, Karyn Lord, Caitlyn MacGlaflin, Katrina Mojzesz, Fern Strong and Belinda Whipple Worth. Through August 26. Info, 889-9404. Tunbridge Public Library in Tunbridge Village.

SEVENDAYSVT.COM

TERRY JOHN WOODS: “Line of Horizon,” works by the designer and author of New Farmhouse Style, Summer House, and Farmhouse Modern. Through October 31. Info, 875-8900. DaVallia at 39 North in Chester.

randolph/royalton

‘ODANAKSIS: SUMMER TIME’: A group exhibition of works created by the collective, which found inspiration in various Upper Valley locations. Through September 30. Info, artbcook@gmail. com. Info, 603-795-4622. Converse Free Library in Lyme, N.H. OLAFUR ELIASSON: “Multiple shadow house,” the first solo exhibition in Canada by the internationally acclaimed artist, who applies scientific principles in order to explore our relationship to time and space. Through October 9. Info, 514-847-6226. Montréal Museum of Contemporary Art, CA. m

ART 79

2V-mswalker041917.indd 1

4/17/17 3:47 PM

movies The Glass Castle ★★

“

he medium is the message,” Marshall McLuhan famously proclaimed. Rarely have those words rung truer than during the eternity it took to slog through The Glass Castle. Directed and cowritten by Destin Daniel Cretton (Short Term 12) and based on the highly regarded 2005 memoir by Jeannette Walls, this is another of those movies about colorful anti-establishment parents who raise their offspring to question society’s rules while practically ruining their lives in the process. If the reckless behavior and child endangerment it depicts were the subject of a TMZ report, somebody would be going to jail. But since it’s the subject of a meandering, overly sentimental Hollywood weepie, no such luck. Brie Larson is a terrible talent to waste. But that’s precisely what happens here, as she portrays Walls primarily at a point in the ’80s when she’d escaped her parents and become a celebrated gossip columnist for New York magazine. Cretton takes a Cuisinart to the source material, intercutting scenes of her appalling, impoverished childhood with others from her young adulthood as a member of Manhattan society. Making that childhood a living hell were

her alcoholic father, Rex, played by Woody Harrelson in bellicose hillbilly mode; and flaky artist mother, Rose Mary, whom Naomi Watts never quite succeeds in bringing into focus. In much the same spirit as last year’s Captain Fantastic, the film offers a portrait of a family living off the grid, repeatedly packing up and moving in the dead of night, while generally marching to the beat of its know-itall patriarch. Walls grew up with two sisters and a brother. Her book documents countless acts of negligence and outright cruelty endured by the children, including prolonged intervals of malnourishment and hunger. At one point, a 3-year-old Jeannette is left to cook for herself and is literally scarred for life when her dress catches fire. Cretton rewrites history, making her older so as not to put his twinkly feel-good finale too much at risk. In another scene, Jeannette and her siblings make a meal of a stick of butter covered with sugar, the only food in the home, which also lacked electricity and running water. Meanwhile, Rose Mary obliviously paints canvas after canvas (the film provides no appraisal of her work) and never says a word when Rex disappears on drinking binges for days at a time.

BOHEMIAN CRAPSODY Cretton’s heavily sanitized adaptation blurs the line between free-spirited parenting and child endangerment.

The movie, by contrast, focuses on the more fanciful aspects of Rex’s parenting style. When the kids’ birthdays roll around, for example, he lets them pick a star and “gives” it to them as a present. Then there’s the eponymous edifice. Talk about belabored metaphors. Again and again, Rex is shown hunched over a table in the middle of the night, bottle on one side, blueprints for Never Gonna Happen Palace on the other, as he makes meaningless tweaks and deluded doodles. The Glass Castle, to be charitable, represents a career low for all involved. An insult to Walls’ memoir, Cretton’s script manipu-

lates events and perceptions for the purpose of concluding on a preposterous note of celebration. You know, of Rex’s free spirit. His bohemian refusal to play by the rules. His poetic, childlike nature. The filmmaker insults the viewer’s intelligence by suddenly softpedaling the character’s sins after spending two hours attempting to convince us he’s the devil. For that and a hundred other reasons, the film, too, is a meaningless tweak; a long, self-indulgent and incredibly deluded doodle. RI C K KI S O N AK

80 MOVIES

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

Annabelle: Creation ★★★

osters for Annabelle: Creation tout it as “The Next Film in The Conjuring Universe.” That’s right: The ghosts and demons whose “true” stories Ed and Lorraine Warren chronicled over decades of paranormal investigation now have their own extended universe, just like superheroes. Anything to distract the audience from the realization that these films are just a thousand variations on the same old bumps in the night. That said, if bumps in the night entertain you, this prequel to the poorly reviewed Annabelle (2014) has some good ones. Director David F. Sandberg (Lights Out) milks maximum chills from the material and his actors, though he can’t overcome a script in which people repeatedly do stupid things for no reason. An origin story for the titular demonically possessed doll (who first appeared as a footnote in The Conjuring), the film briefly shows us Annabelle’s genesis in the workshop of salt-of-the-earth dollmaker Samuel Mullins (Anthony LaPaglia). We never learn, however, why he chose to endow a doll seemingly inspired by his sweet little daughter (Samara Lee) with the eyes of a malevolent Margaret Keane painting and the carmine grimace of a vampire. Twelve years after their daughter’s accidental demise, in 1957, Mullins and his reclusive wife (Miranda Otto) attempt to heal by taking in a gaggle of female orphans, plus an

SLAYTIME Wilson makes a futile attempt to dispose of the demonic doll in Sandberg’s horror prequel.

attendant nun (Stephanie Sigman). Needless to say, this is a bad idea. Disabled by polio and isolated from her peers, young Janice (Talitha Bateman) begins experiencing strange phenomena in the ramshackle, desolate house. Behind a door that should be locked, she discovers Annabelle in a closet papered with Bible verses, which perhaps should have tipped her off to the whole “evil doll” thing. Instead, Janice and her friend Linda (Lulu Wilson, also an MVP in Ouija: Origin

of Evil) remain oblivious to the supernatural danger far longer than their youth can excuse. The film abounds in “No, don’t go in there!” scenes. While the young actors shine, their characters aren’t fleshed out enough to justify their lapses in logic, or to make us feel invested in their fates. Despite these failings, the film works as a collection of creepy set pieces, with careful camera work used to manipulate audience focus and expectation. Sandberg is lauded for his short fright films, and the best scenes

in Creation are basically that, easily disconnected from the main narrative. Not inclined to Chucky-style campiness, Annabelle stalks people with a certain style. In one scene, the viewer is riveted by an ambulatory drapery that slowly peels itself away to reveal not a CG horror, but nothing at all. It’s an emblem of the sleight of hand these movies practice, always making us anticipate something scarier than they produce. Great production design helps. The house where most of the action takes place has more character than anyone in it, from a creaky dumbwaiter to a record that plays by itself to a faceless scarecrow lurking in the barn. In mid-century horror cinema, nothing said “scary” quite like Victorian bric-a-brac; today, it’s the Eisenhower-to-Ford era that appears to have become the locus of terror. Perhaps the past of 50 or 60 years ago always appears to us as a haunted attic packed with cultural skeletons — such as the warehousing of kids in orphanages, or the shame that poor Janice experiences over her leg braces. We can tell ourselves we’ve put such ugliness behind us, but the logic of these films says the hideous effigy you lock in a closet will always sneak back out. MARGO T HARRI S O N

MOVIE CLIPS

NEW IN THEATERS THE HITMAN’S BODYGUARD: In this action comedy from director Patrick Hughes (The Expendables 3), Ryan Reynolds plays a straitlaced bodyguard assigned to protect a top hitman (Samuel L. Jackson) so he can testify in an important case. With Gary Oldman. (118 min, R. Essex, Majestic, Palace, Stowe, Sunset) LOGAN LUCKY: Director Steven Soderbergh returns to the heist shenanigans of his Ocean’s 11 series, only this time the heisters are working-class siblings hoping to rip off a NASCAR speedway. Channing Tatum, Adam Driver, Riley Keough and Daniel Craig star. (119 min, PG-13. Capitol, Essex, Majestic, Palace, Stowe) MOKA: A grieving mom (Emmanuelle Devos) stalks the couple she believes killed her son in a hit-and-run in this Swiss drama from director Frédéric Mermoud. With Nathalie Baye and David Clavel. (89 min, NR. Savoy)

NOW PLAYING ANNABELLE: CREATIONHHH The killer doll from The Conjuring film series gets a backstory in this period piece from director David F. Sandberg (Lights Out). Stephanie Sigman, Miranda Otto and Lulu Wilson star. (109 min, R; reviewed by M.H. 8/16) ATOMIC BLONDEHHHH Charlize Theron plays an undercover MI6 agent investigating a murder in Cold War Berlin in this action thriller based on a graphic novel series. With James McAvoy and John Goodman. Veteran stuntman David Leitch directed. (115 min, R; reviewed by R.K. 8/2) BABY DRIVERHHHH Edgar Wright (Hot Fuzz) wrote and directed this action thriller about a young getaway driver (Ansel Elgort) trying to leave the biz after one last risky heist for a crime boss (Kevin Spacey). With Jon Bernthal, Jon Hamm and Lily James. (113 min, R; reviewed by M.H. 7/5/17)

THE DARK TOWERHH In this adaptation of Stephen King’s eight-book fantasy/Western mash-up series, Idris Elba plays the Gunslinger who battles a mysterious Man in Black (Matthew McConaughey). Nikolaj Arcel (A Royal Affair) directed. (95 min, PG-13)

DETROIT 1/2H This historical drama from director Kathryn Bigelow (Zero Dark Thirty) revisits the riots sparked by the police killings of three young black men at Detroit’s Algiers Motel in 1967. John Boyega, Algee Smith and Anthony Mackie star. (143 min, R; reviewed by R.K. 8/9)

H = refund, please HH = could’ve been worse, but not a lot HHH = has its moments; so-so HHHH = smarter than the average bear HHHHH = as good as it gets

THE GLASS CASTLEH1/2 In this adaptation of Jeannette Walls’ best-selling memoir, Brie Larson plays a young woman contending with a family of itinerant dreamers and schemers. With Woody Harrelson, Naomi Watts and Ella Anderson. Destin Daniel Cretton (Short Term 12) directed. (127 min, PG-13; reviewed by R.K. 8/16) AN INCONVENIENT SEQUEL: TRUTH TO POWERHHH1/2 A decade after An Inconvenient Truth, Al Gore returns in this documentary with an update on what we are and aren’t doing to fight the terrifying specter of climate change. With Barack Obama and Donald Trump. Bonni Cohen and Jon Shenk directed. (98 min, NR)

 Ages 18-35

KIDNAPHH1/2 Halle Berry plays a mom who decides not to leave the fate of her abducted son to law enforcement in this thriller from director Luis Prieta (Pusher). With Sage Correa and Chris McGinn. (94 min, R)

 2 outpatient screening visits

LADY MACBETHHHHH A young woman forced into marriage discovers unexpected routes to power in this award-winning psychosexual drama set in rural 19th-century England. With Florence Pugh, Cosmo Jarvis and Paul Hilton. William Oldroyd directed. (89 min, R; reviewed by M.H. 8/9) LANDLINEHHH1/2 Set in 1995, this indie comedy from Gillian Robespierre (Obvious Child) examines one messed-up family in New York through the eyes of a teen. With Jenny Slate, Jay Duplass, Abby Quinn and John Turturro. (97 min, R) MAUDIEHHH1/2 Sally Hawkins plays Canadian folk artist Maud Lewis in this biopic that explores her hard-scrabble life with her husband (Ethan Hawke) in a one-room Nova Scotia cottage. Aisling Walsh (“Fingersmith”) directed. (115 min, PG-13) THE NUT JOB 2: NUTTY BY NATUREHH Surly the squirrel (voice of Will Arnett) and his animal friends must stop the nefarious mayor from turning their park into a cheesy fun fair in this family animation sequel. With Katherine Heigl and Maya Rudolph. Cal Brunker directed. (91 min, PG) SPIDER-MAN: HOMECOMINGHHH1/2 In the latest Marvel flick, Tom Holland plays the teenage webbed crusader in an adventure set after the events of Captain America: Civil War, also starring Robert Downey Jr., Michael Keaton and Marisa Tomei. Jon Watts (Cop Car) directed. (133 min, PG-13; reviewed by M.H. 7/12)

 8 day/7 night inpatient stay  4 outpatient follow-up visits  Up to $1650 compensation

For more information

Call 802-656-0013 Email: UVMVTC@uvm.edu or visit UVMVTC.org

.__,________,VACCINE TESTING CENTER NOW PLAYING

» P.83 2v-UVMVaccinetestingCTR(Respiratory/MilitaryAD)062817.indd 1

6/19/17 12:20 PM

MOVIES 81

RATINGS ASSIGNED TO MOVIES NOT REVIEWED BY RICK KISONAK OR MARGOT HARRISON ARE COURTESY OF METACRITIC.COM, WHICH AVERAGES SCORES GIVEN BY THE COUNTRY’S MOST WIDELY READ MOVIE REVIEWERS.

GIRLS TRIPHHH1/2 Four long-time friends bare their souls and get a little wild at the Essence Festival in New Orleans in this comedy from director Malcolm D. Lee (Barbershop: The Next Cut). Regina Hall, Queen Latifah and Jada Pinkett Smith star. (122 min, R)

Volunteers needed for a research study to test a vaccine against a respiratory virus that aﬀects our military troops

SEVEN DAYS

ratings

A GHOST STORYHHHHH A musician (Casey Affleck) returns from the dead to haunt his significant other (Rooney Mara) in this moody indie drama about loss from director David Lowery (Pete’s Dragon, Ain’t Them Bodies Saints). (92 min, R; reviewed by M.H. 8/2)

08.16.17-08.23.17

DESPICABLE ME 3HH1/2 Gru (voice of Steve Carell) is tempted to return to his supervillain ways after meeting his long-lost twin brother in the continuation of the hit family animation series. Kristen Wiig and Trey Parker costar. Eric Guillon, Kyle Balda and Pierre Coffin directed. (90 min, PG)

THE EMOJI MOVIE 1/2H You add these cutesy icons to your text messages and posts. Now, see the cutesy animation in which an emoji struggles with his natural tendency to express a full range of emotions. T.J. Miller, James Corden, Maya Rudolph and Anna Faris contributed voice talent. Tony Leondis (Igor) directed. (86 min, PG)

SEVENDAYSVT.COM

THE BIG SICKHHHHH An illness complicates a couple’s burgeoning cross-cultural romance in this fact-based indie comedy directed by Michael Showalter (Hello, My Name Is Doris). Kumail Nanjiani, Zoe Kazan and Holly Hunter star. (120 min, R; reviewed by R.K. 7/19)

DUNKIRKHH1/2 Christopher Nolan (Interstellar) wrote and directed this epic account of the 1940 battle in which Allied soldiers in France found themselves surrounded by the invading German army. With Fionn Whitehead, Mark Rylance and Tom Hardy. (106 min, PG-13; reviewed by R.K. 7/26)

Healthy Volunteers, We Need You!

movies

friday 18 — thursday 24

MARQUIS THEATRE Main St., Middlebury, 388-4841, middleburymarquis.com

wednesday 16 — thursday 17

Kidnap

LOCALtheaters

friday 18 — wednesday 23 Schedule not available at press time.

(*) = NEW THIS WEEK IN VERMONT. FOR UP-TO-DATE TIMES VISIT SEVENDAYSVT.COM/MOVIES.

BIG PICTURE THEATER

48 Carroll Rd. (off Rte. 100), Waitsfield, 496-8994, bigpicturetheater.info

wednesday 16 — thursday 17 Baby Driver War for the Planet of the Apes friday 18 — tuesday 22 Schedule not available at press time.

BIJOU CINEPLEX 4

Rte. 100, Morrisville, 888-3293, bijou4. com

wednesday 16 — tuesday 22 The Dark Tower Dunkirk The Emoji Movie The Nut Job 2: Nutty by Nature Valerian and the City of a Thousand Planets Wonder Woman

CAPITOL SHOWPLACE wednesday 16 — thursday 17 The Big Sick Detroit Dunkirk The Glass Castle The Nut Job 2: Nutty by Nature (2D & 3D) Spider-Man: Homecoming

08.16.17-08.23.17

SEVENDAYSVT.COM

93 State St., Montpelier, 229-0343, fgbtheaters.com

friday 18 — thursday 24 The Big Sick Dunkirk The Glass Castle *Logan Lucky The Nut Job 2: Nutty by Nature Spider-Man: Homecoming

ESSEX CINEMAS & T-REX THEATER

21 Essex Way, Suite 300, Essex, 8796543, essexcinemas.com

wednesday 16 — thursday 17 Annabelle: Creation Atomic Blonde The Dark Tower Despicable Me 3 Detroit Dunkirk The Emoji Movie (2D & 3D) The Glass Castle *The Hitman’s Bodyguard (Thu only) Kidnap *Logan Lucky (Thu only) The Nut Job 2: Nutty by Nature (2D & 3D) Spider-Man: Homecoming War for the Planet of the Apes friday 18 — wednesday 23 Annabelle: Creation Atomic Blonde The Dark Tower Despicable Me 3 Dunkirk The Emoji Movie The Glass Castle *The Hitman’s Bodyguard Kidnap

The Big Sick Dunkirk An Inconvenient Sequel: Truth to Power

*Logan Lucky The Nut Job 2: Nutty by Nature Spider-Man: Homecoming

MAJESTIC 10

190 Boxwood St. (Maple Tree Place, Taft Corners), Williston, 878-2010, majestic10.com

wednesday 16 — thursday 17 Annabelle: Creation Baby Driver The Big Sick The Dark Tower Despicable Me 3 Detroit Dunkirk The Emoji Movie The Glass Castle *The Hitman’s Bodyguard (Thu only) Kidnap *Logan Lucky (Thu only) The Nut Job 2: Nutty by Nature Spider-Man: Homecoming Wonder Woman friday 18 — wednesday 23 Annabelle: Creation Baby Driver The Dark Tower Despicable Me 3 Dunkirk The Emoji Movie The Glass Castle *The Hitman’s Bodyguard Kidnap *Logan Lucky The Nut Job 2: Nutty by Nature Spider-Man: Homecoming Wonder Woman

MERRILL’S ROXY CINEMA

222 College St., Burlington, 864-3456, merrilltheatres.net

Mountain Rd., Stowe, 253-4678. stowecinema.com

wednesday 16 — thursday 17 Atomic Blonde The Big Sick Dunkirk friday 18 — thursday 24 The Big Sick *The Hitman’s Bodyguard *Logan Lucky

SUNSET DRIVE-IN

155 Porters Point Rd., Colchester, 8621800. sunsetdrivein.com

wednesday 16 — thursday 17

wednesday 16 — thursday 24 The Big Sick Dunkirk The Glass Castle An Inconvenient Sequel: Truth to Power Lady Macbeth Maudie Spider-Man: Homecoming

The Nut Job 2: Nutty by Nature & The Emoji Movie Annabelle: Creation & Atomic Blonde Spider-Man: Homecoming & The Dark Tower Wonder Woman & Dunkirk

PARAMOUNT TWIN CINEMA

241 North Main St., Barre, 479-9621, fgbtheaters.com

wednesday 16 — thursday 17 Annabelle: Creation The Dark Tower

friday 18 — thursday 24

THE SAVOY THEATER

*The Hitman’s Bodyguard & Baby Driver Annabelle: Creation & The Dark Tower The Nut Job 2: Nutty by Nature & Spider-Man: Homecoming Wonder Woman & Dunkirk

wednesday 16 — thursday 17

WELDEN THEATRE

friday 18 — thursday 24

PALACE 9 CINEMAS

10 Fayette Dr., South Burlington, 8645610, palace9.com

wednesday 16 — thursday 17 Annabelle: Creation Atomic Blonde The Dark Tower Despicable Me 3 Detroit (Wed only) Dunkirk The Emoji Movie **Fairy Tail: Dragon Cry (dubbed) (Wed only) Girls Trip *The Hitman’s Bodyguard (Thu only) Kidnap *Logan Lucky (Thu only) The Nut Job 2: Nutty by Nature **RiffTrax: Doctor Who: The Five Doctors (Thu only) **TCM: Bonnie and Clyde (Wed only) Wonder Woman

Annabelle: Creation Wonder Woman

26 Main St., Montpelier, 229-0598, savoytheater.com

104 No. Main St., St. Albans, 527-7888, weldentheatre.com

A Ghost Story An Inconvenient Sequel: Truth to Power Landline

wednesday 16 — thursday 17 Annabelle: Creation The Dark Tower Girls Trip The Nut Job 2: Nutty by Nature

friday 18 — thursday 24 An Inconvenient Sequel: Truth to Power Landline *Moka **Where the Rivers Flow North (Tue only)

friday 18 — thursday 24 Annabelle: Creation Atomic Blonde The Dark Tower Kidnap The Nut Job 2: Nutty by Nature

LOOK UP SHOWTIMES ON YOUR PHONE!

GO TO SEVENDAYSVT.COM ON ANY SMARTPHONE FOR FREE, UP-TO-THE-MINUTE MOVIE SHOWTIMES, PLUS OTHER NEARBY RESTAURANTS, CLUB DATES, EVENTS AND MORE.

JOIN Darren & Kristin

SEVEN DAYS

STOWE CINEMA 3 PLEX

Annabelle: Creation Atomic Blonde The Dark Tower Dunkirk The Emoji Movie **Extraordinary: Stan Lee Tribute (Tue only) **Fairy Tail: Dragon Cry (dubbed) (Sat only) Girls Trip *The Hitman’s Bodyguard Kidnap (except Mon & Thu) *Logan Lucky The Nut Job 2: Nutty by Nature **RiffTrax: Doctor Who: The Five Doctors (Thu only) **Starship Troopers: Traitor of Mars (Mon only) Wonder Woman

Romantic weekends and destination weddings! Featured in Yankee, Country Living and Vermont magazines, the Lilac Inn can best be described as a small luxury hotel with personalized service and unexpected amenities. Situated in a pristine, picturesque area in the Vermont countryside, the Inn was more recently described as a “charming sprawling estate” and a “romantic getaway.”

@ 5p and 6p on

WCAX!

82 MOVIES

.COM WCAX.COM WCAX.COM WCAX.COM WCAX.COM WCAX.COM WCAX.COM

Give us a call today.

We want to help you plan a beautiful event or special weekend.

53 Park Street, Brandon | 802-247-5463 | lilacinn.com Untitled-19 1

1/30/17 11:16 AM

8H-lilacinn080217.indd 1

8/1/17 2:25 PM

MOVIE CLIPS

Their Playlists: NOW PLAYING

« P.81

NOW ON VIDEO

VALERIAN AND THE CITY OF A THOUSAND PLANETSHH Director Luc Besson (Lucy) gives his usual wacky touch to this sci-fi epic based on a French graphic novel series about two 28th-century agents (Dane DeHaan and Cara Delevingne) solving a mystery. With Clive Owen and Ethan Hawke. (137 min, PG-13; reviewed by M.H. 7/26) WAR FOR THE PLANET OF THE APESHHH1/2 In the follow-up to Dawn of the Planet of the Apes (2014), simian patriarch Caesar (Andy Serkis) must face his demons and confront the formidable Colonel (Woody Harrelson) to avenge his kind. Matt Reeves again directed. (140 min, PG-13; reviewed by M.H. 7/19) WONDER WOMANHHHH The Amazon princess (Gal Gadot) gets an origin story to explain her transformation into a DC Comics staple in this rare female-centric superhero film, directed by Patty Jenkins (Monster). With Robin Wright, David Thewlis and Connie Nielsen. (141 min, PG-13; reviewed by M.H. 6/7)

ALIEN: COVENANTHHH1/2 In Ridley Scott’s prequel to Alien and sequel to Prometheus, a ship full of 22nd-century colonists happens on a supposedly uninhabited planet emitting a distress signal. Michael Fassbender, Katherine Waterston and Billy Crudup star. (122 min, R; reviewed by M.H. 5/24)

Ours:

THE CASE FOR CHRISTHH1/2 In the latest faith-based film from PureFlix, Mike Vogel plays Lee Strobel, an atheist journalist who changed his tune after he began investigating Christianity. (112 min, PG)

500 songs

2792 279 7 2 79 & Counting!

EVERYTHING, EVERYTHINGHH1/2 A girl (Amandla Stenberg) whose allergies keep her house-bound risks everything for romance with the boy next door (Nick Robinson) in this adaptation of the YA bestseller. Stella Meghie directed. (96 min, PG-13) HOW TO BE A LATIN LOVERHH1/2 Ken Marino, formerly of comedy troupe the State, makes his feature directorial debut with this comedy about a Lothario (Eugenio Derbez) reconnecting with his estranged sister (Salma Hayek) while scheming to wed a wealthy widow (Raquel Welch). (115 min, PG-13)

More movies!

Film series, events and festivals at venues other than cinemas can be found in the calendar section.

OFFBEAT FLICK OF THE WEEK B Y MARGOT HARRI SON

Untitled-16 1

sevendaysvt.com/liveculture.

4t-joke.indd 1

TO SUBMIT, GO TO: SEVENDAYSVT.COM/JOKE.

5/15/17 3:21 PM

MOVIES 83

READ THESE EACH WEEK ON THE LIVE CULTURE BLOG AT

SPEAKING OF COMEDY...

check out the “Parmelee Post” online. It’s a new humor column on local news that hasn’t happened.

SEVEN DAYS

Offbeat Flick of the Week: We pick an indie, foreign, cultish or just plain odd movie that hits local theaters, DVD or video on demand this week. If you want an alternative to the blockbusters, try this!

No, we’re not kidding. Each week, we’ll publish one joke submitted by a comic on our arts blog, Live Culture. So, what are you waiting for?

08.16.17-08.23.17

What if we told you that you could share your jokes with the world?

SEVENDAYSVT.COM

Calling All Jokers!

Moka Unable to process the reality of her son's death, a grieving woman (Emmanuelle Devos) tracks down the couple who may have killed him in a hit-and-run. She even gets herself a gun. It sounds like the plot of a Death Wish spin-off, but in the hands of Swiss director Frédéric Mermoud, this set-up yields an acclaimed study of mourning and the search for closure. "You could rightly call it a thriller, but a slow-burning one, and a film that’s driven by character, not plot points," writes G. Allen Johnson in a rave review in the San Francisco Chronicle. Veteran French actress Nathalie Baye costars as the woman who may or may not be the killer. You can see Moka starting Friday at the Savoy Theater in Montpelier.

4/27/17 4:20 PM

fun stuff FRAN KRAUSE

84 FUN STUFF

SEVEN DAYS

08.16.17-08.23.17

SEVENDAYSVT.COM

Have a deep, dark fear of your own? Submit it to cartoonist Fran Krause at deep-dark-fears.tumblr.com, and you may see your neurosis illustrated in these pages.

EDIE EVERETTE

MORE FUN! STRAIGHT DOPE (P.30) CROSSWORD (P.C-5) CALCOKU & SUDOKU (P.C-7)

Hit the

ROAD WITH THE

Vermont Family Summer Fun Guide Verm ont Family Summer Fun Guide Verm Vermont ontFam Family ilySum Summer merFun FunGui Guidede

FREE FREE FREE FREE

2017 2017 2017 2017

ActionPa cke Ac tio d nAc tio nAc Itinera tio nPa rie cke sd Pa cke dd Pa cke Itin era rie s PLUS Itinera erarie riess SkiItin ResPLUS orts in PLUS the Sum merin PLUS Ski Res orts

Ski Res orts inin Outdoo r Fest ivals Ski the Res Sum orts mer the Sum mer Berry -Pick ing the Outdoo Sum mer r Fest ivals OutdooRoun r ivals dup Outdoo BerryrFest Fest -Pick ivals ing Berry -Pick ing Roun dup Berry -Pick ing Roun dup Roun dup ..

Brought to yo ub y.

Brought to yo ub y Brought to y.o ub y Brought to y.o ub y. ..

SEVENDAYSVT.COM 08.16.17-08.23.17 SEVEN DAYS FUN STUFF 85

Calling All Jokers!

What if we told you that you could share your jokes with the world?

Make the most of Vermont's short but sweet summer season with the Daytripper, Kids VT's new curated guide to summer family fun. Filled with some of our favorite places to visit, eat, picnic and play, the Daytripper will help you and your kids explore Vermont with a new sense of adventure! Pick up a copy today at hundreds of locations throughout the state.

TO SUBMIT, GO TO: SEVENDAYSVT.COM/JOKE.

2v-DayTripper0617.indd 1

5/26/17 10:32 AM

fun stuff JEN SORENSEN

HARRY BLISS

“Oh, no — they’re three doors down on the left, we’re ‘People for the Ethical treatment of attorneys.’”

86 FUN STUFF

SEVEN DAYS 08.16.17-08.23.17 SEVENDAYSVT.COM

RACHEL LIVES HERE NOW

REAL FREE WILL ASTROLOGY BY ROB BREZSNY AUGUST 17—23

LEO

(JULY 23-AUG. 22)

“If you love someone, set them free,” said new age author Richard Bach. “If they come back, they’re yours; if they don’t, they never were.” By using my well-educated intellect to transmute this hippy-dippy thought into practical advice, I came up with a wise strategy for you to consider as you reevaluate your relationships with allies. Try this: Temporarily suspend any compulsion you might have to change or fix these people; do your best to like them and even love them exactly as they are. Ironically, granting them this freedom to be themselves may motivate them to modify, or at least tone down, the very behavior in themselves to which you’re semi-allergic.

TAURUS

(April 20-May 20): Congratulations! I expect that during the next three weeks, you will be immune to what psychoanalyst Joan Chodorow calls “the void of sad-

GEMINI

(May 21-June 20): The coming days would be an excellent time to celebrate (even brag about) the amusing idiosyncrasies and endearing quirks that make you lovable. To get you inspired, read this testimony from my triple Gemini friend Alyssa: “I have beauty marks that form the constellation Pegasus on my belly. I own my own ant farm. I’m a champion laugher. I teach sign language to squirrels. Late at night, when I’m horny and overtired, I may channel the spirit of a lion goddess named Sekhmet. I can whistle the national anthems of eight different countries. I collect spoons from the future. I can play the piano with my nose and my toes. I have forever banished the green-eyed monster to my closet.”

CANCER (June 21-July 22): Your education may take unusual forms during the coming weeks. For example, you could receive crunchy lessons from velvety sources, or tender instructions from exacting challenges. Your curiosity might expand to enormous proportions in the face of a noble and elegant tease. And chances are good that you’ll find a new teacher in an unlikely setting or be prodded and tricked into asking crucial questions you’ve been neglecting to ask. Even if you haven’t been particularly street smart up until now, Cancerian, I bet your ability to learn from uncategorizable experiences will blossom. VIRGO (Aug. 23-Sept. 22): In 1892, workers began building the Cathedral of St. John the Divine in New York. But as of August 2017, it is still under construction. Renovation has been and continues to be extensive. At one point

in its history, designers even changed its architectural style from Neo-Byzantine and Neo-Romanesque to Gothic Revival. I hope this serves as a pep talk in the coming weeks, which will be an excellent time to evaluate your own progress, Virgo. As you keep toiling away on behalf of your dreams, there’s no rush. In fact, my sense is that you’re proceeding at precisely the right rate.

LIBRA (Sept. 23-Oct. 22): In accordance with the astrological omens, I hereby declare the next two weeks your own personal Amnesty Holiday. To celebrate, ask for and dole out forgiveness. Purge and flush away any nonessential guilt and remorse that are festering inside you. If there truly are hurtful sins that you still haven’t atoned for, make a grand effort to atone for them — with gifts and heartfelt messages if necessary. At the same time, I urge you to identify accusations that others have wrongly projected onto you and that you have carried around as a burden even though they are not accurate or fair. Expunge them. SCORPIO (Oct. 23-Nov. 21): How many countries has the United States bombed since the end of World War II? Twenty-five, to be exact. But if America’s intention has been to prod these nations into forming more free and egalitarian governments, the efforts have been mostly fruitless. Few of the attacked nations have become substantially more democratic. I suggest you regard this as a valuable lesson to apply to your own life in the coming weeks, Scorpio. Metaphorical bombing campaigns wouldn’t accomplish even 10 percent of your goals and would also be expensive in more ways than one. So I recommend using the “killing with kindness” approach. Be wily and generous. Cloak your coaxing in compassion. SAGITTARIUS

(Nov. 22-Dec. 21): You know about the Ten Commandments, a code of ethics and behavior that’s central to Christianity and Judaism. You may not be familiar with my Ten Suggestions, which begin with “Thou Shall Not Bore God” and “Thou Shall Not Bore Thyself.” Then there are the Ten Indian Commandments proposed by the Bird Clan of East Central Alabama. They include “Give as-

sistance and kindness whenever needed” and “Look after the well-being of your mind and body.” I bring these to your attention, Sagittarius, because now is an excellent time to formally formulate and declare your own covenant with life. What are the essential principles that guide you to the highest good?

CAPRICORN (Dec. 22-Jan. 19): Here’s a definition of “fantasizing” as articulated by writer Jon Carroll. It’s “a sort of ‘in-brain’ television, where individuals create their own ‘shows’ — imaginary narratives that may or may not include real people.” As you Capricorns enter the High Fantasy Season, you might enjoy this amusing way of describing the activity that you should cultivate and intensify. Would you consider cutting back on your consumption of movies and TV shows? That might inspire you to devote more time and energy to watching the stories you can generate in your mind’s eye. AQUARIUS (Jan. 20-Feb. 18): In 43 car-

toon stories, the coyote named Wile E. Coyote has tried to kill and devour the swift-running flightless bird known as the Road Runner. Every single time, Wile E. has failed to achieve his goal. It’s apparent to astute observers that his lack of success is partly due to the fact that he doesn’t rely on his natural predatory instincts. Instead, he concocts elaborate, overly complicated schemes. In one episode, he camouflages himself as a cactus, buys artificial lightning bolts and tries to shoot himself from a bow as if he were an arrow. All these plans end badly. The moral of the story, as far as you’re concerned, is: To reach your next goal, trust your instincts.

PISCES (Feb. 19-March 20): You temporarily have cosmic permission to loiter and goof off and shirk your duties. To be a lazy bum and meander aimlessly and avoid tough decisions. To sing off-key and draw stick figures and write bad poems. To run slowly and flirt awkwardly and dress like a slob. Take advantage of this opportunity, because it’s only available for a limited time. It’s equivalent to pushing the reset button. It’s meant to reestablish your default settings. But don’t worry about that now. Simply enjoy the break in the action.

SEVENDAYSVT.COM

ARIES (March 21-April 19): “To disobey in order to take action is the byword of all creative spirits,” said philosopher Gaston Bachelard. This mischievous advice is perfect for your use right now, Aries. I believe you’ll thrive through the practice of ingenious rebellion — never in service to your pride, but always to feed your soul’s lust for deeper, wilder life. Here’s more from Bachelard: “Autonomy comes through many small disobediences, at once clever, well thought-out and patiently pursued, so subtle at times as to avoid punishment entirely.”

ness, the abyss of fear, the chaos of anger and the alienation of contempt and shame.” I realize that what I just said might sound like an exaggeration. Aren’t all of us subject to regular encounters with those states? How could you possibly go so long without brushing up against them? I stand by my prediction and push even further. For at least the next three weeks, I suspect you will also be available for an inordinate amount of what Chodorow calls “the light of focused insight” and “the playful, blissful, all-embracing experience of joy.”

CHECK OUT ROB BREZSNY’S EXPANDED WEEKLY AUDIO HOROSCOPES & DAILY TEXT MESSAGE HOROSCOPES: REALASTROLOGY.COM OR 1-877-873-4888