Issuu on Google+


Harga Eceran Rp2.500,-

Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Pahing, 30 September 2013/25 Zulqaidah 1434 H

No: 24356 Tahun Ke-67

Terbit 24 Halaman

Waspada/Surya Efendi

FENOMENA LANGIT KOTA MEDAN: Langit di atas Kota Medan diambil Minggu (29/9) sore, terlihat berwarna-warni mirip pelangi. Fenomena ini hanya berlangsung beberapa saat.

Bus Pinem Terbalik, 6 Tewas Polres Pidie Sita 343 Kg Ganja Tujuan Medan SIGLI (Waspada) : Tim gabungan Polres Pidie menyita 343 Kg ganja dari Banda Aceh yang akan dibawa ke Medan di jalan lingkar, Desa Keunire, Kec. Pidie, Jumat (27/9) pukul 22:30. Bersamaan dengan itu, polisi mengamankan dua kurir dan menyita satu truk Puso BA 8685 AU, berikut ganja yang dibawa. Kedua kurir, KAS, 55, sopir, dan Muna, 26, kernet. Kapolres Pidie AKBP Sunarya didampingi Kasat Narkoba AKP Aiyub, Minggu (29/9) mengatakan, penggagalan pengiriman ganja itu, dilakukan dalam operasi rutin di jalan lingkar, Desa Keunire, Kec. Pidie.

Saat itu, kata Sunarya, petugas mencurigai truk tersebut, karena menerobos blokade petugas yang melakukan razia. Petugas meminta kembali truk tersebut berhenti. Setelah truk itu parkir persis di salah satu warung di jalan lingkar Keunire, polisi melakukan penggeledahan, dan menemukan ganja seberat 343 Kg dibungkus dan diletakkan dalam bak truk bagian belakang. “Kami juga membawa sopir KAS ke Banda Aceh untuk menangkap seseorang berinisial K, yang dicurigai sebagai pemilik ganja tersebut. Namun, K duluan kabur,” kata Sunarya.

PERBAUNGAN(Waspada): Enam orang tewas , belasan orang lainnya luka berat dan ringan setelah bus penumpang umum CV. PO Pinem BK 7772 LC dari Rokan Hilir tujuan Medan, yang mereka tumpangi dari Pekanbaru menuju Medan terbalik di tingkungan tajam jalan lintas Sumatera (Jalinsum) Km 41-42 Simpang Bengabing,Dusun I Desa Pasar Bengkel,Kec. Perbaungan,Kab. Serdang Bedagai, Minggu(29/9) pukul 05:00 subuh.

Kelompok Bersenjata Serang Kampus Di Nigeria, 50 Tewas

Lanjut ke hal A2 kol. 1

Waspada/Eddi Gultom

BUS penumpang Umum CV.PO.Pinem dalam posisi terbalik

Lanjut ke hal A2 kol. 7

tidak ada pohon tumbang, hanya dahan atau ranting-ranting pohon sempal dan sempat membuat arus lalulintas di Jl. Imam Bonjol dan Simpang Tumapel atau Jl. Teuku Umar macat selama 15 s/d 20 menit,” ujar Aga Nofian, STP Lurah Petisah Tengah. Lanjut ke hal A2 kol. 7

Al Bayan

Berkat Doa Ibrahim Oleh Tgk. H. Ameer Hamzah Ya Tuhan kami! Jadikanlah aku dan anak cucuku orang-orang yang tetap mendirikan shalat.Ya Tuhan kami, perkenankanlah doaku Ya Tuhan kami, beri ampunlah aku dan kedua ibu bapaku dan sekalian orang-orang Mukmin pada hari hisab. (QS. Ibrahim:40-41)

Calhaj Kloter 11 Medan Sehat


SEJUMLAH warga melihat kondisi bus Pinem yang mengalami kecelakaan di Pasar Bengkel, Serdang Bedagai, Minggu (29/9).

5 Anggota Mapala Unand Tewas Terseret Air Bah PADANG (Waspada): Lima anggota Mahasiswa Pecinta Alam Universitas Andalas (Unand) ditemukan tewas, satu masih dicari

dan dua lainnya selamat. Mereka hanyut di Sungai Patamuan, Batu Busuak, Kec. Pauh, Kota Padang, Sabtu (28/9). Aldian, anggota senior Ma-


pala Unand menjelaskan, rekan-rekannya saat itu sedang melakukan survei medan untuk kegiatan anggota baru. Dalam perjalanan pulang,

mereka diseret air bah. “Mereka berangkat delapan orang naik dari batu

Lanjut ke hal A2 kol. 3

22 Imigran Gelap Tewas, 30 Dicari Dan 28 Selamat

BETAPA indah doa nenek moyang kita Nabi Ibrahim as. Doanya dikabulkan Allah dengan menjadikan keturunannya sebagai orang-orang yang beriman kepada Allah SWT. Dua putranya, dan satu cucu dan anak cucunya, serta keturunannya lagi menjadi rasul-rasul pembawa risalah Tauhid. Dua anaknya adalah Nabi Ismail dan Nabi Ishak. Nabi Ishak mempunyai anak Nabi Ya’kub as,

Lanjut ke hal A2 kol. 6

Saksimata menyebutkan sekitar 50 mayat berada di rumah sakit ibukota negara bagian Yobe, Damaturu. Kebanyakan dari korban adalah anak-anak muda yang diyakini sebagai mahasiswa. Para mahasiswa itu ditembak mati ketika mereka tidur di asrama di kampus Perguruan Tinggi Pertanian di negara bagian Yobe. Nigeria Timurlaut berada dalam keadaan darurat di tengah satu pemberontakan oleh kelompok Bako Haram, yang berjuang menggulingkan pemerintahan Nigeria untuk menciptakan satu negara Islam dan telah melancarkan serangkaian serangan atas sejumlah sekolah. Lanjut ke hal A2 kol. 6

Suhu Di Madinah 410C

Angin Kencang Landa Medan, Sedan Ringsek MEDAN (Waspada): Hujan deras disertai angin kencang yang mengguyur Kota Medan sekitarnya, Minggu (29/9) sore, mengakibat sebatang dahan pohon sempal (patah) dan menimpa satu mobil Lancer di Jl. Imam Bonjol Medan. “ Di Kel. Petisah Tengah

D A M AT U RU , Ni g e r i a (Waspada): Kelompok bersenjata menyerbu dan memberondongkan peluru terhadap satu perguruan tinggi di Nigeria Timurlaut, demikian BBC Minggu (29/9). Serangan itu terjadi ketika rakyat Negeria baru dilanda teror di sebuah pusat perbelanjaan di Nairobi, Kenya, dan menewaskan puluhan orang beberapa hari lalu.Orang-orang bersenjata itu menyerang dengan membabibuta dan sudah 50 orang meninggal dunia. Para penyerang menyasar sekolah dan kampus-kampus, menyerbu Akademi Pertanian di negara bagian Yobe dan menembak para mahasiswa saat tertidur pada malam hari, kata Komisaris polisi Sanusi Rufai.


IMIGRAN gelap asal Lebanon, Pakistan dan Irak terkapar tak berdaya di Kampung Cikolek, Jawa Barat, Jumat (27/9).

SUKABUMI (Waspada): Tim SAR gabungan masih melakukan pencarian 30 orang imigran gelap yang hilang di laut setelah kapal tongkang yang membawa imigran itu karam di perairan Tegalbuleud, Kab. Sukabumi, Jumat (27/9). Kepala Pusat Data Informasi dan Humas BNPB, Sutopo Purwo Nugroho mengatakan, pencarian masih dilakukan di sekitar Pantai Cikole, Kecamatan Agrabinta, Desa Sinar Luat, Kabupaten Cianjur, Jawa Barat. Dari data awal, sebanyak 22 orang imigran ditemukan tewas. Sebanyak 13 korban adalah perempuan dan sembilan Lanjut ke hal A2 kol. 3

MEDAN (Waspada) : Kondisi jamaah Kloter 11 Embarkasi Medan, saat ini dalam keadaan sehat meski suhu udara di Madinah mencapai 41 derajat Celcius. Demikian disampaikan Drs H Jaharudin,SPdI, MA, TPIHI Kloter 11 Embarkasi Medan, Minggu (29/9) melalui SMS dari Madinah. Kabid Penerangan Agama Islam, Zakat dan Wakaf di Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara, itu mengatakan, Calhaj Kloter 11 umumnya sehat dan sudah melaksanakan serangkaian ibadah sunat dan mengunjungi tempat-tempat bersejarah di Madinah. Meski udara terbilang panas, kata Jaharuddin, dia bersama petugas lainnya di kloter itu tetap memberikan pengawasan pada Calhaj, dan memberikan arahan terkait pelaksanaan ibadah. Ia mengingatkan jamaah agar tidak bepergian seorang diri untuk menjaga hal-hal yang tidak diinginkan, antaranya tersesat. “Alhamdulillah semua jamaah dalam Kloter 11 sehat. Saat ini kami masih di Madinah dan Selasa subuh akan ke

Makkah,”kata Jaharuddin. Belum ditemukan Sebelumnya Calhaj Kloter 2, Chabibul Chair menyampaikan, 5 koper jamaah Kloter 4 asal Padangsidimpuan dan Sibolga yang hilang Senin lalu saat masuk ke Makkah, hingga kemarin belum ditemukan. Lanjut ke hal A2 kol. 1

Ada-ada Saja Lagu Cinta Dan Tangis Bocah MENDENGAR lagu cinta, sebagian orang bisa merasa senang dan terbuai.Apalagi diiringi alunan musik yang syahdu. Namun, tidak bagi

Lanjut ke hal A2 kol. 2

Serampang - Pak sopir kalau ngantuk istirahat dulu - He...he...he...

Harga Eceran: Rp 2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Pahing, 30 September 2013/25 Zulqaidah 1434 H z zNo: 24356 Tahun Ke-67 z zTerbit 24 Halaman

Waspada/Surya Efendi

FENOMENA LANGIT KOTA MEDAN: Langit di atas Kota Medan diambil Minggu (29/9) sore, terlihat berwarnawarni seperti pelangi.

PO Pinem Terbalik 6 Tewas PERBAUNGAN(Waspada): Enam orang tewas , belasan orang lainnya luka berat dan ringan setelah bus penumpang umum CV.PO Pinem BK 7772 LC dari Rokan Hilir tujuan Medan, yang mereka tumpangi dari Pekanbaru menuju Medan terbalik di tingkungan tajam jalan lintas Sumatera ( Jalinsum) Km 41-42 Simpang Bengabing,Dusun I Desa Pasar Bengkel, Kec.Perbaungan,Kab.Serdang Bedaga, Minggu (29/9) pukul 5:00 subuh. Korban tewas, luka berat dan ringan dievakuasi ke RSU Trianda Pasar Bengkel dan RSU Melati Perbaungan. Keenam korban tewas di tempat kejadian, Sahri, 70, warga R.Baru Sukamakmur,

70.618 Calhaj Indonesia Di Makkah Sudah 19 Orang Wafat

Desa Rambah Baru, Kec. Rambah Samo, Kab.Rokan Hulu, Provinsi Riau, Amni, 49, Warga Dusun Bourterem, Desa Bangko Sampurna, Kec.Bangko Lanjut ke hal A2 kol. 2

Tantangan Terbesar Muslim Datang Dari Dalam PBB (Antara): Perdana Menteri Malaysia meminta umat Islam pecinta damai di seluruh dunia untuk bersatu melawan ekstremis yang menggunakan agama sebagai alasan melakukan kekerasan. Perdana menteri itu menekankan bahwa kemoderatan adalah kunci menang perang untuk masa depan Islam. “Di seluruh dunia, ekstremisme mengambil nyawa dan menghancurkan kesempatan. Ini mempengaruhi kita semua. Tetapi itu adalah segelintir orang, dari satu iman, yang paling menderita,” kata Perdana Menteri Malaysia Mohd Najib bin Tun Haji Abdul Razak di debat Umum Majelis Umum PBB Sabtu waktu setempat atau Minggu (29/9) WIB. “Saya percaya ancaman terbesar bagi umat Islam saat ini tidak berasal dari dunia luar, melainkan dari dalam,” katanya seraya menyebut konflik antara Sunni dan Syiah mengancam Lanjut ke hal A2 kol. 6

Al Bayan

Berkat Doa Ibrahim Oleh: H. Ameer Hamzah Ya Tuhan kami! Jadikanlah aku dan anak cucuku orang-orang yang tetap mendirikan shalat.Ya Tuhan kami, perkenankanlah doaku Ya Tuhan kami, beri ampunlah aku dan kedua ibu bapaku dan sekalian orang-orang Mukmin pada hari hisab. (QS. Ibrahim:40-41) BETAPA indah doa nenek moyang kita Nabi Ibrahim as. Doanya dikabulkan Allah dengan menjadikan keturunannya sebagai orang-orang yang beriman kepada Allah SWT. Dua putranya, dan satu cucu dan anak cucunya, serta keturunannya lagi menjadi rasul-rasul pembawa risalah Tauhid. Dua anaknya adalah Nabi Ismail dan Nabi Ishak. Nabi Ishak mempunyai anak Nabi Ya’kub as, selanjutnya Nabi Ya’kub mempunyai anak yang menjadi rasul, yakni Nabi Yusuf as. Lewat keturunan Nabi Lanjut ke hal A2 kol. 6

Waspada/Eddi Gultom

BUS penumpang Umum CV.PO.Pinem dalam posisi terbalik setelah menghantam kios door smer dan tiang baleho di Dusun I,Desa Pasar Bengkel, Kec.Perbaungan, Kab.Serdang Bedagai,Minggu (29/9).

Kelompok Bersenjata Serang Mahasiswa Di Nigeria, 40 Tewas D A M AT U RU , Ni g e r i a (Waspada): Kelompok bersenjata menyerbu dan memberondongkan peluru terhadap satu perguruan tinggi di Nigeria Timurlaut, demikian BBC Minggu (29/9). Serangan itu terjadi ketika rakyat Negeria baru dilanda teror di sebuah pusat perbelan-

jaan di Nairobi, Kenya, dan menewaskan puluhan orang beberapa hari lalu.Orangorang bersenjata itu menyerang dengan membabibuta dan sudah 40 orang meninggal dunia. Para penyerang menyasar sekolah dan kampus-kampus, menyerbu Akademi Pertanian

di negara bagian Yobe dan menembak para mahasiswa saat tertidur pada malam hari, kata Komisaris polisi Sanusi Rufai. Saksimata menyebutkan sekitar 40 mayat berada di rumah sakit ibukota negara bagian Yobe, Damaturu. Lanjut ke hal A2 kol.6

Polres Pidie Sita 343 Kg Ganja Tujuan Medan SIGLI (Waspada) : Tim gabungan Polres Pidie menyita 343 Kg ganja dari Banda Aceh yang akan dibawa ke Medan di jalan lingkar, Desa Keunire, Kec. Pidie, Jumat (27/9) pukul 22:30. Bersamaan dengan itu, polisi mengamankan dua kurir dan menyita satu truk Puso BA 8685 AU, berikut ganja yang dibawa. Kedua kurir, KAS, 55, sopir, dan Muna, 26. Kernet. Kapolres Pidie AKBP Sunarya didampingi Kasat Narkoba AKP Aiyub, Minggu (29/9) mengatakan, penggagalan pengiriman ganja itu, dilakukan dalam Lanjut ke hal A2 kol. 1

Waspada/Muhammad Riza

KAPOLRES Pidie AKBP Sunarya (tengah) diapit dua tersangka dan dua anggota Polres Pidie memperlihatkan barang bukti ganja seberat 343 Kg yang disita dalam razia rutin, Jumat (27/9).

MADINAH (Antara): Sebanyak 70.618 calon haji Indonesia dari 173 kelompok terbang (kloter) sudah berada di Makkah, Arab Saudi, demikian data Sistem Informasi dan Komputerisasi Haji Terpadu (Siskohat), Minggu (29/9). Kepala Seksi Pelayanan Siskohat MU Asep SA menjelaskan, sejak Sabtu (28/09) pagi sampai Minggu (29/9) dini hari, Makkah telah menerima 5.738 calon haji dari 14 kloter jamaah haji Indonesia dari Madinah dan 5.211 calon haji dari 13 kloter jamaah yang tiba di Jeddah. Empat belas kloter dari Madinah tersebut adalah kloter 12 dan 13 Jakarta (454 jamaah) dan (453 jamaah), kloter 23 dan 25 Solo (369) dan (375), kloter 18, 19 dan 20 Jakarta-Bekasi masing-masing (448), (446), (449), kloter 7 Balikpapan, (360), kloter 7 Lombok (325), kloter 2 Palembang (359), kloter 10 Batam (444), kloter 16 dan 17 Surabaya (441) dan (444), dan kloter 18 Makassar (371).

Selain itu, ada seorang jamaah haji dari kloter 23 Embarkasi Solo (SOC/23) yang dievakuasi dari Madinah dengan menggunakan ambulans sehingga jumlahnya menjadi 5.739 jamaah. Adapun tiga belas kloter dari Jeddah yang sudah tiba di Makkah adalah

Banjarmasin/6 (325 jamaah), Solo/41 (375), Makassar/19 (374), Palembang/8 (358), Surabaya/ 36 (439), Jakarta/25 (455), Surabaya/35 (434), Solo/42 (375), Solo/43 (375), Sura-baya/37 (444), Makassar/20 (373), Lanjut ke hal A2 kol. 6

Suhu Di Madinah 41 Derajat Celcius MEDAN (Waspada) : Kondisi jamaah Kloter 11 Embarkasi Medan, saat ini dalam keadaan sehat meski suhu udara di Madinah mencapai 41 derajat Celcius. Demikian disampaikan Drs H Jaharudin,SPdI, MA, TPIHI Kloter 11 Embarkasi Medan, Minggu (29/9) melalui SMS dari Madinah. Kabid Penerangan Agama Islam, Zakat dan Wakaf di Kanto r Kementer ian Agama Wilayah Provinsi Sumatera Utara, itu mengatakan, Calhaj

Percobaan Bunuh Diri Novi Karena Tertekan Tuntutan Jaksa JAKARTA (Waspada): Novi Amalia, model majalah dewasa, mengaku tidak sadar ketika melakukan percobaan bunuh diri pada Jumat(27/9). Kuasa Hukum Novi, Rangga Lukita, mengatakan, Novi melakukan percobaan bunuh diri karena dia terus berpikir mengenai tuntutan jaksa terkait kasus kecelakaan lalu lintas. “Saya tanya dia kenapa melakukan itu, dia jawab karena tertekan atas tuntutan 7 bulan penjara terhadap dirinya,” ujar Rangga, Minggu (29/9). Akibat perbuatannya itu, Novi mengalami luka di bagian tangan serta kakinya. Novi kini masih dalam perawatan di Rumah Sakit Ketergantungan Obat. Rangga menuturkan, secara fisik kondisi Novi cukup parah.”Di tangan kiri dan kanannya ada bekas jahitan. Lanjut ke hal A2 kol. 1

Kloter 11 umumya sehat dan sudah melaksanakan serangkaian ibadah sunat dan mengunjungi tempat-tempat bersejarah di Madinah. Meski udara terbilang panas, kata Jaharuddin, dia bersama petugas lainnya di kloter itu tetap memberikan pengawasan pada Calhaj, dan memberikan arahan terkait pelaksanaan ibadah. Ia mengingatkan jamaah agar tidak bepergian seorang Lanjut ke hal A2 kol. 6

Ada-ada Saja

Lagu Cinta Dan Tangis Bocah MENDENGAR lagu cinta, sebagian orang bisa merasa senang dan terbuai.Apalagi diiringi alunan musik yang syahdu. Namun, tidak bagi bocah ini.Ia akan menangis keras setiap kali mendengar

Lanjut ke hal A2 kol. 6

Serampang - Jangan lupa banyak makan buah wak... - He... he... he...

Berita Utama


WASPADA Senin 30 September 2013

Pramuka Menjadikan Generasi Tidak Kehilangan Ke-Indonesia-an MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho mengatakan, gerakan Pramuka semakin diperlukan untuk menjadikan generasi ini tidak kehilangan nilai-nilai keIndonesia-an mereka. ‘’ Nilai-nilai positif kemanusiaan dan cinta Indonesia yang tergambar dalam Trisatya dan Dasa Dharma Pramuka, bisa membentuk generasi muda Indonesia sebagai generasi unggul dan tangguh,’’ kata Gubsu selaku ketua Majelis Pembimbing Daerah (Kamabida) Pramuka Sumatera

Utara saat memimpin upacara peringatan HUT ke-52 Pramuka di Lapangan Simaremare Kota Sibolga Sabtu(28/9). Menurut Gubsu, Pramuka masih relevan untuk menjawab masuknya nilai-nilai dari luar negeri. Lewat aktivitas kepanduan ini bisa melahirkan kader-kader pemimpin Indonesia masa depan. Pramuka harus terus digiatkan dalam dunia pendidikan kita, karena gerakan ini turut membentuk karakter disiplin, bertanggung jawab, kreatif memanfaatkan waktu serta bagaimana kita

mengemban tugas,” kata Gubsu pada acara yang dihadiri antara lain Ketua Tim Penggerak PKK Sumut Hj Sutias Handayani, Ka Kwarda Sumut H Nurdin Lubis, SH, MM, Wali Kota Tebingtinggi Umar Junaidi Hasibuan, Wakil Bupati Deliserdang Zainuddin Mars, para pengurus Kwardasu dan Ketua Kwartir Cabang seSumatera Utara. Dalam peringatan HUT Pramuka tersebut, Gubsu menganugerahkan penghargaan Satya Lencana Melati, Dharma Bakti dan Panca Warsa kepada

para pemimpin kabupaten/ kota dan pengurus Kwardasu atas jasa-jasa mereka memajukan Kepramukaan di Sumut. Ketika membacakan sambutan Ketua Kwartir Nasional, Gubsu mengatakan, Pramuka menekankan penguasaan ilmu pengetahuan dan teknologi, selain tetap memupuk nilai-nilai sosial budaya unggulan khas Indonesia. “Lewat Pramuka misalnya, Pramuka Siaga dilatih serta dibiasakan untuk mengantri. Sejak SD anak-anak belajar antri, bekerjasama dan tidak

saling serobot hingga gilirannya tiba. Saat antri, anak Pramuka siaga juga belajar bersosialisasi dengan orang yang ikut mengantri, memanfaatkan waktu selama mengantri,” katanya. Sementara itu, Wali Kota Sibolga M Syafri Hutauruk dalam sambutannya berharap peringatan HUT Pramuka ini menjadi momentum untuk meningkatkan peran dan aktivitas Pramuka sebagai organisasi kepanduan dalam membangun gerenasi muda berwatak kokoh, tangguh dan berkepribadian Indonesia.(m28)

Survei Insis: 42,9 Persen Publik Tak Puas Kinerja Anggota DPR


MISS WORLD 2013 TERPILIH, Megan Young asal Filipina (tengah) bersama kontestan lainnya seusai penganugerahan mahkota dalam Final Kontes Miss World 2013 di Nusa Dua, Bali, Sabtu (28/9). Kontestan Prancis, Marine Lorphelin berada di posisi kedua setelah Filipina, sementara posisi ketiga diraih kontestan Ghana, Carranzar Naa Okailey Shooter.

Polres Pidie.... operasi rutin di jalan lingkar, Desa Keunire, Kec. Pidie. Saat itu, kata Sunarya, petugas mencurigai truk tersebut, karena menerobos blokade petugas yang melakukan razia. Petugas meminta kembali truk tersebut berhenti. Setelah truk itu parkir persis di salah satu warung di jalan lingkar Keunire, polisi melakukan penggeledahan, dan menemukan ganja seberat 343 Kg dibungkus dan diletakkan dalam bak truk bagian belakang. “Kami juga membawa sopir KAS ke Banda Aceh untuk menangkap seseorang berinisial K, yang dicurigai sebagai pemilik ganja tersebut. Namun, K duluan kabur,” kata Sunarya. Pada tempat yang sama, KAS menjelaskan ganja tersebut milik temannya K. Ia mengakui tidak mengetahui barang yang diangkutnya adalah daun ganja. Dia baru mengetahui setelah berada di Jl. Soekarno-Hatta Banda Aceh. Namun, katanya, barang tersebut tidak bisa lagi diturunkan.Kalau saya turunkan di jalan, saya juga akan ditangkap. Jadi saya putuskan angkut saja, namun naas setiba di Pidie, kami ditangkap,” katanya. (b10)

Percobaan... Saya tidak mengetahui pasti berapa jahitan,” jelas Rangga. Namun, secara fisik cukup parah.Menurut Rangga, kondisi Novi sekarang ini sudah cukup stabil. “Mentalnya sudah stabil, sudah bisa diajak ngobrol,” imbuhnya. Novi Amelia, terdakwa kasus kecelakaan lalu lintas dituntut tujuh bulan penjara oleh Jaksa Penuntut Umum dalam persidangan di Pengadilan Negeri Jakarta Barat, Selasa 17 September 2013. Novi Amelia menabrak tujuh orang di kawasan Taman Sari, Jakarta Barat pada 11 November 2012. Jaksa menilai Novi melakukan tindak pidana melanggar pasal 312 dan Pasal 310 ayat 2 Undang-Undang No 22 Tahun 2009 tentang Lalu Lintas dan Angkutan Jalan. Jaksa mengungkapkan, Novi juga terbukti lalai dalam mengendarai kendaraan bermotor sehingga menimbulkan kecelakaan dan melukai orang lain. (vn)

Jawaban Problem Catur,

PO Pinem...

TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ...., Gxg2+. 2. RxG (terpaksa), Be2+. 3. Rf1, Mf2+mat.

Jawaban TTS: TTS

Umum Serba “Dang”

Pusako, Kab.Rokan Hilir, Provinsi Riau, Idas, 65, warga R.Batu Sukamakmur, Desa Rambah Baru, Kec.Rambah Samo, Kab.Rokan Hulu, Riau, Rodyah, 40, warga Desa Ariantan, Afdeling V Kalda, Kec. Kabun, Kab.Rokan Hulu Riau, Nintan Boru Sihombing, 69, warga Jl. Pancing, Medan, dan seorang lagi bocah berusia 6 tahun, belum diketahui identitasnya. Sedangkan korban luka berat dan ringan, Dewi Mawar Sari, 16, warga Tamora Riau, Ratnawati, 46, warga Balam Riau, Riadi, 17, warga Desa

JAKARTA (Waspada): Lembaga sur vei Insitut Riset Indonesia (Insis) merilis data kinerja buruk anggota Dewan Perwakilan Rakyat (DPR), Minggu (29/9). Peneliti Institut Riset Indonesia, Mochtar W Oetomo mengatakan, berdasarkan survei yang dilakukan lembaganya sebanyak 42,9 persen publik tidak puas dengan kinerja DPR dalam membuat undang-undang. Dengan rincian 5,6 persen publik sangat tidak puas, sebanyak 37,3 publik persen puas. Hanya 0,6 persen publik yang sangat puas. Mochtar menilai angka buruk dilihat dari capaian target legislatif DPR yang tergolong rendah. Ia menyebutkan, dari daftar 70 rancangan undang-undang yang terdaftar dalam prolegnas pada tahun ini, hanya 13 rancangan yang selesai jadi undang-undang. “Selain itu banyak undang-undang yang digugat ke Mahkamah Konstitusi, ini membuat

publik menilai kinerja DPR dalam legislasi kurang baik,” jelasnya. Kinerja pembahasan APBN anggota dewan juga jadi sorotan masyarakat yang menilai kurang bagus. Terkait hal ini, Mochtar mengatakan, sebanyak 16,8 persen publik tidak tahu, sangat puas 1,9 persen, puas 34,8 persen, tidak puas 39,8 persen dan sangat tidak puas 6,8 persen. “Hal ini berkaitan dengan politisasi anggaran,” ujar dia. Dalam hal tingkat kemampuannya menampung aspirasi, ujar Mochtar, sebanyak 1,2 persen publik sangat puas, 14,3 persen puas, 61,5 persen tidak puas, dan sangat tidak puas 12,4 persen. Ini berarti secara umum DPR dinilai tidak aspiratif. Dari sisi pengawasan undang-undang dan APBN, Mochtar mengatakan 50,9 persen tidak puas, sementara hanya 23,6 persen responden yang puas dengan kinerja itu. “Ini dapat dilihat dari sedikit-

Kemenhub: Silahkan Punya Mobil Banyak JAKARTA (Waspada): Kementerian Perhubungan tidak mempermasalahkan kemungkinan bertambahnya jumlah kendaraan di kota-kota besar jika kebijakan low cost green car (LCGC) diterapkan Pemerintah. Direktur Bina Sarana Transportasi Perkotaan Kemenhub Djoko Sasono mengungkapkan, pihaknya akan mengatur agar penggunaan kendaraan pribadi tidak lebih nyaman dibandingkan kendaraan umum. “Kami melihatnya dalam perspektif bagaimana kendaraan digunakan di jalan. Silakan punya mobil banyak karena tidak ada aturannya. Yang kita atur adalah bagaimana agar tidak digunakan seleluasa di jalan,” kata Djoko dalam diskusi bertajuk “Mobil Murah Diuji, Transportasi Layak Dinanti” di Jakarta, Sabtu (28/9). Menurut Djoko, banyak instrumen kebijakan yang sudah ada dan diterapkan di kota-kota besarterkaitpengaturanlalulintas kendaraan darat agar efektif. Sejumlah instrumen itu di antaranya, penerapan aturan

three in one atau tiga penumpang dalam satu mobil, penerapan tarif parkir yang tinggi, dan mengurangi lahan parkir dengan melarang parkir di bahu- bahu jalan. “Lama-lama kan orang akan berpikir, susah banget parkirnya kalau bawa mobil. Kemudian angkutan umum harus ditingkatkan,” kata Djoko. Dia pun berharap industri otomotif di Indonesia dapat tumbuh untuk mendukung perkembangan angkutan umum. “Kita harus ada industri otomotif yang mampu memenuhi kendaraan umum di Indonesia, untuk industri truk, industri bis dan macam-macam, jadi tidak usah beli di China, dan itu bisa menghemat devisa,” tambahnya. Adapun hal yang harus diwaspadai dari kebijakan LCGC adalah bagaimana mobil murah ini nantinya dipasarkan. Dampak keberadaan mobil murah ini, menurutnya, akan berbeda jika dipasarkan di tempat yang moda transportasinya tidak terlalu banyak.

Analis Kebijakan Publik dari Universitas Paramadina Dinna Wisnu menilai bahwa Kemenhub termasuk pihak yang dirugikan dengan adanya kebijakan LCGC ini. Menurut Dinna, dengan anggaran Rp 30 triliun untuk semua moda transportasi, baik laut, udara, dan darat, masalah yang dihadapi Kemenhub semakin pelik. “Mereka merasa dengan masalah ini, masalah yang harus diurus semakin pelik,” ujarnya. Dinna lantas menilai bahwa Kementerian Perdagangan dan Kementerian Perindustrian lah yang diuntungkan dari kebijakan LCGC tersebut. “Kementerian Perdagangan, Kementerian Perindustrian, itu punya kepentingan sendiri karena mereka, kerjasama dengan industri otomotifnya jadi baik, tekanan dari negara lain, ASEAN plus three untuk memperkuat industri otomotif, sudah selesai. Tapi kan kemudian kementerian lain hanya bisa melongok,” kata Dinna.

Pematang Cengal Barat, Kec. Tg.Pura, Kab.Langkat, Iyak, 50, warga Desa Ariantan Afdeling V Kalda, Kec.Kabun, Kab. Rokan Hulu, Riau, Rudolf Tobing, 49, warga Kota Medan, Herman, 21, warga Bukit Lawang, Kab.Langkat, Wartono, 33, warga Kandis Riau, Wan Jaya, 46, warga Titi Kuning Tamora Riau, Bima, 4, dan Trigilang Prayoga, 6, (abang beradik) bersama ibunya Kesumawati, 35, warga Desa Karya Mukti, Kec.Rimbo Melintang Pekan Baru, Riau, Samon, 48, warga Batu Putih, Pekan Baru, Riau, Zulfikar Naen, 30, warga Desa Padang Cermin, Kec.Selesai, Kab.Langkat, Ngatina (belum

diketahui identitasnya), Domardi Tinambun, 44, warga jalan Binjai Km 12, Kec. Sunggal, Kab.Deliserdang, Hamzah, 22, warga Desa Bukit Lawang, Kab.Langkat. Pengemudi bus PO Pinem yang belum diketahui identitasnya diduga begitu kejadian langsung kabur. Informasi Waspada peroleh dari salah seorang penumpang yang selamat, sebelum kejadian, bus yang mereka tumpangi melaju kencang. Menjelang tikungan tajam Bengabing, diduga sopir mengantuk dan tidak mengetahui di depan ada tikungan dan tetap tancap gas.Saat itulah

bus nyelonong ke kiri jalan arah ke Medan. Sopir bus, yang sadar busnya nyelonong, lalu banting stir ke kanan jalan sehingga bus terbalik. ‘’Ketika itu, banyak penumpang terbentur dan tercepit, mengakibatkan luka berat dan ringan serta meninggal dunia,’’ katanya. Pantauan Waspada di tempat kejadian perkara( TKP), bus tersebut setelah terbalik menghantam kios doorsmer milik Sofian warga setempat, kemudian menghantam tiang baleho. Kasat Lantas Polres Serdang Bedagai AKP Hasan Basri dan Kanit Laka Iptu Junaidi bersama anggota Satlantas Polres Serdang Bedagai, yang turun ke TKP dibantu warga setempat segera mengevakuasi para korban ke RSU Trianda Pasar Bengkel dan RSU Melati Perbaungan. Sementara, Kapolres Serdang Bedagai AKBP Binedictus Anies Purnawan, Minggu(29/ 9) pagi, meninjau para korban di RSU Trianda Pasar Bengkel. Menurut Kapolres, peristiwa itu dikatagorikan menonjol karena korbannya sampai lima orang dan belasan orang luka berat dan ringan. Untuk itu, kata Kapolres, pihaknya mengimbau kepada para pengemudi baik pengemudi angkutan umum maupun pribadi berhati hati dalam mengemudikan kendaraan.’’ Jika mengantuk, istirahat. Jangan dipaksakan. Selain itu, jangan ugal-ugalan. Kalau sudah terjadi tidak bisa disesali,’’ kata Kapolres. (a08)

Jawaban Sudoku:

5 6 2 1 7 3 4 8 9

8 1 7 9 6 4 3 5 2

4 9 3 5 8 2 6 1 7

3 7 9 8 2 5 1 4 6

6 4 5 7 3 1 2 9 8

2 8 1 6 4 9 5 7 3

7 2 4 3 1 8 9 6 5

1 5 6 2 9 7 8 3 4

9 3 8 4 5 6 7 2 1

nya anggora DPR menggunakan hak angket, hak menyatakan pendapat maupun interpelasi,” kata dia. Terlebih, banyak hak pengawasan itu penuh dengan nuansa politik dan akhirnya menguap di tengah jalan. Survei tersebut dilakukan sejak 17 Agustus hingga 20 September 2013 di 34 provinsi. Survei menggunakan metode random sampling dengan jumlah responden 1070. Margin of error kurang lebih 3 persen dengan tingkat kepercayaan 95 persen. Pengumpulan data dilakukan melalui wawancara tatap muka dengan pertanyaan terbuka. Profil responden yakni laki-laki 51 persen dan perempuan 49 persen dari umur 25 sampai 40 tahun. Responden kebanyakan lulusan SLTA, disusul sarjana, dan SMP. Pekerjaan paling banyak ibu rumah tangga. Dari sisi pendapatan, kata Mochtar, masih didominasi dengan responden berpendapatan rendah. (vn)

Waspada/Eddi Gultom

TINJAU: Kapolres Sergai AKBP Binedictus Anies Purnawan SIK,MSi (kiri)didampingi Kasat Lantas AKP Hasan Basri dan Kanit Laka Aiptu Junaidi meninjau para korban di RSU Trianda Pasar Bangkel,Kec.Perbaungan,Minggu (29/9) pagi.


GUBSU H Gatot Pujo Nugroho menyematkan penghargaan kepada pengurus Kwardasu atas jasa-jasanya turut memajukan gerakan Pramuka, pada HUT Pramuka di Lapangan Simaremare Sibolga, Sabtu (28/9).

Kelompok... Kebanyakan dari korban adalah anak-anak muda yang diyakini sebagai mahasiswa. Para mahasiswa itu ditembak mati ketika mereka tidur di asrama di kampus Perguruan Tinggi Pertanian di negara bagian Yobe. Nigeria Timurlaut berada dalam keadaan darurat di tengah satu pemberontakan oleh kelompok Bako Haram, yang berjuang menggulingkan pemerintahan Nigeria untuk menciptakan satu negara Islam dan telah melancarkan serangkaian serangan atas sejumlah sekolah. Jumlah korban dalam serangan terakhir itu masih belum jelas, namun ada kecemasan, angka kematian kemungkinan tinggi. Nama Arab resminya adalah Jama’atu Ahlis Sunna Lidda’awati wal-Jihad, yang artinya “Warga Berkomitmen untuk

70.618 Calhaj... Jakarta-Bekasi/39 (435), dan Jakarta-Bekasi/40 (449). Dan hari ini juga Daker Makkah diperkirakan akan kedatangan 13 kloter jamaah haji dari Madinah dan 12 kloter jamaah haji dari Jeddah. 19 Calhaj Wafat Sementara itu, Kepala Seksi Penghubung Kesehatan Daker Makkah dr. Raymon Andreas menjelaskan, sampai dengan Minggu (29/09) pukul 01:00 WAS, jamaah calon haji Indonesia yang wafat di Arab Saudi berjumlah 19 orang terdiri atas, 11 wafat di Madinah, 7 wafat di Makkah dan 1 wafat di Jeddah.

Suhu... diri untuk menjaga hal-hal yang tidak diinginkan, antaranya tersesat. “Alhamdulillah semua jamaah dalam Kloter 11 sehat. Saat ini kami masih di Madinah dan Selasa subuh akan ke Makkah,”kata Jaharuddin. Belum ditemukan Sebelumnya Calhaj Kloter 2, Chabibul Chair menyampaikan, 5 koper jamaah Kloter 4 asal Padangsidempuan dan Sibolga yang hilang Senin lalu saat masuk ke Makkah, hingga kemarin belum ditemukan. Ketua Kloter 4 Basyah Sag, kata Chabibul, saat ditemui di pemondokan 920 kawasan Bahutmah Minggu (29/10) menyatakan 5 koper tersebut belum ditemukan.

Ada-ada Saja... lagu cinta bernada sedih atau bahkan suara musik klasik. Adalah Louis Mushrow asal Hawarden, Wales Utara yang selalu menangis jika mendengar lagu cinta yang mendayu. Itu karena bocah berusia 9 tahun ini menderita sebuah penyakit kelainan bernama sindrom SmithMagenis. Meski kondisi ini dinyata-

Al Bayan... Ismail as melahirkan Nabi besar Muhammad SAW. Doa tersebut juga mencakupi kepada seluruh kaum Mukminin laki-laki dan perempuan, maka sangat pantas bila Nabi Muhammad SAW mengajarkan kepada kita shal a w a t k e p a d a Na b i Mu hammad dan keluarganya, dan kepada Nabi Ibrahim dan keluarganya sebagaimana kita baca dalam shalat. Nabi Ibrahimlah yang membangun Ka’bah bersama putranya Ismail. Ka’bah sebagai kiblat

Tantangan... kehidupan dan mata pencaharian jutaan muslim, dari Syria dan Lebanon sampai Irak dan Pakistan. “Agama kami yang diturunkan untuk perdamaian dan didasarkan pada toleransi sedang diputar oleh kaum ekstrimis yang menyebarkan argumen palsu untuk mendorong perpecahan dan membe-

Penyebaran Ajaran Nabi dan Jihad.” Mulanya fokus menentang pendidikan Barat. Nama Boko Haram, satu ungkapan dalam bahasa etnis lokal Hausa yang artinya, “Pendidikan Barat dilarang.” Satu sumber rumah sakit mengatakan kepada media, 26 orang tewas dalam serangan tersebut. Provos kampus Molima Idi Mato mengatakan kepada The Associated Press kemungkinan angka kematian sebanyak 50 orang.Pasukan keamanan masih mengumpulkan mayatmayat dan kira-kira 1.000 mahasiswa telah melarikan diri dari kampus. Seorang jurubicara militer di negara bagian Yobe, Lazarus Eli, mengatakan, kelompok bersenjata itu juga telah membakar kelas-kelas belajar. Juni lalu, Boko Haram melakukan dua serangan atas sekolah di kawasan itu dan menewaskan sembilan anak di satu

sekolah di pinggiran Maiduguri, sementara 13 pelajar dan guru dibunuh di satu sekolah di Damaturu. Juli di desa Mamudo di negara bagianYobe, militan Islamis menyerang asrama-asrama pelajar dengan senjata api dan peledak, menewaskan sekurangkurangnya 42 orang, sebagian besar mahasiswa. Boko Haram menganggap sekolah-sekolah sebagai simbol budaya Barat. Presiden Goodluck Jonathan memerintahkan satu operasi terhadap Boko Haram Mei lalu. Boko Haram dipimpin oleh Abubakar Shekau. Militer Nigeria mengatakan Agustus lalu, pihaknya telah membunuhnya dalam satu tembak menembak. Namun, satu rekaman video yang disiarkan pekan lalu mempertunjukkan dia masih hidup. Laporanlaporan sebelumnya yang mengatakan kematiannya tidak terbukti. (m10)

Jamaah haji yang wafat di Madinah adalah Amaq Sapoan bin Amaq Sapar (L/58) dari kloter 5 Lombok, Nasir bin Sagrib (L/62) dari kloter 3 Solo, Asmawati binti Asmawi (P/52) dari kloter 4 Jakarta, Amin bin Dollah Nduri (L/62) dari kloter 6 Solo dan Rotena binti Malik (P/77) dari kloter 1 Palembang. Selain itu, Icih Bachriyah binti Bachrudin (P/63) dari kloter 19 Jakarta, Umiyati binti Djasmad (P/57) dari kloter 10 Medan, Edy Lukita bin Muchtar (L/47) dari kloter 28 JakartaBekasi, Wahyuni Dyah Ernawati binti Soesilo (P/49) dari kloter 11 Jakarta, Jema binti Salim (P/74) dari kloter 2 Palembang, Aq Lemuh bin Amaq

Sunaya (L/73) dari kloter 10 Lombok. Jamaah haji yang wafat di Makkah adalah Abdurrohman bin Marhad (L/62) dari kloter 2 Solo, Gozali Tusi bin H. Abd. Rahman (L/68) dari kloter 8 Jakarta, Kimin bin Ahmad Sujak (L/067) dari kloter 15 Solo, Indo Cemmi binti Laburante (P/54) dari kloter 1 Balikpapan, Musiyanah binti Alwi (P/73) dari kloter 1 Surabaya, Amad Masyira bin Amad (L/70) dari kloter 35 Jakarta-Bekasi, dan Enat binti Toni (P/65) dari kloter 1 Jakarta-Bekasi. Adapun jamaah haji Indonesia yang wafat di Jeddah adalah M. Arifin bin Hape (L/ 65) dari Kkoter 15 Makassar.

“Kami sudah 2 kali melapor ke sektor 8, mereka masih menelusuri mulai dari bus yang mengangkut Kloter 4 hingga di hotel Madinah dan penginapan di Makkah, “ ujar Basyah. Dikatakannya Kloter 4 masuk ke Makkah, Senin pukul 01 WAS langsung melakukan tawaf umroh dan sa’i. Selesai itu kembali ke pemondokan di 820 dan 823, dan baru diketahui 5 koper tidak ada. Masalah lain dialami Kloter 5, kata Chabibul, adalah fasilitas pemondokan yang kurang layak selain lift yang tidak memadai, fasilitas kamar yang kecil ditempati 5 orang. Sedangkan suasana Kota Makkah semakin sesak dan sekitar Ka’bah semakin membludak, dipadati umat Islam se dunia.

“Suasana Ka’bah penuh sesak saat jamaah haji dari penjuru dunia melakukan tawaf umroh dan sa’i,” sebut Cabibul Chair yang bergabung dengan jamaah dari KBIH Jabal Noor. Kondisi sesak Ka’bah membuat petugas di berbagai saktor sibuk memberikan pengarahan dan memperhatikan jamaah karena banyak yang tersesat setelah meninggalkan Masjidil Haram dan akan kembali ke pondokannya. Ketua Sektor 9 bernama Anwar mengakui banyaknya jamaah yang tersesat, umumnya jamaah asal Pulau Jawa. Bahkan ada yang harus kehilangan uangnya karena terlalu banyak membawa dan terlalu memberi peluang pada orang yang tidak dikenal untuk memegang tas mereka. (m37)

kan tidak berbahaya bagi Lois, tapi sang ibu mengaku terganggu karena selalu mendapat cibiran dan ejekan dari orang-orang saat putranya tiba-tiba menangis di depan umum ketika mendengar suara musik. “Anda akan mendapat cibiran dan orang akan menyuruh untuk mendiamkan anak anda. Namun Louis tak bisa menahan tangisnya,” kata ibu Lois yang dilansir,

Minggu (29/9). Sang ibu mengaku orangorang mengira ia tidak bisa mengajar putranya karena selalu menangis. “Orang terkadang mengira Lois menangis karena ia sedang kesal... Kami tahu jenis musik tertentu mengeluarkan segala emosi kesedihan di otak Lois,” tambahnya. Menurut laporan, sindrom Smith-Magenis tercatat menjangkiti 1 dari 25.000 orang di dunia.(net/rzl)

kaum Muslimin terpelihara sampai sekarang. Ibrahim juga yang pertama berqurban, lontar jumrah, istrinya Hajar yang pertama Sa’i antara Shafa dan Marwah. Nabi Ibrahim juga yang naik atas bukit Jabal Qubis dekat Masjidil Haram memanggil manusia untuk datang bersujud kepada Allah di depan Ka’bah. Menunaikan ibadah haji dan umrah bila ada kesanggupan. Sungguh besar jasanya kepada umat Islam. Nabi Muhammad sampai memberi nama Ibrahim kepada putranya dari Mariah Qibti-

yah sebagai kenangan kepada nama Nabi Ibrahim Khalilullah. Kiranya, doa Nabi Ibrahim masih perlu kita bacakan terus menerus agar anak dan cucu kita tetap mendirikan shalat lima waktu. Kiranya Allah jua dapat memberi ampunan kepada kita yang banyak dosa ini. Semoga pada hari akhirat nanti kita tidak tersandung waktu dihisab amal ibadah. Mari kita contoh Ibrahim dan Nabi Muhammad SAW dalam keimanan dan kebersihan aqidah.

narkan kekerasan,” katanya. “Di seluruh dunia Islam, ekstremis membungkus agenda sesat mereka dengan kain agama, memutus tali keluarga, negara dan umat,” katanya. Tetapi Muslim tidak berdaya untuk bertindak, kata Razak. “Saya percaya moderasi dalam agama dan proses politik dapat membendung hilangnya hidup dan kebebasan di dunia muslim. Di balik keke-

rasan tragis, ada pertempuran yang dilancarkan untuk masa depan Islam.” Dia mengatakan umat Islam seharusnya tidak melakukan kesalahan moderasi yang melemahkan. “Pemimpin Muslim harus berbicara dan mengecam kekerasan, supaya kebungkaman mereka adalah keliru untuk penerimaan,” kata Razak seperti dikutip Xinhua.


Berita Utama

WASPADA Senin 30 September 2013

Gubsu: Pramuka Menjadikan Generasi Tidak Kehilangan Ke-Indonesia-an

Waspada/Eddi Gultom

KAPOLRES Sergai AKBP Binedictus Anies Purnawan SIK,MSi (kiri)didampingi Kasat Lantas AKP Hasan Basri dan Kanit Laka Aiptu Junaidi meninjau para korban di RSU Trianda Pasar Bangkel,Kec.Perbaungan,Minggu(29/9) pagi.

Bus Pinem Terbalik ... Korban tewas, luka berat dan ringan dievakuasi ke RSU Trianda Pasar Bengkel dan RSU Melati Perbaungan. Ke enam korban tewas di tempat kejadian adalah Sahri, 70, warga R.Baru Sukamakmur, Desa Rambah Baru, Kec.Rambah Samo, Kab.Rokan Hulu, Riau, Amni, 49, Warga Dusun Bourterem, Desa Bangko Sampurna, Kec.Bangko Pusako, Kab.Rokan Hilir, Riau, Idas, 65, warga R.Batu Sukamakmur, Desa Rambah Baru, Kec.Rambah Samo, Kab.Rokan Hulu, Rodyah, 40, warga Desa Ariantan, Afdeling V Kalda, Kec.Kabun, Kab.Rokan Hulu, Nintan Boru Sihombing, 69, warga Jl. Pancing, Medan, dan seorang lagi bocah berusia 6 tahun, belum diketahui identitasnya. Sedangkan korban luka berat dan ringan, Dewi Mawar Sari, 16, warga Tamora Riau, Ratnawati, 46, warga Balam Riau, Riadi, 17, warga Desa Pematang Cengal Barat, Kec.Tg.Pura, Kab.Langkat, Iyak, 50, warga Desa Ariantan Afdeling V Kalda, Kec.Kabun, Kab.Rokan Hulu, Rudolf Tobing, 49, warga Kota Medan, Herman, 21, warga Bukit Lawang, Kab.Langkat, Wartono, 33, warga Kandis Riau, Wan Jaya, 46, warga Titi Kuning Tamora Riau, Bima, 4, dan Trigilang Prayoga, 6, (abang beradik) bersama ibunya Kesumawati, 35, warga Desa Karya Mukti, Kec.Rimbo Melintang Pekanbaru, Samon, 48, warga Batu Putih, Pekanbaru, Zulfikar Naen, 30, warga Desa Padang Cermin, Kec.Selesai, Kab.Langkat, Ngatina (belum diketahui identitasnya), Domardi Tinambun, 44, warga jalan Binjai Km 12, Kec.Sunggal, Kab.Deliserdang, Hamzah, 22, warga Desa Bukit Lawang, Kab.Langkat. Pengemudi bus PO Pinem yang belum diketahui identitasnya diduga begitu kejadian langsung kabur. Informasi Waspada peroleh dari salah seorang penumpang yang selamat, sebelum kejadian, bus yang mereka tumpangi melaju kencang. Menjelang tikungan tajam Bengabing, diduga sopir mengantuk dan tidak mengetahui di depan ada tikungan dan tetap tancap gas.Saat itulah bus nyelonong ke kiri jalan arah ke Medan. Sopir bus, yang sadar busnya nyelonong, lalu banting stir ke kanan jalan sehingga bus terbalik. ‘’Ketika itu, banyak penumpang terbentur dan tercepit, mengakibatkan luka berat dan ringan serta meninggal dunia,’’ katanya. Pantauan Waspada di tempat kejadian perkara(TKP), bus tersebut setelah terbalik menghantam kios doorsmer milik Sofian warga setempat, kemudian menghantam tiang baleho. Kasat Lantas Polres Serdang Bedagai AKP Hasan Basri dan Kanit Laka Iptu Junaidi bersama anggota Satlantas Polres Serdang Bedagai, yang turun ke TKP dibantu warga setempat segera mengevakuasi para korban ke RSU Trianda Pasar Bengkel dan RSU Melati Perbaungan. Sementara, Kapolres Serdang Bedagai AKBP Binedictus Anies Purnawan, Minggu(29/9) pagi, meninjau para korban di RSU Trianda Pasar Bengkel. Menurut Kapolres, peristiwa itu dikatagorikan menonjol karena korbannya sampai lima orang dan belasan orang luka berat dan ringan. Untuk itu, kata Kapolres, pihaknya mengimbau kepada para pengemudi baik pengemudi angkutan umum maupun pribadi berhati-hati dalam mengemudikan kendaraan.’’ Jika mengantuk, istirahat.Jangan dipaksakan. Selain itu, jangan ugal-ugalan. Kalau sudah terjadi tidak bisa disesali,’’kata Kapolres.(a08)

Suhu Di Madinah ... Ketua kloter 4 Basyah, kata Chabibul, saat ditemui di pemondokan 920 kawasan Bahutmah Minggu (29/10) menyatakan 5 koper tersebut belum ditemukan. “Kami sudah 2 kali melapor ke sektor 8, mereka masih menelusuri mulai dari bus yang mengangkut Kloter 4 hingga di hotel Madinah dan penginapan di Makkah, “ ujar Basyah. Dikatakannya kloter 4 masuk ke Makkah, Senin pukul 01:00 WAS langsung melakukan tawaf umroh dan sa’i. Selesai itu kembali ke pemondokan di 820 dan 823, dan baru diketahui 5 koper tidak ada. Masalah lain dialami kloter 5, kata Chabibul, adalah fasilitas pemondokan yang kurang layak selain lift yang tidak memadai, fasilitas kamar yang kecil ditempati 5 orang. Sedangkan suasana Kota Makkah semakin sesak dan sekitar Ka’bah semakin membludak,dipadati umat Islam se dunia. “Suasana Ka’bah penuh sesak saat jamaah haji dari penjuru dunia melakukan tawaf umroh dan sa’i,” sebut Cabibul Chair yang bergabung dengan jamaah dari KBIH Jabal Noor. Kondisi sesak Ka’bah membuat petugas di berbagai saktor Jawaban Problem Catur, sibuk memberikan pengarahan dan memperhatikan jamaah TTS Dan Sudoku karena banyak yang tersesat Dari Halaman Sport. setelah meninggalkan Masjidil Haram dan akan kembali ke pondokannya. Jawaban Problem Catur: Ketua Sektor 9 bernama Anwar mengakui banyaknya jamaah yang tersesat, umumnya 1. ...., Gxg2+. jamaah asal Pulau Jawa. Bah2. RxG (terpaksa), kan ada yang harus kehilangan uangnya karena terlalu banyak Be2+. membawa dan terlalu memberi peluang pada orang yang tidak 3. Rf1, Mf2+mat. dikenal untuk memegang tas mereka. (m37)

Ada-ada Saja ...

Jawaban TTS: TTS

Umum Serba “Dang”

Jawaban Sudoku:

5 6 2 1 7 3 4 8 9

8 1 7 9 6 4 3 5 2

4 9 3 5 8 2 6 1 7

3 7 9 8 2 5 1 4 6

6 4 5 7 3 1 2 9 8

2 8 1 6 4 9 5 7 3

7 2 4 3 1 8 9 6 5

1 5 6 2 9 7 8 3 4

9 3 8 4 5 6 7 2 1

bocah ini.Ia akan menangis keras setiap kali mendengar lagu cinta bernada sedih atau bahkan suara musik klasik. Adalah Louis Mushrow asal Hawarden, Wales Utara yang selalu menangis jika mendengar lagu cinta yang mendayu. Itu karena bocah berusia 9 tahun ini menderita sebuah penyakit kelainan bernama sindrom Smith-Magenis. Meski kondisi ini dinyatakan tidak berbahaya bagi Lois, tapi sang ibu mengaku terganggu karena selalu mendapat cibiran dan ejekan dari orang-orang saat putranya tiba-tiba menangis di depan umum ketika mendengar suara musik. “Anda akan mendapat cibiran dan orang akan menyuruh untuk mendiamkan anak anda. Namun Louis tak bisa menahan tangisnya,” kata ibu Lois yang dilansir, Minggu (29/9). Sang ibu mengaku orangorang mengira ia tidak bisa mengajar putranya karena selalu menangis. “Orang terkadang mengira Lois menangis karena ia sedang kesal. …Kami tahu jenis musik tertentu mengeluarkan segala emosi kesedihan di otak Lois,” tambahnya. Menurut laporan, sindrom Smith-Magenis tercatat menjangkiti 1 dari 25.000 orang di dunia.(net/rzl)

MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho mengatakan, gerakan Pramuka semakin diperlukan untuk menjadikan generasi ini tidak kehilangan nilai-nilai ke-Indonesia-an mereka. ‘’ Nilai-nilai positif kemanusiaan dan cinta Indonesia yang tergambar dalam Trisatya dan Dasa Dharma Pramuka, bisa membentuk generasi muda Indonesia sebagai generasi unggul dan tangguh,’’ kata Gubsu selaku ketua Majelis Pembimbing Daerah (Kamabida) Pramuka Sumatera Utara saat memimpin upacara peringatan HUT ke-52 Pramuka di Lapangan Simare-mare Kota Sibolga Sabtu(28/9). Menurut Gubsu, Pramuka masih relevan untuk menjawab masuknya nilai-nilai dari luar

negeri. Lewat aktivitas kepanduan ini bisa melahirkan kaderkader pemimpin Indonesia masa depan. Pramuka harus terus digiatkan dalam dunia pendidikan kita, karena gerakan ini turut membentuk karakter disiplin, bertanggung jawab, kreatif memanfaatkan waktu serta bagaimana kita mengemban tugas,” kata Gubsu pada acara yang dihadiri antara lain Ketua Tim Penggerak PKK Sumut Hj Sutias Handayani, Ka Kwarda Sumut H Nurdin Lubis, SH, MM, Wali Kota Tebingtinggi Umar Junaidi Hasibuan, Wakil Bupati Deliserdang Zainuddin Mars, para pengurus Kwardasu dan Ketua Kwartir Cabang se-Sumut. Dalam peringatan HUT Pramuka tersebut, Gubsu menganugerahkan penghargaan Satya Lencana Melati, Dharma

Bakti dan Panca Warsa kepada para pemimpin kabupaten/ kota dan pengurus Kwardasu atas jasa-jasa mereka memajukan Kepramukaan di Sumut. Ketika membacakan sambutan Ketua Kwartir Nasional, Gubsu mengatakan, Pramuka menekankan penguasaan ilmu pengetahuan dan teknologi, selain tetap memupuk nilainilai sosial budaya unggulan khas Indonesia. “Lewat Pramuka misalnya, Pramuka Siaga dilatih serta dibiasakan untuk mengantre. Sejak SD anak-anak belajar antre, bekerjasama dan tidak saling serobot hingga gilirannya tiba. Saat antri, anak Pramuka siaga juga belajar bersosialisasi dengan orang yang ikut mengantre, memanfaatkan waktu selama mengantre,” katanya. (m28)

Survei Insis: Priyo Aspiratif, Ruhut Paling Ngotot 73,9 Persen Responden Tak Puas Kinerja DPR JAKARTA (Antara): Institut Survei Indonesia (Insis) di Jakarta, Minggu (29/9), mengumumkan hasil survei atas evaluasi kinerja dan citra DPR di mata publik dan Wakil Ketua DPR Priyo Budi Santoso dinilai sebagai politisi paling aspiratif. Selain Priyo, sejumlah anggota DPR yang disukai oleh para responden sebagai politisi paling aspiratif dalam menampung pendapat maupun aduan masyarakat adalah Rieke Dyah Pitaloka, Ganjar Pranowo (sekarang Gubernur Jawa Tengah) dan Taufik Kurniawan. Sedangkan Ruhut Sitompul dinilai sebagai anggota DPR yang paling keras (ngotot) dalam menyampaikan pendapat. Peneliti Insis Mochtar W Oetomo mengatakan Priyo paling disukai dan aspiratif karena dalam sejumlah kasus aktual sering memberi komentar positif bagi publik. Dalam survei ini Priyo Budi Santoso mendapat penilaian tertinggi dari responden sebagai anggota DPR yang paling disukai karena aspiratif (6,91 persen), Rieke Dyah Pitaloka (6,16 persen), Ganjar Pranowo (5,6 persen), Taufik Kurniawan (4,67 persen), Budiman Sujatmiko (3,92 persen), Mahfudz Siddiq (3,45 persen), Ahmad Muqowam (2,89 persen), Ahmad Muzani (1,86 persen), Eko Hendro Purnomo (1,4 persen), lainnya (40,46 persen), dan tidak menjawab (21,21 persen).

Survei dilakukan pada 20 Agustus - 20 September 2013 di 33 provinsi, dengan jumlah responden 1.070 orang. Pengumpulan data dilakukan melalui wawancara tatap muka dengan pedoman kuesioner. Sementara, dalam survei tersebut, Ketua DPR Marzuki Alie menjadianggotaDPRyangpaling dikenal dengan hasil survei (10,28 %), lalu Ruhut Sitompul (9,53 %), Priyo (8,87 %), Hidayat NurWahid (7,28 %), Puan Maharani (7 %), Pramono Anung (6,54 %), Hajriyanto Y Thohari (5,14%), Fahri Hamzah (4,39%), Bambang Soesatyo (3,73%), Ahmad Yani (3,08%), Tantowi Yahya (2,8%), Rieke Dyah (2,33%), lainnya (9,06%), dan tidak jawab (19,9%). Popularitas Marzuki tinggi karena sebagai Ketua DPR, kata Mochtar, Marzuki sering muncul di televisi maupun media massa terutama dalam beberapa bulan terakhir kiprah Marzuki dalam Konvensi Partai Demokrat banyak diberitakan televisi. “Sebanyak 86,3 persen res-

ponden mengenal anggota DPR melalui televisi,” kata Mochtar. Adapun anggota DPR Ruhut Sitompul dinilai sebagai anggota DPR yang paling keras (mengotot) dalam menyampaikan pendapat (34,95%), lalu Bambang Soesatyo (7%), Eva Kusuma Sundari (3,92%), Fahri Hamzah (3,73%), Sutan Bhatoegana (3,45%), Nurul Arifin (2,89%), Martin Hutabarat (1,86%), Ahmad Yani (0,93%), Syarifuddin Suding (1,4%), lainnya (7,57%), tidak menjawab (32,24%). Secara umum responden menyatakan tidak puas dengan kinerja DPR dalam menyerap keluhan masyarakat. Sebanyak 73,9 persen responden mengaku tidak puas dalam kerja DPR menyerap aspirasi. Mereka juga menilai bahwa negatif terhadap citra DPR. Responden yang menjawab citra DPR tidak baik (38,5%), semakin tidak baik (26,1%), baik (29,2%), semakin baik (1,9%), dan tidak menjawab (4,3%).

600.000 Jamaah Tiba Di Saudi MINA, Arab Saudi (Waspada): Sedikitnya 600.000 jamaah dari seluruh penjuru dunia telah sampai di Arab Saudi untuk melaksanakan haji. Sementara, hampir 2 juta jamaah akan melaksanakan haji tahun ini, demikian menurut Arab News Minggu (29/9), mengutip keterangan Gubernur

MakkahPangeranKhaledalFaisal. Dalam laporan cuaca untuk Oktober, Presidensi Meteorologi dan Lingkungan mengatakan, suhu di Makkah siang hari akan panas, dengan cuaca yang menyenangkan di malam hari. Suhu berkisar 38-43 Celcius pada siang hari dan 24 sampai 27 Celcius di malam hari. (an/m10)

5 Anggota Mapala ... Busuak, Limau Manih, Padang, menuju Sungai Patamuan. Mereka berangkat jalan kaki, bukan dengan perahu, tapi jalan darat,” kata Aldian, Minggu (29/9). Dia menjelaskan, rekan-rekannya itu berangkat Sabtu pukul 10:00 dan sampai di lokasi sekitar pukul 15:30. Kemudian di lokasi, Bukit Pungguang Ladiang, mereka istirahat dan memasak. Setelah selesai sekitar pukul 17:50WIB, mereka melanjutkan perjalanan. Namun, dari Bukit Pungguang Ladiang mereka harus menyeberangi Sungai Padang Janiah. Sungai Padang Janiah memiliki lebar sekitar 20 meter.Namun,bagianyangdialiri air hanya selebar 7 meter dan dangkal. Tapi ketika enam orang berada sekitar dua meter di bagian sungai yang berair, tiba-tiba debit air semakin tinggi. “Enam orang yang sudah berada di air terseret. Sedangkan yang dua orang lagi masih berada di luar sungai,” kata Aldian. Dua orang yang selamat tersebut melaporkan via telepon ke kantor Mapala Unand. Komunikasi tidak berjalan lancar. Karena jaringan yang tidak cukup, membuat suara putusputus. Akhirnya dilanjutkan via pesan singkat seluler. Pihak kantor Mapala Unand merekomendasikan yang masih selamat agar tetap bertahan di lokasi. “Kami di sini mulai melakukan pencarian setelah mendapat laporan kalau mereka ada trouble. Kami melapor ke pihak berwajib dan menurunkan anggota kami,” tuturnya. Setelah dilakukan pencarian

22 Imigran Gelap ... laki-laki. Ada lima anak wanita dan dua anak laki-laki di antara korban meninggal, 28 orang yang ditemukan selamat. “Total penumpang dan awak kapal 80 orang. Kapal itu mengangkut imigran gelap dari Lebanon, Jordania, Afrika danYaman dan Pakistan untuk mencari suaka ke Australia. Setelah pencarian dilakukan, kapal tersebut ditemukan sudah dalam kondisi pecah dan hancur,” kata Sutopo kemarin. Cuaca Buruk Mengingat cuaca yang tidak normal di jalur laut, maka petugas mencari dari jalur udara menggunakan helikopter. Kapolres Cianjur, Jawa Barat, Ajun Komisaris Besar Dedy Kusuma Bakti, saat dihubungi mengatakan, dalam kondisi saat ini, ombak tinggi dan angin kencang, pencarian di laut tidak


TIM SAR mengevakuasi jasad seorang mahasiswa pecinta alam (Mapala) Universitas Andalas (Unand) yang tewas akibat dihanyutkan air bah di Batubusuk, Padang, Minggu (29/9). oleh pihak BPBD, masyarakat, Mapala Unand, anggota Polri, korban hanyut ditemukan sudah tak bernyawa. Minggu pagi, sudah ditemukan empat orang lainnya. Dari lima korban, dua ditemukan di Muara Parkit, Aia Tawa dan tiga

di daerah Batu Busuak. Dengan ditemukannya lima orang korban, berarti masih ada satu orang korban hanyut yang belum ditemukan. “Kita berdoa semoga yang belum ditemukan dalam keadaan baik-baik saja,” kata Aldian.

Delapan anggota Mapala Unand yang menjadi korban: 1. Aidil Akbar (laki-laki), masih dicari Jurusan: Fakultas Ekonomi Akutansi angkatan 2011 2. Rizki Tega (laki-laki), meninggal dunia Jurusan: Fakultas Ekonomi D-III angkatan 2010 3. Deni Linardo (laki-laki), meninggal dunia Jurusan: Fakultas Pertanian angkatan 2010 4. Veglan Rizki Ananda (laki-laki), meninggal dunia Jurusan: Fakultas Ekonomi angkatan 2012 5. Artica Caspela (perempuan), meninggal dunia Jurusan: Fakultas Kedokteran Psikologi angkatan 2011 6. Elin Florita (perempuan), meninggal dunia Jurusan: Fakultas Teknologi Pertanian angkatan 2012 7. Ivo Nurdio Putra, (laki-laki), selamat Jurusan: Fakultas Sosiologi angkatan 2009 8. Meta Ramarita (Perempuan), selamat Jurusan: Fakultas Peternakan angkatan 2010. (vn) memungkinkan. Tim mengandalkan pencarian dengan helikopter. “Sedangkan tim yang lain difokuskan pada penyisiran pantai. Tadi tim baru saja menemukan jenazah. Kami sedang coba angkat dari laut. Dari laporan sementara jumlahnya dua orang,” ujar Dedy, Minggu (29/9). Dengan penemuan ini, Dedy yakin jumlah korban akan terus bertambah. “Kelihatannya masih akan ada korban yang akan di temukan tim. Kami berharap ombak membawa jenazah ke dekat pantai. Ini akan mempercepat evakuasi,” katanya. Dedy berharap masih bisa menyelamatkan korban yang kemungkinan masih hidup. Hingga saat ini tim evakuasi berhasil menyelamatkan 28 orang imigran dalam kondisi hidup. “Kami akan terus cari. Sesuai SOP pencarian dilakukan hingga H+6 dari waktu kejadian.

Hari ini hari kedua. Mudah-mudahan masih ada yang sanggup bertahan dan bisa diselamatkan,” katanya. Korban yang selamat kini masih mendapat perawatan dan di tangani pihak imigrasi Kelas II Sukabumi. Polisi, kata dia, masih kesulitan mengumpulkan informasi dari korban selamat karena terkendala bahasa. “Kami sulit ngumpulin informasi manifes. Jadi belum diketahui pasti berapa jumlah penumpang kapal. Apa 80 orang, apa lebih atau kurang. Kami belum bisa pastikan,”paparnya. Saat ini tim gabungan yang melakukan evakuasi berjumlah 300 orang dari unsur TNI, Polri, Sarda, BPBD, Relawan dan warga. ”Untuk polisi 100 orang. Ini termasuk bantuan tim sar dari Polda Jabar yang tiba kemarin,” katanya. (vn)


GUBSU H Gatot Pujo Nugroho menyematkan penghargaan kepada pengurus Kwardasu atas jasa-jasanya turut memajukan gerakan Pramuka, pada HUT Pramuka di Lapangan Simaremare Sibolga, Sabtu (28/9).

Indonesia Butuh Pemimpin Nasionalis Sejati Dan Patriotis JAKARTA (Antara): Mantan Ketua PP Muhammadiyah Ahmad Syafii Maarif menegaskan, bangsa kini membutuhkan pemimpin yang tidak menjadikan kekuasaan sebagai mata pencaharian karena rakyat sudah jenuh dengan diisintegritas pemimpin. “Bangsa butuh pemimpin nasionalis sejati, penuh patriot,” ujar Syafii Maarif pada silaturahim salah satu peserta konvensi bakal calon Presiden Partai Demokrat di Jakarta, Minggu (29/9). Syafii mengingatkan bangsa sedang berjalan ke tahun politik 2014 di mana kesadaran masyarakat untuk memilih pemimpin berjiwa patriot dan dapat memaknai arti nasionalisme sangat penting untuk perjalanan bangsa. Rasa patriot dan nasionalisme, kata Syafii, dapat dicerminkan dari bagaimana pemimpin melindungi aset bangsa, termasuk sumber daya negara dari keserakahan asing. “Kedaulatan ekonomi kita sekarang sedang

Kelompok Bersenjata ... Jumlah korban dalam serangan terakhir itu masih belum jelas, namun ada kecemasan, angka kematian kemungkinan tinggi. Nama Arab resminya adalah Jama’atu Ahlis Sunna Lidda’awati wal-Jihad, yang artinya “Warga Berkomitmen untuk Penyebaran Ajaran Nabi dan Jihad.” Mulanya fokus menentang pendidikan Barat. Nama Boko Haram, satu ungkapan dalam bahasa etnis lokal Hausa yang artinya, “Pendidikan Barat dilarang.” Satu sumber rumah sakit mengatakan kepada media, 26 orang tewas dalam serangan tersebut. Provos kampus Molima Idi Mato mengatakan kepada The Associated Press kemungkinan angka kematian sebanyak 50 orang.Pasukan keamanan masih mengumpulkan mayat-mayat dan kira-kira 1.000 mahasiswa telah melarikan diri dari kampus. Seorang jurubicara militer di negara bagian Yobe, Lazarus Eli, mengatakan, kelompok bersenjata itu juga telah membakar kelas-kelas belajar. Juni lalu, Boko Haram melakukan dua serangan atas sekolah di kawasan itu dan menewaskan sembilan anak di satu sekolah di pinggiran Maiduguri, sementara 13 pelajar dan guru dibunuh di satu sekolah di Damaturu. Juli di desa Mamudo di negara bagian Yobe, militan Islamis menyerang asramaasrama pelajar dengan senjata api dan peledak, menewaskan sekurang-kurangnya 42 orang, sebagian besar mahasiswa. Boko Haram menganggap sekolah-sekolah sebagai simbol budaya Barat. Presiden Goodluck Jonathan memerintahkan satu operasi terhadap Boko Haram Mei lalu. Boko Haram dipimpin oleh Abubakar Shekau. Militer Nigeria mengatakan Agustus lalu, pihaknya telah membunuhnya dalam satu tembak menembak. Namun, satu rekaman video yang disiarkan pekan lalu mempertunjukkan dia masih hidup. Laporan-laporan sebelumnya yang mengatakan kematiannya tidak terbukti. (m10)

diacak-acak, bangsa sudah bosan dengan pemimpin yang tidak jelas dalam mengambil kebijakan,” ujar dia. Kebijakan pemimpin, kata Syafii, harus dapat diterjemahkan dalam tindakan ter-

ukur, bukan hanya retorika belaka yang justru dapat menimbulkan antipati masyarakat. “Bangsa ini sudah lelah dengan kepemimpinan yang tidak jelas dan hanya basa basi belaka,” ujar dia.

Percobaan Bunuh Diri Novi Amalia Karena Tertekan Tuntutan Jaksa JAKARTA ( Waspada): Novi Amalia (foto), model majalah dewasa, mengaku tidak sadar ketika melakukan percobaan bunuh diri pada Jumat(27/9) kemarin. Kuasa Hukum Novi, Rangga Lukita mengatakan, Novi melakukan percobaan bunuh diri karena dia terus berpikir mengenai tuntutan jaksa terkait kasus kecelakaan lalu lintas. “Saya tanya dia kenapa melakukan itu, dia jawab karena tertekan atas tuntutan 7 bulan penjara terhadap dirinya,” ujar Rangga, Minggu (29/9). Akibat perbuatannya itu, Novi mengalami luka di bagian tangan serta kakinya. Novi kini masih dalam perawatan di Rumah Sakit Ketergantungan Obat. Rangga menuturkan, secara fisik kondisi Novi cukup parah.”Di tangan kiri dan kanannya ada bekas jahitan. Saya tidak mengetahui pasti berapa jahitan,” jelas Rangga. Namun, secara fisik cukup parah.Menurut Rangga, kondisi Novi sekarang ini sudah cukup stabil. “Mentalnya sudah stabil, sudah bisa diajak ngobrol,” imbuhnya. Novi Amelia, terdakwa kasus kecelakaan lalu lintas dituntut tujuh bulan penjara oleh Jaksa Penuntut Umum dalam persi-dangan di Pengadilan Negeri Jakarta Barat, Selasa 17 September 2013. Novi Amelia menabrak tujuh orang di kawasan Taman Sari, Jakarta Barat pada 11 November 2012. Jaksa menilai Novi melakukan tindak pidana melanggar pasal 312 dan Pasal 310 ayat 2 Undang-Undang No 22 Tahun 2009 tentang Lalu Lintas dan Angkutan Jalan. Jaksa mengungkapkan, Novi juga terbukti lalai dalam mengendarai kendaraan bermotor sehingga menimbulkan kecelakaan dan melukai orang lain.(vn)

Angin Kencang ... Hujan disertai angin kencang yang tiba-tiba, kata Aga, menyebabkan dua titik jalan lintas di kelurahannya mengalami kemacatan. “Namun kita sudah menginstruksikan kepada Kepling segera mengantisipasi antrian panjang kendaraan yang akan melintasi jalan tersebut,” ujar Aga. “Namun di Jl. Imam Bonjol, sempalan pohon di pinggiran Lapangan Banteng menyebabkan satu sedan Lancer ringsek.Kaca belakang pecah karena tertimpa,” ujarnya. Safii, Kepling Petisah Tengah menyatakan saat ini sejumlah Kepling berada di lapangan membersihkan dahan atau ranting yang patah, dibantu mobil derek dan petugas pemotong. “Untuk membersihkan bekas dahan tumbang, kita telah meminta bantuan satu truk dari Dinas Pertamanan,” ujar Safii. Pantauan Waspada, hingga pukul 20:15 para petugas kelurahan dari Petisah Tengah sedang melakukan pembersihan di sekitar Lapangan Banteng, Jl. Imam Bonjol dan Jl. Kejaksaan, Medan. (m38)

Polres Pidie Sita 343 Kg ... Pada tempat yang sama, KAS menjelaskan ganja tersebut milik temannya K. Ia mengakui tidak mengetahui barang yang diangkutnya adalah daun ganja. Dia baru mengetahui setelah berada di Jl. Soekarno-Hatta Banda Aceh. Namun, katanya, barang tersebut tidak bisa lagi diturunkan.Kalau saya turunkan di jalan, saya juga akan ditangkap. Jadi saya putuskan angkut saja, namun naas setiba di Pidie, kami ditangkap,” katanya. (b10)

Waspada/Muhammad Riza

KAPOLRES Pidie AKBP Sunarya (tengah) diapit dua tersangka dan dua anggota Polres Pidie memperlihatkan barang bukti ganja seberat 343 Kg yang disita dalam razia rutin, Jumat (27/9).

Al Bayan ... selanjutnya Nabi Ya’kub mempunyai anak yang menjadi rasul, yakni Nabi Yusuf as. Lewat keturunan Nabi Ismail as melahirkan Nabi Muhammad SAW. Doa tersebut juga mencakupi kepada seluruh kaum Mukminin laki-laki dan perempuan, maka sangat pantas bila Nabi Muhammad SAW mengajarkan kepada kita shalawat kepada Nabi Muhammad dan keluarganya, dan kepada Nabi Ibrahim dan keluarganya sebagaimana kita baca dalam shalat. Nabi Ibrahimlah yang membangun Ka’bah bersama putranya Ismail. Ka’bah sebagai kiblat kaum Muslimin terpelihara sampai sekarang. Ibrahim juga yang pertama berqurban, lontar jumrah, istrinya Hajar yang pertama Sa’i antara Shafa dan Marwah.

Nabi Ibrahim juga yang naik atas bukit Jabal Qubis dekat Masjidil Haram memanggil manusia untuk datang bersujud kepada Allah di depan Ka’bah. Menunaikan ibadah haji dan umrah bila ada kesanggupan. Sungguh besar jasanya kepada umat Islam. Nabi Muhammad sampai memberi nama Ibrahim kepada putranya dari Mariah Qibtiyah sebagai kenangan kepada nama Nabi Ibrahim Khalilullah. Kiranya, doa Nabi Ibrahim masih perlu kita bacakan terus menerus agar anak dan cucu kita tetap mendirikan shalat lima waktu. Kiranya Allah jua dapat memberi ampunan kepada kita yang banyak dosa ini. Semoga pada hari akhirat nanti kita tidak tersandung waktu dihisab amal ibadah. Mari kita contoh Ibrahim dan Nabi Muhammad SAW dalam keimanan dan kebersihan aqidah.

WASPADA Senin 30 September 2013

Luar Negeri

A3 Pengurangan Jamaah Akibatkan Jatuhnya Sewa Hotel Di Makkah

Italia Kacau, Berlusconi Tarik Sejumlah Menteri ROMA, Italia (Reuters): Silvio Berlusconi menarik sejumlah menterinya dari kabinet dan menyebabkan pecahnya pemerintahan PM Enrico Letta serta menyebabkan negara dengan perekonomian terbesar ketiga di zona Eropa itu mengalami kekacauan. Pembicaraan dimulai untuk mendapatkan suara mayoritas di parlemen guna mendukung dibentuknya kabinet baru dan menghindari kembali dilakukannya pemilihan setelah tujuh bulan pemilihan terakhir dilaksanakan. “Banyak sekali langkah-langkah yang tengah kami susun menghadapi resiko kegagalan,” kata Menteri Perburuhan Italia Enrico Giovannini kepada televisi Rai Sabtu (28/9). Pada Senin biaya pinjaman kami akan meningkat pada banyak bidang.” Tindakan Berlusconi dilakukan sehari setelah Letta menantang Partai Pusat Kanan untuk mendukungnya dalam pemungutan suara untuk mendapatkan kepercayaan di parlemen. Jumat sore, kabinet gagal menyetujui langkah keuangan untuk mengatasi defisit anggaran sesuai dengan batas yang ditetapkan Uni Eropa, menyebabkan koalisi rapuh tersebut mendekati perpecahan. Ketegangan antara dua pihak meningkat selama beberapa minggu menyusul dipecatnya Berlusconi dari parlemen setelah dia dinyatakan bersalah dalam hal pencurangan pajak bulan lalu. AnggotaparlemendariPartaiKebebasanRakyat(PDL)pimpinan Berlusconi minggu ini mengancam keluar dari parlemen jika pertemuan komite senat pada 4 Oktober mendatang memutuskan memproses pemecatan pemimpin mereka, yang menginjak usia 77 tahun pada Minggu, berdasarkan UUD yang melarang seorang yang terbukti bersalah untuk memegang jabatan di parlemen.(m23)

Resolusi Damai PBB Atasi Konflik Syria PBB, New York (AP): Perserikatan Bangsa Bangsa akhirnya sepakat mengesahkan satu resolusi damai demi menyudahi konflik berdarah di Syria. Resolusi damai itu diputuskan Sabtu (28/9) waktu Amerika Serikat. Dalam resolusi itu termaktub dua tuntutan Dewan Keamanan PBBkepadaPemerintahSyria.Pertama,PresidenBasharAssadmenyerahkanseluruhpersediaansenjatakimia.Kedua,ahlibadaninternasional diberikan akses tak terbatas ke tempat penyimpanan senjata kimia. BBC melaporkan, tenggat waktu yang ditetapkan dalam resolusi itu masih sama, yakni pertengahan tahun 2014 mendatang. Di dalam resolusi itu juga dicantumkan ayat 7 dari piagam PBB yang mengizinkanadanyaseranganmiliter.Konsepyangsemuladisepakati oleh Pemerintah Amerika Serikat dan Rusia itu kemudian didukung oleh 15 anggota DK PBB lainnya. Kesepakatan itu terjadi dalam sebuah pertemuan di markas PBB di kota NewYork. Resolusi itu adalah terobosan besar demi mengatasi kebuntuan penyelesaian konflik sudah berlangsung 2,5 tahun. (m10)

Iran Masuki Era Baru Hubungan Dengan AS WASHINGTON (AP): Presiden AS Barack Obama dan Presiden Iran Hasan Rouhani untuk pertama kalinya berbincang melalui telefon Jumat (Sabtu 28/9 WIB) setelah keduanya tidak sempat bertemu di sela Sidang Umum PBB di New York. Pembicaraan tersebut sekaligus menandai sejarah baru atas hubungan kelam AS-Iran setelah Revolusi Islam Iran pada 1979. “Baru saja saya berbicara dengan Presiden Rouhani melalui telefon, kamimembicarakanupayayangtengahberlangsungterkaitprogram nuklir Iran,” kata Obama dalam pernyataan yang disiarkan televisi. “Kamimenyadariadanyaberbagaitantangankedepan,sekaligus fakta bahwa pembicaraan tadi adalah komunikasi pertama antara Presiden Iran dan AS sejak 1979 yang menekankan adanya rasa saling tidakpercayaantarakeduanegara,tetapihalitujugamengindikasikan prospek untuk membuka lembaran sejarah baru,” kata Obama. Obama mengatakan bahwa dirinya menyampaikan keyakinannya kepada Rouhani atas sebuah resolusi yang dapat mengakhiri sengketaprogrampengayaanuraniumyangdilakukanIran.Program tersebut selama ini selalu dituduh sebagai upaya Iran untuk memiliki senjata nuklir, hal yang dibantah oleh Teheran. Obama juga bahkan meminta maaf atas kemacetan lalu lintas di New York, sebuah sinyal meredanya ketegangan antara kedua seteru itu.(bbc/ant/m10)

The Associated Press

SEORANG pria Pakistan melarikan seorang anak kecil menjauh dari lokasi ledakan tidak lama setelah satu bom mobil meledak di Peshawar, Pakistan, Minggu (29/9). Satu bom mobil meledak di satu jalan sibuk di Pakistan Baratlaut Minggu, yang menewaskan puluhan orang dalam ledakan bom ketiga yang melanda kota itu dalam satu minggu ini, demikian menurut kalangan pejabat.

Peshawar Diguncang Bom, 37 Orang Tewas, 75 Cedera PESHAWAR, Pakistan (Reuters): Satu bom meledak di kota Peshawar, baratlaut Pakistan dan menewaskan 37 orang serta mencederai 75 lainnya Minggu (29/9), seminggu setelah pengebomanatassatugerejadikota perbatasan itu yang menewaskan sejumlah orang, kata polisi dan petugas rumahsakit. Kekerasan semakin meningkat di Pakistan dalam beberapa bulanterakhir,yangmerusakusaha PM Nawaz Sharif meredakan pemberontakan dengan meluncurkan pembicaraan damai dengan Taliban. Ledakan Minggu terjadi di luar kantor polisi di Peshawar yang padat dengan pertokoan dan keluarga. Belum ada yang mengaku bertanggungjawab. Ledakan terjadi di daerah sibuk, Pasar Kissa Khawani, di Peshawar, yakni gerbang menuju daerah suku yang bermasalah dan dipengaruhi oleh kelompok Taliban dan jaringan Al Qaeda. Dia mengatakan, diperkirakan sebuah mobil digunakan membawa bom, dan petugas penyelidik akan memberikan penjelasan mengenai penyebab ledakan setelahpetugaspenjinakbomselesai mengumpulkan bukti-bukti dari

tempat kejadian. Petugas keamanan kota setempat mengatakan, jika ledakan ituterjadididekatpospolisi,tetapi belumdiketahuiapakahpospolisi itu sebenarnya sasaran teroris. Serangan Minggu adalah seranganbomyangketigadiPeshawar dan daerah pinggirannya dalam tujuh hari terakhir ini.

Minggu sebelumnya, penduduk Peshawar juga mengalami seranganbombunuhdiridigereja yang menewaskan 82 orang, sehingga memicu protes luas secara nasional oleh kelompok masyarakat Kristen. Masyarakat madani meminta pemerintah Pakistan memberi perlindungan yang lebih baik kepada kelompok kecil.

Puluhan Ribu Warga Taiwan Tuntut Presiden Mundur TAIPEH, Taiwan (AP): PuluhanribuwargaTaiwanmelakukan rapat umum menentang Presiden MaYing-jeou di tengah jatuh jajak pendapat dan kemarahan bipartisan atas penyadapan legislator. Sekitar 20.000 pengunjuk rasa berkumpul di depan Kantor KepresidenandipusatkotaTaipeh Minggu (29/9) untuk menuntut Ma mundur karena sejumlah isu, termasuk manajemen ekonomi dan skandal penyadapan yang memancing amarah para anggota parlemen lintas partai. Protes sore itu oleh para demonstran yang mengenakan pakaian serba hitam merupakan

yangterbesardarikelompokgrass root terpisah Minggu di ibukota. Para pemrotes menuntut penghapusanDivisiPenyelidikanKhusus, satu badan kejaksaan yang menyadap data yang digunakan untuk menyerang Ma, ketua parlemen dan partai saingannya Wang Jin-Pyng. Ma mudah terpilih kembali dengansatulandasanpeningkatan hubunganekonomidenganChina, tetapidewanlegislatifyangdipimpin Wangmenundakesepakatanekonomi utama lintas-selat.(m10)

Jumat , penduduk Peshawar jugadikejutkanbomberkekuatan besar yang mengoyak satu bus pegawaipemerintahdiujungkota itu, membawa korban 18 orang meninggal. Korban ledakan Minggu dipastikan oleh polisi dan Arshad Javed, seorang dokter di Lady Reading Hospital di Peshawar. Ledakan itu terjadi setelah serangan dilancarkan satu faksi Taliban atas gereja Anglican di Peshawar minggu lalu yang menewaskan lebih 80 orang, serangan paling mematikan yang terjadi terhadap kaum Kristen di Pakistan yang didominasi Muslim Talibanberulangkalimenolak UUD Pakistan dan menyerukan agar ditegakkannya hukum Islam secara menyeluruh dan menyerukan perang dengan India.Sharif akan bertemu dengan sempalannya dari India Manmohan Singh di sela-sela pertemuan Majelis Umum PBB pada Minggu, hanyabeberapajamsetelahSingh menggambarkan Pakistan sebagai ‘pusat terorisme di kawasan kami’.(m23/m10)

KEPUTUSAN pemerintahArabSaudiuntukmengurangijumlah jamaah lokal tahun ini sampai 50 persen telah memaksa perusahan penyelenggara Haji untuk berpikir melipatgandakan biaya yang harus dikeluarkan jamaah yang mereka tangani, guna mengatasi kerugian mereka. Hal itu diungkapkan oleh seorang pejabat senior pemerintah Arab Saudi. Saad Al-Qurashi, ketua Komite Nasional untuk Haji dan Umrah, mengatakan pengurangan 50 persen jamaah itu akan memiliki dampak negatif bagi pendapatan perusahaan penyelenggara Haji, yang baru diberi tahu tentang pengurangan tersebut Juni lalu. Ketika berbicara dengan Arab News, dia mengatakan Kementerian Haji telah menyelesaikan pembagian tenda di Mina untuk para penyelenggara Haji lokal dengan mengenakan bayaran 1.500 sampai 7.500 Riyal Saudi per satu tenda, bergantung kedekatannya dengan Jamarat. Sejumlah perusahaan mengenakan bayaran dengan harga yang berbeda antara 7.000 sampai 20.000 Riyal Saudi berdasarkan pelayanan yang mereka berikan. Al-Qurashi mengatakan bahwa biaya hotel dan kamar apartemen dekat Masjidil Haram telah jatuh dari 2.800 sampai 500 Riyal Saudikarenapengurangan20persenjamaahasingdanpengurangan 50 persen jamaah domestik itu. Perusahaan penyelenggara Haji telah menutup sekitar 400 kantor cabang di berbagai bagian di negara itu dan ribuan pekerjanya di-PHK, katanya. Al-Qurashi membantah laporan pers tentang pembatalan penerbangan Haji. “Semua penerbangan domestik sepenuhnya dipesan untuk Haji,” jelasnya. Al Qurashi mengatakan ada penurunan besar dalam jumlah jamaah Haji dialokasikan untuk perusahaan berlisensi. “Jika sebuah perusahaan yang berlisensi melayani 2.000 tahun lalu, mereka hanya akan mendapatkan 700 tahun ini,” katanya. Kenaikan harga kemungkinan akan menaikkan jumlah Haji ilegal tahun ini dan Al-Qurashi mengatakan jumlah jamaah tersebut bisa mencapai 500.000 orang musim ini. Pemerintah telah memperingatkan para jamaah Haji asing ilegal akan dideportasi dan tidak akan diizinkan untuk kembali selama 10 tahun. Departemen Paspor mengatakan akan mengerahkan polisi wanita untuk menghentikan Haji ilegal perempuan. Siap sambut jamaah Sementara itu, Departemen Pabean Saudi telah menyelesaikan kesiapannya untuk menerima jutaan jamaah Haji tahun ini, dengan memasang 71 alat pemeriksa seperti peralatan Sinar-X, pengerahan 50 wanita pemeriksa dan penggunaan anjing pelacak untuk mengidentifikasi orang-orang yang dicurigai di berbagai titik masuk. Issa Al-Qudabi, jurubicara departemen itu, mengatakan dalam satu pernyataan bahwa departemennya telah mengembangkan program dan melatih para personilnya untuk mendukung operasi pabean. Ini untuk menjamin kemulusan masuk para jamaah dari seluruh dunia, katanya. Lebih dari 800.000 jamaah diharapkan sampai dengan menggunakanlebihdari2.800penerbangandiBandaraInternasional Prince Mohammed Bin Abdul Aziz di Madinah. Menurut statistik daritahunlalu,sebanyak4.800penerbangandiperkirakanmembawa lebih dari 1,1 juta penumpang. Al-Qudabi mengatakan inspektur pabean akan menggunakan teknik modern, termasuk mesin Sinar-X dan anjing pelacak di Bandara Internasional King Abdul Aziz di Jeddah dan pintu masuk lainnya. Para inspektur wanita akan dikerahkan di Bandara InternasionalKingAbdulAzizdiJeddah,BandaraPrinceMohammed bin Abdul Aziz di Madinah, Pelabuhan Islam Jeddah, dan pusat pabean darat lainnya. Paling banyak jenis barang yang disita para inspektur pabean selama musim Haji beberapa tahun lalu adalah obat-obatan, beberapa jenis tepung tak dikenal, kamera, makanan kadaluarsa dan beberapa jenis produk yang dibawa para jamaah dari berbagai negara dengan tujuan dagang. Departemen itu telah menyelesaikan pelatihan bagi 8.432 orang dalam tahun 2012, katanya. (an/gn/mujo)

Siapa ‘Janda Putih’ Yang Diduga Di Balik Terorime Di Mal Kenya SEORANG wanita kulit putih berkebangsaanInggrismendadak menjadi orang paling dicari di seluruh dunia. Namanya sebenarnya Samantha Lewthwaite, tetapi karenaberbagaikegiatannyayang misterius dia mendapat julukan ‘white widow’, atau ‘janda putih.’ Menurutbeberapasaksidiadiduga mendalangi aksi terorisme yang menyerangMalWestgatediKenya, akhir pekan lalu, karena ada yang melihat dia bersama putranya di lokasi peristiwa berdarah itu. SiapasebenarnyaSamantha? Wanita 29 tahun itu dilahirkan oleh pasangan Andy Lewthwaite dan Christine Allen. Ayahnya seorangtentaraInggrisdanibunya Katholik Irlandia. Masa kanakkanak Samantha dihabiskan di Banbridge,CoDown.Takadayang istimewa dari Samantha, dia melakoni masa kecil layaknya anakanak lain. Dia kemudian pindah ke Aylesbury.Tahun 1995,kedua orangtuanyabercerai.Takdiketahuiapa penyebabnya dan Samantha memutuskan masuk Islam di umur 17tahun.Kemudian,diamenikah denganGermaineLindsay,pemu-

da asal Jamaika. Mereka dikaruniai tiga orang anak. Sayang, keluarga mereka tak utuh lagi sejak tahun 2005. Germainemenjadimartirdalambom bunuhdiri di stasiun King’s Cross, London,Juli2005.Sekitar26orang tewasdalamkejadianitu.Samantha kemudian menghilang pada 2009 bersama anak-anaknya. Dua tahun kemudian, barulahdiamunculkembali.Rupanya, saat itu dia baru saja bepergian ke Kenya menggunakan paspor palsu. Samantha pun menjadi buron.NamasamarannyaNatalie Webb.Nama itu didapatnya dari seorang perawat Inggris. Dengan nama itu, Samantha menyewa setidaknya tiga properti diJohannesburg.Diatercatattinggal di Mayfair,sebuah lingkungan yang banyak dihuni masyarakat berkebangsaan Asia. Dia sempat bekerja sebagai ahli komputer di sebuah pabrik makanan halal. Samantha mendadak mengundurkan diri dari pekerjaannya setelah pejabat Kedubes AS datangmewawancarainya,tahun lalu. Webb alias Samantha juga dikejar utang. Dia terlilit utang

4.000poundsterlingdaribankdan toko pakaian. Namun,utangitudihapuskarena bank gagal melacak keberadaannya. Pemerintah Johannesburgmenyebutkan,merekamenemukan setidaknya dua ID yang berbedapadabeberapalisensimengemudi dan paspornya. Samanthaberkelitsepertibelut.Licin. Dia akhirnya kembali terlihat dalampenyerangandimalKenya, Sabtu(21/9)lalu.Seorangsaksimenyebutkan, seorang wanita kulit putih terlihat membawa senjata, bergabung dengan para teroris kelompokAl-Shabaab.Wanitaitu, didugaSamantha,ikutmenembaki orang-orang. Bersamanya, terlihat dua anak laki-laki berusia belasan tahun. Satu di antaranya terlihat mengenakanbandanadanmembawa sarung gitar tempat menyimpan pistol. Kesaksian itu dikukuh-kan oleh seorang tentara yang ikut mengamankan penyeranganitu.AksiterorismediKenya itumenewaskanlebihdari60orang. Kini, Samantha kembali menghilang. Interpol mengeluarkan‘surat perintah penangkapan’

untuk pencarian wanita itu. Seluruh negara diminta ikut mencarinya. Dikhawatirkan, Samantha memanfaatkan tiga anaknya untuk ‘berlindung’. Keluarga Samantha di Aylesbury tak percaya kerabat mereka terlibat penyerangan sadis itu. Elizabeth Allen, nenek Samantha bahkan sampai masuk rumah sakit.Menurutmereka,Samantha hanya wanita Inggris biasa yang takberkepribadianmencolok.Dia tipe pengikut, bukan pemimpin. Konselor Raj Khan, yang tahu persis kepribadian Samantha menyebutkan wanita itu terkesan menyenangkan dan sopan. Sama sekalitakkeraskepala.“Sayabe-narbenar takjub dia menjadi kepala organisasi teroris internasional,” katanyasepertidikutiplamanMirror. Niknam Hussain, mantan Walikota Aylesbburry pun menegaskan pihaknya berpendapat Samantha tak bersalah. Sampai ada bukti wanita itu terlibat, dia akan tetap beranggapan demikian.Mantanbosdipabrikmakanan tempat Samantha pernah bekerja pun berkomentar,dia wanitayangpendiam.(vn/bbc/r-m10)

Pentas Pilkada Pilkada DS Libatkan 4 Polres



Senin 30 September 2013

DELISERDANG ( Waspada): Polisi melibatan empat Polres Deliserdang, Polresta Medan, Polres Binjai dan Polres Belawan dibantu personel TNI dalam mengamankan pilkada Deliserda 23 Oktober nanti.

“Dalam pengamanan pilkada nanti akan dikerahkan atau melibatkan empat Polres Deliserdang, Polresta Medan, Polres Binjai dan Polres Belawan serta personel TNI,” kata Kepala Polres Deliserdang AKBP Dicky Patrianegara seusai menggelar

Seleksi Calon KPUD Batubara Terindikasi Kolusi Waspada/ Ibnu Kasir

MASYARAKAT berebut kalender Ngogesa di sela-sela Pesta Budaya di Bukitlawang, Sabtu (28/9).

RH Bangun: Demokrat Langkat Komit Menangkan Ngogesa-Sulistianto STABAT (Waspada): Segenap simpatisan dan kader Partai Demokrat Langkat tetap komit untuk mendukung dan memenangkan pasangan no. urut 4 Ngogesa Sitepu – Sulistianto sebagai calon bupati dan wakil bupati Langkat periode 20142019 mendatang. “Dalam Pilkada 23 Oktober nanti, ramai-ramai kita mendatangi Tempat Pemungutan Suara ( TPS) untuk mencoblos nomor 4,” tegas Rudi Hartono Bangun selaku Ketua PD Demokrat Kabupaten Langkat di hadapan seribuan warga yang hadir dalam acara Pesta Budaya Bukitlawang di Kec. Bahorok, Sabtu (28/9). Bangun yang juga caleg no.8 dari Demokrat untuk DPR-RI itu mengemukakan, masyarakat dalam pelaksanaan pilkada mendatang hendaknya tetap mengedepankan rasa kebersamaam.

“Langkat ini milik kita, daerah kita yang harus kita jaga ketertiban dan keamanannya dengan meningkatkan rasa kebersamaan dan kepedulian serta saling tolong menolong,” ujarnya seraya melantunkan sebait pantun yang berbunyi: Kalau Tuan Datang Ke Stabat, Itulah Dia Ibukota Kabupaten Langkat, Kalau Sudah Ada Nomor Empat, Itu Merupakan Pilihan Tepat. Ungkapan bait pantun tersebut mendapat aplaus meriah dari masyarakat yang hadir. Sebelumnya Ketua MUI Kecamatan Bahorok Hamdan AR bersama warga masyarakat berdoa bersama agar pasangan Ngogesa Sitepu-Sulistianto mendapat ridha Allah swt guna melanjutkan kepemimpinannnya di bumi Langkat yang religius ini. Hal senada juga dikemukakan Sidin, tokoh masyarakat dan

M Saidi pemuka agama setempat, secara tegas mendukung kepemimpinan Ngogesa agar dilanjutkan. Menurut mereka, Ngogesa merupakan pemimpin yang peduli masyarakat. “Beliau juga merupakan dermawan yang dilakoninya jauh hari sebelum menjadi bupati.” Sementara Ngogesa Sitepu yang juga Ketua Partai Golkar Kabupaten Langkat dengan nada haru mengucapkan ribuan terima kasih kepada komponen masyarakat di daerah ini yang sejak awal tetap mendukungnya untuk menjadi bupati Langkat. “Tanpa dukungan masyarakat, kami ini tidak ada apaapanya,” kata Ngogesa seraya berharap jelang pilkada 23 Oktober mendatang, masyarakat harus mengedepankan rasa kebersamaan, pilihan boleh beda, tapi persatuan diantara kita harus terjaga.(a01)

Jelang Pilkada Langkat Jauhkan Sikap Bermusuhan LANGKAT (Waspada): Cabup Langkat Ngogesa Sitepu mengajak segenap elemen masyarakat di daerahnya untuk terus berpartisipasi aktif dalam mendukung program pembangunan di tengah masih terbatasnya anggaran untuk menjawab tuntutan warga di kabupaten berpenduduk sekitar satu juta jiwa yang tersebar di 23 kecamatan tersebut. “Partisipasi aktif itu dapat diwujudkan dengan berbagai langkah nyata, di antaranya mengembangkan lahan pertanian untuk meningkatkan volume produksi padi,” kata Ngogesa Sitepu di Stabat, kemarin. Diakuinya, langkah tersebut sebenarnya sudah banyak direaliasikan oleh petani di Langkat, seperti petani di Sendayan Kecamatan Babalan dengan membangun sarana dan prasarana pertanian sehingga produktivitas hasil panen mereka semakin meningkat. Menurut dia, partisipasi aktif masyarakat lainnya dalam

menyikapi keterbatasan anggaran pembangunan juga dapat dilakukan dengan cara bergotong royong membangun daerah baik secara swadaya dan swadana. “Kita harus memaklumi, keterbatasan anggaran harus disikapi dengan kesiapan masyarakat memberikan sumbangsih moril dan materil bagi kebaikan daerah yang kita huni. Mudah-mudahan, dengan keikhlasan kita bekerja melayani kepentingan umum tentu akan bernilai ibadah dan amal kebaikan,” ucap Ngogesa. Ia menambahkan, Kabupaten Langkat pada 23 Oktober 2013 akan menggelar pemilihan kepala daerah (Pilkada) bupati dan wakil bupati periode 20142019. Terkait dengan momentum pilkada Langkat, Ngogesa yang merupakan salah seorang dari empat calon, mengharapkan doa dari warga setempat. Namun demikian, menjelang pilkada ia mengingatkan

seluruh komponen masyarakat di daerah itu agar senantiasa menjaga nilai-nilai persaudaraan dan menjauhkan sikap bermusuhan maupun saling mencederai. Sementara itu, tokoh masyarakat Sendayan Robert Panggabean, menilai, Bupati Langkat Ngogesa Sitepu selama ini telah menunjukkan kepedulian serta perhatian terhadap upaya memajukan pembangunan di daerah itu, termasuk di bidang pengembangan pertanian. “Sekarang ini hasil pertanian masyarkat bisa meningkat dari lima ton per hektare menjadi tujuh ton per hektare,” tambahnya. Kepedulian Pemkab Langkat di bawah kepemimpinan Ngogesa Sitepu juga banyak dirasakan warga Sendayan, antara lain pembangunan sarana sarana irigasi, pemberian bantuan benih padi dan meningkatkan kualitas jalan desa. (a01)

Komunitas Minang P. Brandan Hindari Golput PANGKALAN BRANDAN (Waspada): Komunitas suku Minang Pangkalanbrandan bertekad untuk menyukseskan pilkada Kab. Langkat pada Oktober 2013 ini. Mereka juga berkomitmen untuk tidak golput dan tetap mencoblos pasangan cabup-cawabup Langkat yang sesuai hati nurani. Komitmen itu diungkapkan beberapa pengurus komunitas suku Minang di Pangkalanbrandan yang menamakan

kelompoknya Persatuan Anak Dagang Minang Pangkalanbrandan kepada Waspada, Minggu (29/9). Ketua Persatuan Anak Dagang Pangkalanberandan S Jambak mengajak masyarakat Minang yang ada di Pangkalanberandan untuk tetap berpartisapasi politik dalam Pilkada Langkat nanti.Dia mengimbau kepada masyarakat Minang di Pangkalanbrandan untuk tidak golput dan tetap ikut memilih pasangan cabup-cawabup

sesuai hati nurani. Sementara salah seorang pengurus Persatuan Anak Dagang Pangkalanberanan Faizal juga melontarkan hal yang sama. Dikatakan, saat ini masyarakat Minang Pangkalanbrandan sudah pintar dalam memilih cabup yang layak memimpin demi kemajuan Langkat.”Bulatkan hati, pilihlah sesuai hati nurani demi memajukan Langkat,” ungkap Faizal. (c01)

Hari Ini Pleno Pembagian Divisi Empat Anggota KPU Sumut MEDAN (Waspada): Pemilihan Mulia Banurea menjadi Ketua KPU Sumatera Utara periode 2013-2018 berjalan penuh kekeluargaan. Mulia dipilih dalam rapat pleno internal yang dilakukan lima komisioner KPU Sumut yang baru dilantik di Jakarta, Kamis lalu. Hadir dalam pleno tersebut komisioner Nazir Salim Manik, Mulia Banurea,Yulhasni, Benget Silitonga, Evi Novida Ginting. “Pak Mulia Banurea yang terpilih jadi Ketua KPU Sumut,” kata Yulhasni, kemarin. Terpilihnya Mulia Banurea dilakukan secara aklamasi. Empat komisioner lainnya sepakat untuk menunjuk agar yang bersangkutan memimpin KPU Sumut. Pemilihannya sendiri menurutnya berjalan penuh kekeluargaan. Sebelumnya, Ketua KPU RI Sumut Husni Kamil Manik

mengatakan Mulia Banurea terpilih berdasarkan rapat yang diikuti lima komisioner di penghujung pembekalan komisioner baru di Jakarta, Jumat. “Yang terpilih Mulia Banurea,” kata Ketua Komisi Pemilihan Umum (KPU) RI Husni Kamil Manik melalui pesan singkatnya yang diterima di Medan, Jumat. Namun Husni Kamil Manik tidak menyebutkan proses pemilihan tersebut, apakah melalui pemungutan suara atau kesepakatan secara aklamasi. Menurut catatan, Mulia Banurea adalah Ketua GP Ansor Kabupaten Dairi yang juga Wakil Ketua KNPI Sumut. Mulia Banurea yang dihubungi melalui telepon genggamnya mengatakan, penentuan pimpinan KPU Sumut dilakukan melalui musyawarah

dan mufakat. Mengenai pembagian divisi untuk empat komisioner akan dilakukan dalam rapat pleno di kantor KPU Sumut di Medan. “Mungkin, Senin (30/9) nanti akan diplenokan,” katanya. Ketika ditanyakan tentang upaya peningkatan partisipasi yang diamanatkan KPU RI, Mulia menyatakan hal itu menjadi salah satu prioritas yang akan dilakukan. Untuk merealisasikan hal itu, pihaknya akan meningkatkan komunikasi kepada seluruh pemangku kepentingan. Ia mencontohkan komunikasi dengan unsur forum komunikasi pimpinan daerah dan pimpinan organisasi kemasyarakatan. “Begitu juga komunikasi dengan media, harus terus ditingkatkan,” katanya.(m13/ant)

LIMAPULUH (Waspada): Banyak warga memberikan penilaian negatif menjurus ‘kolusi’ terhadap tim seleksi (timsel) calon anggota KPUD Kab. Batubara yang menetapkan namanama peserta yang lolos 10 besar, Jumat (27/9) “Kita sudah menduga peserta calon seleksi yang lolos 10 besar tidak jauh dari ‘orang-orang itu jugo’ atau orang lama ditambah calon yang dekat dengan timsel,” kata Irwan, tokoh pemuda Batubara, Minggu (29/9) Menurut Irwan, ke-10 nama calon komisioner yang lolos yaitu Alhusai ni, Azhar Tanjung, Bahrul Ilmi, Khairil Anwar, Lidya Puspa Ningsih, M.Amin Lbs, Mukhsin Khalid, Mustafa, Ravlan Toni Batubara, Taufik Abdi Hidayat Irwan mengatakan kinerja timsel wajar diragukan karena tidak terdapat calon komisioner yang banyak mendapat sorotan masyarakat: tidak independen dan profesional serta berpihak kepada penguasa. Tanpa harus menyebutkan nama, ada calon komisioner memasang baliho untuk salah seorang cabup. Malahan dia dikontrak sebagai pengacara Pemkab Batubara. “Apakah dibolehkan tugas rangkap? Pemicu pelemparan kantor KPUD Batubara ada hubungan dengan calon yang disebut-sebut tidak layak masuk 10 besar. Untuk itu bagaimana nanti wibawa KPUD Batubara 5 tahun ke depan,” ujar Irwan. Selain itu di antara 10 nama yang lolos terindikasi kolusi, dua orang adik kandung dan adik ipar anggota timsel dan satu orang adik ipar “orang kuat” di Pemkab Batubara. Untuk itu, Irwan meminta KPU Sumut untuk lebih teliti meloloskan mereka menjadi lima besar. (a12)

Masyarakat Batubara Jangan Terprovokasi LIMAPULUH ( Waspada): Masyarakat diimbau tidak terprovokasi dengan kelompok tertentu karena KPUD Batubara menjamin dirinya bekerja berlandaskan peraturan, sedangkan bagi calon yang merasa keberatan sudah dipersilahkan mengajukan gugatan ke Mahkamah Konstitusi (MK). ‘’Jika ada calon yang merasakan keberatan atas putusan ini, silakan ajukan ke MK, kita tunggu,’’ kata Ketua KPU Kab Batubara Khairil Anwar kepada Waspada baru-baru ini. Dalam penetapan KPUD, OK Arya Zulkarnain - Harry Nugroho meraih suara terbanyak 65.899 atau 36,45 persen.(a13)

Penegak Hukum Agar Turun Tangan P.SIDIMPUAN (Waspada): Aparat penegak hukum diminta segera menangani kasus dugaan korupsi, kolusi, dan nepotisme (KKN) yang dilakukan tim seleksi (timsel) calon anggota KPUD kabupaten/kota se-Tabagsel, khusunya dalam menetapkan namanama peserta yang lolos 10 besar. “Jika orientasinya materi dan nepotisme, ini memalukan. Keputusan timsel cukup berdasar untuk dibatalkan. Jaksa dan polisi harus segera menyelidikinya,” kata Ketua Perhimpunan Advokat Indonesia (Peradi) Tabagsel Ridwan Rangkuti, Sabtu (28/9). Rangkuti menduga, permainan uang dan nepotisma dalam penentuan 10 besar calon anggota KPU kabupaten/kota se Tabagsel cukup kental sekali. Ketua Peradi Tabagsel berharap aparat penegak hukum untuk segera mengambil langkah penyelidikan terhadap dugaan KKN antara timsel dengan calon anggota KPU yangg lolos 10 besar. (a27)

Pilkada Serentak Jadikan MK Punya Waktu Adili Sengketa JAKARTA (Waspada): Pilkada serentak disimpulkan sangat memungkinkan menyelesaikan atau memperbaiki masalah yang kerap terjadi dalam pilkada. Salah satunya MK menjadi punya waktu khusus memproses pengujian undang-undang di luar pilkada/pemilu. Hal ini menjadi pembahasan diskusi “Quo Vadis RUU Pilkada? Menata Pemilu Indonesia Melalui Pilkada”, Jakarta (25/9). Menurut Veri Junaidi dari Purludem, pilkada serentak menjadi pilihan pemilu akan datang. “Jika pemilu dilakukan serentak, maka MK memiliki banyak waktu untuk menyelesaikan masalah lain (judicial review), di luar waktu sidang untuk menyelesaikan perselisihan pemilukada,” kata Veri. Mengingat keputusan kasus sengketa pilkada memiliki batasan waktu, sehingga jika pemilu serentak menjadi pilihan, maka MK tidak perlu sepanjang tahun menyidangkan kasus sengketa pilkada. Saat ini pembahasan tentang RUU Pemilu yang diharapkan sudah diselesaikan Komisi 2 DPR RI ternyata masih jalan di tempat. “Terdapat 2 pilihan untuk pelaksanaan pemilu serentak. Pertama, serentak dilaksanakan baik di tingkat daerah dan nasional, yang kedua bisa saja dibagi dalam 2 tahap, pemilu diadakan serentak di semua daerah saja, kemudian tahap kedua pemilu untuk tingkat nasional”, jelas Veri lebih lanjut. Diskusi yang digagas Perkumpulan untuk Pemilu dan Demokrasi (Perludem) ini menghadirkan: Prof Satya Arinanto (UI), Prof Syamsudin Haris (LIPI) dan Veri Junaidi dari Perludem. Pemilu serentak disepakati memberikan ruang yang cukup besar kepada masyarakat untuk menggunakan aspirasinya. (m13/ant)

pasukan di Lapangan Garuda, Tanjungmorawa, Sabtu (28/9). Apel siaga ini untuk menunjukkan kesiapan siagaan Polri/TNI dan instansi terkait dalam pengamanan Pilkada Deliserdang yang tergabung dalam Operasi Mantap Praja 2013. Menurut Kapolres, untuk memaksimalkan pengamanan dilakukan dua pola pengamanan yang ditentukan dari faktor kerawanan kriminalitas, kerawanan politik, dan kerawanan geografis. Kapolres komit akan mengamankan proses pilkada Deliserdang yang akan berlangsung pada 23 Oktober 2013 sampai selesai dengan penuh kesungguhan dan netralitas. Kapolres mengajak semua pihak berdoa serta berjanji untuk berupaya agar pesta demo-

krasi tersebut dapat berjalan dengan aman damai dan tentram, sesuai dengan harapan bersama. Pasangan cabup/cawabup agar turut menjaga keamanan pesta demokrasi itu. “Siapapun yang memenangkan pilkada nantinya diharapkan dapat meningkatan kesejahteraan masyarakat Deliserdang,” katanya. Lebih lanjut Kapolres memaparkan tentang pola pengamanan dengan menggunakan sistem 1:1 yakni satu TPS akan diawasi oleh seorang polisi dan pola kedua 1:2 yaitu satu polisi akan mengawasi dua TPS yang juga dibantu petugas linmas. Pilkada Deliserdang akan berlangsung 23 Oktober 2013 diikuti 11 pasangan calon

bupati-wakil bupati, yakni Ashari Tambunan-Zainuddin Mars yang diusung PAN, PKB, PBB, dan Gerindra. Selanjutnya pasangan Tengku Ahmad Thala’a-Hardi Mulyono (Golkar, PPP, Partai Patriot), FatmawatiTakrim-Subandi (Demokrat), Timbangen Ginting-Parningotan Sembiring (PDIP, PPRN, PDK, PKPI, PIS, Partai Buruh, Partai Kedaulatan, PKDI, dan PDS), dan Muhammad Idris-SatryaYudhaWibowo (PKS, Hanura). Sedangkan pasangan calon yang maju dari jalur perseorangan, yakni Harun NuhBambang Hermanto, Rabu Alam-Purnama Ginting, Eddy Azwar-Selamat, MusdalifahSyaiful Syafri, Sudiono-Haris Binar Ginting, dan SihabuddinNemaken Tarigan. (m13)

Alat Peraga Langgar Aturan Agar Ditertibkan MEDAN (Waspada): Badan Pengawas Pemilihan Umum (Bawaslu) Sumut meminta Parpol untuk menertibkan alat peraga kampanye yang melanggar aturan, sebelum diturunkan langsung oleh Pemda. Untuk itu, partai politik (Parpol) telah diberi waktu hingga 27 September 2013 agar secara sadar menertibkan alat peraga sendiri dan kadernya. Demikian disampaikan Pimpinan Bawaslu Sumut Bidang Pengawasan dan Humas A. Andri, Sabtu (28/9). Ditegaskannya, Peraturan Komisi Pemilihan Umum (PKPU) No.15/2013 tentang kampanye diundangkan 27 Agustus 2013 dan berlaku sebulan setelah diundangkan. “Bawaslu meminta seluruh Parpol menghormati dan menaati aturan,”ujarnya. Aturan kampanye, lanjutnya, sangat jelas menyebutkan yang bisa memasang alat peraga dalam bentuk baliho dan reklame hanya parpol.

Muatanya tentang nomor, visi-misi dan program, jargon dan gambar pengurus partai dan bukan calon anggota legislatif. “Fakta di lapangan, kita melihat ada baliho memuat calon anggota DPRD. Itu pelanggaran,” tegasnya. Berkaitan dengan itu, kata Andri, Bawaslu Sumut sudah mengirimkan surat edaran kepada Panwaslu se Sumut dan jajaranya untuk mengidentifikasi pelanggaran-pelanggaran pemasangan alat peraga kampanye di luar ruang antara lain, pemasangan di rumah ibadah, rumah sakit dan tempar pelayanan kesehatan, gedung milik pemerintah, lembaga pendidikan, jalan protokol dan jalan bebas hambatan serta sarana publik juga pepohonan. “Rekomendasi paling lama sudah dibuat sejak berlakunya aturan,” ucapnya. Guna penertiban tersebut, menurut Andri, dikoordinasikan dengan Pemko/Pemkab

se Sumut guna menurunkannya. Ketika ditanya mengenai belum adanya penetapan zona kampanye oleh KPU kabupaten/kota karena dalam aturan tersebut disampaikan, pemasangan spanduk calon legislatif hanya boleh di titik/zona yang sudah ditetapkan oleh KPU. Sedangkan ukuran maksimal spanduk 1,5 X 7 meter dan hanya satu di zona yang sudah ditetapkan. Sedangkan penetapan zona itu berdasarkan koordinasi KPU dengan pemerintah. “Kalau KPU lamban menentukan zona, bukan berarti kita ikut pula terbawa rendong. Aturanya sudah sangat jelas dan tegas. Turunkan,’’ katanya. Dia mengatakan, jika parpol tidak mengikuti aturan atau tidak memerintahkan kadernya menurunkan sendiri alat peraganya, Panwaslu akan merekomendasikan agar Pemda segera menurunkan alat peraga itu.(m34)

Pilih Cabup Deliserdang Yang Dapat Lanjutkan Konsep GDSM LUBUKPAKAM (Waspada): Masyarakat khususnya di Kecamatan Percut Seituan meminta masyarakat Deliserdang di semua kecamatan untuk memilih cabup dan cawabup yang dapat melanjutkan pembangunan yang sudah dilaksanakan Pemkab Deliserdang. “Kami merasakan dampak pembenahan dan pembangunan infrastruktur jalan, bahkan dalam sepuluh tahun terakhir berhasil membangun jalan kabupaten yang baru sepanjang 1995 km melalui program Gerakan Deliserdang Membangun (GDSM),” kata Edi, masyarakat Bandar Klipa, Percut Seituan, kemarin. Dia mengatakan percepatan pembangunan infrastruktur jalan di daerah itu cukup membanggakan, seiring dengan peluncuran GDSM. Dia kagum dan salut dengan jalan-jalan di Deliserdang yang tidak ada lagi yang tidak beraspal. Tidak hanya itu, lanjutnya, banyak penambahan jalan-jalan baru yang berdampak positif kepada peningkatankesejahteraandanekonomi masyarakat Deliserdang. Dia tahu persis kalau sebelum GDSM panjang jalan kabupaten hanya 1.317 Km, namun berkat partisipasi masyarakat kini telah terbuka ruas-ruas jalan kabupaten yang baru hingga

panjanganya mencapai 3.272 Km. Ia mengatakan berhasilnya pembukaan jalan-jalan baru tersebut juga tidak terlepas dari tingginya partisipasi masyarakat yang dengan kerelaan hatinya memberikan sebahagian lahannya untuk pembukaan ruas jalan. Berdasarkan rekapitulasi dinas terkait seluas 6 juta M2 lebih lahan masyarakat diberikan dengan cuma-cuma untuk pembangunan jalan. Jika dinominalkan luas lahan yang diserahkan masyarakat untuk pembangunan jalan sesuai dengan NJOP-nya, partisipasi masyarakat khusus untuk infra struktur jalan mencapai Rp215 miliar lebih. Ia mengatakan dalam percepatan pembangunan di Deliserdang, banyak program yang diluncurkan selain program GDSM, misalnya di bidang rehabilitasi gedung sekolah dengan program “cerdas” (percepatan rehabilitasi dan apresiasi terhadap sekolah). Sutrisno masyarakat Lau Dendang mengatakan pemerintah pusat juga sempat tersentak ketika akhir 2006, bupati Deliserdang Amri Tambunan berani memproklamirkan diri bahwa Deliserdang bebas dari sekolah tidak layak pakai.

Padahal, sebelum digulirkan konsep Cerdas, sekira 70 persen sekolah dasar dari 621 sekolah kondisinya cukup memprihatinkan karena tidak layak sebagai tempat proses belajar mengajar. Apalagi, katanya, Pemkab menyadari betapa pentingnya sarana pendidikan yang layak untuk anak bangsa sebagai generasi penerus. Sementara jika ingin memperbaiki seluruh sekolah dasar yang tidak layak pakai, dana pemerintah untuk itu tidak mencukupi. Makanya kerjasama antara pemerintah, masyarakat dan swasta sangat penting dalam peningkatan pembangunan. Sebagai warga, mereka mengajak masyarakat Deliserdang untuk memilih pemimpin yang sudah teruji dan meletakkan dasar pembangunan 10 tahun terakhir ini cukup berkesan bagi kemajuan Deliserdang. Menurut mereka, sosok pemimpin itu ada pada cabup no. urut 1 Ashari Tambunan dan Zainuddin Mars sebagai cawabup yang saat ini menjabat sebagai wakil bupati yang mendampingi Bupati Amri Tambunan menggerakkan konsep GDSM yang telah dinikmati masyarakat Deliserdangs sekarang. Cabup no. urut 1 juga figur yang bersahaja dan religius. (m13)

Cabup No. 1 Berludruk Dengan Masyarakat Lau Dendang PERCUT SEITUAN (Waspada): Calon Bupati Deliserdang no. urut 1 Ashari Tambunan, Minggu (29/9), dinihari berbaur dan menampung keluhan masyarakat untuk kelanjutan pembangunan Deliserdang. Pertemuan itu dikemas dengan sama-sama menyaksikan pertunjukan kesenian asal Jawa Timur “Ludruk” bersama masyarakat di Dusun III Desa Lau Dendang, Kec. Percut Seituan. Kehadiran cabup disambut masyarakat dengan antusias bahkan mereka tidak menyianyiakan kesempatan untuk bersalaman dengan cabup Ashari. Cabup Ashari Tambunan yang juga Ketua Nahdlatul Ulama Sumut dalam kesempatan itu mengatakan dirinya merasa bangga dapat menghadiri acara ini, karena dapat menguatkan hubungan silaturahim seluruh komponen ma-

syarakat dalam ikatan rasa kebersamaan melalui pertunjukan acara seni budaya tradisional.

Dikatakannya, seni budaya juga merupakan bagian dari pembangunan pembentukan karakter bangsa dalam peles-

Waspada/Khairul K Siregar

CABUP no. urut 1 Ashari Tambunan bersama masyarakat dalam acara pertunjukan kesenian Ludruk di Dusun III Desa Lau Dendang Kec. Percut Seituan, Minggu (29/9) dinihari.

tarian budaya yang harus tetap dipertahankan agar terus tumbuh dan berkembang, sesuai dengan tuntutan perkembangan zaman sebagai akibat pengaruh globalisasi di tengah masyarakat. “Kesenian Ludruk ini sangat luar biasa untuk menyatukan masyarakat Deliserdang,” kata Ashari yang berpasangan dengan H Zainuddin Mars sebagai calon wakil bupati (cawabup) yang saat ini menjabat sebagai wakil bupati. Ashari mengaku pagelaran seni budaya tradisional ini merupakan tontonan atau hiburan yang menarik, karena lakon cerita yang disampaikan bukan hanya sekadar tontonan tapi biasa juga menjadi tuntunan sehingga nantinya tuntunan itu bisa diterapkan di tengah tengah masyarakat. Ashari mengaku mendukung sepenuhnya acara ini dan

akan menjadikan program pengembangan seni budaya di Deliserdang untuk melawan arus globalisasi. Ashari memberikan apresiasi yang setinggitinggi kepada para pegiat seni budaya tradisional serta berharap untuk tetap semangat mengembangkan seni budaya sehingga seni budaya tradisional bisa terus tumbuh dan berkembang. “Saya berjanji akan melestarikan seni budaya ini dalam program pembangunan Deliserdang lima tahun ke depan. Untuk itu saya minta kebersa-maannya pada pilkada 23 Oktober mendatang,” katanya seraya pertemuan ini harus terus dipertahankan dan dipelihara dengan baik karena ini merupakan momentum berharga untuk mewujdkan impian melanjutkan pembangunan di Deliserdang. (crul/m13)


WASPADA Senin 30 September 2013

A5 Minggu, 29 September Rennes v Nantes


Sabtu, 28 September Lorient v Marseille Paris SG v Toulouse Evian v Bordeaux Sochaux v Valencs Nice v Guingamp Lyon v LOSC Lille St Etienne v Bastia

0-2 2-0 1-1 2-0 1-0 0-0 2-2

Klasemen Ligue 1


TRIO bintang Real Madrid (kiri ke kanan) Gareth Bale, Cristiano Ronaldo dan Isco, meratapi kekalahan timnya dari Atletico Madrid di Santiago Bernabeu, Minggu (29/9) dinihari WIB.

Madrid Pantas Menyerah MADRID (Waspada): Atletico Madrid mengakhiri laju 23 laga derbi tanpa kemenangan di La Liga Primera, Sabtu (Minggu WIB), ketika Diego Costa menyarangkan gol tunggal ke gawang pesaing sekota Real Madrid di Santiago Bernabeu. Menyusul kemenangan 2-1 pada final Piala Raja Spanyol di arena sama, Mei lalu, Atletico membuktikan potensinya dengan kemenangan tandang 1-0 pada jornada ketujuh bertajuk El Derbi Madrileno edisi ke-261 itu. Costa menorehkan gol kedelapannya di La Liga musim ini ke gawang Los Blancos. Bomber asal Brazil itu merangsek untuk mengejar operan Koke dan melesakkan bola melewati kiper Diego Lopez menit 11. Menurut superstar Cristiano Ronaldo, timnya memang pantas menyerah dari Los Rojiblancos. “Kami tidak bermain bagus, kami tidak

pantas menang. Atletico mencetak gol cepat dan memenangkan laga dengan baik,” papar bintang Portugal itu. “Kami tak merasa nyaman melawan mereka yang menumpuk pemain di belakang. Kami kesulitan mencetak gol, tapi kami tak boleh mendramatisir masalah ini,” tambah Ronaldo melalui, Minggu (29/9). Kekalahan ini membuat Madrid menjauh dari duet pemimpin klasemen, Atletico dan Barcelona. Juga menjadi pukulan serius jelang matchday 2 Liga Champions melawan FC Kopenhagen, Rabu (2/10) mendatang. “Kami harus terus bekerja dengan harapan bisa meraih

musim fenomenal. Kami tidak sempurna namun kami bukanlah tim yang buruk,” tekad Ronaldo. “Kami tetap harus menegakkan kepala, berjuang dan terus bekerja. Sebab kami memiliki banyak hal yang harus dimenangkan tahun ini,” klaim mantan winger Manchester United dan Sporting Lisbon tersebut. Seperti halnya Ronaldo, entrenador Carlo Ancelotti juga mengakui Madrid pantas menyerah, karena bermain sangat jauh dari harapan di saat Atletico tampil begitu solid. “Atletico Madrid pantas memenangkan pertandingan. Mereka sangat terorganisir dan solid dalam bertahan. Saya rasa Atletico dapat bersaing untuk gelar liga musim ini,” puji Ancelotti. Sukses ini sangat bersejarah bagi Los Rojiblancos, yang terakhir kali mengalahkan Los Blancos di liga 14 tahun silam, tepatnya pada 1999. “Kami lamban dalam serangan. Kami tak

punya pertandingan yang bagus,” ratap Ancelotti lewat Soccerway. “Kami harus bangkit dan terus berkembang, kendati kalah dalam sebuah laga kandang tidak mudah. Saya mesti memikirkan solusi, padahal kami bermain bagus hingga akhir pekan lalu,” tutur mantan pelatih Paris SG, Chelsea dan AC Milan tersebut. Atletico semestinya dapat menggandakan keunggulan pada sejumlah kesempatan. Gelandang Koke melepaskan tembakan melengkung yang membentur mistar gawang Lopes, sedangkan kiper Thibaut Courtois mampu menggagalkan upaya Alvaro Morata. “Ini akan menjadi sempurna secara demagogik untuk mengubah dinamika liga yang selalu dikuasai dua tim. Namun kekuatan ekonomi dari Barcelona dan Madrid jelas masih jauh lebih unggul,” sentil Diego Simeone, entrenador Atletico. “Itu yang membuat kami sulit untuk menantang mereka

Senin, 30 September (GMT) Granada v Ath Bilbao


Minggu, 29 September Osasuna v Levante


Sabtu, 28 September Valencia v Vallecano Almeria v Barcelona Sociedad v Sevilla Real v Atletico Madrid

1-0 0-2 1-1 0-1

Jumat, 27 September Valladolid v Malaga


selama satu musim penuh. Tapi kami juga punya senjata dan kami mencoba memberikan hidupkamidisetiappertandingan,” katanya lagi. Mantan punggawa Timnas Argentina itu menilai, loyalitas para pemainnya pantas mendapat acungan jempol, sehingga tidak terpengaruh kepindahan mesin gol Radamel Falcao ke AS Monaco. “Mereka bermain sangat bagus,” sanjung Simeone. (m15/ant/rtr/sport/sw)

Berharap Messi Main Lawan Celtic Klasemen La Liga Barcelona Atl Madrid Real Madrid Villarreal Bilbao Valencia Espanyol Levante Malaga Sociedad Getafe Celta Sevilla Valladolid Real Betis Granada Elche Almeria Osasuna Vallecano

7 7 7 6 6 7 6 7 7 7 6 6 7 7 6 6 6 7 7 7

7 7 5 4 4 4 3 2 2 1 2 1 1 1 1 1 0 0 1 1

0 0 1 2 0 0 2 4 3 4 1 3 3 3 2 2 3 3 0 0

0 0 1 0 2 3 1 1 2 2 3 2 3 3 3 3 3 4 6 6

24-5 21 19-5 21 14-7 16 12-6 14 12-10 12 10-10 12 10-7 11 6-11 10 11-6 9 6-8 7 7-10 7 7-9 6 11-13 6 6-9 6 6-7 5 3-5 5 5-10 3 10-17 3 5-13 3 5-21 3

MADRID (Waspada): Pemain terbaik dunia Lionel Messi harus keluar dari lapangan, Sabtu (MingguWIB), ketika baru bertanding 28 menit saat Barcelona menjinakkan Almeria 2-0 pada jornada tujuh La Liga Primera. Messi membuka keunggulan El Barca lewat tendangan kaki kiri cukup apik menit 21 di Juegos Mediterraneos. Tapi berselang tujuh menit, dia mengalami cedera otot paha belakang kaki kanannya hingga harus digantikan Xavi Hernandez. Bintang berusia 25 tahun itu akibatnya diragukan dapat mentas saat El Catalan menantang tuan rumah Celtic pada matchday dua Liga Champions, Selasa (1/10) malam.

Kendati demikian, Adriano Correa sebagai pencetak gol kedua Barca ke gawang Almeria menit 56, berharap sang bintang hanya cedera ringan dan bisa main di Celtic Park. “Semoga tidak ada masalah dengan Messi untuk pertandingan selanjutnya. Dia pemain penting dan mampu membuat perbedaan dalam tim,” ujar winger Adriano, seperti diberitakan AFP, Minggu (29/9). Messi absen dalam perjalanan Barca ke Malaga serta pada laga leg kedua Piala Super Spanyol melawan Atletico Madrid awal musim lalu, karena masalah pada pahanya tersebut. “Kami berharap tidak ada hal serius yang terjadi kepadanya dan akan segera bermain di laga

selanjutnya, karena Messi pemain penting,” timpal entrenador Gerardo ‘Tata’ Martino kepada AS. “Dengan dia, tim menjadi berbeda. Messi mengalami sedikit kejang otot di kaki kanannya saat mencetak gol. Saya belum bisa mengatakan apapun sebelum hasil pemeriksaan kondisinya selesai,” tambahnya. Tata kembali membuat perubahan dengan mencadangkan Neymar da Silva dan Xavi, kemungkinan agar keduanya memiliki kondisi fisik maksimal menjelang lawatan ke Glasgow. Almeria hanya sebentar mampu menahan gempuran Barca. Selain dari sepakan voli jarak jauh Andres Iniesta yang melayang di atas mistar gawang,

sampai Messi menguasai bola di sudut dekat sisi kanan dan berlari ke tepi kotak penalti. Dia memainkan umpan satu-dua dengan Pedro Rodriguez dan melepaskan tembakan kaki kiri melengkung ke tiang jauh gawang tim tuan rumah. Setelah menaikkan tempo serangan sebelum turun minum, Barca menggandakan keunggulannya di babak kedua. Cesc Fabregas memberi operan pada Adriano untuk diteruskan ke sudut gawang Almeria. Pada laga lainnya, Valencia meneruskan kebangkitannya dari start buruk musim ini dengan kemenangan 1-0 atas tim dasar klasemen Rayo Vallecano. (m15/ant/afp/as)

Main Lepas Kunci Praveen/Vita YOGYAKARTA (Waspada): Gelar ganda campuran YonexSunrise Indonesia Grand Prix Gold 2013 gagal direbut Tontowi Ahmad/Liliyana Natsir. Di final, sang juara dunia menyerah dari Praveen Jordan/ Vita Marissa. Tampil di GOR Amongraga, Minggu (29/9), Praveen/ Vita memaksa kompatriotnya itu bermain hingga set ketiga. Unggulan keenam tersebut pun menang 20-22, 21-9, 1421 dalam duel yang berdurasi 49 menit. Vita menjelaskan dirinya bersama Praveen bermain lepas tanpa beban menghadapi unggulan pertama tersebut. Tak hanya itu, Vita juga melihat Tontowi banyak melakukan kesalahan sendiri sepanjang pertandingan. “Hari ini kami bermain lebih santai, di pertemuan sebelumnya sempat rubber set, jadi kami pikir peluang kami ter-


JUARA dunia Tontowi Ahmad/Liliyana Natsir (kiri) kali ini harus mengakui keunggulan Praveen Jordan/Vita Marissa (kanan) di final Yonex-Sunrise Indonesia Grand Prix Gold 2013, Minggu (29/9). buka. Selain itu, titel Juara Dunia 2013 milik Tontowi/Liliyana juga sedikit membuat kami jadi lebih lepas. Tontowi juga banyak sekali melakukan kesalahan sendiri,” papar Vita. “Sebagai pemain muda, saya tampil tanpa beban. Kemena-

ngan ini menjadi motivasi untuk saya bisa lebih baik lagi, membuat saya makin yakin,” sambung Praveen. Dengan kemenangan ini, Praveen/Vita membuat rekor pertemuan dengan Tontowi/ Liliyana imbang 1-1. Bagi Ton-

towi/Liliyana, kekalahan tersebut minimal mengingatkan mereka untuk segera berbenah diri. “Sebenarnya hasil ini sudah saya prediksi. Karena sejak World Championships kami tidak bertanding cukup lama, persiapan juga kurang. Apalagi

sejak babak pertama kami belum bertemu lawan berat. Waktu ketemu mereka (Praveen/ Vita), saya sudah tahu ini akan jadi pertandingan berat. Ternyata benar,” ungkap Liliyana juga mengingatkan Tontowi harus banyak introspeksi. Di final ganda putra, unggulan kedua Angga Pratama/ Rian Agung Saputro mengakhiri kejutan Ronald Alexander/Selvanus Geh 17-21, 21-15, 21-16. Ini merupakan gelar ketiga bagi Angga/Rian setelah New Zealand dan Australia. Simon Santoso sukses mengunci kemenangannya di tunggal putra sekaligus meraih gelar pertamanya tahun ini, setelah mengalahkan Dionysius Hayom Rumbaka 21-17, 21-11. Dua titel yang lepas dari genggaman Indonesia terjadi di tunggal dan ganda putri. Tunggal dijuarai Di Suo dan Dongping Huang/ Yi Fan Jia (China) tampil sebagai jawara ganda. (m33/tsw)

Adi Katompo Kuasai Seri I Menpora Minta Equestrian Akhiri Polemik BANTEN (Waspada): Rider senior Adi Katompo sukses membuktikan ketangguhannya dengan tampil sebagai peserta terbaik kelas bergengsi FEI World Cup Jumping SEA League seri pertama di APM Equestrian Center, Tigaraksa, Tangerang, Minggu (29/9). Dengan menunggang kuda APM Nastello, Adi sempat tertinggal dalam catatan waktu dari Ferry Wahyu Hadianto (Arthayasa Equinara) yang membukukan waktu 69,58 detik. Akan tetapi, saat keduanya kembali turun gelanggang, Ferry melakukan delapan kesalahan. Sebaliknya, Adi justru tampil lebih baik dengan hanya membuat satu kesalahan. “Saya tidak menyangka atas hasil ini. Ini kejutan karena saya baru sekitar 1,5 bulan bersama APM Nastello. Terima kasih kepada ibu Triwatty Mar-

ciano (Sekjen EFI) yang telah mendukung saya dengan APM Nastello,” kata Adi usai pengalungan medali, Minggu (29/9). “Pada seri kedua dan ketiga di Thailand, saya bakal absen karena terbentur regulasi. Sebab, kuda yang akan saya gunakan harus masuk karantina lebih dahulu di Malaysia selama tiga bulan, sehingga waktunya tidak memungkinkan ikut dua seri tersebut,” papar Adi. Pada seri pertama kejuaraan dunia jumping kali ini, Alvaro Menayang dengan kuda Pottenvilla dari Gading Equestrian Team menyelesaikan lomba dengan waktu 73,71 ditambah 8 angka kesalahan. Alvaro disusul Ferry Wahyu dan Adi. Setelah itu, giliran Manfred Schidt (kuda APM Serafina) menjadi peserta terbaik kelas CSI 1* (135) dengan waktu 75,58 detik/8 kesalahan. Penunggang

kuda dari Bala Turangga, Denkavkud TNI AD, Parongpong, Lembang, Jawa Barat, kembali merajai kelas show jumping 100cm, yakni Serda Jamhur Hatta (kuda Sandoz). Dalam sambutannya pada acara pembukaan, Menpora Roy Suryo meminta semua pihak menghentikan polemik terkait atlet yang akan dikirim ke SEA Games 2013 di Myanmar, Desember mendatang. “Saya akan menegakkan aturan. Memang untuk pengiriman atlet ke SEA Games berada di bawah wewenang KOI (Komite Olimpiade Indonesia). Namun kami akan direct agar semua berjalan sesuai aturan,” tegas Roy. Sebelumnya beredar rumor cabang equestrian adalah salah satu cabang di mana pengiriman atletnya masih ditunda KOI. Kabarnya, upaya itu dilakukan

Waspada/Yuslan Kisra

RIDER Adi Katompo dengan kuda APM Nastello bersama Sekjen EFI Triwatty Marciano dan Manajer Timnas Equestrian Indonesia di SEA Games 2013 Prasetiana Sumiskum, Minggu (29/9). karena KOI masih keukeuh agar digelar kualifikasi ulang sebagai buntut dualisme dalam tubuh

equestrian Indonesia dengan dibentuknya Eqina Pordasi. (yuslan)

Paris SG AS Monaco Marseille Lille Nice Nantes St-Etienne Rennes Lyon St Reims Bastia Evian TG Toulouse Guingamp Montpellier Bordeaux Lorient Ajaccio Sochaux Valencs

8 7 8 8 8 8 8 8 8 7 8 8 8 8 7 8 8 7 8 8

5 5 5 4 4 4 4 3 3 2 2 2 2 2 1 1 2 1 1 1

3 2 2 2 2 1 1 3 2 4 3 3 3 2 5 4 1 3 2 0

0 0 1 2 2 3 3 2 3 1 3 3 3 4 1 3 5 3 5 7

12-4 18 13-3 17 12-5 17 8-4 14 11-9 14 11-8 13 11-9 13 8-7 12 12-7 11 5-4 10 7-10 9 10-14 9 6-10 9 10-10 8 8-10 8 7-11 7 6-11 7 5-8 6 6-14 5 4-14 3


PENYERANG PSG Zlatan Ibrahimovic (atas) menekuk bek Toulouse Abel Aguilar di Parc des Princes, Paris, Minggu (29/9) dinihari WIB.

Pesan Les Parisiens PARIS (Waspada): Juara bertahan Paris SaintGermain menyampaikan pesan khusus kepada para pesaingnya, Sabtu (MingguWIB), saat menekuk Toulouse 2-0 pada matchday delapan Ligue 1 Prancis. Sempat tersendat pada awal musim, Les Parisiens menunjukkan bahwa mereka tidak lelah untuk terus mendikte musuh sekaligus memburu kemenangan. “Saya memberikan pesan kepada pemain bahwa kami harus mengontrol laga, kendati

mengalami kelelahan,” beber Laurent Blanc, pelatih PSG, seperti dikutip dari Goal, Minggu (29/9). “Malam ini terlihat ada pemain yang memang masih mengalami kelelahan, tapi ada pemain yang masih terlihat segar,” tambah bek legendaris Prancis tersebut. Marguinhos membuka keunggulan Les Parisiens menit 41 di Parc des Princes. Striker anyar Edinson Cavani kemudian memantapkannya menit 79 melalui eksekusi penalti. “Terpenting hasilnya sama, tiga poin. Laga di Valenciennes berharga tiga poin, begitu juga MESIN gol Barcelona Lionel Messi ‘dikeroyok’ pemain Almeria di di Juegos Mediterraneos Stadium, Minggu (29/9) dinihari WIB. -AP-

dengan laga ini. Dari dua partai kami mendapatkan enam poin, ini merupakan hasil yang bagus.,” klaim Blanc. “DiValenciennes, saya mengatakan itu merupakan sebuah hasil yang sangat memuaskan, karena sisanya berlangsung tidak bagus,” lanjut mantan pelatih Girondins Bordeaux tersebut. Dengan kemenangan kandang ini, Blanc meyakini pasukan Les Parisiens sudah memperbaiki kesalahan yang dilakukan pada awal musim. Cavani cs pun plong dalam persiapan menjamu SC Benfica pada matchday dua Liga Champions, Rabu (2/10) malam. “Kami menjalani banyak pertandingan, satu laga dalam tiga hari, tentu sulit untuk mencapai 100 persen pada setiap pertandingan,” ucap striker Zlatan Ibrahimovic. “Tapi kami mempersiapkan diri dengan baik dan berusaha untuk membuat keseimbangan antara latihan dan pertandingan. Toulouse tim bagus dan selalu sulit melawannya, tapi kami berusaha menang dan mendapatkannya,” pungkas Ibra. (m15/goal/afp/espn)



WASPADA Senin 30 September 2013

Ramsey Luar Biasa LONDON (Waspada): Manajer Arsene Wenger memuji penampilan Aaron Ramsey (foto), yang kembali mencetak gol kemenangan Arsenal saat melibas Swansea City 2-1 di Liberty Stadium. “Pada laga tadi, dia sempat kesulitan di awal, tapi akhirnya Ramsey berkembang menjadi lebih kuat dan kuat. Lalu Ramsey menjadi luar biasa di babak kedua,” beber Wenger, seperti dilansir Sky Sports, Minggu (29/9). Menurut The Professor, gelandang Wales itu telah menunjukkan kapasitasnya sebagai salah satu pemain muda terbaik The Gunners. Ramsey malah telah mencetak delapan gol di semua ajang musim ini, hanya dari 10 percobaan. “Dia bermain sangat kooperatif ketika melawan Swansea. Sangat penting untuk tetap menjaga fokus dan kamu harus bisa berkembang serta meningkat dari hari ke hari. Kami sedang fokus ke arah sana,” klaim We-

nger. Berkat gol demi gol Ramsey dan kemenangan atas Si Angsa Putih pada matchday enam Liga Premier, Sabtu (Minggu WIB), Meriam London kini sendirian memimpin di puncak klasemen dengan koleksi 15 poin. Luar biasa, mengingat laskar Wenger sempat mengalami pukulan awal ketika dipecundangi AstonVilla pada partai pembuka liga di Emirates Stadium. Di Liberty Stadium, Arsenal pun menunjukkan kelas hebatnya pasca mengalami kebuntuan sepanjang babak pertama. Pemain muda Serge Gnarby yang membuka keunggulan Gunners menit 58, yang digandakan Ramsey menit 62. Swansea memperkecil ketinggalan pada menit 82 melalui

gol Benjamin Davies. Kekalahan membuat Angsa Putih asuhan Michael Laudrup rawan tertarik ke zona degradasi. “Saya pikir ini menjadi faktor penting sukses tim sepanjang awal musim. Bagaimana memanfaatkan peluang yang ada dengan meraih kemenangan, saat sejumlah tim pesaing lain menelan kekalahan,” ujar Wenger. Kebahagian pelatih asal Prancis itu memang makin lengkap, sebab para rivalnya di papan atas gagal meraih hasil positif. Chelsea bermain seri dengan Tottenham Hotspur, Manchester United dan Manchester City masing-masing dipecundangi West Bromwich dan Aston Villa. “Itu kejutan dan sempat sedikit menambah tekanan kepada kami. Kami akan merasa bersalah jika tidak bisa memanfaatkan situasi ini dan gagal memperkuat posisi di klasemen,” sindir Wenger. “Saya kemudian senang,


Klasemen Liga Premier Arsenal 6 Tottenham 6 Chelsea 6 Southampton 6 Man City 6 Liverpool 5 Hull 6 Everton 5 Aston Villa 6 West Brom 6 Cardiff 6 Man United 6 Swansea 6 Stoke 5 Newcastle 5 West Ham 6 Norwich 5 Fulham 6 C Palace 6 Sunderland 5

5 4 3 3 3 3 3 2 3 2 2 2 2 2 2 1 1 1 1 0

0 1 2 2 1 1 1 3 0 2 2 1 1 1 1 2 1 1 0 1

1 1 1 1 2 1 2 0 3 2 2 3 3 2 2 3 3 4 5 4

13-7 15 6-2 13 7-3 11 5-2 11 14-7 10 5-3 10 6-7 10 6-4 9 9-8 9 6-5 8 6-7 8 8-8 7 8-9 7 4-5 7 5-8 7 4-5 5 3-6 4 4-9 4 4-10 3 3-11 1

tapi ini masih awal kompetisi. Jangan lupa kami sempat berada dalam krisis besar-besaran setelah pertandingan pertama (dipukulVilla 1-3),” pungkas The Professor. (m15/vvn/sky/rtr)


BEK Milan Phileppe Mexes memanjat badan kawan-kawannya ketika merayakan gol gelandang Valter Birsa ke gawang Sampdoria di Stadion San Siro, Minggu (29/9) dinihari WIB.

Modal Minimal Milan MILAN, Italia (Waspada): Setelah melewati tiga laga tanpa kemenangan di Liga Seri A, AC Milan akhirnya lega karena menang tipis 1-0 atas tamunya Sampdoria pada giornata tujuh di Stadion San Siro. Modal minimal itu bahkan dianggap sangat berarti bagi allenatore Massimiliano Allegri, terkait lawatan Milan ke Amsterdam untuk menantang Ajax pada matchday dua Liga Champions besok malam di Arena. “Saya memiliki skuad yang bagus, tapi memulai dengan buruk di Seri A. Kami sudah kembali ke jalur, kini kami menyiapkan diri untuk Liga Champions dan kemudian Juventus,” tutur

Allegri, seperti dilansir Tribal Football, Senin (29/9). “Kami memenangkan pertandingan sulit dan penting. Kami membutuhkan kemenangan ini setelah tiga laga sebelumnya hanya memetik dua poin,” tambah pria berusia 46 tahun itu. Tidak diperkuat beberapa pemain pentingnya, termasuk striker Mario Balotelli yang terkena hukuman skorsing, I Rossoneri gagal tampil baik. Gol tunggal penentu kemenangan Milan disarangkan gelandang Valter Birsa menit 46. Tiga menit setelah meraih keunggulan, Robinho menyianyiakan operan sempurna Andrea Poli dengan melepaskan tembakan lurus ke kiper Sampdoria Angelo Da Costa di depan gawang.

Il Samp asuhan Delio Rossi hanya menawarkan sedikit semangat juang, sehingga lebih menguntungkan Setan Merah. “Kami menjaga clean sheet dan tidak membiarkan lawan menciptakan peluang, kecuali sundulan pada babak pertama,” klaim Allegri. Mantan arsitek Cagliari itu tak lupa memuji Birsa, winger 27 tahun yang diboyong Rossoneri pada bursa transfer musim panas dari Genoa sebagai bagian pertukaran dari Luca Antonini. “Dia (Birsa) pemain dengan teknik bagus, yang telah bermain apik melawan Bologna dan Napoli. Dia datang dari Genoa pada saat terakhir dan hanya sedikit yang mengenalnya. Namun dia bisa membuktkan diri di Milan,” puji Allegri. (m15/okz/tf/fi)

Pandev Cemerlang Albiol Cedera ROMA (Waspada): Goran Pandev memborong dua gol dalam rentang waktu 11 menit, Sabtu (Minggu WIB), yang membawa Napoli ke puncak klasemen Liga Seri A melalui kemenangan 2-0 di markas Genoa. Penampilan cemerlang bintang kemenangan I Partenopei itu di Luigi Ferraris Stadium, justru datang saat dia bermain di belakang penyerang tengah. Posisi ini memang dia minta langsung kepada allenatore anyar Rafael Benitez. “Saya mengatakan kepadanya bahwa tidak ada perkecualian. Dia (Pandev) bermain di tengah dan dia harus mencetak gol, dia melakukannya,” jelas Benitez, seperti dilansir Reuters, Minggu (29/9). Napoli memulai duel tandang ini dengan dua penyerang Gonzalo Higuain dan Marek Hamsik menghuni bangku pemain cadangan. Benitez melakukan ini, sebab Partenopei akan melawat ke markas Arsenal di ajang Liga Champions besok malam di Emirates Stadium. Pandev mencetak gol menit 14 dan 25, membuat timnya unggul satu angka atas tim peringkat kedua AS Roma, yang menjamu Bologna dinihari tadi di Stadion Olimpico.”Malam ini kami bermain benar-benar baik dan layak untuk menang,” papar Pandev. “Kami benar-benar menginginkan tiga angka, setelah malam yang mengerikan pada Rabu lalu. Namun malam-malam itu dapat terjadi pada siapapun,” tambah bintang Macedonia itu. Genoa membuat tim tamu berada di bawah tekanan sepanjang babak kedua. Penyebabnya bek Raul Albiol mengalami cedera, sehingga digantikan Paolo Cannavaro pasca turun minum. Cedera Albiol, yang dibeli Napoli dari Real Madrid, Agustus lalu, menjadi kekhawatiran bagi Benitez, ketika berniat untuk memuncaki klasemen Grup F Liga Champions dengan membidik kemenangan di markas Meriam London. Pria Spanyol itu juga sempat dikritik pada pertengahan pekan lalu, ketika dia merotasi timnya hingga Napoli hanya bermain 1-1 saat menjamu tim papan bawah Sassuolo di San Paolo. Padahal, Sassuolo akhir pekan lalu baru digasak tamunya Inter Milan 0-7. (m15/ant/rtr/afp) BEK Napoli Raul Albiol cedera setelah duel dengan pemain Genoa di Luigi Ferraris Stadium. -AP-

Garuda Jaya Termotivasi SUGBK Kualifikasi Piala AFC U-19 JAKARTA ( Waspada): Babak kualifikasi Grup G Piala AFC U-19 akan digelar 8-12 Oktober mendatang di Stadion Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta. Laga penyisihan awalnya akan digelar di Stadion Gelora Delta Sidoarjo, namun dipindahkan oleh Badan Tim Nasional (BTN). Pelatih Timnas U-19, Indra Sjafri, mengaku tidak keberatan dengan keputusan BTN tersebut. Sebaliknya, Indra malah mengaku senang atas kepindahan lokasi pertandingan. Setelah menjuarai Piala Antara AFF U-19, Evan Dimas cs tidak bisa berpuas hati karena ba- WINGER Timnas U-19, Maldini (tengah), bersama rekanbak kualifikasi Piala AFC U- rekannya menghadapi ujian lagi saat bertarung di ajang kualifikasi Grup G Piala AFC U-19 di Jakarta, 8-12 Oktober 19 sudah di depan mata. Tim besutan Indra Sjafri mendatang. tergabung di dalam Grup G bersama Korea Selatan, Fili-pina, dan Laos. Jadwal Kualifikasi Grup G AFC U-19 Pada laga pertama, Garuda Jaya akan ditantang Selasa (8/10) Laos pada 8 Oktober nanti. Dua hari kemudian, 15.30 WIB Korsel vs Filipina Indonesia berhadapan dengan Filipina dan 19.30 WIB Indonesia vs Laos selanjutnya menantang Korea Selatan. Kamis (10/10) Untuk bertanding di ajang tersebut, Timnas 15.30 WIB Laos vs Korsel U-19 masih melakukan Training Centre (TC) 19.30 WIB Filipina vs Indonesia dan seleksi di Sidoarjo. Pada Rabu (2/10), Indra Sjafri dan pasukannya akan tiba di Jakarta. Terkait Sabtu (12/10) kepindahan ke Senayan, Indra menilai hal itu 15.30 WIB Laos vs Filipina 19/30 WIB Korsel vs Indonesia akan menambah motivasi anak-anak asuhnya untuk bermain lebih baik. “Tidak ada masalah, malahan kami senang bisa bermain di stadion sebesar SUGBK,” ungkap bisa main di Jakarta. Anak-anak sangat tertarik Indra. (m33/goal)



WASPADA Senin 30 September 2013

Senin, 30 September (GMT) Everton v Newcastle



Minggu, 29 September Stoke v Norwich Sunderland v Liverpool

0-1 -

Sabtu, 28 September Aston Villa v M City Fulham v Cardiff Hull v West Ham MU v West Bromwich Southampton v Palace Swansea v Arsenal Tottenham v Chelsea

3-2 1-2 1-0 1-2 2-0 1-2 1-1

Klasemen Liga Premier


BINTANG kemenangan Juve Paul Pogba (kanan) merayakan golnya dengan allenatore Antonio Conte di Olympic Stadium, Turin, Minggu (29/9).

Hasil Siaga Satu Juve Senin, 30 September (GMT) Fiorentina v Parma


Minggu, 29 September Torino v Juventus Atalanta v Udinese Cagliari v Inter Milan Catania v Chievo Sassuolo v Lazio Hellas v Livorno AS Roma v Bologna

0-1 2-0 1-1 2-0 2-2 2-1 -

Sabtu, 28 September Genoa v Napoli Milan v Sampdoria

0-2 1-0

Klasemen Liga Seri A Napoli Juventus AS Roma Inter Milan Fiorentina SS Lazio Hellas Livorno AC Milan Torino Cagliari Udinese Atalanta Parma Genoa Catania Chievo Bologna Sampdoria Sassuolo

6 6 5 6 5 6 6 6 6 6 6 6 6 5 6 6 6 5 6 6

5 5 5 4 3 3 3 2 2 2 1 2 2 1 1 1 1 0 0 0

1 1 0 2 1 1 1 2 2 2 4 1 0 2 1 1 1 3 2 2

0 0 0 0 1 2 2 2 2 2 1 3 4 2 4 4 4 2 4 4

14-4 16 11-4 16 12-1 15 16-3 14 11-6 10 11-10 10 9-9 10 8-6 8 11-10 8 8-8 8 8-9 7 7-8 7 8-10 6 6-9 5 5-10 4 4-10 4 5-12 4 7-11 3 4-11 2 4-18 2

TURIN, Italia (Waspada): Juventus mengamankan poin penuh dengan menjinakkan Torino 1-0 dalam derbi Turin pada giornata keenam Liga Seri A, Minggu (29/9). Ini merupakan hasil nyata dari sikap ‘Siaga Satu’ yang diperintahkan allenatore Antonio Conte kepada anak-anak Nyonya Tua, sebelum duel sekota di Olympic Stadium tersebut. “Kami sadar derbi selalu berbeda. Saya ingat tahun (199495) saat kami memenangi gelar juara, tapi kalah dua kali lawan Torino,” kenang Conte, yang saat itu menjadi centrocampista Super Juve. “Buku statistik harus dibuang saat hadapi derbi dan kami mesti tetap siaga satu. Semua bisa saja terjadi,” tambahnya dalam Tuttor-Sport. Juve pun terus memperkuat benteng pertahanannya, kendati tampil menyerang sepanjang laga. Setelah bermain tanpa gol hingga turun minum, Kwadwo Asamoah hampir membuka keunggulan tim tamu menit 52. Namun tendangan Asamoah masih mampu diblok kiper Torino Danielle Padelli. Berselang dua menit, The Old Lady akhirnya mampu memecah kebuntuan melalui sundukan Paul Pogba. Memanfaatkan sepak pojok, Pogba me-

Modal Minimal Milan MILAN, Italia (Waspada): Setelah melewati tiga laga tanpa kemenangan di Liga Seri A, AC Milan akhirnya lega karena menang tipis 1-0 atas tamunya Sampdoria pada giornata tujuh di Stadion San Siro. Modal minimal itu bahkan dianggap sangat berarti bagi allenatore Massimiliano Allegri, terkait lawatan Milan ke Amsterdam untuk menantang Ajax pada

matchday dua Liga Champions besok malam di Arena. “Saya memiliki skuad yang bagus, tapi memulai dengan buruk di Seri A. Kami sudah kembali ke jalur, kini kami menyiapkan diri untuk Liga Champions dan kemudian Juventus,” tutur Allegri, seperti dilansir Tribal Football, Senin (29/9). “Kami memenangkan pertandingan sulit dan penting. Kami membutuhkan kemenangan ini setelah tiga laga sebelumnya hanya memetik dua

nanduk bola liar di depan gawang Il Toro untuk menaklukkan Padelli. “Kami memiliki rasa hormat yang luar biasa kepada mereka (Torino). Mereka tim yang luar biasa dengan pemain-pemain yang bagus,” ucap Conte. Kekalahan ini semakin menambah panjang rekor buruk Torino melawan tim sekotanya itu dalam kurun waktu 18 tahun. Torino belum pernah menga-

lahkan Super Juve di pentas Seri A sejak 1995 silam. “Pada akhirnya memang kami dapat tampil lebih baik, termasuk saya sendiri. Kini saya mesti memaksakan diri untuk lebih siaga, karena pintu keluar bisa terbuka kapan saja,” beber kiper Gianluigi Buffon. Kiper utama sekaligus kapten Juve itu mengatakan demikian, setelah gawangnya kebobolan terus dalam empat laga sebelumnya melawan Hellas Verona, Chievo Verona dan Inter Milan. “Kami tampil lebih bagus dan memulai duel dengan baik pula. Jujur saja, kami selalu ke-

DUA penyerang Dortmund, Marco Reus (atas) dan Robert Lewandowski, masing-masing menyarangkan dua gol ke gawang Freiburg.

5 4 3 3 3 3 3 2 3 2 2 2 2 2 2 2 1 1 1 0

0 1 2 2 1 1 1 3 0 2 2 1 1 1 1 1 2 1 0 1

1 1 1 1 2 1 2 0 3 2 2 3 3 3 3 2 3 4 5 4

13-7 15 6-2 13 7-3 11 5-2 11 14-7 10 5-3 10 6-7 10 6-4 9 9-8 9 6-5 8 6-7 8 8-8 7 8-9 7 4-6 7 4-6 7 5-8 7 4-5 5 4-9 4 4-10 3 3-11 1

LONDON (Waspada): Manajer Arsene Wenger memuji penampilan Aaron Ramsey (foto), yang kembali mencetak gol kemenangan Arsenal saat melibas Swansea City 2-1 di Liberty Stadium. “Pada laga tadi, dia sempat kesulitan di awal, tapi akhirnya Ramsey berkembang menjadi lebih kuat dan kuat. Lalu Ramsey menjadi luar biasa di babak kedua,” beber Wenger, seperti dilansir Sky Sports, Minggu (29/9). Menurut The Professor, gelandang Wales itu telah menunjukkan kapasitasnya sebagai salah satu pemain muda terbaik The Gunners. Ramsey malah telah mencetak delapan gol di semua ajang musim ini, hanya dari 10 percobaan. “Dia bermain sangat koo-

Ramsey Luar Biasa peratif ketika melawan Swansea. Sangat penting untuk tetap menjaga fokus dan kamu harus bisa berkembang serta meningkat dari hari ke hari. Kami fokus ke arah sana,” klaim Wenger. Berkat gol demi gol Ramsey dan kemenangan atas Si Angsa Putih pada matchday enam Liga Premier, Sabtu (Minggu WIB), Meriam London kini sendirian memimpin di puncak klasemen dengan koleksi 15 poin. Luar biasa, mengingat laskar Wenger sempat mengalami pukulan awal ketika dipecundangi AstonVilla pada partai pembuka liga di Emirates Stadium. Di Liberty Stadium, Arsenal pun menunjukkan kelas hebatnya pasca mengalami kebuntuan sepanjang babak pertama. Pemain muda Serge Gnarby yang membuka keunggulan Gunners menit 58, yang digandakan Ramsey menit 62. Swansea memperkecil ketinggalan pada menit 82 melalui gol Benjamin Davies. Kekalahan membuat Angsa Putih asuhan Michael Laudrup rawan tertarik ke zona degradasi.

“Saya pikir ini menjadi faktor penting sukses tim sepanjang awal musim. Bagaimana memanfaatkan peluang yang ada dengan meraih kemenangan, saat sejumlah tim pesaing lain menelan kekalahan,” ujar Wenger. Kebahagian pelatih asal Prancis itu memang makin lengkap, sebab para rivalnya di papan atas gagal meraih hasil positif. Chelsea bermain seri dengan Tottenham Hotspur, Manchester United dan Manchester City masing-masing dipecundangi West Bromwich dan Aston Villa. “Itu kejutan dan sempat sedikit menambah tekanan kepada kami. Kami akan merasa bersalah jika tidak bisa memanfaatkan situasi ini dan gagal memperkuat posisi di klasemen,” sindir Wenger. “Saya kemudian senang, tapi ini masih awal kompetisi. Jangan lupa kami sempat berada dalam krisis besar-besaran setelah pertandingan pertama (dipukulVilla 1-3),” pungkas The Professor. (m15/vvn/sky/rtr)

Pandev Cemerlang Albiol Cedera

BEK Milan Phileppe Mexes memanjat badan kawan-kawannya ketika merayakan gol gelandang Valter Birsa ke gawang Sampdoria di Stadion San Siro, Minggu (29/9) dinihari WIB.

ROMA (Waspada): Goran Pandev memborong dua gol dalam rentang waktu 11 menit, Sabtu (Minggu WIB), yang membawa Napoli ke puncak klasemen Liga Seri A melalui kemenangan 2-0 di markas Genoa. Penampilan cemerlang bintang kemenangan I Partenopei itu di Luigi Ferraris Stadium, justru datang saat dia bermain di belakang penyerang tengah. Posisi ini memang dia minta langsung kepada allenatore anyar Rafael Benitez. “Saya mengatakan kepada-

Poli dengan melepaskan tembakan lurus ke gawang kiper Sampdoria Angelo Da Costa. Il Samp asuhan Delio Rossi hanya menawarkan sedikit semangat juang, sehingga lebih menguntungkan Setan Merah. “Kami menjaga clean sheet dan tidak membiarkan lawan menciptakan peluang, kecuali sundulan pada babak pertama,” klaim Allegri. Mantan arsitek Cagliari itu

tak lupa memuji Birsa, winger 27 tahun yang diboyong Rossoneri pada bursa transfer musim panas dari Genoa sebagai bagian pertukaran dari Luca Antonini. “Dia (Birsa) pemain dengan teknik bagus, yang telah bermain apik melawan Bologna dan Napoli. Dia datang dari Genoa pada saat terakhir dan hanya sedikit yang mengenalnya. Namun dia bisa membuktkan diri di Milan,” puji Allegri. (m15/okz/tf/fi)


poin,” tambah pria berusia 46 tahun itu. Tidak diperkuat beberapa pemain pentingnya, termasuk striker Mario Balotelli yang terkena hukuman skorsing, I Rossoneri gagal tampil baik. Gol tunggal penentu kemenangan Milan disarangkan gelandang Valter Birsa menit 46. Tiga menit setelah meraih keunggulan, Robinho menyia-nyiakan operan sempurna Andrea

Beda Rasa Bayern, Dortmund


bobolan dalam beberapa laga terakhir lewat tendangan tepat sasaran pertama dari lawan,” klaim Buffon. Tambahan tiga poin dari Torino, membuat sang juara bertahan menempel ketat pemimpin klasemen Napoli, yang sehari sebelumnya mempecundangi Genoa 2-0 di Luigi Ferraris Stadium. Inter Milan gagal membayangi, setelah ditahan Cagliari 1-1 di Sant’Elia. Sempat memimpin melalui gol Mauro Icardi menit 75, Inter akhirnya hanya membawa pulang satu poin akibat kebobolan gol balasan Radja Nainggolan menit 83. (m15/goal/ts/uefa)

Arsenal 6 Tottenham 6 Chelsea 6 Southampton 6 Man City 6 Liverpool 5 Hull 6 Everton 5 Aston Villa 6 West Brom 6 Cardiff 6 Man United 6 Swansea 6 Norwich 5 Stoke 6 Newcastle 5 West Ham 6 Fulham 6 C Palace 6 Sunderland 5

BERLIN (Waspada): Borussia Dortmund mengukuhkan tempatnya di puncak klasemen pasca pesta gol menggasak SC Freiburg 5-0 pada spieltag delapan Bundesliga Jerman. Juara bertahan Bayern Munich tetap menempelnya dengan selisih gol, setelah menang tipis 1-0 atas tamunyaVfLWolfsburg di Allianz Arena. Hasil ini membuat kedua finalis Liga Champions musim lalu itu beda rasa menatap matchday kedua penyisihan grup, 1-2 Oktober nanti. Dortmund yakin untuk menjamu Olympique Marseille pada Grup F di Signal Iduna Park, sedangkan Bayern agak cemas jelang mengunjungi markas Manchester City di Grup D. “Kami menang, tetapi kami harus memperbaiki beberapa hal. Saya dapat memastikan bahwa kami akan menampilkan permainan bagus di Manchester dan Leverkusen,” papar pelatih Bayern Pep Guardiola, seperti dilansir Reuters, Minggu (29/9). Die Roten memerlukan waktu satu jam untuk memecah kebuntuan ketika bintang Jerman Thomas Mueller mencetak gol perdananya di liga musim

Minggu, 29 September ini. Mueller menyambar operan Franck Ribery dari sayap kiri ke tiang jauh. Kemenangan satu bola itu jauh dari penampilan apik pemilik treble winner dari arena Liga Champions, Bundesliga dan Piala Jerman tersebut. Bayern gagal mendikte Wolfsburg, meski menikmati penguasaan bola sebanyak 70 persen. Sedangkan Dortmund kelihatan terlalu leluasa ketika menjamu Freiburg. Masing-masing dua gol yang disumbangkan winger Jerman Marco Reus dan penyerang Polandia Robert Lewandowski, menuntaskan dominasi Die Borussen. Gelandang Jakub Blaszczykowski menambahi gol kelima, saat laga tinggal menyisakan sepuluh menit. “Saya gembira dengan babak pertama,” jelas Juergen Klopp, pelatih Dortmund. Bayer Leverkusen tetap berada di peringkat ketiga, hanya terpaut satu angka dari Dortmund dan Bayern berkat kemenangan 2-0 atas tamunya Hanover 96. Dua gelandang Jerman Simon Rolfes dan Sidney Sam, masing-masing menyumbang satu gol di babak pertama. Leverkusen asuhan Sami Hyypia akan menjamu Real Sociedad di Liga Champions,

W Bremen v Nuremberg Braunschweig v Stuttgart

3-3 -

nya bahwa tidak ada perkecualian. Dia (Pandev) bermain di tengah dan dia harus mencetak gol, dia melakukannya,” jelas Benitez, seperti dilansir Reuters, Minggu (29/9). Napoli memulai duel tandang ini dengan dua penyerang Gonzalo Higuain dan Marek Hamsik menghuni bangku pemain cadangan. Benitez melakukan ini, sebab Partenopei akan melawat ke markas Arsenal di ajang Liga Champions besok malam di Emirates Stadium. Pandev mencetak gol menit 14 dan 25, membuat timnya unggul satu angka atas tim peringkat kedua AS Roma, yang menjamu Bologna dinihari tadi di Stadion Olimpico.”Malam ini kami bermain benar-benar baik dan layak untuk menang,” papar Pandev. “Kami benar-benar menginginkan tiga angka, setelah malam yang mengerikan pada Rabu lalu. Namun malam-malam itu dapat terjadi pada siapapun,” tambah bintang Macedonia itu. Genoa membuat tim tamu berada di bawah tekanan sepanjang babak kedua. Penyebabnya bek Raul Albiol mengalami cedera, sehingga digantikan Paolo Cannavaro pasca turun minum. Cedera Albiol, yang dibeli


BEK Napoli Raul Albiol cedera setelah duel dengan pemain Genoa di Luigi Ferraris Stadium. Napoli dari Real Madrid, Agustus lalu, menjadi kekhawatiran bagi Benitez, ketika berniat untuk memuncaki klasemen Grup F Liga Champions dengan membidik kemenangan di markas Meriam London. Pria Spanyol itu juga sempat

dikritik pada pertengahan pekan lalu, ketika dia merotasi timnya hingga Napoli hanya bermain 1-1 saat menjamu tim papan bawah Sassuolo di San Paolo. Padahal, Sassuolo akhir pekan lalu baru digasak tamunya Inter Milan 0-7. (m15/ant/rtr/afp)

Sabtu, 28 September Leverkusen v Hannover B Munich v Wolfsburg Dortmund v Freiburg Hertha Berlin v Mainz Hoffenheim v Schalke E Frankfurt v Hamburg

2-0 1-0 5-0 3-1 3-3 2-2

Jumat, 27 September Augsburg v M’gladbach


Klasemen Bundesliga Dortmund B Munich Leverkusen Hanover Hertha M’gladbah Bremen Augsburg Hoffenheim Wolfsburg Mainz Frankfurt Schalke Stuttgart Nuremberg Hamburg Freiburg

7 7 7 7 7 7 7 7 7 7 7 7 7 6 7 7 7

6 6 6 4 3 3 3 3 2 3 3 2 2 2 0 1 0

1 1 0 0 2 1 1 1 3 0 0 2 2 1 5 2 3

0 0 1 3 2 3 3 3 2 4 4 3 3 3 2 4 4

21-5 14-2 17-7 10-10 13-8 17-13 8-11 8-11 18-18 9-9 10-15 10-12 10-16 11-9 9-12 12-19 8-17

19 19 18 12 11 10 10 10 9 9 9 8 8 7 5 5 3

Rabu (2/10), sehingga sangat senang mendapatkan kemenangan ini setelah melesakkan 17 tembakan berbanding tujuh tembakan yang dile-paskan tim tamu. (m15/ant/rtr/afp)

Waspada/Arianda Tanjung

ANGGOTA SMeCK Hooligan semangat menyanyikan yel-yel mendukung PSMS Medan di tengah hujan deras dan padamnya listrik yang mewarnai HUT SMeCK ke-10 di pelataran parkir Stadion Teladan Medan, Minggu (29/9) malam.

SMeCK Harus Tetap Solid MEDAN (Waspada): Suporter Medan Cinta Kinantan (SMeCK) Hooligan merayakan hari jadinya ke-10 di pelataran parkir Stadion Teladan Medan, Minggu (29/9) malam. Meski hujan deras dan listrik padam mewarnai jalannya kegiatan, semangat ratusan anggota komunitas pendukung Ayam Kinantan justru menambah khidmatnya acara tersebut. Plt Ketua SMeCK Holigan, Wayan Sasmika, mengatakan SMeCK salah satu supporter PSMS yang konsisten dalam mendukung baik dalam keada-

an senang atau susah. “Saya berharap dengan momentum hari jadi SMeCK ini, ribuan anggota yang ada di seluruh Indonesia tetap solid dan kompak mendukung tim kebanggaan kita bersama, PSMS Medan,” ujarnya. Lebih lanjut, Wayan juga mengatakan SMeCK juga akan terus memantau keadaan sejumlah pemain PSMS PT Liga Indonesia yang hingga saat ini belum jelas nasibnya terkait pelunasan gaji. “Sejumlah pemain masih sering mengadu sama kami

agar dipertanyakan kejelasan nasibnya. Kami hanya ingin ke depan PSMS dapat berjaya lagi, seperti tahun-tahun sebelumnya,” kata Wayan. Ardiansyah, anggota SMecK lainnya, mengatakan sejak bergabung dengan SMecK lima tahun lalu, dirinya seperti memiliki keluarga baru. “SMeCK seperti keluarga kedua saya. Jujur, organisasi ini sejak dulu dikenal kompak, makanya banyak orang yang ingin bergabung di kelompok suporter ini,” tegasnya. (cat)


WASPADA Senin 30 September 2013


Tren Positif Persiraja Berlanjut Bekuk Bontang FC 3-0 BANDA ACEH (Waspada): Persiraja Banda Aceh kembali melanjutkan tren positifnya di kandang. Seperti dua laga lanjutan Indonesian Premier League (IPL) sebelumnya, Laskar Rencong pesta gol dan kali ini menang 3-0 atas Bontang FC di Stadion H Dimurthala, Minggu (29/9). Dalam pertandingan tersebut, Persiraja menurunkan seluruh pemain terbaiknya. Sebaliknya, tim tamu datang ke Aceh dengan kekuata 11 pemain saja. Seakan tak terpengaruh dengan kabar nasib kompetisi yang sedang dipergunjingkan, skuad Persiraja kembali mencatat hasil bagus di hadapan publiknya sendiri. Tim racikan Wahyu AW membuka skor melalui Angga Parnanda pada menit 33 hasil meneruskan umpan matang tendangan bebas Mukhlis Nakata. Sebelum gol tersebut, Persiraja sempat memiliki peluang melalui striker jangkung Fahrizal Dillah. Namun, dua kans-

nya dikandaskan tiang gawang. Mengawali babak kedua, Persiraja tidak mengendurkan serangannya ke daerah pertahanan Laksar Khatulistiwa. Layaknya di babak pertama, sejumlah peluang yang didapat Fahrizal lagi-lagi gagal dikonversi menjadi gol. Untuk menambah daya serang, Wahyu AW menarik Fahrizal dan memasukkan Septi Hariansyah pada menit 55. Tak lama kemudian, Septi mencetak gol dan memperbesar keunggulan timnya. Tidak puas dengan dua gol, Laskar Rencong menyempurnakan skor menjadi 3-0 lewat hentakan kapten tim Erik Saputra pada menit 86.

Dalam sesi temu pers, Pelatih Bontang FC Dedi Siswanto mengaku sudah memprediksikan timnya akan kalah. Apalagi mereka hanya memboyong 11 pemain ke Banda Aceh. Dikatakan, pemainnya sudah pasti kelelahan, karena tidak ada pemain pengganti. “Harus diakui, tuan rumah tampil bersemangat, saat di kandang kami saja mereka bisa mencuri satu poin,” tukas Siswanto memuji tuan rumah yang bermaterikan pemain muda nan potensial. Direktur Operasional Persiraja, Riza Iskandar, pun ikut memuji penampilan Andrea cs. Pasalnya, penampilan pemain tidak terpengaruh dengan kondisi finansial tim yang memburuk. “Mereka tampil bagus, manajemen mengucapkan terima kasih atas sikap profesional yang sudah ditunjukkan pemain,” papar pria yang akrab disapa Jaja ini. (b07)

PSBL Hanya Mampu Imbang Vs Persikab 1-1 LANGSA (Waspada): Tuan rumah PSBL Langsa hanya mampu bermain imbang kala menjamu Persikab Bandung dalam lanjutan Divisi Utama Liga Prima Indonesia Sportindo (LPIS) 2013 di Stadion Langsa, Minggu (29/9). Kedua tim berbagi angka setelah imbang 1-1. Gol Persikab dicetak Rinaldy Zainal menyambut umpan matang di mulut gawang PSBL pada menit 45. Tak ingin kecolongan di kandang sendiri, PSBL membenahi permainan di babak kedua. Dengan memainkan tempo cepat, Elang Biru pun akhirnya mampu mencetak gol

penyeimbang. Menit 54, Wahyu menyelamatkan timnya dari kekalahan. Setelah gol Wahyu, tuan rumah kian gencar menyerang lawan. Kendati begitu, tekanan demi tekanan yang dilancarkan PSBL tidak juga membuahkan hasil. Hingga peluit panjang, skor 11 tidak berubah. Pertandingan juga diwarnai beberapa pelanggaran keras dan protes wasit. Alhasil, wasit mengeluarkan tiga kartu kuning untuk PSBL dan dua untuk Persikab. Pelatih Persikab, Suhandono, mengaku puas dengan hasil yang dicapai anak-anak binaannya.

“Meski para pemain kurang istirahat, mereka bisa bermain maksimal. Padahal kami hanya berjumlah 13 pemain, karena itu hasil seri saja sudah cukup baik,” katanya. Pelatih PSBL, Anwar, mengatakan timnya terlalu mengikuti pola permainan lawan di 45 menit pertama. Namun, anakanak berhasil keluar dari irama tersebut di babak kedua hingga mencetak gol penye-imbang. “Inilah hasil dari sebuah pertandingan. Meskipun seri, kita tetap di posisi runner-up klasemen sementara dan lolos ke semifinal,” kata Anwar . (m43)

Peluang Timnas U-16 Kandas

Waspada/Munawardi Ismail

ANGGA Parnanda (kiri) tampil apik bagi Persiraja Banda Aceh saat bersua Bontang FC dalam lanjutan kompetisi IPL di Stadion H Dimurthala, Minggu (29/9).

KUALALUMPUR (Waspada): Tertutup sudah peluang Timnas U-16 untuk melaju ke babak selanjutnya saat kembali takluk 03 dari Jepang di babak kualifikasi Piala Asia U-16. Bermain di Stadion Kuala Lumpur, Cheras, Minggu (29/9), Garuda Muda kalah kelas dari skuad Negeri Matahari Terbit. Di babak pertama, tim besutan Mundari Karya sempat menahan imbang Jepang. Namun petaka datang saat pertandingan masuk 45 menit kedua. Tiga kali tanpa balas dalam tempo 15 menit, Jepang membobol gawang Indonesia masing-masing menit 53, 66, 68. Kekalahan ini akhirnya memaksa Timnas U-16 harus melupakan mimpi lolos ke putaran final Piala Asia. Dari tiga pertandingan, Garuda Muda hanya mengoleksi satu poin hasil bermain imbang tanpa gol dengan Filipina. Melawan Vietnam, Indonesia takluk 2-1. Nantinya, Jepang didampingi Vietnam yang menduduki runner-up klasemen. (m33/goal)

Hadapi China Tanpa Penonton Kualifikasi Piala Asia 2015


KADISPORA Medan, Drs Abdul Azis, memberi sambutan dalam pembukaan turnamen futsal IRMB Medan Deli di Lapangan KIM Centre, Jl Simpang KIM 2, Medan Deli, Sabtu (28/9).

Kadispora Medan Berharap Pemain Andal Turnamen Futsal IRMB MEDAN (Waspada): Kadispora Medan, Drs Abdul Azis, berharap turnamen futsal yang digelar Ikatan Remaja Masjid Bersatu (IRMB) Medan Deli dapat meningkatkan pembinaan sekaligus melahirkan atlet-atlet andal di Kota Medan. “Saya berharap turnamen ini dapat terus digelar dan menjadi kalender tetap IRMB dan KONI Kecamatan Medan Deli. Pendanaannya nanti akan ditampung di Dispora Medan,” ujar Abdul Azis saa membuka

turnamen di Lapangan KIM Centre, Jl Simpang KIM 2 Medan Deli, Sabtu (28/9). Kadispora juga mengucapkan terima kasih kepada panitia yang telah melaksanakan kegiatan ini, sebagai salah satu sarana membangun olahraga futsal di Kota Medan yang memang sangat digemari masyarakat. Abdul Azis pun meminta semua tim bertanding dengan semangat sportivitas. Pembina IRMB Kecamatan Medan Deli, Dra Hj Ainal Mar-

Problem Catur

diah, mengatakan sebagai cabang olahraga yang sangat digemari masyarakat, pembinaan futsal sudah seharusnya ditingkatkan, salah satunya dengan banyaknya digelar kompetisi. Ketua IRMB Kecamatan Medali Deli, M Aminsyah, menjelaskan digelarnya turnamen ini selain untuk pembinaan dan prestasi juga menjalin komunikasi serta keakraban sesama anggota IRMB Kecamatan Medan Deli. (m42)


JAKARTA (Waspada): Kabar tidak sedap harus dihadapi Timnas Senior Indonesia saat menjamu China dalam lanjutan kualifikasi Piala Asia 2015 di Stadion Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta, 15 Oktober mendatang. Hal tersebut terkait keputusan Komisi Disiplin AFC yang mengharuskan Indonesia menggelar laga tanpa penonton, menyusul pelanggaran yang dilakukan saat dinilai gagal menjadi tuan rumah yang baik pada kualifikasi Piala AFC U-22 di Pekanbaru, 5-15 Juli lalu. “Pada pertanding itu, suporter menyalakan flare dan ada sedikit kericuhan. Akibatnya, AFC menjatuhkan sanksi dan dampaknya kini kita rasakan,” kata Sekjen PSSI, Joko Driyono, Minggu (29/9). Ditambahkan, hukuman menggelar laga tanpa penonton seharusnya terjadi ketika menjamu Arab Saudi di Stadion Utama pada 22 Maret 2013 silam. Hanya saja, kala itu PSSI berhasil meminta keringanan dan sanksi baru terjadi saat Indonesia menjamu China dan Irak pada 19 November mendatang. “Tentunya menjadi kerugian besar buat kita. Apalagi yang ada kaitan dengan sponsor-sponsor. Saat ini kami tengah berupaya meminta keringanan. Setidaknya untuk VVIP tetap bisa dihadiri tamu undangan,” beber Joko. Masih kata Joko, untuk menghindari hal-hal yang tidak diinginkan, PSSI telah memutuskan untuk memindahkan laga kualifikasi AFC U-19 dari Stadion Gelora Delta Sidoarjo ke Stadion Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta, 8-12 Oktober mendatang. Menurutnya, keputusan memindahkan venue tersebut diambil setelah dilakukan evaluasi atas penyelenggaraan kejuaraan AFF U-19 Championship 2013 di Sidoarjo dan Gresik pekan lalu. “Hal pokok dalam evaluasi tersebut adalah domain ketertiban, keamanan, dan kelancaran pertandingan. Terjadi beberapa permasalahan di Sidoarjo, khususnya saat final,” beber Joko menyebutkan adanya insiden loket dan layar di luar stadion yang dirusak serta pagar roboh. “Ini karena jumlah calon penonton melebihi kapasitas stadion. Kapasitas SUGBK lebih memadai dan dapat menampung penonton lebih banyak,” pungkas Joko. (yuslan)


PESERTA UKT mengikuti arahan jurus-jurus yang diberikan penguji di Gelanggang Remaja Medan, Minggu (29/9).

Bobby: Motivasi Penting Lahirkan Prestasi 504 Taekwondoin UTI-Pro Ikuti UKT MEDAN (Waspada): Sebanyak 504 taekwondoin Universal Taekwondo Indonesia Profesional (UTI-Pro) Sumatera Utara (Sumut) II mengikuti Ujian Kenaikan Tingkat (UKT) wilayah I di Gelanggang Remaja Medan, Minggu (29/9). Jumlah taekwondoin yang ikut UKT tersebut mengalami peningkatan signifkan dari tahun sebelumnya. Ketua Pengprov UTI-Pro Sumut, Nelson Simatupang, pun menyatakan bangga dengan perkembangan di UTI-Pro Sumut. “Bila tahun lalu hanya 500an atlet, maka saat ini sudah cukup meningkat dua kali lipat hingga 1000-an atlet di Sumut. Ini menunjukkan kepercayaan dari orangtua kepada UTI-Pro



Jawaban di halaman A2. 8







1 A








Kota Medan, Bobby Oktavianus Zulkarnain, mengajak seluruh peserta UKT lebih meningkatkan motivasi dan berlatih keras, sehingga bisa melahirkan prestasi di masa mendatang. “Dengan UKT ini, buatlah sebagai tolak ukur dari ilmu yang dipelajari dalam latihan selama ini,” kata Bobby menjamin Pengprov UTI-Pro Sumut sudah mengeluarkan sertifikat dalam tempo 30 hari usai UKT. Ketua Pelaksana UKT UTIPro Sumut, Irwansyah Putra, mengatakan peserta yang ikut UKT terdiri atas 240 atlet sabuk putih, 97 kuning, 76 kuning strip hijau, 31 hijau, 21 hijau strip biru, 10 biru, 20 biru strip merah, 5 merah, dan 3 merah strip 1. (m15)

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1.

Hitam melangkah, mematikan lawannya tiga langkah.


sudah semakin besar,” kata Nelson disambut riuh seluruh peserta UKT. Makanya, tambah Nelson, pihaknya harus membagi sampai tiga wilayah dalam pelaksanaan UKT tersebut. Diketahui, 504 atlet yang mengikuti UKT wilayah I meliputi Medan, Langkat, Deliserdang, dan Sergai.Wilayah II meliputi Siantar, Simalungun, Tobasa, Asahan, dan Tanjungbalai, sedangkan wilayah III di Tanahkaro. “Wilayah II dipusatkan di Siantar. Jadi kita bukan tidak mau mengajak mereka melakukan UKT bersama, namun jumlah peserta wilayah I saja sudah cukup banyak. Kita cukup memberi apresiasi,” ucapnya. Ketua Pengcab UTI-Pro

1. Jenis dan irama musik, ditandai oleh pukulan tetap bunyi gendang rangkap pada hitungan ke-4 dan ke-1. 3. Rumah atau bangsal tempat menyimpan barang. 6. Pergi menghadiri undangan perkawinan. 7. Ada kalanya; Sekali-sekali. 8. Tanah yang diusahakan dan ditanami. 9. Bahan pakaian. 11. Gendang panjang, di tengah lebih lebar dari pada ujungnya. 14. Upacara tutup tahun pada suku Dayak setelah penuaian padi selama tujuh hari. 16. Mencangkul dan membersihkan tanah di sekitar pohon supaya tanah tetap subur. 17. Selaput; Kulit ari (kata ulang, garis tengah sudah tertulis). 18. Orang yang tidak tentu tempat kediamannya dan pekerjaannya.


1. Tidak dalam; Cetek. 2. Penyakit kusta yang sudah parah; Tinju. 4. Binatang air berkaki sepuluh dan bersepit dua untuk makanan dan umpan memancing. 5. Pohon tinggi besar, kulit batangnya mengeluarkan getah putih yang dapat dijadikan lilin untuk membatik. 6. Burung pemakan serangga berbulu kuning. 9. Tumbuhan palem yang hidup di tanah bencah dan daunnya dapat dibuat atap; Kabupaten Deli—— dan ——Bedagai. 10. Jemputan (pesta kawin dsb). 12. -——Gerdung, lagu Karo. 13. Halang; Saudara tua dari ibu; Kakak ibu. 15. Anak perempuan atau istri pertapa.



9 7 3 1 5 6 8 2 3 3 6 1 8 2


2 1 4 3 2 6 9 5 1 4 8 4 6 3 1 9 5 9 8 6 1 2 5 9 8 9 6 2 6 4 3 *215


WASPADA Senin 30 September 2013

Hadapi China Tanpa Penonton Kualifikasi Piala Asia 2015 JAKARTA (Waspada): Kabar tidak sedap harus dihadapi Timnas Senior Indonesia saat menjamu China dalam lanjutan kualifikasi Piala Asia 2015 di Stadion Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta, 15 Oktober mendatang. Hal tersebut terkait keputusan Komisi Disiplin AFC yang mengharuskan Indonesia menggelar laga tanpa penonton, menyusul pelanggaran yang dilakukan saat dinilai gagal menjadi tuan rumah yang baik pada kualifikasi Piala AFC U22 di Pekanbaru, 5-15 Juli lalu. “Pada pertanding itu, suporter menyalakan flare dan ada

sedikit kericuhan. Akibatnya, AFC menjatuhkan sanksi dan dampaknya kini kita rasakan,” kata Sekjen PSSI, Joko Driyono, Minggu (29/9). Ditambahkan, hukuman menggelar laga tanpa penonton seharusnya terjadi ketika menjamu Arab Saudi di Stadion Utama pada 22 Maret 2013 silam. Hanya saja, kala itu PSSI berhasil

meminta keringanan dan sanksi baru terjadi saat Indonesia menjamu China dan Irak pada 19 November mendatang. “Tentunya menjadi kerugian besar buat kita. Apalagi yang ada kaitan dengan sponsor-sponsor. Saat ini kami tengah berupaya meminta keringanan. Setidaknya untuk VVIP tetap bisa dihadiri tamu undangan,” jelas Joko. Masih kata Joko, untuk menghindari hal-hal yang tidak diinginkan, PSSI telah memutuskan untuk memindahkan laga kualifikasi AFC U-19 dari Stadion Gelora Delta Sidoarjo ke Stadion

Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta, 812 Oktober mendatang. Menurutnya, keputusan memindahkan venue tersebut diambil setelah dilakukan evaluasi atas penyelenggaraan kejuaraan AFF U-19 Championship 2013 di Sidoarjo dan Gresik pekan lalu. “Hal pokok dalam evaluasi tersebut adalah domain ketertiban, keamanan, dan kelancaran pertandingan. Terjadi beberapa permasalahan di Sidoarjo, khususnya saat final,” beber Joko menyebutkan adanya insiden loket dan layar di luar sta-

Grandfinal Ambarwulan YMR Di Binjai MEDAN (Waspada): Kejuaraan Ambarwulan Yamaha Matic Race 2013 memasuki babak grandfinal yang bakal digelar dalam rangkaian HUT TNI ke68 di kawasan Lapangan Merdeka, Binjai, Minggu (6/10) depan. Ketua Panpel, Nunung Pamela, mengatakan kejuaraan 10 kelas ini memperebutkan trofi Wali Kota Binjai, Dandim 0203/Langkat serta Ketua FKPPI 0203 Binjai dan FR Center dengan menyediakan dua hadiah utama sepeda motor bagi juara umum kejuaraan di kelompok seeded dan pemula.

Nunung, didampingi Pembina ACI Mulya Nasution, promotor Sylvani Nasution, dan Ketua Panitia Lokal M Jend, mengungkapkan kejuaraan berlangsung dalam empat putaran. Putaran I di Kisaran, putaran II di Stabat, dan putaran III kembali di Kisaran. Pimpinan klasemen kategori seeded dipegang M Irvansyah dan Pemula oleh M Ari Alatas. “Babak grandfinal dipastikan bakal berlangsung sengit. Sebab untuk memastikan diri sebagai juara umum, M Irvansyah dan M Ari Alatas akan mendapat tantangan berat dari la-

wannya, termasuk racer tuan rumah Binjai yang juga dikenal andal,” sebut Nunung di Medan, Minggu (29/9). Mulya Nasution menyatakan event ini memang dimaksudkan untuk menyemarakkan HUT TNI ke-68, sehingga ACI akan mengemas acara dengan sebaik mungkin untuk menghidangkan persaingan menarik dan tontonan bagi masyarakat penggemar otomotif di Kota Rambutan. Dikatakan, peserta dapat mendaftar di Sekretariat Jl Pencak No 10 Medan. “Panitia bertambah semangat karena dukungan unsur

Muspida Kota Binjai yang telah disampaikan saat audiensi kepada Wali Kota Binjai dan Dandim,” ucap Nunung. Ke-10 kelas yang diperlombakan adalah Yamaha Matic Standar s/d 130cc Open, Yamaha Matic TU s/d 150cc Open, Yamaha Matic Standar s/d 130 cc Pemula, Yamaha Matic Tune Up s/d 150cc Pemula, Yamaha Bebek 4 Tak Standar s/d 125cc Pemula, Matic Standar s/d 130cc, Bebek 4 Tak Standar s/ d 110cc, Bebek 4 Tak Standar s/d 125cc, Bebek 4 Tak Standar 125cc Lokal, dan Bebek 4 Tak Standar s/d 110cc Lokal. (m47)

Jadwal Kualifikasi Grup G AFC U-19 Selasa (8/10) 15.30 WIB Korsel vs Filipina 19.30 WIB Indonesia vs Laos Kamis (10/10) 15.30 WIB Laos vs Korsel 19.30 WIB Filipina vs Indonesia Sabtu (12/10) 15.30 WIB Laos vs Filipina 19/30 WIB Korsel vs Indonesia dion yang dirusak serta pagar roboh. “Ini karena jumlah calon penonton melebihi kapasitas stadion. Kapasitas SUGBK lebih memadai dan dapat menampung penonton lebih banyak,” pungkas Joko. (yuslan)

lima TNI Jenderal TNI Moeldoko. Turut hadir Kapolri Jenderal Pol Timur Pradopo, Kasad Jenderal TNI Budiman, Kasal Laksamana TNI Marsetio, dan Kasau Marsekal TNI Ida Bagus Putu Dunia. Acara ini sekaligus ditujukan menjaring atlet baru dari TNI maupun masyarakat. Untuk menyebarkan semangat HUT TNI, Mayor Agus dan Garuda Finisher melanjutkan lari dengan berpartisipasi dalam kegiatan Adidas King of The Road. Dengan mengambil lokasi di BSD Green Office ParkBSD City ini, Mayor Agus dan peserta lain mengitari rute sejauh 17 Km. Tidak sekadar lari, Mayor Agus tetap meluangkan waktu menyapa dan berbincang sesama peserta. “Melalui kegiatan lari 27 Km, kami konsisten memperkenalkan komunitas Garuda Finisher dan terus menginspirasi masyarakat untuk tidak pernah menyerah karena kompetisi terberat adalah melawan diri sendiri,” ujar Mayor Agus. Ditambahkan Garuda Finisher didirikan pada 20 Mei 2013 bersamaan HUT Brigade Infanteri Lintas Udara 17 Kostrad.

MAYOR Agus Harimurti Yudhoyono (tengah) beserta komunitas Garuda Finisher diabadikan bersama usai kegiatan marathon dalam rangka HUT TNI ke-68 di Jakarta, Minggu (29/9).

PALEMBANG (Waspada): Medali emas kembali berpeluang disumbangkan pewushu putri Indonesia asal Sumut, Lindswell. Bersama Fredy (Riau), Lindswell memiliki kans menyandingkan medali emas Taiji pada pentas Islamic Solidarity Games III/2013 di Palembang, Senin (30/9) ini. Linsdwell dan Fredy samasama telah menyumbangkan emas dari nomor Taijji Quan (taiji tangan kosong) pada Sabtu (28/9). Pada Senin (30/9) ini, ke-

-Waspada/Danau Antariksa-

Di akhir kegiatan, Mayor Agus yang juga berasal dari kesatuan tersebut mengatakan “It doesn’t matter how fast or how slow you are, just run and finish what you have started” (Tidak masalah berapa cepat atau lambat Anda, tetaplah berlari dan finish apa yang telah Anda mulai). (m33)

Kadispora Medan Berharap Pemain Andal Turnamen Futsal IRMB


KADISPORA Medan, Drs Abdul Azis, memberi sambutan dalam pembukaan turnamen futsal IRMB Medan Deli di Lapangan KIM Centre, Jl Simpang KIM 2, Medan Deli, Sabtu (28/9).

Problem Catur

MEDAN (Waspada): Kadispora Medan, Drs Abdul Azis, berharap turnamen futsal yang digelar Ikatan Remaja Masjid Bersatu (IRMB) Medan Deli dapat meningkatkan pembinaan sekaligus melahirkan atlet-atlet andal di Kota Medan. “Saya berharap turnamen ini dapat terus digelar dan menjadi kalender tetap IRMB dan KONI Kecamatan Medan Deli. Pendanaannya nanti akan ditampung di Dispora Medan,” ujar Abdul Azis saa membuka turnamen di Lapangan KIM Centre, Jl Simpang KIM 2 Medan Deli, Sabtu (28/9). Kadispora juga mengucapkan terima kasih kepada panitia yang telah melaksanakan kegiatan ini, sebagai salah satu sarana


membangun olahraga futsal di Kota Medan yang memang sangat digemari masyarakat. Abdul Azis pun meminta semua tim bertanding dengan semangat sportivitas. Pembina IRMB Kecamatan Medan Deli, Dra Hj Ainal Mardiah, mengatakan sebagai cabang olahraga yang sangat digemari masyarakat, pembinaan futsal sudah seharusnya ditingkatkan, salah satunya dengan banyaknya digelar kompetisi. Ketua IRMB Kecamatan Medali Deli, M Aminsyah, menjelaskan digelarnya turnamen ini selain untuk pembinaan dan prestasi juga menjalin komunikasi serta keakraban sesama anggota IRMB Kecamatan Medan Deli. (m42)

JAKARTA (Waspada): Babak kualifikasi Grup G Piala AFC U-19 akan digelar 8-12 Oktober mendatang di Stadion Utama Gelora Bung Karno (SUGBK) Senayan, Jakarta. Laga penyisihan awalnya akan digelar di Stadion Gelora Delta Sidoarjo, namun dipindahkan oleh Badan Tim Nasional (BTN). Pelatih Timnas U-19, Indra Sjafri, mengaku tidak keberatan dengan keputusan BTN tersebut. Sebaliknya, Indra malah mengaku senang atas kepindahan lokasi pertandingan. Setelah menjuarai Piala AFF U-19, Evan Dimas cs tidak bisa berpuas hati karena babak kualifikasi Piala AFC U-19 sudah di depan mata. Tim besutan Indra Sjafri tergabung di dalam Grup G bersama Korea Selatan, Fili-pina, dan Laos. Pada laga pertama, Garuda Jaya akan ditantang Laos pada 8 Oktober nanti. Dua hari kemudian, Indonesia berhadapan dengan Filipina dan selanjutnya menantang Korea Selatan. Untuk bertanding di ajang tersebut, Timnas U-19 masih melakukan Training Centre (TC) dan seleksi di Sidoarjo. Pada Rabu (2/10), Indra Sjafri dan pasukannya akan tiba di Jakarta. Terkait kepindahan ke Senayan, Indra menilai hal itu

duanya akan tampil di nomor Taiji Jian (taiji pedang). Nantinya, Lindswell kembali berhadapan dengan Hamideh Barkhor (Iran) dan Chan Lu-Yi (Malaysia). Dari sisi prestasi dan pengalaman bertanding, atlet binaan Yayasan Kusuma Wushu Indonesia (YKWI) Medan ini diperkirakan bisa mengatasi kedua lawannya. Demikian juga dengan Fredy. Di nomor ini, Indonesia juga masih punya Marthen Mardhan

nit 53, 66, 68. Kekalahan ini akhirnya memaksa Timnas U-16 harus melupakan mimpi lolos ke putaran final Piala Asia. Dari tiga pertandingan, Garuda Muda hanya mengoleksi satu poin hasil bermain imbang tanpa gol dengan Filipina. Melawan Vietnam, Indonesia takluk 2-1. Nantinya, Jepang didampingi Vietnam yang menduduki runner-up klasemen. (m33/goal)

MEDAN (Waspada): Sebanyak 504 taekwondoin Universal Taekwondo Indonesia Profesional (UTI-Pro) Sumatera Utara (Sumut) II mengikuti Ujian Kenaikan Tingkat (UKT) wilayah I di Gelanggang Remaja Medan, Minggu (29/9). Jumlah taekwondoin yang ikut UKT tersebut mengalami peningkatan signifkan dari tahun sebelumnya. Ketua Pengprov UTI-Pro Sumut, Nelson Simatupang, pun menyatakan bangga dengan perkembangan di UTI-Pro Sumut. “Bila tahun lalu hanya 500an atlet, maka saat ini sudah cukup meningkat dua kali lipat hingga 1000-an atlet di Sumut. Ini menunjukkan kepercayaan dari orangtua kepada UTI-Pro sudah semakin besar,” kata Nelson disambut riuh seluruh peserta UKT. Makanya, tambah Nelson,

pihaknya harus membagi sampai tiga wilayah dalam pelaksanaan UKT tersebut. Diketahui, 504 atlet yang mengikuti UKT wilayah I meliputi Medan, Langkat, Deliserdang, dan Sergai.Wilayah II meliputi Siantar, Simalungun, Tobasa, Asahan, dan Tanjungbalai, sedangkan wilayah III di Tanahkaro. “Wilayah II dipusatkan di Siantar. Jadi kita bukan tidak mau mengajak mereka melakukan UKT bersama, namun jumlah peserta wilayah I saja sudah cukup banyak. Kita cukup memberi apresiasi,” ucapnya. Ketua Pengcab UTI-Pro Kota Medan, Bobby Oktavianus Zulkarnain, mengajak seluruh peserta UKT lebih meningkatkan motivasi dan berlatih keras, sehingga bisa melahirkan prestasi di masa mendatang. “Dengan UKT ini, buatlah sebagai tolak ukur dari ilmu yang




1 A








beberapa kali mengukir prestasi di tingkat nasional, di antaranya menjadi juara III Kejurnas Inkai di Surabaya (2010) dan Manado (2012). “Tentu pretasi yang saya raih ini masih belum ada apaapanya, saya harus lebih banyak berlatih lagi untuk sejumlah kompetisi bergengsi lainnya.Ya, syukur-syukur bisa ikut PON 2016 di Jawa Barat nanti,” janji Kharen kepada Waspada, Sabtu (28/9). Lebih lanjut, Kharen berkata memiliki keinginan untuk mengharumkan nama Indonesia di tingkat internasional terutama dalam cabang karate. “Kelak saya ingin seperti Umar Syarif yang mampu mengharumkan bangsa dengan prestasi yang telah diraihnya di kejuaraan tingkat dunia,” sambung anak sulung dari dua bersaudara ini. Kepala SMA Eria Drs H Khoiruddin Hasibuan MPd didampingi Wakil Kepala Bidang

Waspada/Arianda Tanjung

Kesiswaan Dra Hj Mulyana Munir mengucapkan selamat atas prestasi yang telah diraih anak didiknya itu. “Alhamdulillah, siswa SMA Eria terus mengukir prestasi. Memang ekskul selalu menjadi salah satu prioritas di sekolah ini, sehingga terus berprestasi,” katanya sembari berharap Kharen dapat lebih mengembangkan bakat dan prestasinya. *Arianda Tanjung


PESERTA UKT mengikuti arahan jurus-jurus yang diberikan penguji di Gelanggang Remaja Medan, Minggu (29/9). dipelajari dalam latihan selama ini,” kata Bobby menjamin Pengprov UTI-Pro Sumut sudah mengeluarkan sertifikat dalam tempo 30 hari usai UKT. Ketua Pelaksana UKT UTIPro Sumut, Irwansyah Putra,

mengatakan peserta yang ikut UKT terdiri atas 240 atlet sabuk putih, 97 kuning, 76 kuning strip hijau, 31 hijau, 21 hijau strip biru, 10 biru, 20 biru strip merah, 5 merah, dan 3 merah strip 1. (m15)

Sudoku Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1. Mendatar


9,40 saat bertanding di nomor Dao Shu dan menempati posisi keempat. Selain empat nomor tadi, Indonesia juga berpeluang menambah emas dari nomor gabungan Nan Dao+Nan Gun putri. Di nomor ini, Ivana Ardelia Irmanto (DIY ) memimpin dengan 9,62 poin. Di nomor Nan Dao+Nan Gun putra, Indonesia berharap pada Johannes Bie. (m15)

504 Taekwondoin UTI-Pro Ikuti UKT

Jawaban di halaman A2.


Tangdillalo (Kaltim). Selain itu, kans pewushu asal Sumut Charles Susanto meraih emas terbuka di nomor gabungan Jian Shu+Qian Shu. Charles sementara memimpin setelah mengumpulkan 9,66 poin di nomor Jian Shu. Di nomor gabungan Dao Shu-Gun Shu, Indonesia menyertakan Aldi Lukman asal Sumut. Namun kans Aldi menjadi pewushu terbaik cukup berat, karena baru mengantongi nilai

Bobby: Motivasi Penting Lahirkan Prestasi



akan menambah motivasi anak-anak asuhnya untuk bermain lebih baik. “Tidak ada masalah, malahan kami senang bisa main di Jakarta. Anak-anak sangat tertarik bisa bermain di stadion sebesar SUGBK,” ungkap Indra. (m33/goal)

Siswa Eria Raih Perunggu Popnas SEJAK kecil sudah melihat sang ayah sering berlatih olahraga beladiri karate membuat pria bernama lengkap Kharen ArdiantaTarigan (foto) atau yang akrap disapa Kharen tertarik untuk mencobanya. Bakat yang ada pada pria berusia 15 tahun ini terlihat saat dirinya sering meniru gerakan sang ayah saat berlatih seperti menendang dan memukul. Lantas, sejak duduk di bangku kelas II SD, dirinya sudah mulai masuk ke dalam salah satu organisasi karate di Medan. Terbukti, sejauh ini sejumlah prestasi sudah ditoreh putra pasangan Ardianto Tarigan dan Sriani Br Sitepu ini, termasuk meraih medali perunggu pada ajang Pekan Olahraga Pelajar Nasional (Popnas) di cabang karate kumite beregu di Jakarta baru-baru ini. Ini bukanlah prestasi nasional pertama yang diraih Kharen, sebelumnya siswa kelas IX SMA Eria Medan ini sudah pernah

Hitam melangkah, mematikan lawannya tiga langkah.



WINGER Timnas U-19, Maldini (tengah), bersama rekan-rekannya menghadapi ujian lagi saat bertarung di ajang kualifikasi Grup G Piala AFC U-19 di Jakarta, 8-12 Oktober.

Kharen Ingin Harumkan Nama Bangsa

Peluang Timnas U-16 Kandas KUALALUMPUR (Waspada): Tertutup sudah peluang Timnas U-16 untuk melaju ke babak selanjutnya saat kembali takluk 0-3 dari Jepang di babak kualifikasi Piala Asia U-16. Bermain di Stadion Kuala Lumpur, Cheras, Minggu (29/9), Garuda Muda kalah kelas dari skuad Negeri Matahari Terbit. Di babak pertama, tim besutan Mundari Karya sempat menahan imbang Jepang. Namun petaka datang saat pertandingan masuk 45 menit kedua. Tiga kali tanpa balas dalam tempo 15 menit, Jepang membobol gawang Indonesia masing-masing me-

Garuda Jaya Termotivasi SUGBK

Wushu Sumut Berpeluang Sumbang Emas

Pererat TNI - Masyarakat Lewat Lari JAKARTA (Waspada): Kegiatan lari tidak lagi sekadar menjadi pilihan meningkatkan kebugaran tubuh, melainkan olahraga yang dapat mempererat solidaritas antar satuan TNI secara perorangan maupun kesatuan. Tidak tanggung-tanggung, komunitas lari Garuda Finisher dibentuk untuk mempererat hubungan TNI dengan masyarakat oleh Mayor Agus Harimurti Yudhoyono MSc MPA. Bersama Garuda Finisher, Mayor Agus konsisten menebarkan semangat kebersamaan dan sportivitas di berbagai elemen masyarakat dengan ikut berpartisipasi maupun menginisiasi kegiatan lari. Seperti halnya pada Minggu (29/9), secara khusus Mayor Agus beserta Garuda Finisher mengikuti kegiatan Maraton 10K dalam rangka HUT TNI ke-68. Sebanyak 10 ribu peserta berlari mengikuti rute Pintu Barat Daya Monas-Thamrin-Bundaran HISudirman dan Univ Atmajaya diakhiri balik ke arah Monas. Peserta kegiatan lari dilepas oleh Menteri Pertahanan Purnomo Yusgiantoro dan Pang-


1. Jenis dan irama musik, ditandai oleh pukulan tetap bunyi gendang rangkap pada hitungan ke-4 dan ke-1. 3. Rumah atau bangsal tempat menyimpan barang. 6. Pergi menghadiri undangan perkawinan. 7. Ada kalanya; Sekali-sekali. 8. Tanah yang diusahakan dan ditanami. 9. Bahan pakaian. 11. Gendang panjang, di tengah lebih lebar dari pada ujungnya. 14. Upacara tutup tahun pada suku Dayak setelah penuaian padi selama tujuh hari. 16. Mencangkul dan membersihkan tanah di sekitar pohon supaya tanah tetap subur. 17. Selaput; Kulit ari (kata ulang, garis tengah sudah tertulis). 18. Orang yang tidak tentu tempat kediamannya dan pekerjaannya.


1. Tidak dalam; Cetek. 2. Penyakit kusta yang sudah parah; Tinju. 4. Binatang air berkaki sepuluh dan bersepit dua untuk makanan dan umpan memancing. 5. Pohon tinggi besar, kulit batangnya mengeluarkan getah putih yang dapat dijadikan lilin untuk membatik. 6. Burung pemakan serangga berbulu kuning. 9. Tumbuhan palem yang hidup di tanah bencah dan daunnya dapat dibuat atap; Kabupaten Deli—— dan ——Bedagai. 10. Jemputan (pesta kawin dsb). 12. -——Gerdung, lagu Karo. 13. Halang; Saudara tua dari ibu; Kakak ibu. 15. Anak perempuan atau istri pertapa.



9 7 3 1 5 6 8 2 3 3 6 1 8 2


2 1 4 3 2 9 5 1 4 6 8 4 6 3 1 9 5 9 8 6 1 2 5 9 8 9 6 2 6 4 3 *215



WASPADA Senin 30 September 2013

Timnas U-23 Gagal PALEMBANG (Waspada): Indonesia gagal merengkuh medali emas sepakbola Islamic Solidarity Games (ISG) 2013. Sempat unggul cepat, Timnas U-23 takluk 1-2 dari Maroko di Stadion Gelora Sriwijaya Jakabaring, Palembang, Minggu (29/9). Mengawali laga, kedua tim tampil seimbang. Namun pertahanan Maroko blunder melepas umpan yang langsung dikejar Bayu Gatra. Keluar dari sarangnya, kiper Maroko terpaksa mengganjal Bayu di area terlarang. Tanpa ragu, wasit menunjuk titik putih. Alfin Tuasalamony ditunjuk sebagai eksekutor dan sukses menjalankan tugasnya. Sayang, dalam situasi unggul, Indonesia justru kesulitan mengembangkan permainan. Tertinggal sejak awal dan tiada henti melancarkan serangan, Maroko akhirnya ber-

hasil membobol gawang Kurnia Meiga. Setelah peluang emas pertama membentur tiang gawang di menit 54, Ma-roko akhirnya menyamakan kedudukan di menit 72 lewat Hassuni Aemani. Tepat menit 82 atau 10 menit berselang, Maroko bahkan balik unggul 2-1. Tendangan El Karti Walid yang masuk ke jantung pertahanan Indonesia gagal dihalau Kurnia Meiga. Dalam tempo 15 menit tersisa, Timnas U-23 memiliki dua peluang. Namun, kedua peluang emas hasil sepakan Andik Vermansyah hanya membentur tiang gawang Benachour Badreddin. Skor 2-1 bertahan untuk Maroko dan impian Indonesia meraih emas sepakbola ISG pun kandas. Kalah di final, Timnas U-23 yang dipersiapkan untuk SEA Games 2013 di Myanmar harus puas mempersembahkan medali perak. Sebelumnya, Turki

Perolehan Medali Sementara ISG Indonesia Mesir Turki Malaysia Iran Maroko Arab Saudi Azerbaijan Aljazair Oman Bahrain Suriah Irak Qatar Jordania Tunisia Kuwait Guyana UAE Palestina Bangladesh Turkmenista Kamerun Libya

29 25 20 19 17 9 7 6 5 3 2 2 2 1 1 1 0 0 0 0 0 0 0 0

29 23 25 13 14 13 3 8 5 2 1 1 1 1 1 0 5 2 1 1 1 0 0 0

23 28 41 22 10 12 4 7 7 5 3 2 1 2 1 3 3 0 3 0 0 2 2 1

memastikan medali perunggu usai mengalahkan Arab Saudi, 2-1. (m33/ant)

PEBALAP Marc Marquez (kanan) menjuarai MotoGP Aragon, sedangkan Dani Pedrosa terjatuh di Sirkuit Motorland, Minggu (29/9) malam. -AP-

Marquez Semakin Dekat Hasil MotoGP Aragon Marc Marquez Jorge Lorenzo Valentino Rossi Alvaro Bautista Stefan Bradl Cal Crutchlow Bradley Smith Andrea Dovizioso Nicky Hayden Andrea Iannone

Spanyol/Repsol Honda Spanyol/Yamaha Factory Italia/Yamaha Factory Spanyol/Honda Gresini Jerman/LCR Honda Inggris/Yamaha Tech 3 Inggris/Yamaha Tech 3 Italia/Ducati Team AS/Ducati Team Italia/Pramac Ducati

42:03.459 42:04.815 42:16.386 42:17.246 42:17.432 42:18.121 42:34.679 42:44.130 42:56.872 42:58.526

10 Besar Kejuaraan Dunia Marc Marquez Jorge Lorenzo Dani Pedrosa Valentino Rossi Cal Crutchlow Stefan Bradl Alvaro Bautista Andrea Dovizioso Nicky Hayden Bradley Smith

Spanyol/Repsol Honda Spanyol/Yamaha Factory Spanyol/Repsol Honda Italia/Yamaha Factory Inggris/Yamaha Tech 3 Jerman/LCR Honda Spanyol/Honda Gresini Italia/Ducati Team AS/Ducati Team Inggris/Yamaha Tech 3

278 Poin 239 219 185 156 135 125 112 102 80

ARAGON, Spanyol (Waspada): Rider Repsol Honda, Marq Marquez, memenangkan duel sesama rider Spanyol di depan pendukung sendiri setelah mengatasi perlawanan juara bertahan Jorge Lorenzo untuk merebut gelar MotoGP Aragon di Sirkuit Motorland, Aragon, Minggu (29/9). Marquez menyelesaikan 23 putaran balapan dengan waktu 42 menit 3,459 menit. Rookie tersebut unggul 1,356 detik atas Lorenzo yang finish 42:4,815. Valentino Rossi, rekan setim Lorenzo di Yamaha, merebut podium ketiga dengan selisih 12,9 detik. Gelar di Aragon menjadi kemenangan keenam bagi Marquez di musim 2013 dan menjadikannya di ambang gelar juara dunia. Dengan keunggulan 39 angka atas Lorenzo, Marquez hanya perlu naik podium di sisa empat seri mendatang untuk menjadi juara di musim debutnya. Seperti biasa, Lorenzo langsung menyerang dengan melewati Marquez selaku peraih

Ultah Terpahit Pedrosa ARAGON, Spanyol (Waspada): Di kala moment ulang tahun terasa spesial, Dani Pedrosa justru merasakan kepahitan. Merayakan hari jadinya ke-28, rider Repsol Honda itu terjatuh di lintasan Sirkuit Motorland saat berpacu dalam MotoGP Aragon, Minggu (29/9). Pahitnya, kado Pedrosa adalah kegagalan menyelesaikan balapan. Ironisnya, Pedrosa merupakan jawara di Aragon tahun lalu. Namun, tahun ini cerita berbeda menimpa pria asal Negeri Matador itu. Melintasi tikungan 12, Pedrosa terjatuh dan harus ditandu menuju pusat medis. Hasil pemeriksaan awal menunjukkan Pedrosa tidak mengalami cedera serius.

“Sayangnya, sepertinya mereka (Marquez dan Pedrosa) saling bersentuhan dan sensor ban belakang (pada motor Pedrosa) rusak. Setelah itu, tidak ada lagi kontrol traksi yang menyebabkan Dani kecelakaan. Beruntung, dia bisa kembali ke garasi dan baik-baik saja,” ucap Manajer Tim Repsol Honda, Livio Suppo. Setelah balapan, Suppo terlibat pembicaraan cukup panjang dengan Marquez yang akhirnya menjuarai lomba tersebut sekaligus mengungguli duet Yamaha, Jorge Lorenzo dan Valentino Rossi. Hasil ini pun kian memperbesar peluang Marquez menjadi kampiun MotoGP di musim debutnya.

“Saya sedikit menyenggol Pedrosa dan melihatnya terjatuh. Saya juga sempat melebar, tapi bisa melanjutkan balapan,” ungkap Marquez dalam sesi konferensi pers. Usai balapan sialnya, Pedrosa masih menyempatkan hadir di konferensi pers. Kepada wartawan, Pedrosa menjelaskan dirinya tidak mengalami cedera dan tetap kondisi sehat. Kendati begitu, dirinya mengaku pinggul dan daerah selangkanya terasa nyeri akibat terjatuh. “Pinggul dan tulang selangka saya memang terkena benturan keras. Beruntung, saya baik-baik saja dan terhindar dari cedera parah, khususnya bahu,” ungkapnya. (m33/mgp)


PEBALAP Repsol Honda Dani Pedrosa (kiri) terjatuh, sedangkan Marc Marquez (kanan) menjuarai MotoGP Aragon, Minggu (29/9) malam.

pole di tikungan pertama, disusul Dani Pedrosa dan Rossi. Persaingan lagi-lagi menjadi milik trio Negeri Matador antara Lorenzo, Marquez, dan Pedrosa. Di lap kelima, Pedrosa berhasil menyusul Marquez untuk menempel Lorenzo. Namun satu lap berikut Pedrosa keluar dari balapan karena mengalami terjatuh. Alhasil, persaingan perebutan gelar juara menjadi milik Lorenzo dan Marquez. Marquez, sempat melebar sebelum Pedrosa terjatuh, kembali menekan Lorenzo di paruh kedua lomba. Pada putaran ke14, pria berusia 20 tahun ini me-

nyalip seniornya itu untuk seterusnya memimpin lomba dan merebut gelar kampiun. Bagi Marquez, hasil ini menebus dua kali runner-up di dua lomba terakhir. Sementara itu, Rossi memenangkan pertarungan di rombongan kedua dengan mengatasi Alvaro Bautista (Honda Gresini), Stefan Bradl (LCR Honda), dan Cal Crutchlow (Yamaha Tech 3). The Doctor pun menapak podium pertama kali sejak menjuarai MotoGP Belanda, akhir Juni lalu. Selepas Aragon, Marquez masih memimpin klasemen kejuaraan dunia dengan total 278 poin disusul Lorenzo (239). Pedrosa tetap di urutan ketiga dengan 219 angka dan Rossi menempel hasil mengoleksi 185 poin. Berikut, MotoGP berlanjut di Sirkuit Sepang, Malaysia 13 Oktober mendatang. (m47/ap)


STRIKER Timnas U-23, Sunarto (15), terjatuh akibat ganjalan pemain Maroko dalam final sepakbola ISG III di Stadion Gelora Sriwijaya, Jakabaring, Palembang, Minggu (29/9) malam.

Lorenzo Kalah Cepat

ARAGON, Spanyol (Waspada): Jorge Lorenzo (foto kiri) sempat berpeluang memenangi MotoGP Aragon, Minggu (29/ 9). Namun pebalap Spanyol itu mengakui bahwa Marc Marquez (foto kanan) lebih kencang dibanding dirinya di Sirkuit Mo-torland. Lorenzo, start lebih baik daripada Marquez yang start terdepan, memimpin sampai

putaran ketujuh dalam kondisi mendapat perlawanan ketat dari Marquez dan Dani Pedrosa. Keunggulan itu membesar ketika Pedrosa terjatuh dan Marquez melebar ke luar lintasan di lap ketujuh tersebut, sehingga Lorenzo melesat. Akan tetapi, Marquez terus menempel dan mendekati Lorenzo. Setibanya di enam putaran terakhir, Marquez berhasil

menyalipnya dan Lorenzo tak sanggup mengejar ketinggalannya. Akibatnya, Lorenzo pun harus puas finish kedua. “Seperti biasa, aku mencoba melebarkan jarak di awal lomba. Tapi ketika Marc memangkas semua jarak itu, aku rileks untuk mencoba dan menghemat tenaga untuk terus bertarung sampai akhir balapan,” tutur Lorenzo. “Sungguh, dia lebih tangguh di sepanjang akhir pekan ini. Aku sudah berusaha sekuat tenaga untuk membuntuti, tapi ternyata mustahil. Tak ada alasan, dia lebih cepat dan kami harus memikirkan balapan selanjutnya,” aku Lorenzo sportif. Dengan selisih 39 poin di klasemen sementara, Lorenzo dan Marquez yang masih memimpin kompetisi diprediksi akan bertarung lebih sengit lagi di sisa empat seri. Keempat seri itu adalah Malaysia, Australia, Jepang, dan Valencia (Spanyol). (m33/mgp)

Pasang Iklan Telp. 4528431 HP. 081370328259 Email:



WASPADA Senin 30 September 2013

PEBALAP Marc Marquez (kanan) menjuarai MotoGP Aragon, sedangkan Dani Pedrosa terjatuh di Sirkuit Motorland, Minggu (29/9) malam. -AP-

Marquez Semakin Dekat ARAGON, Spanyol (Waspada): Rider Repsol Honda, Marq Marquez, memenangkan duel sesama rider Spanyol di depan pendukung sendiri setelah mengatasi perlawanan juara bertahan Jorge Lorenzo untuk merebut gelar MotoGP Aragon di Sirkuit Motorland, Aragon, Minggu (29/9).

Marquez menyelesaikan 23 putaran balapan dengan waktu 42 menit 3,459 menit. Rookie tersebut unggul 1,356 detik atas Lorenzo yang finish 42:4,815. Valentino Rossi, rekan setim Lorenzo di Yamaha, merebut podium ketiga dengan selisih 12,9 detik.

Gelar di Aragon menjadi kemenangan keenam bagi Marquez di musim 2013 dan menjadikannya di ambang gelar juara dunia. Dengan keunggulan 39 angka atas Lorenzo, Marquez hanya perlu naik podium di sisa empat seri mendatang untuk menjadi juara di

musim debutnya. Seperti biasa, Lorenzo langsung menyerang dengan melewati Marquez selaku peraih pole di tikungan pertama, disusul Dani Pedrosa dan Rossi. Persaingan lagi-lagi menjadi milik trio Negeri Matador antara Lorenzo, Marquez, dan Pedrosa.

Djokovic Berpeluang Samai Rekor Agassi NEW YORK, AS (Waspada): Novak Djokovic (foto) sudah lama nyaman berada di peringkat pertama dunia hingga memasuki pekan ke-100. Torehan manis tersebut membuat petenis asal Serbia itu menyamai rekor yang dimiliki oleh Andre Agassi (AS). Djokovic menjadi orang kesembilan yang sukses bertahan cukup lama di posisi puncak ATP. The Djoker mendekati rekor milik Agassi (101 pekan), Rafael Nadal (Spanyol/ 102), Bjorn Borg (Swedia/109), John McEnroe (AS/170), Jimmy Connors (AS/268), Ivan Lendl (Rep Ceko/270), Pete Sampras (AS/286), dan Roger Federer (Swiss/302). “Saya dididik untuk punya mimpi besar dan menjadi nomor satu di dunia. Capaian ini membutuhkan kerja keras dan


dedikasi bertahun-tahun. Butuh proses panjang untuk menjadi seorang juara,� kata Djokovic, Minggu (29/9). Kesuksesan Djokovic bermula pada Juli 2011, di mana dirinya sukses mengakhiri dominasi Federer dan Nadal. Petenis berusia 26 tahun tersebut menggeser keduanya usai memenangkan Wimbledon 2011. Terlebih, dirinya berhasil memboyong tiga titel grand slam dan lima trofi ATP World Tour pada tahun yang sama. Kini, posisinya dengan koleksi 11120 poin mulai terancam oleh Nadal yang berada di posisi kedua. (m33/ap)

Pasang Iklan

Di lap kelima, Pedrosa berhasil menyusul Marquez untuk menempel Lorenzo. Namun satu lap berikut Pedrosa keluar dari balapan karena mengalami terjatuh. Alhasil, persaingan perebutan gelar juara menjadi milik Lorenzo dan Marquez. Marquez, sempat melebar sebelum Pedrosa terjatuh, kembali menekan Lorenzo di paruh kedua lomba. Pada putaran ke-14, pria berusia 20 tahun ini menyalip seniornya itu untuk seterusnya memimpin lomba dan merebut gelar kampiun. Bagi Marquez, hasil ini menebus dua kali runner-up di dua lomba terakhir. Sementara itu, Rossi memenangkan pertarungan di rombongan kedua dengan mengatasi Alvaro Bautista (Honda Gresini), Stefan Bradl (LCR Honda), dan Cal Crutchlow (Yamaha Tech 3). The Doctor pun menapak podium pertama kali sejak menjuarai MotoGP Belanda, akhir Juni lalu. Selepas Aragon, Marquez masih memimpin klasemen kejuaraan dunia dengan total 278 poin disusul Lorenzo (239). Pedrosa tetap di urutan ketiga dengan 219 angka dan Rossi menempel hasil mengoleksi 185 poin. Berikut, MotoGP berlanjut di Sirkuit Sepang, Malaysia 13 Oktober mendatang. (m47/ap)

Te l p . 4 5 2 8 4 3 1 H P. 0 8 1 3 7 0 3 2 8 2 5 9 E m a i l :

Hasil MotoGP Aragon Marc Marquez Jorge Lorenzo Valentino Rossi Alvaro Bautista Stefan Bradl Cal Crutchlow Bradley Smith Andrea Dovizioso Nicky Hayden Andrea Iannone

Spanyol/Repsol Honda Spanyol/Yamaha Factory Italia/Yamaha Factory Spanyol/Honda Gresini Jerman/LCR Honda Inggris/Yamaha Tech 3 Inggris/Yamaha Tech 3 Italia/Ducati Team AS/Ducati Team Italia/Pramac Ducati

42:03.459 42:04.815 42:16.386 42:17.246 42:17.432 42:18.121 42:34.679 42:44.130 42:56.872 42:58.526

10 Besar Kejuaraan Dunia Marc Marquez Jorge Lorenzo Dani Pedrosa Valentino Rossi Cal Crutchlow Stefan Bradl Alvaro Bautista Andrea Dovizioso Nicky Hayden Bradley Smith

Spanyol/Repsol Honda Spanyol/Yamaha Factory Spanyol/Repsol Honda Italia/Yamaha Factory Inggris/Yamaha Tech 3 Jerman/LCR Honda Spanyol/Honda Gresini Italia/Ducati Team AS/Ducati Team Inggris/Yamaha Tech 3

278 Poin 239 219 185 156 135 125 112 102 80

Medan Metropolitan

WASPADA Senin 30 September 2013

KASAT Lantas Polresta Medan Kompol M. Budi Hendrawan, SIK, SH dan personelnya Brigadir Ericson Ritonga, SH memantau arus lalulintas di jalur wisata Medan – Berastagi tepatnya tikungan PDAM Tirtanadi, Sibolangit, Sabtu (28/9).


Waspada/ME Ginting

Jalan Medan - Berastagi Rawan Kecelakaan Kasat Lantas Polresta Medan Ingatkan Sopir Bus Umum Tidak Ugal-ugalan MEDAN (Waspada): Ruas jalan Medan – Berastagi rawan kecelakaan terutama pada hari Sabtu, Minggu dan hari libur umum lainnya. Pasalnya, lebar jalan tidak sebanding dengan volume kendaraan yang melintas pada hari libur tersebut. Pantauan Waspada di lapangan pada Sabtu (28/9) hingga Minggu (29/9), lebar jalan yang berkisar enam meter itu, dilintasi ribuan kendaraan bermotor baik dari arah Medan menuju Berastagi dan sebaliknya. Sementara, sejumlah sopir bus penumpang umum terlihat ugal-ugalan dan saling berlomba di tengah jalan yang berliku serta padat lalulintas itu. Guna mengantisipasi terjadinya kecelakaan lalulintas tersebut, Kasat Lantas Polresta Medan Kompol M. Budi Hendrawan, SIK, SH bersama personelnya memantau arus kendaraan di ruas jalan Medan – Berastagi. Kasat Lantas Polresta Medan Kompol M. Budi Hendrawan, SIK, SH mengatakan, di sepanjang jalan Medan – Berastagi, terdapat sejumlah lokasi yang dianggap rawan kecela-

kaan lalulintas. Diantaranya, tikungan PDAM Tirtanadi, kawasan Sembahe atas, Sibolangit, Bandar Baru dan lainnya. “Pada Sabtu, Minggu serta hari libur umum lainnya, volume kendaraan yang melintasi ruas jalan tersebut meningkat hingga 30 persen. Sebab, banyak masyarakat yang ingin berlibur di daerah wisata Berastagi dan sekitarnya,” kata Kompol Budi didampingi personelnya Brigadir Ericson Ritonga, SH. Lebar jalan yang tidak sebanding dengan volume kendaraan menjadi salah satu faktor penyebab kemacatan dan kecelakaan lalulintas. Kondisi ini semakin parah jika sopir bus penumpang umum bertindak ugal-ugalan di jalan raya. Sat Lantas Polresta Medan terus berupaya mencegah terjadinya kemacatan dan kecelakaan lalulintas di jalur wisata Medan – Berastagi. “Setiap hari libur, Sat Lantas Polresta Medan menempatkan 15 hingga 20 personel di sepanjang jalur wisata Medan – Berastagi. Kita berupaya memberi pelayanan kepada masyarakat yang hendak berlibur ke daerah pegunungan,” ujar Budi. Pasca terjadinya erupsi Gu-

nung Sinabung, Kompol Budi mengatakan, volume kendaraan sedikit menurun dibanding hari-hari biasa. Beberapa hari kemudian, volume kendaraan kembali meningkat terutama pada Sabtu dan Minggu. Saat mengatur arus lalulintas di tikungan PDAM Tirtanadi, Kecamatan Sibolangit, Kompol Budi Hendrawan bersama personelnya Brigadir Ericson Ritonga, SH mengimbau setiap pengemudi kendaraan bermotor agar berhati-hati dan mematuhi rambu lalulintas. Budi juga mengimbau sopir bus dan angkutan umum lainnya agar tidak ugal-ugalan di jalan raya. “Sopir bus harus mengutamakan keselamatan penumpang dan pengguna jalan lainnya. Jangan ugal-ugalan di jalan raya. Ingat, keluarga anda menanti di rumah,” imbau Budi melalui pengeras suara. Selain itu, Budi juga sempat menegur sejumlah pengendara sepedamotor yang tidak memakai helm. “Helm merupakan salah satu syarat kelengkapan berkendara. Helm melindungi pengendara sepedamotor dari dampak buruk akibat kecelakaan lalulintas,” ujarnya.

Rusak Sementara itu, badan jalan Medan – Berastagi terlihat rusak di beberapa lokasi. Padahal, ruas jalan tersebut menghubungi ibukota Provinsi Sumatera Utara ke daerah objek wisata Berastagi. Permukaan jalan terlihat tidak rata dan berlubang karena sering digenangi air. Banyak faktor yang menyebabkan kerusakan jalan tersebut. Diantaranya longsor, drainase tidak berfungsi, banyaknya tempat pencucian kendaraan (doorsmeer) dan lain-lain. Keberadaan genangan air tersebut menyebabkan tingkat ketahanan badan jalan menjadi berkurang sehingga mudah rusak, apalagi jika dilintasi bertonase tinggi yang melebihi kemampuan jalan. Karena itu, tidak mengherankan jika ada lokasi tertentu di sepanjang jalan Medan Berastagi yang selalu mengalami kerusakan. Untuk mengurangi potensi kerusakan tersebut, diperlukan penyiapan dan pembangunan saluran drainase di pinggir jalan guna mencegah munculnya genangan air di badan jalan.(h03/m36)

Politeknik MBP Wisuda 223 Ahli Madya MEDAN (Waspada): Politeknik Mandiri Bina Prestasi (MBP), Sabtu (28/9), mewisuda 223 ahli madya dari berbagai program studi (Prodi) di Aula AMIK MBP Jln. Letjen Jamin Ginting, Padang Bulan, Medan. Koordinator Kopertis Wilayah I Sumut-Aceh Prof. Dian Armanto mengatakan, para mahasiswa yang kuliah di perguruan tinggi swasta pantas ber-

bangga. Karena berdasarkan UU RI No. 12 Tahun 2012 tentang Pendidikan Tinggi, telah diamanatkan tidak ada perbedaan antara Perguruan Tinggi Negeri (PTN) dan Perguruan Tinggi Swasta (PTS).Yang membedakan keduanya hanya tingkat akreditasi dijadikan standar penilaian mutu pada setiap prodi. Kepada pengelola Politeknik

MBP, Koordinator Kopertis itu menyarankan agar terus melakukan evaluasi demi perbaikan dalam pengelolaan institusi sehingga menghasilkan lulusan berkualitas yang siap pakai. “Saya berharap Politeknik MBP menjadi lokomotif bagi perubahan dan modernisasi serta daya saing bagi bangsa Indonsia,” katanya dalam sambutan tertulis yang dibacakan Drs. Rudy K.

Waspada/Aidi Yursal

KETUA Yayasan MBP Dr. Anna Mari Ulina Bukit dan Direktur Politeknik MBP Drs. Tenang Malem Tarigan serta para dosen foto bersama dengan para wisudawan/ti di Aula kampus AMIK MBP.

Nababan,M.Si. Sementara Ketua Yayasan Mandiri Bina Prestasi (MBP Dr. Anna Mari Ulina Bukit mengucapkan selamat kepada para wisudawan/ti yang setelah melewati berbagai rintangan dan tantangan selama mengikuti perkuliahan sehingga berhasil menyelesaikan pendidikan tingginya. Dia meminta kepada para wisudawan agar tidak berhenti sampai di situ, tetapi terus melanjutkan ke jenjang pendidikan lebih tinggi. Direktur Politeknik MBP Drs. Tenang Malem Tarigan mengakui walau perguruan tinggi swasta yang dipimpinnya itu baru berumur 11 tahun, namun telah berhasil menjadi kampus yang dikenal di tingkat lokal dan nasional. “Sertifikasi Sistem Manajemen Mutu ISO 9001:2008 yang berhasil diraih dan secara berkelanjutan dipertahankan merupakan pengakuan internasional terhadap Politeknik MBP,” katanya seraya mengumumkan tiga lulusan terbaik tahun 2013 yaitu Reniwati Nababan (Keuangan Perbankan) dengan IPK 3,79, Esrawati Sitorus (Akutansi) IPK 3,74 dan Norika Siburian (Akutansi) IPK 3,70. (m22)


Medan Metropolitan

WASPADA Senin 30 September 2013

Waspada/Ismanto Ismail

POHON yang ditanam Pemko Medan beberapa tahun silam sebagai hutan kota agar menciptakan kenyamanan di sepanjang Jln. Nibung Raya, Kel. Petisah Tengah, Kec. Medan Baru, kini hanya tinggal tiga sampai lima pohon saja diduga telah banyak yang ditebang. Foto diambil, Minggu (29/9).

Tanggap Darurat Dinyatakan Berakhir Status Gunung Sinabung Jadi Waspada Level 2 MEDAN (Waspada): Status tanggap darurat Gunung Sinabung di Kabupaten Tanah Karo dinyatakan berakhir. Masyarakat yang berada di pengungsian sudah bisa kembali ke desa masingmasing dan dapat melakukan kegiatan sebagaimana biasanya.

“Kepala Pusat Vulkanologi dan Mitigasi Bencana Geologi menyatakan bahwa status Gunung Sinabung turun dari Siaga level 2 menjadi Waspada level 2,” kata Kepala Pelaksana Badan Penanggulangan Bencana Daerah (BPBD) Sumut DR. Asren Nasution, MA kepada Waspada di Medan , Minggu (29/9). Namun, lanjutnya, masya-

Tiga Pengendara Sepedamotor Bawa Narkoba, Sajam Diringkus MEDAN (Waspada): Petugas Reskrim Polsek Medan Timur meringkus tiga pengendara sepedamotor yang membawa narkoba dan senjata tajam saat menggelar razia rutin di dua lokasi Jln. Gaharu dan Jln. Prof HM Yamin, Sabtu (28/9) sekira pukul 22:00. Tersangka MR, 24, warga Jln. Letda Sujono Gang Pribadi 2 Me d a n , d a n E K , 4 0 , w a r g a J l n . I s t i q o m a h G a n g Bandung, mengantongi tiga paket sabu-sabu. Sedangkan tersangka DDP, 18, warga Jln.l Pusaka, Pasar IX Tembung, membawa senjata tajam tanpa izin. Penangkapan ini bermula saat puluhan personel Polsek Medan Timur menggelar razia di Jln. Prof HM Yamin sekira pukul 22:00 WIB. Malam itu, tersangka MR yang membawa narkoba, melintas di Jln. Prof HM Yamin dengan mengendarai sepedamotor BK 5236 ADL. Petugas menghentikan laju kendaraan tersangka MR. “Setelah dihentikan, petugas curiga dengan gerak gerik tersangka lalu dilakukan penggeledahan dan menemukan satu paket sabu-sabu,” ujar Kanit Reskrim Polsek Medan Timur Iptu Jama K Purba, Minggu (29/9) siang. Selain menemukan satu paket sabu-sabu, polisi juga mengamankan barang bukti satu buah jarum suntik, dan mancis. Untuk pengembangan lebih lanjut polisi lalu memboyong tersangka ke Mapolsek Medan Timur. Tidak lama berselang, sekira pukul 23:00 WIB, petugas yang menggelar razia di Jln. Prof HM Yamin, berpindah lokasi ke Jln. Gaharu. Saat itulah, tersangka EK yang mengendarai sepedamotor Mio Hitam BK 3841 CV terjaring petugas. Dari kantong celana tersangka EK ditemukan dua paket sabu-sabu seharga Rp400 ribu. Selain meringkus kedua pecandu narkoba itu, petugas juga mengamankan seorang mahasiswa yang membawa senjata tajam saat melintas di Jln. Prof HM Yamin. Akibat perbuatannya itu, tersangka DDP dijerat UU Darurat. (h04)

rakat dan pengunjung Gunung Sinabung diharapkan tidak melakukan pendakian dan kegiatan dalam radius 2 kilometer dari kawah gunung tersebut. “Meski dinyatakan aman, tapi kita tetap waspada. Masyarakat diharapkan tetap mengikuti arahan pemerintah. Jika ada yang meragukan, maka segera minta penjelasan dengan menanyakan langsung kepada pemerintah daerah setempat. Jauhi dan hindari yang tidak jelas sumber dan kebenarannya,” ujar Asren.

MenurutAsren,BPBDSumut dan Kodim 0205 Tanah Karo sudah memasang spanduk di desadesa guna memberi penjelasan atau arahan kepada warga agar tidak panik dan tetap tenang. Terkait selesainya masa tanggap darurat, Gubsu Gatot Pujo Nugroho menyampaikan syukur dan terimakasih serta penghargaan atas perhatian semua pihak terutama para relawan, TNI/Polri, dermawan yang dengan tulus menunjukkan rasa empati kepada warga di pengungsian.

“Sebagai pribadi dan atas nama pemerintah Sumut, pak Gatot Pujo Nugroho menyampaikan terimakasih kepada semua pihak,” ujar Asren. Menurutnya, rasa saling tolong menolong sesungguhnya modal sosial yang harus dipertahankan. “Walaupun status aman, pak Gatot mengimbau agar masyarakat tetap waspada,” ujarnya. BPBD Sumut akan terus memantau Gunung Sinabung dan dalam waktu dekat akan melakukan sosialisasi ke seluruh

Pelajar SMA Keroyok Pelajar SMP MEDAN (Waspada): Merasa tidak senang karena dikeroyok sejumlah siswa Sekolah Menengah Atas (SMA), Muhammad Sandi, 15, warga lahan garapan Jln. Perhubungan Desa Lau Dendang, Kec. Percut Seituan, Sabtu (28/9) sekira pukul 15:00 mengadu ke Polsek Percut Seituan. Pasalnya, siswa kelas IX SMP swasta di Medan ini dianiaya hingga babak belur di depan sekolahnya Jln. Durung, Kecamatan Medan Tembung. Usai membuat pengaduan di Polsek Percut Seituan, korban Sandi didampingi abang kandungnya Fandi, 22, menuturkan, awalnya korban sedang menunggu angkot 121 A Rahayu tujuan Desa Laut Dendang. Di saat bersamaan, korban berpapasan dengan teman sekolahnya berinisial H, 14, warga Jln. Kapten B. Sihombing Kec. Percut Seituan, yang juga sedang menunggu angkot. Tak lama angkot yang ditunggu datang

dan keduanya menaiki angkot tersebut. Setahu bagaimana, H memukul kepala korban. Korban yang tidak terima kepalanya dipukul, lalu membalas pukulan tersebut. Akibatnya terjadi keributan di dalam angkot. Keduanya turun dari angkot dan berkelahi di depan sekolah mereka. Saat itu, sejumlah pelajar di sekolah tersebut sempat melerai perkelahian itu. Diduga tak senang, H mengadu kepada abangnya yang duduk di bangku SMA. Tidak berapa lama, empat pelajar SMA mendatangi korban dan memukulinya hingga babak belur. Teman korban, Diki, 14, yang melihatnya tidak mampu berbuat banyak. Setelah dipukuli, korban pulang ke rumahnya dan mengadukan kejadian ini kepada abangnya, Fandi. Melihat adiknya dipukuli, Fandi membawa korban ke Polsek Percut Seituan untuk membuat pengaduan.

“Aku sedang nunggu angkot mau pulang bang. Rupanya si H naik juga sama kawankawannya. Terus dipukulnya kepalaku, kubalas lah. Tapi dia marah dan mengajak aku berantam,” cerita Sandi yang menderita memar di wajahnya. Fandi, abang korban, mengharapkan petugas Polsek Percut Seituan segera menindaklanjuti pengaduannya sekaligus menangkap para pelaku penganiayaan. “Polisi harus segera menangkap pelakunya, karena bila tidak ditangkap akan mengganggu proses belajar di sekolah tersebut,” sebut Fandi. Sementara itu, Kapolsek Percut Seituan AKP Ronald Sipayung ketika dikonfirmasi terkait masalah ini mengatakan, pihaknya sudah menerima laporan atas kasus penganiayaan itu dan memprosesnya. “Sudah kita terima laporannya dan kini masih dalam proses”, jawab Ronald singkat. (h04)

desa di 4 kecamatan yang berada di kaki Gunung Sinabung. “Kita sudah buat rencana. Walaupun sederhana tapi bermanfaat bagi masyarakat. Sinabung bagian dari kehidupan masya-

rakat Karo, maka tidak ada pilihan, kita harus hidup harmonis dengan Sinabung,” tambahnya. Guna membangun harmonisasi, maka strategi yang efektif adalah melestarikan dan mem-

bangkitkan kearifan lokal. “Generasi muda harus kembali kepada kearifan lokal. Itu mitigasi yang efektif dalam pengurangan risiko bencana,” demikian Asren.(h02)

Pintu Pagar Gereja HKBP Nommensen Dijebol MEDAN (Waspada): Keributan antarsesama jemaat di Gereja HKBP Nommensen Jln. Rumah Sakit, Kel Pulo Brayan Bengkel, Kec Medan Timur, Minggu (29/9), terus berlanjut. Setelah saling lempar batu, pintu pagar gereja akhirnya dijebol jemaat yang tidak bisa melaksanakan kebaktian. Informasi yang diperoleh di lokasi kejadian, sekira pukul 13:00, sejumlah jemaat dari kelompok pro Pendeta P Panggabean langsung menutup pintu gereja dan pagar di depan gereja usai melaksanakan kebaktian. Meski telah usai melaksanakan kebaktian, namun para jemaat tersebut tidak meninggalkan gereja. Mereka tetap bertahan di dalam lingkungan gereja. Aksi jemaat tersebut membuat jemaat yang pro aturan dan peraturan tidak bisa masuk ke dalam gereja guna melaksanakan kebaktian. Setelah terlibat saling sorak dan menyindir, tibatiba jemaat dari dua kubu saling lempar batu. Beberapa petugas kepolisian terkena lemparan. Tidak hanya itu, sejumlah jemaat merusak pintu pagar. Sejumlah personel Polsek Medan Timur, Sat Sabhara Polresta Medan dan Gegana Brimob yang berada di lokasi segera mengamankan kedua kubu jemaat yang bertikai. Para

jemaat dari kubu Pendeta P Panggabean yang berada di dalam lingkungan gereja akhirnya dikeluarkan dengan pengawalan ketat aparat kepolisian. Begitu juga dengan kubu lawannya juga membubarkan diri sehingga suasana kondusif. Jemaat dari kubu pro aturan dan peraturan yang gagal beribadah merasa kesal karena pihak lawannya sengaja mengunci pintu gereja dan pintu pagar sehingga mereka tidak bisa melaksanakan kebaktian. “Ini negara hukum, jangan larang orang untuk melaksanakan ibadah. Beri kami kebebasan beribadah sesuai UUD 45,” teriak seorang jemaat yang berada di luar gereja. Pantauan Waspada, seratu-

san personel Polri termasuk Polwan sejak pukul 09:00 sudah berada di sekitar lokasi gereja HKBP Nommensen guna mengamankan kebaktian di gereja tersebut. Terlihat juga Kasat Binmas Polresta Medan Kompol A Hutauruk, Kasat Intel Polresta Medan Kompol Faisal Napitupulu, Kapolsek Medan Timur Kompol Juliani Prihartini,Wakapolsek AKP Lili, Kanit Reskrim Polsek Medan Timur Iptu Jama K Purba, Kanit Intel Iptu P Simamora, Panit Intel Drs. H Hermansah dan Kanit Provost Rizal sibuk mengantisipasi kericuhan tersebut. Hingga pukul 15:30 seluruh jemaat akhirnya membubarkan diri dan kembali ke rumah masing-masing. (h04)

Waspada/Andi Aria Tirtayasa

POLISI berjaga-jaga di gereja HKBP Nommensen, Kec Medan Timur, Minggu (29/9).

Hagana USM Indonesia Jadi Relawan Aktif, Terlatih Dan Terkoordinir MEDAN (Waspada): Mahasiswa Siaga Bencana (Hagana) Universitas Sari Mutiara (USM) Indonesia yang terbentuk dan lahir pada akhir tahun 2012, kini menjadi relawan aktif yang terkoordinir dan terlatih. Dimana, anggota yang terdiri dari mahasiswa dan alumni USM Indonesia itu, siap ditempatkan di berbagai lokasi bencana. “Hagana USM Indonesia memang sudah terlatih dan terkoordinir pada kluster (kelompok atau bidang) kesehatan dan psikososial,” kata Koordinator Relawan Kluster Kesehatan dan Psikososial USM Indonesia Otniel Ketaren, MSi kepada Waspada, Jumat (27/9), menanggapi perhatian dan penilaian berbagai pihak terhadap kehadiran Hagana USM Indonesia pada saat terjadi bencana erupsi Gunung Sinabung, Tanah Karo belum lama ini. Menurutnya, relawan Hagana bukan relawan dadakan, akan tetapi relawan yang sudah mengetahui serta menguasai tugas dan fungsinya dalam penanggulangan bencana. “Relawan harus terlatih dengan baik. Bukan sekadar relawan yang tidak mengetahui tugas dan fungsinya di lokasi bencana, sehingga kehadi-


KOORDINATOR Relawan Kluster Kesehatan dan Psikososial USM Indonesia Otniel Ketaren, MSi rannya hanya menambah beban para korban bencana,” tegasnya. Nota Kesepahaman Dijelaskannya, pada Agustus 2013, USM Indonesia dan Badan Penanggulangan Bencana Daerah (BPBD) Sumatera Utara telah melaksanakan penandatanganan naskah kerjasama atau nota kesepahaman. Ini merupakan langkah kongkrit dari Hagana yang ada di USM

Indonesia menjadi relawan penanggulangan bencana. “Dalam penanggulangan bencana, ada lima pilar yang terlibat. Diantaranya Pemerintah, Swasta, Perguruan Tinggi, Masyarakat dan Media Massa. Hagana USM Indonesia berada pada pilar Perguruan Tinggi dan fokus kepada Kluster Kesehatan dan Psikososial. Hagana akan mengambil peran pada kluster yang dikuasainya dan berkoordinasi dengan pihak BPBD Sumatera Utara,” jelas Otniel didampingi Kepala Biro Humas USM Indonesia Ir. Fadmin Malau Tidak saja ketika terjadi bencana, Hagana USM Indonesia juga akan terus melakukan koordinasi dengan BPBD Sumatera Utara dalam mengantisipasi terjadinya bencana, seperti mengembangkan kurikulum pendidikan kebencanaan dan penelitian bidang kebencanaan. Sejalan dengan Nota Kesepahaman yang telah ditandatangani, maka pelatihan terkait dengan kebencanaan Kluster Kesehatan dan Psikososial akan dilakukan di USM Indonesia dengan pelaksana BPBD Sumatera Utara. Menurutnya lagi, kerjasama

antara USM Indonesia dengan BPBD Sumatera Utara akan menghasilkan sumber daya manusia yang andal dan mampu bekerja dengan baik dalam penanggulangan bencana. “Relawan itu tidak hanya sekadar melihat-lihat saja, tetapi bekerja membantu penanggulangan bencana dengan cepat dan tepat sasaran,” imbuhnya. Mantan Kepala BTKL-PP Medan UPT Kementerian Kesehatan RI ini mengaku optimis pada masa mendatang Hagana akan lebih baik lagi, karena semakin fokus dengan bidangnya yakni Kluster Kesehatan dan Psikososial. Disamping itu, sesuai dengan Tri Dharma Perguruan Tinggi dan lima pilar penanggulangan bencana, maka USM Indonesia akan terus menjadi yang terbaik dengan memebrikan pelatihan-pelatihan kepada para relawan. Tidak sampai itu saja, Hagana USM Indonesia akan mensosialisasikan penanggulangan bencana bagi semua orang, mulai dari anakanak, remaja dan orangtua sebagaimana yang ada dalam Nota Kesepahaman yakni mengembangkan kurikulum pendidikan kebencanaan dan penelitian bidang kebencanaan. (h02)


REKTOR USM Indonesia Dr. Ivan Elisabeth Purba, MKes dan Kepala BPBD Sumut DR. Asren Nasution, MA melakukan penandatangan naskah kerjasama, Kamis (29/8) lalu.

Medan Metropolitan

WASPADA Senin 30 September 2013

Mayat Dalam Parit

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight


Tiba Dari


GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-278 11 Banda Aceh GA-142 12 Banda Aceh GA-280 14 Palembang GA-266 15. Palembang GA-268 16. Batam GA-270 17. Batam GA-272 18. Padang GA-260 19. Penang GA-802 20. Penang GA-804

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.30 06.10 09.40 17.10 06.00 17.1 09.30 13.20 10.35 06.20 13.55

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Palembang Palembang Batam Batam Padang Penang Penang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-279 GA-143 GA-281 GA-267 GA-269 GA-271 GA-273 GA-261 GA-803 GA-805

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 08.45 12.35 19.45 09.55 21.15 12.50 19.45 16.25 08.55 16.20

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru 14 Singapura 15 Singapura

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981 QZ-8022 QZ-8028 QZ-664 QZ-668

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10 11.00 07.00 09.20 18.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru Singapura Singapura

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029 QZ-665 QZ-669

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30 12.35 21.15

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura


MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Jadwal Perjalanan Kereta Api No KA

Nama KA





U.28 Sri Bilah Eks/Bisnis Medan RantauPrapat U30 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.32 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.34 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.27 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.29 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.31 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.33 Sri Bilah Eks/Bisnis Rantau Prapat Medan U35 Sri Lelawangsa Ekonomi Tebing Tinggi Medan U36 Sri Lelawangsa Ekonomi Medan Tebing Tinggi U37 Sireks Ekonomi Siantar Medan U38 Sireks Ekonomi Medan Siantar U.39 Putri Deli Ekonomi Tanjung Balai Medan U.40 Putri Deli Ekonomi Medan Tanjung Balai U.41 Putri Deli Ekonomi Tanjung Balai Medan U.42 Putri Deli Ekonomi Medan Tanjung Balai U.43 Putri Deli Ekonomi Tanjung Balai Medan U.44 Putri Deli Ekonomi Medan Tanjung Balai U45 Sri Lelawangsa Ekonomi Binjai Medan U46 Sri Lelawangsa Ekonomi Medan Binjai U47 Sri Lelawangsa Ekonomi Binjai Medan U48 Sri Lelawangsa Ekonomi Medan Binjai U49 Sri Lelawangsa Ekonomi Binjai Medan U50 Sri Lelawangsa Ekonomi Medan Binjai U51 Sri Lelawangsa Ekonomi Binjai Medan U52 Sri Lelawangsa Ekonomi Medan Binjai U53 Sri Lelawangsa Ekonomi Binjai Medan U54 Sri Lelawangsa Ekonomi Medan Binjai U55 Sri Lelawangsa Ekonomi Binjai Medan U56 Sri Lelawangsa Ekonom Binjai Medan U57 Sri Lelawangsa Ekonomi Medan Binjai U58 SriLelawangsa Ekonomi Binjai Medan U59 Sri Lelawangsa Ekonomi Medan Binjai Reservasi Tiket KA Medan (061-4248666)

08.17 10.47 15.46 22.50 08.45 15.20 17.10 23.55 05.36 18.17 06.25 14.27 07.55 06.57 13.20 13.12 19.00 16.57 05.45 05.00. 07.15 06.30 09.15 08.30 11.35 10.00 14.30 12.30 16.15 17.45 17.00 21.30 20.10


13.57 16.00 21.16 03.52 14.04 20.43 22.11 05.09 07.53 20.38 10.22 18.15 12.52 11.28 17.55 17.36 23.20 21.35 06.14 05.29 07.44 06.59 09.44 08.59 12.04 10.29 14.59 12.59 16.44 18.14 17.29 21.59 20.39

Waspada/Rizky Rayanda

SEJUMLAH warga mengevakuasi sesosok mayat yang ditemukan di dalam parit Jln. Garuda, Perumnas Mandala, Minggu (29/ 9) pukul 08:00.

No. KA



MEDAN (Waspada): Truk-truk pengangkut hasilhasil perkebunan lebih banyak memadati ruas jalan di Provinsi Sumut. Ini membuat truk perkebunan menjadi penyumbang utama kerusakan ruas-ruas jalan di Sumut. “Daya tahan jalan di Provinsi Sumut semakin berkurang karena lebih banyak dilintasi truktruk perkebunan milik pemerintah maupun swasta,” ujar Kepala Dinas Bina Marga Sumut Ir H Effendy Pohan MSi, kepada wartawan, Minggu (29/9). Effendy Pohan mengatakan hal itu usai bersama Kabid Pembangunan dan Peningkatan Jalan Ir Abdul Haris Lubis MSi, Kasi Pembangunan dan Peningkatan Jalan Lamhot Pasaribu ST, MSi, dan para UPT Bina Marga meninjau ruas-ruas jalan di daerah lintas timur, lintas tengah,

dan lintas barat. Antara lain titik ruas jalan yang ditinjau seperti SibuhuanBatas Riau, Aek Godang-Gunung Tua, Sigambal-Batas Paluta, Aek Nabara-Negri Lama-Panipahan, Ulu Pungkut MadinaBatas Sumbar, AH Nasution By Pas Padangsidimpuan, Kota Pinang-Gunungtua, SipirokSimpang Tandosan-Aek Humbang Batas Taput, Sipirok-Marancar-Sipenggeng, Simpang Kota Pinang batas Paluta dan lainnya. Dia menyebutkan, truk-truk yang mengangkut hasil perkebunan dengan muatan (tonase) yang berat. Artinya, ruas-ruas jalan yang ada, jelas tidak mampu menahan beban berat muatan truk tersebut. “Terkesan muatan dipaksakan,” katanya. Menurut Effendy, sangat tidak tepat jika truk-truk dipaksa bermuatan yang melebihi kapasitas. Perusahaan semestinya

memilik itikad baik untuk juga ikut memelihara ruas-ruas jalan yang ada. “Semestinya harus ada perasaan bahwa ruas-ruas jalan juga digunakan masyarakat. Kasihan kita kalau jalan cepatcepat rusak, yang pastinya membuat biaya ekonomi tinggi dan menguras dana pemerintah untuk kembali memperbaikinya,” sebutnya. Untuk jalan rusak akibat kelebihan tonase truk-truk itu, kata dia, sangat wajar jika perusahaan perkebunan mengkompensasinya dengan turut mengalokasikan dana perbaikan ataupun pemeliharaan jalan. “Semisal dana-dana CSR, semestinya juga ada dialokasikan untuk perbaikan dan pemeliharaan jalan. Tidak masalah mau siapapun yang mengerjakannya, asalkan ada action perbaikan jalan. Atau jika dana itupun diserahkan kepada peme-

Dugaan Korupsi Alkes Labusel

Istri Tersangka Rekanan Pengadaan Alkes Ditahan MEDAN (Waspada): Penyidik Subdit III/Tipikor Direktorat Reserse Kriminal Khusus (Dit Reskrimsus) Poldasu menahan MM, istri dari tersangka RW, rekanan pengadaan Alat Kesehatan dan Keluarga Berencana (Alkes dan KB) atas dugaan korupsi pengadaan Alkes dan KB di Kab. Labuhanbatu Selatan (Labusel). Kabid Humas Poldasu Kombes Pol. Heru Prakoso dikonfirmasi wartawan, Minggu (29/9) mengatakan, pihaknya telah menahan MM, istri dari tersangka RW yang saat ini ditahan Kejaksaan Tinggi Lampung atas kasus yang sama. Tetapi Heru tidak menjelaskan secara detail penangkapan terhadap MM. Namun, kata Heru, penyidik Tipikor akan segera mengirimkan berkas perkara para tersangka kasus korupsi pengadaan Alkes dan KB Labusel itu

kepada kejaksaan Tinggi Sumut. “Untuk tindaklanjutnya, penyidik segera mengirim berkas kepada JPU,” sebutnya. Kasus dugaan korupsi Alkes dan KB terungkap saat dilakukan serah terima tiga unit alat kesehatan dalam kondisi rekondisi, yaitu refrigerator centrifuge dan dua incubator transport yang nilainya mencapai Rp3 miliar. Besarnya kerugian negara berkisar Rp10 miliar. Dananya bersumber dari Anggaran Pendapatan Belanja Daerah (APBD) dan daftar isian pelaksanaan anggaran (DIPA) No. 3230/02404.4.01/02/2012 tanggal 22 Mei 2012 senilai Rp23 miliar. “Sekarang ini kita masih menunggu hasil audit BPKP Sumut yang menghintung kerugian negara. Sedangkan hitungan sementara dari Poldasu, kerugian negara atas kasus itu diperkirahan Rp10

milar,” ujarnya. Heru mengatakan, sampai saat ini saksi yang sudah diminta keterangannya sebanyak 22 orang, termasuk saksi ahli dari lembaga kebijakan pengadaan barang jasa pemerintah (LKPP) Jakarta. Penyidik Tipikor Poldasu juga telah mengamankan barang bukti alat kesehatan dan KB rekondisi dari empat Puskesmas di Labusel. Selain itu, telah menggeledah rumah tersangka JT (rekanan) di Labusel untuk mencari dokumen yang dijadikan barang bukti dalam kasus itu. Atas kasus tersebut, enam tersangka sudah ditahan Poldasu yaitu, Sy selaku PPK (pejabat pembuat komitmen), JW (direktur perusahaan), JT (wadir I rekanan),TN alias AS dan Kadis Kesehatan Labusel RL, yang semuanya warga Labusel, dan terakhir MM istri dari rekanan RW.(m27)

SENI dan budaya tradisional yang dimiliki Indonesia masih memiliki tempat di hati masyarakat. Sebab, dengan menampilkan kesenian dan budaya

dalam satu acara, membuat masyarakat merasa terhibur. Maka tak heran, banyak orang memanfaatkan seni dan budaya tradisional untuk menyam-

paikan informasi dan edukasi. Seperti yang dilakukan Perwakilan Badan Kependudukan dan Keluarga Berencana (BkkbN) Sumut di Lapangan

Berangkat KNIA Tiba Medan

U62 04:00 04:37 U63 05:55 06:42 U4A 06:15 06:52 U71 08:35 09:19 U8A 08:20 08:57 U5A 09:25 10:02 U14A 11:10 11:47 U11A 12:25 13:02 U18A 13:45 14:22 U15A 14:55 15:42 U22A 15:15 15:52 U19A 16:25 17:02 U26A 17:15 17:52 U23A 18:30 19:07 U26 19:10 19:47 U73 20:15 20:59 U70 20:00 20:37 U75 22:15 22:59 U72 22:00 22:37 U69 00:15 00:52 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

rintah lalu pemerintah mengelolanya untuk perbaikan jalan, itupun bisa saja,” tuturnya. Memang, tugas pemerintah salah satunya adalah menyediakan infrastruktur jalan bagi masyarakat. Namun sejatinya, semua pihak harus bersama-sama mewujudkan jalan yang mantap untuk lancarnya aksebilitas transportasi.

“Nah kalau ini kan sudah pemerintah jalankan, persoalannya adalah efektifitas penggunaan jalan itu sendiri, kalau ada pihak-pihak yang oleh kegiatan usahanya menyebabkan jalan rusak, kami kira si perusahaan itu harus bertanggungjawab. Bentuk tanggung jawabnya adalah dengan turut memperbaiki jalan-jalan yang rusak itu,”

katanya. Pemprovsu sendiri di tahun 2013 melalui Dinas Bina Marga Sumut, membangun 152,2 km jalan. Dengan penambahan pembangunan jalan sebesar 4,99 % dari 3.048,5 km jalan provinsi tersebut, maka jalan provinsi berstatus mantap pada akhir 2013 akan mencapai mencapai 2.164 km.(m28)

Poldasu Razia Senpi MEDAN (Waspada): Polda Sumut akan melakukan razia senjata api ataupun replikanya seperti airsoft gun, soft gun dan lainnya sebagai langkah antisipasi perampokan bersenjata di Medan dan wilayah lainnya di Sumut. Kasubbid Pengelola Informasi dan Dokumentasi (PID) Bid Humas Poldasu AKBP MP Nainggolan mengatakan itu kepada wartawan, Sabtu (28/9). Dia menyebutkan, razia kepemilikan senjata api dan replikanya disebabkan Poldasu tidak lagi mengeluarkan izin penggunaan senjata, termasuk air softgun. “Upaya penertiban senjata sebagai langkah antisipasi maraknya kejahatan bersenjata di Sumut, seperti perampokan bersenjata api di sejumlah toko emas di beberapa tempat,” sebutnya. Tentang kegunaan airsoft gun dan soft gun, kata Nainggolan, hanya diperuntukkan untuk latihan olahraga menembak. Poldasu memberikan rekomendasi kepemilikan itu kepada Perbakin, dan digunakan untuk latihan saja, bukan untuk dibawa-bawa. “Apabila terdapat senjata api ataupun replikanya pada masyarakat, maka dipastikan ilegal, dan pemiliknya akan dijerat UU darurat dengan ancaman hukuman di atas lima tahun,” sebutnya.

Ditangguhkan Sementara itu, penyidik Subdit IV/Renakta Dit Reskrimum Poldasu telah menangguhkan penahanan anggota DPRD Sergai berinisial S, yang ditangkap di kamar hotel di Medan bersama gadis di bawah umur RA, 16. Informasi diterima wartawan, S telah berdamai dengan pihak keluarga RA, sehingga polisi menangguhkan penahanannya. Kasubdit IV Renakta Dit Reskrimum Poldasu AKBP Juliana Situmorang saat dikonfirmasi tidak bersedia menjawab. Ponselnya dihubungi tidak mengangkat. Namun Direktur Direktorat Tahanan dan Barang Bukti (Dit Tahti) Poldasu AKBP W Panjaitan membenarkan S telah ditangguhkan penahanannya.“Penangguhannya sekira dua pekan lalu, saat ini S tidak lagi berada di dalam tahanan,” ujarnya. Diberitakan sebelumnya, anggota DPRD Sergai S ditangkap bersama gadis berinisial Ra dari kamar di hotel di Jln. Sisingamangaraja, Medan, Rabu (31/7) malam. Penangkapan itu setelah polisi menerima informasi yang menyebutkan seorang mucikari menjual wanita di bawah umur kepada oknum anggota dewan.(m27)

Teror Bom Melalui SMS MEDAN (Waspada): Security Carefour Plaza Medan Fair menerima SMS teror bom dari orang yang tidak bertanggungjawab, Minggu (29/9). Informasi peroleh Waspada di lapangan, seorang security di Plaza Medan Fair sekitar pukul 13:30 menerima SMS dari seseorang yang tidak dikenal. SMS itu bertuliskan “Kota Medan saya teroris dari Batam hati2 ada bom di Medan Citra Garden.” Selanjutnya, security itu meneruskan kepada petugas keamanan di Carefour Jln. Letjen Jamin Ginting-Padangbulan Medan dan ke Polsek Medan Baru. Kapolsek Medan Baru Kompol Nasrun Pasaribu SH, SIK, MH yang mendapat informasi itu lalu menindaklanjuti dengan menurunkan Kanit Intelpam AKP Jhon S Purba SH, bersama

personelnya dari Intelpam dan Reskrim ke lokasi. Hasil penyelidikan dilapangan tidak ditemukan bom yang disebutkan dalam SMS tersebut. Selanjutnya, Jhon S. Purba memanggil dua security yang bertugas di Komplek Citra Garden Jln. Letjen Jamin Ginting-Padangbulan Medan. Dia memberi arahan kepada security tersebut agar peduli dan proaktif menjaga lingkungan tempat tugasnya untuk menghindari terjadi hal yang tidak diinginkan. “Satpam sebagai Pam Swakarsa dan sebagai perpanjangan polisi wajib menanyakan siapa saja orang yang masuk ke wilayah tempat tugasnya. Selain itu, tetap berkoordinasi dengan petugas kepolisian apabila menemukan sesuatu yang mencurigakan,” kata Jhon Purba. (m36)

Sosialisasi KKB Melalui Media Seni Dan Budaya Tradisional

Kuala Namu- Medan

No. KA

MEDAN (Waspada):Warga menemukan sesosok mayat dalam kondisi telungkup di dalam parit Jln. Garuda simpang Jln. Selindit, Perumnas Mandala, Kec Percut Seituan, Minggu (29/9) sekira pk 06:30. Setelah diperiksa petugas Identifikasi Polresta Medan, mayat tersebut diketahui bernama Mahruzal alias Nula alias Ambon, 48, warga Jln. Kepodang II, Perumnas Mandala. Informasi yang diperoleh di kepolisian, pagi itu sejumlah warga yang sedang melakukan aktifitasnya seperti berolahraga dan pergi ke pasar untuk berbelanja menemukan sesosok tubuh dalam kondisi telungkup berada di dalam parit. Setelah dicek, ternyata didalamnya terdapat mayat pria dengan posisi telungkup, memakai baju kotak-kotak, celana lea warna biru, dan sepatu ket karet, dan di punggung sebelah kanan terdapat luka gores. Atas penemuan mayat tersebut, sekira pukul 07:00 WIB, warga langsung melaporkannya ke Polsek Percut Seituan. Polisi yang mendapat laporan, langsung mendatangi lokasi serta melakukan olah TKP. Salah seorang warga, Dani mengatakan, saat itu dia melintas di lokasi dan melihat warga sudah berkerumun. “Warga sudah ramai di lokasi dan saat saya hampiri ternyata seorang pria tewas di dalam parit, dengan posisi telungkup,” ujar Dani. Petugas Identifikasi Polresta Medan memeriksa kondisi mayat menemukan luka gores di punggung kanan korban. Kapolsek Percut Seituan AKP Ronald Sipayung ketika dikonfirmasi membenarkan adanya penemuan mayat tersebut. “Pagi itu korban sempat dibawa ke Instalasi Jenazah RSU dr Pirngadi Medan, dan dilakukan visum luar. Tetapi pihak keluarga meminta agar mayat korban di bawa pulang. Kita sudah memintai keterangan 2 orang saksi yang bersama korban saat itu di warung dekat terminal angkot Perumnas Mandala,” ujarnya.(h04)

Truk Perkebunan Penyumbang Utama Kerusakan Jalan Sumut

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu



ANGGOTA Komisi IX DPR RI Drs. Ansory Siregar LC (kanan) didampingi perwakilan dari BkkbN Sumut Rosmawati (empat dari kiri) beserta perwakilan dari Kab. Asahan saat membuka acara Sosialisasi Kependudukan dan Keluarga Berencana (KKB) Melalui Media Seni dan Budaya Tradisional di Lap. Parasamya Kab. Asahan, Sabtu (28/9).

Parasamya Kab. Asahan, Sabtu (28/9). Dengan menampilkan sanggar tari dari berbagai sekolah dan grup lawak dari Kab. Asahan di acara Sosialisasi Kependudukan dan Keluarga Berencana (KKB), ribuan masyarakat yang hadir terasa terhibur dan mengerti akan pesan yang disampaikan. “Acaranya menarik, lucu juga lihat lawakan. Melihat cerita grup lawak tadi, ternyata banyak anak merepotkan. Dalam hal ini, KB ternyata penting untuk membentuk keluarga sejahtera,” kata Uli, 53, warga Kab. Asahan. Mau Berpartisipasi Inilah yang diharapkan BkkbN. Masyarakat memiliki sikap positif dan mau berpartisipasi dalam mensukseskan program KKB. Diantaranya, remaja tidak melakukan pernikahan dini, karena usia yang ideal untuk menikah adalah wanita berusia 20 tahun dan pria berusia 25 tahun. Menggunakan kontrasepsi untuk mengatur kehamilannya, cukup dua anak, serta mening-

katkan pengetahuan keluarga, pasangan usia subur tentang KKB dan ketahanan keluarga. “Pesan yang ingin disampaikan melalui media ini mudah dipahami dan dicerna masyarakat pada umumnya, sehingga mereka mau berpartisipasi menyukseskan program KKB, yakni mewujudkan keluarga kecil bahagia dan sejahtera. Ini juga upaya kita untuk menggemakan kembali program KKB serta melestarikan seni dan budaya Indonesia,” jelas perwakilan dari BkkbN Sumut Rosmawati. Ketahanan Keluarga Sedangkan Ketua Iman dan Taqwa Kab. Asahan H. Ahmad Kosim menjelaskan kepada ribuan masyarakat yang hadir tentang alasan pemerintah membentuk BkkbN. Salah satunya adalah membangun ketahanan keluarga. “Ketahanan keluarga identik dengan kekuatan dan kuat itu identik dengan kesehatan serta pendidikan anak. Jika kita bisa mengatur jarak kehamilan, maka anak-anak sehat dan pembiayaan pendidikan anak

mudah diatasi. Kita tidak kewalahan jika hanya memiliki anak dua,” pesannya. Butuh Cinta, Tentram, Kasih Sayang Bercerita tentang ketahanan keluarga, Anggota Komisi IX DPR RI Drs. Ansory Siregar, LC menerangkan, ketahanan keluarga dibangun berdasarkan kecintaan, ketentraman serta kasih sayang dalam keluarga. Hal ini juga mencegah generasi yang narkobais. “Kalau ketahanan keluarga kita kuat, maka bangsa kita juga menjadi kuat. Sebaliknya, kalau keluarga kita berantakan maka bangsa kita tidak dihargai oleh bangsa luar. Ketahanan keluarga yang dilandasi kecintaan, ketentraman dan kasih sayang ini juga bisa mencegah kenakalan remaja dan anak didik kita,” ungkapnya sembari mengapresiasi BkkbN Sumut dalam kegiatan ini. Selain menampilkan seni dan budaya tradisional, BkkbN Sumut juga memberi layanan KB gratis serta pemutaran film tentang KB. (h02)



1 CM Rp. 13.200 1,5 CM Rp. 19.800

2 CM 3 CM


AUTOMOTIVE Informasi Pembaca

Bursa Automotive


: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window


PICK UP DP 9 Jtan, Angs 2 Jtan XENIA DP 26 Jtan, Angs 2 Jtan TERIOS DP 36 Jtan, Angs 3 Jtan AYLA DP 23 Jt Angs 1 Jtan Hub : MAHRIZAL ASTRA 0813 9669 0059



DP 9 Jt’AN Angs 2 Jt’AN DP 20 Jt’AN Angs 3 Jt DP 23 Jt’AN Angs 1Jt’AN DP 23 Jt’AN Angs 3Jt’AN DP 35 Jt’AN Angs 4 Jt’AN DP 25 Jt’AN Angs 3 Jt’AN 0812 6315 4132


Xenia Dp 2 6 J t a n A n g s 3 J t a n Terios Dp 35 Jtan Angs 4 Jtan Pick Up Dp 9 Jtan Angs 2 Jtan Hub. Irnanda 0813 7580 2895

DIJUAL DAIHATSU TARUNA CSX Warna Biru Tahun 2000. Harga 80 Jt Nego. Kondisi Mulus, Hub. 0852 6167 3711 DAIHATSU ROCKY 4 X 4 Thn 93. Hitam, Medan Asli, BR 31”, Vr, Harga 68 Juta Bisa Kurang/Damai. Hub : 0852 7052 5730 PESAN SKRG Honda Brio SATYA !! DP 20 Jt-an, Angs 2 Jt-an, Jazz & Freed DP 60 Jt-an, Crv DP 100 Jt-an. Hub : 0813 7645 2268 - ISUZU PANTHER ROYALE Thn1997. Hijau - LONG BED Pick Up Thn 1990. Siap Pakai, Terawat. Hub : 0823 6868 1818 / 77525511 # ISUZU 100 % BARU #

PANTHER Pick Up Turbo..............DP 20 Jtan PANTHER LM, LS, GR.TOURING... DP 50 Jtan Hub : SUPRAPTO 081375070088/ 061-77860168

DIJUAL MOBIL NISSAN SERENA Thn 2005. Warna Hitam, Plat Tunggal, Keadaan Mulus. Hub. 0812 6485 2027


ERTIGA DB DP 40 JT Angs 4 Jt PICK UP DP 14 JT Angs 2,5 Jt APV PICK UP DP 21 Jt Angs 2,7 Jt ENIF SIMANGUNSONG 0812 6584 8885

SUZUKI Carry Pick Up 2004/ 1000cc. Warna hitam, BK Mdn/ KIR Hidup. Harga 40 Juta. Hub. USA 0813 6100 5048

Rp. 26.400 Rp. 39.600

4 CM 5 CM

Rp. 52.800 Rp. 71.500

SUZUKI KARIMUN Thn 2000. Coklat Muda, BK Lengkap, Siap pakai, Hrg 58 Juta / Damai. HP. 0823 6083 3715 # SUZUKI BARU TERMURAH #

ERTIGA .......DP 40 Jtan / angs 3,5 Jtan APV PU........DP 20 Jtan / angs 2,5 Jtan CARRY PU ...DP 15 Jtan / angs 2,5 Jtan Hub : H E R I 0 8 1 3 7 6 4 5 1 5 6 7

SUZUKI KARIMUN Thn 99/2000. W. Silver, Luar Dalam Cantik, Siap pakai, Hrg Rp 57Jt Nego. HP : 0821 6080 2009

DIJUAL SUZUKI BALENO Silver Metalik Thn 2001. BK, Orisinil, Rp. 85 Jt. HP. 081 1614 4101

SUZUKI REALVAN Th 98. W. Merah Maroon, Ac Dbl, Tape, Vr, Br, Cl, Jok Kulit, BK Medan, Body Kaleng Mulus Seperti, H. Nego. Hub : 0813 6233 0595


- CARRY PU FD DP 12 Jt / Angs 2,5 Jtan - APV Mega Carry DP 20 Jtan / Angs 2,6 Jtan - APV Arena Gl DP 28 Jtan / Angs 4,2 Jtan - Ertiga Dp 38 Jtan / Angs 5/4 Jtan Hub. Ridwan Siregar 0813 6143 7654

TOYOTA GREAT COROLLA Thn 95. W. Hitam, Bk Mdn, Lengkap, Siap Pakai, Hrg. Rp. 70 Jt Nego. HP : 0821 6080 2009 TOYOTA Great Cocolla SEG 1995 Mobil Original, eksterior dan interior, biru metalik, Minat Hub. 0853 5998 8048 (TP)


TOYOTA KIJANG INNOVA 2.0 G Th 2008. Bensin, SIlver Metalic, Cl, Pw, Ps, Pajak 2014. Bk Medan, A/ N Sendiri, Kondisi Terawat Sangat Baik. Rp. 170 Jt Nego. Cash/Bantu Kredit. Peminat Hub : 0813 7042 4849, 0811 600 1856

6 CM 7 CM

Rp. 85.800 Rp. 100.100


Dapatkan Special Harga dan Penawaran terbaik dari Kami Seputar Toyota anda. Telah hadir New Kijang Innova, Fortuner, Rush. Hub : Anwar Damanik 0823 7088 0815



Melayani Antar Jemput Medan<-> Bandara Kuala Namu. Nb. Tarif Murah. Hub. 0812 6410 0774


MENCARI TUKANG JAHIT Pakaian Wanita Yg Berpengalaman di Lasmi Textil & Taylor. Hub Ibu YULIA Jl. Sisingamangaraja Ruko Medan Market Sp. Limun. Hp. 0852 6249 8656, 089 8457 5840


STUK. BK. 1183 BN. No uji : MDN 16229-A. A/N : KPUM. Alamat : Jl. Rupat No. 30-32 Medan. Merk : Daihatsu


1 (SATU) Buah BPKB Asli Bk 8841 LU. A/N. Sahat M. Tarigan. Alamat Jl. Sejahtera Gg. Lestari Helvetia Timur Medan


1 (SATU) Buah BPKB Asli Bk 1630 GN. A/N. Erwinsyah Putra. Alamat Jl. Ampera Gg Dame No. 38 D Medan

WASPADA Media yang Tepat untuk Iklan Anda


1 HARI CLEAR Khusus Surat Tanah, Tanpa Izin Usaha/ Syarat Gampang. Hub. 0812 6078 7230


TOYOTA GREAT COROLLA Th 94. W. Abu - Abu Metalic, Ac, Tape, Vr, Br, Ps, Pw, Cl, BK Medan, Body Kaleng Jamin mulus, H. Nego. Hub : 0812 6219 1744

Ingin Promosikan Produk Anda Harian


DAFTAR LANGSUNG BELAJAR WAKTU BEBAS Ms Word+Excel Rp 125(2minggu) Design Grafis Rp 500rb(1 bulan) Acad/3DMax Rp 300rb(10hari) Corel Draw/Photoshop Rp 100rb(2 minggu) TOEFL Rp 150rb JL. SEI BATANGHARI 170 Medan Telp 8442158

Gaji Rp. 1.200.000 Uang Makan Rp. 600.000 2,1 JT Uang Kost Rp. 300.000 Sebagai Atk/Ckr Promosi, Minggu Libur. Jl. Serdang No. 2 D Mdn. 0823 6155 6236 ,0823 6059 7816, 0852 0683 2257, 0823 6262 5181, 0857 6214 1142, 0878 6789 0402

1 (SATU) Buah BPKB Asli Bk 1247 Fl. A/N. Rahmawati. Alamat Jl. B. Katamso Gg. Pahlawan 2

TIMOR DOHC. W. Hijau, Thn 98, Siap Pakai, Lengkap. HP : 0821 6080 2009


SPESIALIS DANA CEPAT Proses 3 Jam Cair, Tanpa USaha, Surat Terjamin, Jaminan : SHM, SK Camat, HGB, BPKB Mobil, Spd Mtr, Truk, Mobil Kredit/ Over Leasing, Bantu Pelunasan BPKB, UP : Family Finance : Bpk Ray 0813 7044 6668 - 0813 7044 6633

TOYOTA KIJANG SUPER COMMANDO Th 95. W. Biru Metalic, Ac, Tape, Vr, Br, Pw, Cl, BK Medan, 1 Nama Dari Baru, Jok Kulit, Body Kaleng Mulus, H. Nego. Hub : 0852 7599 6758

TOYOTA AVANZA 2010 G SILVER. Tangan Pertama, Tape, Radio, Jok Kulit, Kondisi Terawat, Siap Pakai. Rp. 133 Jt. Hub 0813 6172 1176 - 0813 6218 6577

8 CM Rp. 114.400 9 CM Rp. 138.000



2 (Dua) Buah Sertifikat Hak Milik An. Arahmani Nst, SH. 1. No. Seluas +/- 200M2 2. No. Seluas +/- 200 M2. Di Jln. Sido Bakti No. 10 Dusun V Desa Deli Tua Kec. Namo Rambe Kab. Deli Serdang



Melayani Pengurusan HO, SIUP, TDP, Izin Usaha Industri, Izin Usaha Pariwisata, Izin Usaha Angkutan Darat, Biro Perjalanan Umrah, Dll. Hubungi 0877 6948 1474 , 081 2600 5943



1. Personalia (L/P, Min.D3, Bersedia ditempatkan diluar kota) 2. Legal (S1 Hukum Perdata, Pengalaman Min.1 Thn) 3. Supervisor Lapangan (L, Bersedia ditempatkan dlm & Luar Kota) 4. Marketing (L/P, Bisa Komputer, Bersedia ditempatkan dlm & Luar Kota) 5. Teknik Sipil (Civil Engineer) 6. Teknik Listrik (Elektrikal) 7. Teknik Kimia Industry (QC) Lamaran lengkap kirim ke PT. Srikandi Inti Lestari. Jl. KL. Yos Sudarso No. 49 A Medan, Jl. Pukat II No. 78 G Medan TIDAK DIPUNGUT BIAYA APAPUN

10 CM Rp. 154.000 11 CM Rp. 181.000

Senin, 30 September 2013


PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Anda Butuh Perabot Jepara Asli?


Info Pemesanan Iklan Hub. 0811 604 690


12 CM Rp. 198.000 6x6,6 kolom Rp. 132.000



* Umroh Reguler 9 HR ( Pertengahan Dan Akhir Desember, Januari 2014) * Umroh Reguler 13 HR (Akhir Desember) * Umroh Plus Dubay (Februari 2014) * Umroh Plus Aqsha dan Jordania (Februari 2014) * Umroh Plus Turky 12 HR (Maret 2014) MANASIK HAJI MULTAZAM DI MULAI 12 JANUARI 2014


Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243






Menerima cepat P/W (17-38 thn) untuk diposisikan di “KANTOR”. Pend. min SMU/SMK sederajat, Mahasiswa/i. Pengalaman kerja tdk diutamakan, Penghasilan Rp. 2.500.000/Bln Hub : Bpk Ridho SE/IBU HANIPAH HP : 0853 6241 0606 / 0878 9181 4141 Alamat Kantor : Di samping Medan Plaza di belakang Macan Mart No. 120 Syarat : Cukup KTP +Guntingan Iklan Lsg Interview


Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 -



Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

DIJUAL 1 Unit Rumah Ukuran Tanah 14,5 x 13 Meter, Luas Bangunan = 130 M2, SHM, Di Jln Garu II-B Gg. Pribadi No. 91 G. Buka 550 boleh kurang. Hubungi: SOFYAN HARUN 081 2608 8206



DIJUAL RUMAH 1 1/2 Tingkat 6 KT, 5 KM, 1 Grasi, Surat Sertifikat SHM, Ukuran Tanah 14 x 20. Alamat Jl. Darussalam/Sejahtera No. 23. Hub Hp. 0812 6378 1308

ANDA BUTUH CaC03, Ca0, Asam Semut. SMS : 0821 - 60603887, Email :

DIJUAL RUMAH Uk. tanah 10 x 10. Alamat Jl. Menteng VII Gg. Cempaka Medan. Harga Nego. Hub. 0813 6137 1037



Bangun 12 Unit (SHM). Harga cuma 300 Jtan, Samping SD & SMP Negeri (Sisa 8 Unit). Jl. Kenanga, Desa Baru, B. Kuis. Hub : 0811 605 220



Tanah ukuran 7x42 SHM Jln. Halat No. 40 Medan Hub. 0812 6565 6878 Tanpa Perantara. DIJUAL TANAH Pasar 10 Gg. Musholla Tembung. Uk : 10 x 15, SK. Camat. Jl. Beringin Pasar 5 Gg. Saun Tembung, Uk. 10 x 13,5, Full Keramik, SK. Camat, Harga Nego. Hub : IBU Salidar 0 8 1 2 6 3 1 5 1 4 6


Tanah Jl. Jermal 5 Ujung Medan Denai. UT. 20 x 21 M2. SHM. Hub : 0812 8308 0795, 0878 0969 7473












Cetak Spanduk CALEG Rp 11.000/m Hub. 7738 9081 - 081 6310 9081


Jl. Pertahanan / Patumbak Taman Jasmin Mas No. A4 Amplas. Hp : 0812 604 1050 Flexy 061-7769 8634 Izin Kejatisu B-23/DSP 5/001/2008


UK. 5,5 X 27 MTR (3 1/2 Tingkat). Jl. SM. Raja (Depan UISU). SHM. Hub. 0812 6485 2027

Metode pengobatan dengan cara ditotok dibagian syaraf dan kelemahannya dan diberikan Ramuan/ Jamu, 100% alami tidak ada efek samping bebas usia, bebas untuk semua agama, REAKSI DITEMPAT KHUSUS PRIA: - Panjang: 13, 15, 16, 18, 20 - Besar: 3, 4, 5, 6 - Impotensi - Kurang Keras/Ejakulasi dini - Tidak punya keturuan - Hernia KHUSUS WANITA: - Memperbesar payudara - Mempersepit vagina KONSULTASI UMUM: - Buka Aura - Pengasihan/penglarisan usaha - Masalah rumah tangga - Ingin dapat jodoh/pelet Alamat: Jl. SM. Raja depan Hotel GARUDA PLAZA samping Klinik BUNDA Gg. Keluarga No. 13C HP. 0812 6057 6444

1. Impotent L. Syahwat (gula), kurang gairah/ keras, tambah besar & panjang 2-3-5 cm, ejakulasi dini, mani encer, telor turun, mandul, terbukti di tempat, permanen, aman, tanpa efek samping mahar 100 ribu 2.Urat terjepit, otot persendian kaku, mati rasa, angin duduk, mahar 50rb 3. Pagar badan, pelet, penglaris mahal 50rb 4.Pengobatan ghaib (ruqyah), membuang hasad dengki manusia, ilmu2 hitam, dll. 100rb 5. Buka aura, kewibawaan, penunduk, awet muda, murah jodoh/kerja, buang sial, dgn minyak panas, air raksa, samber lilin mahar 200rb 6. Ramuan “ Keperawanan agar rapat, legit, wangi, kesat, keputihan 300rb 7.Patah tulang, terkena guna, santet, narkoba, stress, siplis (raja singa), medis/ non medis, lainnya. 8.Memisahkan WI/PIL 9. Buka pintu ghaib, pandangan ghaib, silat ghaib, komunikasi dengan seluruh ghaib.

RUMAH DIJUAL CEPAT LT. 10 X 44 m, LB 10 x 20 (Termasuk Toko 4 x 8 m). Harga Nego. Alamat Jl. Orba No. 123. Jl. Binjai Km 12,5. Hub. 081 2654 4179 , 0852 6273 3778 Ruko 2 1/2 LT Jl. Karya Wisata, UT. 4 x 24 M2, UB. 4 x 16 M2. SHM. Hub. 0812 8308 0795 , 0878 0969 7473




Murah Ready Stock, Dpt Diantar, Lok. Medan - Tuntungan. Hub : 0823 6531 6268 / 0813 2251 3100 / 0813 6715 9963 DICARI INVESTOR

Income Pasti 5 Jt Setiap Hari Selama 100 Hari (No MLM). Hub : PT MONEX. T. 6221-41008844 atau SMS “Petunjuk” HP. 0878 7671 6076 (


Kami Menjual Lembu Qurban dgn kwalitas terbaik, dgn harga yang bersaing. Lokasi : Jl. Setia Budi No. 240 (Depan Bank Mega) Tj. Sari Medan. Hub : MISNAR 0823 6326 3926/ LILIK 0821 6766 0302


Jadikan Bisnis Tambahan...... Bergabung Dgn IFA Dahsyat...... Bisnis yg sdh teruji dan banyak Yg sdh Berhasil...... Produk : Cookware, Fashion, Tas, Sepatu, Dompet, Kopi Ginseng, Dll. Bonus Uang, Komisi SP. Motor, Komisi P.Ibadah, Komisi Perjalanan Wisata, Rumah, Mobil Dll. Utk Meraih Kesuksesan bersama IFA, Hanya Komitmen dan Kerjasama Group. Berminat : Hub. PAK GORI Titi Kuning Hp. 0813 6146 3766, Telp. 0828 6110 0373 (NO. SMS)


WC HP. 0813 7035 7291 WC







Keterangan lebih lengkap silahkan hubungi:

Ada Garansi

TELPON : 061 - 4576602 FAX : 061 - 4561347


845.8996 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim


ALAT MUSIK DIJUAL 2nd : Amp BMB Dax 55 (c). DAJ7 II, DAR 8a, Dax 1000, Power Mixer SUB By 4 (3.0). 40 TR, RAL 52 Tr (4,5). EQ Alesis Digital 60 (1.5). Spk Ramsa 12.8. Terima Visa 0 %. Jln Indragiri 25 dkt asia. 061-7345487

* Format: JPG - TIFF (Photoshop)

Medan Metropolitan B5 Tujuh Anggota Geng Kereta Ditangkap WASPADA

Senin 30 September 2013

MEDAN (Waspada): Tim Khusus (Timsus) Reskrim Polsek Medan Baru menangkap tujuh diduga anggota geng kereta terlibat kasus perampokan handphone dalam penyergapan di dua lokasi berbeda, Minggu (29/9) dinihari. Ketujuh tersangka yakni, TH, 18, penduduk Jln. Tangguk Bongkar II, RMT, 19, penduduk Jln. Pahlawan, OBS, 16, penduduk Jln. RS Haji-Pancing, TM, 19, penduduk Jln. Cokroaminoto Gang Mesjid, RR, 18, penduduk warga Perumnas Mandala, WS, 19, Jln. Nuri I Perum-

nas Mandala, MA, 16, penduduk Jln. Nuri VX, Perumnas Mandala. Dari mereka disita barang bukti tiga sepedamotor dan lainnya. Informasi di lapangan menyebutkan, petugas yang sedang melakukan patroli mendapat informasi ada terjadi perampokan handphone di Jln. Sudirman Medan, diduga pelakunya anggota geng kereta. Petugas menuju ke lokasi melakukan penyelidikan dan menangkap tersangka RH di kawasan Lapangan Merdeka Medan. Dalam hasil pengembangan, petugas kembali menciduk enam teman tersangka ketika sedang ngumpul di kawasan

Hotel Soechi Jln. Bogor Medan. Usai menjalani pemeriksaan, tersangka RH mengakui, dia dan rekannya mengambil handphone. Ketika ditanya nama geng kereta mereka, apa ?, tersangka RH mengatakan, belum ada namanya walaupun geng kereta kelompoknya sudah berdiri dua bulan. Sebelumnya, Polsek Sunggal meringkus lima anggota geng kereta Susah Senang Bersama (S2B) diduga terlibat kasus penganiayaan dan perampokan sepedamotor milik Budiono, 20, di lokasi SPBU Jln. Ringroad, Pasar II, Medan Sunggal. Dua di antaranya pelajar SMP Swasta dan SMA Negeri.

Para tersangka, CIS, 18, (ketua geng kereta S2B) dan empat anggotanya yakni NDL, 16, pelajar SMP, JPM, 19, RZ, 18, AS, 17, pelajar SMA, kelimannya warga Pintu Air IV, Kel. Kwala Bekala, Kec, Medan Johor. Dari mereka disita barang bukti, sepedamotor Honda Supra tanpa plat BK, Honda Beat dan lainnya. Sedangkan, sepedamotor Yamaha Mio BK 5138 OH yang dirampok geng kereta dibawa pelaku lainnya. Peristiwa itu terjadi, Minggu (15/9) dinihari pukul 01:30, saat korban Budiono, warga Jln. Bunga Cempaka Gang Dahlia, Kel. Tanjungrejo, Kec. Medan

Selayang, mengendaraiYamaha Mio berboncengan dengan pacarnya Sri Ningsih Rahayu, 18, warga Jln. Sukamaju Pembangunan, Glugur Rimbun, Kec. Pancurbatu, Deliserdang, hendak mengisi bensin di SPBU Jln. Ringroad, Pasar II. Ketika masuk ke lokasi SBPU, tiba-tiba ada puluhan orang mengendarai sepedamotor dan dua orang di antaranya langsung menendang sepedamotor yang dikendarai korban. Melihat korban terjatuh, para geng kereta itu kemudian memukul tangan kanan korban dengan kayu broti. Selanjutnya, mereka membawa kabur sepedamotor korban. (m36)

Terdakwa Penipuan Rp1,29 M Dituntut Tiga Tahun Penjara Hakim Tangguhkan Penahanan penangguhaannya suatu waktu MEDAN (Waspada): Walau Jaksa Penuntut Umum (JPU) dari Kejaksaan Negeri Medan menuntut tiga tahun penjara, namun majelis hakim PN Medan mengabulkan permohonan penangguhan penahanan terdakwa penipuan proyek senilai Rp1,29 miliar. Hal itu terungkap dalam sidang kasus penipuan dengan terdakwa Riki Lubis alias Kiki yang kerap mengaku sebagai keponakan Wali Kota Medan non aktif, di Lantai III Ruang Candra PN Medan, Jumat (27/9). “Atas perbuatannya, terdakwa melanggar pasal 378 KUHPidana tentang penipuan dengan tuntutan selama tiga tahun penjara,” ujar JPU Johanes dihadapan majelis hakim diketuai Nelson Marbun SH. Menurut jaksa, terdakwa telah melakukan penipuan terhadap korban Alfian Lubis

dengan total kerugian sebesar Rp1,29 miliar. Usai mendengar pembacaan tuntutan, lalu majelis hakim melanjutkan persidangan dengan agenda membacakan penerimaan permohonan penangguhan penahanan yang sebelumnya diajukan tim kuasa hukum terdakwa. Majelis hakim beralasan menerima penangguhan penahanan terdakwa dari tahanan Rutan menjadi tahanan kota karena pemeriksaan terhadap kasus tersebut telah selesai. Selain itu, terdakwa menjaminkan abang kandungnya Safrudin Ismail Lubis sebagai penjamin dan juga memberikan uang penjamin Rp15 juta yang dititipkan ke PN Medan. “Karena dia yang menghidupin keluarganya. Itu yang menjadi pertimbangan hakim. Yang jelas pemeriksaan perkaranya tinggal pembelaan. Namun

Pencuri Sepedamotor Dihajar Massa MEDAN (Waspada): Pencuri sepedamotor berinisial Har, 48, warga Jln, Gurila, Kel. Sei Kera Hilir I, Kec. Medan Perjuangan, babak belur dihajar massa di Jln. Tempuling, Kel. Sidorejo, Kec. Medan Tembung, Sabtu (28/9) sekira pukul 06:30. Dalam kondisi berlumuran darah, tersangka Har diserahkan kepada petugas Polsek Percut Seituan. Menurut informasi, pagi itu korban Riki Irawan, 28, warga Jln. Tempuling, sedang ‘memanaskan’ mesin sepedamotor Vario BK 4617 ACR di depan rumahnya merangkap kedai tersebut. Setelah itu, korban melayani pembeli di kedainya. Tiba-tiba datang tersangka Har langsung mendorong sepedamotor korban. Melihat hal itu, korban mengejar tersangka yang berusaha kabur. Riki mengatakan, tersangka sudah membawa sepedamotornya sejauh 10 meter. “Sudah dibawanya sepedamotorku sejauh 10 meter, dan langsung kukejar. Pelaku dapat saat kukejar, tetapi dia melawan dan kami berdua sempat berantam. Tak lama, warga sekitar datang dan langsung menghakimi pelaku. Usai menghakimi pelaku, warga langsung melaporkannya ke petugas Polsek Percut Seituan,” sebutnya. Kata dia, selama ini tersangka sudah sering diperhatikannya mondar mandir di Jln. Tempuling dan mungkin sudah memantau jauh-jauh hari. Terpisah, Kapolsek Percut Seituan AKP Ronald Sipayung ketika dikonfirmasi membenarkan adanya tersangka curanmor yang diamankan. “Tersangka sudah kita amankan, dan masih kita mintai keterangannya, beserta korbannya. Kita juga sudah mengamankan sepedamotor korban untuk dijadikan barang bukti,” tuturnya. (h04)

Ciri Pelaku Pembunuh Karyawan PLN Diketahui MEDAN (Waspada): Penyidik Polsek Patumbak mengaku sudah mengetahui ciri-ciri pelaku pembunuhan terhadap Heri Ferianto Sirait, 21, warga Jln.Garu VIII Gang Serasi, Medan, tetapi sampai saat ini belum berhasil menangkapnya. Kanit Reskrim Polsek Patumbak AKP Hatopan Silitonga dikonfirmasi wartawan, Minggu (29/9) mengatakan sudah mengetahui ciri-ciri pelaku. “Kita ketahui ciri-ciri pelaku dari keterangan beberapa saksi yang telah diminta keterangannya. Semoga dalam waktu tidak lama dapat ditangkap,” kata dia. Sejauh ini, sebut Hatopan, mereka masih memeriksa saksisaksi dan mengumpulkan barang bukti yang ada. Dari keterangan saksi, korban merupakan karyawan PT PLN itu tewas ditikam oleh pelaku berjumlah sekira enam orang. “Saat itu korban sempat melakukan perlawanan mempertahankan sepedamotornya yang diambil kawanan perampok, tetapi seorang pelaku menikam dada korban,” ujarnya. Peristiwa terjadi di Jln. Sisingamangaraja Km 10, tidak jauh dari Mapoldasu, Jumat (27/9) sekira pukul 05:00. (m27)





Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA Dibuka sampai pukul 22.00


bisa saja dicabut apabila terdakwa tidak koperaktif,” kata ketua majelis hakim Nelson. Selanjutnya, majelis hakim menunda persidangan pada pekan depan dengan agenda mendengar pembelaan terdakwa dan kuasa hukumnya. Dalam dakwaan jaksa dinyatakan, terdakwa Kiki mengaku kepada korban memiliki banyak paket proyek di Pemko Medan seperti Dinas Perkim, Dinas Kesehatan, Dinas Pertamanan, dan Dinas Pendidikan.

Korban Alfian yang percaya kepada terdakwa lalu mengambil paket proyek di Dinas Perkim dengan nilai pagu anggaran Rp3 miliar melalui Kiki, setelah memberikan dana sebesar Rp300 juta. Namun, baru setengah atau senilai Rp1,5 miliar dari proyek tersebutdikerjakan,terdakwaKiki mengharuskankorbanAlfianmengambil proyek di dinas lain denganmasing-masingsetoranberbeda dengan ancaman bila tidak dilakukan maka setengah lagi proyek itu dikerjakan orang lain.

Alfian lalu menyetorkan uang untuk proyek dinas lainnya seperti pada Dinas Pendidikan Medan Rp600 juta, Dinas Kesehatan Medan Rp200 juta, BKKBN Rp235 juta, dan Dinas Pertamanan Rp100 juta. Ternyata, setelah uang disetorkan, setengah lagi proyek di Perkim itu telah dikerjakan pihak lain tanpa sepengetahuan Alfian. Bahkan, proyek di dinas lain juga telah dikerjakan oleh pihak lain. Merasa telah ditipu terdakwa, Alfian melaporkan Kiki ke polisi. (m38)

Caleg DPRD Medan Partai Hanura Adakan Gotroy MEDAN (Waspada): Sejumlah calon legislatif DPRD Medan daerah pemilihan (Dapil) I dari DPC Partai Hanura Kota Medan, menggelar bakti sosial berupa gotong royong (gotroy) bersama warga di Jln. Seksama, Lingkungan I, Kel. Sitirejo III, Kec. Medan Amplas, Minggu (29/9). Gotong royong yang dilakukan dekat Pasar Simpanglimun itu membersihkan sampahsampah yang selama ini bertumpuk di dalam parit. Ketua DPC Partai Hanura Kota Medan Hariman Tua Debata Siregar SE menjelaskan, kegiatan bakti sosial yang digagas pengurus PAC Partai Hanura Kec, Medan Amplas ini merupakan bentuk kepedulian sosial Caleg Partai Hanura dan seluruh pengurus dan kader kepada

warga sekitar domisili caleg. “Bakti sosial gotong royong untuk mencegah agar warga sekitar Jln. Seksama tidak tergenang air tatkala hujan turun,” ujar Hariman Siregar didampingi pengurus lainnya di antaranya Boby Iskandar dan M Rusli Tanjung. Menurut dia, kepedulian sosial yang dilakukan merupakan realisasi dari instruksi Ketua DPD Partai Hanura Sumut H Zulkifli Effendi Siregar MSc, agar seluruh pengurus DPC kabupaten/kota se Sumatera Utara, melaksanakan kegiatan bakti sosial sehingga Partai Hanura tetap berada di tengah-tengah masyarakat dan bersama masyarakat membersihkan lingkungan sekitar tempat tinggal. Calon legislatif DPRD Me-

dan Dapil I (Medan Amplas, Medan Denai, Medan Kota, dan Medan Area) yang ikut gotong royong bersama warga yakni Riri Stepanie Siregar, Aulia Rahman, Satya Anugerah Akbar, Hasrul, Hendra DS, dan Dian C Anggara. Sementara itu, Kepala Lingkungan I Kel. Sitirejo III Irianto mengucapkan terimakasih kepada para caleg Dapil I DPC Partai Hanura Kota Medan karena telah berbaur dengan warga untuk membersihkan sampah-sampah yang berada di dalam parit sepanjang hampir 500 meter. “Setelah sampah-sampah diangkut, sepanjang Jln Seksama tidak akan tergenang air saat hujan deras turun,” tutur Irianto. (h04)

Waspada/Andi Aria Tirtayasa

KETUA DPC Partai Hanura Kota Medan Hariman Tua Debata Siregar SE, bersama caleg DPRD Medan Dapil I foto bersama usai melaksanakan gotong royong di Pasar Simpanglimun Jln. Seksama, Kel. Sitirejo III, Kec. Medan Amplas, Minggu (29/9).

PSMTI Medan Sunggal Dilantik MEDAN ( Waspada): 28 Pengurus Persatuan Sosial Marga Tionghoa Indonesia (PSMTI) Kec. Medan Sunggal, dilantik oleh pengurus PSMTI Sumut dan Medan, Minggu (29/9). Pada kesempatan itu PSMTI juga menggelar bakti sosial dengan menyerahkan paket sembako kepada warga miskin disekitar wilayah Medan Sunggal. Acara pelantikan dihadiri Ketua PSMTI Sumut Eddy Djuandi, Ketua PSMTI Medan Halim Loe, perwakilan Den POM, Dewan Penasehat PSMTI Sumut SofyanTan,perwakilanDanramil, pihak Kecamatan Medan Sunggal,paralurahdanperwakilandari Polsek Medan Sunggal. Sementara itu, seratusan warga terlihat memadati acara.

Mereka senang berdirinya PSMTI Medan Sunggal, karena visi misinya membantu masyarakat dan turut serta dalam arus besar pembangunan Indonesia, khususnya di wilayah Medan Sunggal. “Bakti sosial seperti donor darah serta lainnya dapat meringankan beban masyarakat,” kata warga. Ketua PSMTI Medan Sunggal Adryanto mengatakan, dirinya siap turut serta dalam arus besar pembangunan Indonesia, khususnya di wilayah Medan Sunggal. “Kita siap membantu program pemerintah, terlebih untuk masyarakat Medan Sunggal,” ujarnya berharap melalui wadah PSMTI dapat menjaga tali persaudaraan antarwarga Tionghoa dan seluruh masyara-

kat di Medan Sunggal. Sedangkan Ketua PSMTI Medan Halim Loe berharap besar agar PSMTI Medan Sunggal dapat melaksanakan visi dan misi PSMTI untuk turut serta dalam arus besar pembangunan. “Saya berharap PSMTI Medan Sunggal dapat melaksanakan visi misi itu,” sebutnya. Penguru PSMTI Medan Sunggal yang dilantik, Ketua Andryanto, Sekretaris Eng Wi dan Bendahara Riki dengan sejumlah bidang. Acara pelantikan dimulai dengan menyanyikan lagu Indonesia Raya, kemudian hening cipta dan mars PSMTI. Di akhir acara dilaksanakan pembagian sembako bagi keluarga kurang mampu di wilayah Medan Sunggal.(m27)


Ingin Promosikan Produk Anda


WASPADA Media yang Tepat untuk Iklan Anda


KETUA PSMTI Medan Halim Loe (kiri) menyerahkan pataka kepada Ketua PSMTI Medan Sunggal Andryanto saat pelantikan 28 pengurus PSMTI Medan Sunggal, di Jln, Sunggal, Minggu (29/9).

Waspada/Ismanto Ismail

TUJUH tersangka diduga anggota geng kereta terlibat kasus perampokan handphone mendekam di ruang tahanan Polsek Medan Baru.

Al Washliyah Prediksi Idul Adha 15 Oktober MEDAN (Waspada): Pengurus Besar Al Jam’iyatul Washliyah memprediksi Hari Raya Idul Adha jatuh pada hari Selasa, 15 Oktober 2013 atau 10 Dzulhijjah 1434 Hijriah. AlWashliyah berpedoman dengan kriteria hilal di atas 2 derajat dalam menetapkan Idul Adha tahun ini. Hal ini dikatakan Ketua Majelis Hisab Rukyah PB Al Washliyah H Arso SH, MAg, kepada wartawan disela-sela Kegiatan Temu Kerja Penetapan Penanggalan Kelender Hijriah Tahun 1435 Hijriah, di Universitas Al Washliyah Medan, Minggu (29/9). Menurut Arso, pada tanggal 5 Oktober 2013 terjadi Ijtima’ pada pukul 07.34, 23 detik dengan ketinggian 2 derajat 48 untuk Pelabuhan Ratu. Dengan demikian wilayah Indonesia ketinggian hilal 2-4 derajat. “Andai kata tanggal 5 Oktober tidak perubahan rukyah, berdasarkan kriteria imkan, 1 Dzulhijjah jatuh pada 6 Oktober 2013. Sementara hari Arafah tanggal 14 Oktober atau 9 Dzulhijjah,” sebutnya. Meski demikian, Al Washliyah tetap mengikuti keputusan pemerintah dalam hal ini Kementerian Agama RI. “Al Washliyah akan mengikuti sidang Isbat tanggal 5 Oktober 2013 mendatang,” kata Arso didampingi Ketua Majelis Pendidikan PB AlWashliyah H Ismail Efendy, Sekretaris Majelis Hisab Rukyah PB AlWashliyah Hasan Matsum MAg, Pembantu Rektor IV Univa Medan Sultoni Trikusuma, PR

III UMN Al Washliyah Drs H Milhan Yusuf MA, Drs HA Hamim Azizy, T Mahmud SAg, dan Akmal Samosir SAg. Dijelaskannya, AlWashliyah sebagai ormas Islam terbesar di Indonesia, tetap berpedoman kepada Rukyah dan Hisab, tetapi sebagai penentu adalah Rukyah. Jika Rukyah tidak berhasil dengan kriteria imkan, maka Al Washliyah masih sepakat dengan hasil kesepakatan negara MABIN (Malaysia, Brunei, Singapura, dan Indonesia). “Ketinggian hilal 2 derajat sesudah terbenam matahari sulit terjadi Ijtima’ atau sudut elogasi 3 derajat dan umur hilal 8 jam sejak Ijtima’,” ujarnya. Arso mengatakan hal itu hasil kesepakatan lokakarya tahun 2011. Sedangkan adanya perbedaan dengan ormas Islam lain, AlWashliyah tetap merujuk

kesepakatan tim Hisab Rukyah Kemenag. Ramadhan 2014 Dalam kesempatan itu, Arso menuturkan, 1 Ramadhan 1435 Hijriah jatuh pada 29 Juni 2014, dengan ikmal Sa’ban 30. “Tapi begitu tetap menunggu keputusan Kemenag,” tuturnya. Majelis Hisab Rukyah PB Al Washliyah juga menyusun imsakiyah Ramadhan, jadwal sholat, serta kalender 1435 Hijriah. “Tahun 2014, kita buat program pengkaderan ahli hisab dan rukyah untuk regenerasi selanjutnya,” katanya. Sementara Ketua Majelis Pendidikan PB Al Washliyah H Ismail Efendy mewakili Ketua Um u m P B A l Wa s h l i y a h berharap Majelis Hisab Rukyah PB Al Washliyah berperan aktif melakukan aktivitas untuk kepentingan umat. (cwan)


MAJELIS Hisab Rukyah PB Al Washliyah foto bersama disela-sela Temu Kerja Penetapan Penanggalan Kelender Hijriah Tahun 1435 Hijriah, di Universitas Al Washliyah Medan, Minggu (29/9).

Polisi Diminta Objektif Tangani Masalah Pemuda MEDAN (Waspada): Kepolisian diminta tegas dan objektif serta mengedepankan profesionalitas dan netralitas dalam menangani masalah kelompok pemuda di Kota Medan. “Dengan tindakan tegas ini diyakini akan meredam kemungkinan terjadinya gesekan yang lebih besar, sehingga kondusivitas Medan akan selalu terjaga dan terpelihara dengan baik,” kata Ketua DPD KNPI Kota Medan El Adrian Shah SE (foto), Sabtu (28/9). Penegasan ini disampaikan El kepada wartawan di Sekretariat KNPI Medan Jln. Merbabu. Menurutnya, tindakan tegas harus dalam koridor profesionalitas. Artinya, jangan hanya mengedepankan ketegasan, tapi mengabaikan kreativitas, ekspresi dan kebebasan untuk menyampaikan pendapat. Mengenai insiden beberapa hari lalu yang melibatkan oknum pemuda, El mengatakan, ini merupakan bagian dari dinamika kepemudaan yang bergerak dinamis dan kritis dalam mencermati perubahan yang terjadi di tengah masyarakat. “KNPI sebagai wadah berhimpunnya OKP sangat menyesali terjadinya insiden yang melibatkan pemuda di Kota Medan,” katanya. Sebab, setiap gesekan yang terjadi akan menimbulkan dampak negatif kepada kondusivitas daerah dan kehidupan masyarakat. Karena itu, lanjut El, ketika insiden ini sampai ke pihak kepolisian dan ada yang menjadi korban

dari kedua belah pihak, maka KNPI Medan segera mengambil langkah penting dengan membawa pemuda yang mengalami cedera dalam insiden tersebut ke rumah sakit guna mendapat pertolongan medis. “Inilah bentuk keperdulian KNPI terhadap OKP dan pemuda di Medan. Kita tidak melihat siapa yang benar dan salah dalam insiden tersebut,” tegas El. OKP dibentuk sebagai tempat bersatunya potensi pemuda untuk belajar, berkarya, berinovasi, menggali kreativitas dan aktivitas positif lainnya guna menjadi motor penggerak dalam pembangunan. “OKP dibentuk untuk kepentingan pemerintah dan masyarakat. Karena itu, organisasi kepemudaan (OKP) bukan untuk kepentingan oknum dan pihak tertentu,” katanya. Namun pada hakekatnya OKP memiliki peran sangat strategis dalam menjaga kondusivitas dan kerukunan di tengah masyarakat, karena pemuda memiliki daya gerak dan motorik yang dinamis terutama terhadap perkembangan yang terjadi di tengah masyarakat. Karena itu, El kembali menegaskan KNPI Medan sebagai wadah berhimpunnya OKP dan elemen pemuda akan berusaha semaksimal mungkin menjadi jembatan jika terjadi gesekan pemuda di daerah ini. “KNPI siap menjembatani demi terpeliharanya persatuan dan kesatuan pemuda serta kondusivitas Kota Medan,” ujar El seraya berharap pemuda Kota Medan tetap kompak. (m39)

Ekonomi & Bisnis


WASPADA Senin, 30 September 2013

Standar Servis Minimum PLN Catatan Gus Irawan PASTI sangat berbeda akan kena penalti dan melaItu karena aturan mengelola bank dengan kukan kompensasi sedangkan perusahaan pemerintah yang di luar Jawa dengan durasi kompensasi sebesar 10 membangkiti listrik di Sumut. padam lebih lama.( ( Tingkat persen dari biaya Namun dalam beberapa mutu pelayanan listrik di abonemen bukan dari prinsip perusahaan pasti ada Jakarta juga berbeda-beda biaya pemakaian. persamaannya. baik antara pusat kota yang Contohnya abonemen Melihat kondisi PLN hanya 1 jam dan pinggir kota bagi konsumen Sumut sekarang saya mengbisa lebih lama dari 3 jam. Jika pengguna 450 volt ingat-ingat bagaimana dulu tingkat mutu pelayanan tersedi usia saya yang baru 36 but tidak dipenuhi, PLN wajib sebesar Rp15 ribu. tahun harus memimpin Bank memberikan kompensasi 10 Kalau ada kompensasi, Sumut. Bank yang waktu saya persen dari tarif. konsumen hanya pimpin pertamakalinya dalam Sesuai Undang-Undang mendapatkan Rp1.500. kondisi SOS. Kita memulai Nomor 20/2002 tentang KeteMenurut Yayasan membenahi bank itu bukan nagalistrikan Pasal 34 (1) b, Lembaga Konsumen dari nol tapi dari minus. konsumen tenaga listrik Lalu kemudian di pengmempunyai hak untuk menIndonesia kalaupun hujung periode saya memimdapatkan tenaga listrik secara aturannya diubah pin bank milik warga Sumut terus-menerus dengan mutu menjadi 50 persen, itu mencatatkan aset hingga dan keandalan yang baik. PLN tidak akan Rp20 triliun. Bank adalah Selain itu, PLN terikat aturan bangkrut. Karena yang bisnis kepercayaan. Hanya yang lebih teknis, yakni SK dihitung dari abonemen. karena kepercayaan masyaraDirjen Listrik dan Pemanfaatkat, baru mereka mau mean Energi Nomor 1612/43/ nyimpan uang di situ. 600.3/2003 yang mengharusKalau tanpa kepercayaan bayangkan akan kan PLN memberikan kompensasi sebesar 10 seperti apa perbankan kita. Di awal-awal mem- persen dari biaya beban (biaya abonemen) jika benahi Bank Sumut saya fokus pada kondisi PT PLN melanggar 3 (tiga) indikator yang internal. Membenahi struktur organisasi dan dideklarasikan, yaitu lamanya gangguan, jumlah menanamkan prinsip pelayanan ke nasabah. gangguan, dan kesalahan membaca meteran.( Ditambah lagi dengan fitur-fitur yang meTapi harap diketahui standar kompensasi mudahkan penabung untuk mengakses Bank ini pun tidak akan membuat efek jera kepada Sumut. Di ujung periode, saya fokus pada PLN. Kenapa? memberikan standar servis minimum pada Itu karena aturan kompensasi sebesar 10 nasabah. persen dari biaya abonemen bukan dari biaya Artinya setiap karyawan sudah tahu standar pemakaian. Contohnya abonemen bagi servis apa yang harus mereka berikan ke konsumen pengguna 450 volt sebesar Rp15 ribu. nasabah. Mulai dari hal-hal kecil. Misalnya saat Kalau ada kompensasi, konsumen hanya nasabah komplain berapa lama mereka bisa mendapatkan Rp1.500. Menurut Yayasan mendapatkan penyelesaian. Lembaga Konsumen Indonesia kalaupun Ada standar yang mereka dapatkan. Saya aturannya diubah menjadi 50 persen, PLN tidak kira walaupun berbeda ritme dan aturan akan bangkrut. Karena yang dihitung dari organisasi PLN yang sekarang masih terus abonemen. memadamkan listrik secara bergilir perlu Nah uniknya, dengan tingginya frekuensi menerapkan standar servis minimum ini. pemadaman listrik, ada pelanggan yang Kalau pemadaman listrik terjadi selama dua tagihannya malah makin naik padahal listrik jam, apa yang harus didapatkan konsumen. terus padam selama 4 jam dengan tiga sampai Memang dalam aturannya ada kompensasi empat kali pemadaman. sebesar 10 persen atas tagihan. Namun pelakPerubahan manajemen tentu menjadi sanaannya tidak begitu jelas. Saya sudah coba tuntutan perusahaan. Dari sisi manajemen tanya beberapa pelanggan kelas 450 volt dan publik pasti terjadi perubahan yang semula 900 volt, nyatanya belum pernah ada yang menganut pada orientasi kepentingan internal mendapatkan kompensasi itu. perusahaan akan bergeser kepada kepentingan Dalam aturannya masyarakat yang menga- eksternal atau masyraakat disertai peningkatan lami pemadaman listrik minimal satu jam dapat pelayanan dan pendelegasian sebagai tugas menuntut kompensasi keringanan pembayaran pelayanan publik. 10 persen dari biaya beban rekening. Harus ada standar servis yang jelas. Berapa Ketentuan kompensasi PLN tersebut diatur konsumen dapat kalau pemadaman bergilir. dalam Peraturan Menteri Energi dan Sumber Kompensasi apa yang akan diberikan. Hanya Daya Mineral dimana PLN harus menetapkan karena PLN satu-satunya penyedia listrik yang tingkat mutu pelayanan di setiap daerah di membuat konsumen masih mau menggunaseluruh Indonesia. kan jasanya. Kalau ada perusahaan lain masuk Tingkat mutu pelayanan ini berbeda-beda dan liberalisasi energi dibuka lebar lama-lama dan Jakarta termasuk kategori tinggi. Kalau di BUMN ini akan seperti BUMN lain yang Jakarta 1 jam mati dalam 1 bulan maka PLN ditinggalkan masyarakat.

Australia 10 Besar Investasi Tertinggi Di Indonesia JAKARTA (Waspada): Hubungan kerjasama Indonesia dengan Australia sudah terjalin dengan lama. Bahkan Australia merupakan salah satu dari 10 negara dengan nilai investasi tertinggi (top ten investor) di Indonesia. Selama 2012, tercatat Australia berinvestasi langsung sebesar 744 juta dolar AS. Staf Khusus Presiden bidang Hubungan Internasional Teuku Faizasyah, mengatakan, hubungan kedua negara yang terjalin lama terlihat dari komitmen penguatan kerjasama bilateral yang sejalan dengan kerangka Kemitraan Komprehensif yang dicetuskan pada tahun 2005. Presiden RI dan PM Australia Tony Abbott, dalam pertemuannya membahas isu-isu yang menjadi prioritas bersama sesuai dengan kerangka Kemitraan Komprehensif, di antaranya

kerjasama ekonomi dan kerjasama sosial kebudayaan, termasuk people-to-people contacts. Terkait kerjasama bilateral di bidang ekonomi, Faizasyah memaparkan, pada periode 2008-2012 terdapat peningkatan nilai perdagangan bilateral sebesar 6,8 persen per tahun. “Oleh karena itu, kerja sama investasi, termasuk di sektor pertanian dan pariwisata, kiranya akan menjadi salah satu topik pembicaraan,” ujar Faizasyah, seperti dikutip dari Setkab, Minggu (29/9). Sementara itu, terkait pengembangan hubungan antar-masyarakat, Staf Khusus Presiden bidang Hubungan Internasional itu meyakini dapat menjadi fondasi yang kokoh bagi peningkatan kerjasama bilateral di antara kedua negara. (okz)

120.000 TKI Bermasalah Di Arab Saudi JAKARTA (Waspada): Menteri Koordinator Bidang Kesejahteraan Rakyat Agung Laksono, mengungkapkan data. Bahwa saat ini ada sekira 120.000 Tenaga Kerja Indonesia (TKI) bermasalah dan melampaui izin tinggi di Arab Saudi. Dari angka tersebut baru sekira 3.250 TKI yang bisa memanfaatkan perbaikan dokumen dan izin tinggal dari imigrasi Arab Saudi. Padahal, sejak program Amnesty dimulai Mei lalu, Kementerian Luar Negeri mencatat ada sekitar 89.000 TKI yang butuh perbaikan dan perpanjangan dokumen. Jumlah ini belum termasuk TKI lain yang belum sempat mengurus Amnesty. Selain itu ada sekira 120.000 TKI yang bermasalah dan melampaui izin tinggal. Menko Kesra Agung Laksono, mengatakan, lambatnya pengurusan amnesti disebabkan lamanya proses pengurusan administrasi di kantor imigrasi Arab Saudi. Pemerintah Arab selama ini hanya menyediakan satu hari layanan, yaitu pada Kamis, dengan kapasitas maksimal 200 orang. “Inilah yang sedang kita upayakan. Bagaimana caranya waktu layanan ini ditambah,” kata

Agung, Minggu (29/9). Selain penambahan kapasitas, Menko Kesra mengatakan tim gabungan dari Kementerian Luar Negeri, Kementerian Tenaga Kerja dan Badan Nasional Penempatan dan Perlindungan TKI (BNP2TKI) juga telah meminta pemerintah Arab Saudi membuka ruang untuk memperpan-jang masa amnesti. Pemerintah juga berjanji akan terus melobi pemerintah Arab Saudi untuk menambah kapasitas layanan dokumen keimigrasian bagi para TKI di Arab Saudi, sebelum sampai batas akhir masa layanan dokumen pada 3 November mendatang. Hingga kini belum banyak TKI yang bisa memanfaatkan program pengampunan pengurusan dokumen izin tinggal dan perbaikan paspor bagi TKI bermasalah. Direktur Perlindungan WNI, Kementerian Luar Negeri Tatang Budie Utama Razak, mengatakan, pemerintah berharap hingga berakhirnya masa amnesti pada 3 November nanti, pemerintah Arab Saudi segera mengeluarkan kebijakan baru. “Kami minta ada kebijakan baru yang bisa memudahkan para TKI,” ujarnya.(okz)

IHSG Gagal Bertahan Di Jalur Positif JAKARTA (Waspada): Selama sepekan Indeks Harga Saham Gabungan (IHSG) gagal bertahan di laju positifnya. Itu terjadi terutama imbas dari banyaknya sentimen negatif dari Amerika Serikat (AS) seputar pembahasan APBN pasca merespon positif keputusan perpanjangan stimulus di pekan sebelumnya. Yakni dengan adanya masalah baru, berimbas pada laju bursa saham Asia yang juga turut menghambat pergerakan IHSG. Sepanjang pekan kemarin, asing kembali jualan sebesar Rp1,94 triliun, atau jauh di bawah dari sebelumnya nett buy sebesar Rp1,12 triliun. Pembahasan government spending dan kemungkinan diberlakukannya pemangkasan stimulus di bulan-bulan berikutnya dan adanya pertentangan serta kritik dari beberapa kepala The Fed lainnya terhadap penundaan tappering off stimulus mempengaruhi laju IHSG yang di awal pekan juga mengalami pelemahan dan

diteruskan di hari-hari selanjutnya. Kepala Riset Trust Securities Reza Priyambada, menjelaskan laju nilai tukar rupiah yang masih melemah dan laju Han Seng Indeks (HIS) yang kembali ke zona merah, setelah adanya bencana badai di awal pekan juga turut mempengaruhi IHSG yang memperpanjang pelemahannya. Meski asing sempat mencatatkan nett buy, namun dirasa kurang mampu mengangkat IHSG dari zona merahnya. “Kuatnya belenggu negatif dari pelemahan nilai tukar rupiah dan imbas pelemahan bursa saham global membuat IHSG terus mendekam di zona merah sepanjang sesi perdagangan. Pelemahan berlanjut setelah nilai tukar rupiah, dan masih adanya transaksi jual asing membuat IHSG yang sebelumnya merayap positif berbalik arah jelang akhir sesi,” katanya Reza Priyambada, di Jakarta, Minggu (29/9).(okz)

Waspada/Surya Efendi

MEMPERKECIL UKURAN TEMPE: Seorang perajin tempe menjemur tempe yang telah dikemas dalam bungkus plastik di industri rumah tangga Medan Sunggal, Minggu (29/9). Perajin banyak yang memperkecil kemasan tempe ini dikarenakan harga bahan baku pembuat tempe masih mahal.

Kadin Minta Gas Benggala Untuk Industri MEDAN (Waspada): Kamar Dagang dan Industri (Kadin) Sumut mendesak Kementerian Energi Sumber Daya Mineral (ESDM) memprioritaskan gas dari Sumur Benggala di Kab. Langkat, diserahkan sepenuhnya untuk keperluan industri. Pjs Ketua Kadin Sumut Tohar Suhartono, Minggu (29/ 9), mengatakan, pihaknya telah mengirimkan surat ke Menteri ESDM untuk masalah krisis gas dan listrik. Karena, akibat krisis ini sudah mulai terjadi Pemutusan Hubungan Kerja (PHK) dan karyawan yang dirumahkan. Menurutnya, berdasarkan laporan yang diterimanya, saat ini ribuan karyawan kehilangan pekerjaannya. “Kami berharap agar prioritas gas Benggala-1 seutuhnya

diperuntukkan bagi industri. Tidak tidak dibagikan kepada yang lainnya atas dasar beberapa pertimbangan seperti, dari 54 perusahaan industri yang memakai gas sebagai bahan bakar, 6 di antaranya telah tutup dan satu tidak dapat beroperasi, serta yang lainnya tidak dapat beroperasi secara optimal,” kata Tohar Suhartono. Didampingi Wakil Ketua Umum Kadin Sumut Johan Brien, Tohar Suhartono, menyebutkan, akibat banyaknya perusahaan yang telah tutup, diketahui sebanyak 5.000 orang pekerja kehilangan pekerjaannya. Selain itu, akibat perusahaan yang tidak dapat beroperasi secara optimal, 1.500 karyawan terpaksa dirumahkan. Disebutkannya, 95 persen produksi perusahaan pemakai gas adalah untuk tujuan ekspor, maka akibat krisis gas berkepanjangan tersebut menyebabkan ekspor Sumut menurun. “Kadin bergerak untuk kepentingan alur industri. Industri adalah bagian perekonomian yang harus disinyalir adanya bahan baku gas. Dan gas adalah

bahan baku utama yang tak mungkin tergantikan. Gas kalau tidak ada maka industri akan menurun bahkan akan mati,” ujar Tohar. Sementara itu, Johan Brien, mengatakan kebutuhan gas di Sumut 29,54 mmscfd. Namun kondisi saat ini menurun drastis tinggal 7 mmscfd pada awal Agustus 2013. Jika nanti ada pertambahan 4 mmscfd dari gas Benggala-1, maka akan menjadi 11 mmscfd. Walaupun masih kurang, tapi bisa membantu menyambung hidup operasional beberapa industri. Namun saat ini gas dari Benggala tersebut harus dibagi dua dengan PLN. “Bagi PLN gas sebesar 2 mmscfd tidak berarti, tetapi bagi industri sangat berarti. Yaitu dapat membuat beberapa industri di Sumut dapat kembali beroperasi secara normal. Sebaliknya, jika gas Benggala-1 ini tidak diprioritaskan untuk industri, maka akan menambah jumlah perusahaan yang gulung tikar dan ribuan pekerja terancam kehilangan pekerjaan,” Johan Brien. (m41)

Rizal Ramli Jadi Ketua Kadin —Suryo : Itu Acara Lucu-lucuan DENPASAR ( Waspada): Ekonom Rizal Ramli, terpilih sebagai Ketua Umum Kadin Indonesia, melalui forum rapat pimpinan nasional (Rapimnas) di Bali, Sabtu (28/9). Tapi Ketua Umum Kadin sebelumnya Suryo Bambang Sulisto, menyebut acara tersebut ilegal. Rizal Ramli, dipilih oleh mayoritas pengurus daerah Kadin dan asosisi yang hadir dalam Rapimnas. Selain itu, peserta Rapimnas menunjuk Setiawan Djodi, sebagai Ketua Dewan Penasehat dan Oesman Sapta Odang, sebagai Ketua Dewan Pertimbangan Kadin. Dari 23 pengurus Kadin yang hadir sepakat memilih Rizal, sebagai Ketum Kadin sampai diselenggarakan munas ke-7 yang akan digelar di Jakarta bulan Oktober 2013 mendatang.

Dalam sambutannya, Rizal, menyatakan sebenarnya tidak mengira mendapat kepercayaan sebagai Ketua Kadin yang baru. “Ke depan Kadin bisa memainkan peranan lebih signifikan untuk berkontribusi bagi perekonomian di percaturan nasional dan internasional,” ujar Rizal, saat menyampaikan pidato usai terpilih sebagai Ketum Kadin. Karena itu, Rizal, berjanji untuk membenahi dan memperbaiki organisasi ini bersama-sama dengan anggota Kadin daerah. Rapimnas di Bali itu tidak dihadiri oleh Suryo Bambang Sulisto, yang saat itu masih menjabat sebagai ketua Kadin yang sah. Kondisi internal Kadin saat ini tengah memanas. Kepemimpinan Suryo, dinilai tidak mampu mendorong

perekonomian nasional yang tengah bergejolak dan dinilai memburuk. Bahkan Kadin dituding kerap diintervensi pihak-pihak tertentu. Menanggapi situasi tersebut, puluhan elit pengurus DPD se-Indonesia pun menggelar Rapimnas di Bali. Mereka mengonsolidasikan diri guna melengserkan Suryo. Sedianya, Kadin menggelar munas pada Oktober mendatang di Jakarta. Lucu-lucuan saja Sementara Ketua Umum Kadin Suryo Bambang Sulisto, menanggapi pelaksanaan Rapimnas di Bali, menyebutkan acara itu illegal. Baginya acara yang yang mengatasnamakan Kadin dan memilih Rizal Ramli sebagai Ketua Umum itu hanya acara lucu-lucuan saja. (okz/ vvn)

BNI Gelar Debat Mahasiswa Nasional MEDAN (Waspada): PT Bank Negara Indonesia (Persero) Tbk bekerjasama dengan tvOne menggelar program Debat Mahasiswa dengan tema Aspirasi untuk Negeri. “Program ini digelar untuk memberikan ruang bagi para mahasiswa yang duduk pada jenjang pendidikan Diploma 3 (D3) hingga Strata 1 (S1) untuk menyampaikan gagasan inovatif dan ide kreatif dalam menjawab berbagai permasalahan yang dihadapi masyarakat,” kata CEO BNI Kantor Wilayah Medan Johnny R Tampubolon, kemarin. Johnny R Tampubolon mengatakan, debat ini digelar dengan format menghibur dan penyisihan dilakukan di Medan, Yogyakarta, Surabaya, Makassar dan Jakarta. Tahapan penyisihan di Medan akan berlangsung pada tanggal 1-3 Oktober 2013 di Raz Plaza, Jalan Dr Mansyur. Johnny R Tampubolon mengatakan, Debat Mahasiswa

ini dipilih karena kelompok mahasiswa merupakan intelektual muda yang mampu membawa perubahan pada perjalanan berbangsa di Indonesia, mulai dari era Orde Lama, Orde Baru hingga Orde Reformasi. Salah satu upaya yang dapat dilakukan untuk mengakumulasikan energi mahasiswa ke arah aktivitas positif adalah mengajak mahasiswa menyalurkan pemikiran, renungan, ide dan gagasan ke dalam wadah yang bersifat positif dan memiliki dorongan kompetisi, yakni melalui Debat Mahasiswa. Hal ini sesuai dengan tagline BNI yakni Melayani Negeri, Kebanggaan Bangsa, sehingga tagline Debat Mahasiswa ini adalah Aspirasi untuk Negeri. “Dimana dalam suatu aspirasi bisa terkandung banyak gagasan, solusi dan ide yang kreatif,” ujarnya. Pada tahap penyisihan di Medan, telah terdaftar 39 tim yang berasal dari berbagai uni-

versitas di Kota Medan, Pematangsiantar, Riau, Padang, Banda Aceh dan Sigli. “Audisi dilaksanakan tanggal 1 dan 2 Oktober 2013. Lima tim yang masuk babak final akan ditandingkan pada Kamis (3/10). Sedangkan babak final tingkat nasional berlangsung pada Februari 2014 di Jakarta,” ujar Johnny R Tampubolon. Program ini juga didesain untuk menjembatani BNI dalam meningkatkan fungsi intermediasinya dengan kelompok masyarakat yang tepat, sesuai kriteria nasabah bagi setiap produknya. Dalam kesempatan ini, produk utama yang didorong oleh BNI adalah Taplus Muda. “Dengan jalan ini, BNI turut mendukung upaya nasional dalam meningkatkan financial literacy pada kelompok penduduk berusia muda dan memberi jalan bagi upaya BNI untuk menjadi lifetime banking bagi mahasiswa,” ujar Johnny R. (m41)

Erupsi Sinabung Potensi Timbulkan Kredit Macat MEDAN (Waspada): Bank Indonesia (BI) memprediksi erupsi Gunung Sinabung, di Kabupaten Karo berpotensi menimbulkan kredit macat. Karena, erupsi bisa menyebabkan kerusakan tanaman petani. Pemimpin BI Kantor Wilayah IX Sumut dan Aceh Hari Utomo, di Medan, Jumat (27/9), mengatakan hal ini perlu menjadi perhatian semua pihak secara resius. Katanya, di Kab. Karo ada lima kantor cabang dan sembilan kantor cabang pembantu. Bank yang beroperasi di kabupaten tersebut antara lain BRI, BNI, Bank Permata, Bank Sumut, Bank Syariah Mandiri, Bank Danamon, BTPN, dan Bank Mega. Melihat potensi besar terjadi kredit macat itu, maka perlu dilakukan langkah identifikasi lebih jauh. Data menunjukkan, erupsi Gunung Sinabung dua pekan lalu berdampak besar pada hasil pertanian dan hortikultura. “Oleh karena itu BI bersama perbankan akan melakukan identifikasi debitur atau kelompok tani yang berisiko kredit macet untuk kemudian menentukan langkah-langkah penanganan dari sisi perbankan,” kata Hari Utomo. Penanganan yang dilakukan bisa berbagai cara. Mulai dari bantuan dalam bentuk Corporate Social Responsibility (CSR), dana bergulir, maupun bantuan lainnnya. Sementara itu, Kepala Dinas Pertanian Sumut M.Roem, mengatakan Pemerintah Provinisi Sumut sedang mendata erusakan tanaman pascaerupsi Sinabung. Kerusakan tanaman bukan hanya karena terkena debu vulkanik Sinabung, tetapi karena juga kurang dirawat dampak warga mengungsi. Pemkab Karo sendiri masih menetapkan kawasan itu sebagai tanggap darurat hingga akhir pekan ini.(ant)

Telkomsel Konsisten Tingkatkan Jaringan Broadband Di Sumbagut MEDAN (Waspada): Telkomsel ke depannya lebih vokus melakukan penetrasi jaringannya di bidang Broadband sesuai arahan pemerintah serta secara konsisten terus menjaga kualitas layanannya baik layanan dasar meliputi voice, SMS maupun layanan data. Berbicara dengan wartawan Jumat (27/9), General Manager (GM) ICT Operation Sumbagut M Hamzah Berdikari didampingi Ida Rohana-Legal & Stake Holder menyatakan, berdasarkan data statistik Bank Dunia bahwa penetrasi jaringan broadband 10 persen dapat meningkatkan pendapatan daerah. Karenanya bila insfrastruktur mendukung broadband dibangun Telkomsel disambut masyarakat, mestinya perekonomian bisa tumbuh seperti yang diharapkan pemerintah. Ia mengakui, walaupun saat ini Telkomsel begitu gencarnya membangun fasilitas jaringan Broadband, namun dalam pelaksanaannya masyarakat dirasa masih belum memanfaatkannya secara maksimal, padahal sekarang ini jendela dunia ada di internet. Di sisi lain, M. Hamzah Berdiri menambahkan, layanan Telkomsel Regional Sumbagut meliputi wilayah Provinsi Nanggroe Aceh Darussalam (NAD) dan Sumatera Utara di dukung lebih dari total 7200 BTS (2G dan 3G). Hingga kuartal ke 3 tahun 2013, telah membangun lebih dari 1500 BTS dengan komposisi 70% BTS 3G dan 30% BTS 2G. Persentase peningkatan yang lebih besar pada pembangunan BTS 3G merupakan wujud komitmen Telkomsel untuk memenuhi kebutuhan pengguna layanan data yang semakin meningkat. Menurutnya, saat ini kebutuhan masyarakat untuk menggunakan data sangat tinggi dan Telkomsel secara berkesinambungan meningkatkan pembangunan jaringan 3G secara masif termasuk melakukan modernisasi jaringan. Dengan peningkatan pembangunan jaringan 3G diharapkan pelanggan akan semakin nyaman menggunakan layanan data Telkomsel terutama saat internetan, baik untuk browsing, chatting hingga video streaming dengan youtube. Sebagai bagian dari Telkom Group, saat ini telah tersedia akses internet WiFi diberbagai wilayah dengan layanan dan Telkomsel Flash Zone. Pelanggan dapat menikmati akses internet dengan kecepatan tinggi dan untuk login ke jaringanWiFi pelanggan menghubungi *303*601# lalu akan mendapatkan username dan password. Tantangan saat ini dihadapi adalah tindakan vandalisme pihak yang tidak bertanggungjawab terhadap perangkat telekomunikasi di BTS. Sebagai wujud komitmen Telkomsel dalam menjaga kualitas layanan Telkomsel bekerjasama dengan aparat keamanan dan masyarakat untuk turut bersama menjaga keamanan perangkat telekomunikasi. Untuk mengantisipasi catuan daya listrik terutama pada wilayah yang rawan pemadaman, Telkomsel melakukan langkah antisipatif berupa memobilisasi perangkat genset bergerak, yang dapat dimanfaatkan di wilayah manapun sesuai kebutuhan. Sejak daerah ini mengalami krisis listrik, Telkomsel telah menyediakan 400 genset permanen termasuk 120 genset bergerak.(m19)


WASPADA Senin 30 September 2013




SEORANG bocah menirukan gerak tubuh dari patung pasukan Cakrabirawa ketika mengunjungi Museum Jenderal Besar DR AH Nasution, Jakarta Pusat, Minggu (29/9). Petugas dari Dinas Sejarah Mabes TNI AD merawat diorama di Museum Jenderal Besar DR AH Nasution. Tanggal 1 Oktober diperingati sebagai Hari Kesaktian Pancasila untuk mengenang korban dari peristiwa G30S/PKI yang juga merenggut nyawa putri Jenderal Besar Nasution, Ade Irma Suryani Nasution (kanan).

Anggota Komisi III DPR Heran Hasil Sitaan KPK Belum Diaudit JAKARTA (Waspada): Anggota Komisi III DPR RI, Fahri Hamzah merasa heran atas pernyataan Komisi Pemberantas Korupsi (KPK) mengenai penyelamatan keuangan negara dalam kasus-kasus korupsi. Pasalnya pernyataan itu tidak terklarifikasi berdasarkan aturan dan hukum yang berlaku. Jadi penyelamatan keuangan negara, hanyalah klaim sepihak KPK sebab tidak pernah diaudit oleh Badan Pemeriksa Keuangan (BPK). Menurut laporan BPK kepada Badan Akuntabilitas Keuangan Negara (BAKN), tambahnya, BPK belum pernah melakukan audit terhadap barang-barang yang disita KPK, sehingga barangbarang yang disita dan disetor ke kas negara tanpa proses audit. “ Ini yang jadi tanda tanya, dari mana KPK bisa mengumumkan berhasil menyelematkan keuangan negara dengan besaran tertentu. Padahal, barang-barang sitaan harus diaudit terlebih dahulu baru kemudian disetorkan ke kas negara,” ujar Fahri ketika dihubungi wartawan Minggu (29/9). Barang-barang yang disita disetor ke kas negara tanpa proses audit, jelasnya, sangat rawan diselewengkan. Dengan proses seperti ini, bisa saja yang dirampas 100, tapi yang disetor hanya 5.Sebenarnya ini tidak boleh dilakukan. BPK sendiri, disebutkan sampai saat ini tidak tahu dimana KPK menyimpan barang-barang sitaan. “Ini bisa terjadi karena KPK tidak ada yang mengawasi,” tambahnya. Oleh karena itu, politisi dari Partai Keadilan Sejahtera (PKS) itu mempertanyakan kenapa permintaan DPR kepada BPK terkait audit terhadap KPK sampai sekarang belum pernah masuk ke DPR. BPK, jelas Fahri, juga tampaknya takut untuk melakukan audit terhadap KPK. ”Padahal kita sudah meminta sejak lama kepada BPK, tapi sampai saat ini laporan terkait audit kinerja BPK atas KPK tidak juga masuk. Ada kesan antara BPK dan KPK saling sandera juga,”tegasnya.

Dengan Pesawat Pengangkut Jamaah Haji

Dia menambahkan, berdasarkan hasil pertemuan dengan para mantan penyidik KPK beberapa waktu lalu, penetapan seseorang sebagai tersangka, tidak ada ubahnya dengan penetapan headline media. “Kantor KPK itu seperti kantor redaksi di media massa. Menentukan status tersangka terhadap seseorang tak beda dengan penentuan judul headline,” tukasnya. Sementara pakar Hukum Tata Negara dari Universitas Parahyangan Bandung, Asep mengatakan prinsip hukum terkait uang yang masuk kas negara harus teraudit dahulu. Jika uang tersebut langsung dimasukkan tanpa proses audit oleh BPK, maka uang tersebut bukanlah uang negara dan tidak bisa dimasukkan dalam kas negara. “Kalau sudah diaudit BPK baru bisa sah, dimasukkan ke kas negara. Jadi, memang tidak bisa diklaim begitu saja tanpa audit,” ujar Asep ketika dihubungi. Tidak itu saja, menurut Asep, aset dari hasil sitaan juga harus jelas disimpan dimana, digunakan untuk apa dan bagaimana menyim-pannya. ”Kalau aset-aset sitaan itu ternyata disimpan di rekening-rekening pribadi, bukan hanya bunga dari aset yang tidak jelas larinya, tapi juga asetaset sitaan tersebut sangat rawan digelapkan,” tandasnya. Kondisi ini, jelasnya, harus disikapi oleh DPR. Kalau BPK tidak berani mengaudit, sementara kejaksaan dan kepolisian juga tidak pernah berani mengusik KPK, maka DPR lah yang harus keras menyuarakan hal ini. DPR menurutnya, tidak perlu takut, meski harus melawan opini publik yang mengatakan DPR ingin melemahkan KPK. Asep mengingatkan bahwa KPK juga perlu diawasi. Jangan melihat seolah orang-orang di KPK adalah malaikat, yang hanya diawasi oleh Tuhan.”Kita lihat secara proforsional, kalau memang kejadiannya KPK melanggar hukum dan aturan, maka harus ditindak juga. Walau sulit, KPK tetap harus ada yang mengawasi,” tandasnya.(aya)

Pemerintah Pulangkan WNI Overstay JAKARTA (Antara): Menteri Koordinator bidang Kesejahteraan Rakyat (Menko Kesra) Agung Laksono mengatakan, pemerintah siap memulangkan Warga Negara Indonesia (WNI) yang overstay di Arab Saudi dengan menggunakan pesawat pengangkut jamaah haji. “Pemulangan dilakukan sepanjang tidak menganggu jadwal rotasi penerbangan haji,” kata Agung Laksono di Jakarta, Sabtu (28/9).

Sampai 19 September 2013, jumlah WNI overstay yang sudah terdaftar untuk pulang dengan menggunakan pesawat pengangkut jamaah haji Garuda Indonesia ini sekitar 2.500 orang. Di luar itu masih ada sekitar 1.100 orang yang pulang ke tanah air dengan biaya mandiri. Data Kementerian Luar Neg e r i m e n y e b u t k a n , WNI overstay di Arab Saudi mencapai 120 ribu WNI. Dari jumlah ter-

KPK Terus Dalami Korupsi PON Riau PEKANBARU (Antara): Komisi Pemberantasan Korupsi (KPK) terus mendalami kasus dugaan korupsi dalam penyelenggaraan Pekan Olahraga Nasional (PON) yang melibatkan sejumlah legislator dan pejabat daerah, termasuk Gubernur Riau, Rusli Zainal. “Yang jelas penyidik masih terus mendalami kasus PON Riau. Sampai saat ini,” kata Juru Bicara KPK, Johan Budi, saat dihubungi dari Pekanbaru, Minggu(29/9). Kasus korupsi PON Riau berawal dari rencana pemerintah daerah dan para legislator Riau untuk merevisi Peraturan Daerah (Perda) Nomor 6 Tahun 2010 tentang Penambahan Biaya Arena Menembak PON Riau. Terkait kasus tersebut, KPK juga telah menetapkan belasan orang dari kalangan oknum eksekutif maupun legislatif di Provinsi Riau sebagai tersangka. Sejauh ini sebagian anggota DPRD Riau yang menerima suap sudah disidang dan dijatuhi vonis. Demikian juga dengan pejabat Dinas Pemuda dan Olahraga Riau serta pihak swasta yang dianggap terbukti sebagai pemberi suap.

Demokrat Nilai Ruhut Miliki Integritas Uji Kelayakan Sutarman Di JAKARTA (Waspada): Wakil Ketua Majelis Tinggi Partai Demokrat, Marzuki Alie mengungkapkan alasan Partai Demokrat mengajukan Ruhut Sitompul sebagai ketua Komisi III DPR, karena partai Demokrat melihat sosok Ruhut yang bersih, memiliki integritas, tidak pernah bermain kasus, maupun proyek selama sebagai anggota komisi III di DPR. “Memang terlihat Ruhut kerap membuat kontroversi dengan pernyataan-pernyataannya yang mungkin dinilai oleh sebagian publik tidak menyenangkan. Tapi yang perlu dicatat, Ruhut tidak pernah main kasus atau menjadi makelar kasus. Ruhut juga tidak pernah bermain anggaran. Kita perlu orang yang memimpin Komisi III mengawal dan mengawasi lembaga penegak hukum. Ruhut mungkin tidak menarik sedikit, tapi bersih dan tidak bermain dengan kasus,” ujar Marzuki ketika dihubungi di Jakarta, Jumat (27/9). Menurut Marzuki, partainya menyadari bahwa ada sebagian masyarakat yang tidak menyukai keputusan partainya ini, namun diharapkan masyarakat juga harus menyadari bahwa bangsa ini memerlukan pemimpinpemimpin yang jujur dan memiliki integritas. Ruhut, menurutnya, sudah menunjukkan selama empat tahun menjadi anggota DPR tidak pernah terlibat dengan urusan kasus, bermain proyek atau hal-hal yang berkaitan dengan bidang tugasnya sebagai anggota DPR. “Ini bisa dikonfirmasi mungkin dengan para

penegak hukum bahwa Ruhut tidak pernah sekalipun minta tolong pada aparat penegak hukum untuk membantu orang-orang yang terkena kasus pidana. Ini kelebihan yang mungkin tidak banyak dimiliki para pemimpin saat ini. Ruhut mungkin memiliki bahasa, atau komunikasi politik yang aneh sehingga tidak semua orang menyukainya. Tapi kalau melihat kepentingan negara yang lebih besar, maka dialah yang cocok mengawal hukum di Indonesia. Sosok yang bukan pemain seperti Ruhut ini yang kita butuhkan,” tegasnya. Marzuki juga menegaskan, partai lain tidak bisa melarang Partai Demokrat untuk menunjuk Ruhut. Hal ini, menurutnya, karena sejak awal sudah ada kesepakatan atau konvensi di antara partai yang memiliki komisi di DPR dan Partai Demokrat sebagai pemenang pemilu memiliki jatah 3 kursi sesuai kesepakatan atau konvensi. Partai Demokrat ataupun partai lainnya yang memiliki jatah komisi, bebas menentukan siapa yang duduk menjadi pimpinan di komisi.”Jadi ini kesepakatan di antara fraksi di DPR,” tandasnya. Ditanyakan mengapa Partai Demokrat memilih Ruhut dan tidak anggota FPD lainnya, Marzuki mengatakan bahwa Partai Demokrat banyak memiliki kader yang pantas untuk duduk sebagai ketua Komisi III.Tapi. menurutnya, Komisi III adalah komisi yang galak, yang bisa memakan orang setiap saat, sehingga orang seperti Ruhut lah yang dibutuhkan. (aya)

Komisi III DPR Akan Mulus

JAKARTA (Waspada): Anggota Komisi III DPRRI dari Fraksi Gerindra Martin Hutabarat mengakui pengajuan nama Komjen Pol Sutarman sebagai Kapolri dari Presiden Susilo Bambang Yudhoyono (SBY) ke DPRRI sudah diperkirakan sebelumnya. Apa lagi posisi Sutarman sebagai Kabareskrim Polri sudah memberi petunjuk kuat ke arah itu. Senioritasnya juga mendukung dan relatif rekam jejaknya cukup menonjol . “Saya pikir di Komisi III yang membidangi kepolisian dan akan melakukan uji kelayakan dan kepatuhan terhadap calon Kapolri akan berjalan mulus dan diterima DPR,” ujar Martin Hutabarat kepada Waspada, Sabtu (28/9) di Jakarta. Menurut Martin, pembawaan yang sederhana dan mudah dihubungi oleh siapapun, posisi Sutarman sebagai Kapolri tidak akan menjadi menara gading. Di internal pun tidak ada penolakan terhadap Sutarman. Sebagai pengayom masyarakat, tambahnya, Polri tentunya harus tahu menempatkan posisi berdirinya disetiap tarik-menarik kepentingan. Kalau Sutarman terpilih jadi Kapolri, menurut Martin, dia harus dapat melakukan reformasi di tubuh kepolisian. Halinipenting mengingat simpatimasyarakatterhadapKepolisian sekarang sangat rendah. Disamping itu, tugas mempersiapkan pengamanan Pemilu 2014 penting dilakukan sebaik-baiknya. Namun, Martin berpendapat bahwa yang mendesak dilakukan dalam waktu dekat adalah menuntaskan kasus penembakan misterius terhadap anggota-anggota Polri yang sampai sekarang tidak kedengaran lagi kelanjutan penyidikannya. Sementara Ketua DPR Marzuki Alie mengakui bahwa presiden tidak banyak kesulitan melakukan pemilihan calon Kapolri, karena banyak figur jenderal bintang tiga yang memenuhi syarat jadi calon Kapolri. (aya)

IPW Sayangkan Sikap Kalangan DPR


BECAK TENAGA SURYA: Sejumlah siswa Sekolah Menengah Kejuruan (SMK) Kandanghaur mencoba Becak Listrik bertenaga surya di Alun-alun, Indramayu, Jawa Barat, Minggu (29/9). Becak tenaga surya yang mampu menempuh kecepatan maksimal 20km/jam karya siswa SMK tersebut merupakan karya pemanfaatan energi terbarukan.

JAKARTA (Waspada): Indonesia Police Watch (IPW) menyayangkan sikap kalangan DPR yang sudah ramai-ramai koor mendukung Kabareskrim Komjen Pol Sutarman menjadi Kapolri menggantikan Jenderal Pol Timur Pradopo tanpa bersikap kritis dan melihat sisi negatif di balik pencalonan tersebut, kata Ketua Presidium IPW Neta S Pane dalam siaran persnya di Jakarta, Minggu (29/9). Dengan adanya sikap koor kalangan DPR tersebut, kata Neta, IPW melihat proses pencalonan Kapolri baru sesungguhnya sudah selesai. Ada pun uji kepatutan dan uji kelayakan yang akan dilakukan Komisi III DPR hanya forum basa basi yang tidak penting dan hanya buang-buang enerji. “Padahal IPW melihat ada enam masalah besar di balik pencalonan figur Sutarman sebagai calon Kapolri,” ucap Neta. Dikatakannya, enam permasalah tersebut adalah, pertama, jika dilantik pada akhir tahun 2013 berarti usia jabatan Sutarman sebagai Kapolri tinggal 21 bulan lagi. “Dalam masa jabatan yang singkat tersebut apa yang bisa dilakukannya untuk membenahi Polri?,” tanya Neta. Permasalahan kedua, hubungan buruk dengan KPK akibat Sutarman mencoba ‘pasang badan’ dalam kasus korupsi Simulator SIM akan menjadi kendala serius bagi masa depan kedua lembaga. Ketiga, mandegnya penanganan kasus korupsi Alkes. Ke empat mandegnya penangan kasus korupsi plat nomor kendaraan bermotor. Ke lima, mandegnya kasus surat palsu Mahkamah Konstitusi (MK) dan ke enam, selama menjadi Kabareskrim, Sutarman tidak terlihat memaksimalkan unit kerja Tipikor Polri .(j02)

sebut 89.458 orang sudah mengajukan permohonan surat perjalanan laksana paspor (SPLP). Agung menambahkan,WNI overstay yang akan memanfaatkan kekosongan pesawat haji ini biayanya jauh lebih murah hanya 188 dolar AS. “Biaya tersebut antara lain untuk pembelian bahan bakar pesawat dan biaya makan selama di pesawat,” katanya. Sedang mereka yang pulang

secara mandiri dikenakan biaya penerbangan normal sekitar 600 dolar AS. “PemulanganWNI‘overstay’ ini sudah mendapat izin prinsip dari Menteri Agama dan Kerajaan Arab Saudi. Kita akan manfaatkan pesawat haji yang pulang ke tanah air untuk mengangkut mereka dengan jumlah 3.419 kursi,” katanya. Terhadap paraWNI overstay yang pulang secara berkelompok, pemerintah berjanji me-

ngantarkan pemulangan mereka ke kampung halaman dengan pengawalan ketat dari petugas dan tanpa dipungut biaya. Terkait makin sempitnya waktu pemberian amnesti Arab Saudi bagi para WNI overstay yang akan berakhir 3 November 2013, Menko Kesra berjanji akan terus melakukan pendekatan kepada pemerintah Arab Saudi sehingga tidak akan dilakukan sanksi apapun.

NasDem Nilai PLN Gagal Jalankan Tugasnya JAKARTA (Waspada): Pemadaman listrik yang berlarutlarut dilakukan Perusahaan Listrik Negara (PLN) di Sumatera Utara (Sumut) merupakan bukti kegagalan pemerintah atau negara memenuhi kebutuhan rakyat yang sangat mendasar. “PLN sebagai salah satu Badan Usaha Milik Negara (BUMN) yang bertugas memenuhi kebutuh listrik gagal menjalankan tugasnya, “ujar politisi Partai Nasiomal Demokrat (NasDem) Aldentua Siringoringo, SH menjawab Waspada, Minggu (29/9) di Jakarta. Menurut alumni Fakultas Hukum Universitas Sumatera Utara (FH-USU) ini, kegagalan pemerintah memenuhi kebutuhan listrik masyarakat Sumut sudah tidak sesuai lagi dengan apa yang diamanatkan UUD 1945, dimana pada pasal 33 UUD 1945 bahwa bumi, air dan kekayaan alam yang terkandung di dalamnya dikuasai oleh negara dan dimanfaatkan sebesar-besarnya untuk ke-

makmuran rakyat. “Bayangkan kekayaan alam yang dimilik Sumut, khususnya untuk energi yang begitu besar, ternyata tidak dapat dinikmati rakyat, tandas calon anggota legislatif dari daerah pemilihan Sumut III ini. Jangankan banyaknya pembangkit tenaga listrik di Sumut, kalau benar-benar dikelola dan dimanfaatkan hanya dengan keberadaan Danau Toba yang airnya mengalir ke Siguragura dan bermuara ke Asahan mampu memberikan energi listrik yang cukup besar dan bisa membuat Sumut terang benderang. Tapi dengan krisis listrik yang sekarang terjadi bagaimana mau makmur? Kebutuhan listrik untuk menjalankan usaha dan aktivitas masyarakat saja tidak bisa berjalan dengan baik, tandasnya. Pemadaman listrik yang sudah diluar batas kewajaran tentu menimbulkan kerugian yang cukup besar. Para pelaku industri di Sumut pasti menga-

lami kerugian akibat terganggu melakukan produksi dan operasi perusahaan. Aldentua juga menegaskan, akibat pemadaman listrik yang kebablasan di Sumut sudah membuat bidang pariwisata mati suri, khususnya yang bergerak di bidang hotel dan restauran. PLN sebagai BUMN yang memonopoli penanganan listrik, tambah praktisi hukum ini, harus segera memenuhi kebutuhan listrik di Sumut, jika tidak mampu, Aldentua menyarankan agar pemerintah mencabut monopoli dan memberikan pengelolaan dan pemasokan serta distribusi listrik ke perusahaan lain, atau dicari usaha lain yang lebih baik. Pemadaman listrik yang terjadi tanpa mengenal waktu dan sudah berlangsung cukup lama, menurut Aldentua, sudah saatnya masyarakat menuntut dan menggugat pemerintah dan PLN untuk meminta pertanggungjawaban atas kelalaian dan ketidakmampuanya.(aya)

6 Toilet Bandara Di Sumatera, Terbersih se-Indonesia JAKARTA (Waspada): Dari 20 bandara yang mendapat penghargaan Sapta Pesona Toilet Umum Bersih Bandara 2013 yang diselenggarakan Kementerian Pariwisata dan Ekonomi Kreatif (Kemenparekraf), 6 di antaranya merupakan bandara yang ada di Pulau Sumatera. Bahkan Bandara Sultan Syarif Kasim II Pekanbaru menduduki posisi utama mengalahkan Bandara Internasional Soekarno-Hatta, Jakarta. Menparekraf DR. Mari Elka Pangestu mengatakan bandara merupakan pintu gerbang masuknya wisatawan, baik wisatawan Nusantara (wisnus) maupun wisatawan mancane-gara (wisman). “Secara tidak langsung, toilet jadi cerminan budaya bangsa sekaligus mencerminkan citra Indonesia,” ungkapnya usai memberikan penghargaan Sapta Pesona Toilet Umum Bersih Bandara 2013 kepada 20 bandara internasional dan nasional se-Indonesia di Balairung Soesilo Soedarman, Gedung Sapta Pesona, Kemenparekraf, Jl. Medan Merdeka Barat, Jakarta Pusat, Kamis (26/9). Mari berharap penghargaan ini bukan hanya mensosialisasikan standar dan kriteria toilet yang nyaman di bandara, pun dapat memberti kenyamanan wisatawan yang datang. Ketika ditanya apa ada dampak kenaikan wisatawan dengan adanya toilet umum bersih di bandara? Mari menjawab jelas ada pengaruhnya. “Tapi perlu disurvei dulu berapa besar dampak dan kenaikannya itu,” ujarnya. Menurut Mari banyak orang meremehkan penghar-


TOILET bandara bukan sekadar bersih dan nyaman. gaan ini. “Orang boleh ketawa saat bicara penghargaan toilet ini. Padahal ini hal yang serius karena menyangkut kenyamanan pemakainya dan citra bangsa juga tercermin di sini,” terangnya. Oleh karenanya penghargaan toilet ini diharapkan kelak menyentuh tempat lain seperti toilet pelabuhan, stasiun, dan toilet terminal. “Tahun berikutnya nanti juga akan dinilai toilet umum bersih tempat wisata,” tandasnya. Ketua Panitia Penghargaan Sapta Pesona Toilet Umum Bersih Bandara 2013, Naning Adiwoso mengatakan kebersihan dan kelayakan toilet bandara dinilai seperti hotel, berdasarkan bintang mulai dari 1 (yang terkecil) sampai 5 (yang terbesar). Skor minimal untuk mendapat bintang 1 adalah 65. Dalam penghargaan yang ke- 4 ini, ada 6 bandara di Sumatera yang memperoleh

penghargaan tersebut yakni Bandara Sultan Syarif Kasim II di Pekanbaru, Riau yang menempati posisi pertama dengan skor 89,62. “Bandara di Pekan baru ini mendapat bintang 4”, jelas Naning. Kemudian ada Bandara Sultan Badaruddin II di Palembang, Sumsel (75,91), Bandara Internasional Sultan Iskandar Muda di Banda Aceh, Aceh (75,88), Bandara Internasional Minangkabau di Padang, Sumbar (75,60), Bandara Internasional Kualanamu di Deli Serdang, Sumut di peringkat 11, dan Bandara Hang Nadim di Batam, Kepri di posisi 20. Dewan juri yang menilai penghargaan ini terdiri atas Asosiasi Toilet Indonesia (ATI), Kemenparekraf, Kementerian Perhubungan, Kementerian Kesehatan, Kementerian BUMN, Yayasan Lembaga Konsumen Indonesia, media, dan pemerhati toilet.(adji k.)

Agenda 06.45 Sinema Pagi 08:30 Dahsyat 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 THE BIGGEST GAME SHOW (ReRun) 14:00 KABAR KABARI 14:30 Sinema Siang 16:30 SEPUTAR INDONESIA 17:00 TENDANGAN DARI LANGIT 18:00 SURAT KECIL UNTUK TUHAN 19:30 ANAK - ANAK MANUSIA 20:30 TUKANG BUBUR NAIK HAJI THE SERIES 21:45 TVM 23:45 Box Office Movie


06:30 SL Inbox 08:45 Hot Shot 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SL Super Boy Indonesia 16:30 SL Liputan 6 Petang 17:00 Top Chef Indonesia 19:00 3 Semprul Mengejar Surga 20:00 Si Cemong 21:00 Pesantren & Rock n Roll Season 3 22:00 Emak Ijah Pengen Ke Mekah 23:00 Film Layar Lebar Sabtu

07:00 Jendela 07:30 Pengobatan Alternatif Torch 08:00 Layar Unggulan 09:30 Pelesir 10:00 Pose 10:30 Mata Pancing 11:00 Layar Kemilau 15:30 Layar Keluarga 17:00 Inspirasi Sore 17:30 Tuntas 18:00 Temen Tapi Demen 19:00 Gajah Mada 20:30 Raden Kian Santang 22:00 Hidayah 00:00 Layar Tengah Malam 01:45 Frendly Match

06:45 Hati Ke Hati Bersama Mamah Dedeh 07:30 Foody With Rudy 08:00 Clinic Secret Herbal 08:30 Fenomania 09:30 Kaki 5 10:00 Semua Bisa Plesir 10:25 Angry Birds Toons 10:30 Tamu Rempong 11:30 Topik Siang 12:00 KLIK! 13:00 Mantap 14:00 Total Football 14:30 Kampiun Sepakbola Nasional 15.00 Indonesia Super League 17:35 Pesbukers 18.00 RT Sukowi 21:00 Sinema Spesial 23:00 Mata Lensa

07:00 Ultramen Nexus 07:30 Sailor Moon 08:00 Kartun Indonesia 09:00 Metal Fight Beyblade 4 D 09:30 Hot Wheels Battle Force 10:00 Kiss Pagi 11:00 Hypermart Show 4 11:30 Patroli 12:00 Sinema Pintu Taubat Siang : TBA 14:00 Hot Kiss 15:00 Fokus 15:30 Surga Di Telapak Kaki Ibu 16:00 Sinema TV Sore 18:00 Drama Seri : Damar Wulan 19:30 Gebyar BCA 20:30 Barclays Premiere League 23:00 Serial Action Asia

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

08:30 Agung Sedayu Group 09:30 Agung Sedayu Group 10:05 Menu & Venue 11:05 Power Players 12:05 Metro Siang 13:05 Autozone 14:05 Insight Papua 15:05 Tea Time With Desi Anwar 15:30 Dunia Kita 16:05 360 17:05 Metro Hari Ini 18:05 Metro Highlights 19:05 Penantang Terakhir 20:05 Dua Tamu 21:05 Top 9 News 21:30 President 22:30 Stand Up Comedy 23:05 Newsmaker

WASPADA Senin 30 September 2013

08:00 Gaul Bareng Bule 08:30 Celebrity On Vacation 09:30 Ceriwis 10:00 Ala Chef 10:30 Woww 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:30 DR OZ 16:30 Reportase Investigasi 17:00 Andai Aku Kamu 17:30 Info Temen 18:00 Sinema Spesial Keluarga 20:00 Yuk Keep Smile 22:00 Bioskop TransTV

08:30 Live Kabar Pagi 10:30 Nuansa 1000 Pulau 11:30 Live News Kabar Siang 12:00 Santap Siang 13:00 Live News Damai Indonesiaku 15:00 Bumi dan Manusia 16:00 Sport Documentary 17:30 Live News Kabar Petang 19:00 Qualifier World Cup 2014 21:00 Live News Apa Kabar Indonesia Malam 22:00 Nama dan Peristiwa 23:00 Live News Kabar Malam

07:00 Spongebob Squarepants 07:30 Everyone’s Hero 09:30 Arjuna 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Before 30 12:30 Sketsa Tawa 13:00 Takeshi Castle 14:00 Masquerade 15:00 Fokus Selebriti 15:30 Chicken Little 17:30 Coboy Junior Terhebat #eeeaa 18:30 Komeng AcakAdul 19:30 Big Movies 22:30 Big Movies

07:00 Fish N Chef 07:30 Selebrita Pagi 08:30 She Can Tupperware 09:00 Sing n Run 09:30 Spotlite 10:00 Wolipop 10:30 RAN 11:30 Redaksi Siang Akhir 12:00 Selebrita Siang 13:30 One Stop Football 14:30 Mancing Mania 15:00 Seleb Expose 16:00 Redaksi Sore 17:00 CCTV 17:30 5 Juta 5 Menit 18:00 Gila Makan 19:00 Oesman 77 20:00 On The Spot 21:00 Pas Mantab 22:30 Mister Tukul 00:30 [Masih] Dunia Lain


Sejak Lama Megan Young Incar Mahkota Miss World

Miss World 2013 terpilih, Megan Young asal Filipina (tengah) bersama kontestan lainnya seusai penganugerahan mahkota dalam Final Kontes Miss World 2013 di Nusa Dua, Bali, Sabtu (28/9)./ant

Megan Lynne Young, Miss World 2013 mengaku sejak lama mengincar gelar tersebut. “Sangat berarti sekali dengan kemenangan ini. Orang terdekat saya tahu, kalau inilah yang selama ini saya inginkan,” tuturnya di Bali Room, Hotel Westin, Nusa Dua, Bali, Minggu (27/9). Megan dikenal sebagai seorang aktris di Filipina ini juga menuturkan bahwa kemenangannya tersebut bisa menjadi penyemangat bagi anak muda lainnya. Terutama untuk meraih apa yang mereka inginkan. “Ini juga sekaligus menjadi bukti bahwa anak muda lain bisa melakukannya. Mereka harus tahu apa yang diinginkan. Saya sebelumnya begitu juga. Segera setelah ini tujuan saya adalah tidak hanya membantu orang lain saja, tetapi menyuarakan apa yang diinginkan bersama MissWorld Organization,” papar perempuan cantik yang akrab

disapa Megan Young ini. Sebelum memenangkan mahkota MissWorld, Megan diketahui menjadi pemenang fast track kategori Top Model. Selain itu, dia juga menduduki peringkat kelima untuk sesi Beach Fashion dan peringkat empat untuk Multimedia selama masa karantina. Tidak heran jika di malam final Miss World 2013, dia pun berhasil mencuri perhatian para juri terdiri dari Liliana Tanoesoedibjo, Listyanna Erman Gusman, Silvia Agung Laksono, Julia Morley, Mike Dixon, Andrew Minerick, Donna Derby, Vineet Jain, Azra Akin, Ken Warwick, dan Mickey Haughton-James. Sementara posisi Runner Up I Miss World 2013 ditempati Marine Lorphelin, kontestan dari Prancis. Sedangkan kontestan dari Ghana, Charranzar Naa Okailey berhasil menduduki Runner II Miss World 2013.

TERPILIH sebagai seorang Miss World 2013, tentu menjadi pengalaman luar biasa bagi Megan LynneYoung. Karena itu, gadis 23 tahun tersebut mengaku tidak akan melupakannya seumur hidup. “Sekarang saya tidak bisa bilang apa pun seberapa terkenangnya dari momen ini. Ajang ini mengubah hidup saya,” tuturnya. Kendati demikian, Megan sendiri mengatakan secara keseluruhan, mengikuti ajang Miss World 2013 merupakan pengalaman yang sangat berharga. Terlebih bertemu dengan kontestan dari berbagai negara, membuatnya bisa tahu banyak tentang budaya yang ada di dunia. “Pengalaman saya di Bali dan Miss World, khususnya sangat berarti sekali. Semua negara di dunia ada di sini, bersamasama melakukan aktivitas setiap

hari,” imbuhnya. “Sangat menyenangkan bisa hidup bersama, dengan situasi yang sama, baik mereka berasal dari Afrika, Amerika, Asia ataupun Karibia. Banyak sekali budaya, kaya sekali,” tutupnya.

Tak sabar jalan tugas Kontestan asal Filipina ini mengaku sangat senang dan tidak sabar ingin segera menjalankan program sosial MissWorld di bidang Beauty with a Purpose. “Saya baru saja memenangkan kompetisi dan menunjukkan kepada mereka menjadi seorang Miss World. Saya benarbenar tidak menyangka ada crown di kepala saya sekarang,” tuturnya. Karena itu, gadis 23 tahun ini pun mengaku cukup terkejut saat mendengar Julia Morley selaku Chairman Miss World Organization mengumumkannya. “Sangat shock, tapi saya benar-

benar senang. Selama karantina, saya hanya menikmati saja setiap aktivitas. Sekarang saya hanya ingin bertemu dengan keluarga dan para penggemar,” katanya. “Saya hanya orang biasa. Sekarang banyak orang yang mengenali saya,” imbuhnya. Megan sendiri mengaku tidak sabar menunaikan tugasnya sebagai MissWorld 2013, terutama di bidang Beauty with a Purpose. “Saya sangat tidak sabar untuk segera merepresentasikan dunia,” ucapnya. Sebelum memenangkan mahkota, Megan diketahui menjadi pemenang fast track kategori Top Model. Selain itu, dia juga menduduki peringkat kelima untuk sesi Beach Fashion dan peringkat empat untuk Multimedia selama masa karantina. Tidak heran jika di malam final MissWorld 2013, dia pun berhasil mencuri perhatian para juri.(okz)

Soomin April Kiss Siapkan Album Solo

Bobby Fischer/

Penyanyi asal Korea Selatan, Chea Soo Min atau Soomin tergabung dalam girlband April Kiss sedang mempersiapkan album solo perdananya. Album berjudul Way To Go Father rencananya akan dirilis bulan Oktober mendatang. Soomin menjagokan single yang juga berjudul Way To Go Father dalam album perdananya. “Lagu ini memberikan semangat kepada para ayah,” kata Soomin saat ditemui di Korean Culture Center, Jakarta, Kamis. Soomin membutuhkan waktu satu setengah tahun untuk mengerjakan proyek solonya. Menurut dia, jenis musik diusung di album solonya berbeda dengan musik April Kiss sehingga dia butuh waktu lama untuk mencari jenis musik yang tepat untuk dirinya. Penyanyi sekaligus aktris itu mengaku menikmati pengalamannya bergabung dengan girlband April Kiss dan bernyanyi solo meski awalnya sempat merasa sedikit kesepian saat bersolo. “Tapi di album ini saya duet dengan Crispi Crunch, jadi tidak kesepian,” kata Soomin. Soomin berencana kembali ke Indonesia bulan November mendatang untuk mempromosikan album perdananya.(ant)

J-Rocks Rencanakan Buku Perjalanan Karier

Kisah Pecatur Bobby Fischer Difilmkan Film tentang pertarungan ikonik antara pecatur Amerika Serikat Bobby Fischer dan grandmaster Soviet Boris Spassky tahun 1972 akan mulai digarap bulan depan. Seperti dilansir The Hollywood Reporter, pengambilan gambar film itu akan dilakukan bulan Oktober di Montreal. Laman itu menyebut aktor Spider-Man Tobey Maguire akan berperan sebagai Fischer. Sementara aktor Amerika Liev Schreiber sedang dalam negosiasi untuk membintangi film itu sebagai Spassky dan Peter Sarsgaard sedang dalam pembicaraan bermain sebagai pendeta kepercayaan Fischer. Menurut laman IMDB, film akan diberi judul Pawn Sacrifice akan disutradarai Ed Zwick, telah mencetak film-film epik The Last Samurai (2003). Bobby Fischer menjadi grandmaster termuda dalam sejarah pada usia 15 tahun pada 1958. Pertarungan antara Fischer dan Spassky di Reykjavik, Islandia, tahun 1972, menjadikan Fischer sebagai orang Amerika pertama menjadi juara dunia catur, demikian menurut

Soomin April Kiss/

Grup J-Rocks merencanakan sebuah buku menceritakan perjalanan mereka selama sepuluh tahun bersama. Buku berjudul Untuk Bintangku (The Untold Story of J-Rocks) ditulis Iman (vokal dan gitar), Wima (bass), Sony (gitar), dan Anton (drum). Wima menceritakan buku ini ditulis selama empat bulan “Ini bukan hanya awal JRocks tapi awal kami berempat ketemu. Ada beberapa hal yang belum kami ceritakan di mana-

mana kami tuangkan di sini,” jelas Wima saat mengadakan jumpa media, Rabu (25/9) sore. Dalam salah satu bab, buku itu mengulas awal karier J-Rocks saat mengikuti sebuah kompetisi hingga akhirnya mereka menjadi J-Rocks yang sekarang. Buku itu juga memuat bagaimana saat J-Rocks membuat album mereka di Abbey Road. “Kami juga melibatkan J-Rockstar (penggemar J-Rocks) dari awal supaya mereka terwakili. Ini kan untuk mereka juga,” ujar Wima

Buku itu rencananya berisi 60 persen foto dan 40 persen. Foto-foto itulah yang menurut Sony cukup sulit dikumpulkan. Mereka mencari dokumentasi dari awal mereka terbentuk melalui teman dan keluarga. Rencananya, buku Untuk Bintangku (The Untold Story of J-Rocks) akan keluar pada 19 Oktober mendatang. J-Rocks akan menggelar konser tunggal pada 16 November di Malang, Jawa Timur. Konser bernama Persembahan Kar-


ya J-Rocks 1 Dekade ini akan diadakan di Gedung Kartika Graha. Pihak promotor mengemukakan Malang dipilih karena merupakan salah satu kota dengan penggemar J-Rocks terbesar di Indonesia. Gitaris Sony membayangkan konser tunggal itu akan lebih besar dari konser-konser yang selama ini mereka adakan. “Misalnya kalau konser biasa 10 lagu, kami ingin bawakan 20, juga lagu yang belum pernah kami bawakan secara live,” kata Sony.(ant)

Sumatera Utara

WASPADA Senin 30 September 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:17 12:31 12:18 12:25 12:25 12:21 12:18 12:14 12:20 12:20

15:28 15:43 15:28 15:37 15:36 15:28 15:27 15:23 15:30 15:31

Magrib 18:21 18:34 18:21 18:28 18:28 18:25 18:21 18:17 18:24 18:23



Shubuh Syuruq


19:29 19:42 19:30 19:37 19:36 19:33 19:30 19:25 19:32 19:31

04:48 05:01 04:48 04:55 04:55 04:51 04:48 04:44 04:51 04:50

04:58 05:11 04:58 05:05 05:05 05:01 04:58 04:54 05:01 05:00

L.Seumawe 12:23 L. Pakam 12:17 Sei Rampah12:16 Meulaboh 12:27 P.Sidimpuan12:15 P. Siantar 12:16 Balige 12:16 R. Prapat 12:13 Sabang 12:30 Pandan 12:17

06:12 06:25 06:12 06:20 06:19 06:15 06:12 06:08 06:15 06:15

Zhuhur ‘Ashar 15:36 15:27 15:26 15:38 15:22 15:25 15:24 15:21 15:44 15:24





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:27 18:20 18:19 18:31 18:19 18:19 18:19 18:16 18:33 18:21

19:35 19:28 19:27 19:39 19:27 19:27 19:27 19:24 19:42 19:29

04:54 04:47 04:46 04:58 04:45 04:46 04:46 04:42 05:01 04:47

05:04 04:57 04:56 05:08 04:55 04:56 04:56 04:52 05:11 04:57

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:17 12:18 12:28 12:21 12:18 12:25 12:13 12:23 12:16 12:15

18:21 18:22 18:31 18:24 18:21 18:28 18:16 18:27 18:20 18:19

19:29 19:30 19:39 19:33 19:29 19:36 19:25 19:35 19:28 19:27

04:47 04:48 04:58 04:51 04:48 04:55 04:43 04:53 04:46 04:46

04:57 04:58 05:08 05:01 04:58 05:05 04:53 05:03 04:56 04:56

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:14 12:21 12:19 12:14 12:16 12:13 12:13 12:23 12:17 12:12 12:13

15:20 15:26 15:27 15:24 15:25 15:20 15:19 15:35 15:25 15:19 15:22

18:18 18:25 18:22 18:18 18:20 18:17 18:17 18:26 18:21 18:15 18:17

19:26 19:33 19:30 19:26 19:28 19:25 19:25 19:34 19:29 19:23 19:25

04:43 04:50 04:49 04:44 04:46 04:43 04:43 04:53 04:47 04:41 04:43

04:53 05:00 04:59 04:54 04:56 04:53 04:53 05:03 04:57 04:51 04:53

06:18 06:11 06:10 06:22 06:09 06:10 06:10 06:07 06:25 06:11

15:24 15:27 15:41 15:29 15:28 15:36 15:22 15:33 15:24 15:25

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:11 06:12 06:23 06:15 06:12 06:19 06:07 06:18 06:10 06:10

06:08 06:14 06:13 06:09 06:10 06:07 06:07 06:17 06:11 06:06 06:07

Bocah Tewas Kesetrum Listrik STABAT (Waspada): Pemadaman aliran listrik masih terus terjadi di berbagai daerah. Di Dusun Paluh Ibus Desa Karang Gading Kec. Secanggang, Kab. Langkat, pemadaman mengakibatkan seorang bocah tewas kesetrum.

Sepasang Kekasih Ditangkap Konsumsi Sabu STABAT (Waspada): Petugas Sat Narkoba Polres Langkat meringkus sepasang kekasih sedang mengkonsumsi narkotika jenis sabu di salah satu penginapan di Desa Mintakasih Kec. Salapian, Minggu (29/9) dinihari. Kasat Narkoba AKP Lukmin S menuturkan penangkapan berawal dari informasi masyarakat yang ditindaklanjuti. Petugas menyita dua paket hemat sabu senilai Rp200.000 bersama alat isap. Tersangka IW, 30, warga Desa Namanjahe Kec. Salapian bersama AS, 32, warga Desa Kwala Begumit Kec. Binjai Kab. Langkat masih diperiksa di Mapolres. Sementara sehari sebelumnya di tempat terpisah, petugas meringkus dua pria yang mengkonsumsi sabu di kawasan Sei Karang Stabat. Pelaku SU, 38, warga Kwala Begumit Stabat dan JO, 40, warga Kel. Dendang Stabat kini menghuni sel Mapolres Langkat. Disita tiga paket hemat sabu Rp300.000 bersama alat isap.(a03)

Julihartono Pimpin PAC Gebang Siap Memenangkan Ngogesa GEBANG (Waspada): Musyawarah Pemuda Pancasila (PP) PAC Kec. Gebang, secara aklamasi memilih Julihartono (ketua lama) sebagai Ketua Pimpinan Anak Cabang (PAC) PP Kec. Gebang periode 2013-2016, di aula kantor Camat Gebang, kemarin. Ketua Panitia Julianta melaporkan 11 ranting PP di Kec. Gebang, hanya delapan yang defenitif mempunyai hak suara dalam pemilihan ketua. Ketua MPC (Majelis Pimpinan Cabang) Langkat, Terbit Rencana Peranginangin, SE melalui Wakil Ketua 1 M. Adah Sitepu, S.Sos mengatakan, pengurus terpilih dapat melaksanakan pesan Ketua MPCTerbitRencanaPA,SE,kembalikepadatertibregistrasiadministrasi yaitu KTA, kantor, atribut dan lain-lain. Kemenangan tidaklah menjadi tolok-ukur, tapi dalam menjalankan kehidupan sehari-hari PP tidak mengganggu hakhak orang lain, memberi rasa aman dan nyaman, tenteram di tengah kehidupan masyarakat. Ketua terpilih PAC PP Gebang Julihartono, selain mengucapkan terimakasihataskepercayaanyangdiberikan,jugamengajakjajarannya untukbersama-samamembesarkanPP diGebang.“Marikitarapatkan barisan PP Gebang, siap mendukung dan memenangkan H. Ngogesa Sitepu, SH sebagai Bupati Langkat 2014-2019,” ajaknya.(c01)

Keterangandihimpun,Jamik, 3 tahun, seperti biasa sering mengobok-obokusahapengisian baterai milik orangtuanya di rumah mereka. Saat itu banyak warga menggunakan jasa orangtuanya mengecas baterai. Namun karena listrik padam, Sabtu (28/9) sore itu, aktivitas pengisian terganggu. Sang ayah Izun tidak menyadari anaknya masih mengobok-obok usahanyahinggatiba-tibalistrikkembali menyala.SpontanJamikkesetrum saat memegang salah satu kabel

arus listrik. Pihak keluarga bersama warga langsung membawa korban ke klinik terdekat untuk pertolongan, namun beberapa saat kemudian nyawanya tak tertolong. Jenazah korban dikebumikan di pekuburan muslim desa setempat. Kades Karang Gading Kusdiantoro menyesalkan kejadian yang menimpa warganya tersebut, tidak terlepas disebabkan arus listrik yang padam. Dia mengimbaupemerintahuntukcepat

mencari solusi mengatasi pemadaman berkelanjutan. Sehari sebelumnya nenek bersama cucunya kritis terbakar di Desa Pantaigemi Kec. Stabat Kab. Langkat saat listrik padam, saatmenyalakanlamputeplokdan meledak.SementaradiKec.Salapian 18 September silam, massa yang kesal listrik berulangkali padam merusak Kantor PLN hingga hancurberantakan.Sedangkandi Kec. Tanjungpura, emosi warga diluapkan dengan melempari kantorPLNdiJalanPemuda.(a03)

Ngogesa: Ajarkan Generasi Muda Nilai Budaya STABAT (Waspada): Bupati Langkat H. Ngogesa Sitepu mengingatkan masyarakat untuk senantiasa melestarikan seni budaya daerahnya masing-masing sehingga pada gilirannya diyakini memberikan pengajaran kepada generasi muda untuk mampu menjaga nilai-nilai budayasebagaikekayaanbangsa. Selain itu segenap warga tergabung dalam Forum Komunikasi Peduli Sendayan (FKPS) Ngogesa, berharap senantiasa

menjaga rasa kebersamaan dan saling peduli dalam membangun daerah dan lingkungan. Ngogesa mengemukakan itu pada pengukuhan FKPS dalam rangkaian acara Pesta Masyarakat Dusun Sendayan Securai Selatan Kec. Babalan, kemarin. Bupati H. Ngogesa yang hadir bersama tokoh Golkar Sumut Eswin Sukarja, disambut meriah warga Dusun Sendayan dengan acara adat dan tor-tor serta tepung tawar (beras sipirni tondi),

Waspada/HM Husni Siregar

bertujuanmemberikekuatandan berkah guna melanjutkan kepemimpinan masa mendatang. Sementara Ketua HIKBA (Himpunan Keluarga Batak) Langkat, Robert Panggabean mewakili masyarakat mengucapkan terimakasih atas kepedulian Bupati H. Ngogesa terhadapmasyarakatyangmerupakan petani. “Sekarang hasil panen masyarakat bertambah bagus,” kata Panggabean menjelaskan.(a01)

Tiga Ketua Ormas Di Sumut Bergabung Ke NasDem MEDAN(Waspada):TigaKetuaorganisasikemasyarakatan(Ormas) Sumut, yang juga sahabat Caleg DPRD Sumut Dapil Sumut 2 dari Partai Nasional Demokrat (NasDem) H. OK Tun Hidayat, bergabung ke Partai NasDem. Acara berlangsung baru-baru ini di Kantor DPW NasDem Sumut. KetigaKetuaOrmasyangbergabung,yaituKetuaForumSilaturahmi WiridYasin Putri Kab. Langkat Dra Syarifah Rangkuti, Ketua Lembaga Penggerak Reformasi Agraria (LPRA) Sumatera Utara dan Ketua Masyarakat Tehnologi Pertanian Sumut Ir Junaidy Kurniawan. SelainketigaKetuaOrmas,koordinatorbidangsosialdankesehatan masyarakat Sumut H. Peppy Agustin juga turut bergabung ke partai berslogan ‘gerakan perubahan’ itu. KehadiranketigaKetuaOrmastersebutdisambutHOKTunHidayat (Caleg DPRD Sumut Dapil Sumut 2), H. Abdullah Abdul Rahim (Caleg DPRD Sumut Dapil 12 Langkat Binjai), Solvia Karina Tarigan (Caleg DPRD Sumut Dapil II meliputi Tanah Karo, Dairi dan Pakpak Bharat) yangjugaWakilSekretarisDPWNasDemSumut,SisilFDwiKurnianingsih dan TM Khairul (Kader Partai NasDem). (rel/m32)

PT Al Hikmah T. Tinggi Bantu Korban Sinabung TEBINGTINGGI (Waspada): Perguruan Tinggi Al Hikmah kota Tebingtinggi diprakarsai Badan Ekseskutif Mahasiswa (BEM) membantu korban gempa Gunung Sinabung, Kab. Karo. Bantuan yang diberikan merupakan dana yang dikumpul BEM dari sumbungan masyarakat kota Tebingtinggi, khususnya sekolah. Ketua PT Al Hikmah kota TebingtinggiSalman Rasidi, SE, MA didampingiKetuaBEMM.FahrizalNasution,Sabtu(28/9),mengatakan hal itu, disela pelepasan pengiriman bantuan di kampus PT Al Hikmah di Jalan Rao. Menurut Ketua BEM M. Fahrizal Nasution, dana yang berhasil dikumpul mahasiswa PT Al Hikmah mencapai Rp5 juta lebih. Dana itu dikutip dari berbagai sekolah yang ada di kota Tebingtinggi. “Kita kutip mulai dari SD, SMP, SMA hingga perguruan tinggi,” terang dia. (a09)

Makanan Berbahaya Dijual Di Sekolah BINJAI (Waspada): Makanan berbahaya mengandung penyedap dan kimia, banyak dijual di sekolah-sekolah. Hal itu dikemukakan Ir. Dewi Anggraini dari Dinas Pertanian Kota Binjai, Rabu (25/9) di Kelurahan Kartini, Kec. Binjai Kota. Menurut Dewi, makanan yang dibuat menggunakan bahan kimia, zat pewarna dan penyedap akan merusak kesehatan. Dewi juga menyebutkan, ada penjual gorengan memasukkan plastik, agar gorengannya renyah. Oleh sebab itu Tim Penggerak PKK Kota Binjai Ny. Lisa Andriani Idaham, mempraktekkan masakan murah dan tidak berbahaya, bahkan menambah gizi keluarga. Makanan terbuat dari tahu dan tempe bisa dibuat sebagai makanan istimewa. Ny. Lisa Andriani mempraktekkan cara membuat makanan dari tahun dan tempe di hadapan anggota Tim penggerak PKK Kec. Binjai Kota guna memberi makanan sehat tanpa pengawet dan penyedap.(a04)

Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu bersama tokoh Golkar Sumut Eswin Sukarja, manortor bersama masyarakat dusun Sendayan, Desa Securai Selatan, Kec. Babalan.

NasDem Serahkan Santunan Kemalangan BINJAI (Waspada): Partai NasDem Kota Binjai menyerahkan santunan kemalangan kepada 8 kader partai yang meninggal dunia, yakni kader NasDem yang punya kartu anggota. Hal ini dikatakan Ketua DPW Partai NasDem Sumatera Utara HM. Ali Umri, SH, M.Kn yang juga Caleg DPR RI Dapil Sumut 3 didampingi Humas Refwandi SanandiposkopemenanganJalan DanauTempeKel. Sumber Karya, Kec. Binjai Timur, kemarin. Santunan berupa uang Rp1 juta per orang yang diterima ahli

waris,yaitukeluargaalm.Damien, Kliwon, Suhardi dari Kec. Binjai Timur diserahkan HM Reza Syaputra, Caleg Dapil 3 Binjai Timur nomor urut 1. Sedangkan untuk Kec. Binjai Utara diserahkan Hj. Supami, Caleg DPRDSU nomor urut 8 Dapil 12 kepada keluarga ahli waris almarhumah Ngatiyem, untuk Binjai Selatan. Rika Amelia Caleg nomor 2 kepada keluarga almarhum Sadirin. Untuk Binjai Kota dan Binjai Barat, Ketua DPD Partai NasDem Binjai dr. Edi Syahputra Sitepu Caleg nomor

Wabup DS Terima Lencana Melati Pramuka Dari Kwarnas LUBUKPAKAM (Waspada): Wakil Bupati Deliserdang H. Zainuddin Mars yang jugaWakil Ketua Majelis Pembimbing Cabang (Waka Mabicab) Gerakan Pramuka Kabupaten Deliserdang, menerima penghargaan Lencana Melati dari Kwartir Nasional (Kwarnas) Gerakan Pramuka atas jasa besar dan baktinya bagi peningkatan serta pengembangan Pramuka di daerahnya. Penghargaan Lencana Melati diserahkan Gubsu H. Gatot Pujonugroho, ST, M.Si selaku Ketua Majelis Pembimbing Daerah Sumut Ka. Mabidasu), dalam rangkaian peringatan Hari Pramuka ke 52 tingkat Sumut di Lapangan Simare-mare Kota Sibolga, Sabtu (28/9) sore. Penyerahan Lencana Melati Pramuka disaksikan Ketua Pesuruh Jaya Pengakap Negara Malaysia Dato’ DR Mohammad Shahrom Usman, Exco Majelis Pengakap Malaysia Dato’ Ismail Bin Ramli, Sekdaprovsu H. Nurdin Lubis, SH,Walikota Sibolga Drs HM Syarfi Hutahuruk, WakilBupatiTapanuliTengahH.SyukranTanjung, SE, Wakil Kolikota Binjai Timbas Tarigan, Wakil Bupati Simalungun Hj. Nuriaty Damanik,Wakil Bupati Madina Dahlan Nasution dan sejumlah pejabat Pemprovsu. Ketua Harian Mabicab Deliserdang Drs H. Iwa Suryapati didampingi Sekretaris Kwartir Cabang Pramuka DeliserdangYakob Mardianto yang ikut mendampingi H. Zainuddin Mars

menjelaskan perkembangan dan kemajuan Gerakan Pramuka di Deliserdang tidak terlepas dari dukungan sangat besar Ketua Mabicab Deliserdang, Drs H. Amri Tambunan dan Wakil Ketua Mabicab H. Zainuddin Mars. Karenanya sangat pantas Kwartir Nasional GerakanPramukamemberipenghargaanLencana Melati kepada H. Zainuddin Mars yang telah memberi dukungan serta memiliki peran penting memajukan perkembangan Gerakan Pramuka di Deliserdang. Tercatat sejumlah pejabat Pemprovsu dan Pemkab/Pemko di Sumut juga menerima penghargaan Lencana Melati, Dharma Bakti dan Pancawarsa di antaranya Wali Kota Sibolga Drs HM Syarfi Hutauruk (Melati), Ka. Kwarcab Serdang Bedagai Drs H. Rifai Bakri Tanjung, MAP (Melati), Sekretaris Mabicab Deliserdang yang juga Kadis Dikpora Hj. Sa’adah Lubis, S.Pd, MAP (Melati), Wali Kota Tebingtinggi/Ka. Mabicab Ir H. Umar Zunaidi Hasibuan MM (Dharma Bakti). Sebelumnya pada peringatan Hari Pramuka ke 52 tingkat Deliserdang, Kwarnas memberi penghargaan PancawarsaV kepada Drs H. Asrin Naim serta penghargaan Dharma Bakti kepada pembina Pramuka Deliserdang masing masingYakop Mardaranto, Humas Sitepu, Animan, S.Pd, Drs H. RahmadNasution,MAP,DedyMaswardi,S.Sos.MAP dan Drs HM Ali Yusuf Siregar, MAP.(a06)

Mahasiswa Program Doktor FH-USU Pengabdian Masyarakat Di Sergai SEIRAMPAH (Waspada): 21 Mahasiswa Program Doktor Ilmu Hukum Fakultas Hukum Universitas Sumatera Utara (FH-USU) mengadakan kegiatan pengabdian masyarakat di jajaran Pemkab Serdang Bedagai (Sergai). Hal ini dikemukakan pimpinan rombongan sekaligus Ketua Prodi S3 Ilmu Hukum, Prof. Dr. Suhadi, SH, M.Hum didampingi Dr. Tan Kamelo, SH, MS. Mereka diterima Sekdakab Sergai Drs. H. Haris Fadillah, M.Si bersama unsur FKPD, para Staf Ahli Bupati dan Asisten, para Kepala SKPD, Camat se-Kab. Sergai dan tokoh masyarakat, di aula Sultan Serdang kompleks Kantor Bupati di Sei Rampah, Kamis (26/9). Beberapa materi yang dibahas adalah pemaparan makalah dengan judul ‘Kesadaran Hukum dan Prosedur Pengadaan sebagai Fungsi

Sosial dalam Konsep Pembangunan’, ‘Model PembangunanTataRuangPantaidanPenyelesaian Sengketa Tanah’. Dijelaskan Prof. Dr. Suhadi, salah satu perwujudan Tri Dharma Perguruan Tinggi dalam hal ini adalah dharma pengabdian kepada masyarakat gunaberbagiilmupengetahuanbidanghukumkhususnyahukumperdata,terkaitpenyelesaianmasalah sengketa tanah dan ketataruangan wilayah pantai. BupatiSergaiIr.H.Soekirmandalamsambutan tertulis dibacakan Sekdakab Sergai Drs. H. Haris Fadillah mengharapkan melalui pengabdian masyarakat mahasiswa dapat mendorong unsur pemerintahan mau pun masyarakat, membagi ilmu yang bermanfaat dan dapat menjadi pengetahuan serta pedoman dalam pelaksanaan tugas dan pekerjaan sehari-hari.(a08)

Bupati Sergai Tandatangani MoU Dengan PT. Fajar Agung PEGAJAHAN (Waspada): Bupati Serdang Bedagai (Sergai) Ir.H.Soekirmanmenandatangani nota kesepakatan bersama (MoU) dengan DR. Rahmat Shah berisi tentang Pemanfaatan dan Pemeliharaan Fasilitas Umum di area PT. Fajar Agung, di Balai Rahmat Perkebunan PT. Fajar Agung Desa Bengabing Kec. Pegajahan, kemarin. Hadir Asisten Pemerintahan Umum Rudi Sitorus, SH, M.IP,

Staf Ahli Bidang Hukum Hotman Hutajulu, SH, Plt. Kadis Bina Marga Drs. Darwin Sitepu, MAP, Kadis Pendidikan Drs. H. Bhakri Rifai Tanjung, MAP, Kabag Hukum Jufri Eddy, SH, MSP, Kabag Humas Dra. Indah Dwi Kumala dan Camat Pegajahan Misran SE dan lainnya. Diawal sambutannya Bupati Soekirman memberi apresiasi setinggi-tingginyakepadaPT.Fajar Agung karena selalu melakukan

Petugas Honorer PDAM Tirta Wampu Diberhentikan STABAT (Waspada): Iswansyah, 53, warga Stabat yang sudah belasan tahun bekerja sebagai honor lepas di PDAM Tirta Wampu Langkat, diberhentikan. Korban merasa dirugikan sebab menurut dia tanpa kesalahan dan tanpa ada peringatan. Surat pemberhentian diterima kemarin setelah ditandatangani Direktur PDAMTirtaWampu beberapa pekan sebelumnya. “Jika dalam tugas selama ini terdapat kesalahan atau kelalain lainnya, wajar jika saya ditegur kemudian dinasehati. Namun pemberhentian ini tiba-tiba dan sepihak,” katanya. Selama ini korban bekerja sebagai penjaga sekaligus perawat salah satu mesin pompa di bantaran Sungai Wampu. Terkait pemberhentian, Dirut PDAM Tirta Wampu Jufrizal menuturkan yang bersangkutan kurang aktif.(a03)

urut 1 menyerahkan bantuan kemalangan kepada keluarga almarhum Sutan SN Harahap dan Muliawan.S, dan Juminem. Ketua Partai NasDem Sumut Ali Umri bersama Wakil Ketua PartaiNasDemBinjaiBinjaiFahmi Fauzan SH,MKn yang mendampingi penyerahan santunan mengatakan bantuan ini salah satu bentuk kepedulian partai NasDemkepadakaderpartaiyang ditimpa musibah meninggal dunia, dan bantuan mereka terima karena mempunyai kartu anggota NasDem.(a05)

WAKIL Bupati Deliserdang H. Zainuddin Mars yang juga Wakil Ketua Mabicab menerima Lencana Melati diserahkan Gubsu H. Gatot Pujonugroho, ST, M.Si selaku Ka. Mabida pada upacara HUT ke 52 Gerakan Pramuka tingkat Sumut di Lapangan Simare-mare Kota Sibolga.


BUPATI Sergai Ir. H. Soekirman dan Direktur PT. Fajar Agung DR. H. Rahmat Shah menandatangani Kesepakatan Bersama (MoU) tentang Pemanfaatan dan Pemeliharaan Fasilitas Umum pada area PT. Fajar Agung yang diselenggarakan di Balai Rahmat Perkebunan PT. Fajar Agung Desa Bengabing Kecamatan Pegajahan.

kegiatan untuk kemaslahatan masyarakat.Kitaketahuimanusia sebagai makhluk sosial selalu membutuhkanbatuanoranglain dalamkehidupannya. Begitujuga dengan pemerintah, tentu tidak akan mampu melaksanakan pembangunan tanpa dukungan masyarakat, pihak swasta dan stakeholder lainnya. Kesepakatan bersama yang ditandatangani merupakan jalinan kerjasama dengan tujuan mewujudkan dan mensejahterakan masyarakat Kec. Pegajahan khususnyadanSergaiumumnya, jelas H. Soekirman. Soekirman mengharapkan kerjasama ini bisa menjadi pionir dansebagaicontohbagiperusahaan lain untuk dapat memberikan yangterbaikbagilingkungansekitar. Sebelumnya Direktur PT. Fajar Agung DR. H. Rahmat Shah yang juga anggota DPD RI mengatakan dengan dibangunnya fasilitas umum di areal perkebunanPTFajarAgungsepertiKantor Kepala Desa, Kantor Urusan Agama (KUA), Puskesmas, gedung SD, SMP, SMA, Pendidikan Anak Usia Dini (PAUD), Sekolah Luar Biasa (SLB) dan jalan-jalan aspal menghubungkan antar desa, diharap mempercepat program kerja Pemkab Sergai guna memenuhi kebutuhan masyarakat di sekitar area perkebunan.(a08)


SEKDAKAB Drs. H. Haris Fadillah, M.Si menyerahkan cenderamata kepada Ketua Prodi S3 Ilmu Hukum Prof. Dr. Suhadi SH, M.Hum pada kunjungan mahasiswa Program Doktor Ilmu Hukum Fakultas Hukum USU di aula Sultan Serdang kompleks Kantor Bupati Sergai di Sei Rampah.

Anggota DPRD Langkat Korup Mengkhianati Rakyat LANGKAT (Waspada): Sekretaris PDI Perjuangan Kab. Langkat mendesak penyidik Kejaksaan Negeri (Kejari) Langkat secepatnya menangani kasus dugaan korupsi perjalanan dinas para oknum anggota DPRD Langkat tahun 2012-2013, senilai Rp27 miliar. “Jika para anggota dewan termasuk dari PDI Perjuangan sendiri terbukti terlibat merampok uang rakyat, maka mereka harus segera dijebloskan ke penjara,” kata Sekretaris PDI Perjuangan Kab. Langkat, Kirana Sitepu kepada Waspada, kemarin melalui telepon selular. Ia mengatakan, anggota dewan yang diduga korupsiperjalanandinassamadenganpengkhianat terhadaprakyatdanUUD1945.“Sayatidakmenutupinutupi,jikaadaoknumanggotaDPRDberasaldari partai saya, mereka harus diproses,” tegasnya. Sitepu mengaku prihatin melihat perilaku sejumlah oknum anggota dewan yang tanpa punya hati nurani menggerogoti uang rakyat dengan modus biaya perjalanan dinas. Perbuatan oknum anggota dewan ini, katanya, bentuk pengingkaran terhadap rakyat.

Saat ini, lanjut Sitepu, tingkat sosial ekonomi masyarakat menengah ke bawah sangat sulit. “Untuk memenuhi kebutuhan dasar saja rakyat sudah kewalahan, sementara anggota dewan yang mewakili mereka, malah menampilkan kehidupan wah,” katanya. Mantan anggota Komisi I DPRD Langkat itu mengemukakan, selama ini hasil kunjungan kerja atau study banding anggota dewan dirasakan tidak membawa perubahan ke arah lebih baik. “Kinerja dewan belum memenuhi harapan sebagian besar rakyat Langkat,” tegasnya. Sebaiknya, kata Sitepu, uang perjalanan dinas bersumber dari APBD Langkat yang notabene dari hasil keringat rakyat dialokasi untuk pembangunan eknomi kerakyatan atau buat pembangunan infrastruktur di desa-desa tertinggal. Terkait kasus dugaan korupsi perjalanan dinas para oknum anggota DPRD Langkat, penyidik Kejari Langkat telah memeriksa secara marathon sejumlahanggotadewan,namunpenetapanstatus tersangka baru sebatas oknum Sekwan dan mantan Sekwan.(a02)

Sumatera Utara


Korban Lakalantas Merasa Diperlakukan Tidak Adil


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

KOTAPINANG (Waspada): Korban kecelakaan lalu lintas yang terjadi di Jalinsum-Bukit, Kel. Kotapinang, Kec. Kotapinang, Kab. Labusel, Kamis (30/8/2013) lalu berharap pihak Satlantas Polres Labuhanbatuberlakuadildalammenanganiperkaratersebut.Harapan itu diutarakan keluarga korban, Eli Eng Ramli kepada Waspada, Minggu (29/9). “Hingga kini belum ada titik terang terkait kasus itu. Parahnya belum ada itikad baik dari pemilik truk angkutan untuk berdamai dengan kami selaku korban,” kata Ramli. Diceritakan, peristiwa nahas itu terjadi sebulan silam. Pagi itu sekira pukul 8:00, istrinya Lilis Kurniati mengantar anak kembarnya yakni Sihap Kurnia Ramli, 6, dan Maimana Kurniati Ramli, 6, untuk sekolah di Kotapinang menumpangi becak bermotor BK5078YP yang dikemudikan Saparuddin. Ketika melintas di Jalinsum-Bukit, Kotapinang, tepatnya di depan BII, tiba-tiba betor yang mereka tumpangi diseruduk truk intercooler BK9887YK milik CV. Bentrans bermuatan batu pitrun. Akibat peristiwa itu, istri dan anaknya termasuk pengemudi betor mengalami sejumlah luka di sekujur tubuh mereka. Namun, kata dia, sampai kini kasus itu belum juga dilimpahkan ke pengadilan oleh pihak Satlantas Polres Labuhanbatu. Parahnya, ketikaRamlimengurusberkasuntukkeperluanJasaraharjadiMapolres, jumlah korban yang disebutkan dalam berkas hanya tiga orang tidak termasuk putranya Sihap Kurnia Ramli. Kasat Lantas Polres Labuhanbatu AKP Adi Santri Sanjaya yang dikonfirmasi enggan berkomentar dan menyarankan untuk langsung mengkonfirmasi masalah itu kepada Kanit Laka Iptu Syafii Lubis. Namun, telepon seluler Syafii tidak aktif ketika dihubungi. (c18)

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi); Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

Jalinprov Di Batubara Bertambah Rusak Waspada/Agusdiansyah Hasibuan

KAKI tanggul Sungai Tanjung semakin mengecil setelah digerus air sungai yang sedimentasinya kian meninggi.

3.000 Meter Tanggul Sungai Tanjung Kritis KUALATANJUNG( Waspada): Diperkirakan, sepanjang 3.000 meter tanggul Sungai Tanjung yang terletak di Desa Kuala Indah dan Desa Kuala Tanjung, Kec. Sei Suka, Kab. Batubara dalam keadaan kritis dan rawan jebol,. Warga desa berharap perbaikan segera dilakukan. Pantauan Waspada Minggu (29/9), tanggul yang membatasi air Sungai Tanjung agar tidak masuk ke kawasan pemukiman penduduk ini, kondisinya sudah memprihatinkan.Selaindibagian kakinya banyak ditanami tanaman keras seperti sawit, juga dimanfaatkan sebagai sarana jalan pengangkutan hasil perkebunan sawit rakyat di hilir sungai. Terlihat bekas – bekas jalan

truk yang terbenam akibat hujan yang menggemburkan bagian atas tanggul hingga meninggalkan lubang – lubang. Begitu pula bagian kelokan alur sungai yang membuat air langsung menggerus badan tanggul. Tingginya sedimentasi yang terjadi di sungai ini juga makin memperberat beban tanggul, nyaris posisi air kini lebih tinggi dari daratan pemukiman warga.

Menurut informasi yang diterima dari masyarakat, padaMei 2013 lalu, luapan air sungai sangat tinggi disepanjang 3000 meter tanggul hingga rata – rata air melimpah dari atas tanggul. Kepala Desa Kuala Indah Matsyah yang ditemui Waspada membenarkan sudah menyurati Satuan Kerja BalaiWilayah Sungai Sumatra II Kegiatan Pengendalian Banjir. Dalam surat permohonan itu disampaikan akibat yang akan timbul jika tanggul Sungai Tanjung sampai jebol maka akan merendam sedikitnya 918 KK di Desa Kuala Indah dan 1620 KK di Desa Kuala Tanjung. Di daerah yang merupakan kawasan industri ini juga berada

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO

 Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Waspada/Helmy Has

BADAN Jalinprov di Tanjungtiram tambah rusak menyulitkan pemakai jalan butuh perbaikan.

BINJAI (Waspada): Wakil Asisten Teritorial Kepala Staf Angkatan Darat (Waaster KSAD) Brigjend TNI Komaruddin Simanjuntak, bersama rombongan tim penilai Mabes AD terdiri dari Paban Sterad Kolonel Arh Winata dan DirbinpuanterPusteradKolonelInfMarsudi,berkunjung ke Markas Komando Distrik Militer (Makodim) 0203/Langkat, kemarin. Kedatangan rombongan disambut khusus Dandim 0203/Langkat Letkol Inf Tri Saktiyono dan Kasdim Mayor Inf Rudi Junianto beserta jajarannya. Hadir BupatiLangkat H. NgogesaSitepu,Wakil Wali Kota Binjai H. Timbas Tarigan, Ketua DPRD Kota Binjai Zainuddin Purba, Sekda Langkat T. Salahuddin, Kapolres Binjai AKBP Marcelino Sampouw,Danyon Infanteri8/MarinirTangkahan LaganLetkolMarRomiHutagaol,DanyonArhanudse 11/BSMayorArhCandyCristianRiantorydanlainnya. Kunjungan berlangsung 23 hingga 24 September 2013. Diawali tatap muka dan dialog terbuka, serta pembacaan amanah Aster KSAD

Hubungi kami

 Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

lima perusahaan besar seperti PT.Inalum, PT.MNA, PT.Domba Mas, PT Gunung Pantara Barisan. “Sesuai pengalaman kami di gulan Agustus sampai Desember dan bisa pula sampai ke bulan Mei curah hujan cukup tinggi, luapan ai sungai juga turut naik, untuk itu penanganan penanggulangan rehap tanggul Sungai Tanjung kami harapkan segera dilakukan,” kata Matsyah. SebelumnyaKetuaBPDDesa Kuala Indah Mhd. Nasir OK kepada Waspadajugamenerangkan tentang rawannya kondisi tangguldanmengharapkanpihak terkait segera melakukan antisipasi sehingga tidak akan menimbulkan kerugian. (c05)

BATUBARA (Waspada): Salah satu jalan lintas provinsi (Jalinprov) di ujung jalan antara Sei Bejangkar- Simpang Empat Tanjungtiram Batubara bertambah rusak dan belum juga mendapat perbaikan. Para sopir saling berebut menghindarkan lubang yang digenangi air berlumpur dan pejalan kaki merasa takut tak kebagian memanfaatkan pinggir jalan. Tidak jelas siapa yang bertanggungjawab memperbaiki jalan rusak tersebut. Apakah pihak Provinsi atau Pemkab Batubara, namun yang penting bagi warga badan jalan yang rusak tersebut diba segera diperbaiki, jangan dibiarkan bertambah parah menyulitkan pengguna jalan. (a12)

Waaster KSAD Kunjungi Makodim 0203 Langkat

 Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

 Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

WASPADA Senin 30 September 2013

Waspada/Helmy Has

PROYEK pembuatan pengerasan jalan di Dusun III Pematang Panjang terlantar, warga minta disiapkan.

Pengerasan Jalan Dana BDB Terlantar

LIMAPULUH (Waspada): Warga Dusun III Desa Pematang Panjang Kec. Limapuluh merasa kecewa pekerjaan pengerasan jalan dana Bantuan Daerah Bawahan (BDB) Provsu/APBD Batubara 2013 terkesan seperti ditelantarkan. “Kami tak paham mengapa sudah sebulan pekerjaan pengerasan jalan terlantar tidak dikerjakan.Apakahbangunansekarang itu dinilai sudah selesai?” tukas warga Dusun III Pematang Pan-

jang, Sabtu (28/9). Berdasarkan plang proyek pembuatan pengerasan jalan Dusun III itu sumber dana BDB/ APBD sebesar Rp199.342.000, pelaksana CV.Dodo Fareto beralamat Jl. Jenderal Sudirman No.50 Simpang Dolok dengan nomor kontrak 12-Lp-BDB/SPK/ PPKLp/PUD-BB/2013 masa pelaksanaan 90 hari kalender. Menurut warga, pekerjaan dimulai sejak bulan puasa, yang terlihat bangunan turap kemu-

diansudahsebulanterlantartidak dikerjakan,sedangkanpembuatan pengerasan jalan sesuai plang proyek tidak ada. Warga menduga pekerjaan tak siap karena lokasi proyek agak jauhkedalamdiarealkebunsawit warga tidak terpantau pengawasanPU.Karenaituwargaminta pembangunan jalan dapat dikerjakan sampai selesai dimanfaatkan warga memperlancar pengangkutan hasil sawit mereka. (a12)

Mayjend TNI MerisWiriadi olehWaaster Brigjend TNI Komaruddin Simanjuntak di hadapan jajaran Kodim 0203/Langkat, unsur muspida dan tokoh masyarakat. Waaster KSAD menjelaskan, kedatangannya sebagai bagian dari rangkaian penilaian lapangan tahapkeduaterkaitpelaksanaanlombabinterantar kodim tingkat utama se-Indonesia ke-18 tahun anggaran2012/2013,setelahsebelumnyadilakukan penilaiantahappertamaolehDirbinpuanterPusterad Kolonel Inf Marsudi dan Pabandya Sterad Letkol Kav Harpuddin Daing pada 22 dan 23 Juli 2013. Penilaian tahap kedua dilakukan timnya mengingat Kodim 0203/Langkat masuk empat besar kodim utama dari 13 kodim finalis seIndonesia dengan penilaian terbaik dan dianggap memiliki sejumlah program binter unggulan. Menanggapi itu, Dandim 0203/Langkat Letkol Inf Tri Saktiyono mengaku bangga sekaligus senang karena memberi kesan positif dan prestasi tersendiri terhadap satuannya, sebagai perwakilan Kodam I/Bukit Barisan.(a05)

20 Mahasiswa Batubara Terima Beasiswa PT Inalum KUALATANJUNG(Waspada): 20 Mahasiswa Batubara yang berada di sekitar PT Inalum, Kamis (26/9) menerima beasiswa dari perusahaan peleburan aluminium itu, di mana jumlah penerima beasiswa itu tahun ini mengalami peningkatan dari tahun sebelumnya. Penyerahanbeasiswaini dihadiriSeniorManager Humas PT Inalum H.Eddy Kristanto, Sekretaris DinasPendidikanKab.BatubaraSyahriSyam,para Camat,Kades dan orang tua para mahasiswa. Senior Manager Humas PT Inalum H.Eddy Kristanto mengatakan, program bantuan ini merupakan salah satu bentuk kepedulian sosial PT Inalum kepada masyarakat sekitar khususnya bidang pendidikan dan terlaksana atas kerjasama antara PT Inalum dan Disdik Batubara serta pemerintahdesayangberadadisekitarperusahan. Beasiswa ini diberikan kepada masyarakat kurang mampu dari segi ekonomi namun memiliki

prestasi. Berbeda dengan tahun tahun sebelumnya ujar Eddy, acara penyerahanbantuan beasiswa kali ini dilaksanakan di lokasi pabrik peleburan alumunium PT Inalum Kuala Tanjung. “Hal ini kami lakukan sebagai upaya memperkenalkan atau sosialisasi tentang keadaan atau kegiatan kegiatan yang berada di pabrik PT Inalum Kuala Tanjung. Tahun ini, jumlah penerima bantuan beasiswa juga meningkat, yang mana pada tahun sebelumnya tahun ajaran 2012/2013 berjumlah 15 orang mahasiswa/i dan tahun ini 2013-2014 menjadi 20 mahasiswa/i yang akan menerima beasiswa dari perusahaan,” sebut Eddy. Kadisdik Batubara, diwakili Sekretaris Dinas Pendidkan Syahri Syam mengatakan, kerjasama Disdik Batubara dengan PT Inalum dalam meningkatkan mutu pendidikan sangat bermanfaat bagi para mahasiswa/i. (c05)

Tandan Pisang Bercabang Hebohkan Warga Sergai

Waspada/Edi Saputra

TANDAN pisang Ambon bercabang menghebohkan warga Dusun II, Desa Pematang Cermai, Kec.Tanjung Beringin.

TANJUNGBERINGIN (Waspada):Tandan pisang langka jenis Ambonyangbercabangduamilik Sugianto, 35, warga Dusun II, Desa Pematang Cermai, Kec. Tanjung Beringin, Kab. Serdang Bedagai tiga pekan terakhir menghebohkan warga. D i t e m u i Wa s p a d a d i kediamannya, kemarin Sugianto yang kesehariannya membuka warung kopi dan tukang kusuk tradisional menuturkan rumpun pohon pisang ambon bercabang

mulai dikunjungi warga sejak tiga pekan terakhir, yang mendapat informasi dari mulut ke mulut. Diamengatakanmengetahui tandan pisang ambon bercabang yang tumbuh di samping rumah tepat disebelah kamar tidurnya sekiraduabulanlalu,malamsekira pukul 01:30 dikejutkan suara ledakan,setelahdiperiksaternyata berasal dari jantung pisang yang merekah. “Setelah beberapa hari saya perhatikan dalam satu tandan

pisang bercabang dua dengan dua jantung,” ungkap Sugianto. Malik, 35, warga Kec.Pantai Cermin yang menyaksikan mengaku pertama kali melihat buah pisang ambon bercabang dua. Pantauan Waspada, selain tandan pisang bercabang dengan ketingian pohon lebih dari tiga meter, tidak jauh dari rumpun itu juga satu pohon pisang berbuah dua tandan dengan usia sekira tiga bulan namun ukuran buahnya lebih kecil.(c03)

Waspada/Agusdiansyah Hasibuan

SENIOR Manager Humas PT.Inalum menyerahkan beasiswa kepada 20 mahasiswa Batubara di Front Office PT.Inalum.

Sumatera Utara

WASPADA Senin 30 September 2013


DPRD Laporkan Bupati Tapsel Terkait Tambang Emas PT AR TAPANULI SELATAN (Waspada): DPRD Tapanuli Selatan melalui Komisi 3 melaporkan perusahaan tambang emas PT Agincourt Resources (PT AR) karena dinilai sampai saat ini tidak memiliki iktikad baik melanjutkan penanaman pipa pembungan sisa limbah. Sedangkan Bupati Tapsel H Syahrul M Pasaribu dilaporkan diduga sekongkol dengan perusahaan tambang emas asal Hongkong ini. ‘’Benar,kitatelahmelaporkan PT AR ke Komisi VII DPR RI diterima Harry Lottung Siregar terkait MoU,’’ ujar Ketua Komisi III DPRD Tapsel H. Mahmud Lubis, S.Ag kepada Waspada, Minggu (28/9). Dijelaskan, sebelumnya, terjalin MoU (nota kesepakatan) antara PT AR dengan warga Batangtoru dan Muara Batangtoru agar perusahaan tambang emas inimelanjutkanpenanamanpipa dari Saba Julu, Desa Tello Kec. Batangtoru ke Dusun Bongal, Kec. Muara Batangtoru. Kesepakatan ini tempo hari

meredakan ketegangan. Setelah pihak perusahaan tambang menyatakan bersedia melanjutkan penanaman pipa pembuangan sisa limbah sampai ke Desa Bongal, keresahan masyarakat berkurang yang dihantui bahaya pembuangan limbah tambang emas. ‘’Sekarang, perusahaan tambang emas ini mencoba mengangkanginya sesuai kondisi yang kita lihat di lapangan, demikian juga Bupati Tapanuli Selatan, H Syahrul M Pasaribu, diduga sekongkol dengan perusahaan ini,’’ ujar Mahmud Lubis.

Dikatakan, di lokasi belum ada kegiatan penanaman pipa limbah tambang emas sesuai MoU tersebut. ‘’Anehnya, ada surat undangan Wakil Bupati Tapsel H Aldinz Rapolo Siregar Nomor 005/5465/2013 agenda acara pembahasan tindak lanjut notakesepahaman diruangrapat PTAR pada 1 Agustus 2013 kepada lurah dan kepdes di kecamatan itu, yang juga diketahui bupati,’’ujarnya merasa heran. Padahal, kata dia, MoU 2012 tertuang Pasal 3 Ayat 2 menyatakan PT AR bersedia memperpanjang jalur pipa dari Saba Julu Ronggang Desa Tello, Kec Batangtoru diperpanjang ke Dusun Bongal, Desa Muara Hutaraja Kec. Muara Batangtoru, Kab Tapanuli Selatan. ‘’Di lokasi Bongal itulah lokasi yang sesuai MoU PTAR dengan warga diwakili sembilan kepala desa di wilayah itu. Jika MoU diubah, akibatnya sisa proses tambang emas akan mengan-

cam kesehatan masyarakat dari sisa pembuangan limbah tambang emas di masa mendatang,” ungkap Mahmud. Komisi3 DPRD Tapsel menyampaikan laporan ini ke KomisiVII DPR RI (membidangi pertambangan), karena perusahaan diduga ingin melanggar nota kesepahaman dengan masyarakat Muara Batangtoru tentang pemasangan pipa air limbah. “Nota kesepahaman itu dibuat karena masyarakat awalnya keberatan dengan kebijakan perusahaan membuang limbang dihuluSungaiBatangtoru,karena itu masyarakat meminta agar limbah dibuang langsung ke muara sungai,” ujarnya. Namun ternyata, saat DPRD Tapsel mengadakan pertemuan denganmanajemenPTAgincourt Resources pada 3 Mei lalu, terungkap, sampai saat ini pihak perusahaan masih belum melakukan kegiatan apapun terkait

pemanjangan pipa limbah. Padahal, tenggat waktu sudah di ujung tanduk. Menanggapi itu, anggota Komisi VII DPR-RI Bidang Pertambangan dari daerah pemilihan (Dapem) Tapanuli Bagian Selatan (Tabagsel), H Harry Lottung Siregar membenarkan laporan tersebut. “Iya, benar, laporan Ketua Komisi 3 DPRDTapsel sudah kita terima tentang MoU PT AR denganmasyarakatdisana.Kalau memang MoU lanjutan penanaman pipa itu dikangkangi perusahaan, kami akan turun ke lokasi,’’ujarpolitisipusatyangjuga putra Tapsel ini. Bupati Tapsel, H Syahrul M Pasaribu dikonfirmasi Waspada belum lama ini baik lewat pesan singkat ke nomor telepon genggamnya dan dicoba ditelepon, tidak memberikan informasi terkait lanjutan penanaman pipa air sisa proses tambang emas PT AR di Batangtoru. (c13)

Polres Dan Kejari Didesak Usut Proyek Pinger Print Rp2,5 M Di Simalungun SIMALUNGUN (Waspada): Desakanuntukpengusutankasus dugaan korupsi proyek pengadaan pinger print (absensi elektrik) di kantor SKPD dan Puskesmas jajaran Pemkab Simalungun semakin deras. Kalangan LSM dan anggota DPRD Simalungun minta pihak Kapolres dan Kajari daerah itu agar proaktif melakukan pengusutan secara tuntas kasus yang didugatelahmerugikankeuangan daerah mencapai Rp2,5 miliar lebih. “Kasusdugaankorupsi(mark up) proyek pengadaan 101 unit pingerprint PemkabSimalungun tahun 2011 senilai Rp2,5 miliar jangan ditutup-tutupi. Kapolres dan kejaksaan harus proaktif melakukan proses pengusutannya hingga tuntas, jangan melakukan sistim tebang pilih,” kata Direktur LSM Macan Habonaron, Jansen Napitu, Jumat (27/9).

Menurutnya,desakanpengusutankasusdugaanproyekpengadaan pinger print tersebut mengingat permasalahannya sudah berlangsung hampir tiga tahun, sehinggaadakesankasustersebut sengaja‘disimpan’ atau‘dipetieskan’. Padahal berbagai lembaga, termasuk LSM Macan Habonaron, telah melaporkan kasus dimaksud bahkan sudah sampai ke Kejaksaan Agung RI. Ketua KNPSI (Komite Nasional Pemuda Simalungun Indonesia) JanWiserdo Purba mengungkapkan, pengusutan kasus dugaan korupsi pengadaan pinger print dapat menjadi momentum dalam pengusutan kasus dugaan korupsi lainnya di Pemkab Simalungun. Menurutnya, proses pengusutan ini penting agar kejelasan kasus ini dapat diketahui masyarakat. Demikian juga kepada bupati agar tetap proaktif dan tidak membiarkan

kasus itu berlarut-larut. KNPSI sendiri, tukas JanWiserdo,sebelumnyasudahmengadukan masalah ini ke Kejaksaan Agung RI dan hasilnya pihak Kejaksaan Agung memerintahkan Kejari Simalungun, melalui Kajatisu untuk menangani kasus pinger print dimaksud. ‘’Sayangnya, hingga dua tahun lebih setelah itu, pihak Kejari Simalungun tidak merespon perintah dari Kejagung,’’ katanya. Sementara salah seorang anggota DPRD Simalungun, Bernhard Damanik, menyatakan

sangat menyayangkan kasus dugaan korupsi proyek pengadaan pinger print hingga saat ini belum ada titik terang. Menurutnya, proyek pinger print yang telah menghabiskan uang rakyat Rp2,5 miliar lebih itu menjadi proyek gagal, sehingga memanglayakditindaklanjutidan diproses hukum sesuai dengan peraturan dan perundang-undangan. Lebih-lebih karena sejak selesai dikerjakan sampai saat ini alat absensi elektrik tersebut tidak dapatdifungsikandandioperasionalkan, sehingga sangat kuat

dugaanadapenyimpangandalam pekerjaan tersebut. “ Jika aparat hukum di daerah ini punya kemauan, maka pihak penyidik cukup meminta pihak auditorsegeramenghitungdugaan kerugian negara. Karena hampir dipastikan pengadaan proyek itu ada mark up,” ujar Bernhard. Sedangkan Kadishubinfokom, M Andreas Simamora, yang dihubungi tidak memberikan tanggapan apa-apa terkait desakan pengusutan dugaan korupsi proyek pengadaan pinger print. (a29)

306 Honorer K-II Tapsel Ujian CPNS, 353 Madina P. SIDIMPUAN ( Waspada): Pemkab Tapanuli Selatan melaksanakan ujian Calon Pegawai Negeri Sipil (CPNS) bagi honorer Kategori II (K-II) di SMP Negeri I Batang Angkola, Kamis (3/10). “Sesuai surat edaran Menteri Perberdayaan Aparatur Negara dan Reformasi Birokrasi No: SE/10/M.PAN-RB/08/2013, kita gelar ujian CPNS bagi honorer K-II pada 3 Oktober,” kata Kabid Pengadaan Pegawai dan Data BKD Pemkab Tapsel, RadenYusuf, S.Sos di ruang kerjanya, Jumat (27/9). Dijelaskannya, saat ini jumlah tenaga honorer di Pemkab Tapsel 306 orang. Mulai Kamis (26/9) sampai Senin (30/9), para peserta sudah mempersiapakan syarat yang di perlukan. Seperti persyaratan administrasi, pasfoto dan mengisi formulir honorer K-II. Raden Yusuf mengatakan, setiap peserta akan menjalani dua ujian, yakni test kompetensi dasar (TKD) dan test kompetensi bidang (TSB). Namun untuk TSB hanya peserta yang khusus saja, seperti tenaga kesehatan. Honorer Madina Sedangkan 353 tenaga honorer K-II di Kab. Mandailing Natal akan mengikuti seleksi calon pengawai negeri sipil (CPNS) tahun 2013 ini. Tenaga honorer K-II yang akan lulus seleksi secara nasional kemungkinan hanya 30 persen. Hal tersebut disampaikan Kepala Badan Kepengwaian Daerah (BKD) Madina Syahdan Lubis, AP kepada sejumlah wartawan di ruang kerjanya, baru-baru ini. Iamenyatakan, pelaksanaantestertulispenerimaanCPNSkategori tenaga honorer K-II tahun ini bersamaan dengan jadwal tes tulis kategori pelamar umum. Pada tahun ini Madina mendapat kuota penerimaan CPNS kategori pelamar umum 100 orang. “Jika tidak ada perubahan jadwal, tes tertulis seleksi CPNS kategori pelamar umum dan tenaga honorer K-II akan dilaksanakan 3 November 2013. BKD Madina pun tengah mempersiapkan segala sesuatunya untuk kelancaran pelaksanaan ujian tertulis tersebut,” ucapnya. (a27/a28)

Guru Di Paluta Keluhkan Dana Sertifikasi Belum Cair GUNUNGTUA (Waspada): Guru di Kab. Padanglawas Utara mengeluh karena ratusan guru di Paluta belum menerima tunjangan sertifikasi periode April-September 2013. Mereka mendesak Disdik Paluta secepatnya memproses atau membayar tunjangan sertifikasi tersebut, karena itu hak guru. “Kami tak tahu apa penyebabnya, ke-napa tunjangan sertifikasi kami belum juga kami terima. Ini sudah akhir 2013,’’ jelas sejumlah guru di wilayah Gunungtua dansekitarnya,Kec.Padangbolakyangmemintanamanya tidak dimuat kepada Waspada, baru-baru ini. Mereka juga mempertanyakan kenapa tunjangan terlambat dibayarkan padahal guru yang berada di kabupaten/kota lainnya sudahmenerimatunjangantersebut.DinasPendidikanPalutadiminta bersikap transparan serta menjelaskan alasan mengapa tunjangan sertifikasi dari bulan April- September 2013 belum juga dibayar kepada guru. “Kami mau tanya kepada Bapak Kepala Dinas Pendidikan Paluta kapan tunjangan sertifikasi ini dibayarkan, kenapa guru di Paluta ini berbeda dengan guru di daerah lain seperti Madina dan Kab. Padanglawas yang sudah menerima tunjangan sertifikasi,’’ tanya guru dengan nada kecewa. Kepala Dinas Pendidikan Paluta Drs Hazairin Hasibuan dikonfirmasi melalui Kasubbag Keuangan, Pasman Siregar mengatakan pihaknya sudah berupaya mempercepat realisasi dana sertifikasi seperti yang diharapkan rekan-rekan guru di wilayah Paluta, namun pembayaran tunjangan sertifikasi guru memang sangat bergantung pada proses penyaluran dana tersebut dari pusat ke daerah. “Anggarannya belum turun dari pusat. Kalau dana itu keluarnya cepat, maka akan kami salurkan secepatnya juga,” tegasnya. (a35)

Waspada/ Rap.Negara Siregar

KONDISI lalulintas di jalan Patuan Nagari Pematangsiantar semakin semrawut. Terlihat penempatan parkir di kanan dan kiri badan jalan tidak beraturan, menyebabkan jalan protokol itu sulit dilalui kendaraan, seperti terlihat Minggu (29/9).

Parkir Tak Beraturan, PKL ‘Kuasai’ Jalan PEMATANGSIANTAR,(Waspada): Penempatanparkirkendaraanyangsembaranganditambah pedagangkakilima(PKL)yangsemakinmenguasai badan jalan untuk berjualan, mengakibatkan jalan protokol Patuan Nagari di Kota Pematangsiantar semrawut dan macatkan lalulintas. Petugas parkir terlihat seenaknya menempatkan kendaraan seperti mobil dan sepedamotor untukmengisibagiansebelahkanandankiribadan jalan yang lebar 15 meter itu, berdampingan dengan dagangan pedagang yang digelar begitu saja di atas badan jalan. Akibatnya, jalan yang tersisa dan terbuka untuk dilalui kendaraan yang akan melintas di jalan tersebut hanya untuk sekira empat sampai lima meter saja, sehingga jika ada dua kendaraan berpapasan, dipastikan terhambat. Kondisi jalan yang panjangnya hanya 500 meter itu sudah lama dikeluhkan banyak orang, terutamayangharusmelitasijalantersebutdengan tujuan ke Kota Tebingtinggi.Tindakan penataan

yang dilakukan Pemko Pe matangsiantar di lokasi tersebut, tampaknya tidak membuahkan hasil seperti yang diharapkan.Terbukti, keadaan semakin hari semakin tidak beraturan, seperti terekam, Minggu (29/9). H.Abdul Rahman,salah seorang tokoh masyarakat yang membuka usahanya di jalan Patuan Nagari Pematangsiantar, kepadaWaspada, mengatakan,kesemrawutanyangterjadididaerah itu akibat lambatnya penertiban yang dilakukan petugas Pemko. “Dulu mula-mula PKL itu jumlahnya hanya beberapa orang saja, tetapi karena mereka merasa aman dan seperti diizinkan berjualan ditepi jalan itu, semakin hari jumlah yang berjualan semakin banyaksepertisekarangini,jumlahnyasudahratusan pedagang,sudahsulitmenggusurnya.Apalagisetiap hariadapetugasyangmemintarestribusiberjualan daripedagangdisitu.Makapersoalannyadisinisudah sangat komplek,” sebut pengusaha rumah makan itu mengeluhkan. (crap)

DPRD Setujui Pertanggungjawaban APBD Pakpak Bharat 2012 PAKPAK BHARAT (Waspada): DPRD Kab. PakpakBharatsetujuiRancanganPeraturanDaerah (Ranperda) tentang Pertanggungjawaban Pelaksanaan APBD Kab. Pakpak Bharat Tahun 2012 untuk ditetapkan menjadi Peraturan Daerah. Persetujuan tersebut ditetapkan berdasarkan Rapat Paripurna DPRD, Jumat (27/9) setelah sebelumnya perwakilan dari Komisi A, Komisi B, Komisi C, Fraksi Sikadang Njadi dan Fraksi Asa Nduma menyampaikan laporan masingmasing. Penetapan Ranperda tentang Pertanggungjawaban Pelaksanaan APBD Kab. Pakpak Bharat tahun 2012 ditandai dengan penandatanganan Naskah Penetapan oleh Ketua DPRD Ir. Agustinus Manik, Wakil Ketua Edison Manik ,SE dan Sauli I.P Habeahan dan dilanjutkan dengan penandatanganan oleh Bupati Pakpak Bharat, Remigo Yolando Berutu, MBA. Rapat paripurna dipimpin Ketua DPRD Ir.

Agustinus Manik dan dihadiriWakil Bupati Pakpak Bharat Ir. Maju Ilyas Padang, Kapolres Pakpak Bharat, Ketua Pengadilan Negeri Sidikalang, Sekretaris Daerah Drs. Holler Sinamo, MM, para pimpinan SKPD dan dari berbagai elemen masyarakat. BupatiPakpakBharat,RemigoYolandoBerutu, MBA menyampaikan terimakasih dan apresiasi kepada dewan yang telah bekerjasama dalam melakukan serangkaian proses pembahasan dalamsuasanayangaspiratifdankondusifsehingga menghasilkan putusan paripurna berupa Rancangan Peraturan Daerah yang nantinya akan memberikan kontribusi signifikan dan meningkatkan kesejahteraan masyarakat. Bupati juga menyampaikan akan menindaklanjuti catatan-catatan yang ada sesuai dengan mekanisme dan perundang-undangan yang berlaku yaitu dengan mengoptimalisasi penggunaan anggaran. (csb)

Kejatisu Panggil Kadis PU Tapsel

Waspada/Basita Bukit

PINCAB PT Bank SUMUT menyerahkan bantuan “Bank Sumut Peduli Sinabung” di posko penampungan pengungsi di Klasis GBKP Kota Kabanjahe.

Bank Sumut Bantu Pengungsi Sinabung KABANJAHE (Waspada): Sebagai wujud peduli atas musibah dialami warga Karo disebabkan bencana alam Gunung Sinabung, PT Bank Sumut menyerahkan sejumlah bantuan untuk para pengungsi, Kamis (26/9) dan Jumat (27/9). Bantuan diberikan berupa sembako yakni 77 karung beras, 40 kotak minyak goreng, 20 kotak sarden ikan, 201 kaleng sarden daging, 54 kotak air mineral sedang, 169 Kg gula putih dise-

rahkan ke tiga titik lokasi pengungsian yaitu Jambur Tuah Lopati Jl. Samura Kabanjahe, Klasis GBKP Jl. Kiras Bangun Kabanjahe, Jambur Payung (GBKP) Jl. Tiganderket Payung. Bantuan tersebut diserahkan Panitia Bank SUMUT Peduli Sinabung dari kantor pusat didampingi oleh Sufrizal selaku pemimpin cabang PT. Bank Sumut Kabanjahekepadamasingmasing koordinator lapangan posko penampungan bencana

Gunung Sinabung didampingi Camat Kabanjahe Drs. Lesta Karo-karo , MM. Pincab Bank Sumut Kabanjahe Sufrizal mdengatakan, bantuan tersebut bersumber dari Keluarga Besar PT. Bank SUMUT yang membuka rekening “Bank Sumut Peduli Sinabung” untuk dapat menampung bantuan/ sumbangan dari seluruh pegawai PT.BankSumutuntukdiserahkan kepada pengungsi Gunung Sinabung. (c09)

TANO TOMBANGAN (Waspada) : Terkait sejumlah proyek diduga bermasalah di Dinas Pekejaan Umum Daerah (PUD) Kab Tapanuli Selatan, Kadis PU ini, Ir Mulia Rahmat Nasution dan Kabid Bina Marga, Rizal dipanggil Kejatisu dan diperiksa Tipikor, belum lama ini. ‘’Keduanya (Kadis dan Kabid Bina Marga) dipanggil Kejaksaan tingggi Sumatera uatara (Kejatisu)sekaligusdiperiksakeMedanBangterkait proyek bermasalah di kantor PU ini, termasuk proyek Tantom Rp1,9 miliar itu,’’beber seorang pegawai bidang proyek jalan di kantor itu, kepada Waspada, baru-baru ini. Informasi dihimpun, proyek jalan Tantom merupakan proyek Dinas PU Tapanuli Selatan (Tapsel)tahunanggaran2013.senilai1.975.000.000, panjangnya 3,8 Km melalui rekanan CV Cahaya Pelita. Saat dikonfirmasi Waspada Kepala Dinas (Kadis) PUTapsel Ir Mulia Rahmat Nasution tidak berada di kantornya, mewakili keduanyai pengawas proyek jalan, Adi Melfery Spd mengaku Kadis dan Kabid Bina Marga Rizal sedang berada di Medan. “Pak Kadis dan Kabid lagi di Medan, namun terkait proyek jalan di Tantom seharusnya ketebalan aspalnya minimal 10 cm, saya rasa tidak ada kejanggalan di sana. Saat inikan mereka masih dalam tahap pengerjaan, masalah pasir berwarna

tanah liat diamparkan di proyek jalanTantom itu, boleh-boleh saja,’’ ujar Fery, Jumat (20/9) lalu. Diketahui belum genap sebulan kondisi jalan lintas di Kec. Tano Tombangan Angkola, Kab Tapanuli Selatan sudah memprihatinkan, permukaan jalan baru selesai diaspal pori-porinya sudah tampak jelas. Itulah keluhan warga yang menuding pembangunan jalan ini sebagai proyek asal jadi. “Jalan ini belum genap sebulan dikerjakan, tapi kondisinya sudah memprihatinkan hampir secara keseluruhan, ketebalan pengaspalan jalan sekira 5 cm jika dilintasi truk dan bus permukaan jalan mau terkelupas,” keluh warga setempat, Janto Aritonang,46, kepada Waspada, Minggu (22/9). Ketua Komisi 3 DPRD Kab Tapanuli selatan bidang pembangunan, Mahmud Lubis SAg meminta Kadis PU Tapsel dan pengawas tidak meneken progres kemajuan kerja di sejumlah proyek yang sedang dikerjakan jika tidak sesuai petunjuk teknis. ‘’Kadis PU Tapsel jangan ‘main mata’ denga para rekanan nakal yang mengerjakan proyek asal-asalan. Kalau memang tak sesui teknis sejumlah proyek ya tolak saja,’’tegas politisi berlambang Ka’bah ini, Minggu (29/9) melalui Waspada. (c13)

Lalat Buah Penyebab Produktifitas Jeruk Karo Menurun SERANGAN hama lalat buah menjadi persoalan bagi petani jeruk di Kab. Karo. Sebagai wilayah pertanian hortikultura terbesar di Sumut, penanganan

hama itu menjadi program pemerintah guna membantu petani sehingga produksi komoditi hortikultura itu meningkat.

Petani jeruk Darmawan Ginting yang memiliki lahan 2 Ha di Desa Pertumbukan, Kec. Barusjahe, Karo, mengatakan, kemarin,produksijeruknyaturun


PETANI jeruk di Berastagi memasang perangkap khusus Antilat 90 BB untuk hama lalat buah jantan. Tujuannya menekan jumlah populasi lalat buah, sehinggga produktifitas jeruk meningkat.

hingga 75 persen sejak dua tahun ini. Itu disebabkan tanaman jeruk diserang hama lalat buah. Dia yang sudah 9 tahun menjadi petani jeruk mengakui hama itu sudah lama menyerang petani jeruk di Karo, dan dua tahun terakhir serangannya meningkat. Petani jeruk lainnya Mulia Sembiring mengatakan hal sama. Tetapi, kata dia, mereka sudah dapat cara mengendalikan hama itu. Dimulai 2012 dengan adanya penyuluhan dari Dinas Pertanian Karo untuk mengatasi serangan hama lalat buah. Meski belum memperoleh produksi maksimal, tapi dia lebih bersemangat dan meyakini bisa memperoleh produksilebihbanyakpadapanen berikutnya. Untuk pengendalian hama, selain menggunakan insektisida juga dilakukan dengan membuat perangkap lalat, termasuk mengumpulkan buah yang jatuh akibat serangan hama dan disimpan dalam plastik. “Cara-cara itu dapat mengurangi serangan lalat buah, meski belum dapat menghilangkan secara keseluruhan,” katanya. Terkait persoalan itu, Kabid Produksi Dinas Pertanian dan Perkebunan Kabanjahe Munarta Gintingmengakuibelumadaobat

pengendali serangan hama lalat buah, sehingga diperlukan kerjasama antara petani, penyuluh dan pemerintah daerah memutus siklus serangan hama. “Ini menjadi perhatian khusus pemerintah kabupaten, karena jeruk merupakan komoditas unggulan Karo dan Sumut yang diekspor hingga luar negeri,” katanya didampingi Plt Kepala UPT Pertanian Kec. Barusjahe Erik Sitepu. Meminimalisir serangan lalat buah, perlu dilakukan gerakan massal dengan bantuan plastik beningdariDinasPertanianuntuk mengumpulkan buah yang terinfeksisehinggatidakmenularkan hama ke buah lainnya. Pemerintah melalui Kementan jugasudahmemberikanbantuan kepada seluruh petani jeruk seKaro, yakni lima blok bahan aktif Methyl Eugenol (ME-BLOK)/Ha pada2012dan10blok/Hadengan total sekira 100 ribu blok, dan terakhir 16 blok/Ha di tahun 2013 serta 13.125 kantong plastik. Dwijaya Pratama, Agronomist PT Survindo Global menjelaskan cara pengendalian hama lalat buah dengan memasang perangkap (atraktan) Antilat 90 BB yang diformulasikan khusus untuk hama lalat buah jantan.

Antilat 90 BB menggunakan wooden block berisi bahan aktif ME BLOK yang dikemas dalam alumunium foil sehingga mempunyai masa simpan yang panjang. “Antilat dipasang di lapangan menggunakanperangkapkhusus (fligh-T trap) atau perangkap alternatif (botol air mineral). Perangkap yang dipasang harus berisi air ditambah sedikit deterjenpadabagianbawahperangkap agar lalat buah yang masuk tidak lepas kembali. Jika lepas dikhawatirkan akan lebih aktif melakukanperkawinan,”katadia. Semakin banyak lalat buah jantan tertangkap maka akan semakin kecil terjadinya perkawinan, sehinga semakin sedikit jumlah populasinya di lapangan. Senior Advisor for Agricultural Policy and Stategy GIZ Sulaiman Ginting mengatakan, telah bekerjasama dengan Dirjen Hortikultura Kementerian Pertanian untuk pengendalian hama lalat buah pada jeruk siam madu di Karo. Mereka memberi pelatihan kepada para petani dan stakeholder melalui workshop. Tujuannya, meningkatkan kapasitas petugas teknis di lingkungan Kementerian Pertanian dan daerah. (m27)



Jokowi Kian Mengerucut Tak Perlu Revisi Pasal 7


emilu dan Pilpres 2014 sudah semakin dekat sehingga semua parpol sudah mempersiapkan dirinya untuk bisa meraih suara terbanyak dalam pesta demokrasi lima tahunan itu. Saat ini persiapan PDIP lebih berat dengan semakin tingginya tingkat popularitas dan elektabilitas Jokowi di mata publik. Sehingga PDIP terus berupaya menyiapkan jalan mulus buat Gubernur DKI Jakarta itu. Apa jalan tol yang tengah diupayakan Fraksi PDIP di DPR RI. Saat ini mereka ingin mengubah \\t “_blank” atau merevisi Pasal 7 dalam Undang Nomor 42 Tahun 2008 tentang Pemilihan Presiden (Pilpres) yang mengatur soal kepala daerah yang hendak maju menjadi calon presiden. Dalam Pasal 7 RUU Pilpres mengharuskan kepala daerah yang ingin maju sebagai capres dan cawapres harus mendapat izin dari presiden. PDIP menginginkan pasal itu diubah sehingga kepala daerah harus bisa maju sebagai capres tanpa izin presiden sejauh dia diusulkan partai politik. Untuk saat ini baru Partai Gerindra yang melontarkan reaksi tidak senang melihat \\t “_blank” Partai Demokrasi Indonesia Perjuangan ingin merevisi Pasal 7 dalam Undang Nomor 42 Tahun 2008 tentang Pemilihan Presiden yang mengatur soal kepala daerah ketika hendak maju menjadi calon presiden. Sedangkan parpol lainnya masih tenang-tenang saja. Padahal, Parpol lain seperti Golkar sudah memutuskan mencapreskan ketua umumnya Aburizal Bakrie. Sama dengan Gerindra sudah memajukan ketua dewan pembina Prabowo Subianto sebagai capres dalam Pilpres tahun depan. Hanura juga sudah menetapkan Wiranto dan Harry Tanoe sebagai capres-cawapres. Hemat kita, upaya PDIP merevisi Pasal 7 tersebut tidak lain karena takut bakal menjadi batu sandungan buat Jokowi maju sebagai capres tahun depan. Mestinya, ketakutan itu tidak musti terjadi karena Jokowi merupakan figur paling potensial memenangkan Pilpres 2014. Aneh kalau sampai Presiden SBY tidak memberi izin bagi Jokowi maju, sementara kepala daerah lainnya dibolehkan maju dalam Pilkada Intisari maupun para menteri diizinkan mengikuti konvensi Partai Demokrat serta kampanye Megawati wajib menga- ke daerah-daerah. PDIP pasti diuntungkan jika presiden lah,pencapresan Jokowi sampai tidak memberi izin bagi Jokowi maju Pilpres 2014. Itu berarti, Jokowi sengaja sudah merupakan lang- dalam dijegal, dizalimi oleh pemerintah yang berkah tepat dan harga mati kuasa sehingga rakyat akan semakin sayang dan memilih Jokowi dengan cara mundur buat PDIP saat ini saja dari jabatannya saat ini (Gubernur DKI Jakarta). Kemenangan Jokowi bisa lebih dari 60 persen melebihi SBY pada 2009. Oleh karena itu alasan Gerinda menolak merevisi Pasal 7 tidak semata-mata untuk menjegal pencalonan Jokowi tapi karena memang diajukan secara mendadak ketika pembahasan RUU Pilpres hampir selesai. Yang khawatir internal PDIP karena kans terbesar menggolkan kadernya sebagai presiden, ya hanya ada pada sosok Jokowi, pemimpin sederhana yang rajin blusukan ke bawah menemui warganya. Seperti dikatakan anggota Badan Legislasi DPR dari Fraksi Gerindra Martin Hutabarat, RUU Pilpres sudah 1,5 tahun dibahas dan dibicarakan. Ratusan pasal sudah diperbaiki, ada juga 20 pasal tambahan. Sayang kalau harus tertunda lagi dengan pembahasan Pasal 7. Padahal, tertunda-tundanya pengesahkan RUU Pilpres ini disebabkan satu pasal yang tergolong krusial, yaitu pasal presidential threshold. Kalau Pasal 7 di’’dikocok’’ ulang bisa-bisa bakal merembet pada pasal-pasal lainnya sehingga pasti memakan waktu lebih panjang lagi. Justru itu, tidak perlu merevisi Pasal 7 karena hal itu hanya ketakutan berlebih atau seperti orang yang takut akan bayang-bayang. Belum tentu dan mustahil rasanya Jokowi diganjal dengan Pasal 7 oleh Presiden SBY. Kalau itu dilakukan, berarti SBY bakal dikecam oleh masyarakat luas di akhir pemerintahannya. Upaya PDIP merevisi Pasal 7 RUU Pilpres menunjukkan keseriusan elite politik partai berlambang banteng moncong putih memajukan Jokowi dalam Pilpres 2014. Sehingga teka-teki siapa Capres PDIP semakin mengerucut pada sosok Jokowi, meskipun ketua umumnya Megawati belum memberi kepastian. Megawati memang belum memutuskan siapa Capres PDIP, namun berbagai komentar dan perkembangan hasil survei lembaga independen sudah memberi sinyal pada publik kalau Megawati bakal mengalah dan wajib hukumnya memberi peluang tokoh yang bukan trah Soekarno maju dalam Pilpres tahun depan. Megawati tampaknya mulai menyadari kalau peluangnya semakin kecil sehingga kalaupun dipaksakan hasilnya tidak hanya mengecewakan tapi juga mempermalukan dirinya. Untuk kesekian kalinya dia gagal dan gagal lagi dalam Pilpres. Sekali dikalahkan Gus Dur dalam pemilihan di DPR-MPR, dua kali dikalahkan SBY dalam Pilpres, dan jika dipaksakan juga Megawati diprediksi bakal dipecundangi lagi oleh lawanlawan politiknya. Jadi, pencapresan Jokowi sudah merupakan langkah tepat dan harga mati buat PDIP saat ini.+


Faks 061 4510025

Facebook Smswaspada

+6281360716903 Apakah kakanda-adinda tidak ingat kepada Syarifuddien Khalifah ? Apakah tidak faham tentang beliau ? Bayi ajaib yang lahir beberapa windu nan silam • Sudah dapat berbicara dan melafazkan Ayat-Ayat ALLAH didalam Kitabul-Qur‘an , ketika masih bayi. Sa‘ at melahirkan Syarifuddien Khalifah , Ayah-Bundanya penganut agama lain (bukan Muslim) • Syarifuddien Khalifah bermuqiem di Tanah Leluhur si Barry Husein (Obama); KENYA • Bagaimana kalau Kakanda-Adinda yang “beruang” (maqshudnya banyak fulus) menghadirkan beliau di Majlis Ta‘lim kita ?? # all moslem solida rity~krueng si kameng# +6281370417708 Beginilah kalau pemerintah yang tidak mempunyai wibawa, mafia/agen kedelai aja nggak takut apalagi DIRUT PLN, makanya alam semesta ini nggak suka, bencana nggak henti2 nya gitu pun nggak malu, masih bertahan juga. Sebaiknya letakkan aja jabatan Mu biar segera berakhir semua penderitaan rakyat ini ! +6282165364443 Kepada bapak Wali Kota dan bapak Gubsu.. Saya Info kepada bapak’ tolong Jalan SEROJA medan SUNGGAL di Perbaiki... Kalau Hujan selalu banjir... Kami masyarakat sudah Resah pak.. Apa Lagi kalau hujan lebat, lama Hujan air masuk ke rumah. +6285359952665 Kepada Bapak KAPOLRES LAB BATU yg terhormat...kami mendengar & melihat pemakai serta pengedar NARKOBA di Wil Kp Pajak Labura sudah sangat memprihatinkan dan merusak generasi muda,kami mohon agar diperhatikan serta ditindak dgn secepatnya!!! +6281376673433 Kepada intansi yg terkait .Tolong di perhatikan jln Binjai km 7 / jln Patriot ( Depan Kodam .Anak2 yg mngatur jalan bila sore dah mengarah yg tdk baik? Paksa pengendara mobil dll Andai kata dipasang lampu jalan kan bagus? Seperti tempat2 yg lain .Terimakasih atas perhatian intansi yg terkait .WASSALAM +6281990530411 Para murid mengumpulkan uang untuk beli peralatan kebersihan, gorden,kunci kelas,mengecat ruangan disekolah berstandar Nasional, itu terjadi di SMP9 Tebing tinggi +6283194817681 CANDIDATE BUPATI DELISERDANG , YANG DUDUK DIKURSI NOMOR 6 , TAMPAKNYA HARUS MEN GHADAPI RIVAL-RIVAL “ KELAS BERAT ”• PEMILIH YANG BER PLANK ; Al-W ashliyah , yang berplank ; M.A.B.M.I,(Del.Ser.) dan GolKar.(Del.Ser.) • Serasa tidak ada kekhawatiran akan keok • Bagaimana realitanya ? Anggauta Or.Mas. Al-Washliyah sangat bejibun tetapi diragukan loyalitasnya (Sudah ada beberapa contoh)• Anggauta Or. Mas.(Suku/Etnic) MABMI sangat bejibun tetapi loyali tasnya diragukan (sudah ada contoh & pengalaman) • Demikian pula dengan nggauta/Sympatisan Or.Pol.Gol.Kar! Pendak kata ; Heavy (berat) perjuangan Pasangan nomor urut 6 untuk meraih , memasuki Bilik very-very important person (V.V.I.P.) KABUPATEN DELISERDANG • Patik hanya berteriak; “SELAM AT BERJUANG , PADUKA ! ”# all moslem solidarity ~ kr.sikameng # +6281396620001 Alangkah malangnya Prop Sumatera Utara,punya Sampuran Siharimau,air terjun dahsyat diSigura Gura sana,katanya bisa menghasilkan tenaga listrik seantero pulau Sumatera,tetapi hanya digunakan untuk melebur aluminium.Tetapi,untung ada pulau Sicanang,he,he,he.Opo ora hebat.

WASPADA Senin 30 September 2013

Siapa Yang Seperti China? Oleh Prof Usman Pelly, Ph.D Belanda melaksanakan politik buffer dan“belah bambu” (satu dipijak satu lagi diangkat).Pada waktu kekuasaan beralih ke republik,politik itu ternyata terus dilanjutkan.


akalah saya yang berjudul Who are the so-called Chinese in Indonesia, telah saya kirim seminggu sebelum International Convention of Asia Scholars (ICAS3) yang diselenggarakan National University of Singapore. Konvensi itu dilaksanakan tgl, 19-23 Agustus 2003 di Swisbell Hotel Singapura, sehingga para peserta konvensi yang berminat dapat mengambil copy dan lebih dahulu membacanya. Karuan saja saya dibanjiri pengunjung, kebanyakan cendekiawan Tionghoa dari berbagai universitas Asia. Kekagetan saya agak berkurang karena tiba-tiba muncul Dr Keiko Ogawa, antropolog Jepang—teman-lama satu angkatan waktu kuliah di University of Illinois Chicago. Rupanya dia telah melihat nama saya di menu konvensi dan langsung mencari “Bilik Sessi” dimana saya akan presentasi. Saya memberi isyarat kegalauan dengan memerlihatkan ruangan yang penuh, tapi dia tampak ceria dan menyemangati saya untuk mulai dengan membisikan “... your topic is very challenging!” Makalah saya sebenarnya membicarakan pergumulan politik yang menggunakanfaktorperbedaanetnik-rasialdanagama sejak zaman kolonial Belanda—untuk tujuan mengamankan kepentingan kolonial itu sendiri—dengan cara devide et empera (memecahbelahdankemudianmenguasai) etnis-ras dan agama berbeda. Tetapi ironisnya politik itu diteruskan pula oleh pemerintahpusatdiIndonesiasesudahkemerdekaan (dari Orde Lama, Baru dan Reformasi). Diasumsikan bahwa dalam hampir semua kerusuhan ras dan etnik di Indonesia sejak zaman kolonial yang menjadi objek sasaran (victim) adalah etnik China. Padahal asumsi seperti ini sesudah kemerdekaantidakbenar.Memangkerusuhan etnis di perkebunan pada zaman Belanda yang menjadi sasaran adalah China, begitu juga beberapa kali kerusuhan di Medan menjelang kejatuhan rezim Orde Baru (Pak Harto, 13-15 Mei 1998), kemudian disusul di Jakarta (peristiwa Mei kelabu), Surabaya, Bandung dan Makassar. Karena itu ada generalisasi seakan China diidentikkan dengan sasaran kerusuhan etnis dan ras di Indonesia. Kesimpulan ini tidak benar, karena kaitan historis dalam politik antar etnisagama setelah kemerdekaan tidak akurat dan lengkap dikemukakan. Politik Rasial Zaman Kolonial Setelah buruh China keluar dari perekebunan (1890), berdasarkan“poenali-sanksi” mereka harus dipulangkan kembali ke Tiongkok.Tetapi oleh pemerintah Belanda mereka dipergunakan untuk membangun ekonomidanperdagangandikota-kotayang baru tumbuh seperti di Medan, Siantar dan

Binjai. Mereka diberi kemudahan dan fasilitas agar dapat tumbuh sebagai masyarakat ekonomi baru pada lapisan menengah. Sedang pribumi dipaksa untuk tetap tinggal dilapisanbawah.Dengankebijakankolonial ini orang pribumi dipaksa puas bergerak di sektor informal, sebagai penjaja retail di kali lima (PKL). Dengan demikian orang Belanda dan Eropa aman dapat bergerak pada perdagangan papan atas. Dengan cara ini orang China digunakan sebagai buffer (penyangga). Hanya kelompok etnik atau ras yang dipercaya (friend) yang dapat dijadikan penyangga,karena mereka harus mengamankan kelompok-kelompok etnik papan bawahyangtidakdisenangi(enemies)penguasa. Untuk memperkuat kedudukan orang China sebagai kelas menengah pemerintah Belanda memberikan bantuan (support) danperlindungan(proteksi)kepadamereka. Sepertiizinsebagaikontraktordanleveransir di perkebunan dan pekerjaan lainnya di perkotaan seperti industri tekstil. makanan, minumandanrokokyangmenguntungkan dan tidak diberikan kepada kelas bawah. Dengan sistem penyangga ini perdagangan kelas atas yang dipegang orang Belanda dan Eropa (seperti perkebunan, perbankan. ekpor-impor, atau investasi modal asing) dapat diamankan dari keikutsertaan kelompok pribumi. Belanda melaksanakan politik“belah bambu” (satu dipijak satu lagi diangkat). Dengan kebijakan kolonial ini, mereka telah melakukan : (1) Divided and ruled (memecah dan menguasai) berdasarkan garis etnis, ras dan agama, (2) Sebagai kelas menengah China harus menempatkan diri sebagai musuh (enemies) kelas bawahdanmenjaditemansetia(fiends)kelompok penguasa (kolonial). Dengan kebijakan ini pula pemerintah Belanda di bidang perdagangan dapat melakukan indired ruled (pemerintahan tidak langsung) terhadap pribumi. Kelompok Penyangga Sesudah Kemerdekaan Pada waktu kekuasaan beralih dari tangan kolonial ke republik, politik buffer dan belah bambu itu ternyata terus dilanjutkan. Apalagi setelah kemerdekaan pedagang China dengan pengalamannya sebagai pedagang menengah menjadi lebih leluasa bergerakmenguasaiperdagangankelasatas yangditinggalkanorangEropadanBelanda. Justru pula setelah dunia industri modern memasukiperekonomianIndonesia.Usaha dari beberapa pihak kelompok pribumi seperti orang Minang, Aceh dan Mandailing yang sejak semula telah berusaha untuk menerobos kelapisan perdagangan papan atas. Tetapi setelah kemerdekaan selalu kandas oleh politik dan birokrasi pemerintah RI.

Tahun 1955-an di kota Medan umpamanya, telah berdiri beberapa bank orang pribumi, seperti Bank of Sumatra (kepunyaanorangAceh),tetapibankiniterpaksatutup dengan beberapa toko Aceh Kongsi di jalan Kesawan. Sampai tahun 1970 masih ada empat grosir tekstil dipajak ikan lama, sekarang tidak ada satupun lagiyang bertahan. Pemerintah RI dengan birokrasinya memangcendrungkorup,ternyatalebihsenang meneruskan kebijakan pemerintah kolonial dantidakmemberipeluangkepadapribumi. Situasisepertiiniterjadipadakota-kotabesar seperti Jakarta, Surabaya, Medan, Bandung dan Makassar. Karena itu memang benar setiap kerusuhan etnis dan ras di kota-kota tersebut etnis China menjadi sasaran (victim), karena mereka tetap berfungsi sebagai penyangga. Siapa lagi yang berfungsi sebagai kelompok penyangga? Setelah kemerdekaan, terutamapadamasaOrdeBaru,pemerintah Soehartomelakukanpolitik devideandruled terhadap beberapa kelompok etnik yang dianggapnya sebagai “kawan” untuk dijadikanbuffer(kelompokpenyangga)—dalam menghadapi kelompok etnik yang dianggapnya sebagai “musuh.” Seperti (1) Pengiriman Trans Jawa ke Aceh yang dilihat orang Aceh, bukan sebagai komplimenter (pelengkap) untuk membangun pertanian padi sawah, tetapi sebagai kompetitor (pesaing) dari akupasi utama dan menyangkut harga diri mereka sebagai petani padi sawah turun menurun. Pada waktu pemerintahan Soehartomendekatikeruntuhantansmigran Jawa diusir dari Aceh dalam keadaan menyedihkan. Hampir 30 ribu pengungsi trans Jawa harus ditampung di Sumatra Utara. Banyak di antara mereka yang jadi korban amukan orang Aceh (lihat Pelly 2000). (2) OrangTionghoa di Kalimantan Barat telah menganggap diri mereka sebagai pribumi seperti Melayu dan Dayak. Karena itu pemerintah pusat memilih Madura sebagai buffer, agar tanah, hutan dan kekayaan tambang Kalimantan Barat dapat diekploitasi oleh orang Jakarta menurut semaunya. Kekayaan alam Kalimantan Barat telahdikapling-kapling,sedanguntukmenghadapi penduduk pribumi, orang Madura yang dihandalkan. Berdasarkan catatan di Sanggaledo saja, dalam kerusuhan antar etnis ini sekitar 1.500 Madura terbunuh, 5.000 KK mengungsi ke kota Sambas. Pada waktu kami melakukan penelitian di daerah Dagunang (pedalaman Kalbar) mengenai keserasian sosial antar transmigran (1985) kami mendapati keserasian terjalin baik antara orang Jawa, Sunda dan Dayak, tetapi tidak dengan Madura. (3) Kelompok etnik BBM (Bugis, Buton dan Makassar) dan orang-orang Muslim Maluku dijadikan penyangga (buffer) untuk menghadapi orang-orang Kristen Maluku (pemerintah pusat tidak menyukai orang MalukuKristenkarenabanyakterlibatdalam RMS(RepublikMalukuSelatan).Padawaktu pertarungan terjadi, pemerintah harus membantu pengungsian hampir 11 ribu orang BBM kembali ke kampungnya, sehingga tinggal orang Maluku Islam dan Kristen yang melanjutkan pertarungan.

(4) Di NTB muncul perseteruan antara orangBalidanSumbawa(1958-1960).Orang Sumbawa yang dianggap pemerintah penganut Islam fanatik (ekstrim) tidak disuka. Karena itu orang Bali kemudian menguasai birokrasi pemerintahan (tidak hanya Bupati dan Camat, tetapi sampai Saptam pun didatangkan dari Bali). Tiga hari pertarungan puncak yang sengit terjadi. Semua hotel restoran dan rumah-rumah orang Bali dibakar oleh orang Sumbawa, sehingga hampir semua orang Bali yang ada di wilayah Sumbawa terpaksa dipulangkan ke Bali. (5) Di Dilli ibu kota TimorTimur waktu masih masih dalam kekuasaan republik, suatu ketika mengalami huru hara, bermula dari pusat pasar kota itu. Kerusahan etnis antara orang Bugis-Makassar dan orangTimor ini menjalar sampai ke kota-kota kabupaten (1985). Orang-orang Bugis-Makassar sejak pendudukan republik telah mengambilalih perdagangan dan bisnis di daerah itu.Pemerintahpusatmendukungkedudukan orang Bugis-Makassar, bahkan mengucurkan dana untuk pembangunan fasilitas perumahan dan pendirian masjid. OrangorangTimor (Katholik) tergeser dan hampirhampir menjadi penonton. Keberpihakan TNI dan birokarsi RI itu sangat menyakitkan hati orangTimor sebagai penduduk asli dan yangsemulasangatmengharapkankeadilan dan perlindungan dari pemerintah RI. Kerusuhanetnisinitidakayallagiberdampak buruk pada plebisit rakyat Timtim (dalam pengawasan PBB pada masa pemerintahan Habibie)—untuk menentukan apakah rakyat Timtim bergabung dengan RI atau merdeka sendiri. Tetapi kesalahan ini telah dibayar mahal Timtim lepas dari RI. Siapa yang menjadi sasaran kerusuhan itu? Kelima kelompok etnik dan agama dalamkerusuhandiatasbukankelompoketnis Tionghoa, tetapi mereka bernasib seperti China dalam kerusuhan etnis-ras di kotakota besar seperti Medan, Jakarta, Surabaya, Bandung dan Makasar. Seperti kelompok Tionghoa, kelima kelompok etnis itu samasama menyandang tugas sebagai kelompok buffer (penyangga) untuk kepentingan kelompoknya dan pemerintah pusat, tetapi merugikan kelompok etnik pribumi setempat. Peran konyol pemerintah pusat yang melakukan divide and ruled terhadap kelompok-kelompok etnis dan agama di Indonesia—walaupun politik itu berasal dari kolonial yang telah mengakibatkan stigma (cacat) sosial terhadap terminologi“China.” Sebab itu dapat dimengerti apabila kelompok ini ingin memakai nama lain, yaitu etnis Tionghoa, ketimbang China. Tetapi siapa yang bernasib seperti China dalam setiap kerusuhan etnis-ras dan agama di Indonesia tidak hanya monopoli orang Tionghoa— juga kelima kelompok etnis dalam peristiwa di atas. Sejarah telah mengajar kita, memang seharusnya pemerintah memiliki kebijakan baru dalam mengelola pluralitas bangsa dalam negara ini tidak hanya menghandalkan politik kolonial divided and ruled” (pecah belah dan kuasai). Semoga! Penulis adalah Antropolog Unimed

Hari Kesaktian Pancasila Oleh Muhammad TWH

Aidit: PancasilaTidakDiperlukan Penyusupan yang dilakukan PKI ke dalam berbagai lembaga dan organisasi, termasukPWIdan Kantor Berita Antara. Penyusupan itu untuk meratakan jalan mencapai tujuan mereka menggantikan Pancasila dengan idiologi komunis. Maksud ini disadari benar oleh dedengkot Pers Adam Malik, BM Diah dan lain-lain.Tokoh ini mengerakkan pers Pancasila seluruh Indonesia untuk melakukan perlawanan terhadap PKI. Maksud PKI menggantikan Pancasila jelas dari ucapan D.N.Aidit di depan peserta Kursus Kadar Revolusi tanggal 16 Oktober 1964 di Jakarta mengatakan sebagai berikut : “KalaukitasudahbersatuPancasilatidak diperlukan, sebab Pancasila adalah alat pemersatu. Pancasila sebagai falsafah persatuan, tetapi masing-masing golongan sudah mempunyai paham sendiri”. Hal ini dapat dibaca dalam buku“Perlawanan Pers Indonesia (BPS) terhadap Gerakan PKI” buku ini ditulis olehTribuana Said dan D.S. Moeljanto.

sokoguru revolusi”.Wakil Perdana Menteri I Subandrio menyatakan: “Dalam tahun 1965 mungkin akan terjadi kawan seperjuangan menjadi lawan”. Keterangan Subandrio pada hari lain mengatakan:“Bulanbulan mendatang ini tanah air dalam keadaan genting”. Sementara itu tokoh PKI Anwar Sanusi mengatakan“Situasi Ibukota Pertiwi dalam keadaan hamil tua”. Di samping itu PKI dan antek-anteknya menuntut agar dibentuk Angkatan KeV di samping angkatan bersenjata yang telah ada. Dalam hal ini menteri Pangab A.Yani mengatakan: “Membentuk Departemen Angkatan ke V tidak effisien”. Gerakan 30 September hampir sama dengan peristiwa Madiun yang digerakkan PKI Muso 18 September 1948. Gerakan 30 September/ PKI didahului penculikan dan pembunuhan. Melalui RRI Jakarta, yang mereka sebut Gerakan 30 September mengumumkan terbentuknya“Dewan Revolusi Indonesia”yang merupakan kekuasaan tertingginegaraRepublikIndonesia.Dengan sendirinya Kabinet Dwikora demosioner dan MPRS dianggap tidak ada. Pangkat semua jenderal diturunkan,pangkattertinggiLetnan Kolonel. Peristiwa Madiun 18 September 1948 digerakkan PKI Mosodenganpasukan Front Demokrasi Rakyat, Tentara LautIndonesia melakukan pembunuhan kejam terhadappejabatpemerinah, tokoh masyarakat dan rakyat yang anti PKI. PKI Muso mengangkat Kolonel Djokosuyono sebagai Gubernur Militer Madiun. PKI Muso merebut studio dan pemancar “Gelora Pemuda” Madiun memroklamasikan“NegaraSovyetRepublik Indonesia” dan menaikkan bendera merah. Pemberontakan Madiun dalam waktu yang relatif singkat berhasil ditumpas angkatan darat. Tokoh-tokoh penggerak peristiwa itu ditembak mati dalam operasi militer. Menurut buku “Penyusupan PKI kedalamMediaMasaIndonesia1948-1955” pentolan PKI yang melarikan diri ke luar negeri adalah Abdul Majid, Alimin, Ngadiman, Aidit, Nyoto, Lim Tan Djie dan Sumarsono. Namun tindakan secara hukum tidak sempat dilakukan terhadap tokoh PKI, karena tanggal 19 September 1948 Belanda melancarkan Agresinya kedua.

Aba-aba PKI Akan Berontak Surat kabar dan kantor berita yang disusupi PKI memberitakan: “PKI usulkan 15 Juta masa buruh Tani Dipersenjatai”. Berita lain yang berbunyi “Latih dan persenjatai

Penutup Peristiwa G.30 S. PKI adalah peristiwa besar, peristiwa nasional yang merupakan noda hitam dalam sejarah perjalanan bangsa.Tapi orang menganggap peristiwa kecil,

Bangsa Indonesia pernah mengalami malapetaka nasional coup berdarah bertujuan menggantikan Pancasila dengan idiologi komunis.Berkat pertolonganTuhanYME maksud tersebut dapat digagalkan.


emperingati Hari Kesaktian Pancasila berarti mengingat kebesaran Tuhan YME. Berkat pertolonganNya bangsa Indonesia selamat dari malapetaka yang dilancarkan Gerakan 30 September/ PKI. Gerakan ini melakukan coup berdarah, membunuh enam jenderal, putera terbaik bangsa, membentuk Dewan Revolusi Indonesia dan mendemisionirkan Kabinet Dwikora. Gerakan 30 September adalah peristiwa besar peristiwa nasional, tetapi sementara orangyangtidakmengerti,ataumerekayang bersimpati terhadap gerakan itu dianggap peristiwa kecil, peristiwa internal Angkatan Darat. Alangkah naifnya dan kelirunya anggapan tersebut. Gerakan 30 September adalah peristiwa besar apalagi gerakan itu melakukancoupberdarahpula.Apayangmereka lakukantidakbisaberdirisendiripadawaktu kejadian kalau tidak ada proloognya. Proloognya adalah persiapan di bidang politik, sosial dan militer. Gerakan 30 September dilakukan oknummiliter,pemberontakanMadiuntahun 1948jugadilakukanoknummiliter.Buktinya KolonelDjokosuyonodiangkatmenjadiGubernurMiliterMadiunolehpemimpinpemberontak PKI Muso. Sudah menjadi program PKI untuk menyusupkan kadernya ke dalam ABRI khususnya Angkatan Darat karena Angkatan Darat merupakan alat revolusi 1945. Mengenai anggapan peristiwa besar itu adalah peristiwa interbal AD, adalah untuk mengecilkan peristiwa besar. Padahal dilihat dari segi manapun peristiwa itu peristiwa nasional. Pihak AD jauh-jauh hari telah membantah bila ada orang atau golongan yang menganggap peristiwa G.30 S. PKI adalah peristiwa intrnal AD, itu adalah usaha untuk memutar balik fakta dan mengaburkan persoalan dari kejadian sebenarnya. Penyusupan Ke Media Massa Siasat dan ofensif PKI di Indonesia ditingkatkan sejak tahun 1963. PKI melakukan perjuangan gerilya di desa-desa. Aksi revolusioner di kota-kota dan meningkatkan penyusupan ke dalam angkatan bersenjata. Penyusupan yang mereka lakukan bukan saja ke dalam tubuh ABRI, tapi penyusupan ke dalam tubuh partai politik, ke dalam tubuh pers dan lain-lain. Partai Nasional Indonesia yang dipimpin Ali Sastroamijoyo pernahdisusupitokohPKISurakhman,yang sempat bertengger sebagai sekretaris jen-

deral. Setelah diketahui Surakhman tokoh PKIdiamelarikandirikeJawaTengahkemudian dia ditembak mati oleh ABRI dalam operasi di tempat persembunyiannya. Bicara mengenai penyusupan PKI ke dalam pers Indonesia sudah terjadi sejak tahun 1948. Khusus penyusupan ini Drs SumonoMustofadanMuhammadChudari telahmenyusunsatubukuberjudul“Penyusupan PKI ke Dalam Media Massa Indonesia 1948-1965”. Buku ini tebalnya sekitar 400halamanditerbitkanKoperasiKaryawan Pers Adidaya Jakarta.Kebetulan dalam buku tersebut, kami turut menyumbang tulisan berjudul“Penyusupan PKI dan Perlawanan Media Massa Terhadap Dominasi PKI di Sumatera Utara”.

karena insiden dalam tubuh angkatan darat. Padahal untuk melakukan gerakan itu telah dipersiapkanbertahun-tahun,baikdibidang sosial politik maupun penyusupan ke dalam angkatan darat. PeristiwaMadiun(PKI/Muso),PKImencoba ”mencuri tangan” menerbitkan buku putih tahun 1953.Tahun itu juga buku putih PKI itu ditarik oleh Kejaksaan. Dalam buku itu PKI mengatakan peristiwa itu bukan keinginan PKI.Tapi kenyataannya PKI yang melakukan gerakan, didahului pembunuhan, pentolan PKI/Muso memproklamirkan “Negara Sovyet Republik Indonesia”, melalui radio“Gelora Pemuda”. PKI menaikkan benderamerah,kemudianmengangkatKolonel DjokosuyonomenjadiGubernurMiliterMadiun. Allah Mahatahu, maksud jahat dari kedua peristiwa tersebut. Berkat rahmat dan pertolonganNya,maksudPKImenggantikan Dasar Negara Pancasila berhasil digagalkan. Penulis adalah Veteran Perjuangan Kemerdekaan,Wartawan Senior Pemerhati Sejarah.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang di-kirim adalah karya orisinil, belum/tidak diterbitkan di Media mana-pun.Tulisan menjadi milik Was-pada dan isi tulisan menjadi tanggung-jawab penulis.

SUDUT BATUAH * Profesionalisme dan kualitas PLN diragukan - Makanya lampu sering padam * Jangan pilih presiden berdasarkan popularitas - Popularitas belum tentu berkualitas * Pemerintah kendalikan pemakaian BBM 2014 - Mulai dijatah kayaknya?


D Wak


WASPADA Senin 30 September 2013


Tuan Rumah KTT APEC Uang Komite Sekolah Uang komite di sekolah negeri sangat meresahkan. Semua biaya operasional sekolah dibebankan kepada siswa. Sekolah negeri nyaris seperti sekolah swasta. Bahkan ada beberapa sekolah negeri favorit yang jumlah uang komitenya lebih besar dari sekolah sewasta. Besarnya meningkat tajam setiap tahun ajaran. Padahal pemerintah akan meluncurkan wajib belajar 12 tahun, membebaskan uang komite sampai SMA, tapi tak ada realisasinya. Ketika keberatan kenaikan uang komite ini kita pertanyakan, sang kepala sekolah seolah lepas tangan. ”Kenaikan itu keputusan komite, jadi tanyakan saja dengan komite,” demikian pernyataan kepala sekolah buang badan. Padahal komite membuat kenaikan atas persetujuan kepala sekolah. Sepertinya ada main mata antara komite dengan kepsek?! Sekolah negeri adalah sekolah yang biaya oprasionalnya di tanggung negara. Dari mulai gedung, sampai gaji gurunya. Namun dengan berbagai alasan , komite sekolah memungut biaya tambahan. Katanya sekedar buat beli kapur, beli buku absen. Tetapi kenyataannya buat beli seragam guru, beli cat, asbes, kamar mandi, meja kursi, televisi, dan masih teramat banyak untuk disebutkan satu persatu. Ssst... bahkan sebagian digunakan buat tunjangan guru negeri. Jika biaya tambahan ini buat membeli yang kecil, hal ini mungkin dapat dimaklumi. Tapi jika buat membangun pagar sekolah, membangun WC, bahkan membangun ruang kelas lantai tiga, sangatlah memberatkan. Salah seorang wali murid yang keberatan justru dipersalahkan, ”Kenapa bapak tak datang rapat kenaikan uang komite..? Demikian ujar wakil kepala sekolah. Sang orang miskin menjawab pelan, ”Pernah kita datang rapat komite, tapi kita selalu kalah suara dengan pengurus komite yang notabene pejabat!” Karena nyaris semua pengurus komite adalah pejabat kaya raya. Dari mulai polisi, kepala dinas instansi, BUMN sampai anggota DPR. Mereka, yang notabene orang hebat ini tak dapat memahami penderitaan kaum miskin. Sehingga hasil keputusan rapat bernuansa ekskutif. Persepsi besaran sangat berbeda. Artinya, jika si miskin merasa sangat besar uang komite tiga ratus ribu perbulan. Tentu jumlah ini sangat kecil dimata sang pejabat. Uang sebesar itu diperoleh kaum miskin dengan keringat dan air mata. Tetapi orang kaya memperolehnya hanya dengan kedipan mata. Menyikapi penderitaan kaum miskin ini maka Dinas Pendidikan Peropinsi Sumatera Utara harus membuat batasan besaran uang komite sekolah negeri. Jangan menciptakan kasta di dunia pendidikan. Buatkan aturan batasan aspek yang boleh dilakukan, tentukan item yang boleh dibangun. Jangan memungut uang buat pembangunan gedung sekolah lantai lima. Karena biayanya terlalu berat. Pokoknya harus ada campur tangan Kementerian Pendidikan menatanya. Selanjutnya pemerintah meninjau kembali pelaksanaan wajib belajar sembilan tahun. Sejauh mana menyentuh kaum miskin? Program ini sudah sepuluh tahun lebih berjalan, tetapi masih belum sepenuhnya terlaksana. Paling hanya sampai SD, selanjutnya buat SMP terjadi penyimpangan dan penyalahgunaan. Akibatnya wajib belajar sembilan tahun hanya slogan semata. Kaum miskin masih kepayahan tamat SMP. ”Kami tak sekolah karena kami miskin,” demikian ujar mereka kesal. Tolong kembalikan wajib belajar sembilan tahun sepenuhnya. Jangan hanya SD yang gratis. Tapi SMP juga bebas uang komite. Tak perlu lagi pakai surat keterangan miskin. Karena semua siswa, kaya miskin gratis uang komite. Bila perlu segera luncurkan wajib belajar dua belas tahun. Tak pakai bayar sampai tamat SMA. Agar si miskin cerdas, pintar mengejar perbedaan, keluar dari kemiskinan. Karena dari sepuluh orang kaya, delapan di antaranya melalui pendidikan. Nada Sukri Pane Hamparanperak


Dedi Sahputra

Oleh Shohibul Anshor Siregar Sukses sebagai tuan rumah sebuah even memanglah satu hal. Tetapi apa substansinya untuk Indonesia?


anggal 5-7 Oktober 2013, di Bali, akan diselenggarakan KTT APEC dengan mengusung sebuah tema yang cukup obsesional dan sama sekali tak mengejutkan, yakni Resilient Asia-Pacific, Engine of Global Growth. Disebut tak mengejutkan karena memang kerap diumbar para pemimpin pemerintahan dunia sambil berteriak keadilan dalam kemajuan bersama yang sangat tak mungkin. Tiga agenda utamanya ialah Bogor goals (perluasan perdagangan dan investasi, serta reformasi struktural), sustainable growth with equity (daya saing global sektor UKM, financial inclusion, ketahanan pangan dan kesehatan), dan promoting connectivity (isu konektivitas fisik termasuk pengembangan dan investasi infrastruktur dan konektivitas kelautan atau blue economy). Dengan begitu, ada 3 even internasional yang melibatkan banyak negara di Indonesia pada waktu berdekatan dalam bulan September dan Oktober. Even pertama ialah ajang Miss Wolrd yang meski kontroversial, tetapi oleh Hary Tanoesudibyo disebut begitu penting. Pandangannya tak hanya dari aspek jumlah wakil berbagai negara yang hadir sebagai kontestan, tetapi juga penggambaran econonomical benefits termasuk kesempatan promosi luas Indonesia di mata dunia. Memang agak mengarang, karena sebelum bernama resmi Indonesia pun, tempat berjulukan nusantara ini sudah entah siapa-siapa saja dan dari mana saja orang datang ke sini—akhirnya mengeksploitasi dengan berbagai cara— termasuk dengan menjajah seperti Belanda itu. Miss World tak menyumbang untuk popularitas Indonesia, hanya menambah keterangan baru bahwa sebuah dominasi pemikiran yang menolak pamer aurat telah dijungkirbalikkan di sini. Saya kira itu sebuah catatan Indonesia untuk Hary Tanoesoedibyo yang sudah resmi dinobatkan sebagai calon wakil presiden dari partainya (bersama Capres Wiranto). Kedua, even olah raga antar negara organisasi kerjasama Negara Islam yang dibuka oleh Presiden SBY di Jaka Baring, Palembang, pekan lalu. Dalam even

ini 47 dari 57 negara anggota mengirimkan delegasi atau atlitnya untuk unjuk kebolehan. Dari sana Presiden SBY memberi pesan perdamaian kepada dunia. Amat menarik bahwa Islam memanglah sebuah agama dan mungkin sedang dianggap inferior dan malah dikesankan berlumur darah dengan agresivitasnya yang barbar (di dunia Barat) dan sedang diupayakan untuk disingkirkan di “homelandnya” sendiri seperti Indonesia. Islam yang disekulerkan itu tentu amatlah tak masuk akal jika berbicara tentang urusan-urusan profan seperti olah raga, apalagi politik. Pada saat bersamaan Indonesia berjuang memeroleh gelar kejuaraan dalam sebuah title kejuaraan yang tak begitu mendunia dalam sepakbola. Konon 22 tahun berharap untuk itu, dan barulah tercapai bersamaan waktu dengan pembukaan even olah raga di Jaka Baring, Palembang. Menurut berbagai sumber even ketiga (KTT APEC ke-21) sejak dini sudah mendapatkan kepastian kehadiran 11 kepala negara dan 1.200 CEO dari perusahaan besar dunia. Akan diliput oleh 2 ribuan jurnalis, even ini pun disebut akan diamankan belasan ribu aparat keamanan (sebagian menyebut 11 ribuan, sebagian lagi menyebut 14 ribuan). Presiden SBY pun dikabarkan sudah meninjau persiapan, dan menyatakan kepuasannya. Media mainstream kelihatannya memang lebih memilih tendensi pemberitaan dengan pojok-sorot ketuan-rumahan Indonesia—dengan sedikit halaman dan ruang disediakan untuk ajuan pikiran-pikiran kritis yang mempertanyakan manfaat. Ada ko-insidensi even Miss Wolrd dan KTT APEC di tempat yang sama. Tetapi bayangkanlah sejumlah wanita yang diklaim tercantik di dunia hadir di sini, dengan “penyakit” eksibisionis (kesukaan memamerkan kelebihan atraktif hedonis bagian-bagian tubuh kewanitaan), kemudian disusul para pria paling tangguh di dunia, termasuk Presiden Amerika Serikat Barrack Obama dan para kepala negara lainnya serta para pebisnis kaliber internasional. Rasanya tak mungkin ko-eksidensi ini tak diperhitungkan.

Sukses sebagai tuan rumah sebuah even memanglah satu hal. Tetapi apa substansinya untuk Indonesia? Beberapa bulan lalu, ketika menjadi narasumber pada sebuah forum di Medan, seorang diplomat karir menunjuk diplomasi substantif sebagai salah satu masalah Indonesia sembari menyesalkan apa arti sekadar menjadi tuan rumah untuk sejumlah pertemuan berkaliber internasional. Menukik pada makna substantif KTT APEC setidaknya hasil diskusi panel Kementerian Perdagangan dan ISEI menunjukkan sejumlah hal yang patut dijadikan perhatian penting—dan itu semua kelihatan sangat menggamangkan berhubung posisi subjektif dan objektif yang sangat tak menguntungkan. Forum itu mengetengahkan bahwa, pertama, Indonesia perlu membuat peta isu-isu prioritas dengan mengukur untung dan ruginya; kedua, melakukan kolaborasi intensif dengan pengusaha; ketiga, melaksanakan peran think thank dan membangun sinergitas yang komprehentsif; keempat, perlunya langkah-langkah strategis yang mengede-

pankan kepentingan nasional; dan kelima, perlunya kerjasama lebih kuat para pemangku kepentingan untuk memanfaatkan kerjasama APEC. Dalam ungkapan lain, kelima rekomendasi itu adalah jeritan panjang dalamketakberdayaan.Memangadayang secaraoptimistikmenyebutkanKTTAPEC ke-21 di Indonesia dapat sebagai momentum kebangkitan politik luar negeri bebas aktif yang digagas oleh Soetan Sjahrir itu. Tetapi pertanyaannya adalah modalitas apa untuk membayangkan itu dalam lalulintas perhubungan antar negara yang sedemikian kejam? Instrumen dunia untuk menopang liberalisasi yang dahsyat adalah kepentingan para pemodal dan penguasa perdagangan dan teknologi yang sangat tangguh. Sisi-sisi yang amat mencemaskan sudah lahir sejak semula, sepertiWashington Concensusyang rinciannya bisa ditemukan pada berbagai instrumen ikutan lainnya. Penulis adalah Dosen FISIP UMSU, Koordinator Umum Pengembangan Basis Sosial Inisiatif & Swadaya (‘nBASIS).

Ketika Gatot “Menyetrum” PLN

Rem Pulang mengantar anak sekolah kemarin, sepedamotor saya tergelincir. Menghindari mobil di depan yang melintang itu saya tepaksa mengerem mendadak. Rem yang tak bekerja maksimal itu membuat roda depan tak berhenti sempurna hingga sayapun jatuh terjerembab. Beberapa bagian tubuh saya luka lecet. Tapi saya tetap bersyukur untuk beberapa hal. Saya bersyukur karena peristiwa itu terjadi ketika anak-anak sudah diantar ke sekolahnya, saya bersyukur karena ketika terjatuh di tengah arus lalu lintas yang deras itu tidak ada kendaraan lain yang ‘menyambar’ saya. Dan saya juga bersyukur karena rem itu masih bekerja walau tidak sempurna. Begitulah keadilan sebuah peristiwa. Semenderita apapun engkau dibuatnya, akan selalu ada faktor yang mesti disyukuri. Keadilan dan ketidakadilan itu datang dari persepsi, bukan dari setiap objek peristiwa yang datang padamu. Malcom X, mungkin menyadari ini ketika dia mengatakan; tak seorang pun dapat memberikan keadilan. Jika Anda seorang pria, Anda membawanya dalam diri Anda. Tapi.., maafkan saya. Bukan soal adil ini yang hendak saya bicarakan, tapi soal rem. Ya, soal rem. *** Watak rem itu menghentikan atau memperlambat.Tanpanya, kecepatan akan menjadi malapetaka; menghantam apapun di depannya. Dan sejatinya sifat rem itu ada di setiap sesuatu, di kendaraan yang melaju, di lidah yang berkatakata, di sikap yang progresif, di keinginan yang menggunung, dan di syahwat yang menggeliat. Tak terkirakan akibat rem yang tak berfungsi itu. Engkau bisa dibenci banyak orang, menimbulkan masalah besar, bahkan bisa sampai membunuh dan terbunuh.Tapi selalu ada jenis kata-kata yang diucapkan tanpa rem. Prof JE.Sahetapy misalnya—orang yang selalu jadi “bintang” dalam acara dialog di sebuah stasiun televisi. Dia adalah seorang yang paling ditunggu kata-katanya. Tapi setiap kalimat yang diucapkannya nyaris tanpa rem. Dia pernah bilang—beberapa kali bahkan—bahwa SBY harus mengganti Jenderal Timur Pradopo dari jabatan Kapolri. Dia juga tanpa segan bicara miring tentang institusi Polri,“Selama 80 tahun saya hidup, rasanya belum pernah mendengar polisi yang bicara jujur,” katanya di hadapan tatapan mata jutaan penonton di seluruh Indonesia. Kepada sesama peserta dialog dia juga tidak tabu bicara lantang: “Ruhut (Sitpompul) itu mulutnya bau busuk,” katanya. Bukan

cuma di acara ini saja dia berkata seperti itu. Ketika menguji calon hakim, seorang calon dari Gorontalo mengaku sebagai salah seorang muridnya. Bukan keramahan yang diterimanya, malah disemprot kata-kata tajam: “Ya, memang. Tapi saya malu punya murid seperti Anda, karena menjawab pertanyaan apakah pernah masuk Parpol, tidak mengaku. Ternyata dalam CV, Anda pernah aktif di Golkar.” Orang-orang yang menjadi sasaran katakata Prof Sahetapy bukanlah orang sembarang. Mereka punya power bahkan ditakuti karena kekuasaan yang digenggaman. Tapi itu tak mengurangi daya hantam kata-kata sang professor kepada mereka. Ironisnya, mereka yang dihantam itu cuma bisa diam sambil mesem-mesem. Nyata-nyata rem lidah orang tua ini tak berfungsi. Tapi kenyataan lain bahwa sampai saat ini dia tidak saja masih selamat berdiri bahkan dihormati dan disegani. Maka kalau pengemudi, dia pasti sekelas Toretto dalam sekuel The Fast and the Furious. *** Dari mana datangnya rasa hormat dan segan terhadap Prof Sahetapy itu? Dari usia yang sudah tua? Dari kebenaran yang terkandung dalam kata-katanya? Atau dari backing yang “pasang badan” di belakangnya? Kalau soal tua saya kira bangsa ini belum sampai pada pemakluman itu. Coba bayangkan kalau Eyang Subur yang bicara seperti sang professor. Bahkan Amien Rais, tokoh yang punya andil untuk negeri ini yang bicara tentang Jokowi malah dihujat tak karuan. Dan kalau karena kandungan kebenaran, saya justru merasa miris. Karena berapa banyak orang yang bicara kebenaran malah harus menanggung derita. Ucapan yang benar itu malah sering membawa pengucapnya berhadapan dengan hujatan, ancaman, permusuhan, bahkan pembunuhan. Amien Rais tentang Jokowi juga salah satu contohnya. Saya menduga karena konsistensi dan presisi ucapan yang jadi alasannya. Bicara benar saja tidak cukup kalau engkau tidak presisi. Dan ketika presisi, engkau konsisten sampai ke ujung, itulah integritas. Maka ketika Prof Sahetapy berujar, konsistensi itu menampilkan seluruh hidupnya, dan presisi itu menghadirkan pengakuan siapa saja. Konsistensi dalam presisi, adalah dua perangkat yang membuat alam raya menjadi backing-mu. Dengan keduanya engkau akan survive meski tanpa rem.(Vol.451, 30/ 9/2013)

Kolom foliopini dapat juga diakses melalui

Oleh Muhammad Hidayat, SSos, MA “Setrum” Gubsu menjadikan krisis listrik kita jadi perhatian pusat, meski harus diakui penanganan pusat belum maksimal.


ini listrik padam 2 kali sehari, bahkan bisa lebih. Bukan cuma sumpah serapah, masyarakat berulang kali berdemo ke PLN. Bahkan di beberapa tempat, demo itu diakhiri pembakaran fasilitas PLN. Selintas tindakan warga ini bisa dipersalahkan, tetapi di satu sisi, harus diakui itu ekses dari kelakuan PLN sendiri. PLN seperti menutup mata dengan krisis listrik yang terjadi di Sumatera Utara. Awal krisis setrum pertama melanda Sumut pada 2002 lalu. Waktu itu, PT Perusahaan Listrik Negara (PLN) Sumut hanya mampu menyuplai 761 megawatt (MW). Padahal, kebutuhan yang diperlukan masyarakat Sumut dan Aceh di atas 800 MW. PLN harus melakukan pemadaman bergilir. Menurut Pelaksana Harian General Manager Pembangkit dan Penyalur Sumatra Bagian Utara, Sugiartho, krisis listrik selain dipicu kurangnya pembangkit di Sumut, akibat salah satu gas turbin (GT) 21 yang berkapasitas 200 MW sedang turun mesin, sehingga butuh waktu perbaikan sekitar tiga bulan. Di samping turun mesin, salah satu mesin gas turbin, pada Jumat (23/8/ 2002) pipa kondensor PLTU blok satu juga mengalami kebocoran. Akibatnya, PLN mengalami defisit listrik hingga 150 MW. Waktu itu, PLN berjanji mengatasi krisis listrik dengan membangun berbagai pembangkit. Beberapa pembangkit yang dibangun antara lain PLTA Renun yang berkapasitas 80 MW, PLTU Sibolga 100 MW, dan PLTA Sipansihaporas 17 MW. Semua proyek yang total kapasitasnya sekita 200 MW itu diperkirakan selesai tahun 2005. Proyek-proyek ini pun disambut baik warga Sumut yang ingin segera bebas byar pet. Orang di provinsi ini berpikir listrik akan terus menyala. Tapi faktanya tak seindah beritanya. Kondisi ini bagai pepatah orang Melayu, indah kabar dari rupa. Cerita pembangkit baru itu tak jelas juntrunganya. Puncaknya, tahun 2013. Kalau dulu pemadaman hanya sehari sekali. Tapi di tahun 2013 ini pemadaman bisa terjadi lebih dari sekali. Mirip minum obat kata orang-orang. Alasan lama pun kembali terlontar. Mesin pembangkit sudah tua dan butuh perawatan, PLN harus melakukan overhaul dan sebagainya—alasan yang benar-benar membuat orang jengkel. Bagaimana tidak, PLN sebenarnya punya banyak waktu. Dari mulai krisis listrik tahun 2002 hingga 2013 ini, PLN punya waktu 10 tahun. Waktu sepanjang ini, seharusnya dimanfaatkan membangun pembangkit baru yang mampu mencukupi kebutuhan listrik di Sumut.

Ketika cerita ini berulang, Gubernur Sumut juga terkena imbasnya. Orang menilai gubernur tidak peka kondisi rakyatnya. Sepuluh tahun sudah krisis listrik melanda Sumatera Utara, tetapi gubernur nampaknya hanya berdiam diri. Kini, telunjuk rakyat Sumut mengarah kepada Gatot Pujo Nugroho. Sebagai gubernur, masyarakat Sumut punya harapan sangat besar agar Gatot mampu menuntaskan krisis listrik ini. Beban yang sebetulnya sangat berat, bahkan menteri-menteri di republik ini juga belum sanggup menuntaskannya. Buktinya, selain Sumut krisis listrik juga menimpa Aceh, Riau, hingga Kalimantan. Seorang kepala daerah memang dituntut menyediakan infrastruktur yang dibutuhkan masyarakat. Semua paham, listrik sarana vital bagai suatu daerah. Investor pasti akan bertanya ketersediaan energi ketika akan berinvestasi. Jika ketersediaan listrik tidak mampu memenuhi kebutuhan perusahaannya, tidak bisa dibujuk-bujuk, investor pasti akan hengkang. Cerita ini juga sudah menjadi berita biasa. Banyak investor yang keluar dari Sumut, gara-gara listrik tidak bisa menggerakkan mesin-mesin produksi mereka. Mendengar cerita ini, investor yang baru menjejakkan kaki di Sumut, langsung angkat kaki tanpa basabasi lagi. Di tengah pengharapan yang begitu tinggi, jadi sangat menarik menguntit langkah-langkah Gatot mengatasi krisis listrik ini. Apa yang sudah dilakukannya? Tidak adil juga jika belum apa-apa sudah memvonis. Padahal dari media juga nampak Gatot tidak tinggal diam. Sebagai kepala daerah yang baru, masyarakat sudah pasti menunggu implementasi dari janji yang diucapkannya semasa kampanye dulu. Lewat pemberitaan di media massa, saya menyimak banyak upaya dilakukan Gatot mengatasi krisis listrik di Sumut. Dalam berbagai even, Gatot selalu mengajak semua elemen Sumut bersatu mengatasi krisis listrik. Jangan bertindak anarkis meski kepala sudah puyeng dan emosi dibuat PLN. Himbauan yang pas, karenadalamsepekanterakhirwargamulai menyerbu kantor PLN. Dari Sei Rampah sampai Labuhanbatu, dari Te-bingtinggi hingga Salapian. Tak cuma berdemo, tapi juga diwarnai aksi lempar batu. Pada resepsi milad ke-47 Majelis Wilayah KAHMI Sumut, di Hotel Grand Kanaya, Medan, Minggu (22/9) malam Gatot Pujo Nugroho ST MSi kembali menyorotikrisislistrik.Gubsumenegaskan untuk menyelesaikan krisis listrik butuh kerjasamasemuapihak.Didepansejumlah alumni senior HMI seperti AkbarTanjung,

MS Kaban dan senioran HMI Sumut, Gubsu mengungkapkan dirinya terus mendesak PLN untuk menyiapkan solusi jangka panjang bagi kelistrikan di Sumut. Meski PLN berjanji, krisis listrik di Sumut akan berakhir pada pertengahan 2014, namun Gubsu ingin krisis seperti sekarang ini tidak terulang lagi pada 5 atau 7 tahun mendatang. Bukan tanpa sebab, karenakrisis listrik saatini sebenarnyajuga krisis berulang pada 2002 silam. Kalau cuma cuap-cuap begini, pasti semua orang bisa. Semua kepala daerah pasti melakukan hal yang sama, seperti yang dilakukan Gatot. Orang butuh tindakan dan kebijakan, bukan cuma ucapan yang jadibahanberita.Padatitikini,masyarakat Sumut harus jeli dengan kebijakan Gatot mengatasi krisis listrik ini. Cerewet Bertanya Hal pertama yang perlu dipahami semua orang, listrik adalah salah satu urusan nasional. PLN di Sumatera Utara tidak mampu mengatasi persoalan ini sendiri,begitujugakepaladaerah.Seorang gubernur tidak bisa membuat kebijakan dan tindakan menyelesaikan persoalan listrik ini. Sebagian besar kewenangan ini, berada di bawah kendali pemerintah pusat. Dalam kondisi seperti ini, apa langkah yang dibuat Gatot? Salah satu strategi yang dibuat Gatot adalah menjadikan kasus krisis listrik di Sumatera Utara menjadi wacana nasional. Melalui Dewan Energi Nasional (DEN), Gatot mengupayakan Sumatera Utara menjadi daerah krisis energi. Tujuannya apa? Dengan status ini, diharap ada percepatan yang dilakukan pemerintah pusat. Selain itu, Gatot terus berkomunikasi dengan pemerintah pusat dan Dirut PLN. Hal itu diakui Dirut PLN, Nur Pamudji. Menurutnya, dalam setiap kesempatan bertemu, Gatot selalu menanyakan solusi krisis listik di Sumut. Setidaknya ada tiga kali gubernur menanyakan solusi krisis listrik yang menimpa masyarakat Sumut. Terakhir Gubsu menanyakan sekitar sepuluh hari lalu ketika bertemu di Kualanamu. Karena selalu dicereweti seperti itu, Dirut PLN Nur Pamudji langsung datang ke Gubernuran Jl. Sudirman, Medan membahas masalah itu dengan Gatot, Kamis, 5 September lalu. Boleh dibilang, Gubsu sukses “menyetrum” PLN. Apalagi setelah pertemuan dengan DEN, Wakil Presiden Boediono akhirnya bersuara agar Meneg BUMN dan Mentamben turun tangan mengatasi krisis listrik akut di Sumut. “Setrum” Gubsu menjadikan krisis listrik kita jadi perhatian pusat, meski harus diakui penanganan pusat belum maksimal. Kepada Gatot, Nur Pamudji mengungkapkan kondisi pemadaman listrik di Sumut masih akan terus berlanjut hingga akhir Oktober. Menurutnya pemadaman akan berakhir November mendatang, seiring beroperasinya secara penuh mesin pembangkit yang

disewa PLN. Dia menambahkan, persoalan kelistrikan Sumatera Utara baru akan teratasi sepenuhnya setelah beroperasinya pembangkit baru yang sedang dibangun di Sumut dan Aceh. Lalu, apakah persoalan selesai dengan dialog saja? Apa yang dibuat Gatot sebagai gubernur? Kendala yang selalu dihadapi dalam sebuah pembangunan adalah ketersediaan lahan. Hal ini juga menimpa pembangunan pembangkit di Sumut. Gubernur tentu tidak punya lahan. Adalah bupati atau wali kota yang memiliki lahan. Bayangkan, jika bupati atau wali kota tidak menyetujui pembebasan lahan? Pasti, pembangkit tidak akan terbangun. Penutup Lalu bagaimana tindakan gubernur untuk merealisasikannya? Pada titik inilah, seorang gubernur harus memerankan fungsinya sebagai wakil pemerintah pusat di daerah. Sebagai wakil pemerintah pusat di daerah, gubernur memiliki kewenangan mengoordinasikan penyelenggaraan urusan pemerintahan yang menjadi kewenangan kabupaten/kota dan koordinasi pelaksanaan kerjasama antar kabupaten/ kota dalam penyelenggaraan urusan pemerintahan di wilayahnya. Hal ini diatur dalam Peraturan Pemerintah No.19 Tahun 2010. Dalam hal ini, Gatot memainkan perannya dengan baik. Contohnya, distribusi listrik dari PLTU Pangkalan Susu ke Binjai yang terkendala pembebasan lahan. Karena itu, Gubsu meminta Bupati Langkat untuk membantu menyelesaikan masalah lahan di 3 desa di 2 kecamatan di wilayahnya. Saat ini proses distribusi listrik dari PLTU Pangkalan Susu ke Binjai terkendala, karena di 3 desa itu PLN belum bisa mendirikan tower transmisi mereka sebab warga di sana meminta ganti rugi lahan sangat tinggi. Langkah Gatot membantu penyelesaian krisis listrik juga akui Anggota DPD RI asal Sumut Parlindungan Purba. Dalam sebuah wawancara di sebuah stasiun radio di Medan, ketua APINDO Sumut ini mengapresiasisi langkah yang dibuat Gatot. Sebagai wakil pemerintah pusat di daerah, Gatot mencoba mengkoordinasikannya dengan pemerintah kabupaten kota. Selain itu, Gubsu juga terbukti mencari solusi dengan terus berkomunikasi dengan pemerintah pusat, Dewan Energi Nasional dan Dirut PLN sendiri. Akhirnya, semua pihak memang perlu bergandengan. Tak bijak memanfaatkan krisis listrik untuk kepentingan politik (tentu dengan target meraih suara di 2014) sambil meniadakan peran pihak lain. Lebih baik maksimalkan fungsi dan tugas masing-masing untuk bersama menekan pusat memperbaiki kelistrikan Sumut. Penulis adalah Dosen STIKP Medan.



Tolak Rekrut Ulang Komisioner KIP Aceh Timur

LSM Putro Aceh Dukung Pemkab Atim PEUREULAK (Waspada): LSM Putro Aceh yang bernaung di bawah sayap Partai Aceh (PA) siap mendukung program Pemerintah Kabupaten Aceh Timur dalam peningkatan dan pemberdayaan perempuan dari semua bidang. “Karena itu, dukungan Pemda untuk pengembangan LSM Putro Aceh sangat diharapkan,” ungkap Suhaida Yakob, Ketua Umum LSM Putro Aceh Kecamatan Peureulak Barat, Kabupaten Aceh Timur di sela-sela pelaksanaan peusijuk serta prosesi tepung tawar kantor lembaga itu di Gampong Beusa, Minggu (29/9). Menurutnya, program kerja LSM Putro Aceh lebih mengedepankan pada kesejahteraan kaum perempuan dan telah membentuk beberapa kelompok kerja (Pokja) antara lain di bidang keagamaan, keterampilan, pendidikan hukum dan politik. “Seiring perkembangan zaman, maka peningkatan sumber daya manusia sangat penting dirasakan dewasa ini, terlebih untuk mendukung peningkatan perekonomian,” ujarnya. Oleh sebab itu, pihaknya meminta juga kepada Pemerintah Aceh Timur untuk mengikutsertakan LSM Putro Aceh dalam kegiatan – kegiatan yang telah dicanangkan terutama di lingkup PKK Aceh Timur maupun Dekranas. “Terlebih keanggotaan LSM Putro Aceh Peureulak Barat telah mewakili 15 desa di kecamatan ini,” tutur Suhaida. (cri)

Polisi Dalami Kasus Pembunuhan Gadis Bisu IDI (Waspada): Polres Aceh Timur dibantu Polsek Peureulak hingga kini masih mendalami kasus dugaan pembunuhan yang menimpa seorang gadis bisu yang baru berusia 17 tahun di Dusun Suka Jadi, Desa Lubok Pempeng, Kecamatan Peureulak Kota, Aceh Timur Jumat (27/9) lalu. Kepolres Aceh Timur AKBP Muhajir, Minggu (29/9) menjelaskan, gadis bisu tersebut diduga dibunuh, namun pihaknya belum bisa menyimpulkan motif di balik tragedi itu, bahkan keterangan saksi belum mengarahkan pelaku pembunuhan. “Kita akui korban kita duga dibunuh, karena bekas luka terkena benda tumpul di bagian pipi kiri, tapi kasus ini masih kita dalami dan nanti jika sudah mengarah kepada pelaku segera dicari,” kata Muhajir. Sebagaimana diketahui, seorang gadis bisu kelahiran tahun 1996 meninggal dunia dengan dugaan sebelumnya mendapat penganiayaan berat hingga dia tewas. Peristiwa itu terjadi di Dusun Sukajadi, Desa Lubok Pempeng, Kecamatan Peureulak, Aceh Timur, Jumat (27/9) sekira pukul 12:00. Korban bernama Siti Darmayanti Binti Abdul Munir, 17, asal Dusun Sukajadi, Desa Lubok Pempeng, Peureulak. Kini polisi masih menyelidiki kasus dugaan pembunuhan itu. (b24)

Cegah DBD Dengan Lingkungan Bersih LANGSA (Waspada): Salah satu upaya dalam mencegah penyebaran penyakit Demam Berdarah Dengue (DBD) yang disebabkan nyamuk Aides Agepty dengan cara dimulai menciptakan lingkungan rumah yang bersih. Awali dulu kebersihan di rumah kita sendiri sehingga penyebaran penyakit maupun pengembangbiakan nyamuk yang mematikan itu bisa dicegah Demikian kata Wakil Wali Kota Langsa Marzuki Hamid, saat melakukan gotong-royong bersama masyarakat di Gampong Tualang Teungoh, Minggu (29/9). Dikatakan, permasalahan kesehatan yang terjadi di Pemko Langsa adalah tingginya penyebaran penyakit DBD, maka di sinilah dituntut kesadaran masyarakat untuk dapat membersihkan saluran parit agar tidak tersumbat maupun sampah di sekitar lingkungan rumahnya demi terciptanya lingkungan yang bersih dan sehat. “Kepada para keuchik untuk dapat menerapkan gotongroyong setiap minggu kepada setiap warga. Bahkan, kepada keuchik dapat membuat qanun gampong mengenai gotongroyong sehingga masyarakat dapat melaksanakannya secara rutin,” katanya. Keuchik Tualang Teungoh, Danil, mengatakan, kegiatan gotong-royong ini sudah rutin dilakukan yakni setiap seminggu sekali dalam rangka menciptakan lingkungan bersih dan sehat yang terhindar dari penyakit. Selain itu, kepada Pemko Langsa melalui instansi terkait agar dapat menyediakan becak motor (betor) sampah, karena gampong ini belum memiliki seperti gampong lainnya. (m43)

Aceh Timur Kumpulkan 7 Juara BANDA ACEH (Waspada): Menjelang penutupan Pekan Kebudayaan Aceh (PKA) VI, Minggu (29/9) malam, anjungan Kabupaten Aceh Timur masih ramai dikunjungi masyarakat dengan tujuan menyaksikan berbagai macam barang dan benda yang ditampilkan di anjungan tersebut. Salah satu benda sejarah yang tersimpan dalam lemari di anjungan kabupaten itu adalah keris peninggalan Nurul A’la yang dibawa dari Pulau Jawa. Kepala Bagian Humas dan Protokol Setdakab Aceh Timur, T Amran, Minggu (29/9) mengatakan, benda peninggalan putri dari Raja Peureulak tersebut milik dari Abdul Hakim Amin yang dimiliki keluarganya secara turun temurun. “Mengutip dari apa yang disampaikan Abdul Hakim kepada kami, keris tersebut sudah dimiliki ayahnya dan sepengetahuannya benda tersebut telah ada di kediaman mereka,” paparnya. Meskipun keris itu telah ada sejak turun temurun, namun Abdul Hakim belum berani membenarkan keluarganya merupakan keturunan dari Raja Peureulak. “Hari kesembilan pelaksanaan PKA tahun 2013 Kabupaten Aceh Timur menambah tiga gelar juara dari ajang Gebyar PAUD masing-masing, Juara III Kategori Bunda PAUD Berprestasi, Juara III Gugus PAUD (Gugus Tandan Emas Desa Karang Inong Kecamatan Ranto Peureulak) dan Juara II Kategori Lembaga PAUD (PAUD Tunas Harapan),” katanya. Sementara dari ajang perlombaan terakhir dari pelaksanaan PKA VI yaitu lomba paduan suara yang berlangsung di Taman Budaya, Banda Aceh, Sabtu (29/9), Kabupaten Aceh Timur belum mampu menuai hasil positif dan harus kalah dari kabupaten/ kota lain. (b24)

Seorang Calhaj Langsa Gagal Berangkat LANGSA (Waspada): Seorang calon jamaah haji asal Kota Langsa, Maimunah, 60, penduduk Gampong Seuriget, Kecamatan Langsa Barat, gagal berangkat ke Tanah Suci tahun ini akibat terjadi kecelakaan. Ketua rombongan haji Kota Langsa Ibrahim Latif, Minggu (29/9) menjelang terbang mengatakan, yang bersangkutan sudah masuk asrama haji di Banda Aceh satu hari sebelumnya. Namun akibat terjadi kecalakaan jatuh dari tangga Maimunah mengalami patah kaki sehingga terpaksa harus menerima perawatan lebih dahulu sehingga tidak bisa diberangkatkan. Sementara jamaah lain, semua dalam keadaan sehat dan diterbangkan ke Tanah Suci melali Bandara SIM usai shalat Ashar. Ikhwan Rahmatika Latif bin ibrahim,19, merupakan calhaj termuda dan Abdussamad, 74, merupakan calhaj tertua dari Kota Langsa. (b20)

Waspada/Ibnu Sa’dan

IKHWAN Rahmatika Latif bin Ibrahim dan Abdussamad yang merupakan calhaj termuda dan tertua dari Kota Langsa berfoto saat berada di Asrama Haji Banda Aceh

WASPADA Senin 30 September 2013


KASAT Reskrim AKP Muhammad Firdaus memperlihatkan ijazah palsu Universitas Samudra Langsa dan blanko kosong ijazah yang dilakukan tersangka oknum dosen Kopertis Wil I Sumut-Aceh di ruang kerjanya, Minggu (29/9)

Kasus Pemalsuan Ijazah Unsam Terungkap LANGSA (Waspada): Sat Reskrim Polres Kota Langsa mengungkap dan menangkap dua tersangka kasus sindikat pemalsuan ijazah antar provinsi, guru honor di SMK Al Ikhlas di Langkat, SY, 37, warga Pangkalansusu, Langkat, Sumut, MD, 33 warga Desa Pelawi Utara, Kec. Babalan, Langkat dan SU, 50, oknum dosen Kopertis Wilayah I Sumut-NAD yang mengajar di Universitas Samudra Langsa, warga Desa Seturi Selatan, Kec. Babalan, Langkat, yang memalsukan ijazah Universitas Samudra (Unsam) Langsa sejak 2006. Demikian dikatakan Kapolres Langsa AKBP Hariadi melalui Kasat Reskrim AKP Muhammad Firdaus kepada wartawan di Mapolres Langsa, Minggu (29/9). Menurut Firdaus, terungkapnya kasus pemalsuan ijazah Universitas Samudra Langsa berawal dari laporan pihak Kampus Unsam pada 29 Juli 2013 yang mencurigai seorang guru honor di SMK Al Ikhlas di Langkat, SY, 37, warga Pangkalansusu, Langkat datang dengan membawa ijazah palsu yang meminta legalisir untuk keperluan yang bersangkutan. Selanjutnya oleh Dekan Fakultas Ke-

guruan dan Ilmu Kependidikan, Sofiyan melaporkan kejadian tersebut ke pihak kepolisian. Kemudian, kita mencoba kembangkan kasus tersebut dan menangkap MD, 33, di rumahnya di Desa Pelawi Utara, Kec. Babalan, Langkat pada 26 September 2013. Profesi MD dalam kasus ini hanya membantu mencarikan korban yang ingin membeli ijazah tanpa mengikuti prosedur kampus dan perkuliahan. Selanjutnya, berselang beberapa hari kita menangkap dalang pemalsuan ijazah Unsam tersebut, SU, 50, yang merupakan oknum dosen Kopertis Wil Sumut-Aceh yang mengajar di Unsam pada 27 September 2013 di rumahnya di Desa Seturi Selatan, Kec. Babalan, Langkat. Lanjut Firdaus, dalam melakukan pemalsuan ijazah Unsam SU, yang merupakan otak pemalsuan ijazah ini mencaplok mata kuliah dari lima univeritas ternama di Sumatera Utara yang bertujuan untuk diambil transkrip mata kuliahnya sehingga bisa dibuat transkrip nilainya dan ijazah atas nama Univeritas Samudra Langsa. “Dari tangan tersangka kita mengamankan 213 lembar blanko kosong ijazah palsu Unsam, 6 ijazah sudah terisi, 19 lembar kertas berkop surat Unsam untuk transkrip nilai dan dua lembar yang sudah terisi, stempel, lem, bantalan stempel dan pulpen,” jelas Firdaus. Sementara, SU, saat ditanya sudah berapa lama melakukan aksinya mengaku sejak 2006. “Kami sudah melakukannya

sejak 2006, kira-kira sudah 4050 orang yang membeli ijazah palsu. Untuk harga pengurusan ijazah ini, kami membandrol harga sekitar Rp9 juta, seementara Rp3 juta untuk fee perantara. Sedangkan rata-rata yang membeli ijazah ini semua orang Langkat,” jelas dosen Unsam sejak 1989 hingga sekarang dan dosen Kopertis ini. Sementara, MD saat ditanya sudah berapa lama ikut melakukan pemalsuan ijazah ini, mengaku sejak tahun 2010. “Saya melakukannya dari tahun 2010 yang saat itu mengenal SU karena satu kampung,” katanya seraya mengaku mendapat komisi Rp3 juta setiap pembelinya. Kasat Reskrim, Muhammad Firdaus menambahkan, ketiga tersangka diancam hukuman penjara. Untuk MD dikenakan Pasal 55-56 KUHPidana tentang membantu dan turut serta dalam melakukan aksi tersebut diancam 7 tahun penjara, SU, dikenakan Pasal 266 KUHPidana tentang menggunakan dokumen palsu diancam 7 tahun dan SY dikenakan Pasal 263 tentang pemalsuan ijazah diancam 6 tahun penjara. Sementara, bagi para pelaku yang telah menggunakan ijazah palsu tersebut diharapkan menyerahkan diri. “Kepada pelaku sejumlah 45 orang yang menggunakan ijazah palsu tersebut diharapkan menyerahkan diri, sebelum pihak keamanan menangkap. Karena sejumlah 45 nama sudah kita ketahui siapasiapa saja orangnya,” katanya. (m43)

PEUREULAK (Waspada): Ketua Fraksi Partai Demokrat T Zakaria menolah tegas rencana rekrutmen kembali anggota komisioner Komisi Independen Pemilihan (KIP) Aceh Timur periode 2013-2018 sebagaimana direncanakan DPRK Aceh Timur melalui hasil Panmus (Panitia Musyawarah) beberapa waktu lalu yang dipimpin pimpinan dewan. “Fraksi Demokrat di DPRK Aceh Timur tetap komitmen tidak mau terlibat dalam proses rekrutmen ulang yang direncanakan akan diambil dari 15 orang, bahkan surat dari pimpinan dewan sudah diterima Fraksi Demokrat yang diminta untuk mengirimkan dua orang perwakilan sebagai tim penguji rekrutmen ulang komisioner KIP tersebut,” ungkap T Zakaria, Sabtu (28/9) seraya mengatakan, meskipun surat dimaksud belum dibalasnya. Dijelaskan bahwa penolakan rekrutmen kembali itu karena beberapa bulan lalu sudah jelas dan telah melalui prosedur yang ditentukan, di mana Komisi A DPRK Aceh Timur ber-

dasarkan Surat Keputusan (SK) pimpinan dewan telah bekerja melakukan penjaringan dan penyaringan serta memplenokan 5 komisioner KIP terpilih yakni Iskandar A Gani, Mulia Karim, Tarmizi, Ridwan Suud dan Sofyan. Namun, sangat disayangkan ketika berlangsungnya paripurna khusus DPRK Aceh Timur untuk menetapkan hasil pleno Komisi A ini, Ketua Dewan Alaudin selaku pimpinan sidang malah mengajukan pertanyaan kepada qourum siapa setuju dan yang tidak setuju, pada pertanyaan pertama peserta sidang menyatakan setuju semua, tetapi tidak mengetuk palu penetapan, bahkan mempertanyakan hingga tiga pertanyaan ini yang akhirnya terjadi penolakan tanpa alasan jelas. Ketika ditanyakan apabila rekrutmen tersebut tetap dilaksanakan, T Zakaria menegaskan lagi, silakan saja, tetapi Fraksi Demokrat tetap menolak dan menduga kuat ada kejanggalan penolakan hasil pleno Komisi A dalam sidang paripurna khusus dewan waktu itu. (cri)

Kader PNA Harus Ciptakan Pemilu Damai PEUDAWA (Waspada): Ketua Badan Pemenangan Pemilu (Bapilu) Partai Nasional Aceh (PNA) Sofyan Daud meminta kader dan simpatisan partai lokal ini harus mampu menjaga serta menciptakan rasa aman dalam Pemilihan Umum Legislatif (Pileg) 2014 mendatang. “Kondisi inilah yang paling kita inginkan dan harus dipikirkan oleh para kader, simpatisan dan caleg PNA serta bagaimana memberikan pandangan politik yang baik bagi masyarakat Aceh terlebih jangan sampai adanya paksaan saat berlangsungnya Pemilu,” ungkap Sofyan Daud pada acara silaturahim dan pengukuhan Bapilu DPW PNA Aceh Timur di Balai UlamaUmara Alue Bu, Kecamatan Peureulak Barat, Kabupaten Aceh Timur, Minggu (29/9). Menurut Sofyan Daud, bukan waktunya lagi sesama masyarakat Aceh untuk saling menjatuhkan, akan tetapi secara bersama-sama meskipun berbeda partai guna membangun Aceh kearah lebih baik lagi. “Karena program PNA tidak lain untuk mencerdaskan masyarakat dan PNA juga terbuka bagi semua kalangan, asalkan satu tujuan membangun Aceh,” paparnya. Sebab itu, dirinya mengharapkan kepada kader dan para caleg PNA untuk dapat menghi-

langkan sifat arogansi, emosional dan ancaman dalam Pemilu. “Bukan PNA harus dipilih, tetapi pemahaman politik yang harus diberikan untuk masyarakat, karena PNA tidak sanggup membangun Aceh sendiri, tetapi harus bersama-sama elemen masyarakat,” ujar Sofyan Daud lagi. Sementara mantan Gubernur Aceh Irwandi Yusuf yang juga sebagai Ketua Majelis Pertimbangan Pusat (MPP) PNA dalam arahannya pada acara tersebut mengatakan, dalam masa lima tahun memimpin Aceh banyak yang mengatakan dirinya gagal, tapi ia tidak membantah sedikitpun, karena kegagalan dan keberhasilan selama lima tahun menjabat Gubernur Aceh dapat dinilai sendiri oleh masyarakat Aceh, itulah hakim yang adil dalam menilainya. Irwandi Yusuf hanya mengajak masyarakat Aceh untuk pandai bersyukur, saat dirinya menjabat sebagai Gubernur Aceh lebih mengutamakan kesejahteraan rakyat, kestabilan politik dan keamanan. “Jadi harapan saya ke depan jangan ada lagi perselisihan antara sesama partai, ke depan mari kita berkoalisi baik sesama partai lokal maupun dengan partai nasional untuk membangun Aceh ke arah yang lebih sejahtera serta makmur secara ekonomi,” papar mantan Gubernur Aceh ini. (cri)


KETUA PMI Cabang Kota Langsa, T Iskandar Faisal dampingi Sekretaris Zakir Syafi’i,Wakil Sekretaris Zatul Fadli, Ketua Bidang Pengembangan Citra dan Hubungan Antar Lembaga M Jusuf Akoep, Ketua Pengembangan Organisasi dan SDM Syukur foto bersama dengan kontingen SMPN 6 Langsa ketika membuka kegiatan Jumbara di sekolah setempat, Sabtu (28/9)

PMI Langsa Gelar Jumbara PMR

Waspada/M Ishak

GUBERNUR Aceh Zaini Abdullah (kiri) didampingi Kepala Kanwil Kemenag Aceh Ibnu Sadan (tengah) menyerahkan Ikan Keumamah sebagai makanan khas Aceh kepada salah satu calhaj Aceh Timur di Asrama Haji Banda Aceh, Minggu (29/9)

Ikan Keumamah, Hadiah Doto Untuk Jamaah Haji IKAN KEUMAMAH sering disebut juga ikan kayu. Khas Aceh ini dijadikan dari ikan tongkol atau sejenisnya. Setelah dibersihkan lalu dikeringkan melalui sinar panas matahari seraya diberikan garam. Setelah benar-benar kering lalu ikan tersebut diiris tipis-tipis. Makanan khas Aceh inilah yang dikemas dalam sebuah kotak sedang di bumi Serambi Mekkah di musim haji 2013 ini dibekali para calon jamaah haji Aceh ke Tanah Suci. Khas ini dianggap lebih baik dikonsumsi untuk menjaga kesehatan para calhaj asal Aceh selama berada di Tanah Suci selama lebih kurang 40 hari. Ribuan kotak Ikan Keumamah tahun ini sengaja dihadiahi Gubernur Aceh Zaini Abdullah atau akrap disapa Doto kepada para calhaj. “Ini khas Aceh, muda-mudahan bakaqah sesampai di Tanah Suci,” kata Yanti, salah seorang calhaj asal Aceh Timur di sela-sela pelepasan

calhaj Kloter I di Asrama Haji Banda Aceh, Minggu (29/9). Ikan Keumamah ini sangat terasa bumbunya jika ditumis kering dengan bumbu. Salah satu bahan dasarnya adalah asam sunti. Untuk menciptakan aroma wangi yang lebih terasa ditambah daun kari. Keumamah memang lauk yang paling menjadi makanan khas di Aceh. Bukan hanya karena gurihnya, tapi uniknya dari bahan dasarnya. Ikan kayu sebenarnya adalah hasil olahan dari ikan tongkol atau sejenis ikan tuna yang telah direbus kemudian dijemur sampai kering sehingga ikan terasa keras seolah-olah seperti kayu. Inilah dasarnya sehingga khas Aceh ini disebut ikan kayu. Supaya menjadi keumamah, ikan kayu diiris tipis kemudian dimasak dengan bumbubumbu. Cita rasa yang khas membuat kita ingin mencobanya lagi. Keumamah juga menjadi lauk favorit pada saat berpergian, karena bersifat tahan

lama sehingga mudah untuk dikonsumsi. Setelah bencana alam tsunami tahun 2004 silam di Aceh, kini banyak pengusaha penjualan ikan kayu yang sering menjadi oleh-oleh. Cukup praktis penyajiannnya dan bisa dikonsumsi tanpa harus dimasak lagi, karena telah direbus. “Semoga khas Aceh ini bermanfaat untuk para calon Tamu Allah ini di Tanah Suci, karena secara medis juga bagus untuk kesehatan para calhaj,” kata Kepala Kanwil Kemenag Aceh Ibnu Sadan. Dia mengaku, makanan khas Aceh ini hadiah Gubenur Aceh untuk para calhaj musim haji tahun ini yang jumlah keseluruhannya yang diberangkatkan tahun ini mencapai 3.148 calhajyangdibagidalamdela-pan kloter.“Utamakankese-hatandan konsumsilah berba-gai makanan yangbaikuntukkesehatan,karena tanpa kesehatan mustahil ibadah kitasempurna,”tuturIbnuSadan. M Ishak

LANGSA (Waspada): Palang Merah Indonesia (PMI) Cabang Kota Langsa menggelar perkemahan Jumpa Bakti Gembira (Jumbara) yang diikuti 12 kontingen dari siswa SMP dan SMA untuk tiga wilayah, Aceh Tamiang, Kota Langsa dan Aceh Timur di SMP Negeri 6 Langsa, Jumat-Minggu (27-29/9). Ketua PMI Cabang Kota Langsa T Iskandar Faisal didampingi Sekretaris Zakir Syafi’i, Wakil Sekretaris Zatul Fadli, Ketua Bidang Pengembangan Citra dan Hubungan Antar Lembaga, M Jusuf Akoep, Ketua Pengembangan Organisasi dan SDM Syukur mengatakan, kegiatan perkemahan Jumbara ini sebagai wadah remaja menjalin komunikasi dan silaturahim antar sekolah, sekaligus sebagai media pembelajaran bagi pelajar untuk memperdalam dan menumbuhkan jiwa sosial. “Karena dalam kegiatan ini juga diisi dengan berbagai materi yang berisikan tentang pemahaman bagaimana melakukan pertolongan pertama ketika bencana datang dan sebagai relawan PMI mereka dituntut untuk proaktif

ketika menghadapi bencana tersebut,” katanya. Di samping itu, melalui kegiatan ini juga menepis bahwa remaja itu selalu berprilaku ugalugalan, lantas melalui kegiatan ini kita tidak demikian. Maka dari itu bagi peserta yang ikut Jumbara ini tunjukan bahwa kalian adalah generasi sesuai harapan bangsa saat ini. Apalagi, Palang Merah Remaja (PMR) merupakan salah satu kekuatan dari PMI dalam kegiatan-kegiatan di bidang kesehatan dan siaga bencana. “PMR adalah wadah pembinaan dan pengembangan dari PMI,” katanya. Dijelaskan T Iskandar lagi, kontingen yang ikut dalam kegiatan Jumbara ini terdiri dari 10 kontingen Kota Langsa, 1 kontongen Aceh Tamiang dan Aceh Timur. Masing-masing kontingen terdiri dari 20 orang, untuk tingkat SMP diberi nama Madia dan SMA diberi nama Wira. “Jumbara ini merupakan yang pertama di Kota Langsa yang pada prinsipnya mengaplikasikan Tri Bakti PMR, yakni meningkatkan keterampilan hidup sehat, berbakti di masyarakat dan mempererat persahabatan nasional dan internasional,” ujar Iskandar. (m43)


WASPADA Senin 30 September 2013

Polisi Bidik Tersangka Penggelapan Dana BOK

Gubernur Aceh Lepas Calhaj Kloter 1 BANDA ACEH (Waspada): Diperkirakan, Minggu (29/9), Gubernur Aceh Zaini Abdullah melepas calon jamaah haji Aceh kelompok terbang (kloter) 01, yang berlangsung di aula asrama haji embarkasi Banda Aceh. Kloter 01 sebanyak 440 orang, yang merupakan calhaj gabungan dari lima kabupaten/kota telah memasuki asrama haji Banda Aceh, kemarin sore. Kakanwil Kemenag Aceh Ibnu Sadan, melalui Kasubbag Humas dan Informasi Akhyar, Sabtu (28/9), mengatakan, gubernur usai melepas calhaj kloter 01 pukul 10:00, juga menyerahkan bingkisan berupa ikan kayu (ikan keumamah) yang telah siap saji kepada setiap calhaj yang akan berangkat ke Tanah Suci. Dalam pelepasan itu, sebut Akhyar, akan hadir anggota DPRRI dari komisi VIII yakni Sayed Fuad Zakaria (Fraksi Golkar), Raihan Iskandar (Fraksi PKS) dan Erwin dari Fraksi PDIP. Selain itu, juga hadir Irjen Kemenag RI Abdurrachman yang setiap hari memantau keberangkatan calhaj Provinsi Aceh ini. (b02)

Jangan Lupakan Janji SUBULUSSALAM (Waspada): Ketika sudah menjadi pejabat jangan lupakan janji, jangan abaikan masyarakat, baik pemilih atau tidak. Pengalaman pasca Pilkada, acap kali kepala daerah melupakan janji yang pernah disampaikan. Demikian antara lain pesan partai pendukung dan mewakili warga kepada pasangan calon Wali/Wakil Kota Subulussalam periode 2014-2019 nomor urut 4 (ASLI) saat silaturahmi di Desa Jontor, Kec. Penanggalan, Subulussalam, Kamis (26/9) Pasangan ASLI (Asmauddin -Salihin Berutu) secara bergantian menegaskan, sesuai motto ‘Maju Untuk Perubahan’, mengkritisi lima tahun kepemimpinanWali Kota Subulussalam saat ini sehingga harus dilakukan perubahan. Meliputi birokrasi, penerimaan CPNSD, sinyal pengkotakkotakan masyarakat ibarat anak tiri dan anak kandung harus diberantas, pejabat harus melayani secara tulus dan ikhlas tanpa membeda-bedakan suku dan sebagainya. Lalu, pejabat jangan terlalu berhitung politik mengingat desa tertentu, teman atau bukan. Rakyat dilayani secara merata, tidak memarjinalkan satu daerah, jadwalkan kunjungan masyarakat ke pendopo, jadwal bertamu ke kantor hingga rakor intern dan Muspida setempat. Soal APBK yang disahkan DPRK, serahkan kepada SKPK selaku pengelola, bukan kepada orang nomor satu di daerah. Soal netralitas PNS dan kepala desa pada Pilkada, sumber media ini ingatkan para kandidat agar tidak mengkondisikan kedua unsur itu untuk menjadi tim sukses kandidat tertentu. (b28)

Seorang Calhaj Hamil, Enam Ditunda Berangkat BANDA ACEH (Waspada) : Satu orang calon jamaah haji yang tergabung dalam kelompok terbang (kloter) 01 batal berangkat ke Tanah Suci karena hamil. Sementara enam calhaj lainnya ditunda keberangkatan akibat sakit dan alasan lainnya. Koordinator Humas Embarkasi Banda Aceh Akhyar, Minggu (29/9) mengatakan, seorang calhaj yang positif hamil itu bernama Hawati Muhammad Nur Insya binti M Nur, asal Kabupaten Aceh Jaya. Calhaj Hawati ini positif hamil satu bulan ketika tim pemeriksaan kesehatan haji embarkasi Banda Aceh memeriksa kesehatannya. Karenanya, demi kesehatan calhaj yang bersangkutan tidak dibolehkan berangkat menunaikan haji. Adapun enam calhaj lain yang ditunda keberangkatan yaitu Fakhrial Muhammad Joni manifes 206 asal Kota Langsa. Calhaj ini ditunda berangkat karena tak bersedia divaksin. Istrinya Syarida Ariani Syarifuddin manifes 207 terpaksa ditunda juga karena ikut suaminya. Selain itu, calhaj yang menunda keberangkatan akibat sakit masing-masing bernama, Maimunah Muhammad Amin manifes 183 asal Kota Langsa, Subki Abdul Jalil Ibrahim manifes 100 asal Kabupaten Aceh Timur, Syamsiah Abdul Aziz Umar manifes 101 asal Aceh Timur (alasan ikut suami) dan Asiah Beramat Adam manifes 021 yang juga berasal dari Aceh Timur. “Jadi, enam calhaj yang tertunda keberangkatannya dengan kloter 01, itu maka mereka akan diberangkatkan dengan kloter berikutnya,” tutur Akhyar. (b02)

Evaluasi Izin PT Gayo Mineral BLANGKEJEREN (Waspada ) : Lembaga Swadaya Masyarakat, Gayo Lues Musara Ate, mendesak DPRK setempat mengevaluasi segala bentuk izin PT Gayo Mineral (PT GM) yang berinvestasi di wilayah Kecamatan Pantan Cuaca, Kabupaten Gayo Lues. Demikian dikatakan Malik, melalui ketuanya, Minggu (29/ 9) terkait izin operasional PT Gayo Mineral dinyatakan illegal oleh Kepala Kantor Lingkungan Hidup Kabupaten Gayo Lues, karena tidak memiliki izin resmi dari Pemkab Gayo Lues. Dan juga telah mengancam lokasi eksplorasi kawasan hutan lindung serta ruas badan jalan nasional, Gayo Lues – Aceh Tengah terancam ambruk. Ia mengatakan, perizinan dimiliki PT Gayo Mineral yang perlu dievaluasi itu antara lain analisa dampak lingkungan (Amdal) dan teknis pengoperasian tambang emas tersebut. Salah satunya, memakai bahan kimia yang dapat mencemarkan lingkungan, yakni Mercury. Ferry Siswanto, Kepala Kantor Lingkungan Hidup menegaskan, kegiatan operasional mereka sangat membahayakan lingkungan dan tentu saja imbasnya kepada manusia banyak. Dan, ketika peninjauan terakhir, dikatakan Ferry, telah menemukan operasional mereka di lokasi dengan kedalaman pengeboran mencapai 311.9 cm. (cjs)

Aceh Utara Gelar Festival Lagu Aceh BANDA ACEH (Waspada): Anjungan Aceh Utara pada Pekan Kebudayaan Aceh (PKA) VI di Taman Ratu Safiatuddin, Banda Aceh, Jumat (27/9) malam menggelar festival lagu Aceh yang diikuti puluhan peserta. Kegiatan festival itu mendapat sambutan dan antusiasnya kalangan muda yang punya keahlian di bidang tarik suara. Panitia PKA anjungan Aceh Utara, tidak memungut biaya bagi peserta festival itu. “Karena gratis banyak yang berminat unjuk kebolehan di depan publik dan sebagai juri kita tempatkan Sabrin Lamno, artis senior Aceh,” tutur Fakhrurrazi, Kabag Humas Pemkab Aceh Utara. Festival digelar untuk menyahuti hobi kaum muda Aceh. Bagaimanapun, menyanyi adalah sebuah budaya publik yang patut mendapat apresiasi dari kita semua. Keluar sebagai pemenang pertama adalah Iqbal, peserta asal Aceh Selatan, yang tampil dengan membawakan lagu Ubat Hate (Rafly). Untuk juara disediakan tiga unit handphone dari Ibu Cut Ratna Irawati, istri Bupati Aceh Utara Muhammad Thaib. Sisi lain anjungan Aceh Utara adalah menyediakan tempat khusus untuk shalat yang bisa digunakan para pengunjung. Bahkan setiap waktu Maghrib dan Isya, di mushalla ini berlangsung shalat berjamaah. (b06)

Waspada/Muhammad Zairin

SEORANG peserta tampil pada gelaran festival lagu Aceh di depan anjungan Aceh Utara pada PKA di Taman Ratu Safiatuddin, Banda Aceh, Jumat (27/9)


Waspada/Muhammad Zairin

GUBERNUR Aceh Zaini Abdullah didampingi Kakan Kemenag Aceh Ibnu Sakdan menyerahkan bendera merah putih kepada Ketua Tim Pemandu Haji Indonesia (TPHI), Ahmad Bin Abdul Jalil Hasan, saat melepas keberangkatan calhaj kloter pertama, Minggu (29/9) di embarkasi Asrama Haji Banda Aceh.

Zaini Abdullah : Calhaj Diminta Banyak Bersabar BANDA ACEH (Waspada) : Gubernur Aceh Zaini Abdullah meminta seluruh calon jamaah haji asal Provinsi Aceh untuk meningkatkan kesabaran dan menjaga keseimbangan psikologis dalam melaksanakan seluruh rangkaian ibadah haji. Karena, skata Zaini, setiap musim haji seluruh umat Islam di dunia berkumpul sehingga sudah pasti saudara akan mengalami kondisi yang serba harus antre, berdesak-desakan, serta hawa panas akibat musim panas kali ini mencapai lebih dari 40 derajat celcius. “Jadi kondisi tersebut tentunya dapat memicu ketidaksabaran yang justru dapat berpotensi mengurangi kualitas haji,” ujar Zaini ketika melepas calhaj kloter 01 embarkasi Banda Aceh, Minggu (29/9).

Pelepasan kloter perdana itu dihadiri anggota DPR-RI dari komisiVIII yakni Sayed Fuad Zakaria (Fraksi Golkar), Raihan Iskandar (Fraksi PKS), Erwin (Fraksi PDIP) dan Faisal Amin dari komisi X (Fraksi PPP) serta sejumlah pejabat provinsi dan kabupaten/kota lainnya. Kecuali itu, lanjut Zaini, dengan penurunan kuota haji hingga 20 persen atas kebijakan pemerintah Arab Saudi, kemungkinan akan berlanjut hingga 2016. Itu artinya dengan jumlah waiting list Aceh tercatat sekarang 55.329 orang, maka kita perlu waktu 17 tahun lagi untuk memberangkatkan calhaj yang sudah masuk waiting list tersebut. Kakanwil Kemenag Aceh Ibnu Sadan mengatakan, pemberangkatan calhaj Banda Aceh tahun dibagi delapan kloter yang didominasi jamaah perempuan. Di mana sebagian besar berprofesi sebagai ibu rumah tangga hampir 30 persen. Selain itu, kata dia, rata-rata

usia jamaah 51 tahun hingga 60 tahun berjumlah lebih 31 persen. Sedangkan pendidikan para calhaj rata-rata SD/MI 32 persen serta 88 persen calhaj Aceh tahun ini belum pernah menunaikan ibadah haji. Menyinggung dengan pemondokan calhaj embarkasi Banda Aceh selama di Mekkah, menurut Ibnu, para calhaj berada lebih kurang 2.000 meter dari Masjidil Haram. “Meski itu memudahkan jamaah, tapi kami imbau kepada seluruh calhaj agar tetap meningkatkan kesabaran,” tutur Ibnu. Anggota DPR-RI KomisiVIII Sayed Fuad Zakaria mengatakan, kebijakan yang telah disepakati dengan Kementerian Agama RI bahwa untuk musim haji tahun depan wajib diprioritaskan kepada calhaj yang tertunda keberangkatan tahun ini akibat terjadi pemotongan kuota haji 20 persen tersebut. Begitu juga, jika terjadi kenaikan BPIH, maka yang menanggung adalah pemerintah. (b02)

Aceh Tengah Terancam Tak Miliki DAU TAKENGEN (Waspada): Kabupaten Aceh Tengah terancam tidak memiliki anggaran untuk menggerakkan pembangunan. Gaji pegawai dan kegiatan operasional dan pembangun, bakal tidak dimiliki kabupaten penghasil kopi ini. Pemerintah pusat melalui Menteri Keuangan akan memberikan hukuman, karena daerah yang lembat mengajukan Dana Alokasi Umum (DAU). Seharusnya batas waktu pengajuan DAU terakhir tanggal 31 Agustus. Namun karena Aceh Tengah diguncang gempa dengan kerusakan yang cukup tinggi, Menteri Keuangan memberikan dispensasi batas terakhir bagi kabupaten ini, hingga 30 Septem-

ber 2013. Batas terahir yang ditetapkan itu juga dilanggar DPRK setempat, pihak dewan belum memfinalkan usulan DAU untuk kabupaten ini. “Kami berusaha secepatnya melaksanakan sidang. Lambat sedikit biasalah. Kami akan buru dalam sidang ekstra ketat, pagi siang dan malam untuk mengejar keterlambatan ini. Jangan khawatir sudah jadwalkan semua,” ungkap Ketua DPRK Aceh Tengah, Zulkarnaen, Minggu (29/9). Saat sekarang ini DPRK sedang mengadakan sidang pembahasan tim Pansus. Dijadwalkan dalam waktu dua hari ke depan selesai dan dilanjutkan dengan pembahasan anggaran. Diperhitungkan paling lambat

3 Oktober sudah selesai. Bila pengajuan APBK ini lambat disampaikan ke pemerintah pusat, maka daerah tersebut akan dikenakan sanksi sesuai PP nomor 56 tahun 2005 tentang sistem Informasi Keuangan Daerah (SIKD) dan PP nomor 65 tahun 2010. Daerah yang lambat mengusulkan akan dikenakan sanksi lambatnya penyaluran DAU, sebesar 25 persen untuk setiap bulannya, sampai batas waktu Pemda setempat menyampaikan APBK ke pemerintah pusat. “Kita usahakan batas terakhir ini mampu terpenuhi sehingga daerah kita tidak mendapatkan sanksi,” papar Khairul Asmara, Wakil Bupati Aceh Tengah. (b32/b33)

Banda Aceh Dan Nagan Raya Masuk 10 Besar Anggaran Terbuka JAKARTA (Waspada): Kota Banda Aceh dan Nagan Raya masuk 10 besar kota dan kabupaten yang terbuka dalam soal anggaran. Banda Aceh menempati posisi urutan kedelapan dengan nilai skor 31,97 dan Nagan Raya ketujuh dengan nilai skor (37,23). Demikian ungkap Koordinator Advokasi Sekretariat Nasional Forum Indonesia untukTransparansi Anggaran (Seknas Fitra) Maulana di Jakarta, Minggu (29/9). “Pemerintah daerah (pemda) yang memublikasikan infor-

masi anggarannya masih di bawah 25 persen,” ungkap Maulana. Maulana menambahkan, berdasarkan penelusuran 193 siber pemda di sembilan provinsi sejak awal September 2013, ditemukan tidak seluruh pemda memuat anggaran yang disahkan. Disebutkan, dari 193 pemda, 122 masih sangat tertutup karena hanya memperoleh skor di bawah 25,55 pemda di antaranya, bahkan hanya memuat informasi lelang pengadaan barang dan jasa, tanpa me-

mubliskan anggaran kepada publik. Hasil penelusuran terhadap siber milik pemerintah kota dan pemerintah daerah, Fitra menyusun 10 kota dan 10 kabupaten yang dinilai paling baik dalam memublikasikan informasi anggarannya. “Untuk kelompok kota, Blitar peringkat pertama dalam indeks keterbukaan informasi dengan skor 54,39. Sedangkan untuk kabupaten, Kebumen peringkat pertama dengan skor 48,25,” jelas Maulana. (cmh)

Panitia PKA VI Dinilai Kurang Siap BANDA ACEH (Waspada): Selama pelaksanaan Pekan Kebudayaan Aceh (PKA)VI digelar di Taman Ratu Safiatuddin, Banda Aceh, dinilai panitia sangat lemah. Hal itu ditemukan dalam mengatur acara demi acara dan lokasi berbagai pertunjukan serta lokasi pedagang. “Akibat kurang siapnya pihak panitia pelaksana sehingga terkesan pelaksanaan PKAVI layaknya arena pasar malam,” ungkap sejumlah pengunjung PKA, Sabtu (28/9). “Kami merasakan ketidaknyamanan dalam arena PKAVI. Kenapa berani saya mengatakan seperti itu, karena selama perhelatan PKA, suasananya lebih didominasi dengan keberadaan para pedagang sehingga arena PKA menjadi semrawut. Hal ini menunjukkan kinerja panitia kurang siap dalam melakukan pengaturan,” ujar Sufyan A Jalil, warga Pidie. Hal yang sama juga dilontarkan Rahmadsyah, warga Bireuen yang menyampaikan unek-uneknya terkait pelaksa-

naan PKAVI. Disebutkan, lokasi para pedagang seharusnya bisa diatur lebih jauh dari arena utama PKA, tapi kurang diperhatikan pihak panitia. Akibatnya, pengunjung harus berdesak-desakan dan antrean panjang di sela lapakpedagangdanparapembeli. Bahkan akibat ketidaksiapan dan ketegasan panitia dalam pengaturan lapak pedagang yang sembarangan, membuat arus lalu lintas di sejumlah ruas jalan utama mengalami kemacetan panjang. Apalagi semua sisi jalan utama, dijadikan tempat parkir, bahkan Jembatan Lampriet pun menjadi tempat parkir,” kata Rahmadsyah yang khusus datang dari Kabupaten Bireuen guna menyaksikan pagelaran PKA VI. Pernilaian yang sama juga disampaikan anggota DPR Aceh, Mahyaruddin Ysf kepada wartawan, pihak panitia kurang siap. “Saya tidak melihat PKA VI kali ini semeriah PKA yang digelar tahun 1989, saat pertama kalinya saya melihat PKA. Kalau tidak salah itu PKA II masa (gu-

bernur) Pak Ibrahim Hasan. Itu seratus persen kebudayaan Aceh,” katanya. Semestinya, PKA yang dilaksanakan empat tahun sekali benar-benar dalam lingkup menggali dan mengembangkan adat istiadat dan budaya Aceh. PKA juga seharusnya mampu mengoptimalkan sosialisasi dan promosi budaya Aceh ke dunia nasional dan internasional. “Kita berharap nilai-nilai khazanah budaya Aceh itu benar-benar dapat terpublikasikan, terpelihara lewat PKA. Kalau kita lihat hari ini arena PKA itu sedikit sudah lari dari tujuan utama. Ini saya kira perlu ditertibkan, karena jangan sampai suasana pasar itu lebih dominan daripada ajang perhelatan budaya Aceh yang sangat bergengsi,” katanya. Hal yang sama juga dikatakan Iskandar, salah seorang warga Lampaseh Banda Aceh. Ia sangat menyesalkan PKA VI yang berubah menjadi arena pertunjukan tong setan dan pasar malam.(b09)

BANDA ACEH (Waspada) : Polres Aceh Besar menyatakan masih mendalami kasus penggelapan dana bantuan operasional kesehatan (BOK) yang menempatkan dua pegawai Puskesmas Ie Alang, Kec. Cot Glie masing-masing SH, 32. dan Fau, 30. sebagai tersangka. Kepolisian menyatakan jumlah tersangka masih berkemungkinan bertambah seiring dengan berjalannya proses pemeriksaan. “Masih kami dalami, bisa jadi jumlah tersangkanya bertambah. Ini bukan kasus korupsi, tapi penggelapan,” kata Kapolres Aceh Besar AKBP Djajuli melaluiWakapolresWelly Abdillah, Minggu (29/9). Menurutnya, pengusutan berawal dari laporan mantan Kepala Puskesmas Ie Alang tahun 2012, Marzuki atau sebelum puskesmas itu dijabat SH dan bendaharanya Fau, 30. Di mana, kata Welly, dana yang seharusnya dicairkan Marzuki justru dicairkan SH dan Fau, padahal seluruh dana BOK itu dilakukan saat Kapuskes dijabat Marzuki. “Total yang tidak dibayar ke dokter Marzuki itu memang tidak banyak, sekitar Rp7 juta untuk periode Januari-Mei. Keduanya membuat laporan palsu yang menyatakan buku rekening puskesmas dimaksud hilang, padahal buku ada di Marzuki,” kata Welly. Welly mengatakan, meski telah melakukan penarikan dana BOK, namun Marzuki tidak kunjung menerima haknya. Padahal untuk menunggu pencairan dana tersebut, Marzuki menggunakan anggaran pribadi agar program dimaksud Puskesmas Ie Alang dapat berjalan. “Dana ini

harusnya dicairkan tahun 2012, tapi oleh keduanya dicairkan tahun 2013 dengan alasan atas perintah Sekretaris Dinas Kesehatan Aceh Besar,” kata Welly. Lebih lanjut kata Welly, SH dan Fau ditetapkan sebagai tersangka sesuai hasil perkem-bangan penyelidikan Satreskrim Aceh Besar tanggal 2 September dengan nomor B/81 dan 82/ IX/2013/. Laporan itu sendiri diterima kepolisian 28 Mei lalu. Penyidik menjerat keduanya dengan Pasal 226, 374 dan Pasal 55 KUHPidana. Penangungjawab BOK, Sekretaris Dinas Kesehatan Aceh Besar, Herman enggan mengomentari penetapan tersangka kepala dan bendahara Puskesmas Ie Alang. Menurut Herman, tahun 2012 ia belum menduduki jabatan tersebut dan Petunjuk Pelaksanaan (Jutlak) maupun Petunjuk Teknis (Juknis) BOK tahun 2012 dan 2013 berbeda. “Sebaiknya saya tidak mengomentari hal itu karena saya tidak paham soal itu apalagi terjadi tahun 2012,” ujar Herman, Kamis (26/9). Senada disampaikan Mardiah, Pejabat Pembuat Komitmen (PPK) dalam program BOK. Menurut dia, kasus tersebut tidak seperti pemberitaan karena informasi yang diterimanya dari mantan bendahara BOK Fau (tersangka), dana itu telah ditransfer ke rekening Marzuki. “Informasinya tidak seperti itu, karena sesuai keterangan Fau kepada saya dana sudah dikirim ke rekening arzuki dan buktinya ada. Memang saya belum lihat,” kata Mardiah yang mengaku sudah tidak berdinas di Dinkes Aceh Besar. (cb06)

Perambahan Hutan Di Aceh Besar Marak ACEH BESAR (Waspada) : Warga Kemukiman Lamteuba, Kec. Seulimum, Aceh Besar mengeluhkan kembali maraknya aksi perambahan hutan di kawasan mereka sejak tiga bulan terakhir. Warga berharap pihak terkait mengambil langkah-langkah pencegahan agar kerusakan hutan di kawasan tidak bertambah parah. “Dulu sempat berhenti, tapi sejak tiga bulan ini mulai marak lagi. Kami khawatir dampaknya akan berakibat bagi warga di sini,” kata salah seorang warga yang enggan namanya diwartakan, Minggu (29/9). Menurut sumber, sebelumnya warga di kemukiman Lamteuba sempat melakukan razia terhadap para perambah, namun kini upaya tersebut tidak membuahkan hasil. Disebutkan, lokasi yang kerap dirambah yakni di kawasan hutan Babah Dua, Lamteuba dan kawasan hutan pegunungan Seulawah Agam. “Ada beberapa lokasi, tapi yang jelas terlihat

di kawasan hutan Seulawah Agam dan Babah Dua. Kami khawatir saat musim penghujan seperti banjir sebelumnya yang sempat merenggut nyawa seorang bocah,” ujar sumber itu. Selain banjir, perambahan hutan dikhawatirkan akan mempengaruhi debit air bagi kebutuhan warga di Kemukiman Lamteuba. “Kami berharap penegak hukum tegas dan segera mencegah aksi ini,” ujar sumber itu. Maraknya perambahan hutan di kawasan Aceh Besar diakui Kadis Kehutanan Aceh Besar Junaidi. Kondisi tersebut, kata Junaidi, hampir ditemui di seluruh kecamatan seperti di Kec, Lembah Seulawah, Seulimuem, Jantho, Kuta Cot Glie dan Kecamatan Lhong. “Untuk menekan kerusakan hutan, kami sebenarnya sudah gencar melakukan razia dengan patroli ke daerah rawan, tapi memang dibutuhkan kerjasama semua pihak termasuk masyarakat agar perambahan berhenti,” paparnya. (cb06)

Nasabah Bank Kecewa

Saldo Hilang, Uang Tak Keluar BLANGKEJEREN (Waspada) : Sudah banyak yang menjadi korban, akibat ATM Bank Aceh Cabang Blangkejeren, Kabupaten Gayo Lues sering berulah. Di antaranya, rekening terdebet, namun uang tidak keluar sama sekali. Nujum, 24, salah satu nasabah Bank Aceh yang beralamat di Blangkejeren, menjadi korban leletnya Anjungan Tunai Mandiri (ATM) Bank Aceh Blangkejeren. Kejadian itu berlangsung, pada 20 September 2013 lalu, ketika hendak menarik uang di ATM tersebut, mesin ATM berbunyi layaknya proses penghitungan uang seperti penarikan lazimnya, namun bunyi tersebut lama dan berulang-ulang, akhirnya berhenti sendiri. Namun, uang tidak keluar sama sekali, setelah dicek saldo, ternyata rekening terdebet sebesar jumlah penarikan tersebut. “Saya menarik Rp500 ribu dari ATM (Anjungan Tunai Mandiri), tapi uangnya tidak keluar, buku pemberitahuan penarikannya terdebet, selanjutnya saya mencoba penarikan melalui

buku tabungan diTeller Bank Aceh Blangkejeren, tapi kata petugas teller, saldo saya sudah tidak cukup untuk melakukan penarikan,” katanya. Merasa tidak puas, ia kembali melakukan konsultasi dengan pihak Bank Aceh di bagian costumer service, setelah diminta fotocopy KTP dan bermacam lain persyaratan, diakui uang tersebut akan dimasukan lagi ke rekening Nujum pada Rabu, (25/9). Ternyata, setelah hari berikutnya dia chek di rekening, pengembalian uang itu tidak dilakukan pihak Bank Aceh, Sebelumnya, Nujum juga mengaku pernah mengalami hal yang sama di tahun 2011-2012, penarikan yang dilakukan lumayan besar, dengan nominal senilai Rp1.850 juta, uang tidak keluar, saldo berkurang. “Karena saya tidak mengerti, tidak melakukan konplain, akhirnya uang saya lenyap,” terangnya. KejadianinimembuatbeberapanasabahBank AcehmerasaketakutanmenarikuangmelaluiATM BankAcehBlangkejeren,selainmenambahurusan yang ribet, uang juga bisa hilang. (cjs)

Aceh Singkil Tampilkan Alat Tangkap Ikan BANDA ACEH (Waspada): Anjungan Kabupaten Aceh Singkil menampilkan sejumlah peralatan penangkap ikan tradisional pada arena Pekan Kebudayaan Aceh (PKA)VI di Taman Ratu Safiatuddin, Banda Aceh. Amatan Waspada, Sabtu (28/9) di arena PKA, meski cuaca terik menyengat di kota provinsi tersebut, namun antusias pengunjung tetap ramai memadati arena pesta seni - budaya empat tahunan itu. Anjungan kabupaten/kota yang menampilkan seni-budaya dan prasarana adat terlihat lebih menjadi incaran pengunjung dibanding stan lainnya. Pungunjung yang datang kebanyakan bersama keluarga atau kelompok warga dari berbagai pelosok Aceh untuk menyaksikan langsung tampilan yang ada di masing-masing anjungan. Selain untuk sekadar melihat-lihat atau berpose untuk berfoto, ada juga pengunjung yang menanyakan informasi tentang adat-stiadat, budaya atau hal lain tentang daerah bersangkutan dari petugas jaga, termasuk di anjungan ceh Singkil. Anjungan Singkil yang berada di depan stan Satuan Polisi Pamong Paraja dan Wilayatul His-

bah (Satpol PP dan WH) Aceh di bagian lantai bawah gedungnya ditampilkan sejumlah peralatan tangkap ikan tradisional. Alat tangkap tradisional yang ditampilkan di antaranya Bubu berbagai ukuran yang terbuat dari bambu diikat dengan rotan dan sejumlah peralatan tangkap lain yang berbahan baku sama, kemudian Sulangat dan jala, dua jenis tangkap ikan tradisional yang juga banyak terdapat di daerah lain di nusantara. “Banyak pengunjung yang datang menyaksikan dan bertanya tentang alat tangkap ikan tradisional yang kita tampilkan,” ujar Agus, petugas jaga bagian peralatan tradisional anjungan Singkil. “Banyak pengunjung yang kagum dengan tampilan alat penangkap ikan dan peralatan tradisional ini,” tutur Agus saat itu. Pada peralatan adat, Singkil juga tampilkan peralatan pesta perkawinan dilengkapi foto foto pasangan Bupati Safradi bersama istri dan wakil bupati Dulmursid bersama istri yang mengenakan pakaian adat perkawinan namun miniatur reflika buaya dengan mulut terbuka di halaman anjungan Singkil menjadi plesetan yang bermakna lain yang terkesan buas. (b27)

Waspada/Tarmizi Ripan

PENGUNJUNG berdialog dengan penjaga stan tentang peralatan tradisional yang ditampilkan Singkil pada PKA VI di Taman Ratu Safiatuddin, Banda Aceh, Sabtu (28/9)



Jeungki Toup Pade Jadi Perhatian

Siswa SMPN-2 Bireuen Terima Beasiswa BIREUEN (Waspada): Ketua DPD PKS Bireuen M Fauzi bersama Wakil Sekretaris Yusriadi kembali menyerahkan beasiswa miskin untuk 10 siswa SMP 2 Bireuen. Bantuan Khusus Miskin (BKM) dalam bentuk beasiswa tersebut bersumber dari Kementerian Pendidikan dan Kebudayaan RI Jakarta dari hasil aspirasi Iskandar, anggota DPR RI dari Fraksi PKS Dapil Aceh. M Fauzi dalam samburtannya antara lain mengatakan, penyerahan bantuan beasiswa miskin sebagai kepedulian PKS untuk menunjang prestasi siswa miskin dalam mengikuti pendidikan jangan sampai putus sekolah. Bantuan beasiswa sebesar Rp360 ribu tiap siswa disalurkan melalui tabungan siswa masing-masing di kantor Pos Bireuen. Kepala SMPN 2 diwakili Agus berterima kasih kepada PKS Bireuen yang telah berkenan memilih sekolahnya mendapat 10 beasiswa BKM. (b12)

BIREUEN (Waspada): Dua warga negara asing (WNA) asal Australia, Byron Birch dan Corbin Carter, dikabarkan pada saat singgah ke anjungan Seuramoe Kabupaten Bireuen, di arena Pekan Kebudayaan Aceh VI di Taman Ratu Sultanah Safiattuddin, Banda Aceh, Juamt (27/ 9) langsung memperhatikan jeungki toup padee (alat tumbuk padi tradisional Aceh) yang diletakkan di bawah rumah adat Aceh perpaduan rumah Tgk Awe Geutah dengan modern. Kedatangan kedua warga asing saaat itu, awalnya kurang perhatian warga, namun pada saat mendekati jeunki toup padee, para penjaga dan petugas stan langsung mendekati dua warga asal negeri kanguru tersebut. “Kami kagum dengan alat ini (jeungki), alat ini benar-benar unik dan belum pernah kami melihat” kata Bryron Bich dengan Bahasa Inggris

Bocah SD Ditabrak Motor BIREUEN (Waspada): Muhammad Zikrul, seorang bocah berusia 8 tahun yang baru duduk di kelas I SDN I Kuala, Bireuen, dilarikan ke RSUD dr Fauziah, Bireuen, Sabtu (28/9) untuk dioperasi kaki kirinya akibat patah ditabrak pengendara sepeda motor Supra X yang tidak bertanggungjawab di pinggir jalan depan sekolahnya. Informasi yang diperoleh, seorang anak kelas I SD menderita patah kaki kiri setelah ditabrak seorang lelaki dewasa yang mengendarai sepedamotor Honda Supra X saat berada di pinggir jalan depan SDN I Kuala. Anak sulung dua bersaudara dari pasangan Safri, 39,-Nurleli, 33, warga Desa Lancok-Lancok, kecamatan setempat, sedang berdiri di pinggir jalan jalan hendak pulang. Tiba-tiba datang pengendara Supra X yang disebut-sebut sedang main HP sambil mengendarai kendaraan roda dua tersebut tiba-tiba menabraknya hingga patah kaki kiri. Setelah menabrak korban, pengendara langsung tancap gas meninggalkan bocah malang itu sendiri, warga yang melihat kejadian itu dari jarak jauh langsung berusaha mengejar, namun pelaku meloloskan diri. Dokter piket IGD RSUD Dr Fauziah Nofi mengatakan, kaki kiri Muhammad Zikrul patah dan juga menderita luka robek di pipi kanan atas. “Kita akan tangani korban di ruang bedah,” katanya. (cb02)

DUA warga negara Australia yang ditemani seorang warga Bireuen foto bersama di depan jeugki toup padee di anjungan Seuramoe Bireuen di arena PKA Banda Aceh, Jumat, (27/9)

Proyek Dinas PU Dan BLHK Tumpang Tindih LHOKSEUMAWE (Waspada) : Akibat tidak adanya koordinasi atau kurang membina hubungan kerjasama, menyebabkan pelaksanaan proyek Dinas PU dan BLHK Kota Lhokseumawe sering tumpang tindih di lapangan.

di pinggir dan di tengah badan jalan. Antara lain pelaksanaan proyek peningkatan jalan oleh Dinas Pekerjaan Umum di Kecamatan Banda Sakti telah tumpang tindih dengan pelaksanaan proyek pemugaran juga pengecatan seluruh pohon, trotoar dan taman baik yang berada di pinggir atau di tengah badan jalan. Hal itu dibenarkan Kepala Kantor BLHK Kota Lhokseumawe Nofendi melalui Sekretarisnya Faisal. Faisal mengatakan, proyek pengecatan pohon, trotoar dan taman kota di Jalan Malikussaleh, Jalan Panglateh dan Samudera tidak dapat dilaksanakan hingga tuntas. Karena berada tempat dengan pelaksanaan proyek peningkatan jalan oleh Dinas PU. Bahkan, kini nasib proyek tersebut terancam gagal dilaksanakan pada 2013, mengingat bangunan trotoar sudah hancur

dilindas proyek peningkatan jalan. Karena tidak adanya koordinasi kerja, pengecatan taman, trotoar dan taman jadi terkendala. Ini terancam gagal dan terpaksa dilaksanakan pada tahun mendatang, Hal serupa juga terjadi di Jalan Lancang Garam dan Merdek, proyek pembangunan saluran telah menghancurkan trotoar di sepanjang bibir jalan serta merusak taman di tengah jalan. Kadis PU Kota Lhokseumawe Zaidi melalui Sekretarisnya Nirwansyah mengakui di lapangan sejumlah proyek beradu tempat dengan proyek BLHK. Selama ini loading sektor Dinas PU sangat identik dengan kinerja BLHK, makanya tumpang tindih proyek terkadang tidak terhindari di lapangan. Sehingga untuk mencegah terjadinyatumpangtindihproyek, kedepanakanmelakukankoordinasi kerja dengan BLHK. (b16)

3 Bulan, 365 Guru Belum Terima Gaji Waspada/M Ishak

Nek Mah, Calhaj Tertua Miliki 10 Anak, 35 Cucu Dan 40 Piyud MELEMPAR senyum saat seseorang menegurnya menjadi kebiasaan Muslamah Binti Abdurrahman. Wanita berusia 85 tahun ini berasal dari Desa Kumuneng, Kecamatan Peureulak, Kabupaten Aceh Timur. Muslamah atau akrab disapa Nek Mah ini tercatat calon jamaah haji tertua dalam Kelompok Terbang (Kloter) I Embarkasi Banda Aceh yang diberangkatkan ke Tanah Suci, Minggu (29/9). Saat dijumpai Waspada, Nek Mah ini mengaku ke Tanah Suci berkat pengabdiannya dua anaknya, di mana musim haji tahun 2013 ini Nek Mah didampingi dua anaknya yakni Bukhari dan Rabimah. Nek Mah mengaku kini janda yang sudah me-miliki 10 putra-putri bersama suaminya, Muhammad Yasin bin Hasyim (almarhum). Selain memiliki 10 anak, Nek Mah dengan lancar mengaku memiliki 35 cucu dan 45 piyud (anak dari cucu). Meskipun telah berusia 85 tahun, namun Nek Mah mengaku masih bisa mendengar apapun sebagaimana pendengaran orang yang lebih muda darinya, namun Nek Mah mengaku nikmat mata mulai dicabut oleh Allah SWT sejak beberapa tahun yang lalu sehingga Nek Mah sekarang harus memanfaatkan alat bantu berupa kacamata untuk melihat. “Meunyo toe deuh lon kalon gata nyak, tapi meunyo jioh hana lon turi,” kata Nek Mah dalam bahasa Aceh yang artinya— jika dekat bisa saya lihat anda nak, tapi kalau jauh tidak saya kenal kamu nak. Nek Mah yang sesekali menepuk bahu Waspada yang mewawancarainya di tempat duduknya mengaku ke Tanah Suci untuk menunaikan rukun Islam yang kelima. Dia mengaku, setelah sampai nantinya di depan Ka’bah dirinya ingin memnanggil seluruh anaknya, cucunya dan puyudnya ke Tanah Suci. “Meunyo raseki dan panyang umu adak jeut aneuk lon bandum beutrok u Tanoh Auci—jika ada rezeki dan diberikan panjang umur kalau bisa seluruh anak dan cucu serta piyud daya sampai ke Tanah Suci,” kata Nek Mah. M Ishak

IDI (Waspada): Sebanyak 365 guru Baca Tulis Baca Quran (BTQ) yang tersebar dalam tiga kabupaten/kota di pantai timur Provinsi Aceh sudah tiga bulan belum menerima gaji. Meskipun hanya Rp550.000 per bulan, namun tenaga kontrak Dinas Pendidikan Aceh menuntut kejelasan jerih payahnya. “Tiga bulan terhitung Juli, Agustus hingga September 2013 gaji belum kami terima, bahkan nasib kami di tahun 2014 nanti juga belum jelas, apakah kontrak kami akan diperpanjang atau akan diputuskan. Jadi kami minta kejelasan dari Dinas Pendidikan Aceh,” kata Mahdi Junaidi, Minggu (29/9). Dia merincikan, data guru BTQ dari tiga kabupaten/kota

yang belum menerima gaji selama tiga bulan yakni, Kabupaten Aceh Tamiang memiliki 141 guru BTQ, Kota Langsa sebanyak 56 dan Kabupaten Aceh Timur memiliki 168 guru BTQ. “Kita sudah sering komunikasi dengan beberapa guru BTQ yang ada di Aceh Tamiang dan Kota Langsa, mereka (guru BTQ) mengaku sudah bosan keluar masuk ke bank mengecek jerih payah mereka,” kata Mahdi. Dia meminta Dinas Pendidikan Aceh bertanggungjawab atas belum cairnya gaji para guru BTQ, karena selama ini para tenaga pendidik di SD itu tidak memiliki pengharapan lain. “Jangan mentang-mentang kami dari dayah bisa seenaknya dipermainkan. Selama ini kami

sabar atas keputusan dan kebijakan Dinas Pendidikan Aceh yang kabur. “Ke depan harus jelas kebijakannya, apakah gaji kami sebulan sekali atau tiga bulan sekali!,” kata Mahdi seraya menandaskan selama ini para guru BTQ terkatung-katung dan terkadang sedih melihat hasil pengecekan di bank tidak bertambah saldonya. Kadis Pendidikan Aceh Timur Abdul Munir saat dikonfirmasi mengatakan, persoalan guru BTQ berada di bawah wewenang Dinas Pendidikan Aceh. Untuk gaji atau honor juga dibayar secara mekanisme oleh Dinas Pendidikan Aceh. “Itu wewenang Dinas Pendidikan Provinsi Aceh,” katanya. (b24)

Waspada/Abdul Mukthi Hasan

PENGENDARA sepedamotor menaiki tanjakan jalan di Desa Blang Guron, Gandapura, Bireuen, Minggu (29/9) yang hancur aspalnya dan dipenuhi lubang

Nasib Desa Pedalaman Tak Dipedulikan Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


yang diterjemahkan juru bahasanya kepada petugas di stan Bireuen. Kagumnya kepada alat penumbuk padi tersebut membuat kedua pria asing tersebut penasaran dan saat itu berkeinginan untuk mengunjungi Bireuen sekaligus melihat langsung tempat wisata di kabupaten Kota Juang, seperti, kawasan Batee Iliek, Cot Ppanglima, Krueng Simpo, Pantai Kuala Raja, Air Terjun Ceureuceuk, Pandrah. Selain itu dia juga mengaku akan melihat dan menikmati Sate Matang, Mie Aceh, kue Nagasari, masakan Kari kambing, Kopi, lincah (rujak mameh) Kutablang, dan Bingkang Kuala Raja. “Sayang kami tak bisa berlama-lama di sini, sebab visa kami hampir habis masa berlakunya,” tambah Corbin sambil melihatlihat anjungan Seuramboe Bireuen. (cb02)

Jangan Pecahkan Umat Karena Beda Partai Waspada/Abdul Mukthi Hasan

Lantaran memelihara penyakit missKomunikasi, kedua instansi pemerintah itu kerap tertimpa dampak buruk yang tiada akhirnya dalam menjalankan program pembangunan. Akan tetapi, dampak paling buruknya paling sering diterima BLHK sampai pernah menjadi hambatan yang membuat gagalnya pelaksanaan program kerja di lapangan. Apalagi pelaksanaan proyek jalan dan saluran oleh dinas terkait telah melindas serta menghancurkan bangunan trotoar

MUSLAMAH Binti Abdurrahman, 85,asal Kumuneng,Kecamatan Peureulak, Aceh Timur tampak tersenyum saat diabadikan gambarnya sesaat sebelum diberangkatkan ke Tanah Suci dari Asrama Haji Banda Aceh, Minggu (29/9)

WASPADA Senin 30 September 2013

GANDAPURA (Waspada): Sejumlah warga di pedalaman Gandapura, Bireuen, menuding pemerintah daerah tidak mau peduli kepada nasib dan kondisi pembangunan sarana umum di wilayah mereka. Sehingga, mereka merasa tidak mempunyai pemerintah walaupun negeri ini sudah lebih setengah abad merdeka. “Kami di sini (Buket Rata) masih anak negeri ini yang juga masuk dalam wilayah Bireuen, namun herannya kami tidak sedikitpun ada rasa peduli, tidak usah banyak kami sebutkan, lihat saja bagaimana jalan di desa kami ini sudah belasan tahun hancur dan sudah bertaburan kubang begini, namun tidak dipedulikan,” kata sejumlah warga Desa Blang Guron, Damakawan, Pante Sikumbong, Minggu (29/9).

Pantauan Waspada, Minggu (29/9), jalan Desa DamakawanBlang Guron yang pernah diaspal puluhan tahun lalu, kini terlihat aspalnya telah terkelupas dan bertaburan lubang nyaris mirip kubangan kerbau. Beberapa kendaraan roda empat yang melintasi saat itu terlihat harus berjalan zig-zag atau terseok-seok mengarungi lubanglubang besar di atas jalan kawasan dua desa tersebut. Menurut warga, masalah jalan atau sarana dan prasarana pembangunan di kawasan desa mereka tersebut sangat kental kesannya seolah-olah tidak ada urusan dengan pemerintah setempat. Bahkan, warga mengaku untuk memohon secara langsung atau melalui proposal supaya jalan desa diperbaiki seola-olah sudah habis katakatanya.

Kecuali itu, beberapa pejabat pemerintah periode sebelumnya maupun yang sekarang ini, pernah melihat langsung kondisi jalan kawasan tersebut, ketika mereka melintasi jalan kawasan tersebut, namun anehnya setelah itu kesannya seperti tidak terjadi apa-apa juga atau tidak pernah dilihatnya dan juga tidak sedikit ada rasa tersentuh hatinya untuk memperbaiki sarana umum tersebut di kawasan tersebut yang telah lama menjadi keluhan masyarakat. “Kami di pedalaman ini benar-benar terkesan dianaktirikan, jangankan kita mohon untuk diperbaiki yang sudah rusak parah seperti sekarang ini, kami memohon bantuan satu unit pompa air untuk mengaliri sawah saja, sulitnya tujuh belas setan,” kata Muhammad, warga setempat. (cb02)

BIREUEN (Waspada): Pemilihan Umum (Pemilu) untuk memilih anggota DPR, DPR Aceh dan DPR kabupaten merupakan sarana pendelegasian wewenang rakyat kepada wakilnya untuk mengisi lembaga legislatif yang diusung partai politik nasional maupun partai politik lokal. Namun, perbedaan “kendaraan” untuk menuju lembaga legislatif itu bukan berarti harus saling bermusuhan hingga terjadinya perpecahan di tengah masyarakat. “Jangan pecahkan umat hanya karena perbedaan partai,” ujar Pengurus Nahdhatul Ulama (NU) Kabupaten Bireuen, Zulkifli Nurdin, Minggu (29/9). Dia menyebutkan, perbedaan pilihan pada saat Pemilu juga bagian yang dari demokrasi

itu sendiri.“Pemilu tidak akan terjadi bila tidak ada kontestan dari berbagai partai politik, jadi mari kita jadikan Pemilu sebagai momentum untuk memperkuatsilaturahimantarcalonlegis-latifbukan untuk saling bermusuhan,” pinta Zulkifli. Zulkifli mengajak agar masyarakat juga jangan sampai terprovokasi dengan aksi provokatif yang dilakukan orang-orang yang tidak ingin suksesnya pemilihan umum di Kabupaten Bireuen, apalagi sampai terjadinya hal-hal melanggar hukum. Untuk mengwujudkan pemilu yang damai dan nyaman itu tentunya harus dilaksanakan sesuai koridor hukum yang mengaturnya. “Saya yakin bila kita taat hukum, maka semua tahapan pemilu akan berlangsung sukses,” ucapnya. (b17)

Film Profil Bireuen Ditayangkan Di PKA BANDA ACEH (Waspada): Panggung utama Seuramoe Bireuen selain menampilkan berbagai senin budaya tradisionil Aceh, juga menayangkan film dokumenter profil pembangunan Kabupaten Bireuen sebagai kota segi tiga emas di Aceh. Kabag Humas Setdkab Bireuen Farhan Husin sebagai koordinator anjungan Seuramoe Birteuen menjelaskan, film dokumenter Bireuen yang digarap Muhammad MY dibantu Hamdani berisi tayangan Bireuen secara keseluruhan mulai darti sejarah perjuangan para pejuang melawan penjajah. Hijrahnya Presiden RI pertama Soekarno ke Bireuen 18 Juni 1948 setelah ibu kota RI kedua Jogyakarta jatuh dikuasai Belanda, selama seminggu Bireuen menjadi ibu kota RI ke-3 dan rumah kediamanan Panglima Divisi X Komendemen Sumatera Langkat dan Tanah Karo (Pendopo Bupati Bireuen) sekarang menjadi Istana Presiden RI menmgendalikan Republik Indonesia dalam keadaan darurat. Sayangnya, sejarah Bireuen yang memiliki

andil besar dalam mempertahankan Republik Indonesia ibarat benang merah yang terputus tidak tersurat dalam sejarah Republik Indonesia. Film berdurasi 26 menit juga menayangkan kegiatan pembangunan sejak Bireuen dipimpin Bupati Hamdani Raden, Mustafa A Glanggang, Nurdin Abdurrahman dan bupati sekarang Ruslan M Daud, sektor eksplorasi berbagai potensi, mulai sektor pertanian, perkebunan, perekonomian, pendidikan dayah, budaya dan pariwisata ditayangkan setiap malam selama berlangsungnya PKA-6 di Tanman Ratu Saifiatuddin Banda Aceh. Hal ini sangat penting dipromosikan agar Bireuen yang semakin dikenal di berbagai sektor akan merangsang investor asing untuk menanamkan modalnya di Bireuen. Bidang pendidikan Bireuen dibagi dua zona, Kabupaten Bireuen bagian barat sebagai zona pendidikan dayah dan bagian timur sebagai zona pendidikan umum menjadi ciri khas Kabupaten Bireuen. (b12)

Petani Ancam Bunuh Gajah Keng Liar BIREUEN (Waspada): Sejumlah warga di kawasan pedalaman Juli, Bireuen sepertinya sudah habis kesabaran terhadap gangguan gajah liar selama ini yang kesannya sampai sekarang belum tertangani sehingga mereka mengancam akan melukai dan membunuh seekor gajah liar besar yang mereka namakan gajah keng yang kerap masuk ke desa mereka dan merusak tanaman milik para petani di kawasan tersebut, bila pihak terkait tidak segera mengusir atau memindahkannya dari kawasan tersebut. Informasi yang diperoleh, Minggu (29/9), seekor gajah liar yang dinamakan gajah keng kembali masuk ke kawasan km 35 pedalaman Kecamatan Juli dan kembali mengobrak-abrik tanaman milik para petani. Warga dan petani dikabarkan mulai panik dan resah karena gangguan binatang yang

memiliki belalai tersebut dianggap sudah keterlaluan sehingga ada warga dan petani yang mengancam akan melukai atau membunuh binatang berbadan besar tersebut. “Kami telah banyak rugi dengan gangguan gajah ini, kalau tidak segera diatasi jangan salahkan kami bila terjadi sesuatu dengan binatang liar yang dilindungi itu,” kata warga, Minggu (29/9). Pj Keuchik Pante Peusangan Syamsuddin membenarkan warga dan petani seperti sudah habis kesabaran dengan gangguan gajah, makanya ada yang mengancam akan melukai dan membunuh gajah tersebut, namun dia berharap tidak sampai terjadi hal itu. “Saya memohon kepada pihak terkait supaya segera mengusir atau memindahkan gajah keng liar yang sekarang masih berkeliaran di kawasan desa kami ini,” harapnya. (cb02)

Polres Langsa Beri Pemahaman Safety Riding LANGSA (Waspada): Kasat Lantas Polres Langsa, Dony Eko Wicaksono memberikan pemahaman Safety Riding kepada puluhan pelajar SMP dan SMA yang tergabung dalam Palang Merah Remaja (PMR) yang sedang mengikuti Jumpa Bahkti Gembira (Jumbara) PMI Cabang Langsa di aula SMPN 6 Langsa, Sabtu (28/9). Pada kesempatan itu, Kasat Lantas yang baru menggantikan AKP Junaeddy ini memberikan materi dasar-dasar mengemudi yang baik. “Pelajar harus bisa menjadi agen perubahan dan contoh bagi pelajar yang lain untuk menaati ramburambu dan tertib dalam berlalu lintas. Untuk itu kepada anggota PMR Langsa yang terdiri dari pelajar SMP dan SMA sederajat bisa memberikan sosialisasi kepada sahabat di sekolahnya, guna membangun gerakan mendukung keselamatan pengemudi di jalan lalu lintas,” katanya. Dengan demikian, terangnya, petugas polisi lalu lintas yang berada di lapangan dalam menjalankan tugas mendapat dukungan dari kelompok organisasi dan masyarakat untuk samasama menyelamatkan pengemudi dengan cara melakukan sosialisasi kepada pelajar yang lain, seperti apa yang dilakukan PMI Kota Langsa saat ini. Dony juga meminta memahami etika dalam berkendara dan rambu-rambu lalu lintas. Etika

mengemudi harus memahami tentang lajur dan jalur cara menyalip berkendaraan dengan aturan yang menghargai orang lain dan sebaiknya mengalah lebih dahulu dan mengutamakan orang lain untuk mendahului. “Posisi duduk pengemudi harus juga diperhatikan keseimbangan saat berkendara, cara berboncengan dan jangan berboncengan lebih dari yang sudah menjadi ketentuan. Begitu juga helm menjadi bagian keselamatan penting bagi pengemudi dari benturan kepala, untuk itu gunakanlah helm bukan karena takut sama Polantas. Selain itu, utamakan pejalan kaki menyeberang sebagai bentuk penghargaan untuk pengguna jalan yang lebih kita utamakan,” pungkasnya. Setelah melakukan presentasi, Kasat Lantas melakukan diskusi tentang safety riding dan menonton film berlalu lintas dan korban kecelakaan lalu lintas. Kemudian, pertemuan ditutup dengan aksi turun ke jalan di beberapa perempatan jalan di seputaran kota Langsa, di mana anggota PMR membagikan atribut pada pengguna jalan berupa semacam pengingat safety riding, di antaranya kipas bergambar helm dan pocong serta stiker yang dibagi langsung di bawah pengawasan petugas polisi lalu lintas kota Langsa bekerjasama dengan PMI Kota Langsa. (m43)


KASAT Lantas Polres Langsa Dony Eko Wicaksono ketika memberikan pemahaman Safety Riding kepada pelajar SMP dan SMA yang tergabung dalam Palang Merah Remaja (PMR) yang sedang mengikuti Jumpa Bahkti Gembira (Jumbara) PMI Cabang Langsa di aula SMPN 6 Langsa, Sabtu (28/9)

Waspada,senin 30 september 2013