Issuu on Google+

Berastagi 19-29 C

R. Prapat 25-320C

Parapat 19-28 0C

P. Siantar 18-270C

Sibolga 22-30 0C

0

Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Senin Medan 24-320C

BMKG Polonia

http://epaper.waspadamedan.com

SENIN, Pahing, 11 Oktober 2010/3 Zulqaidah 1431 H

No: 23293 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-8, B1-8, C1-12)

Harga Eceran: Rp2.500,-

1,6 Juta Botol Air Zamzam Dibagikan

Kereta Makkah Sekali Angkut 3.000 Jamaah KERETA yang menghubungkan beberapa tempat suci di sekitar Makkah sedang diujicoba sebelum digunakan untuk mengangkut jamaah haji. Kereta yang disebut Mashair Railway dan akan menghubungkan Mina, Arafat, Muzdalifah dan Makkah ini diujicoba selama 30 hari. Dibangun dengan biaya 6,5 miliar riyal, kereta itu akan memiliki kapasitas angkut 72 ribu jamaah setiap jam. Sembilan stasiun telah dibangun di Arafah, Mina, dan Muzdalifah. Tiap tempat itu dibangun tiga stasiun. Lanjut ke hal A2 kol. 6

arabnews

MAKKAH, Arab Saudi (Waspada): Zamazemah United Office mulai Sabtu (9/10) telah mendistribusikan 1.600.000 botol Air Zamzam kepada para Jamaah musim Haji tahun ini. Dalam satu pernyataan-nya kepada The Saudi Press Agency, kepala Zamazemah Office, Sulaiman AboGaliah, mengatakan bahwa setiap jamaah akan menerima satu botol Air Zamzam dengan ukuran 330 ml. (spa/m07)

Menteri Agama Lepas Kloter I Embarkasi Medan

Pemondokan 500 M Dari Masjid Nabawi MEDAN (Waspada): Menteri Agama RI H Suryadharma Ali melepas jamaah calon haji (calhaj) Kloter 1, Senin(11/10) pukul 08:30 di Asrama Haji Embarkasi Medan. Selain Menag, turut melepas jamaah Kloter 1 asal Labuhanbatu tersebut Gubsu H Syamsul Arifin, Kepala Kementerian Agama Provinsi Sumatera Utara Drs H Syariful Mahya Bandar, MAP serta pejabat lainnya. Ketua Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan, Drs H Syariful Mahya Bandar, MAP bersama Sekretaris Drs H Abd Rahman, MA melalui Humas Drs H Sazli di Aula Asrama Haji, Minggu (10/10), mengatakan, sesuai rencana yang dijadwalkan, Kemenag RI tiba di Bandara Polonia pukul 08:00, bersama rombongan, selanjutnya menuju Asrama Haji, kemudian melepas para jamaah Kloter 1 yang akan diberangkatkan siang harinya. Usai pelepasan yang dilaksanakan menteri agama, seluruh jamaah kembali lagi ke kamar masing-ma-

sing untuk menantikan proses keberangkatan siang harinya. “Jadwal yang diterima panitia, usai menteri agama melaksanakan acara pelepasan jamaah, maka seluruh Calhaj kembali lagi ke kamar masing-masing untuk bersiapsiap berangkat siang harinya. Untuk mempermudah proses keberangkatan, tahun ini, proses boarding pass para calhaj oleh petugas imigrasi dilaksanakan dalam bus, sehingga saat seluruh calhaj berada di bandara keadaan sudah tidak sibuk lagi dan diyakini situasi akan lebih steril. Sedangkan jadwal take off pesawat dijadwalkan pukul 14:00,” kata Sazli sembari menambahkan data terakhir jumlah Calhaj seluruhnya dari Embarkasi Medan sebanyak 8.330 orang.

Lanjut ke hal A2 kol. 5

IBADAH HAJI

Dalam Perspektif Perbandingan Hajj: unique among the world’s great Oleh pilgrimages, the hajj is in ways also the Nur A. Fadil Lubis most important. Even compared to the (Rektor IAIN–SU) ancient and highly developed international pilgrimage systems of Christianity and Hinduism, the hajj is remarkable in its doctrinal centrality, its geographical focus, and its historical continuity (Oxford Encyclopedia of Modern Islamic World) HAJI, ibadah penting dan puncak dalam agama Islam, merupakan fenomena unik di antara ritual sejenis dalam agama-agama besar dunia. Ibadah ini dalam banyak hal juga adalah yang paling penting. Bahkan ketika dibandingkan dengan sistem ritual sejenis, baik yang dijalankan di wilayah terbatas pada zaman kuno maupun yang sudah berkembang pesat secara internasional pada era modern di kalangan agama Kristen dan Hindu, dua agama dunia yang ritual wisata relijiusnya cukup bertahan dan berkembang. Lanjut ke hal B8 kol. 1

Waspada/ Anum Saskia

CALHAJ asal Labuhanbatu, Koyimah Nasrun, 102, dan Siti Audita, 21, di Asrama Haji Embarkasi Medan.

Usia 102 Tahun Baru Bisa Berangkat Haji

Waspada/Surya Efendi

KLOTER PERTAMA MASUK ASRAMA: Dua jamaah calon haji melepas rindu dengan keluarga lewat pagar besi ketika Kloter I asal Labuhan Batu masuk Asrama Haji Medan, Minggu (10/10). Kloter I yang mengangkut 455 jamaah ini akan dilepas Menteri Agama RI dari bandara Polonia Medan hari ini, Senin (11/10) menuju tanah suci.

2.000 Pengungsi Banjir Wasior Tiba Di Manokwari Sudah 144 Orang Tewas, 103 Hilang JAKARTA (Antara): Kementerian Perhubungan menyebutkan, Minggu (10/10) malam sekitar pukul 22:45 WIT, Kapal Pelni Nggapulu yang membawa sebanyak 2.000 pengungsi dari Wasior tiba di Manokwari, Provinsi Papua Barat. Kepala Pusat Komunikasi Publik Kementerian Perhubungan Bambang S Ervan di Jakarta menjelaskan, para pengungsi tersebut akan diatur penampungannya oleh Tim Penanggulangan Bencana Banjir Bandang Wasior yang dipusatkan di Pangkalan Utama TNI-AL Manokwari. Diperkirakan sebagian besar pengungsi yang dibawa oleh KM Nggapulu tersebut

akan ditampung di Balai Latihan Kerja (BLK) Kehutanan Posko Pusat TNI-AL “Setelah mereka didata, selanjutnya bagi pengungsi yang berkeinginan kembali ke kampung halamannya masing-masing akan difasilitasi pemulangannya dengan angkutan laut atau moda transportasi ainnya,” kata Bambang. Bencana banjir bandang yang menghantam distrik Wasior hingga sepekan, berdasarkan data Badan Nasional Penanggulangan Bencana (BNPB) telah merenggut korban 144 orang tewas, luka berat 179 orang, luka ringan 641 orang dan hilang 103 orang. Sedangkan jumlah pengungsi yang masuk Manokwari

Walikota Harus Cari Solusi Atasi Kemacatan Lalulintas Walikota Medan diminta segera mencarikan solusi nyata guna mengatasi kemacatan lalulintas yang dinilai semakin parah dan mengkhawatirkan. B1

Muhammad Hafes Pimpin PKS Sumut

Sistem Pendidikan Dinilai Gagal Bentuk Karakter Siswa Sistem pendidikan di Indonesia dinilai gagal membentuk karakter siswa menjadi orang baik yang ditandai dengan banyaknya kasus korupsi. B1

nokwari dengan mengerahkan empat kapal perintis untuk mengevakuasi pengungsi dari Wasior ke Manokwari. Keempat kapal perintis tersebut, yaitu KM Delta Mas, KM Papua Tiga, KM Merantik, serta KM Bintang 23. Selain itu, empat kapal perintis, juga ada satu Kapal Pelni, yaitu KM Nggapulu dan dua kapal swasta, yaitu KM Grasilia dan KM Kalimumu. Di samping itu, juga satu kapal negara navigasi yaitu KM Mahkota dan dua unit kapal SAR. Sementara personel Satgas SAR 60 orang telah dikirim untuk membantu Badan Nasional Penanggulangan Bencana.

Lanjut ke hal A2 kol. 5

Kejagung Perlu Keluarkan Deponeering Perkara Bibit-Chandra JAKARTA (Antara): Ketua Mahkamah Konstitusi (MK) Mahfud MD berpendapat sebaiknya Kejaksaan Agung (Kejagung) mengeluarkan deponeering atau mengesampingkan perkara demi kepentingan hukum untuk perkara Bibit Samad Rianto dan Chandra M Hamzah. “Alasannya Surat Ketetapan Penghentian Penuntutan (SKPP) Bibit-Chandra yang dikeluarkan Kejagung, tadinya dimaksudkan untuk tidak membawa perkara itu ke pengadilan,” katanya melalui pesan singkat, di Jakarta, Minggu (10/10) malam. Pendapat tersebut disampaikan Mahfud terkait putusan Mahkamah Agung yang tidak menerima permohonan

BHD Resmi Pensiun

BACA DI HALAMAN DALAM

Dewan Piminan Pusat Partai Keadilan Sejahtera (PKS) menetapkan sekaligus melantik H Muhammad Hafes, sebagai Ketua Umum Pimpinan Wilayah PKS Sumut periode 2010-2015. B2

hingga 10 Oktober ini mencapai 6.224 orang dan diperkirakan, hingga saat ini tersisa sekitar 200 orang yang ditampung di lokasi pengungsian di Wasior. Rumah yang hancur mencapai sekitar 1.000 unit. Jumlah bantuan berupa bahan makanan, obat-obatan, tenda dan peralatan evakuasi di antaranya dari bantuan Presiden senilai Rp2 miliar. Kemudian dari BNPB sebanyak 13 ton peralatan evakuasi, peralatan rumah tangga dan handuk, dari Bank Mandiri berupa 100 koli pakaian dan selimut. Kementerian Perhubungan sendiri memberikan bantuan berupa fasilitas pengangkutan pengungsi dari Wasior ke Ma-

USIA senja ternyata bukan alasan untuk mengurungkan niat melaksanakan ibadah haji, apalagi di usia itulah segenap kemampuan keuangan baru bisa terpenuhi. Demikian diungkapkan Koyimah Nasrun Binti Abdullah seorang Calhaj asal Labuhanbatu yang tergabung dalam Kloter 1. Perempuan yang pernah berprofesi sebagai dukun melahirkan di kampungnya itu menyebutkan, Minggu (10/10),

Waspada/Mursal AI

SALAH satu bayi yang lahir bertepatan pada 10-10-10.

Bayi Medan Yang Lahir 10-10-10 BAGI sebagian orang, tanggal 10 bulan 10 tahun 2010 merupakan tanggal ‘cantik’ dan unik. Tanggal ini begitu mudah diingat, sehingga banyak orang memilih tanggal dan menjadikan tanggal ini untuk membuat suatu momen atau peristiwa yang mungkin tak bisa dilupakannya. Seperti halnya Riska Yurensa, 24, warga Komplek Tasbih Jl. Setia Budi Medan. Riska memilih tanggal 10-10-2010 ini menjadi tanggal kelahiran anak ketiganya. Bahkan, jam kelahiran bayi lucunya inipun masih berkaitan dengan angka sepuluh, yakni pukul 10:10. Riska melahirkan secara caesar di RSIA. Rosiva Jl. Bangka No. 15 Medan. Lanjut ke hal A2 kol. 2

JAKARTA (Waspada): Sesuai Undang-Undang Polri, Kapolri Jenderal Pol Bambang Hendarso Danuri, Minggu (10/10), resmi pensiun. Terkait hal tersebut, Kabidpenum Mabes Polri Marwoto Soeto mengatakan tidak ada perpanjangan masa jabatan Kapolri Jenderal Pol Bambang Hendarso Danuri. “Nggak ada beliau perpanjangan, tugas rutin tetap beliau yang jalankan,”ucapnya saat dihubungi wartawan, Minggu (10/10). Lebih lanjut perwira menengah ini menambahkan, tidak akan ada pejabat harian. Saat ditanya hingga kapan BHD akan menjalankan tugas sebagai Kapolri?, Marwoto menjawab sampai ada pergantian pucuk pimpinan di Polri. “Yang penting Oktober selesai,” paparnya. Saat ini Marwoto mengaku

Lanjut ke hal A2 kol. 3

Peninjauan Kembali (PK) perkara Bibit S Rianto dan Chandra M Hamzah yang diajukan oleh Kejaksaan Agung. Mahfud menambahkan, di samping itu ada perkembangan baru setelah dikeluarkannya SKPP Bibit-Chandra oleh Kejaksaan Agung, Anggodo Widjoyo yang melaporkan adanya pemerasan oleh pimpinan Komisi Pemberantasan Korupsi, ternyata diputus bersalah dan dijatuhi pidana. Karena itu, kata dia, jika perkara Bibit-Chandra itu tetap diteruskan ke pengadilan, maka sebaiknya Kejagung menunggu dahulu sampai vonis Anggodo memiliki kekuatan hukum tetap (inkracht).

Lanjut ke hal A2 kol. 3

KBRI Siapkan Permohonan Grasi Atas Vonis Gantung Dua WNI

Antara

INDRA Bekti mempersunting Adilla Jelita dan melangsungkan akad nikad dan resepsi pernikahan Minggu (10/10).

Menikah 10-10-10 Indra Bekti Masuk Indonesia Book of Records JAKARTA(Waspada): Pernikahan presenter Indra Bekti dengan Adilla Jelita, yang dilakukan pada tanggal 10-102010, ikut dicatat oleh Indonesia Book of Records atau IBOR. Pernikahan keduanya dianggap sebagai pernikahan unik di mana semua memiliki angka serba sepuluh. Tengok saja, acara ini digelar pada tanggal 10, bulan 10, dan tahun 2010. Untuk ijab kabul digelar pukul 10 kurang 10 atau 09.50, dengan mas kawin 10 dinar. Tak hanya itu, acara resepsi pernikahan yang digelar di gedung

Lanjut ke hal A2 kol. 7

KUALA LUMPUR ( Waspada): Kedutaan Besar Republik Indonesia (KBRI) di Malaysia menyiapkan permohonan grasi kepada Raja Malaysia atas ditolaknya usul naik banding terhadap vonis hukuman mati gantung terhadap Tarmizi Yacob dan Bustamam bin Bukhori oleh Mahkamah Agung Malaysia.

Lanjut ke hal A2 kol. 5

erampang Seramp ang - Ponten 10 baru paten - He...he...he...

P.Sidimpuan 19-29 0C

R.Prapat 25-32 0C

Penyabungan 19-28 0C

Berastagi 18-270C

Sibolga 22-30 C

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Medan 24-32 0C

0

Hujan guntur

BMKG Polonia

Waspada/Surya Efendi

MEDAN (Waspada): Menteri Agama RI H Suryadharma Ali akan melepas jamaah calon haji (calhaj) Kloter 1 bersama Gubsu H Syamsul Arifin, Kepala Kementerian Agama Provinsi Sumatera Utara Drs H Syariful Mahya Bandar, MAP serta pejabat lainnya, Senin (11/10) pukul 08:30 di Asrama Haji Embarkasi Medan. Ketua Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan, Drs H Syariful Mahya Bandar, MAP bersama Sekretaris Drs H Abd Rahman, MA melalui Humas Drs H Sazli di Aula Asrama Haji, Minggu

(10/10), mengatakan, sesuai rencana yang dijadwalkan, Kemenag RI tiba di Bandara Polonia pukul 08:00, bersama rombongan, selanjutnya menuju Asrama Haji, kemudian melepas para jamaah Kloter 1 yang akan diberangkatkan siang harinya. Usai pelepasan yang dilaksanakan Menteri Agama, seluruh jamaah kembali lagi ke kamar masing-masing untuk menantikan proses keberangkatan siang harinya. “Jadwal yang diterima panitia, usai menteri agama

KERETA yang menghubungkan beberapa tempat suci di sekitar Makkah sedang diujicoba sebelum digunakan untuk mengangkut jamaah haji. Kereta yang disebut Mashair Railway dan akan menghubungkan Mina, Arafat, Muzdalifah dan Makkah ini diujicoba selama 30 hari. Dibangun dengan biaya 6,5 miliar riyal, kereta itu akan memiliki kapasitas angkut 72 ribu jamaah setiap jam. Sembilan stasiun telah dibangun di Arafah, Mina, dan Muzdalifah. Tiap tempat itu dibangun tiga stasiun. Kereta api itu merupakan proyek terbesar kedua yang berhasil dikerjakan Departemen Dalam Negeri Arab Saudi setelah pembangunan jembatan jumrah yang sarat teknologi tinggi di Mina dengan biaya 4,5 miliar riyal. Wakil Menteri Dalam Negeri Habib Zain Al-Abidine, mengatakan pada tahap pertama akan disediakan 10 rangkaian kereta yang masing-masing panjangnya 300 meter. ‘’Setiap kereta akan membawa sekitar 3.000 penumpang,’’ katanya. Namun sejauh ini pemerintah Saudi belum menetapkan harga tiket kereta tersebut. Dengan kereta berkecepatan

Lanjut ke hal A2 kol 6

Kemarin warga Desa Buket Teukueh, Kec. Kota Juang, Kab. Bireuen, ‘mengusir’ sekaligus mengultimatum para pengikut aliran sesat Millata Abraham untuk tidak lagi menempati gedung Sanggar Kegiatan Belajar (SKB). Karena kawasan itu juga wilayah desa mereka dan tidak mau orang yang mereka anggap telah murtad ditempatkan dalam wilayah desa mereka. “Kami warga Desa Buket Teukeuh minta kepada pengikut aliran sesat untuk angkat kaki dari SKB yang juga kawasan desa kami,” kata Tgk Imum Desa Buket Teukeuh, Tgk Musa Ibrahim kepada wartawan di komplek SKB Bireuen, Minggu (10/10) sekitar pukul 15.30 WIB. Didampingi sejumlah warga dan geuchiek desa setempat Zulkifli, Tgk Musa Ibrahim mengatakan, di tempat para orang yang diduga telah menggadaikan akidah haram ditempatkan di desa mereka. “Kami tidak pernah menerima

laporan kalau pengikut aliran Millata Abraham itu untuk tinggal sementara dalam wilayah desa kami, tentu warga kami tak mau menerimanya,”

tegas Zulkifli yang dibenarkan sejumlah warganya. Menurutnya, warga desanya mengultimatum memberi waktu kepada para pengikut

aliran sesat itu untuk segera angkat kami dari desa mereka dan diberi waktu mulai pukul

Lanjut ke hal A2 kol 7

Hari Ini, Calhaj Pidie Jaya, Aceh Tengah Dan Bener Meriah Take Off BANDA ACEH (Waspada): Jamaah Calon Haji (Calhaj) Kabupaten Pidie Jaya tahun 1431 H/2010 M, yang bergabung dalam kloter I Embarkasi Banda Aceh bersama calhaj dari Kabupaten Aceh Tengah dan Bener Meriah, dijadwalkan take off, Senin (11/10) hari ini sekira pukul 15:00 melalui Bandara Sultan Iskandar Muda (SIM) Blang Bintang. Karenanya, sejak Minggu (10/10) kemarin 320 orang calhaj asal tiga kabupaten itu telah memasuki Asrama Haji Banda Aceh. Mereka terdiri dari 120 orang Pidie Jaya, 110

Aceh Tengah, dan 88 Bener Meriah serta 2 orang jamaah Kota Banda Aceh, ungkap Kepala Kantor Kementerian Agama (Kemenag) Kabupaten Pidie dan Pidie Jaya, Drs. H. Amiruddin kepada Waspada, di sela-sela kesibukannya mendampingi calhaj di Halaman Masjid Raya Baiturrahman, Banda Aceh, Minggu (10/10) siang. Ditanya khusus jumlah jamaah calhaj Kabupaten Pidie Jaya yang berangkat ke tanah suci musim tahun ini,

Lanjut ke hal A2 kol 2

Warga Paluta Ancam Demo Besar-besaran

Waspada/Muhammad Riza

OMBAK: Seorang warga Tanjong Harapan, Kec, Kota Sigli sedang memperhatikan pecahan ombak saat menghantam badan jalan, Minggu (10/10).

Pasang Purnama Rendam Ratusan Rumah Di Aceh Timur Dan Pidie BAGOK, Aceh Timur (Waspada): Pasang besar purnama dalam beberapa hari terakhir telah meresahkan warga, Minggu (10/10). Pasalnya, akibat dari pasang besar itu, ratusan rumah terendam

IBADAH HAJI

di beberapa desa dalam Kecamatan Nurussalam—Bagok, Kab. Aceh Timur. Sementara di Pidie, belasan rumah juga terendam akibat pasang purnama tersebut. Selain berakibat teren-

damnya perkampungan warga di Desa Teupin Pukat dan Kuala Bagok, serta beberapa desa lainnya, akibat air pasang laut itu, ratusan pelajar dari

Lanjut ke hal A2 kol 3

MEDAN ( Waspada): Ribuan penduduk Simangambat dan Ujung Batu (dulu Kab. Tapanuli Selatan) Kab. Padanglawas Utara mengancam akan melakukan aksi besar-besaran terkait sengketa tanah adat dengan PT First Mujur Plantation & Industry yang hingga kini tidak selesai, sementara Pemkab maupun DPRD setempat tidak serius menanggainya. Hal itu ditegaskan sejumlah warga Simangambat dan Ujung Batu di Medan, Jumat (8/10) didampingi kuasa hukumnya H. Hamdani Harahap, SH, M.Hum serta Marasamin Ritonga, SH. Dikatakan, rencana aksi besar-besaran tersebut disebab PT FMPI tetap saja tidak bersedia menggantirugi, sementara Pemkab Paluta yang turut terlibat dalam perjanjian antara masyarakat dan perusahaan tersebut ternyata tidak melakukan upaya dengan tujuan agar PT FMPI menyelesaikannya kepada masyarakat. Utusan maupun perwakilan masyarakat Simangambat

Pisang Aneh Berbuah Dari Tengah Batang

Dalam Perspektif Perbandingan Oleh Nur A. Fadil Lubis (Rektor IAIN–SU) Hajj: unique among the world’s great pilgrimages, the hajj is in ways also the most important. Even compared to the ancient and highly developed international pilgrimage systems of Christianity and Hinduism, the hajj is remarkable in its doctrinal centrality, its geographical focus, and its historical continuity (Oxford Encyclopedia of Modern Islamic World) Haji, ibadah penting dan puncak dalam agama Islam, merupakan fenomena unik di antara ritual sejenis dalam agama-agama besar dunia. Ibadah ini dalam banyak hal juga adalah yang paling penting. Bahkan ketika dibandingkan dengan sistem ritual sejenis, baik yang dijalankan di wilayah terbatas pada zaman kuno maupun yang sudah berkembang pesat secara internasional pada era modern di kalangan agama Kristen dan Hindu, dua agama dunia yang ritual wisata relijiusnya cukup bertahan dan berkembang. Lanjut ke hal B8 kol 1

Antara

CALHAJ ACEH KELUARKAN BENDA CAIR . Salah seorang calon haji mengeluarkan botol bersisi cairan dari kopornya menyusul larangan membawa barang cair dari pantia haji di Asrama Haji, Banda Aceh, Minggu (10/10). Sebanyak 325 calon haji kloter pertama dari 13 kloter memasuki asrama haji dan dijadwalkan berangkat menuju Makkah hari ini (Senin 11 Oktober 201).

Pengikut Aliran Sesat Masih Banyak

BIREUEN (Waspada): Meski pengikut aliran sesat di Kabupaten BirLanjut ke hal A2 kol 1 euen sebagian sudah disyahadatkan, namun hingga Minggu (10/10) diperkirakan masih banyak berdomisili di daerah itu, demikian informasi Waspada peroleh kemarin.

Kereta Makkah Sekali Angkut 3.000 Jamaah

ISSN: 0215-3017

Terbit 28 Halaman (A1-8, B1-8,C1- 12) z zHarga Eceran: Rp 2.500,-

KLOTER PERTAMA MEDAN MASUK ASRAMA: Dua jamaah calon haji melepas rindu dengan keluarga lewat pagar besi ketika Kloter I asal Labuhan Batu masuk Asrama Haji Medan, Minggu (10/10). Kloter I yang mengangkut 455 jamaah ini akan dilepas Menteri Agama RI dari bandara Polonia Medan hari ini, Senin (11/10), menuju tanah suci.

Take Off Pukul 14:00

Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999)

http://epaper.waspadamedan.com

SENIN, Pahing, 11 Oktober 2010/3 Zulqaidah 1431 H z No: 23293 * Tahun Ke-64

Menag Lepas Kloter 1 Medan

Harian Umum Nasional Terbit Sejak 11 Januari 1947

Waspada/Mursal

Bayi yang dilahirkan Riska Yurensa, 24, warga Komplek Tasbih Jl. Setia Budi Medan pada tanggal 10-10-2010.

Bayi Medan Yang Lahir 10-10-’10 BAGI sebagian orang, tanggal 10 bulan 10 tahun 2010 merupakan tanggal ‘cantik’ dan unik. Tanggal ini begitu mudah diingat, sehingga banyak orang memilih tanggal dan menjadikan tanggal ini untuk membuat suatu momen atau peristiwa yang mungkin tak bisa dilupakannya. Seperti halnya Riska Yurensa, 24, warga Komplek Tasbih Jl. Setia Budi Medan. Riska memilih tanggal 1010-2010 ini menjadi tanggal kelahiran anak ketiganya. Bahkan, jam kelahiran bayi lucunya inipun masih berkaitan dengan angka sepuluh, yakni pukul 10:10. Riska melahirkan secara caesar di RSIA. Rosiva Jl. Bangka No. 15 Medan. “Ini kemauan saya, dokternya pun menganjurkannya tanggal segini. Menurut saya tanggal ini mudah diingat.

Lanjut ke hal A2 kol 5

S A N G Pe n c i p t a , Allah SWT, tak hentihentinya menunjukkan kebesaran-Nya kepada manusia sebagai umatNya. Karena bila dengan kehendak-Nya, apa yang tidak dapat diterima akal dapat saja terjadi. Seperti buah pisang satu ini misalnya. Secara logika tak mungkin

Lanjut ke hal A2 kol 2

Waspada/Irwandi MN

Seorang warga menunjukkan pisang yang berbuah dari tengah batangnya.

dan Ujung Batu tersebut adalah Tanaim gelar Tongku Raja Adil Hasibuan, Syahrin Hasibuan, Rokkaya Sutan Siregar, dan lainnya selaku utusan 33 desa. Sementara, Marasamin Ritonga, menjelaskan, tanah adat adat yang diserahkan kepada perusahaan (PT FMPI) itu seluas kurang lebih 12 ribu hektare. Namun ternyata, 2003 perusahaan tersebut merambah hingga di luar HGU nya, sehingga masyarakat pun menuntut supaya lahan rambahan perusahaan di luar HGU tersebut segera dikembalikan. Maka, lanjut Marasamin, pada 2005 diwujudkan sebuah perjanjian, di antaranya HGU akan diukur ulang, dan oleh BPN pengukuran ulang dilaksanakan. Pada pengukuran ulan tersebut disaksikan semua pihak, baik pihak perusahaan, masyarakat, Pemkab, DPRD serta elemen terkait lainnya. ‘ ’ Te r n y a t a d a r i h a s i l pengukuran tersebut terjadi

Lanjut ke hal A2 kol 3

F-PD DPRD P.Sidimpuan Sinyalir Dana Fogging Tak Disalurkan

Nikah massal pada 10-10-’10 di China.

Reuters

Ramai-ramai Menikah Pada 10-10-’10 BAGI mereka yang percaya atau menyukai takhayul, hari Minggu (10/10) dianggap sebagai tanggal “keramat.” Itulah sebabnya pada tanggal 10 bulan 10 tahun 2010, banyak pasangan pengantin di penjuru dunia melangsungkan pernikahan. Baik orang Barat maupun orang Timur yakin hari ini adalah hari keberuntungan untuk memulai salah satu babak yang penting bagi hidup mereka. Anna Ryan di Sydney, Australia, adalah seorang wanita yang percaya betul dengan peruntungan horoskop dan dia meyakini bahwa hari Minggu kemarin adalah hari terbaik. Dia mengatakan bahwa segala hal yang dilakukan pada hari itu akan berakhir baik dan penuh keberuntungan. Lanjut ke hal A2 kol 1

P.SIDIMPUAN (Waspada): Minimnya perhatian dan kurangnya penyuluhan Dinas Kesehatan Kota Padangsidimpuan terhadap kesehatan masyarakat yang terkena penyakit menular Demam Berdarah Dengue (DBD) di pemukiman padat, ternyata menuai protes anggota DPRD Fraksi Partai Demokrat. Pemukiman padat itu antara lain di Kelurahan Ujung Padang, Aek Tampang, Kampung Losung, Sadabuan dan kelurahan lain di kawasan

Lanjut ke hal A2 kol 7

Serampang - Ponten 10 baru paten ... - He.... he....he....

Berita Utama

A2

Pengembala Lembu Temukan Mayat Mr X

Fraksi Demokrat: Peran Semua Pihak Diperlukan Dalam Menjaga Stabilitas PANYABUNGAN ( Waspada): Peran serta semua pihak sangat diperlukan dalam menjaga stabilitas dan keamanan ketertiban di Kabupaten Mandailing Natal, dalam rangka untuk menekan eskalasi timbulnya berbagai penyakit masyarakat yang belakangan ini sering terjadi. Hal itu dijelaskan Ketua Fraksi Demokrat DPRD Madina Ir Ali Mutiara kepada wartawan baru-baru ini di Panyabungan. Katanya, dari hasil pantauan yang dilakukan pihak keamanan (kepolisian-red), eskalasi serta modus tindak kejahatan dan penyakit masyarakat semakin meningkat. Untuk itu diharapkan sebuah persepsi yang sama dari semua elemen untuk memandang pencegahan dan penanggulangan persoalan ini sebagai tanggung jawab bersama. “Karena itu, kami mendorong dan mengharapkan partisipasi pihak ketiga, dalam hal ini masyarakat dan khususnya pihak-pihak swasta, nasional maupun asing, untuk turut berpartisipasi dalam meningkatkan rasa aman dan stabilitas keamanan di daerah kita ini,” ucap Ali Mutiara. (csh)

Ramai-ramai Nikah ....

Hal itulah yang membuat guru taman kanak-kanak ini harus bersabar menunggu selama dua tahun demi melangsungkan pernikahan dengan kekasihnya Chris Skaroupka pada tanggal 10 Oktober 2010. “Saya mencari horoskop perkawinan kami hari ini (maksudnya Minggu) sudah sejak lama, dan menurut horoskop, hari ini adalah hari yang sangat positif,” ujar Anna seperti dilansir dari laman The Sunday Telegraph. Bukan hanya Anna yang berpikir demikian, menurut kantor catatan pernikahan dan kelahiran Sydney, terdapat 1000 pasangan yang akan melangsungkan pernikahannya tanggal 10 bulan 10 tahun 2010. Kantor tersebut mencatat bahwa hari Minggu adalah hari pernikahan tersibuk sejak tahun 1856. Kantor ini bahkan mempekerjakan orang tambahan untuk mengatasi banyaknya angka pernikahan pada satu hari. Angka Keberuntungan Keputusan para pasangan untuk melangsungkan pernikahan di hari Minggu tidak lain adalah karena keyakinan peruntungan berdasarkan perhitungan tanggal. Pada tanggal ini menurut para ahli numerologi dan perhitungan China adalah hari terbaik yang jarang sekali ada. Para pasangan terutama mengincar pernikahan pada pukul 10:10, jika dideretkan maka terbentuklah banyak

Menag Lepas....

melaksanakan acara pelepasan jamaah, maka seluruh Calhaj kembali lagi ke kamar masing-masing untuk bersiapsiap berangkat siang harinya. Untuk mempermudah proses keberangkatan, tahun ini, proses boarding pass para calhaj oleh petugas imigrasi dilaksanakan dalam bus, sehingga saat seluruh calhaj berada di bandara keadaan sudah tidak sibuk lagi dan diyakini situasi akan lebih steril. Sedangkan jadwal take off pesawat dijadwalkan pukul 14:00,” kata Sazli sembari menambahkan data terakhir jumlah Calhaj seluruhnya dari Embarkasi Medan sebanyak 8.330 orang. Dia juga menjelaskan, Kloter 1 asal Labuhanbatu ini jumlah jamaah sebanyak 454 orang, seorang gagal berangkat atas nama Aisyah Satya Tanjung penduduk Marsonjah Labusel. Calhaj tertua berusia 102 tahun atas nama Koyimah

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport Jawaban Problem Catur: 1. ......., Bd1+. 2. BxB, Mxc5+. 3. Rh1, Kf2+. 4. Rg1, KxM+. 5. Rh1, Mg1+. 6. BxM, Kf2+mat. (Jika 3. Bd4, MxB+. 4. Rh1, Md1+. 5. BxM, BxB+mat).

Jawaban TTS: M I N G G E N H M A S J I D N J T A T A A U U N K A P M D O A A N N A K I I R A K A T E R I N A I U H A M

U

D E E G J

C R E S E P O N S A N D I E R A N G A N I M R T U A T Y B O A R E S E N A A A N U R

S S I N N G E R R E N D A N G G

Jawaban Sudoku: 9 7 5 4 6 1 8 2 3

3 4 1 8 2 5 6 7 9

8 2 6 7 9 3 5 4 1

5 3 4 1 8 6 2 9 7

7 8 2 9 3 4 1 5 6

6 1 9 2 5 7 4 3 8

4 6 3 5 1 9 7 8 2

2 9 7 6 4 8 3 1 5

1 5 8 3 7 2 9 6 4 ve206

Waspada/Maimun Asnawi

angka sepuluh, tanggal 10-1010, jam 10:10. Deretan angka sepuluh ini pertama kalinya terjadi dalam jangka waktu 100 tahun. Para ahli numer ologi mengatakan bahwa deretan angka 10 ini disebut “10 sempurna” yang melambangkan waktu yang sangat hebat dan kelahiran kembali. Menurut perhitungan China, tanggal ini disebut “Shi Quan Shi mei” atau “sempurna di segala hal”. Artinya, hari ini adalah hari terbaik untuk melangsungkan pernikahan. Banyak warga China yang meyakini hal ini, itulah sebabnya pesta pernikahan di China pada hari ini sudah dimulai pada pukul enam pagi. Me n u r u t l a m a n M a i l Online, di distrik Haidian, Beijing, China, saja terdapat lebih dari 1.200 pasangan yang mendaftarkan pernikahannya hari ini. Tak heran bila hari ini memiliki jadwal pernikahan terbanyak dalam satu tahun. Menurut majalah Brides, di Inggris terdapat 31.000 pernikahan pada hari ini. Jumlah ini sepuluh kali lipat dari jumlah pernikahan di hari biasa. Menurut ahli astrologi dan fisika Australia Milton Black, tanggal 10-10-10 adalah tanggal dengan perhitungan astrologi yang sempurna. Tanggal ini menurutnya adalah tanggal yang dipenuhi dengan harapan, keberuntungan dan sangat positif, terutama yang berhubungan dengan uang dan bisnis. (VIVAnews) Nasrun Binti Abdulah, termuda Siti Audita Binti Chalailuddin. Terkesan Hal lain yang disampaikan Sazli, Pj Bupati Labusel Drs Abd Razak Pasaribu yang memberangkatkan Calhaj dari Lapangan HB Kotapinang, Sabtu malam pukul terkesan dan haru saat mengetahui Calhaj Kloter 1 asal daerah itu saat berangkat ke tanah suci dilepas oleh Menteri Agama. Dia menyampaikan hal itu didampingi Kepala Kementerian Agama Labuhanbatu Zulfan Haris. Tahun ini Calhaj asal daerah itu sebanyak 1.507 orang yang berangkat melalui kloter 1, 4,10 dan 15. (m36/m32/h10)

Hari Ini ....

Amiruddin menyebutkan, totalnya hanya 130 orang. Namun dari jumlah tersebut, 120 jamaah diberangkatkan dengan klotert I, sementara 8 orang akan bergabung dengan kloter XI dan 2 orang bergabung dengan kloter terakhir, yakni kloter XIII. Keterangan Amiruddin diperkuat Kabag Humas Panitia Pembantu Penyelenggara Ibadah Haji (P3IH) Juniazi Yahya S.Ag. Kepada Waspada, kemarin dia menyebutkan calhaj kelompok terbang (kloter) I ini akan diterbangkan menuju tanah suci, Senin (11/ 10) hari ini. Kata dia, Calhaj Kloter I ini terdiri dari 320 orang yang berasal dari Kabupaten Pidie, A c e h Te n g a h d a n B e n e r Meriah dengan rincian Pidie 120 jamaah, Aceh Tengah 110 dan Bener Meriah 88 jamaah. Seperti diketahui, tahun ini, Embarkasi Banda Aceh

Pisang Aneh ....

diterima nalar karena dari tengah batang pisang tiba-tiba mengeluarkan buah. Ajaibnya lagi, dari satu tangkai yang keluar tersebut mengeluarkan dua tandan pisang yang muncul dalam waktu yang berbeda. Mahmud, 50, seorang petani sekaligus pemilik batang pisang ‘langka’ ini mengisahkan tentang temuannya itu, ketika menjawab Waspada di kediamannya, Sabtu(9/10) di Kampung Rakal Perdamaian, P i n t u R i m e G ay o, B e n e r Meriah. “Saya melihat keanehan ini sekitar sebulan lalu. Mulanya saya hendak menebang

WASPADA Senin 11 Oktober 2010

MR X: Mayat Mr X yang ditemukan sepasang suami istri pengembala lembu, Minggu (10/10).

Pasang Purnama ....

bangunan jalan ke sekolah itu, sehingga arus transportasi siswa lancar dan tidak terkendala. “Kita harap kondisi ini dapat ditanggulangi secepatnya,” harap Ilyas. 14 Rumah Terendam Sementara di Pidie, pasang purnama ancam ratusan rumah di daerah pesisir. Antara lain, Kecamatan Kota Sigli, Simpang Tiga, Kembang Tanjong, Batee dan Muara Tiga. Tercatat belasan rumah yang sudah terendam akibat pasang purnama tersebut. Pasang purnama yang terjadi sejak empat hari terakhir ini, dinilai banyak warga terparah, karena terjangan gelombang laut raksasa itu mampu melewati tanggul pembatas dibangun Badan Rehabilitasi dan Rekonstruksi (BRR) Aceh-Nias, pasca tsunami 2004. Amatan Waspada, kemarin, Sabtu malam gelombang pasang, sekira setinggi tiga meter menghantap tanggul batu yang dibangun sepanjang garis pantai Kota Sigli, meliputi Tanjong Harapan sampai depan Pendopo bupati setempat. Air laut tersebut menghantam tanggul hingga masuk ke tengah badan jalan. Sementara di Tanjong Harapan, Kecamatan Kota Sigli, beberapa rumah yang letaknya dekat dengan mulut muara terendam air asin tersebut. Beberapa kepala keluarga (KK) di perkampungan padat penduduk itu,

terpaksa memindahkan alatalat dapur ke tempat lebih tinggi karena air laut itu masuk ke dapur rumah warga setinggi satu meter. Tak ada korban jiwa dalam peristiwa itu, namun ternak unggas milik warga seperti ayam dan bebek banyak yang mati karena terlambat diselamatkan pemiliknya. “Ayam kita kurung pada sore hari, sementara air setelah magrib langsung naik dan menenggelamkan ayam-ayam yang terkurung dalam kandang,” kata beberapa warga Tanjong Harapan, Kota Sigli, Minggu (10/10). Selain merendam rumah, gelombang pasang juga merusak pematang tambak, seperti terjadi, di Desa Lancang, Kec, Kumbang Tanjong, Kota Sigli dan Bate. Serupa juga terjadi di Laweueng. Jebolnya pematang tambak menyebabkan petani tambak merugi, karena ikan peliharaannya seperti bandeng dan udang ikut terlepas. Pasang purnama yang terjadi Sabtu sekira pukul 23:00 Wib di Desa Lancang Barat, Kecamatan Kembang Tanjong menyebabkan 14 unit rumah warga perkampungan nelayan itu terendam air asin. Sofian Amin, 36, warga setempat mengatakan, pasang purnama yang menerjang perkampungan itu menyebabkan abrasi pantai kian parah. Warga yang berdomisili di bibir pantai mulai cemas dengan pasang purnama yang

kelebihan luas dari 12 ribu ha, yakni 1737,61 ha. Oleh PT First Mujur Plantation & Industry diakui sudah 1200 ha dibayarkan ganti ruginya kepada warga. Sedangkan 500 ha lebih diakui mereka belum digantirugi. Akan tetapi hal itu belum bisa mereka buktikan,’’tegas Marasamin. Justru itu, katanya lagi, masyarakat menuntut supaya segera dikembalikan seluruhnya yang di luar Hak Guna Usaha perusahaan itu. Tetapi itu pun hingga kini tidak ada realisasinya, meskipun konon Pemkab Paluta sebagai fasilitatornya.

Sedangkan Hamdani Harahap, menambahkan, sudah pernah Komisi Nasional Hak Azasi Manusia (Komnas HAM) turun langsung meninjau sekaligus ingin menemui Pemkab Paluta untuk mempertanyakannya, akan tetapi kedatangan Tim Komnas HAM itu tidak direspon oleh Pemkab Paluta. ‘’Pemkab Paluta juga sudah disurati karena selaku fasilitator, termasuk bupatinya, namun juga tidak memberikan respon apapun. Padahal, dalam perjanjian antara masyarakat dan PT FMPI itu, Pemkab/Bupati selaku fasilitator,’’ujar Hamdani kesal.

Semestinya, kata Hamdani lagi, sebagai fasilitator maka Pemkab Paluta berkewajiban menyelesaikan persoalan tersebut. Namun, dalam kenyataannya Pemkab terkesan ‘buang badan’ alias mengelak. Dia juga mengemukakan, selaku tim advokasi masyarakat Luat Simangambat dan Ujung Batu, sudah menyurati Bupati Paluta perihal tidak juga terlaksananya isi perjanjian masyarakat dan PT FMPI. Perjanjian itu sudah didaftarkan ke Pengadilan Negeri 16 Januari 2006 oleh mediator sengketa, yakni Komnas HAM. Lalu pernjanjian itu juga me-

akan memberangkatkan 4.187 calon jamaah haji dalam 13 kelompok terbang. Jumlah ini bertambah, bila dibandingkan tahun-tahun sebelumnya yang cuma mendapat kuota 3.599 orang. Terima Telepon Gratis Para calon jamaah haji mendapat kemudahan dalam berkomunikasi. Axis Aceh akan membagi-bagikan kartu perdana secara gratis kepada Calhaj Kloter I Embarkasi Sultan Iskandar Muda. Manajer Penjualan Axis Aceh, Rizalsyah kepada wartawan, Minggu (10/10) mengatakan, pihaknya menawarkan kemudahan dalam layanan komunikasi murah bagi jamaah haji asal Indonesia. Dia menyebutkan, bagi pelangggan Axis yang ingin mendapatkan tarif murah, cukup menelepon ke 1500 dari kartu Axiz saat melaksanakan ibadah haji di Arab Saudi untuk memilih jaringan Al-

Jawal/STC serta mengaktifkan nomor roaming lokal. Rizal mengatakan, dengan program tersebut diharapkan akan memudahkan jamaah haji berkomunikasi dengan keluarga di tanah air. “Sebab para pelanggan dapat menikmati gratis telepon dan mengirim pesan singkat (sms) dari operator manapun. “Program gratis ini akan sangat membantu para calhaj untuk tetap terhubung dengan keluarg dan rekan mereka dengan mudah dan terjangkau,” sebutnya. Vice President Sales and Distributions Axis Syakieb Ahmad Sungkar dalam rilisnya menyebutkan, sebagai bagian dari Saudi Telecom Company (STC)—perusahaan telekomunikasi terdepan di Arab Saudi, Axis akan memastikan koneksi yang baik, stabil dan terjankau selama berlangsungnya ibadah haji. Rizal menambahkan, pihaknya juga menawarkan

tarif jelajah internasional yang kompetitif, Rp1.500 per SMS ke nomor tujuan manapun di seluruh dunia dan Rp50.000/ hari untuk layanan paket data roaming BlackBerry. Lebih dari itu, lanjut dia, anggota keluarga dan temanteman yang berada di tanah air juga dapat menghubungi para pelanggan Axis yang sedang menunaikan ibadah haji di nomor roaming lokal mereka dengan tarif hanya Rp1.388/menit menggunakan layanan AXIS VOIP dengan cara menekan 01012 966 5 (nomor tujuan). (b21/b05)

batangnya. Namun karena tiba-tiba keluar jantung pisang dari tengah batangnya, niat ini saya urungkan,” papar Mahmud. Uniknya lagi jelasnya, setelah berbuah dalam satu tangkai pisang itu bertandan dua. ”Saya kira setelah berbuah, tandan pisang ini normal seperti layaknya buah pisang umumnya. Namun setelah buahnya membesar seukuran pisang normal, ternyata tandan lain kembali tumbuh dalam tangkai yang sama, hanya buahnya lebih kecil seukuran jari-jari.” Dikatakan, kendati pisang aneh itu, telah sebulan yang

lalu ditemukannya. Namun keberadaannya hanya diketahui segelintir warga yang menjadi tetangganya di sana. ”Hanya para tetangga dekat yang mengetahui keanehan pisang ini. Sebagian dari mereka ada juga yang telah mengabadikannya melalui kamera handphone,” sebutnya. “Kini saya membiarkan pisang aneh tersebut begitu saja. Mungkin ada yang ingin melihat kelangkaannya, makanya tidak saya apa-apain,” kata Mahmud, seraya berharap ada hikmah yang baik di balik munculnya salah satu tanda-tanda kekuasan Illahi ini. * Irwandi MN

berbagai tingkatan terpaksa menjinjing sepatu saat pulang pergi ke sekolah. Menurut keterangan yang diperoleh kemarin menyebutkan, kibat air pasang dalam beberapa hari terakhir, sedikitnya beberapa rumah dan halaman serta jalan utama menuju SDN Teupin Pukat, kecamatan setempat, digenangi air laut hingga mencapai ketingian 20 centimeter. “Kondisi ini sudah berlangsung setiap air pasang laut besar. Bahkan terkadang air pasang tengah malam warga harus mengungsi jika pasang purnama terlalu parah,” kata Ilyas Ismail, 38, warga Desa Teupin Pukat. Kata dia, rumah yang direndam air antara lain milik Saiful Basri. Menurut Ilyas, lancarnya air laut masuk ke lokasi pekarangan rumah warga adalah faktor saluran air di desa itu tersumbat. Sehingga air pasang yang datang beberapa jam itu, dengan mudah tergenang hingga beberapa hari. Ilyas mengaku yang disayangkan adalah pelajar ketika hendak ke sekolah pagipagi terpaksa menjinjing sepatu dan tas karena kondisi jalan utama menuju sekolahnya digenangi air. Sebab keberadaan jalan itu rendah. Untuk itu, kata Ilyas, masyarakat amat mengharapkan pemerintah daerah melalui pemerintah desa setempat agar mengusulkan pem-

Warga Paluta ....

Bayi Medan ....

Itu aja kok. Nggak ada maksud apa-apa,” ujar Riska saat ditemui di Ruang ICU Lantai III RS. Ibu dan Anak Rosiva, Minggu (10/10). Riska masih tampak letih usai melahirkan bayi laki-laki tersebut. Meskipun begitu, dia tampak senang dan bahagia saat bercerita seputar buah hatinya. Mengenai nama anaknya, Riska dan suaminya M. Dian Iskandar, 29, telah menyiapkan namanya, yakni Raffa Tri Risan. “Raffa itu artinya kebahagian, Tri itu tiga, karena dia anak ketiga, sedangkan Risan itu gabungan nama saya dan suami saya, jadi jika digabungkan berarti Kebahagian Ketiga Riska dan Dian,” katanya sedikit tersenyum sembari berharap agar ketiga anak-anaknya berbakti kepada kedua orang tua dan berguna bagi nusa dan bangsa. Berat badan bayi laki-laki dari pasangan Riska Yurensa dan M. Dian Iskandar ini yakni

SYAMTALIRA BAYU, Aceh Utara (Waspada): Sepasang suami istri pengembala lembu, Minggu (10/10) pukul 12.30, menemukan sesosok mayat laki-laki di pinggir jalan line pipa, dekat pematang sawah yang telah ditutupi semak-semak, Gampong Kaye Panyang, Kec. Syamtalira Bayu, Aceh Utara. M. Nasir, 30, salah seorang warga yang sedang melintas di jalan itu, mengaku tiba-tiba dipanggil seorang perempuan. Setelah berhenti, perempuan itu memberitahukan, kalau dia dan suaminya baru saja menemukan mayat laki-laki tak dikenal. “Saat itu saya sedang meselama tiga hari terakhir ini kian parah. Kata dia, pascatsunami Aceh, sejumlah 490 kepala keluarga (KK) warga Desa Lancang Barat mengaku mulai khawtir tinggal di tepi pantai karena gelombang laut besar hampir setiap hari menerjang masuk ke r umah-r umah penduduk. Kondisi ini diperparah sejak dikerjakan pembangunan tanggul di Kuala Ie Leubeue yang belum rampung. Kecuali itu, sisa tanggul sepanjang 700 meter yang belum dibangun di bibir pantai tersebut. Akibatnya, pada saat pasang purnama, gelombang air dengan leluasa memasuki perkampungan penduduk. (b20)

Kereta Makkah ....

80 sampai 120 km per jam itu, waktu tempuh selama menjalankan ibadah haji dari tempat-tempat suci itu akan lebih cepat. Jarak dari Arafah ke Muzdalifah akan ditempuh jamaah haji dalam waktu lima menit pada 9 Dzulhijah. Dari Muzdalifah ke Mina juga hanya lima menit. Zain Al-Abidin mengatakan, kereta akan beroperasi sepanjang tahun. Pada tahap kedua, proyek kereta itu akan menghubungkan Mashair Railway dengan Masjidil Haram di Makkah, stasiunnya di Jalan Umm Al-Qura. Kereta ini juga kelak akan dihubungkan dengan jaringan kereta ke Madinah dan Jeddah. (an) negaskan kelebihan di luar HGU yakni 1200 ha diserahkan kepada Negara untuk selanjutnya dibagikan kepada masyarakat adat Luat Simangambat dan Ujung Batu. Kemudian, lanjut Hamdani menjelaskan, karena PT FMPI tidak juga melaksanakan isi pernjanjian tersebut, maka Komnas HAM menyuratinya untuk mengingatkan agar PT FMPI segera melakukan verifikasi lahan. Akan tetapi hingga sekarang PT FMPI tidak pernah menyerahkan lahan luar HGU itu kepada Negara untuk dikembalikan kepada masyarakat, dan juga tidak pernah menyerahkan bukti-bukti tentang ganti-rugi tanah seluas 1200 ha dan melakukan pengukuran. Ditambahkan Hamdani, surat mereka yang serupa isinya juga sudah disampaikan kepada PT First Mujur Plantation & Industry dengan tembusan ke Kapoldasu, Kajatisu, Ketua PT Sumut, Ketua PN Padangsidimpuan, Kapolres Tapsel, Kapolsek Binanga dan lainnya. Makanya, kata dia lagi, jika tidak ada juga respon dari eksekutif (Pemkab Paluta) maupun Legislatif (DPRD Paluta), cukup wajar jika ribuan warga melakukan aksinya. (m34) 3200 gram atau 3,2 kg, dengan panjang badan 49 cm. Riska ditangani oleh dr. Azwar Aboed, Sp.OG. Sementara itu, dr. Suti Nasution, 22, juga melahirkan anak keduanya di RSIA. Rosiva. Hanya saja, Suti melahirkan secara normal pukul 14:00. “Bahagia, apalagi kelahiran anak saya ini tepat pada tanggal unik, 10-10-2010 mudah diingatkan,” ujar suaminya Arnold Budiman, 48, yang juga warga Kompleks Tasbih Setia Budi Medan. Budiman mengaku sangat bersyukur karena istrinya melahirkan tepat pada tanggal cantik. Dia akan memberikan nama bayi perempuannya Meldrik Deine Hutasoit. Irwan, 36, warga Jl. Williem Iskandar yang sedang menunggu kelahiran anak ketiganya tampak cemas. Apalagi istrinya Nuriaty sedang berada di ruang operasi. Namun, sekitar pukul 11:30, dokter beserta bidan RSIA Rosiva mengucapkan selamat kepa-

lintas di jalan line pipa, tibatiba seorang perempuan memanggil dan memberitahukan, kalau dia baru saja menemukan mayat laki-laki tak dikenal. Perempuan itu bersama suaminya mengaku sedang mencari lembunya yang hilang,” kata M. Nasir sesuai pengakuan pengembala lembu itu. Temuan itu langsung diberitahukan kepada penduduk Gampong Kaye Panyang. Lalu diteruskan ke Mapolsek Meurah Mulia. “Tak berapa lama, anggota Polsek Meurah Mulia datang ke lokasi untuk melakukan penyelidikan,” kata Nasir. Amatan Waspada di lokasi kejadian, mayat tanpa identitas itu berciri-ciri, memakai baju kemeja bergaris-garis merah, celana kain warna hitam, celana dalam berwarna putih, sandal beda jenis, mulut dibekap dengan sobekan kain warna hitam, ke dua tangannya diikat ke depan dengan cara disilang, dan kakinya diikat dengan tali sepatu warna hitam. AKBP Kukuh Santoso,

Kapolres Kota Lhokseumawe, melalui Iptu Ahmad Yani Kapolsek Syamtalira Bayu, didampingi Brigadir Budi Irawan, Kanit Reskrim kepada para wartawan membenarkan, pihaknya telah menerima laporan tentang temuan mayat seorang laki-laki dari warga Gampong Kaye Panyang, Syamtalira Bayu. “Setelah mendapatkan laporan tersebut, kita langsung turun ke tempat kejadian, dan ternyata laporan itu benar adanya. Tidak berapa lama kemudian, mayat laki-laki itu diidentifikasi oleh petugas dari Mapolresta Lhokseumawe,” kata Budi Irawan. Setelah diidentifikasi, personel polisi membawa jenazah Mr. X ke Rumah Sakit Umum Daerah (RSUD) Cut Meutia Aceh Utara untuk divisum. Begitupun, hingga berita ini diturunkan, tidak ada yang tahu dengan motif kejadian tersebut. Namun polisi mengatakan, mereka akan terus menyelidiki kasus itu hingga pelaku dan motif pembunuhan terungkap. (cmun)

Pengikut Aliran ....

tuk memudahkan pemeriksaan serta diserahkan ke pesantren. Kelompok kedua orang yang masih ragu-ragu perlu diserahkan ke balai pengajian dalam waktu tertentu baru dikembalikan ke masyarakat dan terakhir ikutikutan. “Mereka harus belajar mengaji lagi di pesantren. Khusus kepada orang-orang yang sudah terlibat dalam ajaran tersebut dan belum diamankan warga atau aparat penegak hukum hendaknya segera menyerahkan diri ke berbagai pihak terkait untuk memudahkan penanganan nantinya,” sebutnya. Dikatakan Ketua DPRK Bireuen itu, kesimpulan lain dalam pertemuan pihaknya beberapa hari lalu itu, yaitu meminta lenmbaga terkait mulai dari MPU, Dinas Syariat Islam serta Kantor Kementerian Agama untuk bahumembahu menyelesaikan masalah itu serta mencegah berkembang lagi. “Mengenai hal ini pihak Pemkab silahkan mengambil kebijakan dan tidak terkesan menghambur-hamburkan uang untuk penanganan masalah itu, dan selama ini, bupati sudah mengambil kebijakan untuk masalah tersebut tidak ada masalah,” pungkasnya. (amh)

F-PD DPRD ....

orang lainnya dalam perawatan medis. Lanjut Khoir, untuk pemberantasan jentik nyamuk di lingkungan padat, sebenarnya sederhana saja yakni dana yang telah dianggarkan di Dinkes itu diterapkan terhadap masyarakat dengan cara memotivasi warga untuk menjaga kebersihan lingkungan, salah satunya adalah menguras bak air sekali seminggu, mengubur barang-barang bekas, kemudian menutup lobang genangan air. “Kalau hal yang mendasar ini diberikan pemahaman terhadap masyarakat, tentunya penyakit menular itu seperti demam berdarah yang berasal dari nyamuk Aedes Aegipty pastinya dapat dihindari,’’ ujar Khoir. Sementara, Kepala Dinas Kesehatan Hj. drg.Doria Hafni Lubis ketika dimintai keterangannya melalui telepon, Jumat (8/10) siang ternyata tidak memberikan tangga-pan. (crm)

danya, karena istrinya melahirkan bayi laki-laki sehat dengan berat 3,3 kg. Selanjutnya, Irwan langsung mengazankan anaknya tersebut. Penanggung Jawab Harian RSIA Rosiva Marni mengungkapkan, pada tanggal ‘cantik’ ini, sebanyak lima orang yang melahirkan di RSIA Rosiva, dua diantaranya melahirkan secara normal dan ketiga lainnya melahirkan secara cesar. “Tadi saya sempat saya bicara sama dokter, katanya banyak orang yang minta melahirkan tanggal ini, mungkin karena tanggal ini cantik ya, dan mungkin mudah diingat,” ujarnya. Adapun yang melahirkan pada tanggal ‘cantik’ di RSIA Rosiva yakni, Iin Yohanes, 23, warga Jl. Sutomo Baru Medan, melahirkan bayi laki-laki dengan berat badan 31 kg, panjang 49cm. Nuriaty, 32, warga Jl. Williem Iskandar Medan, melahirkan bayi lakilaki dengan berat badan 3,2 kg, panjang 49 cm.

Sedangkan di RSUP H. Adam Malik Medan, sebanyak 2 bayi perempuan lahir pada tanggal cantik ini. Bayi pertama, anak ke tujuh pasangan suami istri dari ibu Ramala dan Baharuddin. Bayi yang lahir pukul 10 lewat tersebut, berat badannya 3 kg dengan panjang 49 cm. Kemudian, Lindawati warga Sayum Sembahe melahirkan bayi perempuan dengan berat badan 4,2 kg dengan panjang badan 52 cm. bayi tersebut lahir pukul 13.00 siang. “Bayi Ramala lahir dengan cara vakum yakni disedot. Menurut saya itu karena orang tuanya sudah tak ada tenaga lagi untuk mengeluarkan bayinya dari rahimnya, sedangkan Lindawati lahir cesar,” kata Kasubbag Humas RSUP HAM Sari M. Saragih. Selain di rumah sakit di atas, di beberapa rumah sakit lain juga dipastikan ada bayi yang lahir pada 10-10-2010.

16.00 WIB hingga pukul 20.00 WIB tadi malam untuk dipindah ke lokasi lain. Masih Banyak Sementara itu, informasi yang diperoleh kemarin, warga Kecamatan Peusangan mengklaim bahwa para pengikut aliran sesat di kecamatannya dan di bebebrapa kecamatan lain di Bireuen masih banyak karena menurut mereka aksi mereka telah berlangsung selama lebih 10 tahun dan baru sekarang terungkap. “Kami dapat informasi dari para pengikut aliran sesat, masih banyak pengikut aliran sesat yang masih berada di desa-desa di Bireuen, mereka masih bersembunyi dan mereka belum menyerahkan diri karena pergerakan pemurtadan yang dilakukan oknum tertentu telah berjalan di Bireuen ini lebih 10 tahun,” kata Tgk Munawar Yusuf seorang tokoh masyarakat Peusangan. Ketua DPRK Bireuen, Ridwan Muhammad yang ditanya wartawan terkait hal hasil rapat dengan Muspida plus dua hari lalu yang kabarnya membahas tentang perkembangan aliran sesat menyebutkan, aliran sesat itu ada tiga kelompok. Pertama, mereka yang sudah jadi pengurus ajaran, sanksinya harus diproses hukum bila perlu ditahan un-

perkotaaan yang paritnya warga digenangi air dan terkadang mengalami penyumbatan akibat sampah, sehingga pemukiman kurang terawat dan luput dari pengawasan tentang kebersihan lingkungan. Ketua Fraksi Demokrat H.Khoiruddin Nasution kepada Waspada, Sabtu (9/10) mengutarakan adanya sinyalemen penyimpangan dana fogging di Dinas Kesehatan Rp 286 juta untuk penanganan DB (Demam Berdarah) dan DBD (Demam Berdarah Dengue) terhadap masyarakat Kota Padangsidimpuan.l Dikatakannya, masyarakat telah berulang kali melaporkan kepada Fraksi Demokrat agar Dinas Kesehatan (Dinkes) melakukan fogging untuk pemberantasan jentik-jentik nyamuk yang meresahkan warga. Apalagi baru-baru ini di Kel. Ujung Padang, seorang warga meninggal dunia akibat demam berdarah dan empat

(cmai)

Berita Utama

A2 Penundaan Presiden Ke Belanda Tak Terkait Wilders JAKARTA(Antara): Menko Polhukam Djoko Suyanto menyatakan,penundaan kunjungan kenegaraan Presiden Susilo BambangYudhoyono ke Belanda tidak terkait politisi anti-Islam Geert Wilders. Dihubungi di Jakarta, Minggu(10/10), Djoko Santoso menyatakan, dalam pidatonya sesaat sebelum keberangkatan ke Belanda pada 5 Oktober, Presiden tidak sekalipun menyebut nama Wilders. “Presiden nggak pernah sebut-sebut GeertWilders,” ujarnya. Djoko mengungkapkan, dalam pidatonya di Bandara Halim Perdanakusuma, Presiden Yudhoyono dua kali menyatakan bahwa penjadwalan ulang kunjungan ke Negeri Kincir Angin itu karena tidak nyaman dengan pengadilan di Den Haag yang memproses tuntutan sejumlah pihak termasuk RMS di pengasingan, yang agar hak imunitas SBY dihilangkan sehingga bisa ditangkap setiba di Belanda karena kasus pelanggaran HAM. Sebelumnya, Guru Besar Hukum Internasional Universitas Indonesia Hikmahanto

Juwana menilai isu tentang Geert Wilders akan lebih mengganggu rencana kunjungan Presiden Susilo Bambang Yudhoyono ke Belanda, daripada tuntutan hukum yang diajukan aktivis Republik Maluku Selatan (RMS). Wilders adalah anggota parlemen anti-Islam dan menjabat sebagai pemimpin partai untuk kebebasan (PVV), katanya, di Jakarta, Minggu. Selain itu, Wilders memproduksi film pendek bernuansa politis“Fitna” yang banyak mendapat kecaman dari kaum Muslim. Hikmahanto mengkhawatirkan ada gerakan dari Wilders dan pendukungnya untuk mengganggu kunjungan Presiden Yudhoyono ke Belanda. Jika ini terjadi, dikhawatirkan hubungan bilateral RI dan Belanda akan terganggu. “Publik Indonesia tentu akan marah,” katanya dalam keterangan tertulisnya. Terkait Wilders, ia menduga penundaan kunjungan PresidenYudhoyono ke Belanda adalah bentuk kekhawatiran pemerintah RI terhadap ulah Wilders, sekalipun tidak ada ancaman terbuka dari Wilders.

BMKG Imbau Masyarakat Pesisir Pantai Sumbar Agar Mengungsi PADANG (Antara): Badan Metrologi Klimatologi dan Geofisika (BMKG) Kepulauan Maritim Teluk Bayur, Kota Padang, Sumatera Barat, mengimbau masyarakat yang tinggal di pesisir pantai agar mengungsi terkait banjir rob yang melanda daerah itu dan sekitarnya. Imbauan ini dikatakan Kepala BMKG Kepulauan Maritim Teluk Bayur Kota Padang Amarizal, di Padang, Minggu (10/10). “Tiga hari kedepan banjir rob masih akan terjadi, disebabkan masih adanya peningkatan tinggi gelombang hingga dua meter,” katanya Ia menambahkan, masyarakat yang tinggal di pesisir pantai, Kelurahan Teluk Kabung Utara, Kecamatan Bungus Teluk Kabung dan Kelurahan Sungai Beramas Kecamatan Lubuk Be-

galung, Kota Padang mewaspadai tinggi gelombang yang tidak bisa diperkirakan datangnya. “Imbauan untuk mengungsi sementara mengantisipasi agar tidak jatuhnya korban jiwa,” katanya. Ia menjelaskan, tahun 2010 ini peningkatan air pasang laut sangat signifikan, dan kondisinya berbeda dari tahun 2009 yang masih dalam batas wajar air pasang. Lebih lanjut, kata dia, adanya banjir rob tersebut merupakan dampak dari pemanasan global. Ia mengharapkan masyarakat di pesisir jangan tidur di rumah, sebab banjir rob biasanya datang seiring dengan pasang naik. “Tinggi gelombang akan terus meningkat, waspadai dan jangan dulu kembali ke rumah sampai banjir rob susut,” katanya.

Tak Terima Ditegur, Tikam Pemilik Rumah TEBINGTINGGI (Waspada): Paino,32, warga Jalan Sei Kelembah, Ling.VII, Kel. Durian Kec. Bajenis, Tebingtinggi, menderita luka sayat akibat ditikam seorang pemuda. Kasus itu telah dilaporkan ke Polsek Padang Hulu, Minggu (10/9) dini hari, sesuai LP/ 34/X/2010/TT Padang Hulu. Kepada wartawan di kediamannya, Paino menuturkan peristiwa itu terjadi sesaat setelah ia pulang menarik betor, Sabtu (9/10) malam. Ketika itu, ia melihat MZ alias Jol, 29, warga Jalan Sei Kelembah, Ling.VII, Kel. Durian, Kec. Bajenis, Tebingtinggi duduk di depan rumahnya. Korban menegurnya,’’Ngapai kau di situ?.” Pelaku menjawab, ’’Apa urusan kau.’’

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. 2. 3. 4. 5. 6.

......., Bd1+. BxB, Mxc5+. Rh1, Kf2+. Rg1, KxM+. Rh1, Mg1+. BxM, Kf2+mat. (Jika 3. Bd4, MxB+. 4. Rh1, Md1+. 5. BxM, BxB+mat).

Jawaban TTS: TTS Topik

Umum

M I N G G E N H M A S J I D N J T A T A A U U N K A P M D O A A N N A K I I R A K A T E R I N A I U H A M

U

D E E G J

C R E S E P O N S A N D I E R A N G A N I M R T U A T Y B O A R E S E N A A A N U R

S S I N N G E R R E N D A N G G

Jawaban Sudoku: 9 7 5 4 6 1 8 2 3

3 4 1 8 2 5 6 7 9

8 2 6 7 9 3 5 4 1

5 3 4 1 8 6 2 9 7

7 8 2 9 3 4 1 5 6

6 1 9 2 5 7 4 3 8

4 6 3 5 1 9 7 8 2

2 9 7 6 4 8 3 1 5

1 5 8 3 7 2 9 6 4

Paino pun berang kemudian menanya lagi, ’’Apa mau maling kau?‘’. Ketika itu Jul pulang, namun beberapa saat kemudian pelaku datang lagi bersama temannya Wa,20, warga Jalan Lorong Batu Sangkar, Kel. Durian, Kec. Bajenis, Tebingtinggi dan menggedor pintu rumahnya. ’’Woi buka pintunya cepat,’’ ujar korban menirukan ucapan pelaku. Suriani alias Puput, 30, istri korban kemudian membuka pintu. Setelah pintu terbuka, pelaku bersama temannya langsung masuk dan menikamkan pisau ke tubuh korban berulang-ulang. Beruntung korban dapat menghindar sehingga hanya mendapat dua luka sayatan di bawah lengan tangannya. Mendengar suara keributan di rumah korban, warga sekitar berdatangan termasuk Kepling Swanto, yang kemudian melerai perkelahian tersebut. Kedua pelaku sempat meminta maaf kepada korban, tatapi tiba-tiba Wa memukul rahang korban hingga memar kemudian kabur. Kapolsek Padang Hulu , AKP K Nadeak ketika dikonfirmasi, membenarkan pengaduan korban.’’ Pelaku akan kita kejar sampai dapat,’’ kata Kapolsek. (a09)

Bayi Medan ... “Ini kemauan saya, dokternya pun menganjurkannya tanggal segini. Menurut saya tanggal ini mudah diingat. Itu aja kok. Nggak ada maksud apaapa,” ujar Riska saat ditemui di Ruang ICU Lantai III RS. Ibu dan Anak Rosiva, Minggu (10/10). Riska masih tampak letih usai melahirkan bayi laki-laki tersebut. Meskipun begitu, dia tampak senang dan bahagia saat bercerita seputar buah hatinya. Mengenai nama anaknya, Riska dan suaminya M. Dian Iskandar, 29, telah menyiapkan namanya, yakni Raffa Tri Risan. “Raffa itu artinya kebahagian, Tri itu tiga, karena dia anak ketiga, sedangkan Risan itu gabungan nama saya dan suami saya, jadi jika digabungkan berarti Kebahagian Ketiga Riska dan Dian,” katanya sedikit tersenyum sembari berharap agar ketiga anak-anaknya berbakti kepada kedua orang tua dan berguna bagi nusa dan bangsa. Berat badan bayi laki-laki dari pasangan Riska Yurensa dan M. Dian Iskandar ini yakni 3200 gram atau 3,2 kg, dengan panjang badan 49 cm. Riska ditangani oleh dr. Azwar Aboed, Sp.OG. Sementara itu, dr. Suti Nasution, 22, juga melahirkan anak keduanya di RSIA. Rosiva. Hanya saja, Suti melahirkan secara

WASPADA Senin 11 Oktober, 2010

Komisi III Tak Terima Dituduh “Liar” JAKARTA (Antara): Para anggota Komisi III DPR RI yang menandatangani sikap protes atau mosi tidak percaya kepada Ketua Dewan, tidak terima dituduh ‘liar’. “Tidak benar kalau sikap protes kami dikatakan ‘liar’ oleh Ketua DPR RI Marzuki Alie. Salah satu penanda tangan surat protes itu adalah Wakil Ketua Komisi III Dr. Azis Syamsuddin selaku unsur pimpinan komisi,” tandas Bambang Soesatyo di Jakarta, Minggu (10/11).

Anggota Komisi III DPR RI dari Fraksi Partai Golkar ini mendukung pernyataan dari Fraksi PDI Perjuangan, Gayus Lumbuun sebelumnya yang menilai, Marzuki Alie tak patut mengeluarkan kata-kata demikian. Mosi tak percaya itu dibuat sebagai protes atas undangan Pimpinan Dewan kepada calon Kapolri Komjen Pol Timur Pradopo, lalu menggelar rapat tertutup. Pertemuan tertutup ini men-

jadi kontroversial karena Komisi III masih akan menggelar ‘fit and proper test’ terhadap calon Kapolri itu, sehingga pertemuan tertutup diduga terjadianggap ada proses transaksional. “Sekali lagi kami tegaskan bahwa surat protes tersebut tidak‘liar’. Seluruh fraksi (sembilan Fraksi) di komisi kami menandatanganinya, termasuk Ruhut Sitompul (Fraksi Partai Demokrat,” tuturnya. Nota protes itu, kata Bambang, akan diserahkan kepada

Badan Kehormatan (BK), Badan Musyawarah (Bamus) dan para pimpinan Parpol melalui Ketua Fraksi yang ada di DPR RI. “Hal ini penting agar ke depan Ketua DPR RI tidak lagi melakukan hal-hal yang tidak lazim serta tak etis dan merugikan Dewan, karena dapat menimbulkan dugaan-dugaan adanya politik transaksional dari Pimpinan Parlemen,” kata Bambang Soesatyo, anggota Komisi III DPR RI mengingatkan.

Bawa 41 Kg Ganja Dari Madina Ditangkap Di Padang PADANG (Antara): Jajaran Polres Pasaman Timur berhasil menangkap enam orang bandar narkoba jenis ganja seberat 41 kg di daerah Lubuk Sikaping, Kabupaten Pasaman Timur, Sumatera Barat. “Pengedar ganja yang ditangkap pihak kepolisian yakni berinisial Y,30, warga Mata Air, Kecamatan Padang Selatan Kota Padang, bersama lima orang tersangka lain,” kata Kapolres Pasaman Timur AKBP Gatot Santoso, di Padang, saat dikonfirmasikan melalui telefon seluler dari Padang, Minggu (10/10). Dia mengatakan, petugas menangkap para bandar narko-

ba ini pada dua lokasi yang berbeda di daerah Pasaman, yakni di daerah Lubuk Sikaping, serta dekat jembatan Jembatan Jodoh By Pass Lubuk Sikaping, Kabupaten Pasaman Timur. “Bandar narkoba jenis ganja ini ditangkap oleh petugas pada Minggu (10/10) sekitar pukul 04:00 WIB,” katanya. Menurutnya, penangkapan terhadap bandar ganja ini berdasarkan informasi dari masyarakat, ada yang membawa ganja dari daerah Madina, Provinsi SumateraUtaratujuanKotaPadang. Informasi tersebut ditindak lanjuti oleh petugas dengan mengadakan razia di jalan raya,

Komisi VIII DPR Tinjau 11 Embarkasi Haji JAKARTA(Antara): Anggota Komisi VIII DPR meninjau 11 embarkasi haji di 11 kota besar di Indonesia guna melakukan pengawasan pemberangkatan calon jamaah haji (calhaj) Indonesia pada penyelenggaraan haji tahun 2010. Wakil Ketua KomisiVIII DPR, Ahmad Zainuddin, di Jakarta, Minggu(10/10), mengatakan, peninjauan ke 11 embarkasi haji tersebut dilakukan anggota Komisi VIII dibagi menjadi 11 tim kecil dan dilakukan dalam

dua gelombang. Pada gelombang pertama, kata dia, pengawasan dilakukan oleh enam tim dengan mengunjungi enam embarkasi haji di Surabaya, Makassar, Solo, Batam, Banda Aceh, dan Balikpapan, pada 10-13 Oktober 2010. Gelombag kedua, pengawasan dilakukan oleh lima tim dengan mengunjungi lima embarkasi haji di Padang, Banjarmasin, Medan, Palembang, dan Mataram, pada pekan depan.

Kejagung Perlu ...

belum ada Surat Keputusan yang dikeluarkan oleh Presiden Susilo Bambang Yudoyono untuk memberhentikan Kapolri Jenderal Pol Bambang Hendarso Danuri. “Nanti ada SK dari Presiden,”tukasnya. Sebelumnya Presiden Susilo Bambang Yudoyono, telah menyerahkan satu nama sebagai pengganti Kapolri Jenderal Pol Bambang Hendarso Danuri, Yaitu Komjen Pol Timur Pradopo ke DPR. Namun Timur belum menjalani proses fit and proper test di DPR, sehingga belum bisa dilantik sebagai Kapolri. (Okezone)

radilan,” katanya. Karena itu, kata dia, saat ini, Kejagung dihadapkan pada dua pilihan atas kasus itu, yakni, mengesampingkan perkara dengan deponeering atau meneruskan kasus itu ke pengadilan. “Kejaksaan agung bebas memilihsalahsatunyasesuaidengan kewenangannya,” katanya. Presiden Berharap Diselesaikan Presiden Susilo Bambang Yudhoyono (SBY) mengharapkan kasus dua pimpinan Komisi Pemberantasan Korupsi (KPK), Bibit Samad Rianto dan Chandra M Hamzah bisa diselesaikan di luar jalur pengadilan. Dugaan penyalahgunaan kewenangan yang menjerat keduanya berpeluang dibuka kembali setelah Mahkamah Agung (MA) tidak menerima pengajuan peninjauan kembali (PK) atas Surat Ketetapan Penghentian Penuntutan (SKPP) kasus Bibit-Chandra. Ketua Umum Partai Demokrat Anas Urbaningrum menilai arahan Presiden bisa dijadikan panduan teknis dalam menyelesaikan perkara BibitChandra. “Ada dua pilihan, pertama Kejaksaan Agung harus melakukan penghentian perkara. Kedua, Kejaksaan Negeri mengeluarkan SKPP baru,” kata Anas dalam acara penanaman 999.-999 pohondanHUTPartaiDemokrat di Muara Baru Penjaringan Jakarta Utara, Minggu (10/10). Dariduapilihanitu,sambung Anas, Kejaksaan dipersilakan memilih yang terbaik. “Kami tidak bisa intervensi secara teknis,” ucapnya. (ant/ VIVAnews)

normal pukul 14:00. “Bahagia, apalagi kelahiran anak saya ini tepat pada tanggal unik, 10-102010 mudah diingatkan,” ujar suaminya Arnold Budiman, 48, yang juga warga Kompleks Tasbih Setia Budi Medan. Budiman mengaku sangat bersyukur karena istrinya melahirkan tepat pada tanggal cantik. Dia akan memberikan nama bayi perempuannya Meldrik Deine Hutasoit. Irwan, 36, warga Jl. Williem Iskandar yang sedang menunggu kelahiran anak ketiganya tampak cemas. Apalagi istrinya Nuriaty sedang berada di ruang operasi. Namun, sekitar pukul 11:30, dokter beserta bidan RSIA Rosiva mengucapkan selamat kepadanya, karena istrinya melahirkan bayi laki-laki sehat dengan berat 3,3 kg. Selanjutnya, Irwan langsung mengazankan anaknya tersebut. Penanggung Jawab Harian RSIA Rosiva Marni mengungkapkan, pada tanggal ‘cantik’ ini, sebanyak lima orang yang melahirkan di RSIA Rosiva, dua diantaranya melahirkan secara normal dan ketiga lainnya melahirkan secara cesar. “Tadi saya sempat saya bicara sama dokter, katanya banyak orang yang minta melahirkan tanggal ini, mungkin karena tanggal ini cantik ya, dan mungkin mudah diingat,” ujarnya. Adapun yang melahirkan

pada tanggal ‘cantik’ di RSIA Rosiva yakni, IinYohanes, 23, warga Jl. Sutomo Baru Medan, melahirkan bayi laki-laki dengan berat badan 31 kg, panjang 49cm. Nuriaty, 32, warga Jl. Williem Iskandar Medan, melahirkan bayi laki-laki dengan berat badan 3,2 kg, panjang 49 cm. Sedangkan di RSUP H. Adam Malik Medan, sebanyak 2 bayi perempuan lahir pada tanggal cantik ini. Bayi pertama, anak ke tujuh pasangan suami istri dari ibu Ramala dan Baharuddin. Bayi yang lahir pukul 10 lewat tersebut, berat badannya 3 kg dengan panjang 49 cm. Kemudian, Lindawati warga Sayum Sembahe melahirkan bayi perempuan dengan berat badan 4,2 kg dengan panjang badan 52 cm. bayi tersebut lahir pukul 13.00 siang. “Bayi Ramala lahir dengan cara vakum yakni disedot. Menurut saya itu karena orang tuanya sudah tak ada tenaga lagi untuk mengeluarkan bayinya dari rahimnya, sedangkan Lindawati lahir cesar,” kata Kasubbag Humas RSUP HAM Sari M. Saragih. Di tempat terpisah, dua bayi lahir di RS Haji Mina Medan bertepatan pada 10-10-2010. Pada waktu yang sama, juga lahir seorang bayi di RS Sari Mutiara. Selain di rumah sakit di atas, di beberapa rumah sakit lain juga dipastikan ada bayi yang lahir pada 10-10-2010. (cmai/m26)

Dikatakannya, secara teoritis dirinya sepakat jika kasus tersebut lebih baik dibuktikan di pengadilan saja, apakah BibitChandra itu bersalah atau tidak. “Tapi secara praktis dan politik saya tidak sependapat, sebab pengadilan yang berdasar rekayasa seperti itu tentu tak sehat. Saya khawatir pengadilan pun berjalan secara tidak `fair` karena soal politis dan psikologis,” katanya. Kendati demikian, ia tidak menyalahkan jika MA tidak menerima permohonan kasasi Bibit-Chandra, karena menurut hukum praperadilan itu, perkara hanya sampai di tingkat pengadilan tinggi saja. “MA bukan menolak tetapi tidak menerima kasasi itu, artinya karena MA tidak lagi berwenang untuk memutus prape-

BHD Resmi ...

Reuters

Perkawinan massal pada tanggal 10, bulan 10, tahun 2010 di China.

Menikah 10-10-10 ...

disamping itu ada yang melakukan patroli. “Pihak kepolisian mencurigai sebuah mobil Kijang jenis Avanza serta kendaraan roda dua yang melintasi daerah Lubuk Sikaping,” katanya. Petugas berhasil memberhentikan mobil Kijang jenis Avanza, lanjut Gatot Santoso langsung meminta keluar empat orang yang berada dalam mobil. “Dalam mobil tersebut ditemukan narkoba seberat 30 Kg yang dimasukan dalam karung,” katanya. Sedangkan pengendara sepeda motor berhasil dihenti-

kan oleh petugas di dekat Jembatan Jodoh By Pass Lubuk Sikaping, Kabupaten Pasaman Timur. “Pihak kepolisian berhasil mengamakan narkoba jenis ganja seberat 11 Kg dimasukan dalam tas ukuran besar,” kata Gatot Santoso. Dia menambahkan, pengakuan tersangka pada petugas, barang haram (ganja) dibeli dari daerah Madina, untuk diedarkan ke Kota Padang. “Pihak kepolisian masih melakukan penyidikan dan pengembangan terhadap bandar narkoba jenis ganja seberat 41 Kg itu,” katanya.

KBRI Siapkan ...

Kuala Lumpur, Widyarka Ryananta mengungkapkan, pihaknya tengah menyusun permohonan grasi kepada raja Malaysia. “Kami tetap mendampingi proses hukum Tarmizi dan Bustamam. Karena yang terakhir permohonan bandingnya ditolak, kini KBRI akan memohon grasi,” jelas Widyarka. Widyarka menceritakan, KBRI pernah memohon grasi kepada raja negara bagian Negeri Sembilan, Malaysia terkait vonis mati atas Adi Asnawi, TKI asal Lombok yang didakwa membunuh ibu majikannya. “Permohonan grasi atas Adi Asnawi dikabulkan Raja. Semoga permohonan grasi atas Tarmizi dan Bustamam ini juga dikabulkan.” harap Widyarka seperti dikutip dari laman Tempo Interaktif, Minggu (10/10). Diplomat asal Yogyakarta ini mengungkapkan, saat ini terdapat 177 WNI diancam hukuman mati di Malaysia. “142 orang terkait kasus narkoba, 35 orang lainnya karena kasus pembunuhan,” jelasnya. Dari jumlah tersebut, 70 orang telah dijatuhi vonis hukuman mati dan 67 orang telah melakukan usaha banding, termasuk diantaranya Tarmizi dan Bustamam. (TI)

Sampoerna Strategic, Sudirman, Jakarta Selatan, Minggu malam juga dipandu oleh sepuluh preseter yang semuanya adalah selebritis, yakni Indy Barens, Iwed Ramadan, Irgi Fahrezi, Fitri Tropica, Ruben Onsu, Cici Panda, Irfan Hakim, Nirina, Nycta Gina alias Jeng Kelin, dan Sentot Gempurdijaya alias Papham. “Kita masuk Indonesia Book of records, karena ini merupakan pernikahan yang cukup unik, tanggal 10-10-10, MC sepuluh, kita diiringi Harley Davidson sepuluh, pengiring pengantin sepuluh pasang, yang paling penting itu sepuluh MC-nya di pernikahan, itu yang paling unik,” jelas Indra, sebelum acara resepsi pernikahannya. Penghargaan ini diberikan sesaat sebelum acara resepsi pernikahan digelar. Rekor unik ini diberikan langsung oleh Paul Wienarto selaku Presiden IBOR. “Malam ini kita memberikan rekor kapada yang pertama kali di Indonesia, tanggal 10 bulan 10 tahun 2010, jam 10.00, mas kawin 10 Dinar, MC sepuluh. Dan kita memberikan penghargaan untuk Even yang pertama di Indonesia,” papar Paul. Di China Keputusan para pasangan untuk melangsungkan pernikahan di hari Minggu tidak lain adalah karena keyakinan peruntungan berdasarkan perhitungan tanggal. Pada tanggal ini menurut para ahli numerologi dan perhitungan China adalah hari terbaik yang jarang sekali ada. Para pasangan terutama mengincar pernikahan pada pukul 10:10, jika dideretkan maka terbentuklah banyak angka sepuluh, tanggal 10-10-10, jam 10:10. Deretan angka sepuluh ini pertama kalinya terjadi dalam jangka waktu 100 tahun. Para ahli numerologi mengatakan bahwa deretan angka 10 ini disebut “10 sempurna” yang melambangkan waktu yang sangat hebat dan kelahiran kembali. Menurut perhitungan China, tanggal ini disebut “Shi Quan Shi mei” atau “sempurna di segala hal”. Artinya, hari ini adalah hari terbaik untuk melangsungkan pernikahan. Banyak warga China yang meyakini hal ini, itulah sebabnya pesta pernikahan di China pada hari ini sudah dimulai pada pukul enam pagi. Menurut laman Mail Online, di distrik Haidian, Beijing, China, saja terdapat lebih dari 1.200 pasangan yang mendaftarkan pernikahannya hari ini. Tak heran bila hari ini memiliki jadwal pernikahan terbanyak dalam satu tahun. Menurut majalah Brides, di Inggris terdapat 31.000 pernikahan pada hari ini. Jumlah ini sepuluh kali lipat dari jumlah pernikahan di hari biasa. Menurut ahli astrologi dan fisika Australia Milton Black, tanggal 10-10-10 adalah tanggal dengan perhitungan astrologi yang sempurna. Tanggal ini menurutnya adalah tanggal yang dipenuhi dengan harapan, keberuntungan dan sangat positif, terutama yang berhubungan dengan uang dan bisnis. Black juga mengatakan bahwa wanita juga memiliki kesempatan yang lebih besar untuk hamil pada hari ini. “Beberapa pasangan akan menikah, berbulan madu dan mungkin akan langsung hamil pada malamnya. Mereka yang mengharapkan anak tidak akan menemukan hari yang lebih baik untuk masa subur dan kehamilan dibanding hari ini,” ujarnya. “Setiap anak yang lahir pada hari ini akan memiliki sifat yang positif dan sangat beruntung serta akan menjadi seorang pemimpin,” lanjut Black lagi. (kps/VIVAnews)

kepada wartawan tergabung dalam Tim Media Center Haji (MCH) di kantor Daker Madinah, kawasan Almustaroh, Madinah, Minggu (10/10). Petugas telah melakukan pengecekan ke pemondokan di Madinah. Dari pengecekan tersebut, mayoritas pemondokan telah siap menerima kedatangan jamaah haji. Kondisi serupa juga berlaku di Makkah. Kepala Daker Makkah Cepi Supriatna mengintruksikan dalam dua hari ini sudah mendapat laporan pemondokan haji sudah siap. Sekitar 63 persen pemondokan di Makkah berada di ring I atau jaraknya hanya sekitar 2 kilometer dari Masjidil Haram. Selebihnya, di ring II dengan jarak maksimal 4 kilometer. Lewat 2 Pintu Menurut Subakin, jamaah calon haji Indonesia gelombang pertama yang tiba di Madinah, Selasa(12/10), akan memasuki Madinah melalui dua pintu yakni, Bandara Malik Abdullah Bin AbdulAzizMadinahdanBandara King Abdul Aziz (KAA) Jeddah. Jamaah gelombang pertama

yang masuk Madinah berjumlah 491 kloter yakni, 372 kloter masuk lewat Jeddah dan 119 kloter masuk lewat Madinah. Diperkirakan total jamaah yang tiba sekitar 200.550 orang. “Jumlah pastinya baru bisa diketahui setelah nanti sampai sini. Nanti setelah sampai di Madinah akan dilakukan pengecekan oleh petugas,” kata Subakin. Untuk pengamanan kedatangan jamaah dikerahkan 336 personel, di antaranya 130 orang merupakan tenaga musiman (temus). Hingga kini, jamaah calon haji yang sudah tiba di Madinah adalah jamaah dari Thailand, Turki, Malaysia dan Afrika. Madinah siap Sementara, The Private Establishment of Guides — satu perusahaan yang menangani rombongan haji — telah mulai melaksanakan rencana operasionalnya untuk Musim Haji tahun ini, kata pimpinan perusahaan itu ketika mengumumkan awal operasionalnya setelah melakukan peninjauan ke beberapa tempat penampungan para jamaah haji di Madinah.

Yousef bin Ahmad Huwala ditemani oleh para pejabat senior dari perusahaan tersebut ketika dia melakukan peninjauan Al-Hijra, Al-Bar, dan Bandara Prince Muhammad bin Abdul Aziz Jumat. “Kami selalu berusaha keras untuk terus meningkatkan pelayanan kami untuk para tamu Allah. Kami tingkatkan pelayanan dengan melakukan studi tentang berbagai perkembangan selama beberapa tahun terakhir,” katanya. Huwala mengatakan perusahaannya memantau dengan seksama pelaksanaan rencana yang bertujuan untuk memberikan pelayanan utama kepada para jamaah yang mengunjungi Madinah baik sebelum maupun setelah musim Haji untuk memberikan penghormatan kepada Nabi Muhammad dan melakukan shalat di masjidnya. Huwala mengatakan banyak panduan dari perusahaannya juga akan mengantarkan para jamaah pulang ke tanahairnya, baik lewat darat, laut atau udara. (m36/m32/h10/an/m07)

Kereta Makkah ... Kereta itu merupakan proyek terbesar kedua yang berhasil dikerjakan Departemen Dalam Negeri Arab Saudi setelah pembangunan jembatan jumrah yang sarat teknologi tinggi di Mina dengan biaya 4,5 miliar riyal. WakilMenteriDalamNe-geri, Habib Zain Al-Abidine mengatakan pada tahap pertama akan disediakan 10 rangkaian kereta

yang masing-masing panjangnya 300 meter. ‘’Setiap kereta akan memba wa sekitar 3.000 penumpang,’’ katanya. Namun sejauh ini pemerintah Saudi belum menetapkan harga tiket kereta tersebut. Dengan kereta berkecepatan 80 sampai 120 km per jam itu, waktu tempuh selama menjalankan ibadah haji dari tempat-tempat suci itu akan lebih cepat. Jarak dari Arafah ke Muzdalifah akan ditempuh jamaah haji dalam

waktu lima menit pada 9 Dzulhijah. Dari Muzdalifah ke Mina juga hanya lima menit. Zain Al-Abidin mengatakan, kereta akan beroperasi sepanjang tahun. Pada tahap kedua, proyek kereta itu akan menghubungkan Mashair Railway dengan Masjidil Haram di Makkah, stasiunnya di Jalan Umm Al-Qura. Kereta ini juga kelak akan dihubungkan dengan jaringan kereta ke Madinah dan Jeddah. (an)

dukun melahirkan di daerah tidak bisa dibilang banyak. Tetapi saya terus bertekad untuk menyampaikan niat saya itu dengan cara menabung sedikit demi sedikit. Dulu, saat aktif bekerja, saya harus menghidupi lima orang anak saya, yang saat ini tinggal empat orang.” Suami saya sudah meninggal dunia puluhan tahun lalu, sehingga tugas membesarkan anak-anak sepenuhnya ada di pundak saya. Alhamdulillah, semua kewajiban yang harus saya lakoni sebagai orang tua tunggal terlaksana. Sehingga lima tahun yang lalu, sayapun bisa mendaftarkan diri sebagai calon jamaah

haji. Saya pantas bersyukur, di usia yang senja ini masih kuat dan penuh semangat akan datang ke rumah Allah Masjidil Haram, tempat yang saya rindukan setiap waktu, setiap kali saya bersujud kepada Allah selalu berdoa agar diberi kesempatan menunaikan ibadah haji, katanya penuh haru dan mengaku mempunyai 30 orang cucu. Biar Muda Sudah Mantap Calhaj termuda Siti Audita Binti Cholailuddin berusia 21 tahun. Di sela kesibukannya mengemas barang bawaan di Asrama Haji, kemarin, mengaku sudah mantap melaksanakan

ibadah haji meskipun usianya masih muda dan sedang menimba ilmu di Universitas Negeri Medan (Unimed), Psikologi Pendidikan semester V, tapi dia yakin bahwa apa yang dia laksanakan ini semakin mampu mempertebal keimannya. “Alhamdulillah diberi waktu dan kesempatan oleh Allah bisa melaksanakan ibadah haji di usia 21 tahun. Kebetulan orang tua mempunyai dana dan saya sudah siap berangkat. Saya ikhlas dalam menjalani rutinitas ibadah ini, saya berharap akan menjadi yang terbaik dalam perjalanan hidup ke depan,” katanya. (m36)

Tarmizi Yacob, asal Desa Ceurucuk Kecamatan Samalanga Kabupaten Aceh Jeumpa, Bireun dan Bustamam bin Bukhori asal Desa Reum Baro Kecamatan Samalanga Kabupaten Aceh Jeumpa, Bireun, ditangkap polisi Malaysia pada 5 April 1996. Keduanya dihadapkan ke pengadilan atas dakwaan membawa 3 Kg ganja. Baik Tarmizi maupun Bustamam dijerat pasal 39 B (1) Undang-undang anti narkotika Malaysia tahun 1952. Setelah melalui proses persidangan, keduanya dijatuhi hukuman gantung sampai mati oleh Pengadilan Tinggi Malaysia pada 5 Agustus 1997. Atas vonis tersebut, keduanya mengajukan permohonan banding ke pengadilan banding Malaysia, namun permohonan tersebut ditolak pada 2 Desember 2004. Pengacara Tarmizi dan Bustamam kembali mengajukan banding ke Mahkamah Agung, namun kembali ditolak pada 27 Juli 2010. Kini, harapan keduanya tinggal permohonan grasi kepada raja Malaysia, Mizan Zainal Abidin. Minister Konselor Penerangan, Sosial dan Budaya KBRI

Pemondokan ... Dia juga menjelaskan, Kloter 1 asal Labuhanbatu ini jumlah jamaah sebanyak 454 orang, seorang gagal berangkat atas nama Aisyah Satya Tanjung penduduk Marsonjah Labusel. Calhaj tertua berusia 102 tahun atas nama Koyimah Nasrun Binti Abdulah, termuda Siti Audita Binti Chalailuddin. Terkesan Hal lain yang disampaikan Sazli, Pj Bupati Labusel Drs Abd Razak Pasaribu yang memberangkatkan Calhaj dari Lapangan HB Kotapinang, Sabtu (9/10) malam, terlihat haru saat mengetahui Calhaj Kloter 1 asal daerah itu saat berangkat ke tanah suci dilepas oleh Menteri Agama. Dia menyampaikan hal itu didampingi Kepala Kementerian Agama Labuhanbatu Zulfan Haris. Tahun ini Calhaj asal daerah itu sebanyak 1.507 orang yang berangkat melalui kloter 1, 4,10 dan 15. Rampung Dari Madinah dilaporkan, dua hari menjelang kedatangan jamaah haji Indonesia gelombang pertama, pemondokan jamaah baik di Makkah maupun Madinah hampir rampung. Sejumlah petugas haji,kini tengah melakukan pengecekan akhir. “Kami akan upayakan 100 persen jamaah di Madinah yang akan melakukan arbain bisa menempati markaziah (sekitar 500 meter dari Masjid Nabawi). Untuk itu kami akan kerja ke-ras,” kata Kepala Daerah Kerja Madinah Subakin Abdul Muthalib. Subakin menyatakan hal itu

Usia 102 Tahun ... sebenarnya sudah lama. Diapun tidak bisa lagi menghitung tahun berapa pastinya, hanya saja impian dan harapannya untuk bisa berangkat haji selalu dia simpan dalam hati. Untuk memenuhi harapan dan impiannya itu, diapun berusaha menabungkan uang dari penghasilannya sebagai dukun melahirkan. Dari tabungannya selama puluhan tahun, akhirnya lima tahun yang lalu, bersama anak dan cucunya, Koyimah berani membuat tabungan khusus haji. “Awalnya hanya niat saja, maklumlah penghasilan sebagai

Nusantara

WASPADA Senin 11 Oktober 2010

A3

Pimpinan DPR Bisa Dibawa Ke BK JAKARTA ( Waspada): Gerakan protes terhadap Pimpinan DPR bisa bergulir terus jika pimpinan tidak meminta maaf dan memperbaiki kinerja. Kini gerakan itu sudah ditandatangani 28 legislator lintas fraksi dan komisi. Demikian disampaikan salah satu anggota Komisi Hukum DPR, Gayus Lumbuun dalam perbincangan dengan VIVAnews, Minggu (10/10). Sejumlah anggota DPR mengajukan keberatan atas tindakan Pimpinan DPR memanggil calon Kapolri Komjen Timur Pradopo, beberapa waktu lalu. Ini dinilai melanggar karena pimpinan melangkahi Komisi III sebagai penguji kelayakan dan kepatutan calon Kapolri. “Kami sepakat pimpinan harus minta maaf atas pelanggaran yang telah mereka buat,” kata Gayus. Jika protes ini tidak digubris Pimpinan DPR, para legislator ini akan menyurati semua partai politik dan fraksi agar mengevaluasi kinerja pimpinan. Selain itu, kata Gayus, Badan Kehormatan (BK) pun tidak menutup kemungkinan akan menerima dan menindaklanjuti aduan masyarakat terkait masalah ini. “Kami akan tempuh semua jalur agar ada perubahan di DPR ini,” kata Gayus, yang juga menjabat Ketua BK DPR. Dia memenegaskan, tidak ada niat melengserkan jabatan seseorang dalam masalah pemanggilan Timur Pradopo yang dinilai melanggar itu. “Tidak ada niat mengusik, tapi masalahnya ini sudah kepentingan publik yang dilanggar,

bukan masalah internal semata,” sebutnya. Petisi Penolakan Timur Sementara alumni Universitas Trisakti menyesalkan penunjukan Komjen Timur Pradopo oleh PresidenYudhoyono sebagai calon Kaolri. Mereka mendesak SBY menarik pencalonan Timur karena dianggap terlibat dalam kasus penembakan mahasiswa Trisakti pada 12 Mei 1998. “Kami terdiri para alumni Universitas Trisakti mendesak presiden menarik kembali Timur Pradopo sebagai calon kapolri, sampai terdapat kejelasan secara hukum tentang tragedi Trisakti, serta kejelasan peran Timur Pradopo di hadapan hukum,” kata alumni Trisakti, Dedy Hariyanto di Jakarta, kemarin. Dia mengatakan, saat terjadi peristiwa yang menewaskan empat mahasiswaTrisakti itu,Timur Pradopo menjabat sebagai Kapolres Jakarta Barat. “Dia berada di lapangan pada saat terjadinya pembubaran secara paksa terhadap mahasiswa yang berunjuk rasa secara damai di depan kampus Trisakti,” sebutnya. Alumni Trisakti, akan mengirimkan petisi kepada SBY dan DPR untuk membatalkan pencalonan Timur. Hingga kini, kata dia, telah ada sekitar 250 alumni Trisakti yang menandatangani penolakan Timur. “Nanti saat fit dan proper test kami bersama mahasiswa akan melakukan aksi di depan gedung DPR,” kata dia.(viva)

Kapitalisme Sebabkan Kemiskinan Di Dunia BANDA ACEH (Antara): Pakar Ekonomi Islam dari Lembaga Pengembangan Perbankan Indonesia (LPPI) Arie Mooduto menyatakan, sistem perekonomian kapitalisme yang dianut mayoritas negara di dunia salah satu penyebab banyaknya kemiskinan. “Banyaknya orang miskin di dunia sekarang salah satu penyebabnya adalah kapitalis dan sistem konvensional,” katanya dalam seminar internasional ekonomi dan keuangan Islam di Banda Aceh, Minggu (10/10). Dikatakan, saat ini sedikitnya 824 juta jiwa warga bumi masih miskin dan memprihatinkan, salah satunya karena korban dari kapitalisme yang hanya berpihak kepada pemodal. Menurutnya, sistem ekonomi kapitalisme yang banyak dianut negara-negara di dunia, khususnya negara barat mengenyampingkan rasa keadilan bagi umat manusia sehingga menimbulkan kemiskinan yang merajalela. “Negara kita Indonesia juga sudah menganut kapitalis, sehingga kontras terlihat di tengahtengah bangunan yang mewah-mewah juga ada perumahan kumuh milik orang-orang miskin,” ujar Direktur Bidang Syariah LPPI itu. Banyak perusahaan asing yang beroperasi di Indonesia seperti Freeport yang mengekploitasi hasil bumi di Papua dan Exxon Mobil di Aceh, tidak memperhatikan kesejahteraan rakyat di sekitarnya. “Sudah berapa lama Freeport beroperasi di Timika, Papua tetapi apa yang diperoleh rakyat di sana. Masyarakat Timika, maaf, masih tetap menggunakan koteka. Masyarakat di sana masih hidup miskin,” kata Arie Mooduto.

Kata dia, sejumlah pakar ekonomi dunia sekarang sudah mengakui kalau ekonomi kapitalis ternyata tidak memiliki arah yang jelas. Menurutnya, banyak perusahaan-perusahaan besar di dunia, pelaku ekonomi kapitalis yang akhirnya kolaps setelah memiliki banyak aset, karena tujuannya hanya memperkaya pemodal semata tanpa mempedulikan kemaslahatan umat. Arie Mooduto mengatakan, sistem ekonomi yang memiliki keunggulan lebih dan komplet di dunia hanya sistem perekonomian Islam atau berbasis syariah. Sistem ekonomi syariah jika diterapkan dengan jelas diyakini mampu menjawab permasalahan besar di dunia sekarang, seperti kemiskinan. Menurutnya sistem perekonomian Islam yang salah satunya mengatur tentang pengembangan perbankan (Perbankan Syariah), memiliki arah jelas dan tidak ditemukan dalam sistem ekonomi lainnya, yakni menitikberatkan pada kemaslahatan umat manusia, mengedepankan moral, etika dalam pelaksanaannya dan mewujudkan keseimbangan distribusi pendapatan. “Perekonomian Islam mengandung jihad suci yaitu melenyapkan kemiskinan dari muka bumi dan punya misi universal,” ujar Arie Mooduto. “Moral, aqidah dan kemaslahatan bagi manusia adalah hal yang utama yang harus diperhatikan dalam ekonomi syariah,” katanya. Dikatakan konsep perekonomian Islam sudah jelas diatur berdasarkan Alquran dan Hadist, hanya tinggal mempraktikkan saja.

5.031 Topeng Pecahkan Rekor MURI CIREBON (Antara): 5.031 Topeng buatan tangan pelajar Cirebon berhasil memecahkan rekor Museum Rekor Indonesia (MURI) di Cirebon, Jawa Barat, Minggu (10/10). Pemecahan rekor itu merupakan bagian rangkaian kegiatan Festival Topeng Nusantara yang puncaknya diselenggarakan 16-17 Oktober di Cirebon. Bertempat di halaman Gedung Negara Kantor Badan Koordinasi Pemerintahan dan Pembangunan (BKPP) Wilayah Cirebon, pembuatan topeng dilakukan 500 pelajar sewilayah III Cirebon sejak pukul 09:00, dan berakhir pukul 14:00, atau lebih cepat dari yang direncanakan pukul 15:00 WIB. Penyerahan piagam Muri diserahkan langsung Manajer Muri, Sri Widayati kepada Peggy Melati Sukma selaku juru bicara Festival Topeng Nusantara disambut sorak gembira para pelajar peserta pembuat topeng. Mereka merasa senang kerja keras timnya membuat topeng dari proses awal pencetakan hingga mewarnai tidak sia-sia, padahal hanya mendapat pelatihan satu kali. “Saya senang sekali rekor bisa terpecahkan,

padahal kami hanya diberi pelatihan mencetak topeng sekali saja, itupun dua minggu yang lalu,” kata Andi, pelajar SMP 5 Cirebon. Peggy Melati Sukma menyatakan kebahagiaannya atas prestasi itu dan berharap menjadi sebuah kontribusi generasi muda Cirebon dalam melestarikan dan mempublikasikan topeng nusantara ke pada dunia. “Pemecahan rekor ini akan menjadi memori yang tidak akan terhapus dalam kehidupan para peserta dan akan menjadi sejarah membanggakan yang akan menjadi cerita kepada anak cucu mereka bahwa mereka pernah bersamasama memperjuangkan melestarikan kebudayaan bangasa dengan memecahkan rekor ini,” kata Peggy. Sebagian topeng-topeng buatan tangan para pelajar Cirebon, kemudian dipajang di halaman Gedung Negara BKPP agar bisa dilihat oleh masyarakat. Topeng-topeng itu rencananya juga akan di pajang pada saat puncak kegiatan FTN pada 16-17 Oktober, yang akan menampilkan pagelaran tari topeng dari berbagai daerah yang dikemas secara eksklusif serta kirab topeng nusantara.

30 Pasangan Batam Menikah 10-10-10

Antara

REKOR MURI: Ratusan siswa dari 45 sekolah di wilayah kota Cirebon dan Kabupaten Cirebon mengikuti proses pembuatan 5000 topeng di halaman gedung negara, Cirebon, Jawa barat, Minggu (10/10). Menurut Peggy Melati Sukma selaku koordinator program, kegiatan yang diberi tema “5000 topeng kreasiku” sekaligus untuk memecahkan rokor MURI membuat 5000 topeng dalam satu hari.

BATAM (Antara): 30 pasangan di Batam memilih menikah pada tanggal 10 bulan 10 tahun 2010, kata Kepala Kantor Kementerian Agama Kota Batam, Provinsi Kepulauan Riau Zulkifli Ali. “Hari ini ada sekitar 30 pasangan menikah, 10 di antaranya pada pukul 10 WIB,” kata Zulkifli di Batam, Minggu (10/10). Dibanding dengan harihari lain, maka jumlah pengantin pada Minggu (10/10) jauh lebih banyak. ”Kalau pada hari normal, hanya ada dua pasangan,” kata dia mengatakan, sebenarnya ada lebih banyak pasangan muslim yang meminta dinikahkan pada seri 10-10-10, namun karena keterbatasan jumlah penghulu, maka Kandepag tidak bisa melayani seluruhnya. Untuk dapat menikah tepat pada pukul 10 WIB, tanggal 10, bulan 10 tahun 2010, pasangan sudah mendaftarkan rencana pernikahannya di KUA sejak jauh hari. Menurut dia, para pasangan memilih menikah di tanggal 10-10-2010 karena ingin harinya istimewa di tanggal yang mudah diingat.

Antara

WISATA KOTA TUA: Sebuah kapal wisata melintas di Sungai Batang Arau, Kota Padang, Sumbar, Minggu (10/10), dilatari bangunan-bangunan kuno di pinggiran sungai. Pemprov Sumbar berencana akan memugar kawasan kota tua di tepian sungai Batang Arau dan Kampung Cina sehingga menjadi objek wisata unggulan yang bisa ditawarkan kepada wisatawan domestik maupun mancanegara.

Empat Fakta Rekayasa Bibit-Chandra JAKARTA (Waspada): Mahkamah Agung menolak permohonan Peninjauan Kembali (PK) Surat Ketetapan Penghentian Penuntutan (SKPP) dua pimpinan Komisi Pemberantasan Korupsi (KPK) Bibit Samad Riyanto dan Chandra M Hamzah oleh MA. Karena itu, kasus dugaan penyalahgunaan wewenang Bibit-Chandra bisa lanjut ke pengadilan. Menurut Koordinator Divisi Hukum dan Monitoring Peradilan Indonesia Corruption Watch (ICW), Febri Diansyah, ada sembilan bukti rekayasa dalam kasus yang menimpa Bibit dan Chandra. Sembilan bukti itu kemudian diklasifikasi menjadi empat fakta

rekayasa. Febri mengatakan itu dalam diskusi di Jakarta, Minggu (10/10). Rekayasa pertama terkait pasal pemerasan. Namun kata Febri, pasal itu telah diklarifikasi tim delapan dan putusan pengadilan tindak pidana korupsi terhadap pengusaha Anggodo Widjojo. Anggodo divonis bersalah atas percobaan penyuapan kepada pimpinan KPK. “Anggodo yang inisiatif melakukan suap,” kata Febri. Kedua, rekayasa terlihat dalam kronologi waktu penyuapan. Namun rekayasa kronologi penyuapan ini telah dibantah melalui kesaksian Putranefo Prayugo, Edy Sumarsono dan Ari Muladi dalam persidangan Anggodo.

Ibunda Gus Mus Meninggal Dunia SURABAYA (Antara): Ibunda Wakil Rais Aam Pengurus Besar Nahdlatul Ulama (PBNU) KH Musthofa Bisri atau Gus Mus meninggal dunia dalam usia 87 tahun. M Nabil Haroen, juru bicara keluarga Gus Mus dalam surat elektronik diterima Antara di Surabaya, Minggu (10/10) mengatakan, Nyai Ma‘rufah, demikian panggilan ibunda ulama sekaligus budayawan itu meninggal dunia di RS Islam Arafah, Rembang, Jateng, Minggu sekitar pukul 06:30. “Beliau masuk rumah sakit sejak Rabu (6/10) karena komplikasi penyakit,” kata Nabil, yang berada di rumah duka di kompleks Pondok Pesantren Raudlatut Thalibin, Rembang. Jenazah akan dikebumikan di pemakaman keluarga disekitar kompleks PP Raudlatut Thalibin, Minggu pukul 19:00.

Putranefo pada sidang 8 Agustus 2010 memberikan keterangan telah mengetik kronologi 15 Juli 2009 atas permintaan Anggodo. Dalam kesaksian Edy Sumarsono, 8 Juni 2010, Edy juga menjelaskan diminta Anggodo seolah-olah KPK melakukan pemerasan. Sedangkan dalam kesaksian Ary Muladi 22 Juni 2010 dijelaskan bahwa Anggodo yang menyiapkan kronologi 15 Juli 2009. Febri melanjutkan, rekayasa ketiga terlihat dengan tidak adanya bukti rekaman percakapan sebanyak 64 kali antara Direktur Penyidikan KPK Ade Rahardja dengan Ary Muladi. “Fakta pengadilan Mabes Polri gagal memenuhi perintah pengadilan. Bahkan call data record (CDR) pun tidak dapat dipenuhi,” jelas Febri. Rekayasa keempat dalam, hal penyerahan uang. Berdasarkan kronologi 15 Juli, disebutkan penyerahan uang dilakukan

kepada Bibit di Hotel Belagio, Jakarta 15 Agustus 2008. Namun waktu itu Bibit sedang dalam kunjungan kerja ke Peru pada 12-15 Agustus 2009. “Ada bukti foto dan kesaksian staf-staf KPK,” ucap Febri. Hal berbeda terlihat dalam penyerahan uang kepada Chandra. Disebutkan Chandra menerima uang 15 April 2009 di Pasar Festival Kuningan, Jakarta. Namun saat itu Chandra tidak berada di Pasar Festival. “Kesaksian Ary Muladi pun menyebutkan tidak pernah memberikan uang kepada pimpinan KPK,” kata Febri. Langgar UU Laode Muhammad Syarif, pakar hukum Universitas Hasanuddin, menilai MA cenderung menggunakan“kacamata kuda” saat menolak PK Kejagung terkait kasus dugaan rekayasa yang menjerat Bibit-Chandra. Dalam putusan MA disebut-

kan, penolakan berdasarkan pasal 45a UU No. 5/2004 tentang MA yang menyebutkan praperadilan tidak bisa diajukan kasasi ke MA. Putusan MA dinilai Laode mengesampingkan hakekat keadilan. “MA mendahulukan role of procedure. Namun MA mengesampingkan substansive justice, hakekat keadilan,” kata Laode. MA juga diduga melanggar UUD ’45 pasal 28 ayat i, disebutkan warga negara berhak akan “kepastian hukum yang adil serta perlakuan yang sama di hadapan hukum”. Namun Kejaksaan Agung telah menyiapkan dua opsi. “Pertama melimpahkan perkara ke pengadilan,” kata Plt Jaksa Agung Darmono, Jumat (8/10) lalu. Kedua, Jaksa Agung memiliki kewenangan mengesampingkan perkara demi kepentingan umum atau yang biasa disebut.(viva)

Pemanggilan Gubsu Jangan Didramatisir JAKARTA (Waspada): Wakil rakyat daerah pemilihan Sumut 1 yang juga Wakil Ketua Komisi VI DPR RI, Nurdin Tampubolon meminta masyarakat Sumut untuk tidak mendramatisir pemanggilan Syamsul Arifin, yang kini menjabat Gubsu oleh KPK terkait kasus penyalahgunaan dan pengelolaan kas daerah, serta APBD Langkat 2000 - 2007. Pemanggilan Syamsul

sebagai saksi, Senin (11/10) pagi merupakan hal biasa, bukan peristiwa luar biasa. “Jangan ada yang mendramatisir untuk kepentingan pribadi, kelompok maupun golongan. Pemanggilan itu hal biasa guna menuntaskan proses hukum yang sedang berjalan,” ujar Nurdin menjawab Waspada, Minggu (10/10) di Jakarta. Ketua DPP Partai Hati Nu-

rani Rakyat (Hanura) itu mengharapkan semua pihak menghormati proses hukum dengan mengedepankan asas praduga tidak bersalah. Sebagaimana diketahui, Senin pukul 09:30 Syamsul dijadwalkan memenuhi panggilan KPK. Syamsul Arifin berstatus tersangka terkait kasus penyalahgunaan dan pengelolaan kas daerah, serta APBD Langkat 2000-2007.(aya)

Hati-hati Memaknai 10-10-10 PADANG (Antara): Ulama Sumatera Barat, Gusrizal Gazahar mengingatkan kepada masyarakat, khususnya umat Islam yang tengah melangsungkan pernikahan pada Minggu, 10-10-2010 atau tanggal yang serupa semisal 9-9-2009 dan 11-11-2011, agar berhati-hati memaknainya, karena hal itu dapat menjerumuskan seseorang dalam kurafat yang menjurus pada kesyirikan. “Dalam Islam tidak ada pengkhususan tentang hari pernikahan, apalagi memaknai hari dan tanggal tertentu dengan keistimewaan tertentu,” katanya di Padang, Minggu (10/10). Dia mengatakan, hari ataupun tanggal tidak dapat dikatakan memiliki keistimewaan kecuali ada landasan syar‘i di dalamnya, baik melalui Al-Quran dan Hadits. Dia mencontohkan, seperti hadis Rasulullah tentang keutamaan hari Jumat, yang diriwayatkan oleh Imam Muslim. “Rasulullah pernah bersabda, hari terbaik dimana matahari terbit di dalamnya ialah hari Jumat. Pada hari itu Adam Alaihis Salam diciptakan, dimasukkan ke surga, dikeluarkan daripadanya dan kiamat tidak terjadi kecuali di hari Jumat (Hadis Riwayat Imam Muslim),” kata Ketua MUI Sumbar Bidang Fatwa itu. Namun terkait hari pernikahan, Rasulullah SAW tidak pernah mengkhususkan hari tertentu agar umatnya menikah pada harihari tertentu itu. Semua hari dalam Islam itu baik asalkan dimulai dengan niat karena Allah SWT, katanya menilai, dalam pandangan Islam, tidaklah salah bila umat Islam menikah pada hari ini (10-10-2010) jika itu memang telah dimusyawarahkan antara keluarga dari kedua mempelai. “Yang salah, jika masyarakat menganggap hari ini memiliki keistimewaan tertentu berdasarkan perhitungan-perhitungan yang

mengandung nilai kurafat lalu menjadikannya sebagai sesuatu yang sakral sehingga dalam kategori ini, orang itu dapat dianggap sebagai orang jahil (bodoh) dalam agama.” Terkait itu, dia mengingatkan, masyarakat khususnya umat Islam agar tidak menjadikan opini umum yang berkembang saat ini sebagai suatu pemahaman yang harus dibenarkan. “Masyarakat harus lebih cerdas memahami kontekstual kehidupan termasuk perihal pernikahan dengan memperdalam ilmuilmu Islam,” sebut dia. Ilmu agama terkait pernikahan, sebutnya, sangat penting sebab pernikahan merupakan pintu dari amalan besar ketika seseorang telah memiliki tanggung jawab untuk membina keluarga yang sakinah, mawaddah dan warrahmah. Dia menambahkan, jika ada umat Islam yang terjebak dalam kesalahpahaman terhadap hari ini (10-10-2010), berarti telah muncul pula kejahilan baru dalam masyarakat. “Masalah walimah yang melanggar aturan Islam saja belum dapat dituntaskan, ditambah lagi dengan masalah baru karena jahilnya umat memaknai tanggal 10-10-2010 hari ini,” katanya. Terkait persoalan tersebut, terjadi akibat tatanan dakwah di kalangan umat Islam saat ini sudah beralih kepada dakwah yang hanya mengandung nilai hiburan, tanpa memperhatikan tujuan dasar dan sasaran dakwah itu sendiri. Tatatanan dakwah harus kembali difungsikan oleh mubaligh tidak sebatas kajian parsial saja, namun harus menyentuh hingga persoalan dasar dalam agama Islam yakni kajian tauhid (keyakinan). “Dakwah harus kembali di arahkan pada kajian tauhid yang menyentuhpersolaankeyakinanumatpadanilaiukhrawi (akhirat) hingga umat Islam tidak terjerumus dalam pemahaman kurafat,” tandasnya.

Antara

TULISAN TANGAN: Seorang perempuan mencermati ‘Al Quran Tulisan Tangan’ yang dibuat pada abad 17 Masehi, yang dipamerkan dalam Pameran Koleksi Unggulan Museum di Taman Budaya Jatim, Surabaya, Sabtu (9/10). Pameran yang diikuti sejumlah museum se Jatim dalam rangka HUT Ke-65 Provinsi Jawa Timur tersebut, bertujuan mensukseskan Gerakan Nasional Cinta Museum sebagai sarana pendidikan dan rekreasi.

Luar Negeri Taliban Mengaku Serang Konvoi Pasokan NATO Di Pakistan A4

MIRANSHAH, Pakistan (AP/Antara/AFP) - Taliban Minggu (10/10) mengaku bertanggung jawab atas serangan terakhir konvoi pasokan Pakta Pertahanan Atlantik Utara (NATO) di baratdaya dan berikrar akan terus menyerang sampai serangan pesawat tak berawak Amerika Serikat dihentikan. “Kami bertanggung jawab atas serangan-serangan terhadap truk-truk pasokan NATO dan tanker-tanker di distrik Sibi, Sabtu,” kata jurubicara Tehreeke-Taliban di Pakistan (TTP) Azam Tariq. “Kami akan terus menyerang truk-truk dan tanker-tanker NATO sampai serangan pesawat tak berawak dihentikan,” katanya dalam telepon dari suatu tempat yang tak dijelaskan. Kelompok bersenjata Sabtu membakar sedikitnya 29 tanker minyak di Pakistan barat daya. Itu adalah serangan keenam dalam tempo sepekan terhadap kendaraan pembawa pasokan untuk 152.000 tentara asing yang berperang melawan gerilyawan yang dipimpin Taliban. Serangan sebelumnya juga diakui dilakukan oleh Taliban. Dua petugas polisi cedera dalam serangan di daerah terpencil Mitri, di distrik Sibi, 180 km tenggara Quetta, ibukota provinsi kaya minyak dan gas Baluchistan, yang berbatasan dengan Iran dan Afghanistan. “Sekitar 30 orang bersenjata menyerang tanker-tanker itu, yang diparkir di luar sebuah hotel dan melepaskan tembakan pada Sabtu pagi, melukai dua petugas polisi setempat,” kata Abdul Ma-

teen, seorang pejabat senior pemerintah di Mitri. GerilyawanTaliban telah melancarkan serangan gencar terhadap kendaraan pasokan di Pakistan dalam sepekan belakangan, untuk membalas gelombang baru serangan pesawat tak berawak AS yang ditargetkan kepada para pejuang Taliban dan al Qaida di wilayah suku negara itu. Pihak berwenang Pakistan melaporkan 26 kali serangan pesawat tanpa awak sejak 3 September, yang menewaskan lebih dari 140 orang di wilayah itu, yang dianggap sebagai pusat berkumpulnya pejuang dalam dan luar negeri yang berperang di Afghanistan. Serangan itu dikaitkan dengan rencana AS untuk mencegah dugaan rencana para kelompok garis keras melancarkan serangan-serangan ala-Mumbai di Eropa. Pakistan Sabtu malam mengumumkan, pihaknya memutuskan akan membuka kembali jalur darat utama bagi pasokan NATO ke Afghanistan. Para pejabat di perbatasan Torkham di wilayah Khyber barat laut mengatakan, kendaraan-kendaraan itu mulai meninggalkan daerah tersebut Ahad malam. Buka kembali rute pasokan

Al Qaida Mengaku Serang Intelijen Yaman SANA’A, Yaman (Antara/Xinhua-OANA): Sayap al Qaida yang berpangkalan di Yaman mengaku bertanggung jawab atas rentetan serangan mematikan terhadap petugas dan fasilitas intelijen di Yaman Utara dan Selatan. Pertemuan puncak luar biasa Arab ditutup dengan pernyataan akhir al Qaida menyerang konvoi kedutaan Inggris di Yaman, menewaskan tiga orang. Presiden Yaman, diplomat senior Amerika Serikat membahas upaya memerangi terorisme. Yaman menangkap lima tersangka atas tuduhan berusaha membebaskan tawanan Al Qaida. Dalam pernyataan yang disiarkan di forum jihad Sabtu (9/ 10), al Qaida di Jazirah Arab (AQAP) mengatakan, mereka berada di balik serangan sebuah bus yang membawa para perwira tinggi intelijen di ibukota Sana’a 25 September, yang menewaskan 14 orang dan sejumlah lainnya luka-luka. AQAP melakukan serangan ketika para petugas kontraterorisme itu sedang dalam perjalanan untuk mempraktekkan pelatihan di Sanaa yang disponsori AS. Semua penyerang ‘Mujahidin’ itu kembali ke tempat persembunyian mereka tanpa cedera, kata pernyataan itu. Pada 25 September, seorang perwira intelijen mengatakan kepada Xinhua, bahwa sedikitnya dua agen mereka tewas dan delapan lainnya cedera dalam serangan al Qaida terhadap bus mereka di Sanaa. Dia mengatakan, tiga orang al Qaida bertopeng dan bersenjatakan AK-47 menembak sebuah bus polisi yang sedang melaju di dekat Universitas Al-Eyman, universitas keagamaan yang dikelola dan dimiliki oleh Sheik Abdulmajid al-Zandani, warga suku yang juga ulama salafi. Universitas Al-Eyman pernah dicurigai pemerintah Yaman dan AS menyembunyikan para pejuang al Qaida. AQAP juga mengatakan, mereka berada di balik lima serangan lain dalam beberapa bulan terakhir terhadap fasilitas intelijen di provinsi Lahj, selatan Sana’a, menewaskan delapan agen termasuk direktur bagian investigasi keamanan Kolonel Ali Abdulkarim. Dinas intelijen di negara miskin di pesisir selatan Jazirah Arah itu telah berulang kali dijadikan target oleh AQAP sejak awal tahun ini, menyebabkan puluhan anggota kontra-terorisme mereka tewas atau cedera.

Kementerian Luar Negeri Pakistan mengumumkan dibukanya kembali rute darat penting bagi pasokan Pakta Pertahanan Atlantik Utara (NATO) melintas ke Afghanistan dari Torkham di bagian baratlaut negara itu ‘serta berlaku segera.’ Torkham terletak di rute pasokan utama NATO ke Afghanistan, tempat pasukan AS dan NATO memerangi gerilyawan Taliban selama sembilan tahun, dan karena itu sangat penting bagi upaya perang di Afghanistan.

“Setelah menilai situasi keamanan dalam semua aspeknya, pemerintah memutuskan untuk membuka kembali pasokan NATO/ISAF dari perbatasan Pakistan-Afghanistan di Torkham serta berlaku segera,” kata kementerian tersebut dalam pernyatannya, merujuk pada Pasukan Bantuan Keamanan Internasional (ISAF) pimpinan NATO. Pakistan menutup rute di Torkham itu sebagai protes terhadap serangan lintas-batas helikopter NATO yang para pejabat

Di tengah perbedaan mengenai serangan helikopter NATO itu, lebih dari 100 truk tangki dan truk pasokan NATO hancur dalam serangan gerilyawan dalam hanya sepekan lebih ketika gerilyawan meningkatkan upaya mereka untuk menggangu pasokan tersebut. Taliban Pakistan menjanjikan serangan lagi untuk membalas gelombang baru serangan pesawat mata-mata AS yang ditujukan terhadap gerilyawan Taliban dan al Qaida di bagian baratlaut negara itu. (m07)

Reuters

FERI PENUMPANG LITHUANIA MASIH TERBAKAR DEKAT JERMAN

Asap mengepul dari feri penumpang dan mobil milik Lithuania, Lisco Gloria, dekat kepulauan Fehmarn, Jerman, Minggu (10/10). Lebih dari 200 penumpang dan awak berhasil dievakuasi setelah feri itu mulai terbakar di Laut Baltik, kata pihak berwenang Jerman Sabtu.

Karzai Kunjungi Pusat Taliban Untuk Tinjau Pertempuran ARGANDHAB, Afghanistan (Antara/AFP): Presiden Afghanistan Hamid Karzai dan Jendral senior AS David Petraeus telah terbang ke Kandahar, untuk meninjau serangan besar pimpinan Pakta Pertahanan Atlantik Utara (NATO) di markas kekuatan Taliban itu. Karzai terbang dengan helikopter NATO ke markas besar di distrik Argandhab dengan Dutabesar AS untuk Afghanistan Karl Eikenberry, Petraeus — komandan 152.000 tentara asing di Afghanistan — beberapa menteri kabinet dan gubernur provinsi Kandahar. Dia terhanyut dalam pembicaraan dengan para jendral Afghanistan dan AS yang memberi penjelasan singkat mengenai Operasi Serangan Naga yang diikuti oleh ribuan tentara NATO dan Afghanistan dalam upaya untuk menghalauTaliban keluar dari kota Kandahar dan daerah sekitarnya.

Reuters

Warga Korea Utara yang ikut dalam satu parade untuk merayakan ulang tahun ke-65 pembentukan Partai Pekerja Korea di Pyongyang Minggu (10/10). tentara, rudal, tank dan senjata lainnya — untuk memperingati ulang tahun partai yang berkuasa akhir pekan ini, kata sebuah laporan, Jumat. Kantor berita Korsel itu mengutip sumber-sumber mengatakan perayaan Minggu juga melibatkan sekitar 100.000 warga sipil dalam satu pawai. Kembang api khusus telah diimpor dari China untuk dinyalakan Minggu petang di sepanjang tepi sungai Taedong, yang membelah dua ibukota Pyongyang. Perayaan itu terjadi kurang dari dua pekan setelah putra bungsu pemimpim Kim Jongil diangkat menjadi jenderal bintang empat dan memberikan dua jabatan penting partai ko-

Taiwan Tetap Beli Senjata Meski Hubungan Dengan China Baik TAIPEH, Taiwan (Antara/AFP): Taiwan akan tetap membeli senjata di luar negeri karena pihaknya tidak dapat tergantung hanya pada perbaikan hubungan dengan China untuk menjamin keamanannnya, kata Presiden Ma Ying-jeou, Minggu (10/10). “Tentu, untuk keamanan Taiwan kita tidak dapat menempatkan harapan kita pada hanya memperbaiki hubungan dengan China,” kata Ma dalam pidato Hari Nasional di kota TaipeH. “Karena itu adalah kebutuhan kita dan kebijakan kita yang tidak tidak dapat diubah untuk membangun satu kemampuan pertahanan yang independen dan tetap membeli dari luar negeri senjata-senjata pertahanan yang tidak dapat kita produksi sendiri.” Ma dipilih dengan janji memperbaiki ekonomi Taiwan, terutama dengan meningkatkan pertukaran dengan China. Selama dia berkuasa, hubungan antara Taiwan dan China menghangat dengan cepat dan kini berada dalam persahabatan paling erat sejak tahun 1949, ketika kedua pihak terpecah pada akhir perang saudara. “Kita akan tetap memperluas pertukaran ekonomi, kebudayaan dan sosial untuk meningkatkan saling percaya,” kata Ma. Amerika Serikat Januari lalu menyetujui paket senjata senilai AS$6,4 miliar termasuk helikopter, alat pertahanan anti rudal dan kapal penyapu ranjau untuk Taiwan, yang juga masih mendesak untuk membeli jet tempur F-16. China, yang berikrar akan menyatukan kembali Taiwan yang memiliki pemerintah sendiri itu, jika perlu dengan kekuatan militer, mengecam keras penjualan senjata itu dan kini mulai kembali menghentikan pertukaran militer dengan AS. Bulanlalu,PMChinaWenJiabaoyangdikutipmediayangberpusat di Taipei menyatakan bahwa rudal-rudal China daratan yang diarahksn ke Taiwan pada satu saat akan dipindahkan. Ma kembali menyambut baik hal ini dalam pidatonya Ahad itu. “Pihak berwenang China daratan belum lama ini membuat sebuah pernyataan tentang penarikan rudal-rudal itu. Kami kira ini adalah satu tindakan positif bagi hubungan antara Taiwan dan China dan kita mengharapkan hal itu akan direalisasikan segera,” kata Ma. Para pakar Taiwan memperkirakan militer China menggelarkan lebih dari 1.600 rudal yang diarahkan ke pulau itu.

Pemimpin Oposisi Israel Dukung Pembekuan Parsial Pemukiman

Penguasaan Kandahar tampaknya sangat penting bagi strategi anti-gerilya yang diharapkan akan membalikkan perlawananTaliban yang sudah berlangsung sembilan tahun ke keadaan yang akan memungkinkan pasukan Amerika untuk memulai penarikan dari Afghanistan tahun depan. Presiden kemudian bercakap-cakap dengan para pemimpin suku setempat dan mendengarkan pendapat mereka mengenai operasi militer itu. Lapisan keamanan diterapkan pada kunjunganitudenganratusantentara, polisi dan pengawal presiden dikerakan, dan helikopter-helikopter NATO terbang di atas. Kandahar adalah ibukota yang ditetapkan bagi negara itu pada saat pemerintahan Taliban dari 1996 hingga 2001 dan telah menjadi pusat perlawanan mereka yang semakin keras terhadap pemerintah Karzai yang didukung Barat.

Dua Kim Saksikan Parade Militer

SEOUL, Korea Selatan (Antara/AFP): Ahli waris Korea Utara, Kim Jong-u dan ayahnya, Kim Jong-il, Minggu (10/10) menyaksikan parade besar militer di pusat ibu kota Pyongyang, menurut laporan-laporan. Parade besar itu dilakukan untuk memperingati hari ulang tahun ke-65 partai komunis yang berkuasa. Media negara mengatakan, Kim tua hadir dalam parade militer itu, namun tidak menyebutkan kehadiran anaknya. Meski demikian, kantor berita Yonhap dari Korea Selatan (Korsel) mengatakan, Jong-un juga hadir dalam acara itu. Korea Utara (Korut) akan menyelenggarakan parade militer terbesar — melibatkan 20.000

salahkan karena kematian tiga tentara Pakistan. Aliansi itu mengatakan personilnya menembak sebagai pertahanan diri. Dutabesar AS untuk Pakistan Anne Patterson Rabu telah meminta maaf atas nama rakyat Amerika atas ‘kecelakaan yang sangat disesalkan itu.’ Patterson mengatakan dalam satu pernyataan Kamis, penyelidikan bersama atas insiden itu telah diadakan, bahwa helikopter AS telah keliru mengenai Pasukan Perbatasan Pakistan saat mengejar gerilyawan.

WASPADA Senin 11 Oktober 2010

munis. Tindakan-tindakan itu menegaskan statusya sebagai pengganti ayahnya, 68 tahun yang sakit, kata para pejabat Korsel. Menteri Pertahanan Korsel Kim Tae-young, Senin mengatakan Korut tampaknya menggunakan perayaan ulang tahun itu untuk melakukan “penyusunan satu rencana suksesi” bagi putra Jong-un. Menteri mengatakan sekitar 15.000 tentara dikerahkan dekat Pyongyang untuk parade memperingati ulang tahun ke 65 pembentukan partai itu. Negara yang memiliki senjata nuklir tetapi miskin itu berjuang untuk memberi pangan kepada rakyatnya, dengan se-

pertiga anak-anak kekurangan gizi menurut dana anak-anak PBB. Kantor berita resminya KCNA memberitakan, Jumat, ibukota itu berada dalam suasana festival, dengan pameranpameran seni, foto dan buku diselenggarakan untuk memperingati ulang tahun itu. Masa membanjiri musium-musium untuk mempelajari tentang ‘sejarah agung’ partai itu, atau mengunjungi patung raksasa pendiri negara itu Kim Il-sung untuk meletakkan karangan bunga, katanya. Jalan-jalan dihiasi dengan bendera-bendera dan plakatplakat bertuliskan ‘Partai Berkemauan Keras’ dan ‘Partai tak Terkalahkan.’ Pembangkang tewas Pembangkang tingkat tertinggi Korut yang pernah membelot ke Korsel ditemukan meninggal di rumahnya Minggu, setelah tampaknya mendapat serangan jantung, menurut laporan televisi kabel berita YTN, mengutip para pejabat intelijen. Hwang Jang-Yop, 87 tahun, ditemukan tewas di kamar mandinya dan tampaknya meninggal secara alami, kata saluran TV itu mengutip sumber-sumbernya. Namunjugamengatakan,bahwa para petugas intelijen kini sedang menyelidikikemungkinanbahwa dia dibunuh. Hwang, mantan guru pemimpin Korut sekarang, Kim Jong-il, membelot melalui China pda 1997 dan sejak itu dia tinggal di bawah penjagaan polisi di satu alamat yang tak pernah disebutkan. Dia telah menerima beberapa kali ancaman pembunuhan.

Karzai juga datang dari provinsi di selatan itu, tempat ia berhasil menyelamatkan diri dari pembunuhan yang diupayakan di ibukota provinsi itu pada September 2002. Ada tiga upaya pembunuhan lainnya yang gagal terhadanya di provinsi Paktia, Ghazni dan Kabul pada 2004, 2007 dan 2008. Dalam kunjungannya itu, Karzai kembali minta pada gerilyawan untuk meletakkan senjata mereka dan juga warga setempat untuk bergabung dengan pasukan keamanan pemerintah. “Sekali lagi, dan dari Argandhab, saya minta pada Taliban untuk menghentikan pertempuran, untuk menghentikan pembunuhan saudara-saudara dan sesepuh-sesepuh mereka,” kata Karzai pada kerumunan massa itu. Sementara para sesepuh minta proyek pembangunan irigasi dan listrik. Presiden Karzai pun minta pada dubes AS untuk

membantu memperluas jaringan listrik ke Arghandab dan memperbaiki sistim irigasi. 4 Tentara Italia tewas Empat tentara Italia tewas dan satu lainnya luka serius dalam serangan gerilyawan di Afghanistan barat Sabtu, korban-korban asing terakhir dalam perang yang sekarang dalam tahun ke-10-nya. Kekerasan sekarang pada tingkat terburuknya di Afghanistan sejak Taliban digulingkan oleh pasukan dukungan Amerika Serikat pada akhir 2001. Lebih dari 2.000 tentara asing telah tewas sejak dimulainya perang itu, separuh lebih dari mereka dalam dua tahun terakhir. “Serangan terhadap tentara Italia ini adalah contoh biaya manusia yang tinggi yang harus kami bayar bagi misi yang fundamental bagi keamanan nasional kami,” kata Menteri Luar Negeri Italia Franco Frattini dalam pernyataannya.

JERUSALEM (Antara/AFP): Pemimpin oposisi utama Israel Partai Kadima mengeluarkan dukungan bagi perpanjangan pembekuan pembangunan permukiman dalam wawancara. Tzipi Livni mengeluarkan pernyataan itu Sabtu (9/10) setelah beberapa pekan membisu. Masalah berakhirnya pembekuan permukiman kini mengancam perundingan perdamaian yang telah dimulai baru-baru ini dengan Palestina. “Selama saya pikir bahwa hal itu memungkinkan untuk menegosisasikan perjanjian perdamaian tanpa membayar harga pembekuan, saya tetap bungkam,” katanya kepada televisi Israel. “Tapi hari ini saya pikir tiba saatnya untuk mengecam PM Benjamin Netanyahu soal masalah ini,” katanya menambahkan. Pemerintah harus menerima usul AS untuk memperpanjang moratorium pembangunan permukiman, yang berakhir masa berlakunya pada 26 September, katanya menambahkan. Kabinet keamanan Israel telah bertemu Rabu (13/10), namun meskipun terdapat permintaan dari beberapa menteri, pembaruan kembali pembekuan pembangunan permukiman Yahudi itu tidak dibahas. Israel bungkam mengenai moratorium itu, sedangkan Palestina bersikeras mereka tidak akan melanjutkan perundingan jika para pemukim masih terus mendirikan bangunan di tanah mereka, yang mereka inginkan sebagai negara masa depan. Jumat, para menteri luar negeri Liga Arab memberikan waktu sebulan kepada Amerika Serikat untuk menyelamatkan perundingan perdamaian, agar Israel mengubah sikapnya mengenai pembangunan permukiman, satu keputusan yang disambut oleh beberapa pemerintah negara Eropa. Komite Tindak Lanjut Liga Arab mengatakan, pihaknya ‘mendukung sikap presiden Palestina yang menyerukan penghentian total permukiman demi pelanjutan perundingan langsung.’ Presiden AS Barack Obama berulang kali menyeru Israel agar memperpanjang moratorium 10 bulan tentang pembangunan permukiman di Tepi Barat, untuk menyelamatkan perundingan perdamaian yang diluncurkan di Washington pada 2 September. Tepi Barat adalah wilayah Palestina yang direbut Israel dalam perang 1967.

Pemilu Bersejarah Parlemen Kyrgyzstan Dibuka BISHKEK, Kyrgyzstan (Antara/AFP): Tempat-tempat pemungutansuaradiKyrgyzstanMinggu(10/10)dibukauntukpemilihan yang bertujuan membentuk parlemen demokratis pertama di Asia Tengah, meskipun ada ketakutan terhadap kebangkitan kekerasan di negara bekas Soviet yang dirundung masalah itu. Tempat pemungutan suara akan ditutup pada pukul 20:00 waktu setempat, dan hasil awal diperkirakan bisa diketahui Senin (11/10). Parlemen Kyrgyzstan mendapat kekuatan baru dalam referendum Juni lalu, menyusul revolusi berdarah dan kekerasan antar-etnis mematikan. Hal itu sangat bertolak-belakang dengan peraturan kepresidenan yang ketat di wilayah itu.

Vietnam Selenggarakan Parade Militer Terbesar HANOI, Vietnam (Antara/ AFP): Ribuan tentara berbaris bergerak melewati makam presiden pendiri Vietnam Ho Chi Minh, Minggu (10/10) dalam parade militer terbesar negara itu dalam beberapa tahun belakangan ini. Parade itu, bagian dari satu upacara perayaan 1.000 tahun Hanoi, adalah satu pagelaran kebanggaan nasional yang juga mengirim satu pesan halus kepada China tetangga Vietnam sementara kedua negara terlibat sengketa menyangkut wilayah di Laut China Selatan, kata seorang pengamat. Satu bagian masyarakat termasuk para pekerja, pemuda dan kelompok etnik dan agama ikut serta dalam parade yang menurut para pejabat diikuti sekitar 40.000 orang. “Banyak darah mengalir untuk menjadikan Hanoisepertiyangkitalihatsekarang,” kata Presiden Nguyen Ninh Triet pada acara tersebut. “Rakyat Vietnam mencitai perdamaian... tetapi kita tidak akan tunduk pada kekuatan yang kejam dan aksi kekerasan,” katanya. Parade itu dimulai saat langit mendung sementara 10 helikopter militer buatan Rusia terbang melitasi lokasi acara itu dengan membawa bendera nasional dan spanduk komunis. Para pemimpin Partai Komunis melambaikan tangan mereka dari tempat yang tinggi makam Ho Chi Minh ketika pasukan dan polisi dalam satu kesatuan berseragam hijau, biru, putih dan coklat bergerak melewati mereka. Pasukan itu termasuk para anggota pasukan kusus dengan menyandang senapan-senapan

Reuters

Personel milisi wanita berpawai dalam satu parade militer Minggu (10/10) di Lapangan Ba Dinh pada saat perayaan ulangtahun ke-1.000 pendirian pemukiman di Hanoi yang kemudian menjadi ibukota Vietnam. Pemerintah komunis Vietnam melakukan apa yang disebutnya sebagai satu parade paling besar Minggu di negara berpenduduk 86 juta jiwa itu. Sebanyak 30.000 warga ikut ambil bagian dalam parade tersebut. serbu, wanita milisi etnik minoritas dalam pakaian tradisonal dengan senapang dibahu mereka. Tidak ada senjata-senjata berat dan komponen militer hanya ikut serta sebagian dari program 90menit yang termasuk tarian singa dan pengambaran sejarah Vietnam. Tetapi parade itu mengirim satu pesan bahwa Vietnam bukanlah “satu tempat yang akan anda serang,” kata Carl Thayer, seorang pakar Vietnam di Universitas New SouthWales di Australia. Banyak perangkat keras militerVietnam telah kuno tetapi

negaraitusedangberusahamemperkuatpasukannyakarenasengketa kedaulatan dengan China. Desember, Vietnam dan Rusia menandatangan satu perjanjian senjata yang kabarnya melibatkan pembelian enam kapal selam. Perjanjian disepakati itu setelah pada Juli Rusia mengummkan bahwa negara itu akan menjual 20 pesawat tempur Sukhoi SU30MK2 kepada Vietnam. Hanoi pekan lalu menuntut pembebasan sebuah kapal dan awaknya yang ditahan China sebulan lalu ketika sedang me-

nangkap ikan di kepulauan Paracel. Kedua negara itu saling mengklaim kedaulatan atas Paracel dan Spratly , dua kepulauan yang kaya sumber alam di Laut China Selatan. Kendatipun sengketa itu, kehadiran militer China yang meningkat di Laut China Selatan menimbulkan kecemasan tidak hanya di Vietnam tetapi juga negara-negara tetangga serta AS. Vietnam memiliki satu tradisi militer yang membanggakan dimulai lebih dari 1000 tahun lalu dengan mengalahkan penjajah China.

Sport

WASPADA Senin 11 Oktober 2010

A5

Les Bleus Masuki Jalur Kroasia Bangga Bombardir Israel TEL AVIV (Waspada): Dua gol di babak pertama yang disarangkan Niko Kranjcar memberi Kroasia kemenangan 2-1 atas tuan rumah Israel, Minggu (10/10) dinihari WIB. Pelatih Kroasia Slavan Bilic bangga karena pasukannya mampu membombardir Israel pada pertandingan kualifikasi Euro 2012 Grup F di Tel Aviv tersebut. “Saya senang dan bangga dengan para pemain saya. Kami telah menyerang Israel di babak kedua sebanyak lima atau tujuh kali,” beber Bilic. “Kami hampir mencetak gol ketiga untuk mengunci laga.Tapi saat Israel mencetak gol, waktu menjadi penting dan berbahaya bagi kami menjelang akhir duel,” tambah Bilic. Kranjcar mencetak gol pembuka dari titik penalti menit 36 dan menambahkan gol keduanya empat menit menjelang waktu istirahat melalui tembakan rendah yang luar biasa. Etay Shechter membalaskan satu gol bagi tuan rumah sembilan menit menjelang bubaran. Duel pun menyisakan drama menegangkan pada menit-menit akhir. Namun Hrvatska tetap bisa mempertahankan gawangnya dari tekanan lawan. Hasil ini membuat Kroasia melambung ke peringkat per-

PARIS (Waspada): Dua pemain pengganti Prancis Loic Remy dan Yoann Gourcuff mencetak gol di menit akhir untuk memberi kemenangan 2-0 atas Rumania, Minggu (10/ 10) dinihari WIB. Tambahan tiga poin dalam duel di Stade de France itu memastikan Les Bleus masuki jalur lagi sekaligus memimpin di puncak klasemen Grup D kualifikasi Euro 2012. “Suatu laga biasanya berlangsung 90 atau bahkan 95 menit. Jadi tidak bisa berbuat apaapa hanya menganalisa pada 75 menit pertama,” ucap pelatih Prancis Laurent Blanc. Striker Marseille, Remy, melepaskan tembakan rendah dan masuk ke pojok kiri bawah gawang tim tamu menit 83. Pada injury time yang didominasi tuan rumah, Gourcuff melesakkan gol pamungkas memanfaatkan umpan debutan Dimitri Payet. “Tim tetap bekerja keras dan yakin akan menang. Saya mengucapkan selamat kepada para pemain saya, yang bermain dari awal maupun yang masuk sebagai pemain pengganti,” beber Blanc. Ini merupakan kemenangan pertama Pangeran Biru di Stade de France sejak Oktober 2009. “Suatu perasaan yang magis bisa mencetak gol,” ujar Remy. “Sekarang kami memimpin grup kendati mengalami awal buruk (karena dari Belarusia),

AP

Gelandang Rumania Razvan Cocis (2 kiri) diganjal kapten Prancis Alou Diara (bawah) dalam duel kualifikasi Euro 2012 Grup D di Stade de France, Saint Denis, Minggu (10/10) dinihari WIB. sehingga kami sudah kembali ke jalur. Saya berharap kami dapat melanjutkan kesuksesan ini,” katanya lagi. Rumania besutan Razvan Lucescu membangun pertahanan grendel yang membuat Les Bleus tidak banyak menciptakan peluang, terutama pada babak

pertama. Menit 47 umpan Bogdan Stancu dimanfaatkan gelandang Gheorghe Florescu, tapi bola gagal menembus gawang kiper Hugo Lloris. Setelah itu Les Blues bangkit menyerang serta mengendalikan permainan. (h01/ant/afp/rtr)

Prancis Vs Rumania 2-0 Prancis: Hugo Lloris, Gael Clichy, Anthony Reveillere, Adil Rami, Phillippe Mexes, Samir Nasri (Yoann Gourcuff 74), Florent Malouda, Yann M’Vila, Alou Diarra, Mathieu Valbuena (Loic Remy 68), Karim Benzema (Dimitri Payet 86). Rumania: Pantilimon, Cristian Sapunaru, Ravzan Dinca Rat, Tamas, Cristian Chivu, Mirel Matel Radoi, Gheorge Mihai Florescu, Ravzan Cocis (Roman 87), Ianis Zicu (Ciprian Deac 45), Bogdan Stancu, Daniel Niculae (Maria 63).

Downing Pengganti Lennon Spanyol Tunggu

Reuters

LONDON (Antara/AFP): Stewart Downing (foto) dipanggil masuk tim nasional Inggris untuk laga kualifikasi Euro 2012 melawan Montenegro, setelah Aaron Lennon keluar karena cedera punggung. Pelatih Inggris Fabio Capello memilih winger Aston Villa Downing. Pasalnya, tes menunjukkan bahwa bintang Tottenham Lennon baru beberapa hari lagi bisa pulih dari cedera punggungnya. Lennon sudah tidak bermain bagi The Three Lions sejak Piala Dunia 2010. Dia kembali

ke Tottenham untuk menjalani perawatan selanjutnya. Sebelumnya, bek Everton Phil Jagielka juga keluar dari skuad Capello akibat cedera otot lutut. Meskipun tanpa Lennon dan Jagielka, Inggris yakin akan menang atas Montenegro, Selasa (12/10), setelah membuat start bagus dengan mengalahkan Bulgaria dan Swiss. Montenegro juga mendapat dorongan kuat berkat kemenangannya 1-0 atas Swiss, Jumat lalu, sehingga sempurna memimpin Grup G dengan poin 9 dari 3 pertandingan.

Prandelli Lindungi Cassano ROMA (Waspada): Pelatih Italia Cesare Prandelli menegaskan, Antonio Cassano tetap sebagai striker utama Gli Azzurri, kendati gagal menjebol gawang Irlandia Utara, Sabtu lalu. “Jika Cassano tampil konsisten selama 10 tahun terakhir, bisakah anda bayangkan di mana dia akan bermain saat ini,” ucap Prandelli, seperti dikutip dari FootballItalia, Minggu (10/10). Mantan alenatorre Fiorentina itu juga melindungi Cassano dari kritik pengamat dan pers. “Kritik terhadap Cassano sudah lebih dari cukup,” tegasnya. “Saya menantang para kritikus untuk mencarikan pemain lain yang bisa menciptakan lima peluang melalui assist murni seperti dilakukan Cassano,” katanya lagi. Striker Sampodiria, Cassano, paling banyak mendapat kritik karena dianggap kurang berkontribusi di Belfast, sehingga Azzurri ditahan 0-0 oleh tim tuan rumah. “Cassano selalu bermain di posisi yang tepat dan membuat lini belakang Irlandia Utara kesulitan. Saya sangat puas dengan

AP

Ramos, Alonso

MADRID (Waspada): Entrenador SpanyolVicente Del Bosque harap-harap cemas menanti perkembangan kondisi duo andalannya asal klub Real Madrid, Sergio Ramos dan Xabi Alonso. Alonso tidak tampil bagian dalam kemenangan 3-1 La Furia Roja atas Lithuania, Sabtu lalu, karena sakit. Ramos harus ditarik keluar lapangan pada penghujung laga akibat mengalami cedera minor. Del Bosque pun menunggu perkembangan mereka, sebelum memutuskan susunan skuadnya AP untuk menghadapi tuan ru- Sergio Ramos (kanan) dan mah Skotlandia, Selasa (12/ Xabi Alonso belum pulih dari 10) malam. “Saya mengha- cedera. rapkan kehadiran mereka di Glasgow,” tegasnya. “Kami akan menunggu. Tapi sementara ini, saya tidak berencana memanggil pemain tambahan untuk duel tersebut,” tambah Del Bosque dalam AS, Minggu (10/10). El Matador kini memimpin klasemen Grup I kualifikasi Euro 2012 dengan raihan enam angka dari dua pertandingan. Skotlandia posisi dua dengan koleksi empat poin dari tiga laga. (h01/as/vvn)

Striker Italia Antonio Cassano (kiri) menuai kritik setelah gagal membobol gawng Irlandia Utara di Belfast. performanya,” puji Prandelli lagi. Hasil seri itu sebernarnya sudah cukup membuat Negeri Pizza bertahan di puncak klasemen Grup C dengan nilai tujuh. “Kami menuai poin dan kami melanjutkan pekerjaan untuk hasil yang lebih baik,” timpal winger Italia Mattia Cassani. Pemain Palermo itu yakin, Prandelli akan membangun tim dengan lebih tangguh lagi. “Kami bermain baik dan bertahan dengan sikap positif. Ini situasi sulit, namun bermain seperti ini membantu kami untuk semakin

Problem Catur

tama klasemen Grup F dengan kemasan tujuh poin dari tiga laga. Sedangkan Israel terpaku di peringkat empat dengan empat angka.

Negeri Zionis itu punya peluang memperbaiki posisinya jika bisa mengatasi Yunani pada pertandingan Selasa (12/ 10) malam. (h01/uefa/ant/rtr)

Klasemen Sementara Kualifikasi Euro 2012 Grup A Jerman Austria Turki Belgia Azerbaijan Kazakhstan

3 3 0 0 10-1 9 2 2 0 0 5- 0 6 3 2 0 1 6- 5 6 3 1 0 2 4- 4 3 2 0 0 2 1- 9 0 3 0 0 3 0- 7 0

Grup D Prancis 3 2 0 1 4-1 Albania 3 1 2 0 3-2 Belarus 3 1 2 0 1-0 Bosnia 3 1 1 1 4-3 Romania 3 0 2 1 1-3 Luksemburg 3 0 1 2 0-4

6 5 5 4 2 1

Grup B Irlandia Rusia Slowakia Armenia Macedonia Andorra

3 3 3 3 3 3

Grup E Belanda Hongaria Swedia Moldova Finlandia San Marino

3 3 2 3 2 3

3 0 0 8- 1 2 0 1 10-3 2 0 0 8- 0 1 0 2 3- 3 0 0 2 1- 4 0 0 3 0-19

9 6 6 3 0 0

Grup F Kroasia Georgia Yunani Israel Latvia Malta

3 3 3 3 3 2

2 1 1 1 1 0

7 5 5 4 3 0

Grup C Italia Estonia Slovenia Serbia Irlandia Utara Kep Faroe

2 2 2 1 1 0

0 0 0 1 1 0

1 1 1 1 1 3

6-4 5-3 3-3 5-4 4-3 1-7

6 6 6 4 4 0

3 2 1 0 7- 1 7 3 2 0 1 6- 4 6 3 1 1 1 6- 3 4 3 1 1 1 5- 4 4 2 1 1 0 1- 0 4 3 0 0 4 1-10 0

1 2 2 1 0 0

0 0 0 1 2 2

5-1 2-1 2-1 4-3 2-4 1-5

Grup G Montenegro Inggris Bulgaria Wales Swiss

3 2 3 2 2

3 2 1 0 0

0 0 0 0 0

0 0 2 2 2

3-0 6-1 1-5 0-2 1-3

9 6 3 0 0

Grup H Norwegia Portugal Denmark Siprus Eslandia

3 3 2 2 2

3 1 1 0 0

0 1 0 1 0

0 1 1 1 2

5-2 7-6 2-3 5-6 1-3

9 4 3 1 0

Grup I Spanyol Skotlandia Lithuania Rep Ceko Liechtenstein

2 3 3 2 2

2 1 1 1 0

0 1 1 0 0

0 1 1 1 2

7-1 2-2 2-3 1-1 1-6

6 4 4 3 0

Ozil Bisa Ikut BERLIN (Waspada): Cedera lutut minor memaksa Mesut Ozil (foto) absen dari sesi latihan tim Jerman akhir pekan ini, akibat mengalami memar pada lututnya. Namun gelandang Real Madrid itu diyakini mampu pulih tepat waktu dan bisa ikut terbang untuk menghadapi Kazakhstan pada laga lanjutan kualifikasi Euro 2012, Selasa (12/ 10) malam. “Ozil tidak menjalani latihan Minggu, meskipun tim dokter berharap memar itu bisa berkurang dalam waktu 24 jam,” jelas pihak Federasi Sepakbola Jerman (DFB). “(Tapi), dia tampaknya bisa ikut terbang ke Kazakhstan, Senin malam,” tambah pernyataan itu, seperti dilansir Soccerway, Minggu (10/10).

Ozil menyumbangkan satu gol dalam kemenangan 3-0 Jerman atas Turki, Sabtu lalu, sehingga Der Panzer kian kokoh memimpin klasemen Grup A dengan torehan 9 poin dari tiga laga awal. Namun mantan punggawa Werder Bremen itu terlihat jalan terpincang-pincang saat laga memasuki babak kedua. Hasil pemeriksaan menyimpulkan, Ozil menderita cedera engkel dan memar di lutut. “Pelatih Joachim Low sudah mengatur agar dokter dan pelatih fisik memberinya (Ozil) tes kebugaran pada latihan terakhir Senin nanti,” tegas DFB. “Masih terasa sakit, tapi saya percaya pada perawatan yang diberikan dokter dan ahli fisik di timnas. Mudah-mudahan saya lekas sembuh,” harap Ozil,

AP

pemain keturunan Turki yang bangga membela armada Panser. (h01/soc/sky)

meningkat,” optimismenya. Pasukan Pizza selanjutnya menjamu Serbia, Selasa (12/10) malam. Dalam duel ini, Italia rawan kehilangan bek andalannya Leonardo Bonucci yang membawa cedera dari Belfast. Tim medis La Nazionale telah membawa pemain 23 tahun ke klinik untuk memastikan problem yang menimpa kaki kirinya. “Ada sedikit benturan, tapi itu tidak terlalu serius,” jelas staf medis Italia Professor Enrico Castellacci.(h01/okz/fi/tf)

TTS TOPIK

Sudoku

UMUM

Hitam melangkah, mematikan lawannya enam langkah.

Jawaban di halaman A2.

AP

Bintang kemenangan Kroasia Niko Kranjcar (kanan) merayakan golnya dengan Eduardo da Silva di Ramat Gan Stadium, dekat Tel Aviv, Minggu (10/10) dinihari WIB.

Mendatar

1. Hari yang selalu dipilih untuk melangsungkan pesta perkawinan. 4. Perjamuan resmi yang diadakan untuk menerima tamu dalam pesta perkawinan, berasal dari kata Inggris reception. 6. Tempat pilihan untuk akad nikah selain di rumah. 7. Damping (pengantin). 8. Atur, susun, antara lain untuk acara dan ruang. 10. Jemputan berupa kartu yang dikirim kepada orang-orang terdaftar namanya agar bersedia hadir. 14. Orangtua istri atau suami. 15. Permohonan kepada Tuhan seusai ijab kabul. 17. Alat musik memeriahkan pesta kawin. 19. Jasa boga, menyediakan makanan untuk pesta kawin. 20. Puas dan lega setelah acara berakhir sukses. 21. Daun kelapa muda berwarna kuning yang dihias untuk

diletakkan sebagai tanda ada pesta kawin.

Menurun

1. Istri atau suami dari anak. 2. Suvenir, dibagikan kepada para undangan pesta kawin. 3. Penyanyi (Inggris). 4. Bunga wangi berwarna merah. 5. Salah satu warna buku nikah. 9. Ijab kabul, sebelum acara resepsi perkawinan. 11. Cairan jernih untuk minum. 12. Salah satu sajian makanan dalam pesta kawin. 13. Sekolompok orang yang ditugaskan untuk mengurus halhal yang ditugaskan kepadanya. 14. Termasuk tujuan orang untuk menghadiri pesta kawin. 16. Pilih/tulis tanpa spasi: Ha Run, Ar Rum atau Ko Rum adalah ayat/surat Al Quran yang ditulis dalam kartu undangan perkawinan. 18. Hubungan keluarga antara dua orangtua karena anak mereka kawin.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan hari ini: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai empat menit. Jawabannya lihat di halaman A2 kolom 1.

9

4 6 1

3

5 4 2 4 1 7 1 2 3 6 2 6 7 4 7

7 6 8 6 9 2 5 3 7 9 4 8 5 6 8

9 7

1 1 1

3 4 7 2 3 1 4 ve206

Sport

A6

WASPADA Senin 11 Oktober 2010

Titel Perdana Lorenzo SEPANG, Malaysia (Waspada): Jorge Lorenzo akhirnya memastikan gelar juara dunia MotoGP 2010 setelah finish ketiga di Sirkuit Sepang, Malaysia, Minggu (10/10). Valentino Rossi tampil fantastis untuk memenangi lomba, setelah bertarung ketat dengan Andrea Dovizioso dan Lorenzo. Bagi Lorenzo, finish ketiga ini sudah jauh dari cukup untuk meraih titel pertamanya di ajang MotoGP. Dengan tambahan 16 poin, rider Spanyol itu mengumpulkan total 313 poin dan tak terkejar lagi oleh rival terdekat yang juga kompatriotnya, Dani Pedrosa. Pedrosa sendiri kemungkinan baru bisa tampil di Phillip Island, Australia, pekan depan. Rider Repsol Honda itu mengalami kecelakaan saat latihan di Sirkuit Motegi, Jepang, pekan lalu, sehingga absen di dua seri, termasuk Sepang.

Sebenarnya, pekerjaan Lorenzo mengamankan gelar juara dunia tergolong mudah. Pembalap Fiat Yamaha ini start dari posisi pole dan cukup finish minimal di urutan sembilan. Tetapi, mantan dua kali juara dunia kelas 250cc ini tampil ngotot dan akhirnya melewati garis finish di urutan ketiga. Kendati Lorenzo menobatkan diri sebagai jawara baru, secara keseluruhan balapan di Sepang menjadi panggung aksi dari Rossi. Pasalnya, The Doctor menunjukkan kepiawaiannya menunggang motornya, karena setelah tercecer ke urutan 11 (start dari urutan 6), juara dunia tujuh kali kelas premier ini melibas semua lawannya, termasuk

Hasil MotoGP Malaysia Valentino Rossi Andrea Dovizioso Jorge Lorenzo Ben Spies Alvaro Bautista Nicky Hayden Hiroshi Aoyama Marco Simoncelli Marco Melandri Randy de Puniet Hector Barbera Mika Kallio

(Italia/Fiat Yamaha) (Italia/Repsol Honda) (Spanyol/Fiat Yamaha) (AS/Tech 3 Yamaha) (Spanyol/Rizla Suzuki) (AS/Ducati) (Jepang/Interwetten Honda) (Italia/Gresini Honda) (Italia/Gresini Honda) (Prancis/LCR Honda) (Spanyol/Aspar Ducati) (Finlandia/Pramac Ducati)

duel seru melawan Dovizioso di lap ke-15. Hasil positif juga ditunjukkan Ben Spies. Pembalap Tech 3 Yamaha, musim depan menggantikan Rossi di timYamaha untuk jadi tandem Lorenzo, mampu finish di urutan keempat setelah memenangi duel sesama rookie MotoGP 2010 melawan Alvaro Bautista (Rizla Suzuki) dan Mar-

41m03.448s + 0.224s + 6.035s + 13.676s + 15.402s + 18.826s + 20.218s + 23.574s + 23.964s + 31.850s + 38.579s + 38.849s

co Simoncelli (Gresini Honda). Bila Lorenzo dan Rossi dapat tersenyum lebar, lain halnya dengan Casey Stoner. Pembalap Australia ini harus lebih dulu meninggalkan balapan ketika sedang bertarung di barisan depan. Sebelum menikung, Stoner malah terjatuh dan jawara dunia 2007 asal Ducati itu hanya bertahan satu lap. (m33/ap)

Hari Terindah Untuk Vettel Reuters

SUZUKA, Jepang (Waspada): SebastianVettel (foto) membuka peluang bersaing merebut gelar juara dunia musim ini, setelah memenangi GP Jepang di Sirkuit Suzuka, Minggu (10/ 10). Kemenangan ketiganya musim ini mengantarVettel menempati posisi tiga klasemen sementara dan membuntuti Fernando Alonso (Ferrari) dan rekan setimnya Mark Webber yang masih kokoh di puncak. Balapan di Suzuka memang menjadi ajang pembuktian Red Bull Racing sebagai calon kuat

juara dunia musim ini. Setelah berhasil mengamankan posisi satu dua di sesi kualifikasi, duet Vettel dan Webber memanfaatkan momentum dengan finish di dua posisi terdepan. Kemenangan ini praktis membuat Red Bull sementara berjaya di klasemen. Di klasemen, Webber yang hanya finish kedua masih tetap bercokol di puncak dengan raihan 220 poin. Juara di Suzuka, Vettel berhasil menggeser Lewis Hamilton (McLaren) di posisi tiga dengan koleksi 206 angka atau sama dengan Alonso di tempat kedua. Di klasemen konstruktor, Red Bull juga kian meninggalkan Ferrari dan McLaren. Skuad yang bermarkas di Milton Keynes itu nyaman di puncak dengan raihan 426 poin atau unggul jauh dari dua rivalnya itu. Tanda-tanda kejayaan Red

Bull di Suzuka memang sudah terlihat sejak sesi kualifikasi. Saat start, formasi Vettel-Webber memang sempat dikacaukan dengan keberhasilan Robert Kubica menyodok ke posisi kedua. Namun, pemandangan tersebut tak berlangsung lama. Di dua lap pertama, Kubica harus mengakhiri balapan lebih cepat lantaran mobilnya mengalami masalah teknis. Jalannya balapan sendiri langsung rancu

sejak awal dengan banyaknya kecelakaan menimpa sejumlah pembalap. Salah satunya adalah rekan setim Alonso di Ferrari, Felipe Massa, yang harus out di lap awal. Hal serupa juga dialami pembalap Renault Vitaly Petrov dan Vitantonio Liuzzi (Force India) yang harus mengakhiri lomba lantaran terlibat tabrakan. (m33/ap)

10 Besar Hasil GP Jepang Sebastian Vettel Mark Webber Fernando Alonso Jenson Button Lewis Hamilton Michael Schumacher Kamui Kobayashi Nick Heidfeld Rubens Barrichello Sebastien Buemi

(Jerman/Red Bull) (Australia/Red Bull) (Spanyol/Ferrari) (Inggris/McLaren) (Inggris/McLaren) (Jerman/Mercedes GP) (Jepang/BMW Sauber) (Jerman/BMW Sauber) (Brazil/Williams) (Swiss/Toro Rosso)

1:30:27.323 + 0.905 + 2.721 + 13.522 + 39.595 + 59.933 + 1:04.038 + 1:09.648 + 1:10.846 + 1:12.806

Waspada/Hamdani

Tim Muspida Plus dipimpin Kajatisu Sution Usman Adji (11) dan Ketua KONI Sumut Gus Irawan (atas) pose bersama tim wartawan yang diperkuat anggota DPD/MPR-RI Parlindungan Purba (9) dan Ketua PWI Sumut Drs M Syahrir di QS Futsal, Jalan Bunga Asoka Medan, Minggu (10/10).

Wagub Harapkan QS Futsal Picu Perkembangan Olahraga Sumut MEDAN ( Waspada): QS Futsal diharapkan akan memicu perkembangan olahraga Sumatera Utara (Sumut), khususnya futsal. Dengan begitu olahraga Sumut dapat bangkit kembali. Demikian dikatakan Gubernur Sumatera Utara diwakili Wagubs H Gatot Pudjonugroho ST pada acara Grand Opening Qalbu Salim (QS) Futsal and Food di Jalan Bunga Asoka Medan Sunggal, Minggu (10/10). Menurut Wagubsu, pihaknya sangat salut dengan QS Futsal, karena dikelola seorang remaja yang masih duduk di bangku kelas III SMP, Putra Ahmad Syarief Irawan Pasaribu. “Kita berharap agar anak muda sekarang lebih aktif di bidang olahraga dan sosial, sehingga Sumut bisa bangkit dalam semua aspek kehidupan,” ujar Gubsu. QS Futsal merupakan lapangan futsal pertama di Sumut yang menerapkan keseimbangan, di mana olahraga, hiburan dan makanan dirangkai dalam satu wadah. “Setelah berolahraga, kita dapat berkaraoke bersama keluarga sambil menikmati makanan,” ungkap Wagubsu. Menurut Ketua Umum KONI Sumut H Gus Irawan Pasaribu SE Ak MM, berdasarkan

Waspada/Setia Budi Siregar

Wagubsu H Gatot Pudjonugroho menandatangani prasasti pada peresmian QS Futsal & Food yang berlokasi di Jalan Bunga Asoka Medan, Minggu (10/10). Turut mendampingi Gus Irawan, Putra Irawan, Sution Usmad, Prof Syawal Gultom, dan Parlindungan Purba (kiri ke kanan). penelitian bahwa berolahraga dapat menghemat biaya kesehatan sebesar AS$ 3,5. “Dengan berolahraga, biaya kesehatan semakin efesien dan membuat badan sehat, sehingga kita semakin produktif bekerja,” papar Gus. Pada kesempatan ini, KONI Sumut juga mengucapkan terima kasih kepada QS Futsal, karena sangat memberikan konstribusi terhadap perkembangan olahraga Sumut, khu-

susnya cabang futsal. “Kita berharap dengan dibukanya QS Futsal and Food dapat semakin menggairahkan perkembangan olahraga Sumatera Utara,” tambah Gus. PWI gagal membalas Acara Grand Opening QS Futsal and Food dihadiri oleh Kajatisu Sution Usman Adji SH, Anggota DPD/MPR-RI Parlindungan Purba, Rektor Unimed Prof DR Syawal Gultom MPd,

Bupati Tapsel H Syahrul M Pasaribu, dan Ketua DPRD Tapsel H Rahmad Nasution SSos. Juga Sekum KONI Sumut Drs H Chairul Azmi MPd, Ketua Harian KONI Sumut John Ismadi Lubis, Ketua Badan Futsal Daerah (BFD) Sumut Ir Rafriandi Nasution, pengurus PWI Sumut, jajaran Direksi Bank Sumut, mewakili Danlantamal I Belawan, mewakili Pangkosek Danlanud Polonia dan undangan lainnya. Grand Opening QS futsal and Food ini ditandai dengan jamuan anak yatim serta pertandingan eksibisi antara Muspida Plus melawan PWI Sumut. PWI Sumut yang dikalahkan Muspida Plus 3-4, Juli lalu, gagal membalasnya dan kembali kalah dengan skor 10-14. Gol-gol Muspida Plus antara lain dicetak Sution Usman, Gus Irawan, HM Yahya, dan Rafriandi Nasution. Sedangkan gol PWI disumbangkan M Syahrir, Parlindungan Purba, Jonny Ramadhan Silalahi dan Khairul Muslim. Pada eksibisi lainnya, Bank Sumut juga gagal melakukan revans atasV-Sport AMFC. Bank Sumut yang kalah 3-6 pada final Kejurnas Kit Futsalismo 2010 Seri III Medan, 26 September lalu, kembali takluk dengan skor 2-3. (m20)

Putra Irawan Terinspirasi Bill Gates GM Futsal & Food Putra Ahmad Syarief Irawan Pasaribu (foto) mengakui cabang olahraga futsal sudah berkembang pesat belakangan ini. Bahkan lapangan futsal tumbuh subur bagaikan jamur di musim hujan. “Saya terinspirasi terjun di bisnis olahraga dengan mengembangkan lapangan futsal dengan membaca geografi Bill Gates,” kata Putra Irawan, Minggu (10/10) menanggapi hadirnya lapangan futsal QS di tengah menjamurnya lapangan futsal.

QS adalah kepanjangan dari Qolbu Salim yang berarti hati yang bersih. “Di samping dua lapangan, QS dilengkapi dengan fasilitas ruang ganti pemain dan makanan serta karaoke keluarga,” kata Putra Irawan yang merupakan putra kedua Gus Irawan. Putra lahir di Pematang Siantar 5 Mei 1996 yang hobi bermain futsal ini mengakui ke depan akan memiliki sebuah tim tangguh. Pemain tersebut, dis harapkan terlahir di QS Futsal.

Peresmian QS Futsal juga dicari momen yang tepat, dan dilaksanakan pada jam 10:10, tanggal 10, bulan 10 dan tahun 10 (2010). Deretan angka sepuluh ini pertamakalinya terjadi dalam jangka waktu 100 tahun. Para ahli numerologi menyebutkan bahwa deretan angka 10 ini disebut“10 sempurna” yang melambangkan waktu yang sangat hebat dan kelahiran kembali. Putra yang masih duduk di bangku kelas 3 SMP Shafiyyatul Amaliyyah Medan optimis

Waspada/Setia Budi Siregar

Sumut dapat memperoleh prestasi menggembirakan di cabang futsal. (m20)

AP

Jorge Lorenzo (tengah) merayakan keberhasilannya bersama kru Fiat Yamaha di Sirkuit Sepang, Malaysia, Minggu (10/10).

Catatan Tinta Emas Elias SEPANG, Malaysia (Waspada): Pembalap Spanyol, Toni Elias (foto), mencatat sejarah sebagai rider pertama yang menjuarai kelas Moto2. Gelar di kelas baru, sebelumnya dikenal sebagai kelas 250cc tersebut, diraih setelah finish keempat di Sirkuit Sepang, Malaysia, Minggu (10/10). Hasil di Sirkuit Sepang ini benar-benar menjadi hari bersejarah bagi Elias, mantan pembalap MotoGP. Bukan cuma diraih tepat pada tanggal istimewa 10-10-10, tetapi trofi tersebut merupakan yang pertama sepanjang karirnya di ajang balap motor. Sebenarnya, pertarungan memperebutkan gelar ini sudah selesai ketika Julian Simon jatuh

di awal lomba dan hanya mampu finish di urutan 21. Pasalnya, hanya Simon yang menjadi pesaing tunggal untuk menggagalkan usaha Elias. Secara keseluruhan, lomba di Sirkuit Sepang ini dimenangkan oleh Roby Rolfo yang mengalahkan pertarungan ketatnya dengan Alex de Angelis. Andrea Iannone sendiri finish ketiga disusul Elias. Kelas Moto2, menggunakan mesin 4 tak berkapasitas 600cc, baru dipertandingkan musim ini. Dengan keberhasilannya menjadi juara, Elias berharap musim depan bisa kembali ke MotoGP. Akan tetapi, sampai saat ini belum ada tim dari kelas premier yang tertarik untuk menggaetnya.

Reuters

Pembalap berusia 27 tahun ini tampil di MotoGP dari 20052009. Selama itu, prestasi yang digapai adalah meraih satu

kemenangan dan lima kali naik podium serta posisi terbaik di klasemen akhir adalah urutan tujuh pada 2009. (m33/ap)

Sport

WASPADA Senin 11 Oktober 2010

Boru Tobing Tinggalkan Sumut JAKARTA (Waspada): Kabar kurang menggembirakan datang dari cabang tenis Sumut, setelah atlet muda berbakat Grace Sari Ysidora Tobing memutuskan hengkang ke Riau dan memperkuat daerah tersebut pada pelaksanaan PON 2012 mendatang. Kepastian bakal hengkangnya petenis yang selama ini mengibarkan bendera Sumut di kancah tenis nasional serta dalam dua pekan terakhir membuat kejutan lolos semifinal Turnamen International ITF Women’s Circuit Sportama dan Alfamart, disampaikan langsung ibunda tercintanya, Ritawati Tarigan, kepada Waspada di Jakarta, Minggu (10/10). “Secara pribadi, keputusan pindah ke Riau ini cukup berat. Sebab, jujur saja saya masih ingin si Dede (sapaan akrab Grace-red) tetap membela panji Sumut di pentas PON mendatang. Terlebih melihat hubungan baik yang selama ini terjalin, terutama dengan Pak Gus (Ketua KONI Sumut, Gus Irawan Pasaribu SE Ak) yang sangat perhatian,” beber Rita. Hanya saja, lanjutnya, tuntutan pendanaan Grace yang cukup tinggi memaksa keputusan sulit tersebut diambil, meski dengan konsekuensi hengkang dari daerah leluhur yang cukup dicintai dan dibanggakan itu. Satu hal yang membuat dirinya mantap memilih hengkang, kata istri Sahala Lumban Tobing ini, karena minimnya perhatian Pengprov Pelti

A7

Gelar Kedua Sandy Alfamart International ITF Women’s Circuit

Waspada/Yuslan Kisra

Grace Sari Ysidora Tobing (kanan), foto bersama ibunda Ritawati Tarigan, menyatakan mantap pindah ke Riau. Sumut. “Bayangkan uang saku dan bulanan Grace saat PON lalu yang mestinya menjadi haknya, sepeser pun tidak ada yang kami terima hingga sekarang. Sudah begitu, mereka meminta ganti rugi, jika Dede mau hengkang ke daerah lain. Apa ini masuk akal? Kalau masih tetap seperti itu, sampai kapan pun, sulit bagi atlet tenis di Sumut untuk bisa maju,” sungutnya. Masih kata Boru Tarigan, pendanaan yang dibutuhkan Grace saat ini memang cukup besar. Sesuai jadwal, putrinya dalam waktu dekat akan menjalani serangkaian tur Asia mengikuti grand slam di kategori

junior, yakni Jepang dan Korea Terbuka. Setelah itu, menjalani kamp di Australia selama dua pekan sebelum tampil di Australia Open, Januari 2011. Dihubungi terpisah, Sekum KONI Sumut Drs Chairul Azmi Hutasuhut MPd mengaku kaget dengan keputusan hengkangnya Grace. Meski begitu, Chairul memastikan sama sekali tidak akan memaksakan kehendak sekiranya Grace memang telah memutuskan pindah. “Hanya saja, ada aturan yang wajib dipenuhi. Maklum saja, karena hingga saat ini yang bersangkutan masih terdaftar sebagai atlet Sumut,” ujar Chairul (yuslan)

JAKARTA (Waspada): Unggulan pertama tunggal putri asal Indonesia, Sandy Gumulya, menjuarai Turnamen Alfamart International ITF Women’s Circuit seri kedua berhadiah uang total 10 ribu dolar AS (Rp100 juta), setelah menang 6-2, 6-2 atas petenis China Yang Zi di Kompleks Stadion Tenis Gelora Bung Karno, Senayan, Jakarta, Minggu (10/10). Gelar juara yang direbut kali ini merupakan yang kedua beruntun dalam dua pekan, karena pekan lalu juga tampil sebagai petenis terbaik pada seri pertama di lapangan tenis Elite Club Epicentrum, Kuningan, Jakarta. Sebagai juara, Sandy berhak atas hadiah uang 1,568 dolar AS (Rp15 juta) danYang Zi kebagian 980 dolar AS (Rp10 juta). Final berlangsung di bawah cuaca yang sangat cerah, beda dengan babak penyisihan yang selalu ditandai hujan. Pada final kali ini, matahari bersinar sangat cerah sehingga membuat suhu udara di lapangan mencapai sekitar 40 derajat celsius. Meskipun begitu, cuaca panas menyengat tidak menyurut-

Waspada/Yuslan Kisra

Sandy Gumulya (kiri) diabadikan bersama Mennegpora Andi Alifian Mallarangeng usai menjuarai Turnamen Alfamart International ITF Women’s Circuit seri kedua di Jakarta, Minggu (10/10). kan animo seratusan penonton menyaksikan pertandingan termasuk di antaranya Mennegpora Andi Alifian Mallarangeng dan Ketua Umum Pengurus Pusat Persatuan Tenis Lapangan Indonesia (PP Pelti), Martina Wijaya. Selain menjuarai tunggal, Sandy juga menjuarai nomor ganda, Sabtu (9/10). Berpasangan dengan petenis Jepang

Moe Kawatoko, Sandy menang atas 7-6 (3), 7-5 atas Chan HaoChing/Sirue HE ( Taiwan/ China). “Saya senang dapat menjuarai tunggal dan ganda turnamen ini. Permainan saya sudah hampir mendekati yang terbaik seperti dua tahun lalu,” kata Sandy yang peringkat dunianya dipastikan bakal meningkat dari urutan 587 menjadi 400-an

dunia. Atas prestasi tersebut, Mennegpora Andi Mallarangeng menyatakan kemenangan Sandy membuktikan bahwa sebenarnya Indonesia memiliki potensi untuk berprestasi di sektor putri kancah tenis internasional. Mennegpora juga memberikan perhatian khusus pada petenis putri junior Indonesia yang mampu mencapai per-

empatfinal dan semifinal turnamen tersebut. Para pemain junior tersebut di antaranya Voni Darlina, Aldilla Sutjiadi dan Grace Sari Ysidora Tobing. “Saya yakin kalau para pemain junior ini dibina dengan baik, mereka dapat mengikuti jejak Yayuki Basuki yang mampu mencapai peringkat 20 dunia atau Angelique Wijaya (50 besar),” tutur Andi. (yuslan)

Musawir Bawa Persiraja Tembus Final Piala Gubernur Aceh I

Waspada/Muhammad Hanafiah

Anisa Faraliana (tengah) saat bertanding beberapa waktu lalu di Aceh.

Dua Pecatur Junior Aceh Terganjal

BIREUEN (Waspada): Persiraja Banda Aceh memantapkan langkahnya ke final Turnamen Piala Gubernur Aceh I setelah mengalahkan PSLS Lhokseumawe 2-1 di Stadion Cot Gapu, Bireuen, Minggu (10/10). Sebelumnya, skuad Laskar Rencong menang atas tuan rumah PSSB Bireuen 3-2. Dalam pertandingan melawan PSLS, Persiraja turun dengan skuad terbaiknya hingga kemenangan telah diprediksi sebelumnya. Walaupun sempat bermain imbang dan berada dalam tekanan, Abdul Musawir cs berhasil mencetak gol tercepat selama bergulirnya turnamen memperebutkan total hadiah Rp50 juta itu di menit kedua hasil aksi Fakhrijadillah. Gol itu spontan mengejut-

kan kubu PSLS yang dilatih Imran Juned, sehingga terlihat belum siap menerima hasil tersebut. Pasca gol itu, kedua tim pun mulai sama-sama menekan. Di menit ke-26, pemain bawah Persiraja menyentuh bola di dalam kotak terlarang sehingga wasit menunjukkan titik putih. PSLS akhirnya membobol gawang Laskar Rencong setelah Taufiq mampu menjalankan tugasnya sebagai eksekutor dengan baik. Secara perlahan, Persiraja mencoba keluar dari tekanan dipimpin Abdul Musawir. Sebaliknya, PSLS juga memperoleh peluang menambah gol, namun gagahnya Tong Mayega Ely menjaga pertahanan Persiraja menggagalkan usaha PSLS. Tepat menit ke-88, Musawir

mampu memperdayai kiper PSLS Ismail Toldo. Gol itu langsung disambut kubu Persiraja yang memastikan langkah ke final. Usai pertandingan, Pelatih Persiraja Herry Kiswanto didampingiWakil Manajer Mahdi Olo mengatakan, keberhasilan anak didiknya dikarenakan menjelang akhir permainan mampu keluar dari tekanan. Pelatih PSLS Imran Juned mengatakan kekalahan timnya karena kurang siapnya Muhammad cs menerima kekalahan dan gol cepat di awal pertandingan. Imran juga menjelaskan mayoritas pemain yang diturunkan sebelumnya belum pernah tampil. Pada Senin (11/10) ini, tuan rumah PSSB akan menjamu PSLS Lhokseumawe. (amh)

Kejurnas Catur Di Manado KUALASIMPANG ( Waspada): Dua pecatur junior Aceh dari sekolah catur LP3KI Banda Aceh, Anisah Faraliana (20) dan Famela Naridha (12), sudah berangkat menggunakan biaya sendiri ke Manado. Tapi ternyata mereka masih terganjal untuk tampil di Kejuaraan Nasional Catur Ke-41 yang berlangsung 8-16 Oktober 2010 di Manado, Sulawesi Utara (Sulut). Informasi yang diperoleh menyebutkan, Anisah harusnya bertanding di Kelompok Umur (KU) Junior Putri A (usia 20 tahun) dan Famela di KU Junior Putri D (kurang dari 14 tahun). Tetapi menurut informasi dari sekolah catur LP3KI Banda Aceh Cut Zulfayana yang menyampaikan keluhannya kepada Sekretaris Umum KONI Provinsi Aceh Muhammad Saleh dan Ketua Pengcab Percasi Kabupaten Aceh Tamiang, kedua atlitnya tidak bisa tampil karena tidak mendapat rekomendasi dari Pengprov Percasi Aceh. “Atlet kami berangkat dengan menggunakan biaya sendiri agar dapat tampil di Kejurnas Manado. Tetapi Percasi Aceh tidak mendukung, malahan atlet kami dilarang untuk tampil oleh Percasi Aceh,” sesal Cut Zulfayana, Minggu (10/10). “Apa lah salahnya, kedua atlit LP3KI yang sudah berada di Ma-

nado direkomendasi atau diizinkan tampil oleh Pengprov, bukan malah sebaliknya melarang tampil di kejurnas,” tambah mantan pecatur putri Aceh itu kepada Waspada melalui telepon selularnya. Menurut peraih medali perak Porda V tahun 1988 di Lhokseumawe dan jawara Kejurda Catur se Aceh Tahun 1991 itu, dirinya dari LP3KI sangat menyesalkan upaya pengganjalan tersebut. “Saya sangat kecewa mereka tidak bisa tampil,” tegas Cut, yang sudah berulangkali menggelar kejuaraan catur di Aceh, baik berskala daerah maupun nasional. Percasi Aceh Tamiang sendiri sudah melaporkan persoalan tersebut kepada KONI Provinsi Aceh untuk mencari solusi terbaik, agar kedua atlit catur junior tersebut bisa tampil di kejurnas. KONI Aceh juga diminta segera mengambil tindakan tegas terhadap Percasi Aceh yang sudah dilarang KONI Aceh untuk ikut kejurnas karena masa bhakti kepengurusannya sudah berakhir sejak Juli 2010. Sedangkan informasi yang diterima Pengcab Percasi Aceh Tamiang dari Panitia Kejurnas di Manado, KU Junior Putri A dan Junior Putri D menyediakan kuota 10 pecatur untuk setiap provinsi. Namun kuota tersebut

belum diisi Aceh, sehingga tidak ada alasan untuk mengganjal Anisah Faraliana dan Famela Naridha, yang notabene atlet putri Aceh. Sekum KONI Aceh Muhammad Saleh ketika dihubungi Waspada, membenarkan terjadinya kasus ini. “Kami sudah menerima informasi dan laporan dari berbagai pihak, termasuk Percasi Aceh Tamiang,” tuturnya. Muhammad Saleh juga menyatakan, kepengurusan Percasi Aceh memang sudah habis masa tugasnya hingga dilarang untuk tampil di kejurnas. “Kita sebelumnya telah mengatakan, kepengursan cabor yang sudah habis masa baktinya tidak boleh ikut kejurnas. Percasi Aceh sudah lama habis masa tugasnya, namun belum juga membuat Musda,” paparnya. KONI Aceh, menurutnya, telah menerbitkan rekomendasi untuk Anisah dan Famela, supaya bisa tampil di Kejurnas Manado. Rekomendasi terse-but segera pada Minggu (10/10), langsung dikirim melalui fax kepada Panitia Pelaksana Kejurnas dan PB Percasi di Jakarta. “Ini satu-satunya solusi atau upaya terbaik agar persoalannya bisa selesai. Kita juga berharap agar kedua atlit tersebut bisa tampil di kejurnas,” katanya lagi. (b24)

Persidi - Persas Tanpa Gol Divisi I PSSI Liga Indonesia IDI RAYEUK, Aceh Timur (Waspada): Persidi Idi Kabupaten Aceh Timur ditahan imbang Persas Sabang dalam laga derby antar tim Aceh di partai perdana Kompetisi Divisi I PSSI Liga Indonesia di Stadion UNRI Pekanbaru, Riau, Sabtu (9/10) lalu. Hasil imbang itu melegakan seluruh pengurus bonden kesayangan masyarakat Aceh Timur. Pasalnya, dalam event yang bergulir tahun ini menuju pentas Divisi I tersebut, persiapan tim Persidi Idi kurang maksimal. Sejak kickoff pertandingan dibunyikan wasit Jhon Tedy (Pa-

dang), anak-anak Idi Aceh Timur pantang menyerah dan kerap merepotkan barisan pertahanan Sabang. Beberapa peluang diperoleh pemain kedua tim, namun gagal membuahkan gol hingga turun minum. Babak kedua pun terjadi kondisi yang sama. Beberapa peluang dan tembakan keras lewat kaki penyerang kedua tim juga tidak membuahkan hasil. Kedudukan tetap 0-0 hingga akhir pertandingan. Kepada wartawan , Pelatih Persidi M Hasbi mengatakan Ibrahim Effendi cs setidaknya memiliki tiga peluang emas na-

mun berhasil digagalkan lawan. Peluang tersebut masing-masing didapat Ridwansyah, Nurdin dan Budi Murdhani. “Permainan dan umpanumpan sayap yang diperagakan anak-anak Persidi sangat merepotkan pertahanan tim Sabang. Namun dewi fortuna belum berpihak pada tim kita,” kata Hasbi. Selanjutnya, Persidi akan menghadapi Aceh Utara FC pada Selasa (12/10) besok, Jumat (15/10) nanti berhadapan dengan Madina Medan Jaya dan Senin (18/10) melawan PSAB Aceh Besar. (cmad)

Waspada/Abdul Mukthi Hasan

Pemain Persiraja Banda Aceh menguasai bola yang hendak direbut barisan belakang PSLS Lhokseumawe dalam lanjutan Turnamen Piala Gubernur Aceh I di Stadion Cot Gapu, Bireuen, Minggu (10/10).

Waspada/H Husni Siregar

HARI JALAN KAKI: Wakil Bupati Deliserdang H Zainuddin Mars (2 kanan) serta unsur Muspida di antaranya Ketua Pengadilan Agama H Hamid Pulungan, menyemarakkan jalan santai bersama yang diikuti lebih dari 5.000 peserta dalam rangka peringatan Hari Jalan Kaki Se Dunia (World Walking Day), Minggu (10/10).

JFC Pesta Gol Ke Gawang Inspektorat Liga Futsal HUT Pemko Langsa LANGSA (Waspada): Tim Futsal JFC (Jurnalis Fans Club) yang merupakan juara Liga Futsal Antar Media se Aceh 2010 menghajar Inspektorat Langsa 11-2 dalam lanjutan Liga Futsal HUT Pemko Langsa di Lapangan Grace Futsal, Kota Langsa, Minggu (10/10). Pada event yang dibuka langsung oleh Walikota Langsa Drs Zulkifli Zainon itu, JFC tampil dominan sejak awal pertandingan. Para punggawa asuhan Manajer Tim Samsul Qamal dan Ruslan Gono itu silih berganti memborbardir pertahanan Inspektorat. Gol pembuka JFC dilesakkan lewat sontekan manis Said melalui tendangan bebas. Gol cepat ini langsung membangkitkan semangat anak-anak JFC dan pesta gol pun tak terhindarkan setelah secara bergantian Dedek, Said, Eddyanto, Munawar dan Andika merobek jala gawang Inspektorat. Manajer Tim JFC Langsa, Samsul Qamal, mengatakan event itu sebagai ajang persiapan tim JFC atau ujicoba persiapan mempertahankan gelar pada Liga Futsal Antar Media mendatang yang digagas Warta FC Banda Aceh. “Kita tidak menargetkan apa-apa dalam event ini mengingat pemain JFC yang notabenenya jurnalis tersebut baru saja berlatih jelang event bergulir,” kata Samsul. Sebelumnya, tim Polres Langsa A mengalahkan Kejaksaan 6-2, Sekdakab Aceh Timur membantai Sekdakot Langsa 9-1, BKPP unggul atas Polres B 6-2, Langsa Kota kalah 3-5 dari Bank Muamalat dan Langsa Baro tumbang di tangan Bappeda Langsa 2-3. (cmad)

Sport

A8

WASPADA, Senin 11 Oktober 2010

Titel Ketujuh Nadal TOKYO (Waspada): Petenis nomor satu dunia, Rafael Nadal (foto), meraih gelar ketujuhnya sepanjang tahun setelah memenangi Turnamen Jepang Terbuka di tanggal istimewa, Minggu (10/10). Di final, petenis kidal Spanyol ini menang 6-1, 7-5 atas Gael Monfils (Prancis). Petenis kidal berusia 24 tahun ini, menyelamatkan dua match point saat melawan petenis Serbia Viktor Troicki di semifinal, mengawali perjuangannya dengan meyakinkan. Setelah melakukan break

AP

di awal set, Nadal terus melaju dan hanya kehilangan satu poin. Di set kedua, Monfils memberikan perlawanan gigih. Terbukti, kedua pemain tak pernah kehilangan poin saat memegang servis. Di game ke-11, Nadal bisa mengambil keuntungan ketika meraih winner untuk unggul 6-5. Di game ke-12 bersamaan serving for the championship, Nadal tak membuang kesempatan. Pe-raih sembilan gelar grand slam ini berhasil

.

menyelesaikan pertandingan sekaligus memperbesar rekor pertemuannya dengan Monfils menjadi 7-1. Dengan kesuksesan ini, maka Nadal yang melengkapi koleksi grand slam miliknya pasca memenangi AS Terbuka bulan lalu, meraih gelar ke-43 sepanjang karir. Pada 2010 ini pun, Nadal melengkapi keberhasilannya di ajang grand slam dengan menjuarai Prancis Terbuka dan Wimbledon. (m33/rtr)

Medan Metropolitan

WASPADA Senin 11 Oktober 2010

B1

Walikota Harus Cari Solusi Atasi Kemacatan Lalulintas MEDAN (Waspada): Walikota Medan diminta segera mencarikan solusi nyata guna mengatasi kemacatan lalulintas yang dinilai semakin parah dan mengkhawatirkan. Menurut anggota DPRD Sumut dari daerah pemilihan Kota Medan Brilian Moktar, SE, persoalan kemacatan lalulintas telah sampai pada taraf bisa membuat stres dan frustasi masyarakat pengguna jalan. “Walikota melalui Dinas Perhubungan kita harapkan segera mencarikan solusi, karena kemacatan lalulintas di daerah ini sudah sangat mengkhawatirkan,” ujar

politisi PDI Perjuangan itu kepada wartawan di Medan, Minggu (10/10). Ketua Komisi E (bidang Kesra) DPRD Sumut itu menyebutkan, sejumlah titik kemacatan lalulintas di Medan, seperti di Jalan Imam Bonjol, Jalan M Yamin, Jalan Nusantara, Jalan Pandu, Jalan Iskandar Muda, Jalan Juanda, Jalan Mongonsidi, Jalan Zainul Arifin dan Jalan Cik Ditiro.

Gubsu Berharap BPKP Tidak Nakut-nakuti Birokrasi MEDAN (Waspada): Gubsu H Syamsul Arifin, SE mengatakan, petugas Badan Pengawasan Keuangan dan Pembangunan (BPKP) diharapkan lebih mengutamakan pembinaan terhadap kalangan birokrasi dalam pengelolaan keuangan negara, bukan justru menaku-nakuti. “Utamakan pembinaan. Itu amanat UU,” kata Gubsu dalam serah terima jabatan Kepala BPKP Perwakilan Sumut dari Sudjono kepada penggantinya Mohammad Yusuf di Aula Martabe Kantor Gubsu, Jumat (8/10). Selama ini, kata Gubsu, petugas BPKP selalu terkesan menakutkan di mata kalangan birokrasi, apalagi jika dikaitkan dengan rencana adanya pemeriksaan pengelolaan keuangan negara. Fenomena itu dinilai kontraproduktif karena tidak memberikan manfaat bagi upaya perbaikan pengelolaan keuangan negara. Namun pihaknya bersyukur, fenomena itu mulai berkurang di Sumut karena petugas BPKP mulai mengutamakam pembinaan terhadap kalangan birokrasi. Perubahan itu mulai membawa pengaruh yang cukup positif dalam pemeriksaan laporan pengelolaan keuangan negara di jajaran Pemprov/Pemkab/Pemko di Sumut. “Dalam dua tahun terakhir, mayoritas laporan pengelolaan keuangan negara di Sumut mulai membaik. Mulai meningkat secara perlahan dari disclaimer menjadi wajar dengan pengecualian (WDP),” kata Gubsu. Deputi Pengawasan Instansi Pemerintah BPKP, Imam Bastari mengatakan, pihaknya sangat mengharapkan berbagai instansi pemerintahan di Sumut dapat melanjutkan kerja sama dan koordinasi kepada Kepala BPKP Sumut yang baru. Selaku lembaga negara, kata Imam, BPKP memiliki tugas dan tanggung jawab dalam pengawasan agar seluruh instansi pemerintahan dapat menjalankan kewajibannya guna mewujudkan pemerintahan secara bersih dan baik (good government). “Jadi, Pemda jangan segan-segan untuk meminta masukan dari petugas BPKP,” kata Imam.(m19)

Limbah PT WRP Terbakar BELAWAN (Waspada): Limbah PT WRP di Jalan Ilyas Kelurahan Sei Mati Kecamatan Medan Labuhan, terbakar, Jumat (8/10) siang sekitar pukul 14.00. Asap hitam yang muncul dalam kebakaran itu sangat pekat, sehingga warga dan pemerintahan setempat sempat panik. Api baru bisa dipadamkan setelah empat unit mobil pemadam kebakaran Pemko Medan datang. Belum ada keterangan yang pasti mengenai penyebab kebakaran. Ada yang menyebutkan api berasal dari puntung rokok yang dibuang ketumpukan limbah yang banyak mengandung kertas dan plastik. Ada juga yang mengatakan kebakaran terjadi akibat dari percikan api yang muncul dari limbah kimia cair jenis Accit yang bocor. “Accit bahan kimia yang mudah terbakar dan bila terkena panas bisa memunculkan api,” kata seorang anggota Satpam Marpaung PT WRP adalah perusahaan PMA yang masih bermasalah karena mem-PHK ratusan karyawannya secara sepihak sekitar satu tahun lalu. Bahkan, polisi telah menetapkan pemilik perusahaan yakni Mr Li, warga Malaysia, sebagai tersangka dalam kasus perburuhan itu. Komisi E DPRD Sumut telah meminta pemerintah untuk menutup aktifitas perusahaan itu, namun sepertinya tidak terlaksana karena masih terlihat belasan pekerja yang keluar dari dalam perusahaan saat kebakaran terjadi. “Kami masih kerja,” kata seorang pekerja tanpa mau menyebutkan namanya. Warga setempat, Amir, 39, mengatakan, pabrik penghasil sarung tangan plastik itu tidak memiliki kolam penetralisir limbah atau amdal. Sehingga limbah pabrik itu, selama ini di buang ke parit yang berada di samping pabrik. “Akibatnya parit selalu menghitam dan airnya akan terasa gatal jika terkena kulit manusia,” katanya. (cre)

MPM Bukan Sekadar Seremoni MEDAN (Waspada): Masa Pembekalan Mahasiswa (MPM) baru bukan sekadar seremonial tapi merupakan kegiatan wajib dan sebagai suatu proses kegiatan pengenalan kampus yang dilaksanakan Badan Eksekutif Mahasiwa (BEM) sebagai perpanja-ngan tangan pimpinan perguruan tinggi. MPM bukan arena perpeloncoan, tapi sebagai kegiatan upaya peningkatan intelektual, kreativitas dan solidaritas mahasiswa STIE Harapan agar mampu nantinya belajar mandiri. Demikian sambutan Ketua STIE Harapan Medan Prof. Dr. Azhar Maksum, M.Ec.Ak dalam acara pembukaan MPM kemarin di Kampus Yaspendhar, pekan lalu. Sementara itu Pengurus Yayasan Pendidikan Harapan (Yaspendhar) H. Saiful Nahar, Nasution, SE, MM mengatakan, jadikanlah MPM yang singkat ini sebagai masa perkenalan nilai-nilai kehidupan lingkungan kampus yang sangat berbeda dengan lingkungan sekolah. Kampus bukan lagi sekolahan yang lebih banyak mementingkan rutinitas tapi kampus lebih otonom. Pada acara itu turut diberikan Beasiswa Bebas Uang Kuliah kepada delapan mahasiswa pemuncak TA 2009/2010 terdiri dari: Indah Prianti (IPK:4.00), Elny (IPK:3,85) Johan (IPK:3,83), Herwin Gunawan (IPK:3,73), Fenny (IPK:3,97), David Liong (IPK:3,84), Oka Muhammad Adam (3,51)Witha Shalini (IPK:3,69). Kegiatan MPM tersebut diisi dengan pengarahan Pimpinan STIE Harapan, dosen dan Pengurus Yaspendhar, Drs. H. Awaluddin Sibarani, M.Si, Drs. H. Syarifuddin Alinafiah, M.Pd., H. Ramadhan, SE, Drs. H. Zulfikar. (m41)

Waspada/Ist

Pengurus Yaspendhar saat memberikan sertifikat beasiswa bebas uang kuliah kepada mahasiswa pemuncak TA 2009/2010.

Jalan-jalan utama tersebut, menurut dia, setiap hari selalu dipadati kendaraan, baik roda empat maupun roda dua dan menimbulkan kemacatan. “Apalagi pada jam-jam pulang kantor, kemacatan lalulintas benar-benar membuat masyarakat frustasi. Harapan kita, kondisi seperti ini jangan dibiarkan semakin berlarut-larut. Harus ada solusi nyata dan segera untuk mengatasinya,” katanya. Diungkapkannya, sejauh ini sudah cukup banyak usulan yang disampaikan kepada Pemerintah Kota (Pemko) Medan, namun hingga kini belum ditanggapi degan serius.

Salah satunya dengan melakukan percepatan pembangunan jembatan di Jalan Sudirman. Selain itu, Pemko Medan juga sudah disarankan untuk menertibkan angkutan kota. Selain suka menaikkan atau menurunkan penumpang seenaknya dan bukan di halte, banyak angkutan kota di Medan juga dinilainya sudah tidak layak lagi beroperasi. “Bayangkan saja, hingga kini masih ada angkutan kota keluaran tahun 1970-an yang tetap dibiarkan beroperasi, dan sebagian di antaranya bahkan juga tidak lagi mengantongi izin. Seharusnya ini ditertibkan,” tegasnya. Untuk mengurangi kema-

catan lalulintas di Kota Medan, Brilian Moktar juga menyarankan agar Pemko Medan melanjutkan kebijakan mantan Walikota Bachtiar Jafar dengan membangun jalan penghubung di sepanjang Sungai Deli. Pemkot Medan juga disarankan membangun jalan alternatif di kiri-kanan rel kereta api. “Jika ini dibuat, yakni dibangunnya jalan penghubung di Sungai Deli dari ujung ke ujung serta jalan alternatif di pinggiran rel kereta api, kita yakin kemacatan lalulintas di Kota Medan ini bisa dikurangi. Selain itu, Pemko Medan juga harus tegas terkait keberadaan angkutan kota,” katanya. (h11)

Pembebasan Lahan Jalan Arteri Kualanamu Rumit MEDAN (Waspada): Problem pembangunan Bandara Kualanamu satu per satu mulai terurai. Dari mulai persoalan pembangunan sektor publik dan privat Bandara, pembangunan runway yang tertunda serta problem pembebasan lahan untuk pembangunan jalan arteri Ke bandara. Beberapa persoalan itu sudah mulai menemukan solusinya, namun tidak untuk pembebasan lahan bagi pembangunan jalan arteri. Malah, proses pembebasan itu semakin rumit dan memerlukan koordinasi yang kuat antara berbagai pihak. Hal itu mengemuka dalam rapat koordinasi pembahasan pembebasan lahan untuk jalan arteri Kualanamu di Ruang Melati Lantai IX Kantor Gubernur, Rabu (6/10) sore, dipimpin Sekretaris Daerah Provinsi Sumatera Utara, Dr RE Nainggolan, MM. Rapat itu dihadiri berbagai pihak tekait seperti Asisten Pemerintahan Pemprovsu Hasiholan Silaen, Kepala Dinas Bina Marga Provsu Marapinta Harahap, Kepala Dinas Perhubungan Naruddin Dalimunthe, utusan Pemkab Deliserdang, Asisten Perdata dan Tata Usaha Negara (Asdatun) Kejatisu Tarmizi, Kepala Satuan Kerja NonVertikal Tertentu Balai Besar Wilayah Sumatera Utara Simon Ginting, utusan PTPN II, BPN Deliserdang serta lainnya. Kepala Satuan Kerja NonVertikal Tertentu Balai Besar Wilayah Sumatera Utara Simon Ginting mengatakan, proses pembebasan lahan yang akan dilakukan untuk merealisasikan pembangunan jalan arteri itu tinggal 3,5 kilometer lagi. Dia menyebutkan, sudah ada Rp40 miliar dari APBN untuk proses gantirugi bagi 35 kepala keluarga yang masih bertahan dan bermukim di lahan tersebut. Pihaknya berharap ada jaminan

kalau proses pembebasan lahan itu selesai pada Desember 2010. Simon menambahkan, tanpa ada jaminan pembebasan lahan itu, maka pembangunan jalan arteri tidak akan pernah bisa dilakukan. Sebab berdasarkan Surat Edaran (SE) Menteri Pekerjaan Umum Nomor 09/ 2009 tentang Proses Pelelangan Lahan untuk Pembangunan Jalan ditegaskan, tender atau pelelangan pembangunan jalan tidak akan bisa dilakukan tanpa ada jaminan kalau lahan yang dimaksud telah dibebaskan dan tidak bermasalah dari sisi hukum. “Karena itu, kami berharap Pemprovsu bisa menyurati Kementerian PU agar bisa mengecualikan persoalan lahan 3,5 kilometer ini,” ujarnya. Di samping persoalan lahan di atas, dalam rapat itu juga terkuak kerumitan proses pembebasan lahan eks HGU PTPN II seluas lebih dari 5.000 hektar, lahan tempat Brimob setempat seluas 1.308 meter persegi dan lahan lima persil PT Kereta Api Indonesia (KAI). Kepala Dinas Bina Marga Pemprovsu Marapinta Harahap menyebutkan, dari 15,4 kilometer atau sekitar 34 hektar eks HGU, ada 21 hektar yang sudah dibebaskan. “Selebihnya ada sekitar 13 hektar, di mana ada 7,7 hektar eks HGU yang berada di tiga desa dan rumit untuk diselesaikan persoalan pembayarannya,” ujar Marapinta. Pihaknya kebingungan kepada siapa dana gantirugi lahan itu diberikan, apakah kepada PTPN II atau kepada masyarakat yang tinggal di atas lahan itu. Ketiga desa itu adalah Desa Sena dan Desa Dukuh di Kecamatan Batangkuis, Desa Telagasari di Kecamatan Tanjungmorawa. Salah satu peserta rapat juga menyebutkan ada problem lahan antara PT KAI dengan masyarakat sekitar lima persil.

Masyarakat beranggapan lahan di samping rel kereta api yang akan dibangun menuju Bandara adalah milik mereka. Sementara PT KAI menilai 50 meter lahan di sekitar rel kereta api harus steril dari berbagai bangunan. Sementara dari pihak Brimob mengemukakan permintaan agar lahan dan bangunan milik mereka diganti tidak dengan uang, melainkan dengan lahan dan bangunan yang sama di tempat yang berbeda. Hal ini sesuai dengan petunjuk Kapoldasu yang telah mereka terima. Mendengar hal ini, pihak Pemkab Deliserdang menyebutkan, Pemkab justru harus mematuhi regulasi yang ada, yakni membayar gantirugi dengan uang seperti yang dianggarkan dalam APBD. Asisten Perdata dan Tata Usaha Negara (Asdatun) Kejatisu Tarmizi menyebutkan, dana pembebasan lahan untuk PTPN II tetap harus diberikan kepada PTPN II, bukan kepada masyarakat yang tinggal di atasnya. Hal ini agar sesuai peraturan yang ada. Namun, masyarakat tersebut tetap berhak mendapatkan dana tali asih dari pihak PTPN II. Persoalan pembebasan lahan lainnya pun turut mengemuka dalam rapat itu. Peserta rapat akhirnya menyimpulkan pelelangan atas lahan 3,5 kilometer tetap akan diupayakan ke Kementerian PU agar dikecualikan. “Pemkab Deliserdang dan pihak terkait harus bisa menginventarisir dan mengidentifikasi lahan-lahan yang ada dan diserahkan ke Kejatisu agar dipelajari,” kata Sekda. Biro Pemerintahan Pemprovsu dan BPN Deliserdang segera mendata lahan yang diributkan PT KAI dan masyarakat untuk kemudian dipelajari BPKP agar mendapat advice dan diaudit. (m19)

Sistem Pendidikan Dinilai Gagal Bentuk Karakter Siswa Fenomena Kemerosotan Akhlak MEDAN (Waspada): Sistem pendidikan di Indonesia dinilai gagal membentuk karakter siswa menjadi orang baik yang ditandai dengan banyaknya kasus korupsi, manipulasi, kebohongan dan berbagai konflik dan kekerasan terjadi. “Ini adalah bukti institusi pendidikan kita belum dapat mewujudkan tujuan pendidikan yakni untuk mengembangkan potensi peserta didik agar menjadi manusia yang beriman, berakhlak mulia, sehat, berilmu, cakap, kreatif, mandiri dan menjadi warga negara yang demokratis serta bertanggung jawab,” kata pendiri Indonesia Heritage Foundation, Ratna Megawangi, acara semiloka nasional “Pendidikan Akhak Membangun Karakter Bangsa” di Garuda Plaza Hotel Medan, Selasa (5/10). Semiloka Nasional yang digelar Pusat Penjaminan Mutu Pendidikan (P2MP) Institut Agama Islam Negeri Sumut itu dilaksanakan selama dua hari Selasa-Rabu (5-6/10), dan menghadirkan narasumber Prof. Dr. Nur A. Fadhil Lubis, MA, Ratna Megawangi, PhD, Prof. Dr. Komaruddin Hidayat, Prof. Dr. HM Yasir Nasution. Ratna Megawangi mengatakan, salah satu sebab utama kegagalan tersebut karena sistem pendidikan di Indonesia belum mempunyai kurikulum pendidikan karakter, tetapi yang ada adalah mata pelajaran tentang pengetahuan karakter (moral) yang tertuang di dalam pelajaran agama, kewarganegaraan dan pancasila. Apalagi proses pembelajaran yang dilakukan adalah dengan pendekatan penghafalan. Para siswa hanya diharapkan dapat menguasai materi yang keberhasilannya diukur dengan

Waspada/Sugiarto

Ratna Megawangi, PhD (kanan) saat menjadi narasumber pada semiloka nasional bersama Rektor IAIN, Prof. Nur Ahmad Fadhil Lubis (kiri). kemampuan anak menjawab soal ujian terutama dengan pilihan berganda. Dia mengatakan, salah satu solusi untuk membuat pendidikan moral menjadi efektif adalah dengan melakukan pendidikan karakter, karena pendidikan moral bisanya hanya menyentuh aspek pengetahuan, belum sampai pada aspek prilaku. Sedangkan pendidikan karakter adalah membentuk perilaku siswa menjadi lebih bermoral. Seseorang dapat disebut sebagai orang yang berkarakter apabila tingkah lakunya sesuai dengan kaidah moral. Pendidikan Akhlak Sementara itu Prof. Nur Ahmad Fadhil Lubis menyebutkan, saat ini Indonesia sedang mengalami kemerosotan akhlak yang semakin meluas dengan banyaknya fenomena yang terjadi di Indonesia seperti tawuran, kerusuhan massal, konsumsi narkoba, perzinahan, tindak kriminal, terorisme, korupsi dan lain sebagainya. Fenomena kemerosotan

akhlak tersebut semakin mempertegas urgensi dan pentingnya pemberdayaan kembali pendidikan akhlak. “Hemat saya, pendidikan akhlak merupakan faktor penentu atau instrumen kunci dalam upaya memproduk, membangun, atau mengembangkan individu dan masyarakat yang beradab, sesuai dengan nilai-nilai al akhlak al-karimah,” ujarnya. Prof. Fadhil mengatakan, selama ini pendidikan akhlak telah dilaksanakan, baik di rumah maupun lembaga-lembaga pendidikan formal, seperti madrasah dan sekolah. Dalam UU Sisdiknas sendiri ditegaskan bahwa salah satu tujuan pendidikan nasional, membentuk manusia yang berakhlak mulia. “Namun sepertinya kita gagal dalam membentuk manusia yang berakhlak mulia itu. Salah satu persoalan krusial yang harus direspon oleh dunia pendidikan, khususnya pendidikan Islam adalah masalah pendidikan akhlak,” ujar Rektor IAIN SU ini. (m41)

Waspada/Ist

Walikota Medan H. Rahudman Harahap berbincang dengan Ketua DPD PAN Medan Ahmad Arif didampingi Sekretaris PAN Medan Drs.A Rifai Tambunan.

Jangan Pilih Pemimpin PAN Yang Tak Bersemangat Kedaerahan MEDAN (Waspada): Kader Partai Amanat Nasional (PAN) harus memperkuat ukhuwah dan silaturahmi guna membangun kebersamaan untuk menjaga eksistensi partai di tengahtengah masyarakat Medan. Hal itu disampaikan Ketua DPD PAN Kota Medan, H Ahmad Arif, SE, MM dalam acara Halal Bi Halal dan Silaturahmi PAN Kota Medan di Selecta Ballroom, Jumat (8/10). Hadir dalam acara itu Walikota Medan Rahudman Harahap, Ketua DPW PAN Sumut Syah Affandin, SH, Tokoh Masyarakat Maulana Pohan, unsur pengurus DPD PAN Kota Medan serta seluruh Pengurus PAN tingkat Kecamatan dan Ranting Se-Kota Medan. Dalam sambutannya, Ahmad Arif juga menyinggung soal suksesi DPD PAN Kota Medan yang akan berlangsung di akhir tahun 2010 tersebut. Dia mengatakan dalam dinamika partai serta bersemangat berdemokrasi semua kader PAN berhak untuk maju sebagai calon ketua. Namun Arif mengingatkan semua kader PAN agar tidak terjebak kepada calon yang loyalitas, komitmen dan militansinya kepada partai rendah. “Jangan pilih yang tidak loyal dan lemah komitmennya kepada partai apalagi yang sering menabrak aturan dan keputusan Partai

yang telah ditetapkan,” harapnya. Arif juga mengimbau calon pemimpin PAN Kota Medan ke depan diharapkan bukan kader yang pernah gagal memimpin PAN Kota Medan. PAN harus punya pemimpin yang semangatnya tidak kedaerahan, karena PAN miliki semua golongan dan semua suku” ucap Arif. Dalam kesempatan itu, Arif juga menyampaikan identifikasi kebutuhan dan keperluan partai demi menindaklanjuti dinamika yang terjadi di Kota Medan. “Kita sebagai partai yang lahir dari semangat reformasi, harus terus menerus menjaga eksistensi untuk tetap mendapat kepercayaan masyarakat sebagai tempat menyampaikan aspirasi,” sebut Ketua Fraksi PAN DPRD Kota Medan ini. Dalam momentum halal bi halal ini, Arif juga menyampaikan penghargaan setinggitingginya kepada seluruh jajaran PAN kota Medan serta kader PAN di tingkat kecamatan dan ranting yang telah bersungguh-sungguh menjaga mobilitas, semangat dan kebersamaan sehingga PAN kota Medan tetap eksis di Kota Medan. “Tentu dengan upaya tetap menjaga ukhuwah dan silaturahmi, kebersamaan ini dapat lebih ditingkatkan lagi di masa-masa yang akan datang,” harapnya. (h10)

KDh Diminta Cari Terobosan Tangani KB MEDAN (Waspada): Ketua Tim Penggerak PKK Propinsi Sumut Hj Fatimah Habibi Syamsul Arifin meminta kepala daerah (KDh), bupati dan walikota di 33 kabupaten/kota di Sumatera Utara, agar mencari terobosan baru untuk menangani program KB yang merupakan kebutuhan keluarga pra sejahtera dalam upaya menjarangkan kelahiran. Pernyataan itu disampaikan Ketua Tim Penggerak PKK dalam pertemuan kesepakatan dan komitmen operasional kesatuan gerak PKKKB kesehatan Propinsi Sumatera Utara tahun 2010 yang secara resmi dibuka oleh Ketua TPPKK Sumut di Hotel Madani Medan. Wakil Ketua Tim Penggerak PKK Nyonya RE Nainggolan yang mewakili Hj Fatimah Habibi dan membacakan kesepakatan serta komitmen Tim Penggerak PKK, Jumat (8/10), meminta agar bupati/walikota se-Sumatera Utara dapat mendukung sepenuhnya program KB dan pelayanan kesehatan demi menekan

laju pertumbuhan penduduk dan angka kematian serta kelahiran bayi. “Kegiatan kesatuan gerak PKK-KBKesehatan setiap tahunnya dilaksanakan sejak tahun 1994 mampu dan dapat memberikan konstribusi lebih dari 40 persen pencapaian sasaran atau target tahunan,” katanya. Ny. RE Nainggolan menambahkan, kegiatan PKK-KB-Kesehatan yang telah dilakukan berupa pelayanan KB gratis dan pemeriksaan kesehatan gartis bagi keluarga pra sejahtera dan sejahtera 1 atau masyarakat kurang mampu guna mening-katkan derajat kesehatan para keluarga dan masyarakat secara umum. Pertemuan kesepakatan dan komitmen operasional kesatuan gerak PKK-KB-kesehatan Provinsi Sumatera Utara tahun 2010 menyajikan panel diskusi dengan penyaji Kepala BKKBN Sumut IndraWirdhana, Kepala Dinas Kesehatan Sumut dr Chandra Syafei, SpOG, Kepala Bapemas dan Pemdes Provsu Rusli Abdullah. (m29)

Dana Pembelian Heli Dialihkan Ke Insentif Guru Agama MEDAN (Waspada): Pemprovsu kemungkinan akan menunda pembelian helikopter. Dana Rp40 miliar yang direncanakan sebelumnya akan dialihkan untuk insentif guru agama. Gubernur Sumatera Utara Syamsul Arifin kepada wartawan, Kamis (7/10) mengaku, lebih memilih mengalihkan dana membeli satu unit helikopter senilai Rp40 miliar kepada insentif guru agama. “Menambah penghasilan guru agama jauh lebih bermanfaat, walau membeli helikopter juga termasuk penting, terutama untuk mobilitas kelancaran tugas ke daerah dengan luas daratan 71.680 Km persegi dan luas lautan 110.000 Km persegi,” ujar Gubsu saat ditemui di Aula Martabe Kantor Gubernur Sumut. Menurutnya, dia akan memilih membantu insentif guru agama, jika dana perawatan dari membeli helikopter yang diusulkan itu diakomodir dalam APBD Sumut 2011. “Dari banyak SMS dan saran para staf termasuk diskusi dengan wakil gubernur, akhirnya saya memutuskan untuk mengalihkan dana membeli helikopter itu kepada bantuan insentif guru agama. Apakah guru agama Islam, guru agama Kristen, guru agama Hindu dan guru agama Budha. Karena, selama ini guru-guru itu menerima gaji yang relatif kecil,” ucap Gubsu. Disebutkannya, dari hitung-hitungan

sementara pihaknya ternyata menyewa helikopter jauh lebih efisien ketimbang membeli langsung.Yakni, untuk satu jam terbang, ongkos sewanya mencapai 2.500 dolar AS. Bandingkan ongkos perawatan, membangun helipad, sewa pilot, dan beli avtur untuk satu unit helikopter, maka untuk satu tahun, ongkos yang harus dikeluarkan APBD Sumut sekitar Rp7 sampai Rp10 miliar. “Lagi pula, biaya Rp40 miliar ini belum menghitung risiko kerusakannya atau risiko dipinjam pihak lain. Karena kalau sudah milik Pemprov Sumut, maka tak hanya eksekutif saja yang bisa pakai, legislatif dan yudikatif juga boleh, sehingga akan berebut pula nantinya,” ucap Syamsul. Di tempat terpisah, Sekretaris Daerah Pemprov Sumut RE Nainggolan menambahkan, usulan membeli helikopter tersebut sampai kini masih terus dimatangkan pihaknya. Hal itu dilakukan karena pertimbangan, apakah dana yang akan dikucurkan akan memberikan manfaat lebih besar, ketimbang mengucurkannya untuk kepentingan pembangunan kesejahteraan rakyat di Sumut.“Sampai kini, usulan DPRD Sumut itu masih terus dimatangkan. Karenanya, dalam hal itu kita belum pada posisi untuk memutuskan. Sebab, kita harus menghitung seluruh biayanya, termasuk biaya perawatan dan operasionalnya,” jelas Nainggolan. (m19)

Medan Metropolitan

B2

WASPADA Senin 11 Oktober 2010

Ledakan Tabung Gas

Pertamina Harus Bertanggungjawab MEDAN (Waspada): Melakukan sosialisasi untuk memberikan pemahaman kepada masyarakat tentang penggunaan gas LPG tidaklah gampang. Butuh waktu lama dan keseriusan, baik dari pihak Pertamina, Dinas Perindustrian dan Perdagangan. Untuk itu, sangat diperlukan sosialisasi terpadu antara Pertamina dengan Disperindag.

Waspada/Mursal AI

JENGUK: Anggota DPD RI asal Sumut Parlindungan Purba (tengah) bersama Gas Servis Pertamina Audi Darmaputra menjenguk salah satu korban ledakan tabung gas Syariful, 30, di Ruang Rindu B Bedah Plastik, Minggu (10/10).

Ketua MPO PP Berhalal Bi Halal MEDAN (Waspada): Ketua Majelis Pertimbangan Organisasi (MPO) Dewan Pimpinan Wilayah Pemuda Pancasila Sumatera Utara HB Horas Hutahaean mengadakan halal bi halal di kediamannya Simpang Gudang Arang Jalan Sumatera Belawan, Kamis (7/10). Acara hahal bi halal yang berlangsung sederhana itu dihadiri beberapa tokoh pimpinan wilayah Pemuda Pancasila Sumutera Utara dan Kota Medan, Ketua Pimpinan Anak Cabang Pemuda Pancasila Kecamatan Medan Belawan HM Junaidi Pangaribuan berserta istri dan sejumlah pengurus kecamatan dan anggota. Halal bi halal yang bertujuan menjalin silaturrahmi sesama muslim dan kaum lainnya ini juga dihadiri intansi terkait dan tokoh masyarakat di Kecamatan Belawan, karena HB Horas Hutahaean adalah tokoh masyarakat Belawan dan tokoh Tenaga Kerja Bongkar Muat (TKBM) Pelabuhan Belawan. Ketua MPO Pemuda Pancasila Wilayah Sumatera Utara Haji B Horas Hutahaean menjelaskan, acara halal bi halal ini rutin setiap tahun dilaksanakan di kediamannya dalam rangka memanfaatkan bulan baik di Hari Raya Idul Fitri. “Tidak banyak yang diundang hanya kaum kerabat dekat saja,” jelasnya. Acara halal bi halal ini semakin meriah karena menghadirkan hiburan musik key board.(m35)

900 Sarjana Al-Hikmah Diwisuda MEDAN (Waspada): Daya saing suatu bangsa didefenisikan sebagai tantangan yang mengedepankan pentingnya pengetahuan yang merupakan pendorong utama dalam pertumbuhan bangsa, oleh karena itu setiap sarjanawan harus mampu mengembangkan diri di tengah-tengah masyarakat. “Daya saing tersebut semakin tak bergantung lagi pada pengetahuan yang dimiliki. Oleh karena itu, para sarjanawan harus mampu melakukan pengembangan diri untuk mempertahankan relevansi di tengah-tengah masyarakat,” ungkap Rektor Perguruan Tinggi Islam Al-Hikmah Drs Zainuddin Siregar, SH,SE, MM dalam acara wisuda sarjana yang diikuti 900 lulusan di Auditorium Unimed, Sabtu (9/10). Zainuddin Siregar mengharapkan, agar para mahasiswa lulusan Perguruan Tinggi Islam Al-Hikmah juga harus mampu memberikan respon dan jawaban terhadap tantangan zaman baik saat ini maupun di masa mendatang. “Kita berharap nantinya para alumni tidak hanya mampu mengayomi keluarga sendiri, akan tetapi disamping itu hendaknya dapat memberikan warna dan pengaruh bagi masyarakat sebagai wujud pengabdian kepada agama, bangsa dan negara,” harap Rektor Perguruan Tinggi Al-Hikmah itu. Selain itu, ungkapnya, Perguruan Tinggi Islam Al-Hikmah akan berusaha meningkatkan mutu guna menghadapi tantangan persaingan lembaga pendidikan yang semakin tajam, dengan berupaya membenahi diri untuk menjadi Universitas Al-Hikmah Sumatera Utara. Adapun lulusan yan diwisuda terdiri dari STAI Medan Program SI, Pendidikan Agama Islam (PAI), Komunikasi Penyiaran Islam (KPI), Bimbingan Konseling Islam (BKI) Program S1 angkatan XVIII sebanyak 260 orang, Sekolah Tinggi Ilmu Ekonomi Program S1 Manajemen 320 orang, Sekolah Tinggi Ilmu Hukum Program S1 sebanyak 280 orang, dan D-III Akuntansi angkatan VII 30 orang serta Sekolah Tinggi Ilmu Tarbiyah Tebing Tinggi Program studi Pendidikan Agama Islam (PAI) angkatan ke IV sebanyak 66 orang dan Sekolah Tinggi Agama Islam Tanjung Balai Program Studi Agama Islam (PAI) angkatan ke III sebanyak 70 Orang. Sedangkan dalam acara wisuda tersebut juga diisi pidato orasi ilmiah yang disampaikan oleh Pembantu Rektor (PR) II dari Institut Agama Islam Negeri (IAIN) Sumut Prof Dr H Djakfar Siddik, MA. Turut juga hadir dalam wisuda tersebut perwakilan Kopertis Wilayah I NAD dan Kopertais Wilayah IX Sumut dan Gubernur Sumatera Utara. (cat)

“Sekarangkan terkesan jalan sendiri. Seharusnya harus ada sosialisasi terpadu antara Pertamina dan Disperindag, karena mengawasi peredaran selang regulator dan tabung itu tugas Disperindagsu, saat sosialisasi ajak juga tokoh pemuda, tokoh perempuan serta alim ulama, jadi semua harus dilibatkan,” ujar anggota DPD RI asal Sumut Parlindungan Purba usai menjenguk kelima korban ledakan tabung gas 3 kilogram di RSUP H. Adam Malik Medan, Minggu (10/10). Mengenai kasus ini, Parlindungan meminta agar Pertamina bertanggungjawab atas seluruh biaya rumah sakit dari kelima korban ledakan tabung gas. “Nanti dalam waktu dekat ini kita akan sidak dan ikut mengawasi sosialisasi ke masyarakat,” terangnya.

Sementara itu, perwakilan dari Gas Servis Pertamina Audi Darmaputra mengatakan, Pertamina akan menanggung biaya korban ledakan tabung gas. Untuk itu, kejadian di Jl. Marelan Kel. Tanah Enam Ratus akan dicek terlebih dulu. “Kami akan mengecek, apakah korban memakai selang atau tabung yang diberi secara gratis atau beli sendiri ke distributor,” kata Audi yang juga menjenguk kelima korban ledakan tabung gas. Mengenai hal ini, lanjutnya, Pertamina dan Disperindagsu serta anggota DPD RI selaku pengawas akan melakukan sidak ke penyalur agen LPG, dan distributor selang dan regulator.“Serta melakukan sosialisasi ke masyarakat bersama anggota DPD RI.” Sementara itu, satu dari lima korban yakni M. Alfarobi, 8 bulan, terpaksa di rawat di

Ruang ICU anak lantai III RSUP HAM, karena suhu badannya tinggi. Sedangkan empat lagi yakni Syaiful, 30, istrinya Sri Romaidah, 30, Luthfi, 3, serta adik ipar Syariful, Rusmaini, 20 di rawat di Ruang Rindu B Bedah Plastik lantai II RSUP HAM. Berita sebelumnya, satu keluarga yakni lima orang menjadi korban ledakan tabung gas di Jl Marelan Kel. Tanah Enam Ratus Kec. Medan Marelan, Sabtu (9/10) pagi. Kejadian berawal pukul 7.30 pagi. Saat itu Syaiful hendak dan istrinya hendak mengganti tabung gas yang telah kosong dengan yang baru. Namun, saat Syaiful mau memasang selang regulatornya, bau gas keluar dari tabung gas yang baru dibelinya tersebut. Namun karena panik, Syariful lalu mencampakkannya keluar rumah, lalu meledak. (cmai)

Pemerintah Segerakan Optimalisasi Pendidikan Formal, Non Formal MEDAN (Waspada) : Jika dibandingkan dengan 21 negara di Asia, kualitas pendidikan Indonesia masih berada di posisi dua belas. Posisi tersebut satu tingkat lebih rendah dengan Vietnam. Hal inilah gambaran penelitian dari PERC (Political and Economic Risk Consultancy) yang mengkaji mutu pendidikan dan kualitas tenaga kerja. Ketua DPD HIPKI Sumut Syamsuddin, di Medan usai menggelar acara seminar di Balai Pengembangan Pendidikan Non Formal dan Informal (BPPNFI) Regional I Medan, kemarin menyatakan, jika pemerintah tidak segera melakukan percepatan pengoptimalisasikan pendidikan formal dan non formal, Indonesia akan terus berada di posisi terbawah bahkan lebih buruk dari negaranegara yang baru berkembang. “Gambaran ini memperlihatkan bahwa baik secara kuantitatif dan kualitatif maka pencapaian pendidikan di Indonesia masih jauh dari apa yang diharapkan. Posisi negara Indonesia di Asia dan dunia internasional ternyata menunjukkan posisiyangselaludibawahnegaranegara Asean, bahkan dibanding negara Vietnam, Indonesia masih lebih rendah,” ujarnya. Untuk itulah, lanjutnya, pihaknya menggelar acara seminar untuk membahas segala persoalan yang terjadi di lapangan khususnya pengelola pendidikan non formal agar ke depan pembangunan pendidikan dan peningkatan SDM

semakin meningkat di setiap daerah. “Kita berharap dengan digelarnya seminar ini akan memberikan masukan serta manfaat yang banyak bagi tumbuh kembang pendidikan non formal di setiap daerah kabupaten kota di Sumatera Utara,” lanjutnya. Dalam hal itu Kabid PNFI & PAUD Dinas Pendidikan Sumatera Utara, Dra Yuniar menyatakan, standarisasi kompetensi lembaga kursus atau pendidikan non formal sangat penting bagi tumbuh kembang sumber daya manusia (SDM). “Baik didalam tenaga pendidikan, hasil yang ditelurkan atau dihasilkan oleh lembaga kursus tersebut, bahkan materi pendidikan dan sarana prasarana dari lembaga pendidikan non formal sehingga membuat yakin dan betah para peserta didik,” ujarnya. Dia melanjutkan, hal itulah yang dilakukan dinas didalam mengakreditasi lembaga kursus ataupun pendidikan tersebut. “Pada tahun ini, Dinas PendidikanSumateraUtaraakanmemberikan kesempatan terhadap tiga lembaga pendidikan non formal di setiap daerah untuk dilakukan pembinaan,” ujarnya. Pengurus Kamar Dagang Indonesia (KADIN) Sumatera Utara, Irpan Syaparuddin menyatakan dalam makalahnya tentang peran serta dunia usaha dalam pemanfaatan lulusan lembaga kursus dan pelatihan. “Kadin tidak mungkin membuka lembaga kursus untuk meningkatkan sumber daya

manusia (SDM) yang akan ditempatkan di perusahaannya. Tentunya hal ini akan diserahkan kepada lembaga-lembaga pendidik non formal,” ujarnya. Begitupun, lanjutnya, pengelola pendidikan non formal harus juga paham market sumber daya manusia (SDM) apa saja yang dapat diterima perusahaan besar dan kecil di daerahnya. “Sehingga ke depan mereka tidak hanya membuat lembaga kursus tentang IT, melainkan elektronik, mesin, busana, dan lain sebagainya. Hal inilah yang diharapkan oleh para pengusaha didalam menerima atau mengambil SDMSDM dari lulusan pendidikan non formal yang sesuai dengan kebutuhan perusahaannya,” lanjutnya. Sebelumnya seminar disampaikan oleh Drs Mansur Simamora yang membahas kebijakan direktorat pembinaan kursus dan kelembagaan di dalam peningkatan mutu kursus dan pelatihan dan kiat-kiat merangkul mitra dan sponsor bagi lembaga kursus dan pelatihan oleh Prof. dr Yusnadi MS. Advokasi HIPKI Sumut Jauli Manalu menyatakan, untuk mengembangkan pendidikan non formal di Sumatera Utara seluruh HIPKI Sumut agar bekerjasama dan selalu berdialog didalam membahas pembangunan pendidikan non formal kedepannya. Kemudian acara dilanjutkan dengan halal bi halal BPPNFI Regional I Medan, sekaligus rancangan kerja daerah (rakerda). (m38)

Waspada/Hamzah

Ketua DPD HIPKI Sumut Syamsuddin foto bersama dengan pemakalah dalam acara seminar dan dilangsungkan halal bi halal dan rakerda Balai Pengembangan Pendidikan Non Formal dan Informal (BPPNFI) Regional I Medan, beberapa waktu lalu.

Waspada/Surya Efendi

KETUA PKS SUMUT YANG BARU: Ketua Umum DPW PKS Sumut periode 2010-2015 yang baru terpilih, Muhammad Hafez, Lc, MA (depan mikrofon) memberikan pidato politiknya pada penutupan Muswil ke-2 PKS Sumut di lapangan Benteng Medan, Minggu (10/10).

Muhammad Hafez Pimpin PKS Sumut MEDAN (Waspada): Dewan Pimpinan Pusat (DPP) Partai Keadilan Sejahtera (PKS) menetapkan sekaligus melantik H Muhammad Hafez, MA sebagai Ketua Umum Dewan Pimpinan Wilayah PKS Sumut periode 20102015 dan sembilan pengurus inti lainnya, pada acara penutupan Musyawarah Wilayah II PKS Sumut di Medan, Minggu (10/10). Pelantikan tersebut sempat mengejutkan sejumlah kader, pasalnya sampai dengan pembukaan Muswil, mantan ketua DPW PKS Sumut Mustafa Ismail sempat disebut-sebut bakal dilantik kembali. Karena sebelumnya, DPP PKS menginformasikan nama Mustafa masuk dalam delapan nama pengurus inti yang akan dilantik. Penetapan itu berdasarkan keputusan Dewan Pimpinan Pusat (DPP) Partai Keadilan Sejahtera (PKS) Nomor 092/B/SKEP/DPP-PKS/ 1431 tertanggal 26 Syawal 1431 Hijriah (6 Oktober 2010) yang dibacakan Wakil Ketua Wilayah Dakwah Sumatera DPP PKS M Idris Lutfi Rambe. Idris Lutfi atas nama Presiden PKS pada kesempatan itu sekaligus melantik pimpinan baru Dewan Pimpinan Wilayah (DPW) PKS Sumut periode 2010-2015 berikut pimpinan Majelis Pertimbangan Wilayah (MPW) PKS Sumut dan pimpinan Dewan Syariah. Dalam kepengurusan baru, Hafez didampingi H Satria Yudha Wibowo sebagai sekretaris umum, Heriansyah sebagai wakil ketua umum, Basir sebagai bendahara dan H Mahmud Soleh sebagai ketua bidang kaderisasi. Sementara posisi Ketua MPW PKS Sumut tetap dipercayakan kepada Sigit Pramono Asri yang juga Wakil Ketua DPRD Sumut dengan sekretaris Awilham Manurung, sedangkan H Muhammad Yusuf Fahmi dipercaya sebagai Ketua Dewan Syariah didampingi sekretaris H Muslim Maksum Yusuf. Idris Lutfi menyebutkan, kesembilan pimpinan baru yang pada hari itu dilantik merupakan hasil penyaringan melalui pemilihan umum internal yang digelar di

seluruh kabupaten/kota di Sumut pada 22 Agustus 2010. Mereka yang kemudian ditetapkan sebagai Dewan Pimpinan Tingkat Wilayah (DPTW ) Sumut itu sebelumnya bersaing dengan 16 kader lain yang dipilih oleh 940 kader inti PKS se-Sumut. Oleh DPP PKS, lima di antaranya mereka kemudian ditetapkan sebagai pimpinan DPW, dua sebagai pimpinan MPW dan dua lainnya sebagai pimpinan Dewan Syariah. “Mereka ini bertanggung jawab melengkapi kepengurusan masing-masing,” ujar Idris Lutfi pada kesempatan dihadiri Wakil Gubernur Sumut H Gatot Pujo Nugroho serta sejumlah tokoh masyarakat, pimpinan partai politik serta organisasi kemasyarakatan dan kepemudaan se-Sumut itu. Sementara Hafez dalam pidato politiknya usai pelantikan mengaku siap melanjutkan estafet kepemimpinan. “Kami siap melanjutkan misi dakwah PKS. Insya Allah kami akan seoptimal mungkin menjalankan sekaligus melaksanakan naras-narasi besar untuk bersama-sama membangunan Sumut yang lebih berkeadilan dan berkesejahteraan,” katanya. Mantan Ketua Bidang Kaderisasi DPW PKS Sumut periode 2005-2010 itu mengatakan, visi besar kepengurusan DPW PKS Sumut yang baru adalah menjadi partai dakwah yang kokoh dan trasparatif untuk sepenuhnya melayani kepentingan masyarakat di daerah itu. Sementara itu, Mustafa Ismail yang dikonfirmasi Waspada membenarkan dirinya sempat masuk dalam delapan nama pengurus inti yang akan dilantik. Namun, begitupun dia tidak terkejut walaupun akhirnya tidak jadi terpilih menjadi pengurus inti. Menurutnya, DPP PKS yang paling tahu bentuk komposisi kepengurusan yang sesuai dengan kebutuhan partai. “Lagipula informasi soal delapan nama calon pengurus inti kemarin itu kan sifatnya hanya informal. Kalau pelantikan yang sekarang inilah yang formal,” katanya.(h11)

Pegawai PD Pasar Sampaikan Mosi Tak Percaya Pada Dirut MEDAN (Waspada): Ratusan pegawai PD Pasar Medan secara spontan menyampaikan mosi tidak percaya terhadap kinerja Direktur Utama (Dirut) Mustafa Sutan Nasution sebagai hasil pertemuan mendadak dengan para direksi di kantor PD Pasar Jalan Razak, Jumat (8/10). Hadir dalam pertemuan tersebut selain Dirut PD Pasar diantaranya Direktur Operasional (Dirop) HM Tahjuddin Nur, Direktur Umum dan Keuangan Maratua Simanungkalit, para kepala cabang dan kabag serta ratusan pegawai lainnya. Pertemuan spontan yang dilakukan para pegawai usai apel pagi tersebut mendapat pengawalan petugas Polsekta Medan Baru dan Polresta Medan yang terus berjaga-jaga di ruang rapat pertemuan dan sekitar ruang kerja Dirut. Dalam pertemuan, para pegawai mengungkapkan kekesalan terhadap kinerja perusahaan yang semakin menurun, disamping tidak adanya lagi alat tulis kantor disediakan perusahaan untuk para kepala pasar, serta jaminan kesejahteraan pegawai semakin tidak jelas. Disamping itu, mereka juga menuding Dirut PD Pasar sebagai salah satu yang menghalangi permohonan pegawai untuk bertemu dalam rangka audiensi denganWalikota Medan terkait tuntutan untuk menjadi CPNS. Mutasi pegawai juga dinilai tidak jelas dan terkesan tebang pilih serta diduga sarat kolusi, sehingga jenjang karir dan standar potensi untuk menentukan jabatan pegawai dinilai hanya berdasarkan kedekatan dengan pimpinan. Program perusahaan dalam rangka meningkatkan pendapatan dari kenaikan kontribusi dinilai sangat kurang etis dilakukan saat ini, karena di tengah kondisi pasar yang banyak

mengalami kerusakan, para pegawai sulit memungut dana kontribusi ke pedagang. Sebagian besar pasar tradisional tidak banyak mengalami perawatan, sehingga dengan jumlah kontribusi saat ini banyak pedagang menunggak dan memboikot tidak membayar kontribusi sampai fasilitas yang dituntut harus diperbaiki PD Pasar. Banyak kepala pasar yang harus memohon kepada pedagang, untuk membantu biaya perbaikan dan perawatan beberapa fasilitas pasar yang mendesak dilakukan, akibat biaya dari perusahaan daerah tersebut tidak jelas. Sementara itu pergantian pimpinan PD Pasar selama ini yang dirasakan para pegawai tidak membawa keuntungan dan perbaikan, baik terhadap perusahaan maupun peningkatan pelayanan pedagang apalagi untuk kesejahteraan pegawai. Dirut PD Pasar Medan Mustafa Sutan Nasution didampingi Direktur Umum dan Keuangan Maratua Simanungkalit mengatakan, yang menilai kinerja dirinya sebagai direktur utama bukan pegawai perusahaan yang dipimpinnya. Menurutnya, yang menilai adalah Walikota Medan sebagai kepala daerah pemilik aset PD Pasar Medan. Selain itu yang menentukan kualitas perusahaan berdasarkan audit tahunan dari BPK sebagai institusi yang ditunjuk pemerintah. Terkait hasil pertemuan dan mosi tidak percaya para pegawai akan segera disampaikan secepatnya kepada Walikota Medan, juga terkait adanya opsi yang merencanakan perusahaan daerah tersebut akan dikembalikan ke dinas. (m40)

Medan Metropolitan Gubsu Harapkan Pers Jaga Suasana Kondusif WASPADA

Senin 11 Oktober 2010

B3

Halal Bi Halal PWI Dimeriahkan Winni KDI MEDAN (Waspada): Gubernur Sumatera Utara (Gubsu) Dato’ Seri Haji Syamsul Arifin, SE mengharapkan kepada keluarga besar pers di Sumut untuk menjaga suasana kondusif daerah, sehingga kesinambungan pelaksanaan pembangunan di segala sektor dapat terus dipacu guna meningkatkan kesejahteraan masyarakat. Demikian Gubsu dalam sambutan diwakili Kepala Dinas Kominfo Sumut Drs H Eddy Syo-fian, MAP pada acara Halal Bi Halal Persatuan Wartawan Indonesia (PWI) Cabang Sumut di Theme Park Pantai Cermin Kabupaten Serdang Bedagai (Sergai), Sabtu (9/10).

Hadir di situ, Anggota Dewan Perwakilan Daerah (DPD) RI Parlindungan Purba, SH, MM, Ketua Komisi E DPRD Sumut Brilian Moktar, SE, Wakil Bupati Sergai Ir H Soekirman, Wakil Bupati Deli Serdang H Zainuddin Mars, S.Sos, Sekdakab Sergai Drs H Haris Fadillah

Pembawa 100 Gram Sabu Ditangkap MEDAN (Waspada): Polresta Medan menangkap seorang pria membawa 100 gram sabu-sabu senilai Rp80 juta dalam razia rutin di Jalan Binjai Km 8, Kec. Sunggal, Kab Deli Serdang.. Selanjutnya tersangka BI, 27, warga Gambong Paya, Desa Paya, Kec. Tri Gading, Pidie Jaya, diboyong bersama barang bukti narkoba ke Mapolsekta Medan Sunggal. “Sedangkan pemilik sabu-sabu kini masih dalam buronan,” kata sumber Waspada peroleh di lapangan, Minggu (10/10). Menurut sumber, penangkapan itu berawal saat polisi melakukan razia terhadap kendaraan baik roda dua dan empat yang melintas. Setiap pengendara/sopir maupun penumpang dilakukan penggeledahan dan pemeriksaan terhadap kendaraan. Ketika dilakukan pemeriksaan terhadap taksi yang melintas, polisi menemukan dari saku tersangka yang saat itu sebagai penumpang taksi tersebut satu bungkus plastik berisikan sabusabu 100 gram. Kepada petugas dia mengakui dan membawa sabu-sabu atas suruhan orang lain. “Saya sebagai kurir saja dan membawa sabu-sabu ini akan mendapat komisi,” jelasnya. (m31)

Asosiasi Jurnalis Alumni IAIN Sumut Terbentuk MEDAN (Waspada): Eksistensi IAIN Sumut sebagai satusatunya perguruan tinggi agama negeri di Sumatera Utara, tidak akan mungkin dapat tumbuh dan berkembang secara cepat sebagaimana diharapkan, tanpa mendapat sokongan eksternal disamping internal. Hal itu terungkap dalam diskusi pada pembentukan paguyuban Asosiasi Jurnalis Alumni IAIN Sumut di kampus IAIN Jalan Sutomo/IAIN Medan, Senin (4/10). Diskusi tersebut selain dihadiri para wartawan jebolan IAIN Sumut juga para alumni lainnya dari lintas fakultas. Dialog dengan tema: Menatap masa depan perkembangan IAIN Sumut dalam menghadapi era yang cukup kompetitip dengan nara sumber Drs Ansari Yamamah, MA dan dari dialog itu para peserta sepakat untuk membentuk asosiasi tersebut sebagai wadah pemersatu para alumni yang berprofesi jurnalistik sekaligus sebagai wadah komunikasi dengan almamater. Majelis pada pertemuan itu telah menyepakati komposisi pengurus Asosiasi Jurnalis Alumni IAIN Sumut; Penasehat Drs AnsariYamamah MA, Dewan Pakar H Erwan Effendi (HrWaspada), H Ali Murtadho, MA (Hr Analisa), Ketua Asosiasi Jurnalis Alumni IAIN Sumut Suasana Nikmat Ginting SHi (Hr Bersama), Wakil Ketua Hamdani Nasution (Hr Orbit), Sekretaris Suhairi Ramadhan (Hr Analisa), Wakil Sekretaris Hendra (Hr Orbit) dan Bendahara Abd. Rasyid (Hr Orbit) dilengkapi bidang- bidang. Menurut Ansari, peran alumni yang bergerak di bidang jurnalis sangat strategis dalam membangun dan membesarkan IAIN Sumut ke depan. Peran strategis tersebut diantaranya adalah, para alumni yang bergerak dibidang jurnalis merupakan sumber informasi yang sangat up to date sekaligus mampu menginformasikan program dan visi misi IAIN Sumut ke publik. Ketua Asosiasi Jurnalis IAIN Sumut Suasana Nikmat Ginting didampingi Sekretaris Suhairi Ramadhan dan Bendahara A Rasid mengatakan, wadah ini setidaknya menjadi alat perekat bagi para alumni untuk dapat lebih banyak berbuat dalam rangka pengabdian kepada masyarakat secara umum dan khususnya almamater. (m14)

Waspada/Ist

dr. H Zaenal Muttaqien Sofro, AIFM (kiri) saat menjadi pembicara seminar kesehatan dengan tema Hidup Sehat Tanpa Kekurangan Cairan Tubuh di Hotel Arya Duta beberapa waktu lalu.

Tubuh Manusia Butuh Cairan Cukup MEDAN (Waspada): Tubuh manusia membutuhkan cairan air guna membantu daya tahan yang kuat saat beraktivitas seharihari. Jika komponen tubuh tak bisa memadai kebutuhan air, maka cairan khusus pun bisa membantu seseorang mengatasi rasa haus yang dialaminya. “Minuman isotonik dapat membantu menggantikan cairan dan elektrolit yang hilang melalui keluarnya keringat. Minuman seperti ini akan cepat meresap ke dalam tubuh karena osmolaritasnya yang baik akan terdiri dari elektrolit untuk membantu menggantikan cairan tubuh,” kata dr. H Zaenal Muttaqien Sofro, AIFM saat menjadi pembicara pada acara Pocari Sweat Conference 2010 dengan tema Hidup Sehat Tanpa Kekurangan Cairan Tubuh di Hotel Arya Duta beberapa waktu lalu. dr. H Zaenal Muttaqien Sofro mengatakan, cairan tubuh yang hilang termasuk ion di dalamnya harus diganti, karena vital sekali untuk proses metabolisme secara keseluruhan. Jika kita kurang minum, makanan yang kita konsumsi tidak bisa dicerna dengan baik. Berarti nutrisinya tidak bisa tersampaikan ke seluruh tubuh dengan baik pula. Dampaknya, kondisi tubuh menjadi kurang cairan dan kinerja dapat menurun. Sementara itu, Jaka Widyantara Regional Salesman mengatakan, kegiatan Pocari Sweat Conference 2010 dilaksanakan di 13 kota dengan tema “Be Active & Healthy” diantaranya kota Yogyakarta, Makassar, Jakarta, Semarang, Surabaya, Malang, Solo, Bandung dan Medan. Kemudian akan menyusul Pontianak, Palembang, Denpasar dan Manado. (m41)

MSi, Staf Ahli Bupati Sergai Drs Rahmad Karo-karo, Kapendam I/BB Letkol Caj Dr. H Asren Nasution, Kabag Humas Pemko Medan Drs Hanas Hasibuan, MAP, Ketua PWI Sumut Drs Muhammad Syahrir beserta pengurus, para pimpinan media, Ketua PWI Perwakilan se Sumut, unsur pimpinan Asian Agri, Muspika Pantai Cermin dan undangan lainnya. Menurut Eddy Syofian yang juga Pj Walikota Tebing Tinggi, peran pers sangat vital dan strategis dalam menentukan kondisi daerah. Karena itu Pers diposisikan sebagai bagian tak terpisahkan dari lima pilar penentu keberhasilan pembangunan setelah peran Muspida, tokoh agama, tokoh adat, dan para pemuda. “Sebagai bagian dari pilar penentu itu, maka peran Pers ke depan perlu terus dipacu dan ditumbuhkembangkan dalam menggerakkan seluruh potensi

daerah, mengawal dan meluruskan tujuan pembangunan, serta menjaga suasana kondusif daerah. Tentu dalam menjalankan peran Pers itu tetap menjunjung tinggi sikap profesionalisme,” urainya. Harapan senada juga disampaikan Anggota DPD-RI Parlindungan Purba, SH, MM, Wakil Bupati Sergai Ir H Soekirman, dan Wakil Bupati Deli Serdang H Zainuddin Mars S.Sos. Mereka berharap, melalui momen Halal Bi Halal PWI Sumut, kemitraan yang terjalin dapat terus dibina dan ditingkatkan melalui semangat kebersamaan serta wujud saling menghargai atas tugas-tugas yang diemban. Pada kesempatan tersebut Parlindungan Purba menginformasikan bahwa pihaknya bersama Anggota DPD-RI lainya telah mengusul-kan adanya Komisi Pers sebagai salah satu butir amandemen UUD 1945.

“Hal ini menjadi langkah prospektif terutama dalam upaya penguatan profesionalisme Pers,” katanya. Dihibur Artis KDI Acara Halal Bi Halal mengusung tema “me-rajut kebersamaan mempererat silaturahmi” itu turut dimeriahkan Winni artis Sumut yang lolos audisi KDI Star. Suasana keakraban dan kegembiraan makin larut dengan penampilan duetWinni dengan Kadis Kominfo Sumut Drs H Eddy Syofian, MAP, Ketua PWI Sumut Drs Muhammad Syahrir dan Ketua Komisi E DPRD Sumut Brilian Moktar, SE. Kemeriahan bertambah semarak dengan pencabutan hadiah lucky-draw dan gamegame hiburan seperti joget robot dipandu MC Hartati Rang-kuti dan M Akhiruddin. Winni KDI, putri M Noor wartawan Harian Analisa juga ikut menjadi juri dalam game-game hiburan tersebut. (rel/m08)

Halal Bi Halal AJB Bumiputera 1912 MEDAN (Waspada): AJB Bumiputera 1912 dalamWadah Fokkus Babinrohis Bumiputera Group Medan, mengadakan acara halal bi halal di halaman kantor Bumiputera Jl. Iskandar Muda No.138 Medan, kemarin. Acara yang digelar dalam suasana Lebaran itu kedepannya diharapkan dapat lebih mempererat tali silaturahmi sehingga berdampak dalam peningkatan produktivitas kerja serta kesejahteraan. Acara halal bi halal yang setiap tahunnya digelar jajaran Bumiputera itu turut dihadiri Anggota Badan Perwakilan Anggota (BPA) Drs Nabari Ginting, MSi, Kawil Asuransi Perorangan Medan Drs H Ghoffar Assingapury, MM, AAAIJ, Kawil Asuransi Kumpulan Sumatera H Kamaruzzaman, Kawil Asuransi Syariah Sumatera Drs Taufik Rachman Yudi, Kawil Bank ICB Bumiputera Pardamean Sipayung, VP, Asisten Kawil dan Kabag 3 Lini Bisnis serta Kepala Cabang bersama Mitra Kerjanya semetro Medan. Dalam sambutannya, Anggota BPA AJB Bumiputera 1912 Nabari Ginting mengatakan, bulan puasa sudah dilalui dan bulan kemenangan talah tiba, maka dari itu marilah kita jalani penuh keceriaan serta dapat menanamkan sekaligus dapat mempererat tali silahturahmi

antar sesama. Calon Bupati Karo itu menambahkan, selain mempererat tali silaturahmi, manusia juga harus memupuk rasa saling tolong menolong bagi sesama. “Ketenaran manusia bukan saja dilihat karena harta dan pengetahuannya akan tetapi bagaimana bisa membantu orang lain sebagai sesama manusia,” tandas Nabari Ginting yang juga Ketua Harian Persatuan Olahraga Berkuda (Pordasi) Sumut itu. Sedangkan Kawil Asuransi Perorangan Medan sekaligus Koordinator Wilayah Bumi-putera Group Medan Drs H Ghoffar Assingapury, MM, AAAIJ, menyampaikan rasa terima kasih kepada seluruh karyawan/I Bumiputera yang hingga kini tetap solid dalam bekerja. Dimulai dari bulan kemenangan ini dan seterusnya, seluruh komponen Bumiputera diharapkan dapat lebih menjunjung tinggi nilai-nilai perbedaan dengan mempererat tali silaturahmi baik antar karyawan, nasabah dan pihak-pihak lainnya. “Dengan mempererat tali silaturahmi maka diyakini akan menciptakan komunikasi yang baik bagi karyawan sehingga memudahkan dalam bekerja untuk lebih baik lagi guna meningkatkan produktivitas sehingga akhirnya dapat mening-

katkan kesejahteraan,” tegas Ghoffar yang juga Pembina Fokkus Babinrohis Bumiputera Group Medan itu. Sementara, Ketua Fokkus Babinrohis Bumiputera Group Medan, Helmi Siregar, SmAk mengatakan, kegiatan halal bi halal ini rutin dilakukan setiap memasuki bulan Syawal guna tali silaturrahmi tetap terbina terus. Acara yang diawali dengan pembacaan Alquran oleh Qori Drs. H. Fadlan Zainuddin, dimeriahkan juga oleh nyanyian Orkes khusus dari Fokkus Babinrohis Pemprov Sumut dan vokal nyanyian dari Pejabat Bumiputera beserta Mitra Kerjanya serta Ikatan Keluarga Karyawan/Karyawati Bumiputera (IKKBP). Selain menyampaikan tausiah al-ustazd Ngatman Azis, MPd merasa kagum kepada seluruh komponen Bumiputera dimana toleransi antar umat beragama tampak terlihat. Harapnya, kebersamaan ini jangan sampai terpecah belah. “Justru kebersamaan dan toleransi itu yang harus tetap kita bangun. Yakinlah dengan mempererat tentu produktivitas di Bumiputera pasti meningkat, sesuai tema kita hari ini, jelas Al Ustad yang pada tusiahnya selalu dihubungkan dengan lagu-lagu dan penuh kelakar. (m10)

Nasib Veteran Yang Tersisihkan DENGAN sisa-sisa semangat yang masih melekat, puluhan orang tua berpeci kuning terlihat ‘lantang’ menyanyikan lagu Indonesia Raya.Satu persatu rangkaian acara pelantikan DPC Legiun Veteran Republik Indonesia (LVRI) Kota Medan berjalan dengan lancar, meski protokol sedikit agak lama membaca tertib acara, namun acara tersebut berlangsung khidmat. Pelantikan kali ini sangat jauh berbeda dengan pelantikan organisasi-organisasi lain,yang rata-rata diadakan di gedung ataupun di hotelhotel maupun di wisma-wisma. Namun pelantikan ini, hanya diadakan di dalam ruangan yang hanya berukuran 5 x 5 meter yang hanya berfasilitaskan satu kipas angin, tepatnya di ruangan Kantor DPC LVRI Medan Jalan Gatot Subroto Medan. Pelantikan mantan para pejuang ini juga tidak dihadiri satu orang pun pejabat Pemko Medan meski telah

diundang. Berbeda dengan pelantikan lainnya. Pejabatpejabat pada hadir.Yang terlihat hanya perwakilan dari TNI, yakni Kodim 0201/BS yang diwakilkan Danramil Medan Sunggal Kapten Karjono. Meskipun begitu, pengabdian mereka rasa kesetiakawanan dan keprihatinan tetap tidak luntur dan tidak pudar, karena telah melekat dalam jati diri veteran. Bagi mereka, merebut dan mempertahankan kemerdekaan tahun 1945 adalah kebanggaan tersendiri bagi veteran. Hal ini diungkapkan Ketua DPC LVRI kota Medan Letkol. SUS. (Purn). SM. Aritonang yang baru dilantik oleh DPD LVRI Propsu, Kamis (7/10). Meski saat ini sudah terduduk dikursi roda, namun dengan semangat yang berkobar-kobar, suara SM. Aritonang masih kuat menyampaikan kata sambutan. Dalam sambutannya, Aritonang menyampaikan tentang hak veteran RI yang mengatur peri kehidupan veteran belum terealisasi secara konsekuen dan

merata. Dengan usia 65 tahun Indonesia merdeka, seharusnya pemerintah berpikir realistis dan berpikir empiris untuk memecahkan persoalan bangsa khususnya anggota veteran RI yang belum didasarkan kesiapan inventarisasi. Sementara itu, Danramil Medan Sunggal Kapten Karjono merasa tergugah melihat semangat veteran yang tidak luntur. Menurutnya, para Veteran Republik Indonesia masih dibutuhkan seperti memberi dukungan moril, petunjuk dan panutan bagi generasi penerus. Mereka yang dilantik, yakni Ketua SM. Aritonang, Wakil Ketua Sumbat Sembiring, Sekretaris Suharto, Bendahara Sujihartono, Kabag Organisasi Djainuddin, Kabag Wanvet Asmah, Kabag Generasi Penerus Suardi Suardon, Kabag Kesejahteraan Anggota, Sauridas dan Kabag Minvet Badia Sitompul. *Mursal AI

Waspada/Mursal AI

SAMBUTAN: Ketua DPC LVRI kota Medan Letkol. SUS.(Purn). SM. Aritonang saat memberikan kata sambutan pada acara pelantikan Dewan Pimpinan Cabang Legiun Veteran Republik Indonesia (LVRI) Kota Medan, Kamis (7/10).

Waspada/Ist

JOGET ROBOT: Anggota PWI Sumut beserta keluarga dan mitra kerja mengikuti joget robot berhadiah saat duet Ketua PWI Sumut Drs Muhammad Syahrir dengan Winni KDI ditemani Ketua Komisi E DPRD Sumut Brilian Moktar, SE pada acara Halal Bi Halal PWI Sumut di Theme Park Pantai Cermin, Sabtu (9/10).

LAZ Peduli Ummat Waspada Buka Pendaftaran Beasiswa Mahasiswa Medan (Waspada): LAZ Peduli Ummat Waspada membuka pendaftaran Beasiswa Prestasi Angkatan XVII tahun 2010. Bantuan beasiswa ini diberikan kepada para mahasiswa-mahasiswi yang kurang mampu secara ekonomi tetapi memiliki prestasi akademi yang baik. “Beasiswa ini konsisten sejakYayasan Peduli Ummat didirikan tahun 2000,” ungkap Ir HP Simatupang. Menurutnya, tahun ini beasiswa tetap dibuka mengingat kondisi kebanyakan mahasiswa kesulitan dalam biaya pendidikan. Dikatakannya, untuk lebih memaksimalkan pemberian beasiswa pada tahap XVII ini, mahasiswa diberikan dana selama 6 bulan. “Boleh mengajukan perpanjangan khusus bagi mahasiswa yang nilai semester pertama dalam masa penerimaan beasiswa prestasi akademiknya tidak menurun. Kebijakan ini diambil agar kesempatan untuk menjadi peserta beasiswa lebih merata bagi mahasiswa yang berprestasi lainnya,” kata Simatupang. Saat ini sudah banyak alumni beasiswa LAZ Peduli Ummat Waspada yang sudah menjadi muzakki dikarenakan mereka sudah bekerja sebagai PNS, pegawai BUMN, dosen dan bekerja diperusahaan lainnya dengan kondisi yang mapan diantaranya di Bank Sumut, Bank Mandiri. Diharapkan dengan pembinaan intensif dan aplikatif dari para trainer dan dukungan bea pendidikan lebih banyak lagi alumni yang

berubah dari mustahik menjadi muzakki. Bagi yang lulus akan mendapat beasiswa Rp300.000/bulan dan pembinaan selama enam bulan. Syarat-syarat pengajuan permohonan, Beragama Islam, mahasiswa program sarjana (S1), maksimal semester 5 pada saat pengajuan dengan IP terakhir minimal 2.75 untuk eksak dan 3.0 untuk sosial, menulis surat permohonan dengan melampirkan, pas foto berwarna 3x4 sebanyak 2 lembar, fotokopi KTM 1 lembar, fotokopi Kartu Keluarga 1 lembar, surat keterangan dari fakultas tidak sedang menerima beasiswa, surat keterangan keluarga tidak mampu dari nazir masjid tempat tinggal orangtua, KHS 2 semester terakhir, membuat tulisan dengan judul “Aku sekarang dan 10 tahun mendatang” diketik komputer 1 halaman, kertas A4, 1,5 spasi. “Permohonan yang masuk menjadi milik panitia dan permohonan paling lambat diterima tanggal 22 Oktober 2010,” ujar Simatupang. Adapun tahapan seleksi, pendaftaran 11 s/d 22 Oktober, pengumuman lulus tahap I (Adm) Selasa, 26 Oktober, wawancara Kamis, 28 Oktober, pengumuman penerima bea-siswa Senin, 1 November, pembinaan perdana Sabtu, 6 November 2010. Tempat Pen-daftaran dan Informasi di LAZ Peduli Ummat Waspada Jl. Brigjend Katamso No. 1 Medan. Telepon. 061 – 4511936 ( jam kerja). (rel)

Nilai-nilai Pancasila Semakin Jarang Disosialisasikan MEDAN (Waspada): Gubernur Sumatera Utara Syamsul Arifin mengatakan, sarasehan tentang nilai-nilai Pancasila semakin jarang dilaksanakan sehingga dikhawatirkan menurunnya nasionalisme di kalangan generasi muda termasuk pelajar dan mahasiswa. “Padahal, Indonesia dengan menjadikan Pancasila sebagai palsafah negara memiliki sejarah panjang yang sangat berliku,” ujar Gubsu yang diwakili Kepala Kesatuan Bangsa Politik dan Perlindungan Masyarakat (Kesbanpollinmas) Sumut, Darwinsyah dalam sarasehan peringatan Hari Kesaktian Pancasila di Gedung Binagraha Pemprovsu, Kamis (7/10). Namun dengan keagungan dan kesaktiannya, Pancasila yang telah mengakar dan digali dari budaya bangsa tetap mampu berdiri kokoh sebagai palsafah negara. Salah satu tantangan yang sangat berat dalam mempertahankan Pancasila adalah pemberontakan Partai Komunis Indonesia (PKI) pada 30 September 1965. Pada masa itu, kata Gubsu, PKI melalui aksi yang sangat sadis dan tidak berperikemanusiaan untuk merubah Pancasila sebagai dasar negara. Upaya itu dilakukan PKI dengan cara mengorbankan putera-putera terbaik bangsa yang bertugas di militer seperti Letjen Ahmad Yani, Mayjen S Parman, Mayjen MT Haryono, Mayjen Suprapto, Brigjen DI Panjaitan, Brigjen TNI Sutoyo Siswomiharjo, Kolonel Sugiono dan Kapten Piere Tandean. Sebelum pemberontakan itu, PKI dan pendukungnya telah melakukan berbagai teror dan penganiayaan di berbagai daerah. Karena itu, seluruh elemen bangsa, khususnya kalangan generasi muda sangat diharapkan tidak melupakan sejarah kelam yang ingin melenyapkan Pancasila di tanah air tersebut. Salah satu upaya untuk mewujudkan harapan itu adalah dengan mensosialisasikan nilai-nilai Pancasila termasuk melalui sarasehan di kalangan generasi muda. “Dengan begitu, bahaya laten pengkhianatan terhadap Pancasila itu tidak terulang kembali,” kata Gubsu. Salah seorang peserta sarasehan, Mujahid,

mahasiswa Fakultas Ilmu Sosial Ilmu Politik Universitas Muhammadiyah Sumatera Utara (UMSU) mengatakan, rasa hormat generasi muda terhadap Pancasila berkurang karena pernah menjadi bagian dari “dosa politik” orde baru. Dia menyebutkan, meski menyadari sebagai ideologi bangsa, tetapi Pancasila lebih dijadikan alat politik semata bagi pemerintahan orde baru untuk memuluskan kepentingan penguasa pada masa itu. Ketika reformasi bergulir, muncul kebosanan dari generasi muda terhadap Pancasila karena tidak pernah diwujudkan dalam berbagai aspek kehidupan meski selalu disebutkan dalam setiap acara. “Realisasi Pancasila hanya ‘manis di bibir’ tetapi belum pernah dirasakan rakyat,” katanya. Peranan Pers Kalangan pers dinilai memiliki peranan yang cukup besar dalam melestarikan Pancasila, khususnya dalam melawan gerakan Partai Komunis Indonesia yang ingin merubah idelogi negara itu. “Peranan pers sangat besar, bahkan sebelum Gerakan 30 S/PKI itu berlangsung,” kata wartawan senior yang juga Humas Legiun Veteran RI Sumut, Muhammad TWH . Muhammad TWH mengatakan, “perang” yang dilakukan kalangan pers terhadap Partai Komunis Indonesia (PKI) dimulai sejak DN Aidit selaku Ketua Politbiro CC PKI pernah me-nyatakan Pancasila dapat saja tidak diperlukan lagi. Dalam kursus Kader Revolusi yang dilaksanakan di Jakarta pada 16 Oktober 1964, DN Aidit menyampaikan pidato bahwa Pancasila hanya alat pemersatu. “Jadi, Aidit menyimpulkan, kalau telah bersatu, Pancasila tidak diperlukan lagi,” katanya. Sejak saat itu, kata Muhammad TWH, hampir seluruh kalangan pers yang setia dengan Pancasila menyerang PKI melalui pemberitaan di media masing-masing. Tercatat puluhan surat kabar pada masa itu, seperti Revolusioner, Merdeka, Berita Indonesia, Sementara, Warta Berita dan Karyawan mempermasalahkan pidato DN Aidit tersebut. (m19)

KBPPP Diminta Jalin Komunikasi Bangun Citra Polri MEDAN (Waspada): Kapolsek Kutalimbaru AKP Bambang Rubianto, SH meminta Keluarga Besar Putra Putri Polri (KBPPP) agar menjalin komunikasi dengan berbagai organisasi kemasyarakatan (Ormas) dan elemen masyarakat lainnya dalam rangka membangun citra Polri di tengah-tengah masyarakat. “Di tengah citra Polri yang kini sedang diuji dengan berbagai peristiwa besar di Indonesia seperti aksi perampokan dan teroris, serta berbagai persoalan politik yang selalu menyeret peran Polri, tentu saja kehadiran Keluarga Besar Putra Putri Polri sangat membantu dalam mensosialisasikan citra positif Polri di tengah masyarakat,” ujar AKP Bambang Rubianto dalam pertemuannya dengan jajaran pengurus Kelurga Besar Putra Putri Polri (KBPPP) Resor 01 Medan, LBH Bhayangkara KBPPP Resor 01 Medan, Sibhara Resor 01 Medan, dan Sektor KBPPP Kutalimbaru, di ruang kerja Kapolsek Kutalimbaru, Rabu (5/10). Kapolsek menegaskan, pihaknya siap membantu Sektor KBPPP Kutalimbaru yang berada di wilayah hukumnya dalam rangka membangun citra positif institusi Polri dan keluarga besarnya. Karenanya, ia meminta kepada jajaran pengurus Sektor KBPPP Polri

agar selalu berkoordinasi dengan dirinya. “Tentu koordinasi yang berkaitan dengan penegakan hukum, kalau yang melanggar hukum saya tidak bisa bantu,” paparnya. “Sekarang ini kita tidak bisa lagi main-main dengan persoalan hukum, siapa saja yang salah ya harus dihukum. Lihat saja di media, seorang jenderal pun kalau salah dihukum,” terang Bambang Rubianto yang memiliki karir cemerlang di usia mudanya ini. Sebelumnya Ketua KBPPP Resor 01 Medan Syamsul Bahri menjelaskan, kedatangan mereka ke Polsek Kutalimbaru sekaligus melaporkan telah terbentuknya Sektor KBPPP Kutalimbaru dan tujuh pletonnya. Sebagai keluarga besar Polri tentu saja mereka sangat berharap kehadiran KBPPP Polri di Kutalimbaru bisa membantu peran serta Polri di tengah masyarakat. Turut serta bersama Ketua KBPPP Resor 01 Medan, Sekretaris KBPPP Resor Medan H Hermanto, Direktur LBH Bhayangkara Medan Drs Hasnul Amar SH, Kasat Sibhara Resor Medan Efendi Ginting, Danki Efendi Pardede, Ketua Sektor KBPPP Kutalimbaru Edi Suranta Ginting, Danton Sibhara KBPPP Kutalimbaru Sultan Silta Ginting, Ketua Sektor KBPPP Medan Baru Marno, dan jajaran pengurus lainnya.(cat)

Opini

B4

WASPADA Senin 11 Oktober 2010

Roadmap Menuju Kepsek Profesional Oleh Muhammad Yazid, SPd MAP Peta perjalanan (Roadmap) kepala sekolah profesional harus menjadi titik tumpu kepala daerah untuk peningkatan karier kepala sekolah tersebut

T TAJUK RENCANA

Sabar, Jaga Kesehatan Dan Konsentrasi Ibadah

P

rosesi pemberangkatan haji 2010 sudah dimulai Senin (11/10) siang ini dengan keberangkatan Kloter-1 dari Bandara Polonia, terdiri dari 445 calon jamaah haji (calhaj) asal Labuhanbatu. Satu hari hanya satu Kloter yang diberangkatkan. Sebelumnya mereka menginap satu malam di Asrama Haji Pangkalan Mashur, Medan. Tidak seperti biasa Kloter-Kloter awal menuju Madinah, tapi kali ini mereka langsung menuju Jeddah karena Bandara haji Madinah sedang dalam tahap perbaikan/renovasi. Dengan menggunakan bus besar rombongan akan melanjutkan perjalanan darat selama 4-5 jam menuju kota yang dibangun Nabi Muhammad SAW setelah hijrah dari kota Makkah. Setibanya di penginapan seterusnya bisa mengerjakan ritual ibadah shalat Arbain 40 waktu di Masjid Nabawi. Percayakan saja kepada petugas haji lokal, karom/karu mengurus kamar penginapan, koper-koper yang menumpuk karena bisa memakan waktu satu jam lebih. Biasanya, kalau penginapannya dekat dengan Masjidil Nabawi para calon haji banyak yang bergegas, langsung memasuki masjid yang dibangun Nabi SAW. Kondisi masjid Nabawi kini semakin indah, terawat, bersih, membuat siapa saja pasti terkagum dan bisa shalat sangat khusu’ di dalamnya. Di sini perlu diingatkan, catat dulu nama hotel tempat menginap selama 9 hari di Madinah, atau kenali pintu saat masuk masjid dan keluarlah di pintu yang sama agar tidak kesasar nantinya. Lebih baik berombongan, bisa dalam kelompok kecil lima atau 10 orang sekalipun tidak dalam satu regu. Tapi, bagi para calhaj yang usianya sudah lanjut di atas 50 tahun sebaiknya istirahat dulu sembari petugas menentukan kamar penginapan, manfaaatkan waktu istirahat dengan sebaik-baiknya agar saat terdengar panggilan shalat (azan) berikutnya, kondisi kita sudah fit. Jangan takut tidak bisa shalat Arbain karena panitia Intisari haji memang sudah menghitungnya. Ada kelebihan satu hari dari seharusnya delapan Madinah. Kuatkan niat beriba- hariDidiMadinah seluruh jamaah memperdah semata karena Allah, oleh makanan tiga kali sehari sehingga tidak perlu mengeluarkan uang perbanyak sabar, jaga jamaah sama sekali. Jangan jajan sembarangan. Di kesehatan terutama bagi penginapan tidak tersedia ember dan perauntuk mencuci maka belilah di pasar calhaj berisiko tinggi,raih- latan dekat penginapan, atau minta tolong ke lah haji mabrur petugas. Pokoknya seluruh kebutuhan jamaah; makan tiga kali sehari, transportasi, pengobatan ditanggung panitia haji, bahkan di sela-sela waktu luang nanti jamaah akan dibawa ‘’ziarah’’ mengunjungi tempat-tempat bersejarah guna menambah keyakinan dan ketakwaan kita kepada Allah SWT. Jangan ketinggalan, manfatkan dengan sebaik-baiknya beribadah dan ziarah ini. Memang dalam menjalankan ritual haji kita harus memperbanyak sabar. Terlalu banyak cobaannya sehingga kalau mengikutkan emosi saja, kebiasaan buruk selama di Indonesia, bisa menimbulkan pertengkaran di tanah suci, termasuk bagi pasangan suami-istri. Bahkan bisa-bisa terkena ‘’dam’’ saat bertengkar memakai pakaian ihram. Justru itu, perbanyak sabar, sabar, dan sabar. Ingat tujuan kita untuk ibadah, sehingga segala keegoan diri harus dihilangkan. Bertoleransilah dengan sesama teman sekamar, misalnya jangan terlalu lama menggunakan fasilitas kamar mandi yang terbatas. Jangan gara-gara kita orang lain (rombongan) harus menunggu terlalu lama di dalam bus dll. Begitu juga dengan para jamaah dari negara-negara lainnya di dalam masjid maupun di luar bersilaturahmilah. Khusus bagi para calhaj kategori berisiko tinggi (risti) diminta lebih ekstra hati-hati dalam menjaga kesehatan fisiknya agar dapat melaksanakan ibadahnya dengan lancar dan kondisi kesehatan tetap terjaga, prima. Apalagi prosesi ibadah di Madinah sama sekali tidak terkait dengan haji. Sangat disayangkan kalau sampai kesehatan jamaah sampai menurun saat selesai Arbain dan berangkat menuju Makkah tidak fit lagi. Sebab, prosesi haji seperti tawaf, sai, Arafah, bermalam di Musdalifah/Mina, sampai melontar tiga jumrah benar-banar membutuhkan kekuatan fisik. Untuk itulah kepada seluruh calhaj diminta untuk benar-benar konsentrasi dalam ibadah saja, jangan tergiur untuk jalan-jalan atau melakukan belanja yang tidak penting, apalagi memakan waktu dan tenaga dengan risiko kecopetan, kehilangan dokumen penting. Pergunakan waktu untuk ibadah dan ibadah semata, jauhi masalah duniawi sedapat mungkin selama mengerjakan ritual haji maupun Arbain. Manfaatkan waktu istirahat dengan cukup dan makanlah menu catering secara teratur, bergizi. Kalau badan terasa kurang fit atau sakit segera melapor ke petugas dan berobat ke dokter yang ada di Kloter dan kalau penyakitnya berat segera dibawa dengan ambulans ke rumah sakit rujukan. Dalam kaitan musim haji ini kita meminta panitia penyelenggara ibadah haji (PPIH) bekerja secara profesional dalam memberikan pelayanan kepada jamaah haji di tanah suci secara maksimal guna meraih haji mabrur. Intinya, pelayanan haji harus lebih baik dari tahun sebelumnya. Apalagi pemerintah sudah berpengalaman, rutin melaksanakannya, sehingga jangan sampai lebih buruk, apalagi kalau alasannya karena ONH tahun ini lebih murah Rp5 juta lebih dibandingkan musim haji tahun lalu.+

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN  Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817.  Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan hitam-putih Rp. 33.000,Halaman depan berwarna Rp. 90.000,Ukuran kolom: 40,5 mm E-mail Iklan: iklan@waspadamedan.com

ingkat pendidikan dan kesejahteraan Indonesia berada pada posisi ke-7 dari negaranegara di Asia Tenggara setelah Vietnam, menurut Human Development Index (HDI) yang dilansir UNDP tahun 2005. Ini merupakan sinyal sekaligus warning bahwa kita harus bangkit. Vietnam, negara yang terbilang baru “seumur jagung” mampu menyodok dan bertengger di atas negara kita. Problem ini harus cepat diberikan solusi bila kita tidak ingin kedodoron lebih dibawah Negara Myanmar , Kamboja maupun Laos . Sektor pendidikan menjadi domain prioritas untuk diperbaiki. Kementerian Pendidikan Nasional menjadi ujung tombak untuk mendisain pendidikan murah tapi berkualitas, karena sudah menyerap 20% dari anggaran APBN. Provinsi sampai kabupaten/kota menjadi penopang bangkitnya pendidikan kita, karena penggelontoran dana pendidikan juga mendekati angka 20% bahkan lebih dari APBD. Inovasi dan tingkat kreatifitas siswa umumnya di daerah terbilang rendah, mungkin ini disebabkan kurikulum kita terlalu padat sehingga jumlah mata pelajaran membludak. Siswa SD membawa buku tiap hari satu tas pundak, layaknya seperti tentara yang ingin ke medan perang. Belum lagi bergulir wacana pemberantasan korupsi, pendidikan karakter, budi pekerti dan masih banyak wacana-wacana lain juga ingin ditambah dan diramu dalam kurikulum pendidikan kita. Tidak terbayangkan jika wacana ini berubah menjadi kenyataan, mungkin siswa harus menjinjing dua tas seka-

ligus ke sekolah. Sekolah sebagai satuan pendidikan menjadi “pabrik” untuk menghasilkan produk siswa handal dalam menghadapi persaingan global. Tentu dibutuhkan seorang direktur yang memiliki quality control yang mampu menseleksi siswa yang layak jual di bursa tenaga kerja. Korelasinya siswa inovatif dan kreatif terlahir dari kepala sekolah yang mampu merancang sekolah inovatif. Setiap masuk gerbang sekolah siswa harus enjoy learning, jangan ada tekanan untuk memulai pelajaran. Peta perjalanan (Roadmap) kepala sekolah profesional harus menjadi titik tumpu kepala daerah untuk peningkatan karier kepala sekolah tersebut. Badan pertimbangan jabatan dan kepangkatan (Baperjakat) yang dibentuk di kabupaten/kota dalam hal rekrutmen kepala sekolah harus mempedomani peraturan menteri pendidikan No.13 tahun 2007 tentang standar kepala sekolah, yang implementasinya lebih lanjut dapat diatur di daerah—seperti teknik seleksi calon kepala sekolah, pengangkatan, penempatan dan pembinaan serta perpanjangan dan pemberhentian . Sekolah berbeda dengan jabatan struktural, ada fase-fase yang harus dilalui untuk menjadi kepala sekolah minimal harus memiliki kompetensi kepribadian, sosial, manajerial, supervisi dan kewirausahaan .

Menurut Drs Prasetyo Tri Atmojo, Kasubdis Tendik Kemdiknas, tiga tahap rekrutmen agar terbentuk roadmap menuju kepala sekolah profesional. Pertama, pola seleksi (lisensi) berupa administrasi, test potensi sampai fit and propertest. Kedua, pengangkatan, penempatan dan pembinaan meliputi cluster sekolah (SPM, SSN, RSBI, SBI) disertai dengan penilaian kinerja kepala sekolah. Ketiga, perpanjangan dan pemberhentian yang meliputi masa jabatan, perpanjangan atau pemberhentian dan pembinaan atau pengembangan karier. Roadmap kepala sekolah profesional dimulai dari proses penjaringan yang benar, yakni calon kepala sekolah minimal harus guru yang berprestasi ataupun berdedikasi. Karena guru ini yang memiliki lisensi untuk dicalonkan menjadi kepala sekolah. Lisensi merupakan standar kualilifikasi untuk menjadi pemimpin disekolah. Lisensi diperoleh melalui seleksi guru dan kepala sekolah berprestasi yang menjadi event nasional, atau melalui Lembaga Pengembangan dan Pemberdayaan Kepala Sekolah (LPPKS) Direktorat Jenderal Peningkatan Mutu Pendidik dan Tenaga Kependidikan (PMPTK). Lisensi tersebut akan dicatat didatabase nasional dan diberi nomor unik oleh Dirjen PM-PTK. Masa berlaku lisensi selama 4 tahun terhitung sejak diangkat menjadi kepala sekolah. Pembaharuan lisensi pertama apabila kepala sekolah mendapat nilai Baik (B) dalam penilaian kinerja selama bersangkutan bertugas. Sedangkan pembaharuan lisensi kedua bila yang bersangkutan memperoleh nilai kinerja Sangat Memuaskan. Kita harus memiliki keyakinan mampu bangkit dari style pendidikan konvensional, Human Develompment Index (HDI) Negara kita harus me-

rangkak naik. Sektor pendidikan membutuhkan roadmap menuju kepala sekolah profesional dengan menggelola sekolahnya dengan cara tidak kampungan. Sekolah memiliki MBS (manajemen berbasis sekolah) pergunakan jurus itu, pakai kebijakan partisipatif untuk membangun rasa memiliki sekolah oleh masyarakat. Untuk berani membuat kebijakan partisipatif kepemimpinan kepala sekolah harus kuat. Berani memberdayakan semua komponen dan komunitas sekolah. Kepemimpinan kepala sekolah yang kuat tampak pada kemampuan profesionalnya dan keberaniannya mengambil keputusan dengan perhitungan yang cermat, keputusan itu mendapat dukungan komunitas sekolah.Singapura dan Malaysia masih juara dan runner up HDI di Asia Tenggara, tingkat pendidikan dan kesejahteraan masyarakatnya sudah cukup kuat. Dasar ini mungkin yang menggugah keberanian Malaysia untuk memasuki tapal batas kita, baik di darat maupun maritim. Pendidikan kita masih kaku, tidak memiliki “taste” inovatif terhadap mutu lulusannya yang berdampak minim skill. Ijajah merupakan tujuan akhir, sedangkan parameter ketrampilannya terabaikan. Ini perlu perubahan, dengan keberanian pemimpin sekolah tentunya. Sekolah yang mampu bersaing dalam iklim global berdampak pada kualitas pendidikan. Tentu harus dikomando oleh pemimpin yang memiliki roadmap yang jelas. Tugas utama pemerintah adalah melakukan proses penjaringan kepala sekolah sesuai dengan kriteria dan peraturan perundang-undangan yang berlaku. Baperjakat kabupaten/kota harus jeli melihat reputasi dan prestasi. Hilangkan cara pandang suka atau tidak suka yang merupakan titisan penjajah. Bila lari dari koridor, tentu jawabanya pendidikan kita terus akan molor. Penulis Kepala Sekolah SMPN 3 Sibolga

Refleksi Mutu Pendidikan Di Sumut Oleh HM. Joharis Lubis Ukuran keberhasilan dan mutu pendidikan yang berhenti pada angka-angka ujian

S

ejalan dengan datangnya era reformasi dan otonomi daerah, perubahan paradigma di bidang pendidikan Indonesia telah banyak diperkenalkan, baik di lembaga pendidikan sekolah dasar dan menengah maupun di tingkat perguruan tinggi. Perubahan paradigma pendidikan yang diperkenalkan terjadi perdebatan para elite bangsa yang menempatkan persoalan ekonomi sebagai poros utama untuk perbaikan kehidupan bangsa, dengan berbagai mazhab dan pendekatannya. Namun, hampir tak pernah secara serius para politisi berbicara dan berdebat tentang grand design pendidikan sebagai poros utama perbaikan kehidupan bangsa dengan landasan filosofi dan kerangka pikir utuh tentang pendidikan. Mungkin hal itu karena pendidikan dipandang sebagai layanan yang tidak memiliki atau tidak perlu memedulikan filosofi dan keilmuan pendidikan. UU No. 20/2003 tentang Sisdiknas adalah rujukan normatif yang sarat dengan landasan filosofi dan keilmuan pendidikan. Persoalannya adalah apakah UU Sisdiknas telah dimaknai secara utuh dalam filosofi dan bingkai keilmuan pendidikan yang tepat, sehingga melahirkan kebijakan dan regulasi pendidikan secara utuh yang mengalir ke dalam penyelenggaraan pembelajaran yang mendidik di sekolah? Orang bicara karakter bangsa, demokrasi, mutu sumber daya manusia, daya saing, dan sebagainya, semuanya menyisakan persoalan, dan pendidikan acap kali menjadi bahan tudingan. Mari kita melakukan kontemplasi terhadap apa yang kita lakukan selama ini. Esensi pendidikan menurut Pasal 1 (1) UU Sisdiknas memosisikan peserta didik sebagai “pemikir” yang harus aktif mengembangkan potensi diri dan mencari makna dari dunianya. Di balik ayat ini terkandung sebuah pemahaman mendalam tentang proses belajar peserta didik yang berimplikasi kepada pembelajaran yang harus membangun nilai-nilai diskusi, kolaborasi, dan memaknai pengetahuan secara kultural yang berbeda dari pengetahuan secara personal, membangun “intersubjektivitas” yang memungkinkan orang paham akan apa yang terjadi pada orang lain. Ukuran keberhasilan dan mutu pendidikan yang berhenti pada angkaangka ujian, menurut filosofi dan makna pasal dan ayat yang disebutkan,

adalah kemunduran karena pembelajaran akan hanya menjadi proses menguasai keterampilan dan mengakumulasi pengetahuan. Paradigma ini menempatkan peserta didik sebagai pembelajar imitatif dan belajar dari ekspose-ekspose didaktis yang akan berhenti pada penguasaan fakta, prinsip, dan aplikasinya. Mengawali tugasnya sebagai Menteri Pendidikan Nasional, Mohammad Nuh melempar dua wacana penting, masalah integrasi evaluasi pendidikan dan pentingnya mendesain pendidikan yang mampu membentuk karakter budaya. Bukan sekadar membentuk siswa menjadi individu yang santun, tetapi juga memiliki keingintahuan intelektual yang bermuara pada keunggulan akademis. Integrasi pendidikan dan pembentukan karakter merupakan titik lemah kebijakan pendidikan nasional kita selama ini. Jika dua hal ini ingin menjadi sasaran Mendiknas, mau tidak mau harus berani mengkritisi kembali aneka macam kebijakan pendidikan yang telah lalu. Ada beberapa kebijakan pendidikan warisan Mendiknas sebelumnya yang harus ditelaah kembali karena tidak didasari sikap pikir jangka panjang, tetapi hanya untuk memenuhi kebutuhan reaksioner sesaat. Kebijakan Mendiknas sebelumnya mengundang keprihatinan, seperti Pertama, perubahan kebijakan proporsi pendidikan untuk menciptakan lebih banyak sekolah menengah kejuruan (SMK) dibandingkan dengan sekolah menengah atas (SMA) dengan rasio 70-30. Kebijakan ini amat reaksioner, tidak memerhatikan kepentingan jangka panjang kebutuhan nasional bangsa akan lahirnya generasi peneliti dan tenaga-tenaga terdidik secara akademis. Kedua, perubahan proporsi kebijakan ini tidak didasari cara berpikir integral, bukan hanya tentang keberlanjutan kompetensi akademis, tetapi juga pemahaman akan fungsi evaluasi itu sendiri. Ketiga, pembentukan karakter bangsa dalam konteks pendidikan harus bermuara pada keunggulan akademis. Tugas utama sekolah adalah membentuk anak-anak yang cerdas, pintar, kritis, yang mampu memahami tatanan sosial masyarakat menjadi lebih baik sehingga mereka mampu terlibat secara aktif dalam kehidupan masyarakat. Grand design pendidikan merupakan skenario dalam menuntun bangsa ke jalan nilai-nilai moral dan spiritual,

mengasuh dan mendidik warga negara menjadi bertanggung jawab atas kemaslahatan masyarakat, dunia, dan lingkungan alamnya, mewujudkan warisan nilai-nilai keadilan, keharmonisan, dan kesehatan lingkungan, serta mengembangkan nilai-nilai kerja keras, kebermutuan, dan kejujuran sebagai faktor yang akan melengkapkan kesuksesan ilmu pengetahuan dan teknologi dalam membangun daya saing bangsa. Harapan ke depan, penyelenggaraan pendidikan lebih berpijak kepada landasan filosofi dan mind set utuh pendidikan sebagaimana diamanatkan UU Sisdiknas. Pendidikan perlu kembali kepada khitahnya. Grand Design Pendidikan Provinsi Sumatera Utara yang telah disusun menurut Bahrumsyah tertuang dalam sepuluh terobosan pendidikan Sumut dan enam kebijakan Disdiksu. Sepuluh terobosan itu adalah memberikan bantuan bersubsidi kepada sekolah, memberikan bantuan untuk kesejahteraan pendidik, melakukan manajemen berbasis digital, melakukan pengembangan bahan ajar dan bahan uji berbasis informasi teknologi (IT) dan komunikasi bagi pendidik untuk semua jenjang pendidikan. Bahwa sebuah model pendidikan secara filosofis dan axiologis, orientasi yang dikembangkan adalah untuk menciptakan lulusan (out-put dan out-come) yang tidak tergantung (menggantungkan hidupnya) kepada pihak lain, baik kepada orang tua, masyarakat atau negara. Pendidikan didesain untuk menciptakan manusia yang mandiri, baik secara mental, emosi, intelektual, dan ekonomi. Menurut hemat saya ada 3 isu yang perlu dibangun dalam grand design pendidikan yakni: 1) Pengembangan Ilmu Dasar, Matematik dan Skolastik. Setiap orang harus memiliki ilmu dasar seperti kecakapan berhitung, membaca, dan menulis. Karena ini adalah alat dasar yangutamabagisetiaporanguntukbelajar lebihlanjut.Olehkarenaitu,setiaplembaga pendidikan dasar memiliki kewajiban untuk menuntaskan pengetahuan dan keterampilan tersebut kepada setiap pelajar Indonesia. Dengan kemampuan skolastik dan ilmu dasar lainnya termasuk matematikasetiaporang(pelajar)memiliki landasan untuk melanjutkan level pendidikan dan materi pelajaran ke jenjang dan tahap yang lebih tinggi. 2) Pengembangan ilmu Manajemen Modern. Pada sisi lain, lembaga pendidikan kita harus juga menghasilkan output yang memiliki pengetahuan, wawasan dan keterampilan manajemen modern. Ini merupakan pengetahuan dan keterampilann yang memungkinkan berbagai potensi ilmu pengetahuan, kreativitas, dan inovasi terwadahi dan menghasilkan sesuatu

produk yang bernilai ekonomi. Dengan kemampuan manajemen modern berbagai konsep ilmu pengetahuan dapat dikelolah dalam konteks ‘knowledge management, pendekatan sistem, dan bisnis. Melalui manajemen modern dimungkinkan bakat kreativitas seni, dan science, teknologi dikelolah hingga menghasilkan sesuatu yang bernilai ekonomi. 3) Pengembangan Keterampilan kerja. Untuk mengatasi pengangguran terpelajar dan tingkat kemiskinan yang masih besar jumlahnya di tanah air, maka pengembangan pendidikan berorientasi keterampilan kerja sangat relevan. Hal ini untuk sebagian orang akan terlihat pragmatis, tetapi secara rasional adalah solusi yang masuk akal. Banyak pelajar yang tamat universitas dengan berbagai macam gelar tidak memiliki kecakapan kerja yang relevan dengan dunia industri. Di sisi lain mereka juga tidak memiliki basis pengetahuan, keterampilan dan pengalaman enterpreneur untuk berwira usaha. Mereka inilah yang harus dipikirkan untuk diselamatkan oleh negara. Penulis adalah Dosen FBS-Unimed dan Ketua Konsultasn Pendidikan Indonesia (KoPIndo)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik

SUDUT BATUAH * Kadis Kesehatan sidak Puskesmas malam hari - Ini namanya pejabat bertanggungjawab * Mobil mewah Jepang serbu Indonesia - Makin sesak jalanan kota awak! * Tahun depan saat beli rumah, BPHTB turun - Turunpun BPHTB, kalau kantong cekak sama saja!

oel

D Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedek Juliadi, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), Nurkarim Nehe, Bustami Chie Pit, Sapriadi (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Balyan Kadir Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Sori Parlah Harahap (Gunung Tua), Idaham Butarbutar, Syarif Ali Usman (Sibuhuan), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Opini

WASPADA Senin 11 Oktober 2010

Harimau Sumatera Oleh Rosihan Anwar

P

ADA bulan April 2009, setelah membaca sebuah berita Associated Press (AP) dari wartawannya Zakki Hakim yang mengunjungi Sungai Galam di propinsi Jambi, saya tulis artikel mengenai terancam punahnya harimau Sumatera. MenurutWorldWildlife Fund, jumlah harimau yang pada tahun 2009 hidup liar di daerah tadi adalah tinggal 250 ekor, berbanding dengan sekitar 1000an ekor tahun 1970an/ Omo berarto PantheraTigris Sumatera bisa menjadi predator besar pertama, binatang memakan mangsa binatang lain, yang bakal punah di abad ke-21 ini. Akibat tebang pohon secara tidak sah, akibat makanan harimau berkurang, maka harimau menjadi agresif. Binatang itu memakan otak, jantung dan hati manusia yang diterkamnya. Menurut penangkap harimau, jarang sekali binatang itu memakan manusia. Bila dibunuhnya manusia, lazimnya mayat ditinggal begitu saja. Jadi bila harimau mulai memakan manusia, itu tanda keadaan telah gawat. Bayangkan, akibat illegal logging sepertiga luas hutan di Indonesia telah rusak. Kerugian yang diderita negara 180 miliar dolar AS. Lingkungan hancur berantakan. Habitat harimau di Sumatera merosot tajam. Tiap tahun 270.000 hektar tanah rendah hutan dibersihkan untuk dijadikan onderneming kelapa sawit. Dengan tibanya para para penebang kayu haram, dengan dibukanya perusahaan pertambangan di daerah hutan, makin terdesaklah kehidupan harimau. Kandag-kadang harimau dibunuh oleh penduduk kampung yang ketakutan. Lain kali pemburu gelap datang membunuh karena satu ekor harimau yang mati bisa dijual dengan harga 3.300 dolar AS. Tulang belulang harimau merupakan unsur utama dan penting dalam dunia pengobatan China klassik. Rata-rata menurut sebuah laporan Departemen Kehutanan antara 5 dan 10 ekor harimau Sumatera dibunuh tiap tahun sejak 1998. Dapatkah keadaan ini dihentikan ?Wallahu’alam. Demikian tulisan saya tahun yang lalu. Persis satu tahun kemudian April 2010 wartawan International HeraldTribune Norimitshu Onishi menulis pula tentang harimau Sumatera. Dia menulis dari Balimbing. Di sana dia melihat dua ekor harimau Sumatera yang sudah berada dalam kurungan. Harimau berdua itutelahmembunuhdelapanorang.Berbedadenganmacanyanghidupdalamkebunbinatang dan tampak sudah dijinakkan, kedua harimau tadi masih galak dan liar, mengaum dan memberontak. Tapi dikandung maksud oleh kaum pelestarian alam untuk pada satu ketika nanti mengembalikan harimau yang ditangkap agar hidup di hutan liar. John Seidensticker seorang pakar (expert) harimau dan kepala Pusat Pemeliharaan Ekologi di Smithsonian Conservation Biology Institute diWashington mengatakan sampai belum lamaberselang yangdisebutconflict-tigeraatauharimau-harimaubersengketatelahditangkap, lalu sederhana saja dimasukkan ke dalam kebun-kebun binatang di Indonesia. Begitu banyak jumlahnya, sehingga kebun binatang penuh dengan harimau. Tahun yang lalu dia mengunjungi daerah di Sumatera. Dia bilang masih terlalu dini mengetahui bagaimana keadaan harimau-harimau yang dikembalikan hidup di hutan liar. Cuma satu program jenis ini terdapat di tempat lain.Wildlife Conservation Society telah membebaskan dan memantau keadaan lima ekor harimau Amur di daerah Timur Jauh dari negera Rusia dalam dasa warsa yang lalu. Hasilnya bermacam-macam. Dua ekor macan Amuritutetapberadadekatpemukimanmanusiadanpadaakhirnyaditangkapolehpenduduk. Seekor lagi kembali ke dalam hutan liar, tapi juga diburu secara gelap dan ditangkap. Harimau keempat terlepas rantai lehernya, setelah sepuluh bulan.Yang kelima dibebaskan bulan Januari 2010 ke hutan dan kini tengah dimonitor gerak-geriknya. Di Balimbing Sumatera para karyawan berusaha membentuk kembali keadaan harimauharimau tadi, kebanyakan melalui isolasi atau pengasingan. Dengan begitu mereka hidup seterusnya dengan takut terhadap kehadiran manusia dekat lingkungan mereka. Sumampau direktur kebun binatang paling populer dariTaman Safari Indonesia dan memelopori program rehabilitasi atau mengembalikan harimau ke dalam kehidupan di hutan liar di Balimbing mengatakan“Harimau secara naluri menjauh dari manusia, akan tetapi macan bersengketa atau conflict-tiger telah kehilangan ketakutan terhadap manusia.Satu kali harimau-harimau menewaskan manusia, maka binatang-binatang itu menyadari bahwa kita sebagai manusia tidak ada apa-apanya”. Pada bulan Juli 2008, pusat pemeliharaan harimau di Balimbing membebaskan dua ekor harimaunya yang pertama. Kedua harimau itu jenis jantan. Penduduk desa percaya binatang itu telah membunuh manusia. Harimau itu dipakaikan rantai leher yang membawa alat-alat penelusuran GPS. Kalung leher itu memberikan sinyal-sinyal kepada orang-orang yang memantau di pusat pemeliharaan harimau. Satu harimau telah mewujudkan sebuah wilayah yang terletak di dalam daerah pelestarian di bagian utara. Sedangkan macan yang lain telah bergerak lebih jauh ke utara ke Bukit Barisan Selatan National Park yang letaknya perbatasan, demikian kata Sumampau. (+++)

Dedi Sahputra

Foliopini

dedisahputra@yahoo.com

Putri Lucu Nadine Alexandra Dewi Ames tentu berbangga. Tidak seperti Artika dulu, ajang Putri Indonesia kali ini berlangsung mulus tanpa demo dan aksi-aksi penolakan. Dia bahkan mulus menjadi pemenang meski gagap berbahasa Indonesia dan salah dalam menjawab pertanyaan juri. Maka tidak lama nanti dia akan melenggak-lenggokkan tubuhnya dengan pakaian minim di hadapan jutaan pasang mata dari seluruh dunia. Aksinya itu di tengah air mata banjir Wasior yang belum surut, di tengah kekecewaan rakyat karena Timnas dibantai Uruguay, di tengah isu Jakarta yang bakal kelelep,di tengah tatapan kosong orang-orang miskin. Anda mungkin masuk golongan yang berkata seperti ini: ‘’Anda jangan berbicara soal moralitas dalam persoalan missmiss-an ini, terlambat. Tidak cukup berbicara moral jika hanya pada soal ini, buat apa masalah miss universe atau Putri Indonesia diprotes. Seolah-olah baru pagi ini ada maksiat terjadi di Indonesia. Padahal jika kita mau jujur, maksiat sudah tiap hari ada.Wanita tonjolin aurat ya ada di mana-mana, kita diam saja. Korupsi triliunan didiamkan.Eh,ada Putri Indonesia atau miss universe diprotes. Kayak kaget aja lihat maksiat.’’ Kalau Anda berpandangan seperti itu, saya ingin katakan, sepertinya Anda benar. Sepertinya berbicara soal moral pada ajang pemilihan miss seperti sudah gak jaman lagi. Sudah capek-lah, seperti gak ada urusan lain lagi aja. Lebih bagus lagi ngurusi koruptor yang merugikan orang banyak itu. Sepertinya toh kaum Muslimin yang biasa menentang, saat ini tidak lagi terdengar suaranya, walaupun jelas-jelas si miss ini bakal pamer aurat lagi. Mungkin mereka juga berpandangan sama, sudah berkalikali dikasih tahu, gak mau dengar juga, ya sudah sak karepe dewe. *** Sedang asik menyaksikan acara itu, tiba-tiba penonton di sebelah saya bergumam,”Kok gak ada kontes untuk putra Indonesia ya. Kenapa putri-putrian gini aja yang dikonteskan,’’ tanyanya tanpa alamat. “Lha ini-kan kontes kecantikan, mana ada sih laki-laki yang cantik,” sahut penonton lain. “Inikan cuma kontes pamer “daging” wanita, “daging” lakilaki mana laku,’’ sambungnya. “Ah, jangan sinis begitu. Ini bukan cuma kontes kecantikan, tapi juga kepintaran. Lihat saja banyak yang pintarpintar, ada yang dokter, ada yang pintar

berbahasa Inggris, bahasa Prancis, ada juga yang memiliki IPK terbaik di fakultas Hukum UI,” si penanya tak mau kalah. “Masa sih. Apa ada putri Indonesia yang gak cantik, bagaimanapun persepsi anda tentang cantik itu. Apa ada gadis dari kampung, yang datang dari keluarga sederhana tapi pintar berbahasa asing, punya wawasan luas yang jadi putri Indonesia. Apa ada? Ini tidak lain cuma pamer kemapanan, di tengah kemiskinan dan ketidakmampuan, pamer kecantikan di tengah kejelekkan dan pamer kepintaran di tengah kepandiran,’’ orang itu terlihat emosi dan debat itu terus berlangsung. *** Benarkah semua Putri Indonesia itu pintar-pintar? Ataukah mereka justru lucu-lucu? Saya jadi senyum sendiri mengingat tulisan yang saya baca itu. Begini ceritanya. Ketika Putri DKI yang jadi juara itu sedang menghadapi juri dalam wawancara. Juri: Siapakah tokoh idola anda..? Putri DKI: Karena saya sangat mencintai Indonesia, tokoh idola saya juga orang Indonesia yaitu Tuanku Imam

Bonjol. Kalimat itu mantap diucapkan, dengan intonasi teratur tekanannya, meluncur singkat dan deras bak air bah, hingga memesona para juri. Juri: Kalau begitu, anda pasti tahu kapan Tuanku Imam Bonjol wafat? Jawaban si putri kemudian sangat di luar dugaan, dia kaget hingga membuat para juri juga dibuat kaget,’’Apaaa…, Meninggalll..? Innalillahi…” Tentu saja kaget. Respons seperti itu benar-benar tidak disangka oleh siapapun yang hadir malam itu, termasuk oleh para penonton di rumah. Apa benar dia tidak tahu waktu meninggalnya Tuanku Imam Bonjol, orang-orang bertanya. Tapi tidak begitu dengan si putri. Dia justru merasa bersedih mendengar kabar wafat idolanya tersebut. Diapun mengcross-check kabar itu kepada putri dari Sumatera Barat. ‘’Uni, benarkah Tuanku Imam Bonjo sudah wafat?” tanyanya kepada koleganya itu. “Lho, kan sudah lama mbak,’’ kata Putri Sumbar ini dengan mata penuh selidik. “Ooo, sudah lama ya. Kok saya belum dengar ya. Kapan sih uni?’’ tanyanya lagi. “Mungkin sekitar 1830 mbak,’’ jawab Putri Sumbar “Haa.., 18.30? Habis Magrib dong,’’ sambutnya.

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

B5

Terorisme Dan Perampokkan Oleh Dr Ir Satia Negara Lubis, Mec Terorisme tentu saja berawal dari kegilaan dan kegelapan wajah Barat untuk mengawasi pergerakan wajah masyarakat dunia

K

etika pendeta setengah gila dan kelompoknya yang tidak beradab dengan gagah berani mengoyakngoyak Kitab Suci Alquran, tidak satupun tokoh umat Islam berkomentar tentang radikalismepadakelompoknonmuslimyang secara telanjang menghina secara nyata dan sadis terhadap Islam. Mereka yang biasanya rajin memberi komentar selama ini tentang aksi terorisme yang dilakukan oleh teroris yang notabenenya kelompok Islam, saat itu tiarap dan minder untuk bersuara lantang tentangmappingterorismediluarjihadIslam. Mereka seoalah kaget dan malu dan tertampar wajahnya melihat perbuatan tercelayangdillakukanolehkelompokradikal tersebut. Ketika perbuatan biadab yang dilakukanolehterorisyangmengoyak-ngoyak Alquran itu dilakukan, TV swasta (TV One dan Metro TV) yang biasanya rajin sekali membahas terorisme ala Jamah Islamiyah aliaskelompokOsamaBinLaden,jugasenyap tidak memberikan jam tayang khusus. Berita itu seperti senyap-senyap saja padahal ada luka mendalam di hati umat Islam. Mereka seperti tidak mengetahui bahwa terorisme itu sedang terjadi di belahan dunia lain dan dilakukan bukan oleh mereka yang berjenggot, berjubah atau guru mengaji. Tentu saja kita maklum. Mungkin pengamat itu hanya mengetahui tentang aksi terorisme dengan merujuk pada persfektif Barat yang memang hanya menyoroti terorisme kelompok Islam fundamentalis (istilah Barat). Atau mungkin juga karena pengamatterorisselamaini hanyasekedarmencari perhatian publik dunia yang memang menciptakansuasanasesuaidenganskenario yang mereka buat, dan mereka mencari popularitas dunia karena pengen mendapat

applause. Tentu saja kita maklum kalau TV swasta tidakmemberikanruangkhususuntukmembahas pemarjinalan kelompok Islam di beberapa negara Amerika dan Eropa termasukterorisyangmelakukanpengoyakankitab suciAlquran.Karenajika merekamemberikan ruang penayangan seperti biasa maka tidak akanadasatuiklanpunyangakanmenspomsori acara itu. Maklum nyawa TV swasta tergantung iklan. Terorisme tentu saja berawal dari kegilaan dan kegelapan wajah Barat untuk mengawasi pergerakan wajahmasyarakatdunia. Kegelapan pertama adalahambisimereka yang terlalu besar untuk menguasai perdagangan dan perekonomian dunia (khususnya negara Islam yang kaya). Kegelapan kedua adalah pencapaian titipan hasrat dari kelompok Zionis untuk menerapkangrandstrategikekuasaantunggaltanpa kompromi dimama atas nama Zionis semua perlakukan kekerasan dapat dibenarkan dengan syarat sesuai dengan rencana jahat. Dua wajah gelap itu adalah satu yaitu keinginan untuk menguasai dunia (New Liberalism, New Colonialism dan New Democracy) dengan cara apapun termasuk propoganda, tipuan dan pemutarbalikan fakta, standar ganda dll. Dan hal ini pulalah yang mendapat perlawanan dimana-mana khususnya di negara Islam Anehnya, perlawanan terhadap propaganda Barat juga terpecah menjadi dua bagian. Pertama perlawanan semu atau perla-

wananterhadapkebijakanglobalBarat tetapi sumbernya tetap pada api yang sama yaitu tipuanBaratsendirikepada masyarakatdunia untuk mendeskreditkan kelompok tertentu yangdipilihnyasendiri.SehinggaBaratleluasa menancapkan kuku-kuku racunnya lebih dalam kepada negara yang ingin dikuasai. Kedua, perlawanan sejati, yaitu mereka yang menganggap bahwa Barat telah berusaha memarginalkan Islam beserta akidahnya, sehingga perlu mendapat perlawanan dengan cara jihad. Maka kedua kelompok ini sebenarnya hampir sama tetapi berbeda, hampir beda tetapi sama. Tertembaknya belasan gerombolan perampok di beberapa tempat di Serdang Bedagaibaru-baruinisungguhmerupakanprestasi besar bagi aparat Polri yang secara tangkas dapat membasmi mereka dengan batuan masyarakat. Namun, TV One memberi judul produk beritanya dengan judul “MemburuTerorisme”. Artinya TV Onememaksamasuk untuk menyamakan tindakan kelompok bersenjata yang dianggap oleh Kapolda sebagai kriminal adalah bagian integraldariaksiterorisme.Tentusaja,pemirsa menjadi bertanya-tanya benarkah bahwa yang tertembak itu jaringan terorisme yang dalam menjalankan aksi terornya melakukan pencuriandanperampokan?Ataukahmereka hanya kelompok perampok bersenjata dan sama sekali tidak paham istilah jihad? Selama ini, entah kebetulan berjenggot lalu terlibat peledakan bom dimana-mana entah pula karena setiap bomber yang termasuk dalam kelompok teroris adalah berjenggot.Terlebih lagi mereka yang tertangkap rata-rata berjengkot dan memiliki pengetahuan yang cukup tentang jihad Islam (istilah mereka) serta mereka telah lama bertempur di Afganistan dan Moro.Tak pelak lagi jenggot mereka dikaitkan oleh Barat dengan teroris-

me. Pertanyaannya adalah, mengapa mereka mengumpulkan dana dengan cara merampok dan membunuh security? Cukup banyak ayat di dalam Alquran mengharamkan perampokan dan pembunuhan.Perampokandianggapsebagaibentuk kejahatan yang dapat membuat manusia yang dirampok menjadi sengsara karena stress dan miskin. Sedangkan pembunuhan bentukotoriterseseorangyangdengansengaja menghilangkan nyawa orang lain yang bukan haknya. Kedua kegiatan ini sangat jelas ancamannya di dalam Alquran karena mereka akan mendapat tempat yang sangat pedih di kemudian hari. Bingung deh, dapatkah dua kutub yang sangat berbeda dipersatukan dalam satu gerakan. Mungkinkah pada satu sisi mereka melakukanperbuatanbiadabtetapipadasisiyang lain mereka menggangap sedang melakukan jihad untuk mengejar pintu surga? Anehkan? Islam dengan tegas menjawabnya, tidak mungkin! Perampokan dan pembunuhan adalah perbuatan tercela yang menyalahi konsep dasar Islam sebagai agama yang RahmatanLil‘Alaminataumemberirahmatpada semua alam semesta (semua makhluk yang hidupmaupunyangmati).Sehinggaperbuatan merampok dan membunuh jelas-jelas jauhsekalidarikonsepIslam.Sedangkanjihad bentuk-bentuk aturannya secara terang benderang diungkapkan dalam Alquran. Tidaksatualasanpunyangdapatmenjadi argumen kita bahwa perampok dan pembunuh itu adalah bagian dari mereka yang mengerti tentang Islam. Penutup Bagaimanapunterorismeadalahkejahatan dan itu berbeda dengan konsep jihad dalam Islam. Tidaklah mungkin mengaduk kejahatan dengan kebaikan menjadi satu perbuatan atas nama kemuliaan.Terorisme tidak dikenal dalam kamus Islam, karena bentuk kejahatan itu berlaku pada hati yang keji bukan pada kemuliaan yang dikedepankan dalam pandangan Islam. Penulis adalah Dosen USU

Berita Teroris, “Dosa” Atau Agenda Media ? Oleh Hari Murti, SSos Pertanyaanya, jika dimasukkan unsur sensasi, apakah media kehilangan independensi dan profesionalitasnya?

B

agussekalitulisanRumAhmadYusuf di kolom “Opini” Harian Waspada yang berjudul Menyoal Sensasi Berita Terorisme. Inti yang saya tangkap dari tulisan Rum adalah ia menggambarkan mediamassatelahmelakukan“dosa” dengan memasukkan unsur sensasi dalam pemberitaan terorisme, yang bisa berdampak luas bagi masyarakat. Dalam persfektif etis pemberitaan,Rummenilaipemberitaanterorisme oleh media perlu dipersoalkan. Dalam ilmu jurnalistik, independensi media massa dalam menyampaikan fakta adalah harga mati. Pemberian sensasi bisa merusak independensi tersebut sehingga media massa bisa dianggap tidak profesional. Wartawan, seperti yang ditulis Rum, dalam menyajikanberitakriminalcenderungmembumbuiberitadenganunsurdramatisasidari wartawan. Dalam etika jurnalistik, ini perlu dipertanyakan. Namun dalam pemberitaan tentang terorisme, perlu ada sudut pandang lain, yang sudut pandang tersebut juga masih bisa dipertanggungjawabkan secara ilmiah komunikasi. Pemberitaan yang sensasional dianggap sebagai“dosa” media karena sudut pandang yang digunakan adalah teori jarum hipodermik, yang mengasumsikan bahwa audience hanya pihak yang pasif, yang siap melakukan apa saja sesuai pesan yang diterima. Dalam hal ini, media massa dianggap abai dalam hal ekses informasi. Ekses itulah kemudian menjadi “dosa” media. Teori ini terlalu banyak dikritik dengan teori juga. Contohnya adalah model uses and gratification, yang menyatakan media massa sebenarnya hanya pemuas akan jenis-jenis informasi yang diingini audience. Bahwa di dalam diri audience ada filter yang selektif terhadap informasi.

Agenda media Dari kacamata teori komunikasi dan kebutuhan rill masyarakat kita, sebenarnya pemberitaan media tentang terorisme yang intensif dan sensasional itu masih bisa dibenarkan. Dari persfektif teori, misalnya, ada teori agenda setting yang menggambarkan media massa bisa membentuk apa yang menjadi agenda publik, kemudian agenda publik berkembang menjadi agenda kebijakan. Agenda kebijakan itulah kemudian yang disebut sebagai perang melawan terorisme. Bahwa kita sepakat terorisme adalah musuhdanharusdiperangi,termasukolehmedia massa. Perang melawan terorisme adalah kebutuhan yang riil dan memang diingini oleh hampir semua unsur masyarakat. Inilah sebabnya mengapa warga Serdang Bedagai membantupolisidanTNIdalammenangkap tersangka teroris itu. Kalau media massa tidak mengagendakansecaraintensifpemberitaan tentang penyerangan kantor polisi, rasanya warga juga tidak waspada terhadap orangorang yang mencurigakan. Pertanyaanya, jika dimasukkan unsur sensasi, apakah media kehilangan independensi dan profesionalitasnya? Jelas tidak. Media dianggap tidak independen dan tidak profesionalapabilaiaselalusinkronatauselalu oposisi dengan agenda apapun dan dalam situasi bagaimanapun. Perang melawan teroris adalah agenda kita semua, yang salah satuprajuritnyaadalahmediamassa.ingatlah bahwa di jaman komunikasi global, komunikasi media massa adalah sama esensialnya dengan senjata di perang moderen. Itu kata Dan Nimmo dalam Political Communication and Public opinion in America. IndikasibahwamediamassadiIndonesia cukup profesional dan independen adalah

ia tetap mengambil posisi kontra ketika pemerintah membuat kebijakan yang kontroversial,misalnyamenaikkanhargaminyak. Kalau melawan teroris, semua sumber daya memang harus dikerahkan. Selain itu, tidak satu pun unsur dari negara ini, baik itu rakyat, pemerintah, maupun wilayah yang berkeberatan dengan perang melawan teroris itu, termasuk media massa sendiri. Sebagai ilustrasi, kalau Indonesia berperang dengan negara lain dimana jurnalisme perang harus diterapkan,apakahpenyampaianfaktasecara deskriptif tentang kekalahan kita oleh media massa masih dianggap sebagai wujud dari profesionalisme media? Dari sisi topik pemberitaan, tampaknya harus dibedakan antara berita kriminal dengan berita terorisme. Meskipun kedua bentukitusama-samamengancamjiwamanusia, tetapi konteksnya jauh berbeda. Pelaku kriminal,perampokanmisalnya,bisadibedakan apa motifnya oleh petugas polisi, apakah kriminal murni atau ada motif yang lebih besar. Maka, agak kurang pas jika menilai berita terorisme dari persfektif bagaimana seharusnya berita kriminal. Sebuah topik pemberitaan dikatakan sebagai agenda media apabila topik tersebut dipublikasikan secara sangat intensif dalam satu satuan waktu tertentu. Mengacu kepada pengertian agenda tersebut, maka sebenarnya ada banyak topik yang menjadi agenda media massa, seperti misalnya berita tentang korupsi selama ini. Sayangnya, berita ini tidak dibatasi masa waktunya oleh karena memang kebutuhannya seperti itu. Maka, penyergapan yang diekspos oleh mediaselama18jamitumasihbisadikatakan sebagai agenda media massa. Kalau media massa tidak mengagendakan pemberitaan selama18jamtersebut,kewaspadaanmasyarakat mungkin kecil saja. Lalu, bagaimana dengan fungsi media sebagai pengawas lingkungan. Di sini, media massa dalam posisi yang dilematis. Robert K. Merton dalam bukunya yang

berjudul Sosiologi Komunikasi Massa memang menjelaskan tentang fungsi nyata dan disfungsi tersembunyi dari berita-berita kekerasan di media massa. Menurutnya, memangadadisfungsilatenataueksesdaripemberitaan. Misalnya, berita tentang perampokanakanmembuatorangmenjaditakutkeluar rumah atau justru sebaliknya, melakukan imitasi. Hanya saja, apa yang dijelaskan oleh Robert mengenai ekses pemberitaan ini terbatas apa yang disebut kekerasan atau kriminal murni. Dalam hal “kekerasan” yang dilakukan oleh petugas penegak hukum untuk mempertahankan atau bela negara, maka hampir tidak ada yang menyebut hal tersebut sebagai kekerasan. Contoh, film perang merebut kemerdekaan, di sana banyak adegan keras seperti menembak, mengebom, menyandera, atau bahkan tentara yang sedang meregang nyawa, tidak ada yang menyebut itu sebagai film kekerasan. Mereka menyebut itu sebagai film perjuangan. Atau juga wartawan perang, mereka tidak mau disebut wartawan yang mengekspos kekerasan dan memang tidak ada yang menyebut demikian. Namun demikian, tidak mungkin tidak ada ada “dosa” sama sekali yang dilakukan oleh mediamassa.Sayamelihathalituterjadi ketika proses jurnalistik berlangsung.“Dosa” tersebut adalah pada aspek nonverbal wartawan, yang sering mereduksi atau me-mark up fakta. Tulisan ini hanya ingin memberikan tambahan atas tulisan Rum dari sudut pandang yang berbeda. Hal ini agar media massa tetap mampu melaksanakan fungsi pengawasan lingkungan. Selain itu, sebagai sebuah wahana untuk diskusi sosial, tulisan ini juga tampaknya seperti tulisan Rum, memerlukan tambahan dari sudut pandang yang berbeda dari penulis lainnya. Semoga. Penulis adalah pemerhati media massa, alumnus STIK “Pembangunan” Medan

Masalah Aceh Saat Ini Oleh Muhammad Ridwan Beberapa elemen Aceh menuding bahwa keterlambatan penerbitan PP dan Perpres sebagai bukti ketidakseriusan pemerintah dalam melaksanakan UU PA dan MoU Helsinki

K

elanjutan perdamian Aceh pasca lima tahun perundingan damai Pemerintah RI dengan Gerakan Aceh Merdeka (GAM) MoU Helsinki 15 Agustus 2005 menarik untuk dipelajari. Bagaimanakah prospek dan kendala yang dihadapi dalam mempertahankan perdamaian dikaitkan dengan dinamika perkembangan Aceh yang dapat mempengaruhi perdamaian di kemudian hari. Kesadaran akan penderitaan akibat konflik yang panjang sekitar 30 tahun serta indahnya perdamian selama lima tahun pasca MoU Helsinki telah mendorong semua pihak di Aceh untuk tidak lagi menengok masa lalu dan lebih mempertimbangkan perjuangan pembangunan di alam perdamaian. Para elit eks GAM bersikap pragmatis dengan mengedepankan pemikiran apa saja yang sudah diperoleh dari perdamian itu dan apa saja yang masih harus diperjuangkan bagi kesejahteraan warga Aceh. Perkembangan situasi aktual Aceh itu sendiri semakin kondusif, kegiatan pemerintahan Aceh yang dibentuk berdasarkan Undang-Undang Nomor 11 tahun 2006 tentang Pemerintahan Aceh (UU PA) berjalan normal, pelayanan publik dapat ter-

selenggara. Di sektor keamanan tanpa kendala, peringatan HUT RI ke-65, 17 Agustus 2010 terselenggara di 23 kabupaten/kota tanpa gangguan dan bahkan para kepala daerah yang sebagian berlatar belakang eks GAM pun turut menjadi inspektur upacara. Para eks petinggi GAM pun tampak hadir pada upacara peringatan HUT RI ke 65 di Istana Negara Jakarta, setelah sebelumnya pada 15 Agustus 2010 di Four Season Hotel Jakarta menghadiri peringatan 5 tahun MoU Helsinki. Tentang sikap elemen masyarakat Aceh itu paling tidak tersirat dari pernyataan Malik Mahmud (mantan PM GAM) yang disampaikannya dalam suatu diskusi di Jakarta pada 23 September 2010. Malik Mahmud pada kesempatan itu mengatakan, pihak Aceh (GAM) dapat menerima tawaran perdamaian Aceh dalam NKRI dan meninggalkan inspirasi (harapan) untuk merdeka. Karena adanya kesediaan pemerintah RI untuk memberikan hak-hak yang diminta Aceh. Sikap Aceh tersebut harus tetap didukung pemerintah dan pemerintah harus berusaha untuk tidak mengecewakan rakyat Aceh dengan memenuhi janjinya agar tidak ada lagi korban jiwa dari

semua pihak. Diakui pula oleh Malik Mahmud bahwa gangguan keamanan oleh kriminalitas memang masih terjadi. Namun konflik fisik antara eks GAM dengan TNI/Polri yang sangat ditakuti warga Aceh sudah tidak ada lagi. Situasi keamanan yang kondusif ini harus dimanfaatkan untuk pembangunan Aceh. Yang menjadi kekhawatiran saat ini adalah adanya pihak-pihak yang ingin menjadikan Aceh sebagai basis latihan kegiatan teroris. Namun, kegiatan teroris di Aceh tidak berhasil karena rakyat Aceh tidak mendukung kegiatan mereka. Sementara itu, masalah yang masih dipersoalkan oleh pihak Aceh adalah belum diterbitkan beberapa Peraturan Pemerintah dan Peraturan Presiden sebagai turunan dari UU PA. Beberapa elemen Aceh menuding bahwa keterlambatan penerbitan PP dan Perpres tersebut sebagai bukti ketidakseriusan pemerintah dalam melaksanakan UU PA dan MoU Helsinki. Sikap kritis ini harus disikapi secara arif, dan menganggapnya sebagai ungkapan kehendak untuk segera dapat memperoleh peluang memajukan perekonomian dan kesejahteraan warga Aceh yang memang sempat mengalami ketertinggalan akibat konflik panjang. Namun untuk masalah ini, pemerintah telah memberikan klarifikasi tentang langkah-langkah yang telah ditempuh dalam implementasi UU PA, seperti pembentukan PP No. 20 Tahun 2007 tentang Partai Lokal di Aceh, PP No 58 Tahun 2009 tentang Pengangkatan dan Pemberhentian Sekda Aceh, Kabupaten dan Kota, PP No. 19 Tahun 2010 tentang Tata Cara Pelaksanaan

Tugas, Wewenang dan Kedudukan Gubernur Sebagai Wakil Pemerintah di Daerah, serta Perpres No. 75Tahun 2008 tentangTata Cara Konsultasi dan Pemberian Pertimbangan Atas Rencana Persetujuan Internasional dan Perpres No.11Tahun 2010 tentang Kerjasama Pemerintah Aceh Dengan Lembaga/Badan Di Luar Negeri. Sedangkan mengenai PP dan Perpres lainnya disebutkan penyusunannya akan berproses terus dan diagendakan selesai pada akhir 2010. Penyusunan PP atau Perpres sebagai implementasi UU PA dan MoU Helsinki sebenarnya bukan merupakan batu sandungan dalam melanjutkan dan memelihara perdamaian, namun lebih pada perlunya komunikasi dan konsultasi yang intens antara Daerah dan Pusat, dimana keduanya harus bertindak pro aktif untuk mengatasi kendala-kendala teknis dalam perumusan RPP atau Rancangan Perpres yang akan diterbitkan, Pusat dan Daerah harus mampu memanfaatkan data dan dokumen yang ada di instansi terkait yang ada di Pusat dan Daerah serta mengawal pembahasan secara bersama-sama. Melihat kondisi objektif dari perkembangan aktual Aceh termasuk perilaku elit eks GAM yang konsisten terhadap perdamian, serta kendala yang dihadapi dalam implementasi UU PA yang kiranya dapat segera diatasi, maka dengan sikap optimistisdapatdiharapkanperdamaianAcehdalam bingkai NKRI di masa depan akan bergerak ke arah yang lebih kontrukstif dalam perwujudan kesejahteraan warga Aceh. Penulis adalah pemerhati masalah sosial dan politik.

B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM 4 CM

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

DAIHATSU Zebra Minibus Thn. 1994, W. biru, BK Medan, atas nama sendiri. Hrg. 20 Jt/Nego. Hub. 0812 6536 0808. Di Asrama PM. Brayan.

DAIHATSU Grand Max 1,5D Minibus. Thn. 2008. AC, Tape, VR, PS, CL, Hitam. Plat B. Rp. 85Jt. Hub.91327433 Jl. Biduk 57

Rp. 36.000 Rp. 48.000

5 CM 6 CM

Rp. 65.000 Rp. 78.000

TOYOTA Twincam Lift Back ‘89 AC, Sound System, Abu metalic. Mulus, terawat. Hub. 0813 9661 0354/TP TOYOTA GREAT ‘95 Biru metalic, BK Medan, mulus, siap pakai. Hub. 0813 9661 0354/TP

TOYOTA Avanza E.2005 W. Silver, DVD, TV, Sound System. Cat Orisinal asli, pajak full. H. 114Jt. Hub. 0852 9640 2824

Xenia Li.........DP 11 Jt-an.........Angs 3 Jt-an Terios ............DP 14 Jt-an.........Angs 4 Jt-an Pick Up..........DP 9 Jt-an...........Angs 2Jt-an Hub. JOSUA. 061-77004944/0812 6311 0820

TOYOTA Kijang Thn. 96. Super Standard warna putih. BK Asli Medan. Hub. 06177984847 / 0813 7045 3215

“DAIHATSU BARU UNTUNG & MUDAH”

# TOYOTA BARU #

DAIHATSU Taft GT Thn. 94. Hitam. BK. Hub. 9144382 # DAIHATSU 100% BARU # * Xenia DP: 11Jt Terios DP: 13Jt * Pick-Up DP: 5 Jt Luxio DP: 7 Jt Proses cepat, Data dijemput + Hadiah Hub: Kalpin 0852 7041 9000 ISUZU Panther Hi-Sporty 25, Hijau ‘97, BK AC DB, PW CL, Jok Sm. Kulit, DP 20Jt. Angsuran: 2,14rb. Sisa 35x. Hub. AISYAH: 0813 7728 0512

HONDA Accord M/T Thn. 99. Coklat Muda Met. BK Mdn Rp. 87Jt. Hub. 0812 6594 2789 HONDA Odyssey Matic Thn. 97. Hitam, BK Rp. 89Jt. Hub. 0813 7508 8798 HONDA Accord 85/86. Hijau, BK Medan, PS, PW, CL, Hrg. 14Jt/Nego. Hub. (061) 77277404, 0813 7059 9345 ISUZU Panther Touring Turbo Matic Thn. 2001, Biru muda met, BK Medan Rp. 105Jt. Hub. 77863981

KIA MOBIL

Micro Bus New Travello Pantas Buat Usaha Antar Jemput DP 20Jt & CCL 5,5Jt (Gratis Kaca Film + Alarm)

Hotline Service 0852 6128 1181

Ready: Avanza, Innova, Fortuner, Rush, Yaris, Vios. Bersedia Tukar Tambah dengan mobil lama Anda. Proses Cepat Data Diambil. Hub.: TOMMY 0813 7043 7766 - (061) 7650 4588

DIJUAL MOBIL ODONG-ODONG GAJAH Hub. 0852 7530 5559

BURSA

BUTUH DANA DANA CEPAT

Jaminan BPKB, Mobil, Sp. Motor, Betor dan Taksi semua tahun, syarat ringan, Proses Cepat. Hub. 061-7633 6525 - 0812 6081 3010

KAMI SOLUSINYA, JAMINAN BPKB MOBILL DANA Data lengkap, Langsung cair, BPKB aman Hub. Kami: FINANCIAL SOLUSINDO . (061) 7763.1725 TUNAI HP0815.3447.0666

BUTUH DANA

PT. SINAR MAS MULTIFINANCE. Jaminan Khusus BPKB sepeda motor bunga 1,5%, Discon, 1x cicilan Hub. 0812.656.8635 - 0852 6211 3390

ANDA BUTUH DANA TUNAI

Jaminan BPKB Mobil sepeda motor, Becak. Bunga 1,5%. BPKB Aman, Data Dijemput, Proses Cepat. HP. 061.66477734, 0813 9779 1077 Maaf TP

JADIKAN Kartu Kredit Anda Sebagai Sumber Pendanaan Anda Hubungi FCM 061.3010 2222

MAZDA Aventura Thn. 95. Hijau, BPKB 1 nama Medan, asli, PS, PW, AC, TP, Mulus sekali. H. 28Jt/N. Hub. 0812 602 5621

Jaminan Apa Saja, Sertifikat Tanah. Spd. Motor, Take Over Mobil. Hub. 061-8222774, HP. 0816 314 1807

MITSUBISHI Kuda Diamond Diesel Thn. 2003. Merah maron met, BK Rp. 105Jt. Hub. 0816 3113 953

RENTAL MOBIL

MERCEDES Benz E230 New Eyes, 97/ 98. BK Mdn Tgn-2. BK 2 Angka, 4 A. Bag, ABS, Cool Box, DP 25Jt. Angsuran: 4,1Jtx35. Hub. AISYAH: 0813 7728 0512 DEALER RESMI SUZUKI MOBIL

PU 1.5 DP 12 Jt-an Angs. 2.883.000,APV DP 12 Jt-an Angs. 4.830.000,NB: Proses Mudah & Cepat Data dijemput Hub. 0812 6540 809 / (061) 7772 2121

SUZUKI Grand Vitara 2008 Bulan 9. 2000cc. Hitam metalic Matic, mulus. Plat Medan baru perpanjang. 0813 614 77528

SUZUKI Escudo 1.6. Thn. 2004, mulus, BPKB 1 tangan. Hub. 0813 96610 354 DIJUAL - Suzuki Real Van 97 Silver - Suzuki Aventura 95. Biru. Hub. 0813 9734 3498 TOYOTA BARU Wil. Aceh & Sumut. Pesan sekarang juga, bunga ringan. Kredit s/d 5 tahun. Info: 0812 604 81001

ANDA BUTUH DANA

BURSA

SERVICE/ASESORIS MOBIL

‘MULIA JAYA’ POWER STEERING

- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

9 CM Rp. 126.000 10 CM Rp. 140.000

BURSA

SEPEDA MOTOR

KONSTRUKSI

HONDA Supra 125X, 2008 Akhir. Mulus, Km. 14.000. Hub. 0813 9661 0354

WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 06177008458, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja

BURSA

ELEKTRONIK TRANSFER DVD-VCD Dari VHS, Mini DV, Hi-8, Betamax, Laserdisc, Kaset Tape. Shooting & Foto Resepsi, Ultah, Candid, Pre-Wed, Profile Kharisma Studio Jl. Mahkamah Tel. 7364845-77112200

BURSA

KESEHATAN

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

“H. MOHD. RAWAL” SPECIALIST AMBEYENT TANPA OPERASI PUTUS SAMPAI KE AKAR2NYA DIJAMIN TDK SEMBUH UANG KEMBALI GARANSI

Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke

“H. MHD. RAWAL” PUSAT:

Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

TV, PS, AC, KULKAS, M.CUCI, GENSET, HANDYCAM. LAPTOP PROJEKTOR

AC 1/2/1Pk: 1,3Jt, 1 1/2 Pk: 2 Jt, 1 Pk Baru: 2,3Jt, Kulkas 1 Pt: 600rb, 2Pt 900rd, 2 Pt. Jumbo: 1,8Jt. 5 Rak Show case: 1,7Jt 5 Rak Freezer: 1,2Jt. M. Cuci 1 Tb: 500rb, 2 Tb: 900rb, 4500 w, 3,5Jt. 7000. 4,5Jt. TV 14”/21” 300rb /d 700rb 29”, 1,2Jt. 34”Sony=2,5Jt. LCD Sony Projection = 5,5Jt. 32” LCD Samsung =3,5Jt. PS 1: 400rb, PS 2: 800rb, dll. Handicam Sony, JVC, Mini DV: 1,5Jt, DVD: 2 Jt, Camera 5 Mp s/d 10 Mp: 500rb s/d 1,3Jt. Laptop P3: 1,5Jt. Projector Toshiba=3 Jt. Fax: 500rb, Printer: 450rb (Jual/ Beli) Hub. UD. Senang Hati: 4517509 -77073637 Jl. Sekip 67 A

SPECIALIST MATA TANPA OPERASI Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar awal.com aridara

BURSA

KOMUNIKASI ✓ Grosir

Pulsa Elektrik, Satu Chip Untuk Semua Operator ✓ Hanya Dengan Modal Rp. 50.000 Saja. Anda Sudah Bisa Menjadi Agen Pulsa ✓ Harga Sangat Murah (Gratis Biaya Pendaftaran) / Transaksi 24 Jam ✓ Dicari Agen dan Master Dealer Untuk Seluruh Wilayah Indonesia

Harga Produk

S/AS 5: 5.200 S/AS 10:10.000 S/AS 20:19.900 S/AS 50: 49.250 S/AS 100: 97.500 Informasi Pendaftaran Hubungi:

0813 6125 9330

Jl. Bromo No. 95, Medan Website: www.rizkipulsa.net

ULFA RELOAD Satu Chip Kesemua Operator.

S5= 5200 S10=10.000 S20=19.950 Terima Agen Dalam & Luar Kota

Jl. Denai No. 97 Telp. 061-69692100 - 69641212

BURSA

PHOTO COPY

CANON

& KONICA MINOLTA

CASH & CREDIT SALES, SERVICE, RENTAL & SPARE PART Hubungi:

INDAH BERSAMA

Jl. Karya No.68 Sei Agul Medan Telp. 061-663 9308, 7700 9000 HP. 0813 70900 400, 0852 6144 8000 0816 301 761

MINI & EFEKTIF IKLANKAN PRODUK ANDA

PENGOBATAN

Pengobatan Alat Vital H. Suhendar

H. Suhendar sudah di kenal sebagai pakar kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan kekerasan, tambah kuat dan tahan lama dalam berhubungan Besar dan panjang di tempat Tidak ada hasil, Mahar kembali Ditangani secara profesional Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Paling aman tidak ada efek samping

Mahar Rp. 500 ribu

HUB. MULTAZAM JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING MEDAN TELP. 457.6116/ 0813.6137.2321

Harian

WASPADA Media yang Tepat untuk Iklan Anda

PAKAR TERAPI KEJANTANAN & KEROHANIAN TERBESAR TERPERCAYA BIKIN PRIA PERKASA

1 . UNTUK PRIA : Alat vital loyo, pendek, kecil/tidak berfungsi/impoten total. Kurang kuat keras, plekcur (ejakulasi dini), letoy, tidak tahan lama, bahkan disepelekan pasangan jangan kuatir. Ingin joss, datang dan buktikan disini.

Waspadai Bahaya Leptospirosis (Kencing Tikus)

2. UNTUK TERAPI WANITA (Berdarah Seperti Perawan) : Mengembalikan keperawanan (virgin), hasil bisa dicek ke dokter, menghilangkan keputihan, becek, bau tidak sedap, ingin mencengkram/wangi, buktikan disini (Bergaransi) Mengatasi penyakit yang secara medis tidak dapat disembukan antara lain : CUKUP: · Kelainan sex, homo sex, lesbi,gysex BYR · Gangguan jiwa/mental. Kegelisahan, gila MAHAR · Kurang percaya diri, stress berat, suka marah 500 RB · Suka cemas, kecanduan narkoba, dll JL. SM. RAJA Samping UISU masuk JL. SEMPURNA 300M NO. 49 MEDAN HP. 0812.6827.7999

(izin Kejaksaan No. B.170/DSP5/12/2009) Cara terapi pengobatan di totok dibagian syarafsyarafnya dan diberikan ramuan/ jamu, mengobati segala keluhan pria/ wanita MENGOBATI PRIA Tambah besar: 4, 5, 5.5, 6 Tambah panjang: 14, 15, 16, 17, 18, 19, 20 Impotensi Ejakulasi dini, Kurang ereksi Tahan lama/ Tidak punya keturunan Hernia, Penyakit Gula Pengobatan ini Alami 100% tanpa efek samping, bebas untuk semua Agama, Tanpa pantangan (reaksi ditempat) Praktek menetap: Jl. Pelangi (± 100 meter dari Simpang UISU SM. Raja) No. 42 Medan HP. 0812.6350.4441

Pengobatan Alat Vital H. Suhendar

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6409.1777

AHLI PENGOBATAN ALAT VITAL: PRIA/ WANITA (Untuk reumatik & asam urat)

Klinik H. Suhendar di bawah kontrol dan pengawasan langsung H. SUHENDAR Diberitahukan kepada masyarakat untuk berhatihati terhadap pengobatan sejenis yang mengakungaku kerabat atau saudara, soal cara boleh sama tapi keahlian yang membedakan

Yang sudah dipercaya dan Bisa bukti di tempat !! Ditangani oleh:

A. SAEPUDIN DARI PELABUHAN RATU

Jika anda cari pengobatan harus teliti dulu sebelum berobat, mana yang ahli dan mana yang asli. Sebenarnya banyak pengobatan lain juga yang memberikan bukti, tapi kenyataannya tidak ada perubahan sama sekali. Makanya kalau berobat harus serahkan kepada ahlinya. Cuma disini satu-satunya pengobatan asli dan benar-benar bukti langsung kelihatan perubahannya ditempat. Jika ada keinginan datang dan buktikan di tempat kami. Dijamin anda tidak akan kecewa, pasti berhasil. Bahkan banyak pasien dari tempat lain juga yang datang berobat kesini semua berhasil.

Untuk keluhan dan pengaduan silahkan hubungi langsung:

DIJAMIN Khusus Wanita ! * Ingin kembali perawan, buka aura * Memperbesar/ Kencang payudara, Pelet * Ingin punya keturunan, Pengasihan * Penglarisan Usaha, Problem Rmh Tangga * Ingin cepat dapat jodoh, Ditinggal pacar Alamat: Jln. Amaliun Simpang Laksana No. P.33 100 M dari Yuki Simpang Raya HP: 0813 6203 0992 Izin Kejari DSP 22/-0-101-/2009

Khusus Pria ! * Lemah syahwat, Kuat, Keras, Tahan Lama * Memperbesar, Panjang, Impotensi * Mani Encer, Ejakulasi Dini, Hernia * Mati Rasa/Total, Kencing Manis. * Diabetes, Mandul

H. SUHENDAR HP. 0812.131.6364 Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Telp. (061) 663.4220 Saksikan !!! Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB

Jl. Garu 6 Gg. Belibis No. 25E (Sisingamangaraja) Medan HP. 0815.333.20450 Kejari : No.B.78/N.4.3/DSP.4/12/2008

PEST CONTR O 2000 CONTRO

KLINIK PENGOBATAN ALAT VITAL DARI BANTEN DI TANGANI LANGSUNG BPK. ZAENAL

Ingin Promosikan Produk Anda

Spesialis Pengisian Air Raksa (Mercury): Multi Fungsi, Meramal dengan Media Kartu Tarrot Pemasangan : Susuk Jaran Goyang Susuk Penakluk Susuk Gandasari Susuk Kejantanan dan lain-lain Hubungi ke alamat:

“KLINIK PUTRA BANTEN”

CARA PALING AMAN & SEHAT

DI CARI AGEN UNTUK WILAYAH MEDAN DAN SUMATERA UTARA

NYATA AMPUHNYA, NYATA SEMBUHNYA Dijamin Halal dan Mujarab, setelah sembuh tidak akan kambuh lagi. BUKAN JANJI TAPI BUKTI

BURSA

BERPENGALAMAN PULUHAN TAHUN UMROH REGULER 9HR RP. 15 JT UMROH PLUS MESIR RP. 21 JT UMROH PLUS TURKEY RP. 23 JT UMROH PLUS AQSHA RP. 25 JT UMROH RAMADHAN 1 BLN RP. 26 JT ONH KHUSUS/ PLUS USD 7000 MANASIK HAJI THN 2011

PT. DIMARCO

SPESIALIS PENYAKIT KULIT DAN GATAL - GATAL

KESEHATAN

NAGA INTEN & SRI TANTRY

MULTAZAM HAJI & UMROH

Kompleks Multatuli Indah Blok. BB 32 Telp. 061.4576750 / 76399936

Dapat mengobati segala jenis penyakit kulit dan gatal - gatal, berat ringan, lama dan baru. Sudah bosan berobat kemanamana, “dan sudah pernah sembuh tetapi kambuh lagi”. Kami dapat mengobati sampai tuntas dengan Ramuan Tradisional. Termasuk Kutu Air, Panu, Kurap gajah, Eksim, Pitiligo, jerawat, termasuk Keputihan bagi wanita dan Penyakit kulit lainnya

HP. 0812 6367 676

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

HUBUNGI :

TRADISIONAL OMPUNG TANGGO SIALLAGAN

Izin Dinkes No: 448/2611/III/2008 Izin Kejaksaan No: B-50/DSP.5/03/2008 Alamat Rumah/Praktek: Jl. Putri Hijau No. 46 H Medan (Samping Kantor Lurah Kesawan) Buka Praktek Jam 04.00 Sore s/d 09.00 Malam Setiap Hari.

FAX.4561347

- Efektif Usir TIKUS TANPA RACUN 24 Jam Nonstop - Dengan teknologi Inovasi 3 in 1 - Sensor Radar Ultrasonic - Electromagnetic Plus Double Speaker - Cangkupan hingga 100 M2

RIZKY PULSA

RENTAL MOBIL MURAH Rp. 250.000/Hari Mobil: Avanza, Xenia. HP. 061.66477734, 0813 9779 1077 Maaf TP.

BURSA

Rp. 91.000 Rp. 104.000

BURSA

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428

DAIHATSU 100% BARU PAKET MURAH...!!

Grand Max Minibus DP 13 Jt-an/Angs. 3 Juta-an Gran Max Pick-Up DP 7 Jt-an/Angs. 2 Jt-an Xenia Terios Murah. Hub. 0813 6177 3589/77943677

7 CM 8 CM

TOYOTA BARU

Senin, 11 Oktober 2010

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

WASIRI

TERAPI KEJANTANAN ALAT VITAL PRIA & WANITA PALING SPEKTAKULER DARI PEL. RATU PANTAI SELATAN Ditangani Langsung:

(Untuk Ambeien)

BPK. UMAR & UST. A. AZIS

Melayani berbagai macam keluhan antara lain:

Wasiri berani menjamin kesembuhan tuntas ambeien/wasir anda. Sangat berkhasiat dan cepat menghilangkan ambeien. Wasir yang menonjol maupun yang tumbuh di dalam. Redakan rasa sakit, perih dan menghentikan pendarahan waktu buang air besar, mencegah infeksi dan panas dalam serta melancarkan buang air besar.

KHUSUS PRIA TAMBAH UKURAN:

- Panjang: 13 - 16 - 19 - 22 cm - Diameter: 3.5-4-4.5-5-5.5-6cm - Kuat dan tahan lama - Ejakulasi dini, sphilis/ Raja singa - Mani encer - Lemah syahwat, diabetes, impoten, dl KHUSUS WANITA: - Memperbesar, payudara, terapi perawan/ virgin, kista, lemah kandungan, kanker payudara, ingin mempunyai keturunan, dll PRIA & WANITA Ingin cepat dapat jodoh, penghasilan disegani atasan, menyatukan & memisahkan PIL/ WIL, Puter giling, juga melayani pasang susuk, dll --> Bergaransi, hasil permanen alami tanpa efek samping, langsung reaksi ditempat Alamat: Jl. SM. Raja dekat Taman Makan Pahlawan No. 130B Medan samping Show Room AUTO 2000. Dibelakang bengkel tambal ban

HP. 0813 8042 6253

Harian

WASPADA Tempat Iklan Anda

CROSS

LEBARAN PAKET LEB ARAN

BUNGA O % atau CASH BACK 13 Juta DP RINGAN

Hadiah KACA FILM SOLAR GARD + PARKING SENSOR

KREDIT VIA:

Hubungi Dealer

SUZUKI

ADA JADI MOBIL

JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887

KUSUK & LULUR

MBAK ALIN HUB. 0813.7739.9508

PUSAT PENGOBATAN SPESIAL ALAT VITAL

Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!

KHUSUK & LULUR ATI BERSEDIA DIPANGGIL HUB. 0813.7587.7577

DITANGANI LANGSUNG

BPK. HARYONO ASLI DARI BANTEN

Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri

Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663

NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008

Agenda

WASPADA Senin 11 Oktober 2010

07.30 Si Doel Anak Sekolahan 09.00 Dahsyat 11.00 Silet 12.00 Seputar Indonesia Siang 12.30 Sergap 13.00 Sinema Siang 15.00 Kabar Kabari 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Who Wants To BE Millionaire 18.00 Putri Yang Ditukar 20.00 Kemilau Cinta Kamila 22.00 Mega Sinema 24.00 BOM : Deep Impact 00.00 Seputar Indonesia Malam

CATATAN

07.30 SCTV Musik Inbox 09.30 Halo Selebriti 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV Siang 14.30 Status Selebritis 16.00 Sensasi Artis 18.00 Islam KTP 19.00 Taxi 20.30 Cinta Fitri 22.0 SCTV Sinema 00.30 Liputan 6 Malam

07:00 Disney Club 07.30 Cerita Pagi 08:30 Cerita Pagi 10.00 Cerita Siang 11:00 Sidik 12:00 Layar Kemilau 13:30 Cerita Sore 14:30 Starlite 16.00 Masquarade 16:30 Lintas - 5 18:30 Animasi Spesial 19.00 Upin & Ipin 21.00 Layar Sinema 22:30 Star Vaganza 00:00 Lintas Malam

08:30 Sinema Pagi 10:30 DRTV 11:00 Piss Man 11:30 Topik Siang 12:00 Klik! 13:00 Sinema Siang 16.30 Seleb Ngamen 17.00 Wayang On Stage 18:30 Super Family 19:30 Super Deal 2 Milyar 21:00 Penghuni Terakhir 22:00 Topik Kita 23:00 World Most Amazing Video III 00:00 Topik Malam

07.00 Dive Olly Dive 07:30 FTV Pagi 09.30 FTV Drama 11:30 Patroli 12:00 Happy Song 14:00 KiSS Sore 15:00 Fokus 15:30 Kartun 17:00 Arti Sahabat 18:00 Superboy 19:00 1 Lawan 100 20:30 Take A Celebrity Outb 23.00 Sinema Asia

07.05 Editorial Media Indonesia 08.05 Healthy Life 09.05 Indonesia This Morning 09.30 Breaking News 10.05 The Interview 11.05 Hobbies 13.05 Zero to Hero 14.05 Sport Club 16.05 Discover Indonesia 17.05 Metro Hari Ini 18.05 Metro Hari Ini 20.05 Suara Anda 20.30 Sentilan Sentilun 21.05 Top Nine News 21.30 Genta Demokrasi 22.05 Economic Challenges 22.30 Auto Zone 23.05 Metro Realitas 23.30 Metro Sports 02.00 Mario Teguh

B7 07.30 Rangking 1 08.30 Derings 10.00 Suami Suami Takut Istri 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Online (Olga & Jeng Kellin) 14.30 Jail Fresh 15.30 Kejar Tayang 16.00 Investigasi Selebriti 16.30 Reportase Sore 17.00 Jika Aku Menjadi 18.30 Sketsa 19.00 Gong Show 20.00 Realigi 21.00 Bioskop TRANS TV 23.00 Bioskop TRANS TV 01.30 Reportase Malam

08:00 The Backyardigans 08:30 Dora The Explorer 10:30 Bukan Sinetron 12:00 Abdel & Temon Bukan Superstar 13:00 Global Siang 13:30 Spongebob Squarepants 14:00 Marvo the wonder chicken 14:30 Tak and The Power of Juju 15:00 Petualangan Panji 15:30 Berita Global 17:00 Kapten Tsubasa 19.00 3 Mas Ketir 20.00 Big Movies 21.00 Mendadak Alim 00.00 Global Malam 01.30 MTV Insomnia

06.30 Apa Kabar Indonesia 11.00 Nuansa 1000 Pulau 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Opini 15.00 Kabar 15 15.30 Kabar Pasar 16.00 Menyingkap Tabir 17.30 Kabar Petang 19.30 Jakarta Lawyer 20.30 Apa Kabar Indonesia Malam 22.30 Telusur 23.00 Auto Expert 23.30 Kabar Arena

07:30 Selebriti Pagi 08:00 CAWAN 09:00 Inspirasi Dorce 10:00 Rahasia 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Ayo Menyanyi 14:00 Kuas Ajaib 15:30 Jejak Petualang 16:00 Redaksi Sore 18:00 Wara Wiri 18.30 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata

**m30/B

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Johny Depp Berpakaian Perompak Kunjungi Sekolah Bintang Hollywood Johny Depp membawa pertunjukan dan cerita ke tingkat baru di satu sekolah di London, ketika dia muncul dengan mengenakan aksesoris lengkap seorang perompak.

Johnny Depp/blogspot.com

BURSA

PENDIDIKAN KURSUS KOMPUTER CEPAT -

LPK PAULINE

Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) Desain Grafis + iNTERNET....................... 600 Rb (1 bulan) Aplikasi kantor + Internet....................... 450 Rb (1 bulan)

Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Telp. 844.2158 - 844.2159 BULAN PROMO DISCOUNT 20% TUNAI

BURSA

LOWONGAN DICARI

Dicari tukang pangkas yg berpengalaman Hubungi: Ibu Sri Pangkas Ibunda: Jl. Darusalam 108 Medan HP. 0812.6377.6909 Telp. 415.4020 LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Ditambah uang kerajinan 50rb/bln Hub. Bpk Ridho (061) 453.1124/ 0852.755.23457 Jl. Ayahanda 73C Medan

LOWONGAN KERJA Gaji min 50 Rb/ hari (bukan MLM), Kesempatan terbatas, U/ Pria & Wanita, Jujur & bertanggung jawab Hub Jl. Krakatau No. 2E Medan Telp. (061) 661.5210/ 0811.616.088

TAXI BLUE BIRD

Membutuhkan 137 Pengemudi, Komisi, Bonus, Insentif, Mbl baru Syrt: 23 - 45 thn, Copy SIM/ KTP, Ijazah, Tdk bertato/ Bks Tatto Jl. Kapt. Muslim 92 Sei Kambing Medan 7637.5840 - 844.2345

DISEWAKAN RUMAH

Tipe 36, Sudah Rehab, Pesona Nabila, Muslim, Keluarga, 4 Jt/ thn Hub. Pak Caca 0812.6096.450

RUMAH DIJUAL (DITENGAH KOTA)

Jl. Ceret No. 21 Ayahanda - Mdn 4 KT, 2 KM, Garasi, SHM LT. 338m, LB. 139m, Ling. Aman Hub. 0813.7566.9669

RUMAH DIJUAL

Di Komp. Villa Malina Jl. Permata Nusa No. 6, ringroad Tjg Sari, Uk. 10x15m, SHM, 3 KT, 2 KM, Carpot, List 1300 W, PDAM, Harga 350 Jt/nego Hub. 0812.6397.7600

OVER KREDIT

R. Villa Setia Budi Flamboyan Jl. Flamboyan Raya simp. Melati Medan, Tingkat, 3 KT, 3 KM, AC, Tangki air, Sdh terpasang balik DP 165 Jt sdh Bayar 10x, KPR 10 thn Hub. 081260191367

RUMAH DIJUAL

Di Jl. SOSRO Gg. Buntu, Bandar Selamat Medan Uk. 8,5x21, 4 KT, 2 KM Full keramik, R. Keluarga dan R. Makan, SHM/ B.U, Maaf TP Hub. (061) 735.9123 / 0812.6425.230 Harga NEGO

Sebelumnya seorang penggemar mengirim surat kepadanyauntukmintabantuannyamenampilkan seorang “pemberontak”, demikian laporan media. Beatrice Delap (9) mengirim surat kepada Captain Jack Sparrow, tokoh Johnny di film“Pirates oftheCaribbean”,untukmeminta bantuannya dalam aksi pemberontakan terhadap para guru di Meridian Primary School di Greenwich, bagian tenggara London. “Kami adalah sekelompok tunas muda perompak dan kami

menghadapi sedikit masalah pemberontakan melawan para guru, dan kami ingin tahu apakah anda dapat datang dan membantu,” kata Beatrice di dalam suratnya kepada Johnny. Johnny, berada di bagian tenggara London untuk pembuatan film keempat Pirates of the Caribbean dengan judul On Stranger Tides, mengeluarkan pemberitahuan 10 menit sebelumkedatangannyakepadasekolah itu pada Rabu (6/10) bahwa dia sedang dalam perjalanan. Sekolah tersebut segera mengadakan pertemuan dan Johnny masuk sementara para murid terperangah, kata majalah People. Johnny, sambil memegang surat itu, meminta Beatrice agar maju dan memeluk gadis cilik tersebut tapi Johnny menghapuskan semua pikiran mengenai pemberontakan. “Barangkali kita tak perlu memberontak hari ini sebab ada polisi di luar yang sedang mengawasi aku,” kata Johnny, ayah dua anak.(ant/rtr)

BURSA

PROPERTY

BURSA

ALAT MUSIK

TERCECER Surat Kiosk Petisah 240/ 241 Lt. II Petisah Tahap II. atas nama Irpansya Putra Rahman. Disekitar Pasar Petisah atau Jln. Gatot Subroto

BURSA

PERABOT

BURSA

SPESIALIS REPERASI KURSI

Sofa, Jepara, K. kantor, Ganti kulit/ kain + Busa cat ulang perabotan, Murah dan garansi. NB. Tempahan sofa minimalis Hub. 7740.5997 (Anto)

KONSTRUKSI

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Tel: 4525462 - Fax. 4151359

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Harian

Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

RUKO HALAT 123 PERMAI

Hub: 7772 2123 / 7759 8123 HP. 0811 65 1123

WASPADA BURSA

TRAVEL/ WISATA

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT

8442246 08126427 1725 Ada Garansi ADI Telp.:

WC WC

TUMPAT/ SAL. AIR

845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F

ANDA TUMPAT - SEDOT

Hub. 8219951 Jl. Setia Budi No. 2

WC TUMP TUMPAAT, Sal. AIR, K. Mandi Tel. 06177008458, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja BURSA

PELUANG USAHA DAN INVESTASI

MINI & EFEKTIF

MINI & EFEKTIF

TANAH

BURSA

IKLANKAN PRODUK ANDA

IKLANKAN PRODUK ANDA

ALAT PENGAMAN

TANAH Dijual murah, ±11 Rante, Harga 38 Ribu/ M Net Alamat Jl. Dame Amplas Hub. 0813.9614.0774

Hub. 0811.638.968

3 Tkt Cocok untuk usaha inti kota, DP 100 Jt Sedang dibangun 4 pintu, Ruko Jl.Senam No. 1 Simp Jl. Halat (samping Sekolah Negeri),LB. 4x16, LT. 4x29m), Row depan 10m, Row belakang 3m, Fas. SHM, PLN, PDAM, Pintu plat besi, Cocok utk usaha perhotelan, Fotocopy, Praktek dokter, kost²an, Hospital, Warnet, Kantor NB: 300 meter dari Jl. Juanda dan Bandara Polonia, bisa bantu KPR, KPR per bulan 5 Juta, Harga 525 Jt, Sisa 3 unit, Full keramik, Siap huni ±80 Jt

WC

Jl. Brayan Medan

Tumpat Sedot

Depot Air Minum Jl. Bunga Mawar Psr V Pdg Bulan, Sewa kios masih 32 bulan lagi, Hrg 40 Jt/nego Peminat serius hub. (061) 7764.6810 0812.6343.3568, TP

RUMAH Dijual 2 Tkt di Jl. Jermal III No. 19A Denai, Uk. 9,5x19m, 3 KT, 3 KM, SHM, Siap huni Hub. 0811.602.1321 JUAL MURAH/ B.U

BURSA

HILANG/TERCECER

DIJUAL CEPAT

TANAH DICARI

Rumah di STM/ Jl. Suka Sehat Medan, Tanah 18x19,59, Bangunan ±250m, KM 3, KT 3, Full kramik dan Gypsum Hub. 0812.607.8885 - (061) 7758.8855

bersama-sama meme-riahkan acara Oktoberfest ke 200 tahun ini. BinamanKasanselakuKetua Umum Forum Komuni-kasi Indonesia Jerman dalam sambutannya memberikan ucapan terima kasih kepada seluruh hadirin dan pihak-pihak turut mendukung acara tersebut. Oktoberfest sebagai ajang silaturahmi antara warga asing di Sumut dengan Warga Kota Medan. FKIJ didirikan pada awal

PELUANG BISNIS

Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

Pesta Oktoberfest, festival dua mingguan diadakan setiap tahun di Theresienwiese atau lebih di kenal dengan nama “D’ Wiesn”, berada di M?nchen, Bayern, Jerman digelar FKIJ (Forum Komunikasi Indonesia Jerman) di Medan. Dihadiri 400 lebih undangan terdiridarisimpatisanJermandari instansi pemerintahan hingga konsul kehormatan negara sahabatsepertiAmerika,Australia, Belanda dan Polandia, mereka

TANAH DIJUAL

DIBUTUHKAN

Pegawai Toko Pria & Wanita Dengan syarat: - Berijazah SLTA/ sederajat - Umur maximal 30 tahun - Bersedia tinggal di dalam (Menginap) - Jujur & bertanggung jawab Surat lamaran diantar langsung ke: TAMAN SETIA BUDI INDAH Blok UU-52 (Ruko) Medan Telp. 8200.981 / 0816.317.2702

Oktoberfest Mempererat Budaya

- Lokasi di seberang Tekwan Jl. DI. Panjaitan No. 124 - SHM, Luas: 590m² Hub: 0813.8391.1847 0812.6418.724 - (061) 821.2023

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

PELUANG KARIR !!

Dibutuhkan segera 100 Kary/ti br U/ 5 kntr yg akan dioprskan, Kami bth SMA/ sdrjt-S1, P/W Single, Usia 17 30 thn, U ditmpatkan di Pss: Asmen, Ldr, Spr, Recept, Adm, Gdg, Income 1,5 - 2 Jt/ bl + Karir, Bw sndr brks lamaran anda ke: RAFFISINDO GROUP Jl. Bambuan/ Antara arah Paya Mabar No. 9 Stabat Plng lambat 1 minggu dr sekarang, jam 10.00-14.00 WIB, cpt mndsk !!

Pengurus FKIJ bersama Ketua Umum Binaman Kasan, Direktur Eksekutif Van Cuson Sianturi, Sekjen Marasi Sibarani, Ketua Panitia Murni Huber diabadikan bersama usai Festival Oktoberfiest.

Dicari tanah seluas ±2200m² dan sudah ada bangunan gudang didaerah sekitar Jl. Medan Binjai Km. 9 s/d Km 12, atau disekitar daerah Sunggal

BURSA

MATERIAL

Segera di Launching Di seluruh Indonesia. Hanya Dengan Menabung 6.5Juta. Anda Bisa Mendapatkan Bonus 50 Juta. Berulang-ulang Plus Asuransi Jiwa Hingga 450 Juta. Hub. SILVY: 061.77595123

Harga Ter Murah

Model Terbaru

KRISNA WATER

PELUANG BISNIS 1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro Rp. 22 Jt s/d 38Jt 2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki Menyediakan Mesin RO dan Yamaha Hubungi: CV. HYDRO UTAMA

DIJUAL CEPAT

Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410

SEBIDANG TANAH SERTIFIKAT LUAS 45X16/ 17 (±700M2) BANGUNAN PERMANEN (± 200M2) JL. LETDA SUJONO/ JL. PADANG/ JL. BARU NO. 30A KELURAHAN TEMBUNG – MEDAN TEMBUNG HUB HP. 081362189094

- Dicari/ beli Getah dan buah Jernang getah jernang super dan kering dibeli s/d Rp. 800.000/Kg - Dibeli Srg Burung Walet goa dan gedung Hub. 0813.9603.9268 (Telp/ SMS)

GETAH JERNANG & SARANG BRG WALET

2010 dan merupakan wadah untuk menghimpun simpatisan Jerman, Warga Jerman, Austria, Swiss serta lulusan perguruan tinggi Jerman.“FKIJ bukan hanya untuk para alumni Jerman, tetapi terbuka bagi simpatisan dan pengusaha yang berhubungan dengan Negara Jerman”, tegas Binaman. Dewan Penasehat FKIJ banyak berasal dari praktisi di berbagai bidang, mulai dari akademisi, pengusaha, perbankan serta instansi pemerintahan yang ada di Sumut. “FKIJ akan mewujudkan kerjasama lebih baik antara Jerman dengan Indonesia khususnya daerah Sumut. Juga meningkatkan hubungan lebih erat dan intensif antara Jerman dengan Sumut di bidang ekonomi, perdagangan, budaya, pendidikan, pariwisata dan media massa”, tambah Binaman. Terbukti dengan hadirnya dua Restaurant German Food di Medan tahun 2010 ini, lantas pertukaran mahasiswa UniversitasJermandenganUnimedserta dosen senior dari Jerman memberikankuliahdiUniversitas Nommensen. Informasi yang didapat dari Kabid Konsular Kedubes Jerman di Jakarta, ada sekitar 1000-1200 visa dikeluarkan untuk berkunjung ke Jerman, hal ini membuktikan hubungan yang cukup baik antar kedua Negara. Ketua panitia Oktoberfest MurniHuber bersuamikanOrang Jerman dalam sambutan-nya menyampaikan ucapan terima kasihkepadaKetuaFKIJBinaman Kasan dan Dewan Penasehat Jongkers Tampubolon atas

SERVICE

ELEKTRONIK SER VIS SERVIS

AC

AC

CUCI AC, ISI FREON, BONGKAR PASANG. REPARASI, KULKAS, MESIN CUCI Hub. DIFA SERVIS 0813 9735 7061 061-69644786

KARYA TEKHNIK

SERVICE: AC, KULKAS, M. CUCI, TV JUAL AC BEKAS. BERGARANSI HUB. 061-7791 3537, 0813 755 33375

MAJU TEKNIK

AC

AC

7030118 76750084 KULKAS, M. CUCI DISPENSER (BERGARANSI)

MANDIRI TEKNIK SERVICE

AC, KULKAS, MESIN CUCI B. Pasang, Instalasi, Cuci, Spare Part 061.76764660 “ 0812 6557 521

STASIUN J. SERVICE M. Cuci Dispenser - Garansi AC KULKAS,

76355562, 0813 7565 6534

terselenggaranya Acara ini dilaksanakan Panitia Oktoberfest sekaligus pengurus FKIJ juga. Disebutkannya, Oktoberfest adalah festival terkenal di dunia, suatu pesta budaya rakyat Jerman telah dimulai tahun 1820 di Bavaria Munich Jerman. Saat itu dirayakan mengingat pada pernikahanPangeranLudwigdari Bavaria dan Putri Theresa. Berlangsung dari 18 September sampai 3 Oktober, selama 16 hari setiap tahunnya dan menarik perhatian pengunjung serta wisatawan 6 juta orang, sekaligus mendatangkandevisanegaradan mengangkat perekonomian warga di Bavaria. Dalam acara tersebut, ditampilkan atraksi gergaji kayu, tarian dan nyanyian lagu Jerman. Selain itu, turut memeriahkan suasana ada hiburan band dari Jakarta bersama penyanyi Debbie dan Samsudin. Pembawa acara dipercayakan pada MC Marasi Sibarani (Sekjen FKIJ) didampingi Femy.(rel/m09)

Tao Toba Star Lahirkan Penyanyi Bertalenta Emas Tao Toba Star memperebutkan Piala Gubsu H Syamsul Arifin sebagai kegiatan turut memeriahkan Pesta Danau Toba (PDT) 2010 bakal seru, selain hadiahnya cukup menggiurkan juga diharapkan mampu melahirkan bintang-bintang baru. Demikian disebutkan Andra Hasibuan-General ManagerVisi Production dan Visi FM selaku penyelenggara Tao Toba Star 2010 sambil menyebutkan, festival lagu Batak bertajuk Tao Toba Star 2010 ini akan memperebutkan piala Gubernur Sumatera Utara H. Syamsul Arifin, SE. Menurutnya, selain piala Gubsu, juga bakal disandingkan piala Radio Kardopa FM dan Ketua Panitia PDT serta hadiah puluhan juta rupiah. Even menarik ini akan melaksanakan seleksi di delapan kota/kabupaten yakni Medan 16 Oktober di gedung Kardopa, Jalan Iskandar Muda, Tebing Tinggi di lapangan parkir Radio DIS 16 Oktober, Siantar di Siantar Hotel 19 Oktober, Balige gedung balai desa 17 Oktober, Tarutung gedung Serba Guna 15 Oktober, Samosir di open stage Samosir 16 Oktober, Sidikalang di gedu-ng nasional Djauli Malik pada 12 Oktober dan Dolok Sanggul di lapangan bola setempat pada 15 Oktober. Disebutkannya, pendaftaran ditutup dua hari menjelang audisi di masing-masing kota. Kategori Tao Toba Star dibagi tiga yaitu solo, trio dan vokal grup yang bisa diikuti kalangan umum. Pemenang, akan ditampilkan di panggung utama Pesta Danau Toba pada 23 Oktober disaksikan perwakilan negara atau Menteri Pariwisata. Dengan ajang ini tidak tertutup kemungkinan akan lahir penyanyi bertalenta emas dan siap melejit ke kancah nasional atau internasional sekalipun. “Semoga pemenang nanti bisa dijadikan icon Indonesia

B8

WASPADA Senin 11 Oktober 2010

Tujuh Calhaj Kualuh Leidong Diupah-upah

Camat Drs H Syofyan Yusma, MSi dalam sambutannya, tahun ini sebenarnya ada 9 calhaj yang terdiri dari 4 kloter 2 orang tergabung dengan jamaah haji plus berangkat dari Medan, 3 orang melalui Kota Tanjungbalai tergabung dalam kloter 18, 2 orang berangkat melalui Kota Medan tergabung dalam kloter 16, serta 2 orang berangkat dari Kab. Labuhanbatu Utara tergabung dalam kloter 4 Hal ini sebaiknya tidak terulang lagi pada tahun tuhun mendatang, hendaknya seluruh

warga masyarakat Kualuh Leidong berangkat memunaikan ibadah haji sebaiknya bergabung dengan kloter dari Kab. LabuhanbatuUtara,memangpadatahuntahun sebelumnya jarak dari Tanjung Leidong ke Rantauprapat terlalu jauh, namun setelah pemekaran maka jarak tersebut tidak menjadi alasan lagi. Jamaah Calon Haji yang berangkat dari Kec. Kualuh Leidong di antaranya Nazaruddin Sinaga, anggota DPRD Kab. Labuhanbatu Utara dari Fraksi Golkar. Al Ustadz Hidayat Murni

Batubara, Spd.I dalam tausiyahnya mengatakan, melaksanakan ibadah haji merupakan kewajiban bagi orang yang mampu sebagai manisfestasi pelaksanaan rukun Islam yang kelima, oleh karena niat harus diluruskan agar memperoleh haji yang mabrur. Direncanakan jamaah calon haji yang tergabung dalam kloter 4 embarkasi Polonia Medan dilepas Muspika dan masyarakat Kualuh Leidong diberangkatkan dari Tanjung Leidong tanggal 11 Oktober 2010 mempergunakan kapal cepat melalui Tanjungbalai menuju Aek Kanopan dan tanggal 13 Oktober 2010 diberangkatkan Bupati Labuhanbatu Utara dari Aek Kanopan menuju Medan, lalu tanggal 14 Oktober 2010 akan terbang dari Polonia Medan menuju King Abdul Aziz Jeddah Saudi Arabia.(c01)

IBADAH HAJI ...

m aliran, namun soal haji lebih tampak kesepakatan dan kesepahaman mereka. Umat Islam begitu beragam, baik dari segi akidah-keyakinan, maupun fiqh-perbuatan, termasuk juga permasalahan tasawuf-spiritualisme serta filsafat-pemikirannya, namun ketika mereka berbincang tentang, terlebih ketika melaksanakan, ibadah haji, seluruh umat Islam dari segala penjuru dunia, dari latar belakang yang begitu beraneka, menjadi ummat wahidah, melebur menjadi umat yang satu dan bersatu dalam rangkaian ritual manasik haji. Ketika ada ketidaksepakatan di antara mereka, mereka sepakat untuk tidak sepakat dan harmonis dalam perbedaan. Umar bin Khattab, khalifah rasyidin ke-2, seorang sahabat dan panglima Rasulullah yang begitu dikenal tegas, keras, konsisten dan rasional, akhirnya berucap syahdu sembari menyadari keterbatasan diri: Aku tahu bahwa kau hanya sebungkal batu, tidak dapat mendatangkan mudrat atau memberi manfaat. Seandainya aku tak melihat Rasulullah menciummu, tentu aku tidak akan menciummu. Umar tentu tahu betapa batu yang sama sebelum Islam telah menjadi obyek sesembahan dan fokus

pensakralan kaum animismedinamisme penyembah berhala. Namun ia tahu bahwa ada makna lain dari yang lebih tinggi, lebih Islami dari tindakan Nabi tersebut. Bagi umat Islam sedunia melaksanakan ibadah haji, mengunjungi tanah suci Makkah dan Madinah serta melakukan rangkaian manasik tertentu merupakan panggilan khusus dan undangan istimewa dari Allah Yang Maha Pengasih dan Maha Penyayang terhadap pengikut Muhammad SAW. untuk mengun-jungi baitullah dan tanah suci. Ayat-ayat al-Qur’an begitu nyaring dan lantang menyeru dan mengundang umat Islam untuk berhaji setidaknya sekali dalam kehidupannya. Wa adzdzin fi al-nas bi al-hajj (Haji:27), dan serulah manusia untuk berhaji. Ajakan inilah yang terus berkumandang dan menarik umat Islam dari segala sudut bumi untuk dating dan berseru: Labbaik allahumma labbaik. Aku dengar, aku sadar, dan aku datang mematuhi panggilanMu, saya tiba menerima undangan-Mu. Pengalaman keagamaan berhaji ini tentu tidak sama bagi setiap orang, akibatnya juga sangat beragam, apalagi dampaknya kian beraneka. Namun

LABURA(Waspada): Camat Kualuh Leidong bekerjasama dengan Kepala Kantor Kementerian Urusan Agama Kecamatan melaksanakan upah-upah dan tepung tawar kepada 7 orang jamaah calon haji (calhaj) yang berasal dari kecamatan Kualuh Leidong.

Pernyataan ini dinyatakan oleh Robert Bianchi dalam artikelnya di The Oxford Encyclopedia of the Modern Islamic World (1995: 2:88). Bahwa haji, atau pilgrimage dalam bahasa Inggris, merupakan ritual yang terdapat hampir di seluruh agama, baik agama-agama besar dunia (world religions), maupun religi etnis-lokal, sudah lama dibuktikan dalam ilmu agama-agama. Namun rukun Islam kelima ini menjadi sesuatu yang unik, paling penting (the most important), dan menonjol (remarkable) dalam studi agama-agama karena tiga hal, yaitu doktrin ajarannya yang begitu tersentralisir, geografisnya yang terfokus bagus, dan historisnya yang terus terjalin berkesinambungan. Dua yang pertama akan menjadi perhatian kita kali ini.Yang ketiga akan dipaparkan pada tulisan lain. Doktrin Haji Haji adalah salah satu dari rukun Islam dari lima rukun yang disepakati oleh umat Islam seluruh dunia sepanjang masa dari semua mazhab yang pernah berkembang dan yang bertahan hingga sekarang. Meskipun umat Islam terdiri dari berbagai mazhab dan bermaca-

Makkah Mean Time (MMT): Mulailah Dari Sini

Waspada/Anum Saskia

KONSULTASI KESEHATAN : Seorang Calhaj yang tergabung dalam kloter 1 asal Labuhanbatu yang masuk Asrama Haji, Minggu (10/10) konsultasi kesehatan di ruang pemeriksaan kesehatan. Konsultasi bagi Calhaj sangat perlu guna mengetahui obat-obatan yang mereka perlukan dan obat yang mereka bawa dari dokter daerah asal. banyak sekali pengakuan dan pernyataan para jamaah haji yang men-ceritakan berbagai pengalaman relijius yang terkadang tak terpaparkan dengan kata. Mereka merasa menjadi ‘pribadi baru’, seakan ‘terlahir kembali’. Yang pasti mereka menda-patkan wawasan baru, mereka menjadi warga dari umat Islam universal-global yang melampaui batas-batas warna kulit, kebang-saan, bahasa, batasan jender, kelompok ras-etnis dan aliran politik. Geografi Haji Kalau doktrin haji tampaknya sudah ba-nyak dan lama disadari signifikansinya di kalangan umat Islam, tetapi aspek geografis haji sering terabaikan dan kurang disadari keistimewaannya. Haji merupakan perjalanan tahunan ke kota Makkah selama minggu kedua bulan Dzu al-Hijjah, bulan terakhir dalam kalender lunar yang diadopsi oleh umat Islam. Kalender lunar berarti ritual haji tidak mengikuti perjalanan matahari hingga selalu bergerak mengitari musim yang berganti. Ini berarti dalam siklus kehidupan satu generasi, seseorang bisa berhaji pada empat musim yang berbeda. Ritual haji harus terus terikat dan mengawasi ruang dan

waktu. Salah satu adalah batasan lokasi dalam bentuk miqat, yang menjadi tapal batas setiap calon haji di mana ia harus berniat dan memulai ritual manasik haji, terutama mengenakan pakaian ihram. Ritus inisial dari haji adalah tawaf yang dilaksanakan setidaknya dua kali – pertama ketika baru tiba di Mekkah dan kedua sebelum berangkat meninggalkan tanah haram setelah menyelesaikan rangkaian manasik. Tawaf adalah berjalan berputar sebanyak tujuh kali – berlawanan dengan gerak jarum jam – mengitari ka’bah.. Inilah dia yang menjadi obyek arah wajah dan tubuh umat Islam ketika berdoa dan berserah diri kepada Tuhan Yang Maha Esa. Seluruh umat Islam di planet bumi, bahkan juga di ruang angkasa, sebisanyaharus menghadapkan wajahnya ke arah masjid al-haram Makkah, atau lebih persisnya ke Ka’bah. Banyak ulama mengutarakan bahwa hal ini melambangkan kesatuan umat Islam ketika berserah diri pada Allah Yang Maha Kuasa. Ritual berikutnya adalah sa’i, yaitu berjalan cepat dan/ atau berlari kecil tujuh kali antara dua bukit, Safa dan Marwah, yang terletak tidak jauh dari Ka’bah. Ketika melaksana-

kan rangkaian ritual ini, setiap orang umumnya mengkonsumsi air zamzam, untuk diminum atau berwudu’, yang telah menyelamatkan Hajar dan Ismail puluhan abad yang lalu dan terus setia mengalir untuk kepentingan jamaah haji hingga hari ini. Puncak ibadah haji terjadi ketika terjadi prosesi massif berangkat ke padang Arafah di luar kota Makkah dan jutaan jamaah haji tinggal di tendatenda sembari terus berdoa, beribadah dan membaca kitab suci. Segera setelah matahari terbenam, massa manusia yang menyemut ini bergerak menuju Muzdalifah di mana para jamaah bermalam (mabit) di bawah langit gurun yang terbuka. Menjelang fajar menyingsing, gelombang manusia bergerak menuju Mina, sebuah padang gurun yang dalam sekejap berubah kota tenda terbesar di dunia. Inilah dia dua aspek penting, disamping aspek-aspek lainnya, yang menyebabkan ibadah haji dalam Islam dijuluki Ensiklopedia Oxford sebagai ‘unique among the world’s great pilgrimages’ (unik di antara ibadah pilgrimage yang agung di dunia ini). Selamat menunaikan ibadah haji!.

Selain menjelaskan berbagai ketetuan mengenai proses pelaksanaan ibadah haji, para ustadz dan pembimbing ibadah haji kita segera menjelaskan bahwa ibadah haji, terutama yang mencapai predikat mabrur, akan memperoleh ampunan dosa (ghufira lahu ma taqaddama min dzanbih : al-Hadis). Namun seringkali pembimbingan tidak dilanjutkan pada aktifitas pasca perolehan kemabruran, setelah kembali ke tanah air. Rasulullah Saw., menegaskan bahwa kemabruran merupakan titik awal (startig point) untuk melakukan sesuatu yang teramat penting, yakni perubahan; dari yang baik menjadi lebih baik, dari sikap arogan/sombong menjadi rendah hati, dari hidup yang bergelimang dengan korupsi menjadi lebih suci, dan dari sikap acuh tak acuh pada agama menjadi menjunjung agama dalam kehidupannya, dan dari islamophobia menjadi tulang punggung kemajuan dan perkembangan Islam di lingkungannya. Ibadah haji bukan ritual biasa, tapi ibadah ini adalah ritual pencapaian perubahan melalui kerangka (rites de passage); bertitik tolak dari yang profan melewati ambang pintu suci, kemudian kembali ke alam profan (biasa) dengan sejumlah perubahan. (Arnold Van Gennep, The Rites de Passage, 1960). Rasulullah Saw., menjelaskan bahwa ibadah haji yang sukses akan membuat pelakunya menjadi manusia suci, bagai saat dilahirkan ibunya (kayawmi waladathu ummuhu). Dengan demikian disini ada ‘permulaan’ yang memiliki arti yang sangat penting. Inilah yang yang sering kita lupakan dalam manasik haji kita. Perubahan itu—bagi jamaah haji tahun ini— akan memiliki arti yang lebih penting seiring dengan gagasan Arab Saudi,Khadim al-Haramyn, yang mencoba menggeser Greenwich ke Makkah. Lebih dari 125 tahun titik kawasan perbukitan di tenggara kota London (Greenwich) diakui sebagai pusat waktu dunia dan titik awal setiap hari baru, yang salah satu implikasinya membuat setiap muslim di berbagai bagian dunia secara tak terelakkan menyesuaikan diri meski waktu mereka beribadah sering tidak cocok, jika bukannya mendahului waktu shalat di Haram. Greenwich Mean Time (GMT) yang telah berjaya lebih satu abad, kini dicoba digeser dengan membentuk Makkah Mean Time (MMT) dengan Makkah sebagai pusat dan titik awal waktu. Dengan dibangunnya Abraj al-Bait (Menara Jam Raksasa) di kota Mekkah, dekat Masjidil Haram, maka ini akan menjadi acuan waktu bagi 1,5 milyar umat Islam di seluruh dunia. Bahkan akan dikembangkan menjadi rujukan waktu universal di seluruh dunia. Banyak hal yang perlu dibicarakan dalam kaitannya dengan Makkah Mean Time ini, akan tetapi yang teramat penting bagi kita disamping simbol-simbol itu adalah pentingnya umat Islam melakukan perubahan dari titik ini. Perubahan dari apa ke apa?: Dari keretakan dan keadaan umat Islam yang cerai beraimenjadiumatyangbersatuhinggamerekamemilikikekuatan dan daya tawar, dari sikap yang merunduk-runduk terhadap dunia Barat menjadi umat yang mandiri dan memiliki harga diri, dari manusia yang mementingkan diri sendiri menjadi manusia yang peduli pada yang lain, sebagaimana tradisi jama”ah haji di Makkah. Dari masyarakat yang tidak peduli pada agama manjadi lebih islami, dan dari manusia yang merasa diri cukup menjadi manusia yang butuh kepada tuhan. Dhuyufurrahman, para tamu Allah, berangkatlah rencanakanlah sebuah perubahan besar dalam dirimu, dalam keluargamu, dalam masyarakatmu, dan di tengah bangsamu. Di tempat itu teramat penting bagimu untuk mengikrarkan dan membangun prinsip perubahan itu. Wa Allahu A’lamu bi al-Shawab

Nama-nama Calon Jamaah Haji Kloter 3 Asal Tebingtinggi, Simalungun,Pematangsiantar Dan Medan Masuk Asrama Haji Selasa (12/10) Berangkat Rabu (13/10) Melalui Bandara Embarkasi Polonia Medan 01.Syamsul Bahri Nasution Bin Mahasan Nasution (TPHI), 02. Sujarno Amir Husin Bin Amir Husin,(TPIHI) 03. Purnama Sari Dalimunthe Binti H Bisma, (TKHI-dokter) 04. Ardiansyah Daulay Bin Tamrin Bin Tham, (TKHI-paramedis) 05. LizaWardani Mawardi Binti H Mawardi, 06. Pangadilan Dasopang.Drs Bin Tongku Bo, 07. Yusrihayati Harahap.Dra Binti H.Abu S, 08. Taing Dasopang Binti Tongku Bosar Dasopang. 09. Rosmalina Purba, Dra Binti Maren Purba, 10. Ahmad Ramlan, Ir Bin H. Sumi Damanik. 11. Samidi Bin Madamin, 12. Bungasor Br. Sinaga Binti Sihut Sinaga, 13. Mariati Binti Abdul Kai, 14. Samiati Binti Sarimin, 15. Yufrizal, Ir Bin Mhd.Yanis, 16. Elly Suriani Lubis,Spd Binti Syarbain, 17.Warsih Binti Sarijo, 18. Erlianda Purba Bin Samidin Purba, 19. Ernawati Lubis Binti Masri Azhar Lubis, 20. Perhatian Sembiring Binti Nangkasi Sembiring. 21. Alma Sary Siregar Binti Batang Ilung, 22. Fauziah Binti Saharuddin ( Alm), 23. Sanariyah Ns Binti Abdul Manan Nasution, 24. Surisnawati Binti Kiman, 25. Tenang Br Bangun Binti Rehmalem Bangun, 26. Nora Sibarani.Ba Binti Manahan Ferdin, 27. Pardamean Siregar.Drs Bin H.Ahmad Siregar, 28. Hamsar Bin Kalsum (Alm), 29. Abd Rahman Sitorus Drs Bin M Saleh Sitorus, 30. Syahriati Lubis Dra Binti Akhir Lubis. 31. Saenah Br Silalahi Binti Pautan Silalahi, 32. Supris Jumiati Binti M.Agusman (Alm), 33. Safniwati.Dra Binti Akmal Sk, 34. Eldi Vian, Drs Bin Fauzi, 35. Bawon Bin Wiryo Dimejo, 36. Darmayanti Binti Abdul Karim Lubis, 37. Gamarunnisa Binti Muhammad Farid, 38. Farida Rahman Binti Abdul Rahman, 39. Zahidun Nisa Binti Muhammad Farid, 40. Khairuddin Bin Haidir. 41. Salinun Sitopu Binti Saiman Sitopu, 42. Siti Hasnah Binti Ibrahim, 43. Nursani Purba Binti Jaudin Purba, 44. Nurdiah Binti Mahidin, 45. Rosnilawati Saragih Binti H.Baseran Saragih, 46. Sumiaty Saragih Binti H.Banden Saragih, 47. Siti Rohana Damanik Binti Gamat Damanik, 48. Rosmaida Siregar Binti Darajat Siregar, 49. Khairani Binti Bgd. Muara Simamora, 50. Bakri Bin Jalal. 51. Mhd. Nuh Bin Mhd. Ali, 52, Syaharuddin Purba Bin Muhammad Rasyid, 53. Lilik Bin Sukarta, 54. Nandang Hasanud-

din,Sh Bin E Mahmuddin, 55. Ety Cahyati,Dra Binti Uhay,H, 56. Siti Zahara Binti Abdullah, 57. Jannaiyah Binti Usman Purba, 58. Rukiyah Binti Bandar Damanik, 59. Awaluddin Lubis Bin Paim Bangun Lubis, 60. Habibah Lubis Binti Togu Lubis. 61. Aziah Binti H Umar Ali, 62. Nazaruddin Bin Syarif, 63. Boy Barkah Zakaria,Sh Bin Zakaria, 64. P.Sri Hariaty,Ir Binti Ahmad Kasdi, 65. Satini Binti Mahmud, 66. Damiran Bin Ngadiyo, 67. Marbut Bin Saridin, 68. Harnis Tanjung Binti Burhan Tanjung, 69. Sinem Binti Siorjo (Alm), 70. Jumiati Binti Marimin (Alm). 71. Saidjem Binti Siorjo (Alm), 72. Suryani Binti Abdul Wahab, 73. NartiWahyuni Binti M Salam, 74. Khairul Soma Lubis Bin Juned Lubis, 75. Eriani Binti Mahmud, 76. Parida Binti Ismail, 77. Herman Bin Hasan, 78. Zulfikar Umri Nasution Bin Ikhwan, 79. Herawati Siregar Binti Oloan Siregar, 80. Ikhma Zurani Binti Ir.Zulpan Nasution. 81. Habibah Binti Lamsah, 82. Titik Pelita Binti Sofyan Sori, 83. Siti Aisyah Binti H Harun Lubis, 84. Damiah Sinaga Binti Jaronom Sinaga, 85. Rustam Bin Kaswari, 86. Sri Utami Ningsih Binti Zainal Abidin, 87. Supri Mulyati Binti H Sukiran Adinoto, 88. Latifah Hanum Binti Abdurrahman, 89, Anna Binti M. Sani, 90. Azmah. B Binti Buhori. 91. Mariana Binti H. Zainal, 92. Piruz Binti Faqih Nu Man, 93. Chalidjah Binti Ulung Ismail, 94. Irda Binti Umar, 95. Jufri Bin Jamin, 96. Suryadarma Panjaitan, SH Bin M.Yusuf, 97. Syamsiah, SH Binti Senen Dola Usin, 98. SriWidiyanti Binti H.M. Husni, 99. Elly Surmaita, Dr Binti H.Mukarramin, 100. Nanang Fitra Aulia, Dr Bin H.M.Husni. 101. Poniman Bin Sademo (Alm), 102. Yenni Andriani, Sh,Spn Binti Abdi Kud, 103. Rina Andriani,Sp Binti Abdi K Mahyudi, 104. Paisah Binti Paijo, 105. Suriyasih Binti M. Yacub, 106. Aswiyah Binti Ms. Abdullah, 107. Ramdani Lubis Binti Mahyuddin Lubis, 108. Chazi Achmad Binti H. Achmad Yunus, 109. Sariman Panjaitan Bin Ali Panjaitan, 110. Siti Murni Binti Pungut Marjuki. 111. Siti Ramona Siregar Binti Amaransyah, 112. Nining Ermay Coryanie, Ba Binti H.Adi, 113. Ellya Warti A. Binti Hadiran Ulung, 114. Nurbaiti Nasution Binti Taha Nasution, 115. Ros-

diana Lubis Binti MYusuf Lubis, 116. Suderhan Nasution Bin Sa’aben, 117. Sukiran Bin Ngadimin, 118. Sumarni Binti Abd. Muthalib, 119. Untung Baritno, St Bin Basuki, 120. Magdalena Nasution Binti Panusunan Nasution. 121. Siti Jahrotin Binti Markum, 122. Siti Mariam Binti Nurel, 123. Murniaty Binti Djafarudin, 124. Goloman Syahputra Saragih Bin Likkat, 125. Siti Saleha Binti M.Y.Umar, 126. Agus Heriadi Bin M Yusuf Maulana, 127. Mastiana Nasution Binti H Kamaruddin, 128. Suibatul Aslamiya Binti Abd. Majid, 129. Husnidar Binti M. Zen, 130. Toni Tamrino Bin Nazaruddin. 131. Zaliarnis Binti Zairi, 132. Ummul Choirot Hasibuan Binti H.Syamsu, 133. Insan Lokot Nasution Bin Burhanuddin, 134. Nursila Binti Bagindo Tapar, 135. Salbiah Samosir Binti Zakaria Samosir, 136. Kamisam Binti Salman, 137. Sopiah Lubis Binti H Mhd Isa Lubis, 138. Mhd.Dewasa Bin Ilyas Zein, 139. Saparuddin Hasibuan Bin Marif Hasibuan, 140. Nurbi Binti Dtm Abdurrahman. 141. Sarman Bin Ranuji, 142. Teuku Moechtaruddin, Ir Bin H.Teuku M, 143. Nurhani Situmorang Binti R. Situmorang, 144. Suherni Binti Bainuddin Ahmad, 145. Rutkami Bangun Binti Pijer, 146. Maidarwaty Binti Bustami, 147. Suratno Bin Aton, 148. Razali Tanjung Bin Baginda Hasin, 149. Manidar Binti M Mersiri, 150. Aryati Djalal, Hj Binti Djalal. 151. Masliani Hasibuan Binti Abdullah Hasibuan, 152. Sutrisno Bin Amir, 153. Salbiah Saragih Binti Abdul Hamid Saragih, 154. Nur Halimah Saragih Binti Abdul Hamid, 155. Nurhabibah Nasution Binti H.Chaidir T, 156. Wardah Hanim Binti H.Chaidir Thaib, 157. Ibnu Damanik Bin Bahahuddin Damanik, 158. Darwin Harahap Sag Bin H.Dahlan Harahap, 159. Nasaruddin S Ag Bin Maramulia, 160. Norma Ba Binti Abdul Kholid Alm. 161. Sugiman Bin Marto Karyo I Alm, 162. Tuginem Binti Legimin Alm, 163. Sabarniaty Manurung Binti Jamuda Manurung, 164. Diriaman Nainggolan Binti Binden Nainggolan, 165. Gustinar Sinaga Binti Taulong Sinaga, 166. Dang Tjiptro Hasibuan Binti Natar Sut, 167. Erni Chairani Binti Noor Chalis Yusuf, 168. Endang Sriaseh Binti Saban Alm, 169. Baswan Bin

Nurdin, 170. Amran Harahap Bin Muda Harahap Alm. 171. Nurmislaini Binti Abd Halim Latif Alm, 172. Asniar Binti Asuari, 173. Mahdawani Binti Guntur Lubis,Alm, 174. Nadrah Dra Binti Uspanisya Alm, 175. Warmina Binti Keliwon, 176. Kaliderman Siregar Drs Bin Man Arif A, 177. Nuraini Binti Hasyim Alm, 178. Suminah Binti Sumuharjo Alm, 179. Warsih Binti Yahman, 180. Jono Bin Rabidin. 181. M.Yunus Bin AdamYusuf Alm, 182. Sriyati Binti Darmo Alm, 183. Thamrin Silalahi Bin Abdul Aziz Silalahi, 184. Rasmini BintiWiryodimejo, 185. Hadijah Nasution Binti Mustafa H Nasution, 186.Wasem Binti Sanmuraji Alm, 187. Rente Binti Berkat Ali, 188. Suliyah Binti Kasdullah Alm, 189. Rubes Bin Sarpin, 190. Niharto Bin Dirun. 191. Miskun Bin Dono Kario Alm, 192. Darwin Purba Bin Amiruddin Purba Alm, 193. Siti Aminah Binti Paijan Alm, 194. Wasikin Bin Arsasumita Alm, 195. Ngadinah Binti Ngadino Alm, 196. Suhady Hamid Bin Muhammad Asrori, 197. Irawaty Binti Kasan Wardi, 198. Lena Riyani BintiYahya Sulaiman, 199. Misnah Binti Said Alm, 200. Sidem Binti Cono. 201. Wagini Binti Kasimin, 202. Wagino Bin Selamat, 203. MYamin Purba Bin MYasin Purba, 204. Sarjono Al Tuel Bin Kowangit, 205. Parinah Binti Baedah, 206. Murniati Nainggolan Binti Z Arifin Nainggolan, 207. Sawiyah Binti Suriya, 208. Sawaluddin Bin Jafar Rasidi, 209. Sri Yanti Binti Jemiko, 210. Drs. Arifin Bin Abbas. 211. Samiun Al Paimin Bin Wakijan, 212. Sarni Binti Sukarmo, 213. Jumiati Binti Tukijo, 214. Ambaruddin Bin Abu Sungeb Alm, 215. Hamdan Lubis Bin H Amirsyam Lubis, 216.Yusrida Lubis Binti H Mahmudin Yahya, 217. Hj.Syamsidar Chaniago Binti Kataruddi, 218. Rahmayati Lubis Binti Panusunan Lubis, 219. Khairani Piliang Binti Abdulmuluk Jam, 220. Keliyem Binti Noso. 221. Masliana Siregar Binti Agus Salim Siregar, 222. Hindun Bin Parjo, 223. Leginem Binti Amprun Alm, 224. Fatimah Sirait Binti Jamil Sirait, 225. Tambrin Bin Sahbul Alm, 226. Nuraini Binti Tarmuzi H, 227. Ratna Samosir Binti Manuntun Samosir, 228. Saminem Binti Amat Musin Alm, 229. Sami Binti Kasni Alm,

230. Siti Amra Rambe Binti Namora Julu Lubis. 231. Jamil Nasution Bin Mhd Rasyid Nasution, 232. Masitoh Sinaga Binti Suma Sinaga, 233. M Juri Bin Wonoharjo, 234. Wiji Binti Kromorejo, 235. Paiman Bin M Muntari, 236. Mariaman Br Sinaga Binti Abdul Manap, 237. Sowito Abraha Bin Samingun, 238. Sutiyah Binti Sutiyo, 239. Jawiyah Binti Alm Sadli, 240. Yatimah Binti Alm Sadli. 241. Abdul Munir Bin Abdul Mukti, 242. Juminem Binti Santarji, 243. Ponirah Binti Sanmulio, 244. Tukina Binti Pawirodiweryo Alam, 245. Muhammad Thohir Bin Martodikromo Alam, 246.RusdiantoBinAsmorejo,247. Marliyah Binti H Sarudola Lestari, 248. Maswan Nk Daulay Amk Bin Nuski Daulay, 249. Amin Bin Wagiman, 250. Bahrum J Bin Alm.Jarkasih. 251. Ngatiyem Binti Sumali, 252. Misnah Binti Juri Alm, 253. Sunarmi Binti Surip, 254. Maurung Purba Binti Aristarkus Purba, 255. Saminah Binti Sumiran, 256. Mukhtar Lubis Drs Bin H.Mahyuddin Lubis, 257. Junaini Sihotang Spd Binti Lt Sihotang, 258. Muhammad Satim Bin Palal, 259. Dasam Bin Sanumar Alm, 260. Mudjinem Binti Asmordjo (Alm). 261. Saodah Binti Majusen Alm, 262. Bungarin Manurung Binti Likkar Manurug, 263. Nuraisiah Sinaga Binti Kaiman Sinaga, 264. Kaman Sinaga Bin Jogim,Alm, 265. Sainah Saragih Binti Baharun Saragih, 266. Jaliah Binti H.Mas Sarmo, 267. Wagiran Eryanto Bin Paiman Alm, 268. Sunarti Binti Nadi Alm, 269. Paini Binti Paiman Alm, 270. Teguh Subandi Bin Sumadi. 271. Salikin Bin Wongso Karyo, 272. Erlangga Hasibuan Bin Muslim Hasibuan, 273. Tukiyah Binti Tohar, 274. Supiah Br Manurung Binti Lusten Manurung, 275. Salinim Br Damanik Binti Horali Damanik, 276. Salim Bin Astamija, 277. Sukarni Binti Pardi Alm, 278. Amsiah Binti Maas H, 279. Kaliam Manurung Binti Tuan Sumalin Manurung, 280. Sikin Br Sitorus Binti Rubiyah Sitorus. 281. Drs.Nala Gromi Bin Syamsul Bahri Rambe, 282. Dasro Bin Dipan, 283. Usman Siregar Ba Bin Syarif Siregar, 284. Tumini Binti Saiman, 285. Suprapto Bin Joyo Sumarto, 286. Darminah Binti Ahmad, 287. Yadimin Bin Karsidi, 288. Amnah

Binti Kuat, 289. Muhammad Syukur Bin Muhammad Sukemi, 290. Leginem Binti Sardi. 291. Masdewi Lubis Binti Alimuddin Lubis, 292. Paulina Siregar Binti Elipas Alm, 293. Rahmat Syahputra Harahap Bin H Mara L, 294. Hermon B.S Bin Bachtiar, 295. Sarif Bin Kacung, 296. Jumiati Binti Muchsin, 297. Nurhasanah Siregar Binti Rahang Siregar, 298. Nurjani Harahap Binti Mhd Jamin Harahap, 299. Mesja Binti Tukijo, 300. Nurgrahma Siregar Binti H Daulay Siregar. 301. Fuji Sri Hartati Binti Zubir, 302. Ida Astuti Nasution Binti Anwar Bey N, 303. Saodah Saragih Binti Aman Saragih, 304. Khairil Akbar Siregar Bin Parlaungan, 305. Zunawan Bin Mesdi Zonno, 306. Lely Heriyati Br Lubis Binti Burhan L, 307. Hasnah Binti Abdul Rahman, 308. Tri Haryani Binti Muchtar Saidi, 309. Nurhayati Damanik Binti Handang Damanik, 310. Mariana Chaniago Binti Baginda Ali. 311. Waginem Binti Parto, 312. Ngatiyem Binti Sulaiman, 313. Sirah Binti Sarkam, 314. Ramlah Nasution Binti Djamaluddin Adi, 315. Amir Syarifuddin Drs Bin Nur Hasan, 316. Sunardi Selamat Mm Bin Selamat, 317. Tavipianti Binti Siman S, 318. Musiem Binti Saimin, 319. Netty Binti Gulam Muhammad, 320. Siti Hadjar Napitupulu Binti Abdur. 321. Murtiningsi Katmiran Binti Mangun Kat, 322. Mentes Hidaya Binti Siman, 323. Senen Binti Siman, 324. Armaini Binti Amiruddin Ar, 325. Zulkifli Ir Bin Ponimin, 326. Hariadi Bin Bugel, 327. Prayugo,Drs Bin Muhadi, 328. Endang Ismayuti Binti Bambang Gunawan, 329. Saminem Binti Ponidjo, 330.Yati Binti Amat Kurdi. 331. Nurdiani Siregar Binti Tongku Upar Siregar, 332. Junaida Nasution Binti M Ilyas Nasution, 333. Warsiah Asni Binti Drs.H.Poniman Hadi, 334. Indahsari Binti Drs.H.Poniman Hadinot, 335. Khairina Binti Hasan Basri, 336. Makmur Setyadi,Sh Bin H.Poniman Hadin, 337. Irzam Gani Bin Masri Gani, 338. Abdul Haris Nasution Bin H Ahmad Nasution, 339. Nur Asiah Binti H Adnan Yahya, 340. Achmad Syukri Bin Masalan. 341. Nurhana Binti H.Bahrum Idris, 342. Nurhayati Siregar Binti Abu Bakar Siregar, 343.

Rubiyem Binti Kantur, 344. Amnah Br Lubis Binti M Arif Lubis, 345. Nilawati Harahap Binti Mhd. Siddik Harahap, 346. Rosmawati Binti Rusdiman, 347. Masiha, Ba Binti Alhafiz H.Gulrangsha, 348. Herman Manan Bin H.Abdul Manan, 349. Masir Siregar Bin Muslimin Siregar, 350. Dul Karie Tiar Bin Tiar. 351. Sulaiman Batubara Bin Bachtiar Batuba.352.Ibrahim Parapat Bin Ahmad Rudin.353. Rosmita Br Hutajulu Binti Hermanus Hu.354.Sumiati Binti Imam Suadi. 355.Lasmi Binti Syamsuddin.356. Nurah Binti Monggong.357.Rafiah Binti Karjan.358.Afiani Se Binti Amin Busro.359. Elida Binti Lukman Hakim. 360. Dr Andi Buchari Bin Amin Busro. 361.Ashar Lubis Bin Japinayungan Lubis. 362.Mohd Zuis Lubis Bin Abdul Kader Lubis. 363. Anas Hia Bin Masahudin. 364. Martisah A Binti Akasah.365. Tammat Tarigan,Ir Bin Lembab Tarigan.366.Chairani,Ar Binti H.Anas Rasyid..367. Suriyani Binti Abdullah.368. Siti Hamar Br.Siagian Binti Thohir. 369. Nuryati Damanik Binti Jawadin Damanik.370.Pantas Binti Supeno. 371.H.Harun Jafar Hasibuan Bin H.Jafar.372.Rustam Siregar Bin Marabangun Siregar.373.Rosmawar Binti H Rahman. 374.Pujiati Binti Yadi. 375.NurlindaTanjung Binti Muslim Tanjung. 376.Upik Purba Binti Tayok Purba. 377.Tukina Binti Pawang.378. Siti Aisyah Nasution Binti Jabal Nas. 379. Abdul Halif Batubara Bin Kumpul Batub 380.Nurhaida Sinaga Binti H Yusuf Sinaga. 381.Rosita Sinaga Binti H Yusuf Sinaga.382.Ramadhan Siregar Bin Ibrahim Siregar. 383. Syawal Effendy Piliang,Ba Bin Mok Mud.384.Asliah Sitohang Binti M.Kasim Sitohan.385. Suarti Binti H Sahiran. 386.Siti Aisyah Lubis Binti Djaupar Lubis.387.Zubaidah Binti Jamian Suratmin. 388. Mariatun Sitohang Binti Mhd.Kasim Sit.389.Nurhasanah Binti Oka Bahtera.390.Rahmad S.Siregar Bin Machmud Siregar. 391.Cikrak Binti Abdullah. 392.Rumini Binti Amir. 393. Fachri Siddik Batu Bara Bin Aminullah.394.Mahyudin Ir Bin H St Zaharuddin.395.H.Rusly Dalimunthe Sh Bin H.M Rasyid. 396.Masitah Sebayang Binti H.M Rinta Seba.397.Sukinik Binti Inan.398.Sumartik Binti San-

tarwi.399.Tuginem Binti Sumo. 400.Samiran Bin Ahmad Dasuki. 401.Aniderlina Saragih Binti Artilam Sara.402.Muhammad Ali Purba Bin Lamsyah Purba. 403.Dahris Siregar Bin H.Syahruddin Siregar.404.Abd. Karim S.Sos Bin Nurdin. 405. Nurhayati Binti M. Badrus. 406. Nuraini Harahap Binti M. Tamin Harahap.407.Agustina Tanjung Binti H.M Nasir Md.408.Delaina Binti Bahazar.409. Rita Wati Binti Mhd. Jaslidarto. 410. Zullastri Moenzil Binti Moenzil. 411.Parni Binti Rasan Kemis. 412. Ratiyah Harahap Binti Maharaja Harahap. 413. Dra. Salmah Harahap Binti Maharaja Harahap. 414.Burhanuddin Nasution Bin H.Ali Hasan.415. Suryati Binti Nasman Batubara. 416. Jarisah Binti M.Yatim. 417. Chairun Nisa Binti AsliYahya.418.Masinah Binti Abdul Hamid. 419.Mahyuni Binti Alex Naden. 420.Suarni, Sh Binti Mhd. Idris Sp Pengul. 421.Dra. Suarmis Binti Mhd.Idris Sp Pengu. 422.Lita Nurlina Binti Laman. 423.Shinta Irmawati Binti Kamrul.424. Benno Bin Wono Karyo.425. Bangun Pasaribu Ir Bin Tamal Pasaribu.426.Jupriah Sarifah Ir Binti Idris Sulaim.427 Delima Nasution Binti Asram Nasution 428. Sakdiyah Binti Kasan Pawiro.429. Sukimin S Bin Yasmarta. 430. Zulham Hanafi Bin Hasanuddin. 431. M.Nurdin Lbs Bin Abd.Rahman Lbs.432. SitiYohani Binti Saiman. 433. Aulia Rachman Bin H Razali Doyong. 434. Ridwan Zein Bin Mhd Zein.435.Wan Aisyah Binti H Wan Basmi 436. HariyanaBintiHarunnuddin.437. Milda Sundari Binti H.Suriyadarma. 438. Ricka Indika Binti Burhanuddin. 439. Lanny Kusmini Binti H MisranToepono.440 Nurka-san Bin M Amsi. 441. Darwin Hasibuan Bin Abdul Halim Hasib.442. Nurmala Sihombing Binti Haidir Sihombing. 443. Suwarni Binti Badri. 444 .M.Sanusi Ismail Bin M.Ismail.445. Safi’i Bin M.Sarif. 446. Sadin Bin Wagiman. 447. Zainabun Binti Hm.Syam. 448. Razali Doyong Bin Naam. 449. Drs.Ramlan Bin Solehani.450 .Andryani Binti Abd.Azis. 451 .Salasiah Binti Umar. 452. Rusli Bin M.Yahya. 453 . Risyanto Bin Laidin Purba.454 .Emy Risma Binti M. Kamsir. 455. Nurliana Binti Umar Efendi. (m36/m32/h10)

Sumatera Utara

WASPADA Senin 11 Oktober 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:16 12:29 12:17 12:24 12:23 12:20 12:16 12:12 12:19 12:18

‘Ashar 15:28 15:44 15:29 15:38 15:37 15:30 15:28 15:24 15:31 15:32

Magrib 18:19 18:31 18:19 18:26 18:26 18:24 18:20 18:15 18:22 18:21

‘Isya

Imsak

Shubuh Syuruq

Kota

19:27 19:40 19:28 19:34 19:34 19:32 19:28 19:24 19:30 19:29

04:46 05:00 04:47 04:55 04:54 04:50 04:47 04:42 04:49 04:49

04:56 05:10 04:57 05:05 05:04 05:00 04:57 04:52 04:59 04:59

L.Seumawe 12:22 L. Pakam 12:15 Sei Rampah12:14 Meulaboh 12:26 P.Sidimpuan12:13 P. Siantar 12:14 Balige 12:14 R. Prapat 12:11 Sabang 12:29 Pandan 12:15

06:11 06:25 06:11 06:19 06:18 06:14 06:11 06:07 06:14 06:14

Zhuhur ‘Ashar 15:36 15:27 15:27 15:39 15:23 15:26 15:25 15:22 15:44 15:26

C1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:24 18:18 18:17 18:29 18:17 18:17 18:18 18:14 18:31 18:19

19:33 19:26 19:25 19:37 19:25 19:26 19:26 19:23 19:40 19:27

04:53 05:46 04:45 04:57 04:43 04:45 04:44 04:41 05:00 04:45

05:03 04:56 04:55 05:07 04:53 04:55 04:54 04:51 05:10 04:55

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:15 12:17 12:27 12:19 12:16 12:23 12:11 12:22 12:15 12:14

18:19 18:20 18:29 18:23 18:19 18:26 18:15 18:25 18:18 18:17

19:27 19:28 19:37 19:31 19:28 19:34 19:23 19:33 19:26 19:25

04:45 04:47 04:57 04:49 04:47 04:54 04:42 04:52 04:44 04:44

04:55 04:57 05:07 05:03 04:57 05:04 04:52 05:02 04:55 04:54

Panyabungan 12:12 Teluk Dalam12:19 Salak 12:17 Limapuluh 12:13 Parapat 12:15 GunungTua 12:12 Sibuhuan 12:12 Lhoksukon 12:21 D.Sanggul 12:15 Kotapinang 12:10 AekKanopan 12:12

06:17 06:10 06:09 06:21 06:08 06:09 06:09 06:05 06:25 06:10

15:25 15:28 15:41 15:30 15:29 15:37 15:23 15:34 15:25 15:26

06:10 06:11 06:22 06:14 06:11 06:18 06:06 06:16 06:09 06:09

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

PERBAUNGAN (Waspada) : Satuan Narkoba Polres Serdang Bedagai membekuk dua pengedar shabu-shabu yang sedang menanti pembelinya di kawasan Desa Citaman Jernih, Kec.Perbaungan, Jumat (8/10). Selain meringkus keduanya petugas juga mengamankan shabu seberat 1,6 gram yang disimpan di dalam plastik warna putih bening sebagai barang bukti. Kedua tersangka itu adalah, RCS alias Mikel alias Belanda, 30, warga Desa Citaman Jernih, dan RL alias I, 33, warga Desa Penara, Tanjung Morawa. Menurut keterangan di kepolisian, Minggu (10/10), kedua tersangka ini sudah menjadi incaran petugas sebab disinyalir sudah lama menjadi pengedar shabu-shabu. Kasat Narkoba AKP Novi Erdi didampingi Kasubbag Humas Polres Sergai Iptu Zulkarnain Siregar membenarkan telah mengamankan dua tersangka pengedar shabu-shabu. (a07)

Polres Langkat Giatkan Razia Antisipasi Teroris

Walikota Binjai Akan Buka Musdalub MUI BINJAI (Waspada) :Walikota Binjai HM Idaham direncanakan membuka Musyawarah Daerah Luar Biasa (Musdalub) Majelis Ulama Indonesia (MUI) Kota Binjai, Sabtu (16/10). Hal itu dikemukakan Walikota HM Idaham ketika menerima panitia Musdalub dipimpin Zulkarnain Asri didampingi Misman dan H Prasojo, Jumat (8/10). Idaham juga menyerahkan bantuan hibah Rp25 juta untuk MUI yang diharapkan bantuan tersebut bisa dipergunakan untuk organisasi, administrasi MUI Kota Binjai. MUI Binjai mengadakan Musdalub untuk memilih kepengurusan baru, setelah beberapa pengurus sempat menyatakan membubarkan diri. Beberapa pengurus MUI Binjai mengemukakan,hal tersebut tidak perlu dibicarakan lagi.Yang pasti kepengurusan lama sudah memutuskan mengadakan Musdalub. Majelis Ulama Indonesia diharapkan memilih kepengurusan secara demokrasi tanpa meninggalkan ciri khas keulamaan dan harus mampu menjadi panutan.Sebab MUI merupakan organisasi yang berkaitan dengan agama. (a03)

50 Mahasiswa STAIS T. Tinggi Diospek TEBINGTINGGI (Waspada) : 50 mahasiswa Sekolah Tinggi Agama Islam (STAIS) Tebingtinggi Deli mengikuti Orientasi Study PengenalanKampus(Ospek)diKampusKomplekMtsPercontohan. Orientasi yang berlangsung 3 hari Senin hingga Rabu (4-6/10) digelar Badan Eksekutif Mahasiswa (BEM) STAIS. Ketua STAISTebingtinggi Deli Kh Suherman diwakili Pembantu Ketua III Ismail usai penutupan orientasi pembekalan mahasiswa baru mengatakan, ospek bukan ajang balas dendam antara mahasiswaseniordanjunior.Akantetapiospeksebagaisaranapencerahan dan pengenalan tentang sistem pendidikan di perguruan tinggi. Peserta Ospek didominasi wanita terdiri dari jurusan Pendidikan Agama Islam (PAI), Manajemen Ekonomi Islam (MEI) dan Komunikasi Islam (KOMI) untuk kelas regular dan eksekutif. Setelah mengikuti ospek diharapkan mahasiswa lebih aktif mengikuti perkuliahan. Ketua BEM STAIS Tebingtinggi Deli Muhammad Bayu Dermawan mengatakan, dalam pelaksanaan ospek kali ini lebih menekankan kedisiplinan dan daya kritis mahasiswa. Dengan materi-materi yang diberikan, diharapkan dapat mencerahkan jiwa dan pikiran mahasiswa baru. (a09)

BKPRMI Langkat Siap Gelar Musda STABAT (Waspada):Terciptanya suasa yang kondusif di Langkat, tidak terlepas dari semua komponen masyarakat dan elemen kepemudaan yang semakin dewasa dalam bersikap. Kita semua sangat dan patut bersyukur dengan suasana yang demikian sebagai modal untuk terus membangun daerah dari seluruh aspeknya. Demikian kata Bupati Langkat Ngogesa Sitepu saat menerima Panitia Musda Badan Komunikasi Pemuda dan Remaja Mesjid Indonesia (BKPRMI) Langkat, di rumah dinas bupati di Stabat, Selasa (5/10). Menyinggung pemilihan pengurus, bupati menegaskan tidak ada calon titipan atau intervensi. Kita yakin BKPRMI akan memilih kader terbaiknya sebagai pengurus. Bupati juga mengajak BKPRMI untuk tetap konsisten menjalankan visi misi organisasi karena telah sejalan dengan programnya guna mewujudkan Bumi Langkat Yang Religius. Sebelumnya, Edi Syahputra selaku Ketua Panitia Musda didampingi EmriYulizar Amri, M. Jamin, Suyono, Kurnia Amir dan Mahmuzar melaporkan, Musda berlangsung 8 Oktober 2010 dan panitia berharap kehadiran Bupati sekaligus mohon dukungan bagi suksesnya regenerasi di tubuh BKPRMI Langkat.(a01)

15:21 15:28 15:28 15:25 15:26 15:22 15:21 15:35 15:26 15:20 15:23

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:16 18:23 18:20 18:16 18:18 18:15 18:15 18:24 18:19 18:13 18:15

19:24 19:31 19:29 19:24 19:26 19:24 19:23 19:32 19:27 19:22 19:23

04:42 04:49 04:47 04:43 04:45 04:42 04:41 04:52 04:46 04:40 04:42

04:52 04:59 04:57 04:53 04:55 04:52 04:51 05:02 04:56 04:50 04:52

06:06 06:13 06:12 06:07 06:09 06:06 06:06 06:17 06:10 06:04 06:06

Warga Keluhkan Jalan Karya Wisata Ujung Rusak Dan Tak Ada Parit

Polres Sergai Bekuk Dua Pengedar Shabu

P.BRANDAN (Waspada): Kabag Ops Polres Langkat mengaku belum mengetahui secara detail ada atau tidak keterkaitan aksi perompakan bersenjata yang dialami nelayan di Langkat terhadap aksi dari kelompok teroris. “Petugas Pol Air intensif menjaga keamanan di laut, namun sampaisaatinibelumadamemberikaninformasitentangkerawanan di laut,” ujar AKP Deddy S, di sela razia gabungan Polres Langkat dan Marinir, Sabtu (9/10). PantauanWaspada, razia diikuti sejumlah perwira di antaranya AKP Marjo, AKP HM Kosim Sihombing, AKP Lindung Marpaung, Wadanyonif Marinir-8, Mayor Mar Romy Hutagaol dan Lettu Mar Bambang. Kabag Ops mengatakan, razia gabungan ini merupakan kelanjutan kesepakatan antara Panglima TNI dan Kapolri menyusul penangkapan teroris yang dimulai dari Tanjungbalai, Hamparanperak, dan Dolok Masihul. Kabag Ops mengatakan, razia ini untuk mempersempit ruang gerak kelompok teroris yang belum tertangkap. “Kita berupaya menekan sedini mungkin rekam lintas teroris di jalur lintas MedanAceh dan sebaliknya,” kata Eddy. Menyinggung apakah ada kemungkinan kelompok bersenjata telah masuk dan bermain di Langkat, ia mengatakan, indikasi itu belum ada. Namun begitu, ruang gerak komplotan ini terus dipersempit. Untuk mengaplikasi kesepakatan antara Panglima TNI dan Kapolri, aparat Polres Langkat menggalang kerjasama dengan Batalyon Infanteri-8 MarinirTangkahan Lagan dan Batalyon Reider. Danyonif Marinir Letkol Mar Bambang Hadi Suseno mengatakan, pihaknya siap mem-back up kepolisian untuk menangkal jaringan terorisme dan kelompok bersenjata lainnya. (a02)

Zhuhur ‘Ashar

Waspada/dede

MAKIN PARAH: Rusaknya sebagian ruas Jalan Karya Wisata Ujung, Kec. Namorambe, Kab. Deliserdang kondisinya semakin parah serta nyaris tidak adanya parit di kiri dan kanan badan jalan itu, dikeluhkan warga. Apalagi belakangan ini curah hujan cukup tinggi mengakibatkan jalan ini acap kali digenangi air. Foto direkam, Sabtu (8/10).

Kompor Meledak, Ibu Dua Anak Kritis SIMPANGKAWAT (Waspada): Kompor minyak tanah meledak, ibu dua anak menderita luka bakar dan kritis, Minggu (10/10) sekira pukul 05:30. Informasi dihimpun Waspada menyebutkan, korban Ngatiyem, 28, warga Dusun 8, Desa Sukaraja, Kec. Simpangempat, Kab. Asahan, saat pagi hari sedangmemasak,namunminyak tanah dalam kompor habis, sehingga mengisinya dengan keadaan api masih menyala. Akibatnya api menyambar dan langsungmeledaksehinggatubuh ibu dua anak itu terbakar. Nyawa korban sempat tertolong karena sang suami, Syarial, 30, langsung berusaha memadamkan api dan meminta bantuan tetangga untuk membawa istrinya menjalani pera-

watan di Rumah Sakit Umum T Mansur Kota Tanjungbalai. Direktur RSU Tanjungbalai Diah Retno, melalui petugas unit gawat darurat Ilin Sundari mengatakan,saatsampaidirumah sakit sekujur tubuh korban mengalami luka bakar dan kini tengah dirawat intensif karena kondisinya kritis. Kapolres AsahanN AKBP J Didiek Dwi Priantono, dikonfirmasi Waspada melalui Kapolsek Simpang Empat AKP Rudi Candra, membenarkan peristiwa tersebut. Hingga saat ini masih dilakukan penyidikan terhadap kasus tersebut dengan meminta keterangan Syahrian, dan melakukan olah TKP. “Kita masih mangumpulkan data tentang penyebabkajadian.Tidaktertutup kemungkinan ada motif lain dari kejadian itu,” kata Rudi. Rudi juga mengimbau kepada masyarakat, untuk berhatihati saat memasak menggunakan kompor atau gas, pastikan

api padam saat dilakukan pengisian minyak, dan kencangkan penutup gas. “Lebih baik kita mancagah daripada mengobati dan selalu waspada,” kata Rudi. Tabung Gas Meledak Sementara itu, satu kios berukuran 4 x 4 meter musnah terbakar di Desa Stabatlama, Kec. Wampu, Langkat, Sabtu (9/10) malam. Tidak ada korban jiwa dalam kejadian itu, namun sejumlahuangdansatuhandphone yang berada dalam kios musnah terbakar. Pemilik kios, Ucok, saat kejadian tidak berada di rumah karena sedang menghadiri acara pernikahan. Sementara istrinya Laila dan anaknya Irham yang berada dalam kios selamat tanpa menderita luka. Kejadian tersebut berawal saat listrik padam sekira pukul 19:30. Laila memasang lampu teplokuntukmenerangidagangannya. Sesaat kemudian Irham

mendengar suara tabung gas yang bocor. Belum sempat dia mengeceknya empat tabung gas elpiji ukuran tiga kilogram meledak. Sementara dua tabung lainnya yang kosong turut meledak. Ledakan kemudian disertai berkobarnya api yang menghanguskan isi kios dengan cepat, karena mereka juga menjual bensin dan minyak tanah. Dagangan bensin tersebut akhirnya menjadi bahan bakar untuk menghanguskan kios dalam waktu singkat. Sang ibu dan anaknya hanya dapat menyelamatkan diri tanpa mampu berbuat banyak. Sementara sejumlah warga setempat akhirnya dapat memadamkan api beberapa saat kemudian. Kerugian atas kejadian itu ditaksir pihak korban belasan juta rupiah. Aparat Polsek Stabat kini masih menyelidikilebihlanjutpenyebab kebakaran. ((crs)a38)

Dituduh Mencuri, Warga Secanggang Diamuk Massa Padahal Hanya Numpang BAB STABAT (Waspada): Seorang pria, warga Secanggang akhirnya dapat kembali berkumpul bersama keluarganya setelah diamankan di Mapolsek Padangtualang selama sembilan jam. Kasus yang menimpanya bukan terkait terorisme, narkoba ataupun pembunuhan, melainkan karena hendak membuang air besar (BAB) di toilet rumah warga. Pria berkulit hitam itu dituduh hendak mencuri hingga diamuk massa, padahal tidak ada barang bukti. ‘’Nyawa pun saya taruhkan, saya hanya ingin membuang air besar,’’katanyasaatdiperiksapolisi,

Jumat (8/10). Sehari-hari pria tersebut bekerja sebagai pencari barang rongsokan ke desa-desa untuk dibeli. Pengakuannya di Mapolsek Padangtualang, awalnya karena tidak dapat lagi menahan buang air besar, ayah dua anak itu mengetuk pintu rumah seorang warga di DesaTegal Rejo Kec. Padangtualang untuk menumpang buang air. Namun setelah dipanggil beberapa kali tidak ada jawaban, pria berinisial A itu bergegas masuk ke toilet yang berada di luarrumah.Sesaathendakmasuk, seorang warga setempat me-

manggilnya dan menanyakan identitasnya. Namun entah bagaimana A kemudian dipukuli sejumlah warga di sekitar lokasi sebelum akhirnya dijemput polisi untuk diproses lebih lanjut. Camat PadangtualangYafizham ketika dimintai konfirmasinya membenarkan kejadian itu. Menurut informasi yang diperolehnya, sejak A melintas di desa itu mengendarai sepeda motor warga setempat merasa curiga dengangerak-geriknya,ditambah dia bukan penduduk setempat. Kecurigaan warga bertambah setelah terlihat beberapa kalung

emas dan jam tangan di jok sepeda motor pria tersebut, disangka hasil kejahatan hingga terjadi pemukulan. Meski akhirnya warga Secanggang yang dimaksud tetap mengaku tidak mencuri bahkan tidak terbukti melakukan tindak kejahatan, dia ikhlas dengan apa yang terjadi dengannya Jumat siangitudantidakmenuntutbalik. ‘’Inilah pelajaran berharga bagi saya masuk ke desa orang,’’ ujarnyasambiltertunduklemassesaat sebelum meninggalkan Mapolsek Padangtualang setelah ada jaminandaripihakkeluarga.(a38)

Keluarga Taufik Terpojok Soal Isu Gerombolan Bersenpi DOLOKMASIHUL (Waspada): Pemberitaan di beberapa media terbitan Medan dan Dumai terkait baku tembak antara gerombolan kelompok bersenjata dengan Gabungan TNI/Polri yang menewaskan Taufik Hidayat, Sabtu (2/10) di Dusun IV Marihat Bandar, Desa Dolok Sagala, Kec.Dolok Masihul, Serdang Bedagai dan menghubungkannya dengan Taufik yang pernah tinggal di Dolok Masihul selama 9 tahun itu dianggap sangat memojokkan. Ungkapan itu disampaikan ibunda Taufik Hidayat, Misnah, 58,didampingikakakdanadiknya, Diana,37,danistriTaufik,Marfiani br Siagian, 29, Jumat (8/10) sore di kediaman Adi Nyoto Susanto di Dusun I, Desa Dolok Manampang. “Awalnya kami tidak begitu menghiraukan berita itu, namun adik bapak, Surya, 53, yang tinggal di Dumai mengaku kaget mem-

baca koran sehingga mengirimkannyakerumahmelaluitaxi,” kata Misnah. Pihak keluarga sempat kerepotan dan sempat mempercayai 100 persen bahwaTaufik Hidayat yang tewas adalah anak saya, padahaltidaksamasekali,“ungkap ibu dari 9 anak itu. “Bagaimanatidakkagetbang, dalam berita itu cukup jelas alamat dan nama sekolah tempat saya belajar, bahkan dalam berita tersebut ayah saya Karim Hidayat dikatakantelahmeninggaldunia,” kata Taufik. Bahkan Kepala Desa Dolok Manampang Edi Resmanto dan Kepala Sekolah SMP Alwasliyah 3 Pekan Dolok Masihul Agus haris Fadillah mengaku sangat terganggu dengan pemberitaan itu, karena terus mendapat pertanyaan dari setiap orang bahkan dari Alwasliyah Kabupaten tentang kebenaran berita itu. “Namun kami lega setelah

Waspada/Edi Saputra

Taufik Hidayat, 38, (tengah bersama keluarga ketika berada di rumah sepupunya Adi Nyoto Susanto (paling kanan) seusai berkunjung ke SMP Alwasliyah 3 dan beberapa teman sekolah, foto direkam, Jumat (8/10) sore di Dusun I, Desa Dolok Manampang, Kec.Dolok Masihul. melihat kedatanganTaufik Hida- yang sedang berkembang terkait yat bersama keluarga ke sekolah peristiwa tewasnya pelaku peini sehingga dapat menepis isu rampokanitu,”tambahAgus.(ces)

NAMORAMBE (Waspada): Rusaknya sebagian ruas Jalan Karya Wisata Ujung, Kec. Namorambe, Kab. Deliserdang serta nyaris tidak adanya parit di kiri dan kanan badan jalan itu, dikeluhkan warga. Kalangan warga yang enggan menyebutkan jatidirinya, Selasa (5/10) mengemukakan, ruas Jalan Karya Wisata Ujung kawasan Namorambe maupun Kec. Delitua itu, sangat jarang disentuh perbaikan. Padahal, ruas jalan yang sama namun dalam wilayah Kota Medan, sering mendapat perbaikan. ‘’Belum lama ini ruas Jalan Karya Wisata wilayah Kota Medan ditingkatkan dengan pengaspalan hotmix. Sedangkan ruas jalan itu di wilayah Deliserdang sangat jarang, bahkan nyaris tidak ada parit,’’ujarnya. Permukaan badan jalan itu di kawasan Namorambe, selain ada yang rusak dan hanya ditimbun batu dan pasir, juga sudah retak-retak serta kurang lebar. ‘’Kami tidak tahu mengapa tidak ada perbaikan, padahal hingga perbatasan dengan Kota Medan sudah dihotmix. Tapi, menurut informasi masih ada warga enggan untuk dibuat parit di depan rumahnya untuk menghindari tergenangnya air di badan jalan, sehingga air dapat dengan lancar mengalir,’’paparnya. Dia juga mengemukakan, sejumlah komplek perumahan di kawasan itu pun seperti ‘daerah tak bertuan’ alias tidak mendapat perhatian pemerintah. Seperti terjadinya jalan amblas di depan komplek perumahan Griya Wisata Indah akibat gorong-gorong hancur beberapa tahun lalu, tidak memperoleh bantuan perbaikan dari pemerintah. ‘’Warga perumahan terpaksa memperbaikinya dengan cara swadaya,’’ungkapnya. Jika saja kawasan ini terus-menerus, lanjutnya, kurang mendapat perhatian pemerintah berkompeten, bukan tidak mustahil kelak muncul keinginan warga bergabung saja ke wilayah Kota Medan. Makanya, kita sangat berharap supaya Pemkab Deliserdang memberikan perhatian atas kawasan ini, antara lain memperbaiki ruas jalan dan menambah lebar badan jalan serta membuat parit sekaligus lampu penerangan jalan yang baik. (m34)

Kasus APBD Langkat, Hormati Prinsip Keadilan BINJAI (Waspada): Seluruh elemen masyarakat diminta menghormati proses hukum terkait kasus dugaan korupsi APBD Langkat 2000-2007 yang melibatkan mantan Bupati Langkat Syamsul Arifin. Tanpa harus mendahului keputusan pengadilan dengan tetap menghormati prinsip keadilan dan menjunjung tinggi azas praduga tidak bersalah. Demikian Koordinator Jaringan Jurnalis Hukum dan Demokrasi Sumatera Utara (JJHD-SU) Maizen Saftana kepada pers di Binjai, belum lama ini.“Semuanya kita serahkan pada proses hukum yang saat ini tengah berlangsung, jangan mengeluarkan beragam statemen yang akhirnya mempengaruhi kondusifitas masyarakat Sumut,” ujarnya Maizen. Sebab benar tidaknya keterlibatan Gubernur Sumut Syamsul Arifin yang ketika itu menjabat sebagai Bupati Langkat terkait kasus dugaan korupsi APBD Langkat, semuanya akan diuji di persidangan. Untuk itu sebagai masyarakat yang memiliki nilai-nilai budaya dan agama yang tinggi diminta menghormati proses hukum yang saat ini tengah berlangsung. “Kita serahkan saja semuanya kepada pihak penyidik KPK yang saat ini tengah menja-lankan tugasnya,” tutur Maizen. Maizen menyayangkan sikap sejumlah elemen masyarakat yang dinilai terlalu bersikap reaksional dengan mengeluarkan beragamstatemenyangdapatmembingungkanmasyarakat.Bahkan terkesan mengintervensi kinerja KPK sebagai lembaga penegak hukumyangpadaakhirnyadikhawatirkanmengganggukondusifitas masyarakat Sumatera Utara. “Yang bersalah saja belum diputuskan oleh pengadilan, tapi opini yang muncul di masyarakat seolah-olah Syamsul Arifin telah divonis bersalah, bukankah hal itu dapat menyesatkan masyarakat dan dapat mengganggu jalannya roda pemerin-tahan Provinsi Sumatera Utara, karena sampai hari ini yang bersangkutan masih menjadi Gubsu yang dipilih oleh rakyat,” ujar Maizen. Masih menurut Maizen, ada baiknya semua pihak tetap menghormati proses hukum yang saat ini tengah berjalan, tidak bersikap sebagai jaksa, dan hakim, sebab kepentingan masyarakat banyak harus lebih dikedepankan, bukan kepen-tingan kelompok. (rel/m10)

Dua Janda Saling Jambak Mengadu Ke Polisi TEBINGTINGGI (Waspada) :Dua ibu rumah tangga berstatus janda yang sebelumnya berteman baik, tiba-tiba bertengkar dan saling jambak. Pertengkaran ini diduga berawal dari perasaan tidak senang karena kakak ipar salah seorang janda itu dipacari temannya. Setelah berkelahi saling jambak rambut keduanya saling lapor ke polisi dalam kasus penganiayaan. Kedua janda Yunita br Sitorus,37, janda mantan istri polisi, warga Jalan Darat, Gang Durian, Kel. Rambung, Kec. Tebingtinggi Kota dan Mila br Manalu, 37, janda anak satu, warga Jalan Perintis Kemerdekaan, Kel. Tebingtinggi, Kec. Tebingtinggi Kota, Kota Tebingtinggi membuat pengaduan ke MapolresTebingtinggi, Jumat (8/10). Yunita mengatakan, kejadian bermula ketika ia sedang berjalan di depan warung pinggir Jalan Perintis Kemerdekaan, tiba–tiba Mila Br Manalu menginjak kakinya dengan sengaja. Karena keduanya pernah menyimpan dendam,Yunita langsung menarik rambut Mila hingga sebagian rambutnya terlepas. Dibalas demikian, Mila Br Manalu berang lalu mengancam Yunita akan membawakan teman–temanya. Akan tetapi ancaman tersebut tidak dihiraukan, lalu keduanya saling menarik rambut. Yuni mengaku sudah lama menyimpan rasa sakit hati terhadap Mila yang telah memacari abang iparnya. Sementara itu menurut pengakuan Mila, dia tidak sengaja menginjak kaki Yunita, bahkan karena itu sempat meminta maaf kepada Yunita. Pertengkaran keduanya bukan hanya terjadi di pinggir jalan, namun berlanjut ketika mereka bertemu di ruang sentra pelayanan kepolisian Polres Tebingtinggi. Pertengkaran mulut keduanya berlanjut hingga menjadi tontonan petugas dan warga lain yang sedang membuat pengaduan ke polisi saat itu. Petugas penerima pengaduan saat itu juga meminta kedua janda tersebut untuk saling bermaafan dan berdamai, namun salah satu di antaranya (Yunita) tidak mau berdamai dengan alasan mau melanjutkan perkaranya sampai ke pengadilan. (a09)

C2

Sumatera Utara

WASPADA Senin 11 Oktober 2010

Dishutbun L. Batu Ditengarai Tak Mampu Lindungi Hutan

Gunakan Narkoba, Dua Pria Diamankan KISARAN (Waspada): Dua pria diamankan Sat Narkoba Polres Asahan, diduga menyalahgunakan narkoba jenis shabu-shabu (SS) dan ganja di dua tempat dan waktu berbeda, Kamis (7/10). Informasi dihimpun Waspada menyebutkan, tersangka BS, 38, warga Jalan Panglima Polem, Kisaran, dibekuk petugas di kediamannya sekitar pukul 14:00, karena saat rumahnya digeledah ditemukan tiga lembar plastik bekas pembungkus SS serta pipet kaca bekas, sebuah sendok dan mancis (korek api gas) yang umumnya digunakan untuk mengkonsumsi barang haram itu. Sama halnya dengan TP, 30, warga Dusun IV, Desa Aek Loba, Kec. Aek Kuasan, Asahan, diamankan petugas sekitar pukul 03:00, karena menyimpan dan menggunakan narkoba, sebagai barang bukti diamankan seberat 22,8 gram ganja. Kapolres Asahan AKBP J Didiek Dwi Priantono dikonfirmasi Waspada melalui Kasat Narkoba AKP Napsanto membenarkan. (csap)

Kepala Puskesmas Di L. Batu Diminta Berkinerja Baik RANTAUPRAPAT(Waspada):ParakepalaPuskesmasdiKabupaten Labuhanbatu diminta berkinerja baik dalam hal pelayanan kesehatan kepada masyarakat, sebab pelayanan kepada masyarakat merupakan suatu keniscayaan sesuai dengan visi misi Bupati-Wakil Bupati dr H Tigor Panusunan Siregar, SpPD-Suhari Pane, SIP. Kepala Dinas Kesehatan diwakili Sekretaris dr H Alwi Mujahid, MKes, Rabu (6/10) menyampaikan itu saat sertijab 13 Kepala PuskesmasdiaulaDinasKesehatanJalanKhairilAnwarRantauprapat. Sesuai bimbingan Kadis dan amanat Bupati, dia mengharapkan kesuksesan acara diikuti dengan kesuksesan para Kapus menjalankan tugas dengan baik. Serah terima jabatan ini akan diikuti dengan serah terima administrasi dan inventaris di Puskesmas masingmasing. “Inisaatnyakitamengaktualisasiprogramkerjadalammenjalankan tugas. Kami dari dinas akan sering berkunjung ke wilayah Puskesmas di tiap kecamatan, bisa saja tanpa pemberitahuan, untuk melihat kinerjadiPuskesmas,PuskesmasPembantu(Pustu)danPosKesehatan Desa (Poskesdes). Maka para Kapus harus selalu berkerja melayani masyarakat dengan baik,” ujar dr Alwi. SerahterimajabatanKepalaPuskesmasseKabupatenLabuhanbatu berlangsung tertib. Kebanyakan di antara Kepala Puskesmas (Kapus) itu hanya berpindah tempat. Cuma 4 orang dokter yang dari staf menjadi Kapus menggantikan pejabat lama yang bukan dokter. (a27)

Seleksi Calon Anggota KPU Labura Sudah Sesuai AEKKANOPAN (Waspada) : Tahapan seleksi calon anggota KPU Labura yang dilakukan Panitia seleksi dinilai sudah objektif, transparan dan sesuai dengan aturan. Hal itu ditegaskan Ketua Panitia Seleksi KPU Labura Amran Matondang SH,M,hum,didampingi Sekretaris Panita Asbin Pasaribu S,Ag MA kepada Waspada, Kamis (7/10). Amran mengatakan tahapan yang dilakukan panitia seleksi dari penelitian administrasi, ujian tertulis, tes asesmen psikologi dan wawancara sudah objektif dilakukan dan sudah transparan dan sesuai dengan aturan, katanya. Ditambahkan, 10 orang dinyatakan lulus yang akan dikirim ke KPU Provinsi telah melewati empat tahapan seleksi yang ketat yang dilakukan panitia seleksi.” Tidak ada kepentingan atau titipan saat penjaringan dilakukan, kita melaksanakan seleksi sangat transparan dan sesuai dengan aturan,” tegas Amran. Sebelumnya sejumlah orang yang tergabung dalam Gerakan Labura bersih mendatangi Gedung DPRD Labura, Kamis (7/8), kedatangan mereka diterima H Ismail anggota DPRD dari Komisi A. Dalam dialognya mereka meminta 10 orang yang dinyatakan lulus oleh panitia seleksi KPU harus diulang dan dibatalkan karena mereka menilai seleksi dilakukan tidak transparan dan penuh dengan kepentingan. (csi)

Bupati Terima Audensi BSDMI P2ED RANTAUPRAPAT(Waspada): Bupati Labuhanbatu dr. Tigor Panusunan Siregar menerima audensi Badan Sumber Daya Manusia Indonesia Pemerhati Pengembangan Ekonomi Daerah (BSDMI P2ED)RIKanwilIILabuhanbatu,diruangkerjakantorBupatiLabuhanbatu Rabu (6/10) Jalan SM Raja Rantauprapat. Dalam audensi itu Bupati menyambut baik adanya BSDMI P2ED RI Kanwil II Labuhanbatu sebagai mitra kerja dalam melakukan pembangunan di kabupaten ini. Ketua Kanwil II BSDMI P2ED Haposan Siahaan didampingi Sekretaris Sriono, SH, Wakil Sekretaris Nimrot Siahaan, Bendahara Juniar Sihotang, unsur Komisi Cornel Simarmata, Pantas A. Sinaga, Yuniman Zebua, Bayu Eko Broto, Yayan Pribudi, Joni Siregar, Carli Ester, dalam kesempatan itu menyampaikan kepada bupati terkait programpercepatanpembangunandanpeningkatanekonomididaerah di mana merupakan program kerja dari BSDMI P2ED RI. Bak gayung bersambut, dalam kesempatan itu kepada lembaga ini Bupati Labuhanbatu memaparkan tentang keadaan ekonomi di daerah Labuhanbatu. Menurut bupati, pendapatan perkapita kabupaten penghasil sawit ini dalam setahunnya yang tertuang di atas kertas sebenarnya cukup tinggi yakni sebesar USD1.500 tetapi kenyataannya tidak dapat dinikmati masyarakat Labuhanbatu itu sendiri. (c01)

Beram Curam, Truk Pengangkut Bambu Terbalik Di Simpang Empat INDRAPURA(Waspada):Truk Colt Diesel BK 8280 BD pengangkut bambu yang datang dari arah Jembatan Pagok menuju Indrapura, Jumat (8/10) sekira pukul 15:45 terbalik di Simpang Empat karena ban truk turun ke beram curam. Menurut keterangan sejumlah saksi mata yang ada di simpang itu, truk tersebut bermuatan berat saat akan membelok kekiri menuju arah ke Indrapura kota terlalu sedikit membelok sehingga ban belakangnya turun ke beram yang dalam. Akibatnya truk condong ke kiri ditambah muatannya yang tinggi mengakibatkan berat truk berpindah dan kendaraan itupun terjatuh. Sehingga muatan truk berupa potongan bambu tumpah hingga ke depan pintu kios di tempat itu. Tidak ada korban dalam peristiwa itu, sejumlah petugas pos lantas Indrapura segera datang ke TKP mengatur lalu lintas. (a31)

Warga Sei Bamban Kawal Pembangunan Sergai SEI BAMBAN (Waspada): Masyarakat Kec. Sei. Bamban, Kab. Serdang Bedagai ikut menyukseskan dan mengawal pembangunan berlanjut oleh Pemkab dipimpin Bupati H.T. Erry Nuradi danWabup H Soekirman. Hal itu diungkapkan tokoh masyarakat Sei Bamban Effendy Kurdi di sela-sela halal bi halal jajaran pemerintahan dan masyarakat Sei Bamban di halaman kantor camat, Senin (4/10) yang dihadiri Wakil Bupati H. Soekirman, Sekdakab Sergai Drs H Haris Fadillah, MSi, beberapa anggota DPRD Sergai, Manajer PTPN 3 Rambutan Ir Suarta Sinulingga, Staf Ahli Bupati, sejumlah Kepala SKPD, Ketua DPC GOPTKI Ny Hj Marliah Soekirman, Ketua DWP Ny Hj Imas Haris Fadillah, Camat, Uspika, warga dan PNS. Ditegaskan Effendy, program pembangunan yang telah dilaksanakan Pemkab Sergai kurun waktu lima tahun lalu sudah dirasakan manfaatnya dan sangat berarti bagi masyarakat Sei Bamban, walaupun beberapa sektor lainnya masih perlu perhatian untuk diprogramkan tahun mendatang. Warga Sei Bamban bersyukur dan bertekad mendukung kepemimpinan Bupati Sergai HT Erry Nuradi dan Wabup H Soekirman periode kedua di agar kelanjutan pembangunan lebih nyata dan merata sampai ke pelosok desa, ujar Effendy Kurdi mantan Kepala Desa.(ces)

Waspada/Rasudin Sihotang

BERSERAKAN: Tumpukan sampah terlihat mengganggu pemandangan di Jalan AR Hakim, Kel. Indrasakti, Kec. Tanjungbalai Selatan, Kota Tanjungbalai, Sabtu (9/10). Selain berserakan sehingga tampak kumuh, sampah-sampah itu juga mengeluarkan aroma tidak sedap dan dikhawatirkan menjadi sarang lalat dan nyamuk penyebar penyakit.

Warga Labusel Demo KPU Dan PTPN 3 Tuntut Hasil Pemilukada Dibatalkan KOTAPINANG (Waspada): Sedikitnya lima ratusan warga Labuhanbatu Selatan (Labusel) mengatasnamakan Gerakan Mahasiswa Pemuda Peduli Demokrasi (GMPPD) bersama Koalisi Masyarakat Penyelamat Demokrasi (KMPD) Labusel serta sejumlah pihak tim sukses Cabup/Cawabup Labusel melakukan unjuk rasa damai di kantor Sekretariat KPUD Labusel serta di kantor PTPN 3 Sisumut Kec. Kotapinang, Jumat (8/10). Pengunjuk rasa mendatangi kantor Sekretariat KPUD Labusel di Jalan Kalapane Gang Pancasila, mereka berorasi melalui koordinatorlapanganKhoiruddinMunthe dan koordinator aksi Arianto, M.Hum, didampingi Pimpinan DPRD Labusel H Zainal Harahap menyatakan sikapnya membe-

berkan pelanggaran pelaksanaan Pemilukada Labusel (27/9). Pengunjuk rasa menyampaikan, anggota KPUD Labuhanbatu (Induk) dinilai tidak melaksanakan tugas dan fungsinya secara professional selaku penyelenggara Pemilukada di Labusel seperti penggelembungan Daftar PemilihTetap (DPT), tidak melaksanakan sosialisasi kepada masyarakat tentang Pemilukada, ironisnya lagi KPUD bersikap seperti superman sanggup melaksanakanPemilukadadiduakabupaten dengan waktu bersamaan. Selain itu pengunjuk rasa menuding KPUD membiarkan pemilih datang dari luar wilayah Labusel,jugaditemukannyapemilih ganda serta tidak mengambil tindakan terhadap banyaknya praktik money politic. Kemudian masih ditemukan warga Labusel banyaktidakterdaftardalamDPT, eksesnya masyarakat kecewa karenatidakdapatmenggunakan hak pilihnya. Pendemo juga menyampaikan, KPUD Labuhanbatu (Induk) belum memiliki legalitas yang sah

sebagai pelaksana Pemilukada di Labusel demikian pula Panwaslu tidak sepenuhnya dapat melaksanakan tugas karena Panwaslu Kab. Labusel belum terbentuk saat itu, padahal tahapan Pemilukada sudah berlangsung separuh jalan sehingga banyaktahapanPemilukadatidak mendapat pengawasan dari Panwaslu setempat. KMPD menyerukan dan meminta kepada seluruh masyarakat Labusel untuk bersatu padu guna menolak hasil Pemilukada Labusel serta memboikot legitimasi maupun keabsahan KPUD Labuhanbatu sebagai penyelenggaraPemilukadaLabusel, menolak dan membatalkan hasil Pemilukada serta meminta kepada BPKP segera mengusut dan mengaudit anggaran Sekretariat KPUD Labusel mendorong semua pihak terkait untuk mempercepat pembentukan dan pelantikan KPUD setempat (Labusel)danmenuntutPemilukada Labusel di ulang kembali. Usai berorasi beberapa orang pendemo sebagai perwa-

kilan di terima Sekretaris KPUD Labusel Wahdi Pohan bersama anggota KPUD Labuhanbatu menyatakan, tuntutan pendemo akandisampaikankepadaanggota KPUD Labuhanbatu. Selanjutnya massa meninggalkan kantor Sekretariat KPUD Labusel menuju PTPN 3 di kantor Emplasmen Kebun Sisumut. Di sana pengunjuk rasa kembali berorasi membacakan pernyataan sikap bahwa pesta demokrasi Pemilukada Kab. Labusel ternyatatidakmembuahkanhasil yang sesuai dengan nilai demokrasi dan menodai harapan masyarakat Labusel. Atas aksi itu, pihak PTPN 3 diberikanwaktumenanggapiaksi pengunjuk rasa melalui APK Miswarindra SH menyatakan dirinyatidakmelakukanintimidasi apalagi intervensi dalam PemilukadaLabusel,kamitidakpernah melakukan intervensi kata Miswarindra yang disambut sorakan para pengunjuk rasa dengan mengatakan bohong. Kemudian APK berjanji tuntutan massa akan disampaikan kepada pimpinan, tegasnya. (c05)

Usut Pengalihan Fungsi Hutan Sungai Di Batubara LIMAPULUH (Waspada): Eksekutif dan Legislatif untuk menyelusuri dan mengusut tuntas atas pengalihan fungsi kawasan hutansungaimenjadiarealperkebunan kelapa sawit karena dinilai merusak tatanan lingkungan menyebabkan pasang laut mengenangi sejumlah kawasan pesisir daerah itu. ‘’Inisalahsatufaktorpenyebab pasang mengenangi daratan pemukiman dan rumah penduduk hingga sampai sarana prasarana umum dipedesaan maupun kota kecamatan dan perlu dilakukan penyelusuran oleh eksekutif dan legislatif dengan membentuk tim melakukan pengusutan,’’ tukas

Ridwan Has yang akrab dipanggil Jhon Adek salah satu unsur pengurus DPC PPP Kab. Batubara kepada Waspada, Sabtu (9/10). Pasangbiasanyamengenangi pemukiman penduduk dan kawasan dipedalaman terutama yang berada dipinggir sungai atau pantai, namun kali ini sampai memasuki rumah penduduk, perkantorandansekolahdipinggir jalan protokol. Akibatnya masyarakat terpaksa bekerja keras menyelamatkan barang berharga dan perabotan rumah tangganya ke tempat yang aman menghindari kerusakan. Selain harus menimba dan

membersihkan rumah setelah pasang menyusut. ‘’Ini semua dampak dari pengalihan fungsi hutan sungai yang selama ini merupakan tanaman nipah, bakau dan buging telah berubah menjadi tanaman kelapa sawit,’’ ujarnya sembari mengatakan mulaidaripinggiransungaiKelubi Desa Padang Genting, Labuhan Ruku, Masjid Lama, Dahari Selebar, Bogak dan Guntung (Kec. Talawi, Tanjungtiram dan Lima Puluh) rata-rata telah berubah fungsi menjadi perkebunan. Sedangkanprosespengalihan fungsi hutan itu mulai terjadi tahun1980hinggasekarangtanpa pernahmendapatpenertibandari

berkempoten. ‘’Awalnya status tanah pancanganhinggasampaiterjadiganti rugijualbelilahandipinggirsungai untuk diusahai baik secara perorangan oleh masyarakat hingga sampai berskala besar mengunakan badan usaha atau PT dan mudah untuk ditelusuri karena diproses melalui pemerintahan desa dan kecamatan,’’ ujarnya. Lebih parah lagi anak sungai di sekitar hutan ditutup tanpa memikirkan dampaknya terhadap masyarakat dan dibenteng agar air tidak masuk kedalam areal kebun sehingga begitu musim pasang penduduk menjadi sasaran.(a11)

Angin Kencang Menyapu Asahan, Dua Desa Porak-poranda TINGGIRAJA (Waspada): Anginkencangmenyapuduadesa di Kecamatan Tinggi Raja, Kab. Asahan, tidak ada korban jiwa, namun kerugian diperkirakan puluhan juta rupiah, Jumat (8/ 10) sekitar pukul 20:00. Informasi dihimpun Waspada menyebutkan, ada empat dusun di Desa Mekar Sari dan Tinggi Raja porak-poranda disebabkan peristiwa itu. Awal kejadian bermula dengan datangnya angin kencang disertai petir dan hujan, mengakibatkan sejumlah atap rumah beterbangan, ditambah lagi dengan robohnya pohon dan menimpa sebuah rumah.Warga sekitar berhasil menyelamatkan diri dan sementara berlindung di SD Negeri 010103 Desa Tinggi Raja. Tidak hanya itu, dua tiang listrik patah dan roboh sehingga wilayah itu untuk sementara aliran listriknya terganggu, ditambah lagi dengan robohnya pohon besar mengakibatkan terputusnya jalan besar penghubung dua desa itu ke ibu kota, namun warga sekitar bergotong-royong untuk mengevakuasinya dan memperbaiki rumah yang rusak dengan peralatan seadanya, sehingga keadaan mulai mem-

baik. “Kami terkejut mendengar ada pohon yang roboh disertai dengan mati lampu, sehingga kami pergi ke luar untuk menyelamatkan diri dengan mencari tempat perlindungan di gedung sekolah. Berselang beberapa menit, rumah kami ditimpa pohon,” ujar Mahmud Nainggolan, 40,wargaDesa Tinggiraja,kepada Waspada, Sabtu (9/10). Kejadianmengerikanitu,menurut Mahmud, belum pernah terjadi sebelumnya, sehingga meninggalkan trauma yang mendalam di diri warga. Mereka dihantuirasatakutbilaangindatang lagi dan kembali merobohkan rumah mereka, mengingat keadaancuacasaatinitidakmenentu. “Memang tidak ada korban jiwa, karena kejadiannya di saat orang belum ada yang tidur, namun bila kejadian itu datang saat tengah malam atau menjelang subuh, ketika semua warga sedang terlelap dalam tidurnya, maka akan lebih mengerikan dan tidak terbayangkan. Oleh sebab itu kami berharap, agar keadaan cuaca tidak berubah, sehingga kami tidak perlu takut,” ungkap Mahmud. Camat Tinggi Raja Kab. Asa-

Waspada/Sapriadi

EVAKUASI: Mahmud Nainggolan beserta istrinya Zuraidah, warga Dusun II Desa Tinggi Raja, terlihat sedang mengevakuasi pohon yang roboh disebabkan angin kencang dan menimpa rumahnya dengan. Hingga saat ini warga sekitar masih dihantui ketakutan, akan datangnya angin itu kembali. Foto direkam, Sabtu (9/10). han Drs Ilham dikonfirmasi Waspada melalui saluran telefon mengatakan,sampaisaatinipihaknya masih melakukan pengecekan bangunan yang rusak atau roboh disebabkan angin tersebut, sehingga belum diketahui jumlah pasti berapa kerugian.

“Peristiwa itu tidak menelan korban jiwa, tapi merobohkan rumah dan atap bangunan di pasar tradisional desa Tinggi Raja roboh. Untuk saat ini kami masih melakukanevakuasiagarkeadaan menjadi lebih baik,” kata Ilham. (csap)

RANTAUPRAPAT(Waspada): Dinas Kehutanan dan Perkebunan Kabupaten Labuhanbatu ditengarai tak mampu lindungi kawasan hutandanhutanlindung.Parahnyalagidinasyangseharusnyamenjaga hutan tetap lestari ini tidak memliki data valid berapa luas areal kawasan hutan di Labuhanbatu. Padahal pengendalian keru-sakan hutan di Labuhanbatu sangat penting mencegah beralih fungsinya hutan. Apalagi dinas ini sudah dibekalialatpemantauberupaGPSdansejumlahkemudahanteknologi lain yang bisa digunakan di zaman serba canggih seperti sekarang. “Kami tidak bisa menindak (perusakan hutan), kami hanya sebatas melaporkan kepada pihak provinsi (untuk menindak) bukan wewenang kami,” kata Kepala Dinas Kehutanan dan Perkebunan Pemkab Labuhanbatu Rosihan Noor kepada wartawan, Kamis (7/10). Sebagai contoh, kini perambahan hutan di kawasan Bukit Barisan mulai marak terjadi yang diakibatkan lahanya dialihfungsikan menjadi tanaman kelapa sawit, ditambah lagi kawasan hutan bukit barisan juga dialih fungsikan menjadi kawasan lokasi wisata air terjun DL. Sitorus yang biaya masuknya dikutip dari warga sebesar Rp5.000. Anehnya, ketika ditanya tentang air terjun itu Rosihan Noor terkesan meresa tidak berdosa dengan pengelolaan objek tersebut, sudah kita surati biar mereka mengurus izin ke Departemen Kehutanan,” katanya. Ditanya lagi apakah keberadaan objek wisata tersebut ilegal karena berada di kawasan hutan lindung berdasarkan plank milik Dinas Kehutanan Kabupaten Labuhanbatu. “Kalau masalah ilegal kita tidak bisa bicara karena yang berwenang itu departemen, kalau plank itu kan bukan saya yang bikin plank,” kata Rosihan berkilah. Bahkan ketika ditanya apa tindakan selanjutnya oleh Dinas Kehutanan Labuhanbatu sekali lagi kepala dinas yang pernah menjadi tersangka Pengadaan perangkat Global Position System (GPS) ini tetap bersikukuh berkilah. “Ya kita surati dulu, karena kewenangan Dinas Kehutanan Labuhanbatu hanya sebatas melaporkan kepada pihak departemen” katanya. Ironisnya, informasi yang diperoleh di lingkungan Pemkab Labuhanbatu tersiar kabar kalau tanggal 15 Oktober 2010 mendatang objek wisata yang berada di areal kawasan hutan berdasarkan alat pemantau GPS Dishutbun itu akan dikunjugi istri Gubernur Sumatera Utara Hj Fatimah Habibie untuk diberi penghargaan sebagai lokasi objek wisata percontohan.(c01)

Air Pasang Menggenangi Kecamatan Kualuh Leidong LABURA(Waspada): Sejak, Rabu hingga Jumat (6-8/10) sebagaian besar wilayah Pantai Kec. Kualuh Leidong digenangi air pasang sehingga menggangu aktivitas masyarakat perdaga-ngan dan kegiatan pemerintahan. Puncak Pasang terjadi, Kamis (7/10) pukul 04:00 menggenangi Kantor Camat, Kantor Lurah Tanjung Leidong Rumah Dinas Camat, Kantor Polsek, Asrama Polsek, Asrama Ramil, sekolahsekolah serta jalan-jalan. Genangan air hanya bertahan sampai dengan pukul 07:15 namun akibat genangan tersebut menimbulkan dampak seperti lumpur dan sampah yang di-tinggalkan. Pasang kali ini tidak diprediksi karena biasanya pasang seperti ini tidak pernah terjadi secara tiba-tiba sehingga masyarakat tidak melakukan kegiatan antisipasi sehingganya banyak barang-barang penduduk terendam air pasang. Camat Kualuh Leidong Drs Syofyan Yusma, M.Si dikonfirmasi Waspada melalui seluler, Jumat (8/10) menyatakan, Kantor Camat Kualuh Leidong terendam air pasang terutama aula serta rumah dinas, sisa lumpur dan sampah sedikit mengganggu aktivitas karena harus ekstra keras untuk membersihkan ruangan yang tergenang air. Apalagi airnya ini air laut yang mengandung garam sehingga barang-barang yang terbuat dari besi harus dibilas kembali dengan mempergunakan air tawar agar tidak berkarat. (c01)

Rumah Gelap Tanpa Listrik Di Tanjungbalai TANJUNGBALAI (Waspada): Di Kota Tanjungbalai terdapat rumah yang belum tersentuh aliran listrik dan tampak gelap tanpa penerangan lampu di malam hari. Pantauan Waspada menyatakan, terdapat sebuah rumah di Jalan Arteri, Kel. Sirantau, Kec. Datukbandar, Kota Tanjungbalai, belum memiliki penerangan, terlihat gelap terutama di malam hari. Setelah ditelusuri, ternyata rumah tersebut belum dialiri listrik. Jefri Nasution, 38, beserta istri Rindu Sari, 35 dan keempat anaknya yang masih kecil, memilih tinggal di rumah kontrakannya tersebut sebabhargayangdiberikanterjangkau,meskikataJefritanpadilengkapi instalasi listrik. Menurutnya, pemilik rumah, Asmuni, enggan memasukkan listrik mengingat biaya pemasangan yang tidak terjangkau, sedangkan penghasilan menjadi TKI di Malaysia tidak mencukupi. Jefrimenambahkan,dirinyahanyamenggunakanlampuberbahan bakar minyak tanah untuk penerangan di malam hari. “Saya harus menyediakan 1 liter minyak tanah setiap hari untuk penerangan,” kata Jefri. Ditambahkannya, selain harga mahal, minyak lampu juga sulit dicari. “Serba sulit sekarang bang, untuk memasang instalasi listrik membutuhkan biaya hampir Rp2 juta, sedangkan minyak tanah satu liter sekitar Rp7 ribu lebih, itupun payah dicari,” tukas Jefri. Sedangkan istrinya Rindu, mengaku sangat kerepotan mengurus pekerjaan rumah tangga tanpa aliran listrik. “Abang tau sendirilah, bagaimana sulitnya mengerjakan sesuatu tanpa listrik, tapi meski begitu, aku tetap optimis suatu hari nanti dapat menikmati listrik,” ucap Rindu yang mengaku penghasilan suaminya dari menarik becak bermotor cukup untuk makan keluarga. “Mudah-mudahanwalikotaterpilihnantinyamaumemperhatikan rakyatkecilsepertikamiini,”kataJefri.Ditambahkannya,padapemilihan walikota kali ini, dirinya hanya memilih walikota yang peduli terhadap rakyat kecil. (crs)

Pj Bupati Labusel Lantik Pejabat Eselon II, III Dan IV KOTAPINANG (Waspada): Organisasi atau unit kerja dapat berfungsi maksimal, bila bagian dalam organisasi itu dilibatkan secara aktifuntukmenjalankankebijakanyangsudahditetapkan.Kekompakan dalam suatu organisasi patut dijaga dan dipelihara. Adanya hubungan harmonis antara atasan dan bawahan ditopang komunikasi terbuka merupakan kunci dalam mewujutkan sasaran organisasi. Hal ini dikatakan Pj Bupati Labusel Drs Abdul Rajab Pasaribu MM, Jumat (8/10) di Aula kantor Bupati Labusel, usai melantik dan mengambil sumpah kabatan 20 orang pejabat struktural eselon II, III dan IV A. Pejabat Eselon II yang dilantik yakni Drs Efnit Dalimunthe menjadi Staf Ahli Bupati Bidang Pemerintahan Kab. Labusel, Toga Mahaji A.Pi. MM, jadi Asisten Administrasi Umum pada Setdakab, Drs Ahmad Fuad Kaban Lingkungan Hidup, Drs Rajo Makmur Siregar, MPd Kadis Pendidikan, Ir Zulkifli Kadis PU, Pertambangan dan Energi. Eselon III H Marasakti, SIP menjadi Sekretaris pada Badan Pemberdayaan Masyarakat dan Pemerintahan Desa, H Mahmul, SPd Kepala Bagian Organisasi pada Setdakab, Mangayat Jago Ritonga, SPd Kabid Pendas pada Dinas Pendidikan, Hanidar SAg, MM Sekretaris pada Disnakertrans, Siti Nurjanah, SPd Kabid Pemberdayaan dan Partisipasi masyarakat pada Badan Pemmas dan Pemdes, Nurhamimah SKM Kabid Pemberdayaan Penyuluhan pada Badan Ketahanan Pangan dan Penyuluhan Pertanian, Zulkarnaen Das, SSos Kabid Pengembangan dan Pembinaan pada BKD, Hamkanuddin Siregar, SH Kabid Mutasi BKD, AH.Feller S.IP Kabid Pemberdayaan Perempuan pada Badan KB-Pempernak, Husni Panamri Kabid Lalulintas Dinas Perhubungan. Eselon IV Muhammad Reza Pahlevi, S.STP Kasubbid Pendidikan dan Pelatihan Struktural BKD, Drs M Ifanda Kepala Seksi Mutasi Penduduk Bidang Layanan Penduduk Dinas Kependudukan dan Capil, Juliati Kepala Seksi Bimbingan dan Pengendalian Ketenagaan pada Bidang Bina Jaminan dan Sarana Kesehatan Dinas Kesehatan, Muhammad Soleh Siregar Kasub Bagian Program pada Sekretariat Kantor CamatTorgamba dan Darmayanti Kepala Seksi Ketentraman dan Ketertiban Kantor Lurah Langgapayung.(c05)

Sumatera Utara

WASPADA Senin 11 Oktober 2010

Walikota P. Siantar Minta Kadisdik Satukan Kembali Siswa SMAN 4 P. SIANTAR (Waspada):Walikota Pematangsiantar Hulman Sitorus meminta Kadis Pendidikan mempersatukan kembali siswa SMA Negeri 4 dan segera memberikanNomorIndukSiswa (NIS) yang belum ada selama ini. Walikota meminta itu saat rapat yang digelar Pemko bersama pihak-pihak terkait SMA Negeri 4 di ruang data Pemko Pematangsiantar, Rabu (6/10). Demikian keterangan dari Kabag Humas dan Protokoler Pemko Pematangsiantar Julham Situmorang, Kamis (7/10). Turut hadir saat itu Wakil Walikota Koni Ismail Siregar, Sekda Donver Panggabean, Plt Asisten I Leonardo Simanjuntak, Kadis Pendidikan Jonson Simanjuntak, Kakan Satpol PP Mahadi Sitanggang, Kabag Humas dan Protokoler Julham Situmo-

rang, Kabag Tapem Drs. Rudi Dipo Silalahi, sedang pihak terkait terdiri Dewan Pendidikan Kota (DPK), PGRI, Koordinator guru SMA dan Komite Sekolah SMA Negeri 4. Pada kesempatan itu, Walikota meminta masukan dari pihak yang hadir tentang permasalahan SMA Negeri 4 seperti unsur Komite Sekolah SMA Negeri 4, PGRI, DPK, Koordinator guru SMA Negeri 4 dan lainnya. Masukan dari beberapa pihak yang hadir pada umumnya meminta Pemko melakukan peninjauan kembali kebijakan yang selama ini terjadi di SMA Negeri 4. Menurut walikota, guna mengatasi masalah yang terjadi di SMA Negeri 4 dia mengharapkan adanya masukan dari unsur Komite Sekolah SMA Negeri 4,

PGRI, DPK serta pihak sekolah hingga dalam membuat suatu keputusan. Komite Sekolah SMA Negeri 4 Ahmad Mangantar Manik menyatakanbanggadengankeputusan walikota itu dan menyatakan akan menghadiri rapat lanjutan membahas permasalahan SMA Negeri 4 itu agar permasalahannya segera diselesaikan. Menjawabpertanyaanwartawan, Walikota Pematangsiantar mengakuisebenarnyalokasiSMA Negeri 4 tidak cocok lagi dijadikan sebagai lokasi pendidikan. Namun, meski demikian, menurutnya proses melanjutkan rencana ruislagh(tukarguling)SMANegeri 4itumasihjauhuntukdibicarakan. “Kalau ruislagh, nanti dululah kita bicarakan. Itu masih jauh,” ujarnya. Namun, menurut walikota,

sesuai UU tentang tata ruang provinsi, lokasi SMANi 4 di Jalan Pattimura tidak sesuai sebagai zona pendidikan, bahkan bukan hanya lokasi SMA Negeri 4 dan SD Negeri 122350 yang satu lahan dengan SMA Negeri 4 yang akan dipindahkan,tapitermasuklokasi SMPN 1 di seberang SMA Negeri 4. Menjawab pertanyaan, kalau sekolah itu dipindahkan, lokasi itu akan dijadikan lokasi bisnis, Walikota menyebutkan hal itu sedang dipelajari dan masih akan dirapatkan. WakilKetuaDPRDPematangsiantarTimbulMLinggameminta jangan menganggap ruislagh sebagai hal yang haram. “Selama sesuai dengan prosedur yang benar, tentunya proses itu bisa tetap berjalan,” katanya. (a14)

C3

IP3B Desak Polres Pakpak Bharat Berantas Judi SALAK, Pakpak Bharat ( Waspada): IPPPB (Ikatan Persatuan Perempuan Pakpak Bharat) baru-baru ini kepada pihak Kepolisian Resor daerah setempat meminta dan mendesak supaya memberantas judi Togel (toto gelap) dan KIM yang sekira tiga pekan ini kembali beroperasi.

Sehinggahalinimenimbulkan keresahkan pada masyarakat lainnya dikarenakan peredaran judi merampat hingga sampai ke pelosok desa. Hal tersebut ditegaskan Efi Br Berutu, Ketua IPPPB, Jumat (8/10) setelah dia bersama pengurus beraudensi ke Polres yang diterimaWakapolres Pakpak

Bharat Kompol Bulmar Pasaribu. Dikatakan Efi, dalam pertemuan itu pihak Polres mengajak seluruh elemen masyarakat lainnyabegitujugahalnyadengan IP3B untuk bekerjasama guna memberantas judiTogel dan Kim maupun penyakit masyarakat lainnya. Kapolres AKBP Suriadi Bahar

melalui Kabag OPS (Operasional) Polres Pakpak Bharat AKP Noviman mengatakan, Polres Pakpak Bharat akan menindak dan menangkap siapa saja yang tersangkut masalah penyakit masyarakat tersebut khususnya judi Togel dan KIM ataupun bentuk judi lainnya. (c08)

Sumatera Utara

C4 2012 Pemkab Tapsel Luncurkan e-KTP P.SIDIMPUAN (Waspada): 2012 data penduduk Kab. Tapanuli Selatan sudah tercatat secara nasional melalui sistem elektronik KartuTanda Penduduk (e-KTP) sehingga dapat diakses di seluruh Nusantara. Setiap KTP pendudukTapsel dilengkapisidikjari(chip),sehingga tidak mungkin terjadi KTP ganda, dan2010 berbagaipersiapantelah dimulai. Bupati Tapsel, H. Syahrul MartuaPasaribudidampingiWakil Bupati, H Aldinz Rapolo Siregar, pada rapat koordinasi di aula Kenanga Kantor Bupati Tapsel, Kamis (7/10) memerintahkan seluruh jajaran Pemkab Tapsel terutama instansi kependudukan supaya mendata secara akurat dan benar. “Data kependudukan ini sangat penting. Karena mendukung perencanaan pembangunan, pendidikan, kesehatan dan pelayanan publik, serta keamanan nasional. Secara nasional keluaran pemutakhiran data ini akan menjadi kebutuhan data untuk Pemilu dan Pilkada,” ujarnya. Rapat itu diikuti Camat, Kasi Pemerintahan Kecamatan, dan Operator Sistem Informasi Administrasi Kependudukan (SIAK) Kecamatan dan Pemkab Tapsel yang tergabung dalam Tim Pemutakhiran Data Kependudukan. Bupati juga menegaskan, pemutakhirandatainiharustepat dan cepat. Karena pada intinya negara yang maju adalah negara yang mampu mengelola data kependudukan secara benar dan akurat.

“Dengan adanya pemutakhiran data ini diharap dapat memenuhi beberapa hal. Yakni data valid, tidak ganda, dan data yang benar,” tegas Bupati. Sebelumnya PelaksanaTugas (Plt)KepalaDinasKependudukan dan Pencatatan Sipil Tapsel, H. Hotma Dalid Harahap, mengatakan, latar belakang kegiatan pemutakhiran data kependudukan tersebut adalah UU No.23/2006 tentang Administrasi Kependudukan. Kemudian Peraturan Pemerintah No.37/2007 tentang pelaksanaanUUNomor23tahun 2006. Surat Edaran (SE) Mendagri No.471.13/2751/sj tanggal 5 Juli 2010 tentang Pemutakhiran Data Kependudukan, Penerbitan Nomor Induk Kependudukan (NIK) dan Persiapan Penerapan Elektronik KTP (e-KTP). “Penduduk Tapsel saat ini 64.563 Kepala Keluarga (KK) atau

281.246 jiwa. Pemutakhiran data ini sudah harus selesai paling lambat akhir Desember 2010,” ujar Kadis. Dijelaskannya, persiapan penerapane-KTPyangdilengkapi sidik jari (chip) ini, berupa konsolidasi anggaran untuk pemutakhiran data penduduk yang disediakan melalui dana dekonsentrasi atau APBD pada 2010. Kegiatan tahun 2011 berupa proses penerbitan NIK dimulai sosialisasi dan bimbingan teknis, danpadaakhirnyaditerbitkannya NIK secara on-line serta pemberitahuan NIK kepada seluruh penduduk. Penerapan e-KTP nasional ini dilakukan dengan cara bertahap di 197 kabupaten/kota se-Indonesia, termasuk Tapsel. Secara teknis, menggunakan sinkronisasi database kependudukan kabupaten/kota dengan pusat (on-line). (a20)

Tak Ada Warga Sipil Di Madina Miliki Senpi PANYABUNGAN (Waspada) : Warga sipil di Kab. Mandailing Natal sejauh ini tidak ada yang memiliki senjata api. Kalau memang ternyata ada, maka segera disita karena polisi tidak ada mengeluarkan izin untuk penggunaannya. Hal tersebut ditegaskan Kapolres Madina AKBP Hirbak Wahyu Setiawan ketika dijumpai wartawan baru-baru ini. “Beberapa waktu lalu salah seorang pejabat di Pemkab Madina memiliki senjata api, namun senjata api sudah ditarik Polres,” ucapnya. Dikatakan, tidak ada yang dapat izin menggunakan senjata api kecuali petugas. Dan kalaupun ada warga yang memilikinya akan segera diamankan. Menanggapi maraknya perampokan dan tindak kriminal dengan menggunakan senpi hingga menewaskan beberapa anggota kepolisian, Kapolres HirbakWahyu Setiawan mengungkapkan, pasca perampokan bank CIMB Niaga di Medan, jajaran Polres Madina sudah melakukan perubahan pola keamanan dengan memperketat penjagaan. (a24)

Lembaga Surfaid International PHK Karyawan Secara Sepihak GUNUNGSITOLI (Waspada): Lembaga Surfaid International Cabang Nias melakukan Pemutusan Hubungan Kerja (PHK) terhadap sepuluh tenaga kerjanya secara sepihak tanpa memberikankompensasiberupa pesangon. Bahkan lembaga itu terkesan memaksakankehendakterhadap tenaga kerja untuk menandatangani surat persetujuan pengunduran diri yang telah disiapkan oleh manejemen Surfaid International. Akibatpersengketaanitupara mantan tenaga kerja telah berulangkali melakukan mediasi kepadapihakmanejemenSurfaid Internationalagarhak-haktenaga kerja yang telah di PHK berupa pesangon dapat dibayarkan sesuai yang tertuang dalam UU RI No. 13 Tahun 2003 tentang Ketenagakerjaan namun hingga saat ini belum ada tanggapan positif dari lembaga dimaksud. Hal ini terungkap pada pertemuan antara tenaga kerja yang terkenaPHKdenganManajemen Surfaid International yang di-

fasilitasiDPRDKotaGunungsitoli, Jumat (8/10). Pertemuan dilaksanakan di GedungDPRDKotaGunungsitoli dan dipimpin Ketua Komisi B Damili R. Gea didampingiWakil Ketua DPRD Armansyah Harefa, SE,HadiratST.Gea,sertasejumlah anggota dewan, para mantan tenaga kerja Surfaid International, ManejemenSurfaidInternational CabangNiasmasing-masingManager Program, Asrial dan Office Manager, Caroline. Pada pertemuan itu, juru bicaramantantenagakerjaSurfaid international, Christian Elfianus Gea menyebutkan. Maret 2010 yang lalu pihak manejemen Surfaid International Cabang Nias mereka telah menandatangani KontrakKerjaselamaenambulan yang berakhir pada 13 September 2010.NamunpadaJuni2010pihak manejemen mamanggil mereka untuk menandatangani persetujuan pemutusan hubungan kerja yang telah disediakan leh pihak Syrfaid International. Disebutkan bagi yang tidak menandatangani surat tersebut tidak akan

dibayarkanhak-haknyaolehlembaga Surfaid International. Disebutkan pada Surat Pernyataan persetujuan itu dengan Kop Surat Surfaid International terlihat sudah ada tandatangan di atas nama mereka yang dibubuhi meterai Rp6.000 sehingga terindikasikuatterjadipemaksaan dan pemalsuan tandatangan. Sementara Program Manager Surfaid International yang hadir pada kesempatan itu mengakui adanya surat pernyataan dari tenaga kerja yang telah terlebih dahulu ditandatangani oleh pihak manejemen sebelumnyadanpihaknyatelahmenyampaikan permintaan maaf kepada para tenaga kerja sembari menggantinyadengansuratpernyataan yang baru. Setelah mendapatkan klarifikasi dari kedua belah pihak yang bersengketa, DPRD Kota Gunungsitoli merekomendasikan agar manajemen Surfaid International bersama para mantan tenaga kerja menyelesaikan persengketaan tersebut secara kekeluargaan dalam kurun waktu 7 hari. (a35)

Pemkab Simalungun Serahkan Bantuan Gunung Sinabung SIMALUNGUN (Waspada): Pemkab Simalungun, melalui Dinas Sosial menyerahkan bantuansosialkepadaparapengungsi yang menjadi korban bencana alam letusan Gunung Sinabung di Kab. Karo. Bantuan itu langsung diserahkan Bupati Simalungun diwakili Kadis Sosial Simalungun Drs Mohd Ikhsan Lubis bersama Ketua Komisi IV DPRD Simalungun Johalim Purba didampingi Sekretaris Komisi IV Agus Salim dan anggota Laris Parapat, dipenampungan pengungsi di Gedung Serbaguna Kab. Karo, Kamis (7/10). Bantuan diterima perwakilan masyarakatataupengungsidisaksikan Camat Naman Teren,

Terang Ukur Surbakti, S.Sos. MIP bersama kordinator Posko Bencana Sinabung Drs Agustin Pandia, MSi. Menurut koordinator Posko Bencana Sinabung Agustin Pandia, pengungsi yang berada di Gedung Serbaguna saat ini berjumlah 594 jiwa atau 204 KK yang berasal dari 2 desa yakni Desa Bekerah dan Simacem, Kec. Naman Terem. Mereka terdiri dari para orang tua dan anakanak. Menurutnya, kedua desa berada di zona berbahaya, sehingga masyarakat terpaksa harus diungsikan sampai situasi Gunung Sinabung dalam kondisi normal. “Saat ini masyarakat hanya melakukan aktivitasnya sehari-

hari yaitu ke ladang untuk bercocok tanam dan melihat ternak mereka dengan cara diantar melaluitrukyangdisediakanpada pagi hari usai sarapan dan dijemput kembali pada sore harinya. Warga belum berani tinggal dirumahnya karena kondisi belum mormal,” tegas Padia. KadisSosialKab.Simalungun Mohd Ikhsan Lubis saat menyerahkan bantuan mengatakan, bantuan dari Pemkab Simalungun sebanyak 300 sak beras, (1 sak berisi10 kg), mie instan 269 kotak dan air mineral 500 kotak serta uang sebesar Rp7,5 juta. Dia berharap, bantuan dari Pemkab Simalungun tersebut dapat mengurangi beban penderitaan yangditerimaolehpengugsi.(a15)

WASPADA Senin 11 Oktober 2010

Sumatera Utara

WASPADA Senin 11 Oktober 2010

Banyak Proyek Pembangunan Di Madina Tidak Dipasang Plank PANYABUNGAN (Waspada): Berbagai elemen masyarakat di Kab.Mandailing Natalmenyoroti Satuan Kerja Perangkat Daerah ( SKPD ) dan rekanan proyek fisik agar transparan dan terbuka denganmemasangpapan(plank) proyek. “Hal ini penting suapaya masyarakat bias mengawasi proyek yang sedang berjalan. Papan nama proyek sudah menjadi keharusan di setiap pekerjaan proyek yang dibiayai negara. Di dalamnya mencakup transparansi anggaran, volume pekerjaan, nama rekanan hingga waktu pengerjaan,” ujar Lokot Husda Lubis Wakil Sekretaris DPC PPP MadinakepadaWaspada,Minggu (10/9). Menurut Lokot, selama ini banyak pekerjaan fisik di Madina

seperti ditutup-tutupi karena tidak mencantumkan papan proyek, sehingga tidak diketahui secara jelas jenis pekerjaan tersebut, dari mana sumber dana dan nama kontraktor yang mengerjakannya. Akibatnya, masyarakat maupun lembaga terkait lainnya sulit mengawasi pekerjaan yang dilakukan rekanan. ‘’Tapi tahun anggaran 2010 ini, pekerjaan proyek pembangunan itu harus lebih terbuka kepada masyarakat,” katanya. Setiap rekanan wajib memasang papan nama proyek yang sedangdikerjakannya.Janganlagi seperti selama ini papan nama proyek dipasang hanya untuk mengambil dokumen siap proyek tersebut, tidak pernah dipajang untuk diketahui umum,” tambahnya.

Peringatan yang sama juga disampaikan Sangkot Syukur Nasution seorang aktivis LSM Ampera Madina. Dia minta agar kesadaran kon-traktor maupun pengawas pro-yek di Madina jangan meng-ganggap sepele papan nama proyek. Padahal lanjutnya, dengan tidak dibuatnya papan nama proyek menandakan secara tidak langsung mereka bisa dikenai tuduhan menutup-nutupi suatu hak publik mendapat informasi. “Tidak terpasangnya papan proyek, maka rakyat akan merasa proyek itu sarat KKN, dimana proses tendernya tidak jelas, pelaksanaannya juga tidak jelas diawasi. Belum lagi tuduhan langsung ada penyelewengan dana karena anggaran pembuatan papan nama sendiri selalu

Kerusakan Marka Ganggu Pengguna Jalan Di Sibuhuan SIBUHUAN ( Waspada): Marka jalan yang berada di atas permukaan jalan di sepanjang wilayah Kota Sibuhuan, Kab. Padanglawas kondisinya kini nyaris terhapus. Pantauan Waspada, Kamis (7/10), pengguna jalan terlihat was-was, garis pembatas tidak ada. Pengendara semaunya menggunakan jalur. Sementara marka beberapa ruas jalan yang pernah dibuat DishubTapsel saat itu sudah terhapus. Tidak hanya pengendara, marka yang terhapus itu juga berdampak pada pejalan kaki terutama pelajar saat ke sekolah

maupun pulang sekolah, karena sepeda motor, beca dan mobil berseliweran sampai ke pinggir badan jalan. Kondisi paling parah terlihat di Pusar Pasar tradisional Sibuhuan, dimana pembatas parkir dan pembatas jalur sudah tidak terlihat,sehinggaletakparkir beca yang sedang menunggu penumpang tidak terarah. Sementara zebra cross di beberpa titik, sebagian besar sudah terhapus. Kemungkinan kerusakan marka tersebut diakibatkan gesekan roda ban kendaraan atau adanya perubahan bentuk

(deformasi) pada perkerasan aspal, kemudian adanya pelebaran jalan. Pengguna jalan saat melintas diPasarSibuhuanberharapPemkab Padanglawas segera merehailitasi marka tersebut agar penggunajalannyamandantertib saat melintasinya. Kepala Dinas Perhubungan Padanglawas Irwan M Lubis membenaran kerusakan marka itu. Dikatakan, Pemkab telah menganggarkanperbaikanmarka dengan volume 1.000 meter yang akan dibuat secara terpencar. (crif)

Masyarakat Dambakan Ada Dokter Di PuskesmasUlupungut Dan Muarasipongi PANYABUNGAN ( Waspada): Masyarakat Kec. Ulupungkut dan Muarasipongi mengharapkan Pj Bupati Kab. Mandailing Natal Ir.H.Asfan Sofian Batubara,MM menempatkan dokter di Puskesmas, karena hingga saat ini kedua sarana kesehatan itu belum memiliki tenaga dokter. Warga mengungkapkan itu kepada, Waspada Minggu (10/ 10). Disebutkannya, guna menjangkau dan memudahkan pelayanan kesehatan masyarakat khususnya di daerah terpencil, Pemkab Madina telah membangun Puskesmas. Sayangnya, Puskesmas tidak diimbangi dengan penempatan dokter. ‘’Alhasil dengan kurangnya tenaga dokter di Madina Natal, sangat merugikan PuskesmasPuskesmas di luar Kota Panyabungan. Minimnya tenaga medis dan dokter di Puskesmas akan menghambat pelayanan kese-

hatan kepada masyarakat ,” ujar Syaiful, 35, warga Muarasipongi. Jika dokter sudah bertugas di masing-masing Puskesmas Muarasipongi dan Ulupungkut, saya yakin pelayanan kesehatan semakin menunjang desa-desa, sebagaimana fungsi dan tugas Puskesmas itu, ujarnya. Menurut Syaiful lagi, upaya pemerintah akan memberikan intensif Rp 5 juta per bulan untuk dokter PTT lanjut, adalah kemajuan besar. “Paling tidak, program ini mampu mengurangi ketimpangan penyebaran dan jumlah dokter. Karenanya sudah sewajarnya Pemprov Sumut serius memperhatikan penambahan dokter di Madina,” harapnya. Hal yang sama juga disampaikan Udin Lubis, 45, penduduk Desa Hutagodang. Menurutnya, sejak Puskesmas di ULupungkut didirikan belum pernah ada

tenaga dokter. “Ketiadaan dokter di daerah sangat menyulitkan warga, sebab kalau ingin berobat terpaksa ke luar daerah yang jarak tempuhnya lama,’’ ujarnya. Dia menjelaskan, terkait dokterini,masyarakatdankecamatan sebenarnya sudah menyampaikanhalinikepadaPemkabMadina dalam Musrembang dan reses anggota DPRD Madina, namun sampaisaatinibelumadahasilnya. Jadi kalau ada warga yang sakitparahataumelahirkandalam keadaan kritis bisa tidak tertolong, di samping jarah tempuh yang cukup jauh juga karena jumlah kenderaan sangat minim. Halyangsamajugadisampaikan Hasim, 56, penduduk Muarasipongi. Kata dia tidak adanya dokter di kecamatan itu,telah menghambat pelayanan kesehatan masyarakat desa terpencil. (a24)

LARAS Gelar Pendidikan Dan Pelatihan Pemberantasan Narkoba Bagi Pemuda Se-Sumut PANYABUNGAN(Waspada): Laskar Anak Bangsa Sumatera Utara (LARAS-Sumut) akan melaksanakan Pendidikan dan Pelatihan Pencegahan Pemberantasan Penyalahgunaan dan Peredaran Gelap Narkoba Bagi Pemuda se- Sumatera Utara, 22-27 Oktober di Ponpes Subulussalam Kotanopan, Kabupaten Mandailing Natal. Hal itu dikatakan Ketua LARAS Sumut M Suhery Lubis didampingi Sekretaris Nopri Diansyah di sela-sela persiapan acara di Kotanopan. “Saat ini kita sedang persiapkan acara ini

secara matang dan menyebarkan undangan ke berbagai unsur Muspika. Rencana kegiatan ini dilakasanakanduaangkatan,yaitu angkatan 1 dan II. Kita berharap acara ini berlangsung sukses dan bisa di hadiri para penceramah dan pemateri,” ujar Suhery. Sedangkan terkait masalah tempat kita memang sengaja memilih Kabupaten Mandailing Natal, sebab belakangan ini peredaran narkoba di kabupaten ini sudah sangat mengkhawatirkan. Madina saat ini bukan saja sebagai konsumen tapi sudah produsen, ini dapat dilihat dari

beberapa kali pihak berwajib menemukan ladang ganja di Tor Sihite yang jumlahnya mencapai ratusan hektare. Begitu juga dalam jangka 2 minggu ini Polsek Kotanopan menemukan ganja pertama 15 Kg dan penemuan kedua diperkirakan 13 Kg. Pesertakegiataniniterdiridari perwakilan organisasi kepemudaan, perwakilan partai, perwakilan sekolah, mahasiswa dan peserta lainnya yang diperkirakan mencapai 100 orang. Sedangkan pemateri selain dari Gerakan Anti Narkoba (GAN) Indonesia , Pusat Informasi Narkoba Sumatera Utara (PIMANSU). (cpin)

Baru Diaspal, Jalan Angin Barat Baru Terkelupas PANYABUNGAN, (Waspada) : Baru diaspal beberapa hari lalu , jalan kabupaten menuju Desa Angin Barat Baru, Kecamatan Tambangan, Kabupaten MandailingNatalsudahrusakdan terkelupas. Pengaspalan jalan sepanjangkurangdari1kilometer ini dinilai asal jadi. Pihak terkait diharapkan turun tangan memeriksa proyek tersebut karena dinilai merugikan negara. Pantauan Waspada yang turun ke lokasi, Minggu, (10/10) mendapati sebagian batu kerikil sudah terkelupas dari badan jalan terutama pada sisi jalan. Dari kondisinyadiperkirakan, sesudah diaspaljalantersebuttidakdigiling oleh alat berat sehingga mudah terkelupas. Agar tidak terlihat, pihak pemborong menyiramkan pasir tebal di atas jalan. Selain itu, proyek jalan tersebutjugatidakdiketahuisiapayang mengerjakan, volumenya berapa, berapa nilai anggaran dana, dandarimanaanggarandananya. Sebab di lokasi proyek tidak ditemukan plank merk pengerjaannya. BerdasarkansumberdiDinas PU Madina, proyek ini dikerjakan

Waspada/Alpin

TERKELUPAS: Jalan kabupaten di Desa Angin Barat Baru, Kecamatan Tambangan, Kabupaten Mandailing Natal, baru beberapa hari siap sudah terkelupas, kerikil tampak berserakan di badan jalan, Minggu (10/10). dengan anggaran Rp295.980.000 dengan program kegiatan Peningkatan Jalan Simpang Jalan Negara Angin Barat Baru. Namun jika dilihat kondisi proyektersebutsesudahsiap,mungkin setengah dari nilai anggaranpuntidaksampaialiasdimarkup.

Kepala Desa Angin Barat Baru Abdul Rasyid mengatakan, pihaknyamenyesalkanburuknya pengerjaan proyek tersebut. Berdasarkan pengaduan warganya, kata Rasyid, hampir seluruh jalan memang tidak digiling dengan alat berat usai di aspal. (cpin)

ada dalam kontrak,” ungkapnya. Hal yang sama juga disampaikan Harun Arrasyid Lubis salah seorang tokoh pemuda. Pembuatan dan pemasangan papan proyek, bukan hanya sebagai komponen pelengkap, tetapimenjadi identitaseksistensi proyek itu sendiri.(a24)

C5

STAIN P. Sidimpuan Halal Bi Halal Dan Tepung Tawar Calhaj P.SIDIMPUAN (Waspada): Civitas akademika Sekolah Tinggi Agama Islam Negeri (STAIN) Padangsidimpuan menggelar halal bi halal sekaligus tepung tawar tiga calon jamaah haji dan melepas dua pegawai pensiun, Jumat (8/10). Calhaj STAIN Padangsidimpuan tahun ini ialah Nurintan S.Sos dan suami. Kemudian, Agussalim sebagai petugas haji. Sedangkan pegawai yang memasuki masa pensiun Drs. H Mahabbat Siregar dan Dra. Nuromas Hasibuan. Acara yang dihadiri ratusan

civitas akademika itu digelar di aula, Jalan Imam Bonjol, Kel. Sihitang, Kota Padangsidimpuan. Ketua STAIN Padangsidimpuan, Dr. H. Ibrahim Siregar, MCL, mengemukakan, halal bi halalmenjadi momentum strategis bagi peningkatan hubungan kerja dan persaudaraan segenap civitas akademika. KepadaparacalhajasalSTAIN yang akan betolak ke tanah suci, Ketua STAIN Padangsidimpuan agar menjaga kondisi kesehatan. Sehingga nanti dapat menjalankan seluruh rangkaian ibadah haji dengan baik.

Kepada pegawai STAIN yang pensiun, Ibrahim mengharapkan agar tetap aktif memberikan kontribusipemikirandalampengembangan Perguruan Tinggi Islam Negeri satu-satunya di wilayah Tabagsel. Sebelumnya, Ketua Panitia, Aswadi Lubis SE.MSi, menyebut halal bi halal ini menjadi tradisi danagendatahunanSTAINPadangsidimpuan. Acara diisi siraman rohani oleh Ustadz H. Zulfan Efendi, MA. Katanya, halal bi halal adalah tradisi khas Indonesia yang tidak ada di negara lain. “Semoga

ibadah kita di bulan Ramadhan dan Syawal, serta penyelenggaraan halal bi halal ini berpengaruh positif terhadap kinerja civitas akademik STAIN Padangsidimpuan,” harapnya. Hadir Pembantu Ketua I Drs. H. Irwan Saleh, MA, Pembantu Ketua II Dr. Ichwansyah Tampubolon, Pembantu Ketua III H. Ali Anas Nasution, MA, Kabag Administrasi Drs. Muhammad Syukri Hasibuan, mewakili pimpinan Bank Syariah Mandiri (BSM), Bank Muamalat, dan seluruh civitas akademika STAIN Padangsidimpuan. (a20)

C6

Sumatera Utara

WASPADA Senin 11 Oktober 2010

DPRD Sumut Dukung KPUD Nisel Coret Balon Bupati Bermasalah MEDAN (Waspada): Keputusan rapat pleno Komisi Pemilihan Umum Daerah (KPUD) Nias Selatan mencoret bakal calon (balon) bupati tidak memiliki ijazah, mendapat dukungan dari sejumlah anggota DPRD Sumut. Menurut anggota dewan, kebijakan itu menunjukan KPUD Nisel telah menjalankan fungsi serta tugasnya sebagai penyelenggara Pemilihan Kepala Daerah (Pilkada). Penegasan tersebut dikemukakan anggota Komisi A Bidang Pemerintahan DPRD Sumut dari daerah pemilihan Nias, Nias Selatan, Suasana Dachi, Sabtu (9/10). Menurut Sekretaris Fraksi Hanura DPRD Sumut itu, KPUD Nisel benar-benar telah menunjukan sikap yang obyektif dalam melakukan tahapan verifikasi ulang para balon bupati, dan sesuai dengan persyaratan yang diatur dalam perundang-undangan tentang Pilkada. Dachi menegaskan, apabila tidak ada tindakan tegas dari KPUD Nisel terhadap balon bupati yang tidak memenuhi syarat, makadikhawatirkanakanmuncul

gugatan dari para balon bupati lain ke Mahkamah Konstitusi (MK). Sehingga tidak tertutup kemungkinan Keputusan MK nantinya akan memerintahkan KPUD Nisel melakukan Pilkada ulangdiNiselkarenapelaksanaannya cacat hukum. “Itu bisa saja terjadi jika salah satu balon ternyata terakomodir meskipun tidak memiliki legal formal ijazah yang merupakan syarat prinsip yang diatur melalui undangundang tentang Pilkada maupun peraturan KPU,” katanya. Dachi mengimbau agar seluruh masyarakat Nisel untuk benar-benar menggunakan hak pilihnya pada Pilkada medatang. “Pilihlah figur pemimpin yang bisa membawa perubahan bagi Nisel. Jangan karena iming-iming sesuatu yang sifatnya sesaat pada akhirnya akan merugikan masa depan pembangunan Nisel ,” katanya. Karena Nisel sangat membutuhkan Bupati yang dapat menciptakan kemajuan pembangunan Nisel secara signifikan, untuk mengejar ketertinggalan pemba-

ngunan yang selama ini terabaikan. Anggota Komisi A DPRD Sumut lainnya, Alamsyah Hamdani menyatakan, keyakinannya terhadap KPUD Nisel sebagai pihakpenyelenggaraPilkadayang mengedepankan independensinya. “Surat keputusan tentang penetapan balon dan nomor urut calon Bupati dan Wakil Bupati Nias Selatan, bukti KPUD Nisel telah menunjukan kinerjanya yang sesuai dengan undangundang dan persyaratan yang berlaku. Penganuliran balon bupati yang tidak memenuhi persyaratan merupakan sikap yang bijak dan arief , yang patut diteladani oleh seluruh anggota KPU,” kata politisi Partai Demokrasi Indonesia Perjuangan itu. Dukungan juga disampaikan anggota Komisi A DPRD Sumut H. Syamsul Hilal yang meminta Panwas serta Polres Nisel segera bertindak melakukan proses pengusutan agar memberikan efek jera bagi siapa saja yang coba bermain-main dalam Pilkada. (h11)

PDIP Gunungsitoli Gelar Rakercabsus Penjaringan Balon Walikota GUNUNGSITOLI (Waspada): Dewan Pimpinan Cabang Partai Demokrasi Indonesia Perjuangan (PDIP) Kota Gunungsitoli menggelar Rapat Kerja Cabang Khusus (Rakercabsus) penjaringan bakal CalonWalikota dan Calon Wakil Walikota Gunungsitoli periode 2011-2016 bertempat di Gedung Nasional Gunungsitoli, Sabtu (9/10). Rakercabsus dibuka DPP PDI Perjuangan yang diwakili Pengurus DPD PDI Perjuangan Sumatera Utara, Sarma Hutajulu dan dihadiri para pengurus DPC PDIPerjuangnKotaGunungsitoli, PimpinanAnakCabang,Pimpinan AnakRanting,anggotaDPRDKota Gunungsitoli,parapimpinanparpol di Kota Gunungsitoli serta dua pasanganbalonyangsebelumnya

telah mendaftar dan memenuhi syarat administrasi saat pembukaan pendaftaran balon. Kedua pasangan bakal calon itu Marthinus Lase yang juga Pj Walikota Gunungsitoli berpasangan dengan Dr Sadieli Telaumbanua, sehari-hari dosen pada IKIP Gunungsitoli. Sedangkan pasangan bakal calon lainnya yakni PerwiraTelaumbanua yang merupakansalahseorangpejabat di Kementerian Dalam Negeri RI berpasangan dengan Arisman Harefa yangsaat ini sebagai Ketua DPC PDI Perjuangan Kota Gunungsitoli. Panitia Rakercabsus pada laporannya yang disampaikan Sa’amboro Laoli menyebutkan, peserta Rakercabsus diikuti enamPengurusAnakCabangPDI

Perjuangan di enam kecamatan se-Kota Gunungsitoli serta seluruh Pengurus Anak Ranting se Kota Gunungsitoli. Rakercabsusselainmemberikan kesempatan kepada seluruh peserta Rakercabsus untuk mengenal dan menentukan pilihan bakal calon yang akan diusulkan kepada DPP PDI Perjuangan sebagai CalonWalikota danWakil Walikota pada Pemilukada Kota Gunungsitoli mendatang, juga sekaliguspelaksanaankonsolidasi partai sejak terbentuk di Kota Gunungsitoli. Pada Rakercabsus tersebut kedua pasangan BalonWalikota danWakilWalikota Gunungsitoli periode 2011-2016 diberikan kesempatan menyampaikan visi danmisidihadapanpesertasebelum dilakukan pemilihan. (a35)

HT Zulkarnain Damanik Bersama Pimpinan Ormas Islam Dirikan Yayasan Ukhuwah Islamiyah SIMALUNGUN (Waspada): Setelah tidak menjadi bupati lagi, HT Zulkarnain Damanik, bersama unsur pimpinan organisasi masyarakat (Ormas) Islam seKab. Simalungun akan mendirikanYayasan Ukhuwah Islamiyah. Dikatakan, yayasan tersebut akan menjadi wadah bagi umat Islamdidaerahinidanakanmenjadi mitra yang baik bagi pemerintah daerah, khususnya Pemkab Simalungun. “ Saya akan mendirikan yayasan bersama tokoh-tokoh organisasiIslamdidaerahiniyang diberinama Yayasan Ukhuwah Islamiyah.Yayasan ini dibentuk untuk bermitra dengan pemerintahdalammembangunandaerah Simalungun khususnya dunia Islam,” tegas Bupati Simalungun HT Zulkarnain Damanik, pada acara halal bi halal yang digelar di gedung MUI, Jumat (8/10). Menurutnya,Yayasan Ukhuwah Islamiyah tersebut sudah diaktenotariskan dan yayasan ini adalah milik umat Islam di Kab. Simalungun, karena di dalam kepengurusannya terdiri dari berbagai organisasi Islam dan anggota DPRD Simalungun.

Dia juga mengakui bahwa dirinyalah yang akan menjadi ketuayayasanyangbarudibentuk itu. PendirianYayasan Ukhuwah Islamiyah untuk mengajak kepadaseluruh umat Islamuntuk tetap kompak dan bersatu dalam memajukan daerah ini dan diharapkan pemimpin Kab. Simalungun yang akan datang dapat sejalan dengan yayasan ini, sehingga umat Islam di daerah ini juga dapat bangkit bersama dan eksis dalam mewarnai pembangunan di daerah ini. “Kita harus saling hormatmenghormati dan saling harga menghargai, sehingga kondusifitas daerah ini tetap terjaga dengan baik,” kata Damanik. Mohon Maaf Sekaitan dengan akan berakhirnya masa jabatannya sebagai Bupati Simalungun periode 2005-2010, HT Zulkarnain Damanik, menyampaikan permohonan maafnya kepada masyarakat Simalungun. Dimana sejak memimpindaerahiniselamalima tahun tentu banyak saja kekurangan dan kesalahan. Dia menyampaikan syukur

kepada Allah SWT,karena upayanya selaku Bupati Simalungun untuk mengembalikan tanah yang berada di Kelurahan Pamatang Tanah Jawa yang selama diakui milik salah seorang warga di kelurahan tersebut telah diputuskan oleh Mahkamah Agung (MA) menjadi milik Pemkab Simalungun yang diperuntukkan bagi kepetingan masyarakat Kec. Tanah Jawa. Ajak Dukung JRS-Nur HT Zulkarnain Damanik juga mengajak masyarakat Simalungun agar mendukung Bupati dan Wakil Bupati Simalungun terpilih pasangan JR SaragihNuriaty Damanik (JRS-Nur). Dikatakan, sebagai warga negara yang baik dan orang Islam yang baik, kita harus mendukung atau mensupport pemerintah yang baru siapapun orang yang menjadi pemimpin dan itulah prinsip. Dikatakan, tidak boleh ada konflik maupun penolakan karena semua proses telah dijalankan dan ini merupakan realita yang harus disikapi bersama. (a15)

Pelajar T. Balai Padati Warnet Penyedia Game Online TANJUNGBALAI (Waspada): Setiap hari pelajar di Kota Tanjungbalai ramaikan warung internet (warnet) yang menyediakan paket game online. Pantauan Waspada, di beberapatempatterlihatpuluhanpelajar tengah asyik bermain game online di sebuah warung internet di Jalan Jenderal Sudirman, Kota Tanjungbalai, Sabtu (9/10) pukul 10:00. Menurut seorang penjaga di sebuah warnet, para pelajar kerapkali terlihat memadati warnet sejak pukul 11:00 hingga sore hari. “Biasanya yang main disini ratarata anak SD, SMP dan SMA dan kebanyakan mereka mengambil paket 1 sampai 5 jam setiap main, tolong jangan dimuat namaku ya bang,” ucapnya. Lebih lanjut dikatakannya, terkadang komputer yang disediakan pemilik warnet tidak mencukupi akibat banyaknya pelajar yang ingin bermain. “Bahkan ada yang sabar mengantri dan menunggu hingga berjamjam, asalkan dapat bermain,” tukasnya. Seorang pelajar, Erwin, 11, siswakelasVIdisalahsatuSekolah Dasar Negeri mengaku, setiap pulang sekolah selalu singgah di warnet untuk bermain game online. “Aku selalu main Point Blank, Ayodance, dan juga buka facebook,” kata Erwin. Pelajar lainnya, Herbet, 13,

Waspada/Rasudin Sihotang

BOLOS: Puluhan pelajar berpakaian sekolah tengah asyik bermain game online di sebuah warung internet (warnet) di Jalan Jenderal Sudirman, Kota Tanjungbalai, Sabtu (9/10) pukul 10:00. Para siswa mengaku kerap bolos dari sekolah asalkan bisa bermain game bersama teman-temannya. Foto direkam, Sabtu (9/10). pelajar kelas VII di sebuah SMP swasta mengatakan, dirinya terkadang bolos dari sekolah bersama teman-temannya untuk bermain game online. “Kalau sendirian, enggak seru bang, apalagi main Point Blank, enaknya rame-rame dengan teman,” jelasnya. Menurut Herbet, dirinya selalu mengambil uang milik orang tuanya tanpa meminta izin terlebih dahulu asalkan dapat

bermain game. “Jajanku cuma Rp2 ribu, sedangkan 1 jam bermain game Rp3 ribu, terpaksalah kuambil duit sisa belanja ibuku,” paparnya. Sedangkan,Winda, 15, siswi kelas IX SMP Negeri, juga mengaku berkunjung ke warnet untuk bermain game online.“Aku suka main Ayodance, kalau udah agak capek, baru buka Facebook, buat update statuslah,” kata Winda. (crs)

Bersambung ke hal. C7

Sumatera Utara

WASPADA Senin 11 Oktober 2010

Pesta Danau Toba Miliki Jadwal Tetap Setiap Tahun SAMOSIR (Waspada) : Pelaksanaan Pesta Danau Toba dijadwalkan digelar 20 -24 Oktober 2010 di Parapat. Berdasarkan pengalaman, Pesta Danau Toba selama ini masih diminati dan

dicintai warga Sumut, sehingga untuk 2010 Pesta Danau Toba diharapkan akan lebih sukses, apalagi kali ini yang percaya menjabat sebagai ketua panitia adalah ParlindunganPurbayangjugaanggota

DPD RI. Mengingat Parlindungan Purba merupakan sosok yang selamainidikenalmemilikitingkatkepedulianyangcukuptinggi. “Untuk mensukseskan

Pesta Danau Toba 2010, peran pemuda tidak ketinggalan dan tetap dilibatkan agar pesta itu dapat berjalan sesuai yang diinginkan masyarakat Sumatera Utara,” kata Ketua KNPI Girsang Sipa-

ngan Bolon Jhonson Hutajulu, Rabu (6/10). MenyambutPDT2010,panitia danKNPImelakukanpembersihan DanauTobadiseputarankawasan Parapat 8 Oktober 2010. (c10)

Sambungan dari hal. C6

C7

Wing’s Air Diharapkan Majukan Sektor Pariwisata Di Empat Kabupaten Layani Rute Bandara Silangit-Polonia Medan

Laka Lantas Di Tarutung, Dua Luka TARUTUNG (Waspada): Kecelakaan lalu lintas antara dua sepeda motor di Jalan Pattimura Tarutung, tepatnya di belakang Kantor Pos Tarutung, Sabtu (9/ 10) siang menyebabkan dua pengemudi mengalami luka berat dan patah tulang. Kedua korban tersebut dirawat di RSU Tarutung, sedangkan dua unit sepeda motor milik korban telah diamankan di pos unit laka Polres Taput. Kedua korban laka adalah Viktor Hutagalung, 15, pengemudi Supra X 125 BB 6515 BC, warga Kompleks PajakTarutung-Taput. EdySinaga,27,pengemudiSuzuki Satria BK 4690 NK, warga Ugan, Tarutung-Taput, Terjadinyalakalantastersebut diduga karena kedua korban melaju dengan cepat. Sehingga Viktoryangdatangdariarahkantor pos hendak menikung ke Jalan Pattimura langsung bertabrakan dengan sepeda motor yang dikemudikan oleh Edy Sinaga. Kondisi kedua unit sepeda motor dalam keadaan ringsek. (c12)

DOLOKSANGGUL (Waspada): Dengan beroperasinya maskapaiWing’s Air jenis ATR 72 – 500 dengan rute penerbangan Bandara Silangit Taput- Polonia Medan diharapkan dapat mendongkrak peningkatan perekonomian masyarakat di kawasan Tapanuli, khususnya di empat kabupaten (Taput, Humbahas, Tobasa dan Samosir). Bandara Silangit dapat menjadi pintu gerbang untuk sektor pariwisata dan perdagangan. Apalagi wisata Danau Toba di KecamatanBaktiraja,objekwisata Sipinsur–KecamatanParanginan. Transportasi udara sangat menunjang kegiatan perekonomian rakyat, termasuk para perantau asal Bonapasogit sudah termotivasi untuk pulang membangun kampung halamannya. Demikian disampaikan Bupati Humbang Hasundutan (Humbahas) Drs Maddin Sihombing pada acara Lounching penerbangan perdana pesawat Wing’s Air di Bandara Silangit Tapanuli Utara, Jumat (8/10) yang dihadiri tokoh masyarakat dari Humbahas antara lain TN Nainggolan dan sejumlah pimpinan SKPD Humbahas dan Ketua DPRD. Dikatakan, perkembangan transportasi berdampak positif terhadap berbagai sektor atau multi efek seperti terhadap sektor pariwisata, pertanian, perdagangan dan lapangan pekerjaan. “Selama ini sektor pariwisata kita salah satunya kawasan Danau Toba kurang berkembang karena kurang lengkapnya sarana pendukung seperti sarana transportasi udara, sehingga pengunjung dari manca negara relatif sedikit,” katanya. Demikian juga dengan sektor

Waspada/Parlindungan Hutasoit

ULOS: Bupati Humbahas Drs Maddin Sihombing didampingi Ny Maddin boru Napitupulu memberikan cendramata berupa Ulos kepada Kapten Wings Air di Bandara Silangit. perdagangan dan pertanian yang selama ini minat orang luar terhadap hasil-hasil pertanian di Humbahas cukup tinggi. Namun karenadenganjaraktempuhyang memakan waktu lama, sehingga para peminat atau pebisnis terkendala. Untuk itu, dengan kehadiran Wing’s Air ini merupakan mimpi yang menjadi kenyataan dan disambut gembira seluruh masyarakat di kawasan DanauToba. “Kita harapkan ke depan, penerbangan ini semakin diperluas. Misalnya Batam-Silangit- Jakarta atau ke daerah lainnya termasuk ke luar negeri,” harapnya. Maddin Sihombing menyebutkan, daerah Humbang Hasundutan memiliki objek wisata yang cukup indah dan tidak kalah dengan objek wisata yang ada di daerah lainnya. Saat ini objek-

objek wisata itu terus ditata untuk menjadi salah satu sektor yang dapat diandalkan. Selain itu, sektorpertanianjugaberkembang pesat. Sehingga dengan bertambahnya sarana transportasi udara ini sejumlah sektor tersebut semakin berkembang yang muaranya kesejahteraan masyarakat semakin meningkat. Ini sesuai dengan visi pembangunan “HUTAMAS,” ujarnya. “Kita patut bersyukur, karena kebersamaan empat kabupaten untuk mengembangkan sarana transportasi udara telah membuahkan hasil dengan masuknya pesawatWing’s Air ini. Dampaknya bukan ke daerah ini saja, tetapi juga ke kabupaten-kabupaten kawasanTapanuli lainnya. Pemkab Humbahas sangat mendukung keberadaan Bandara Silangit ini”jelasnya. (a13)

Jamsostek Serahkan Sertifikat Kepada STT HKBP P E M ATA N G S I A N TA R (Waspada): Jamsostek Cabang Kota Pematangsiantar menyerahkan sertifikat Jamsostek kepada STT HKBP sebagai tanda bergabungnyabeberapapegawai STT HKBP menjadi peserta program Jamsostek serta diikuti dengan pemberian kartu anggota kepada 15 peserta. “Jamsostek dengan HKBP memang sudah memiliki hubungan baik dengan bergabungnya hampir 400 Resort dan Distrik HKBP yang ikut serta program Jamsostek,”kataKacabJamsostek Pematangsiantar Sayed Ardhon didampingi Humas Gunawan, Jumat (8/10).

Sayed menjelaskan program Jamsostek merupakan program pemerintah, dimana tujuan utamanya melindungi pekerja terhadap resiko-resiko dalam menjalankan pekerjaan. “Peserta Jamsostek wajib membayar iuran setiap bulannya sebesar 6,24 persen dari UMP per bulan, dimana 0,24 persen untuk jaminan kecelakaan kerja , 5,7 persen untuk jaminan kematian dan0,3persenuntukjaminanhari tua,” terang Sayed. J Buang Manalu yang mewakili Direktur STT HKBP menerimasertifikatitumenyebutkan ada empat program yang ditawarkan Jamsostek kepada STT

HKBP, namun hanya tiga program saja diikuti STT HKBP dan program yang tidak diikuti yakni program kesehatan. Sayed menambahkan, untuk hak-hak peserta bagi yang meninggal dunia akan diberikan uang pertanggungan Rp 12 juta dan Rp200.000,- setiap bulan dalam 24 bulan kepada ahli waris, sedang biaya perawatan kecelakaan kerja biaya ditanggung maksimal Rp 12 juta. Kepala Departemen Diakoni HKBP Pdt. Nelson Siregar yang turut hadir saat itu menyebutkan, pihaknya akan berkoordinasi dengan seluruh pegawai STT HKBP agar menyusul menjadi peserta Jamsostek. (a14)

C8

Sumatera Utara

Warga Sunggal Jadi Jurtul Togel Singapura

Dahlia Masih Tunggu Keputusan CPNS Batubara 2009

BINJAI (Waspada) : DJ, 31,warga jalan Binjai-Medan, Km 13,5 Sei Semayang, Dusun XIII, Pondok Miri, Kecamatan Sunggal Medan, diringkus Unit Judi Susila Sat Reskrim Polres Binjai, Rabu (6/10) ketika menjadi Jurtul (Juru Tulis) Togel Singapura, di Jalan Perintis Kemerdekaan, Kelurahan Kebun Lada, Kecamatan Binjai Utara. Barang bukti yang disita di antaranya HP, uang sebanyak Rp 112.000 diduga uang tebakan pemasang dan alat judi lainnya. Kapolres Binjai AKBP Dra Rina Sari Ginting melalui Kasat Reskrim AKP Ronni Bonic ketika dikonfirmasi tentang diringkusnya warga Sunggal jadi JurtulTogel Singapura di Binjai Utara membenarkannya, tersangka dijerat melanggar pasal 303 subs 303 bis KUHPidana ancaman hukuman diatas 5 tahun penjara katanya kepada wartawan. (a04)

Warga Dolok Masihul Keluhkan Penerangan Jalan DOLOKMASIHUL (Waspada): Warga Pekan Kelurahan Dolok Masihul, Kec.Dolok Masihul, Kab.Serdang Bedagai mengeluhkan sarana penerangan jalan (lampu jalan) yang kondisinya saat ini rusak tanpa ada perbaikan dari instansi terkait dalam tiga bulan terakhir. Hal itu dikatakan Jefri Diansyah Barus,36, Jauhari Salim Harahap, 36, Fahri Nasution,41, Ridwan Sitorus, 38, warga Pekan Dolok Masihul, Kamis (7/10). “Selama ini ada sekitar 7 titik (tiang) di Kelurahan Pekan Dolok Masihul lampu jalan tersebut kondisinya baik, namun dalam tiga bulan terakhir lampu-lampu itu rusak sehingga penerangan jalan jadi terganggu, sehingga mengkhawatirkan keselamatan pengguna jalan,” papar mereka. “Sehingga kami mengharapkan kepada Pemkab Sergai khususnya instansi terkait untuk segera memperbaikinya sesegera mungkin guna mengantisipasi kemungkinan yang bakal terjadi,” imbuh Jefri. Camat Dolok Masihul Fajar Simbolon mengatakan, akan segera menyampaikan usulan dan keluhan serta aspirasi masyarakat tersebut kepada instansi terkait untuk memperbaiki lampu-lampu jalan itu. (ces)

Peternak Sapi PPKS Bukit Sentang Semakin Berkembang P.BRANDAN (Waspada) : Kelompok Tani (KT) peternakan-sapi jenis Brahman Australia PPKS (Pusat Penelitian Kelapa Sawit ) Bukit Sentang, Securai Utara, Kecamatan Babalan, Langkat selaku pengelola sapi bantuan pusat itu kini semakin berkembang. Demikian Kepala PPKS Bukit Sentang Suhardiman melalui KTU Munirin, Senin ( 4/10). Semula bantuan yang berjumlah 120 ekor itu sampai saat ini para kelompok tani Rispa PPKS Bukit Sentang Securai Babalan yang berjumlah tiga kelompok itu terus aktif memelihara hewan ternak impor itu. Lembu impor itu telah berjumlah delapan ekor yang lahir di Langkat apakah ini masih terus berkembang kita doakan saja agar PPKS Bukit Sentang Medan yang berkantor di P.Brandan.terus maju selain sawit dan ternaknya. (c02)

Tidak Ada Kaitan Sumbangan Dengan Kendaraan Dinas BINJAI (Waspada): Kepala Dinas Kesehatan Kota Binjai dr HT Murad El Fuad meminta pegawai Puskesmas yang tidak ikhlas memberi sumbangan Hari Kesehatan Nasional(HKN) 2010 dipersilakan mengambil uangnya. Kadis Kesehatan Rabu( 6/10) menjelaskan, kepada staf Puskesmas yang memperoleh kenderaan dinas sepeda motor,tidak ada paksaan memberikan sumbangan. “Saya belum tahu, jumlah sumbangan di kotak dan berapa anda menyerahkan bantuan untuk HKN,” ujar Fuad. Jangan kaitkan sumbangan dengan peroleh sepeda motor dinas. Kalau tidak ikhlas memberi sumbangan, kendaraan dinas juga tidak diambil,” ujar Fuad. Dr HT Murad El Fuad menyebutkan, Dinas Kesehatan memprogramkan penyediaan sepeda motor bagi staf di Puskesmas 650 unit. Tahun ini disetujui 37 unit. Kadis Kesehatan menyerahkan pemakaian kendaraan dinas itu kepada Ka Puskesmas. Kepala Puskesmas yang menentukan siapa yang berhak. Kebetulan bersamaan dengan pengumpulan dana Hari Kesehatan Nasional, biayanya tidak ada dianggarkan. Seperti tahun lalu pelaksanaan HKN juga berkat sumbangan staf dan terkumpul Rp64 juta. Fuad mengakui, belum mengetahui jumlah sumbangan. Bagi yang menyumbang bisa memasukkan ke dalam kotak yang sudah disediakan. “Kotak belum dibuka, jika tidak ikhlas, sebutkan jumlah dana diberikan, kita saksikan dikotak,” ujarFuad.Sebabsumbanganitutidakadakaitannyadenganperolehan kendaraan dinas. (a03)

Pemkab Simalungun Diminta Alihkan Mobil Pintar Ke Disdik SIMALUNGUN (Waspada): Salah seorang anggota Dewan PendidikanNasional (DPN) SimalungunIrwansyahmemintaPemkab Simalungun segera mengalihkan pengoperasian Mobil Pintar dari Karang Taruna kepada instansi Dinas Pendidikan dan Pengajaran. Harapan itu dikemukakan Irwansyah setelah melihat dua tahun pengoperasian Mobil Pintar bantuan dari Otorita Asahan tersebut kurang optimal, bahkan operasionalnya tidak banyak diketahui masyarakat. “Sudah saatnya Pemkab Simalungun meninjau kembali pengelolaan dan pengoperasian Mobil Pintar tersebut. Saya menilai Dinas Pendidikan dan Pengajaran Simalungun akan mampu mengoptimalkan operasional Mobil Pintar itu, sehingga jelas pemanfaataanya bagi masyarakat,” tegas Irwansyah. Menurutnya, Mobil Pintar yang diserahkan oleh Ibu Negara AniYudhoyonokepadaPemkabSimalungunmelaluiBupatiSimalungun HT Zulkarnain Damanik, pada 2008 lalu sebaiknya dimanfaatkan sebagai perpustakaan keliling ke sekolah-sekolah.Terutama ke sekolah yang berada di wilayah pedesaan untuk menumbuhkan minat baca serta menambah wawasan masyarakat. Bupati Simalungun HT Zulkarnain Damanik, meminta Kantor ArsipdanPerpustakaansertaDinasSosialuntukmengecekkeberadaan Mobil Pintar yang pengelolaannya diserahkan ke Karang Taruna Kab.Simalungun sejak 2008 lalu. (a15)

Suka Sama Suka Pelajar Lakukan Hubungan Suami Istri, Akhirnya Ke Polisi P.SIANTAR (Waspada): Pelajar sedang berpacaran lalu melakukan hubungan layaknya suami-istri meskipun atas dasar suka sama suka, akhirnya berurusan dengan Polres Simalungun. Pasalnya, orang tua/keluarga si pelajar putri tidak senang dan bisa menerima peristiwa itu, lalu mengadukan si pelajar putra, BP, 19. Keterangan dihimpun dan pengaduan di Polres Simalungun, Kamis (6/10) menyebutkan, pelajar putri itu HD, 15, siswa salah satu SMA, warga Kec Dolok Batunanggar, Kab. Simalungun. Keduanya diduga melakukan hubungan layaknya suami istri di kebun sawit Dolok Ilir, Kel. Serbelawan, Dolok Batunanggar, Sabtu (11/9). Mereka berdua pergi berjalan-jalan dan sampai ke areal kebun kelapa sawit. Saat berduaan itu, mereka bermesra-mesraan dan akhirnya BP membujuk HD melakukan hubungan suami isteri. HD yang memang suka terhadap pacarnya tidak menolak ajakan itu. Sesudah itu, hubungan keduanya masih berjalan normal. Namun, lama kelamaan BP mulai jarang menemui HD dan akhirnya tidak pernah bertemu lagi. Akibatnya, HD menjadi pemurung memikirkan tingkah pacarnya itu. Keadaan itu membuat keluarga HD bertanyatanya dan akhirnya menanyakan langsung kepada HD. Meski sempat menutupi perbuatan mereka, HD akhirnya mengakui hubungan suami istri yang sudah dilakukannya dengan BP secara suka sama suka. Namun, keluarga HD tidak dapat menerima perbuatan BP itu, se hingga akhirnya membawa HD ke Polres Simalungun dan mengadukan BP. (a14)

WASPADA Senin 11 Oktober 2010

Waspada/Parlindungan Hutasoit

SIPIR NI TONDI: Gubsu H Syamsul Arifin Silaban, SE didampingi Bupati Humbahas Drs. Maddin Sihombing, MSi disambut para tokoh masyarakat dan keturunan Borsak Junjungan Silaban sekaligus memberikan beras Sipir Ni Tondi sebagai ungkapan rasa syukur atas terlaksananya syukuran di Bonapasogit, di Desa Silaban, Kec. Lintong Nihuta, Minggu (10/10).

Gubsu: Humbahas Dijadikan Pusat Peternakan Kerbau Di Sumut D.SANGGUL (Waspada): Ribuan warga keturunan Borsak Junjungan Silaban mengikuti Pesta Syukuran sedunia di Lapangan SMA Unggulan Desa Silaban, Kecamatan Lintong Nihuta. Kabupaten Humbang Hasundutan, Minggu (10/10). Acara pertama sekali dilaksanakan ini dihadiri Gubernur Sumut H. Syamsul Arifin Silaban SE, Bupati Humbahas Drs. Maddin Sihombing MSi, Wakil Bupati Taput Bangkit P Silaban, SE, Ketua DPRD Humbahas BangunSilabanSE,KetuaMABMI Sumut Nazrin Naim, Kadis Sosial Sumut Saiful Syafri Sipahutar, Darwin(Kesbang SU), Sanggam Bakkaradanparaperantaumarga Silaban dari berbagai daerah. Kedatangan Gubernur Sumutitudisambutdenganacara adat pemberian beras sipir ni tondi oleh tokoh-tokoh marga Silaban sebagai ungkapan rasa kekeluargaanyangdiiringidengan lagu Mars Silaban. Gubsu H Syamsul Arifin Silaban dalam sambutannya menyampaikan rasa bangga atas pelaksanaan partangiangan BorsakJunjunganSilabanSedunia yang dihadiri ribuan turunan marga Silaban. Ini merupakan sejarah penting karena baru pertama sekali dilkasanakan, tetapi yang terpenting momen ini hendaknya dapat merobah nasib keturunan Silaban. “Jangan lagi orang Batak berbondong-bondongkeMedan, Jakarta dan Bandung, sehingga lupa kampung halamannya. Mari kita urus kampung halaman kita ini yang kita mulai dari diri kita sendiri,” harapnya. Gubsu juga mengajak warga Humbahas untuk tetap kompak, bersatu untuk mendukung pembangunan dibawah kepemimpinan Bupati Humbahas Drs. Maddin Sihombing.”Saya sudah

berbicara dengan Bupati apaapa yang perlu dibangun dikampung kita ini. Pembangunan sekolah unggulan sudah kita mulai. Ke depan, lanjutnya, saya akan jadikan Humbahas sebagai pusatpeternakankerbaudiSumatera Utara, caranya dengan pemberian bergulir sehingga semua warga ataupun petani dapat kebagian secara bergilir. Selainitu,Gubsumemikirkan pembangunan Home Stay Batak untuk mendukung pariwisata di kawasanDanauTobayangtujuannya untuk meningkatkan mata pencaharian rakyat, seperti yang terjadi di Bali .”Kita harus jadikan wisataitusebagaimatapencarian, jangan sebagai penonton di daerah kita ini,” ujarnya. Untuk tahun 2011, kata Gubsu, akan diwujudkan kerjasama dengan Pemkab Humbahas dalam bentuk pemberian bantuan di berbagai sektor. Untuk itu kita doakan Butapi Humbahas tetap sehat memimpin Humbahas ini. Sebab saya bermimpi kabupaten ini akan dapat maju pesat. Dan saya selaku marga Silaban tetap komit untuk tetap membangun daerah ini dan saya belum bisa mati dengan tenang apabila

daerah Bona Pasogit tercinta ini belum maju. Jadi kita tidak usah takut dengan keadaan ini. Sementara, Bupati Humbahas, mengatakan, partangiangan marga Silaban itu merupakan suatu berkat yang dapat mendukung kekondusifan masyarakat di Humbahas. Ia juga mengajak anak rantau untuktetappedulikeBonaPasogit, seperti yang dilakukan Gubernur Syamsul Arifin Silaban yang telah banyak memperhatikan pembangunan di sektor pendidikan. Untukitubupatimengharapkan, agar pertemuan yang membangun kebersamaan ini hendaknya dilakukan berkelanjutan, sehingga dapat menjadi motivasi kepada marga lainnya untuk membangun Bona Pasogitnya. Sebelumnya, Ketua Umum Borsak Junjungan Silaban, Sahat Silaban dalam laporannya mengatakan, partangiangan itu merupakan yang pertama sekali sejak 500 terakhir. Jumlah yang hadir diperkirakan 12 ribu yang datang dari berbagai pulau. Acara partangiangan berlangsung suka cita diawali dengan kebaktian bersama, kemudian acara adat dan hiburan.(a13)

Bupati Pakpak Bharat Buka Rapat P3D 2010 SALAK, Pakpak Bharat (Waspada): Bupati Pakpak Bharat Remigo Yolando Berutu membuka secara resmi rapat P3D (Pemantapan Penyelenggaraan Pemerintahan Desa) 2010, Jumat (8/10) di Gedung Serba Guna Salak, Kecamatan Salak, Kabupaten Pakpak Bharat. Acara itu dihadiri Asisten I dan II, para camat dan kepala desa, Ketua BPD (Badan Pemberdayaan Desa) dan sekretaris desa seKabupaten Pakpak Bharat, USAID Amerta, Pimpinan CDAM, Heifer dan Aliansi Pro Agribisnis serta para undangan lainnya. RemigoYolando dalam sambutannya mengatakan, melalui rapat rapat ini, kita tingkatkan kinerja, tugas dan fungsi pemerintahan desa demi mewujudkan masyarakat yang sejahtera. “Hal-hal yang terpenting saya sampaikan secara khusus kepada para perangkat desa khususnya para kepala desa agar senantiasi tampil dengan ellegan, gagah, berwibawa dan berpenampilan sebagai kepala pemerintah di desa serta menjadi panutan dalam berbagai hal,” katanya. Disebutkan Remigo, di dalam visi dan misinya ada tertera satu kalimat yang terpenting yakni, kepemimpinan yang adil dan demokratis. (c08)

Demi Kemajuan Pembangunan, Asahan Butuh Masukan Dari Perantau JAKARTA ( Waspada) : Asahan saat ini membutuhkan bantuan pemikiran, modal usaha dan program nyata guna memacu pembangunan. SesepuhmasyarakatKisaranAsahan H Sujaan Hasibuan MHum mengatakan hal itu dalam Halal Bi Halal Kerukunan Keluarga Kisaran-Asahan di gedung Nyi Ageng Serang, Kuningan, Jaksel, Minggu (10/10). Hadir Bupati Asahan Drs H Taufan Gama Simatupang MAP dan nyonya, anggota DPR RI MaiyasakJohanMHum,ilmuwan DR M Evri dari BPPT Jakarta, Witarsa Tambunan, Subio Marhut Siregar, ribuan warga K3 Jabotabek, utusan K3 Riau, Batam, Bengkalis, Jambi, Bogor, Yogyakarta, Surabaya, dan bendahara K3 Medan-Sumut Charles Antony Panjaitan. KetuaPanitiaHAnharDarwis dan Ketua K3 Pusat H Syahrizal Siregar menyatakan, acara ini sekaligus silaturahmi dan urun rembug saling tukar informasi sebagai bahan pertimbangan perubahan Asahan ke depan. SujaanHasibuanmengingatkan warga yang mudik ke kampung halaman jangan hanya sekadarjalan-jalan,namunmemperhatikan potensi dan masalah apa yang bisa dibantu perantau Asahan. Bupati Asahan Drs H Taufan Gama Simatupang MAP menyambut baik tekad K3 pimpinan Syahrizal Siregar. “Tahun depan acara ini hendaknya disatukan dengan Ikatan Keluarga Asahan, jadi kami tidak mondar-mandir

LIMAPULUH (Waspada): Penerimaan CPNS Formasi 2009 Pemkab Batubara masih menyisakan persoalan, Dahlia salah seorang pelamar yang namanya tercantum dalam pengumuman pemenang CPNS tapi dinyatakan kalah merasa haknya diabaikan terus melakukan upaya keberbagai pihak agar Pemkab Batubara memberikan kesempatan padanya . Kepada Waspada, Sabtu (9/10) Syahrul Saleh, 64, ayah Dahlia mengungkapkan jalan panjang yang telah dilakukannya agar anak perempuan yang diharapkan membantu perekonomian keluarganya dapat berubah nasibnya. “Laporan pertama saya sampaikan kepada Lembaga Pemantau CPNS Batubara, Arsyad Nainggolan dan rekan. Pada saat itu mereka mendampingi Dahlia ke Polres Asahan, namun hingga kinibelumdiketahuiperkembanganapadiPolres,” ujar Syahrul. Pada tanggal 15 Juni 2010 Dahlia dikatakannya juga telah dipanggil Kejaksaan Tinggi Sumatera Utara untuk didengar keterangannya dengan adanya dugaan tindak pidana korupsi dalam penerimaan Calon Pegawai Negri Sipil (CPNS) tahun 2009 pada Pemkab Batubara. Namun menurut Syahrul hingga kini juga belum diterimanya

perkembangan dari Kejaksaan Tinggi tentang masalah anaknya tersebut. Surat terakhir diterimanya dari Badan Kepegawaian Negara yang ditantangani oleh Direktur Pengendalian Kepegawaian I Bosman Sitinjak, SH. MH tanggal 21 Juli 2010 sebagai tembusan surat BKN kepada Bupati Batubara yang mempertanyakan dugaan kecurangan dalam penerimaan CPNS di Kab. Batubara dengan cara merubah nomor ujian 348610005 yang seharusnya milik Dahlia namun pada pengunguman yang dinyatakan lulus adalah peserta nomor 348610005 atas nama Dede Anggara.SurattersebutmemintaBupatiBatubara mengklarifikasi persoalan tersebut dalam waktu yang tidak terlalu lama. Selain itu Syahrul juga telah menyampaikan surat kepada Presiden RI Soesilo Bambang Yudhoyono agar masalah yang sedang dihadapinya mendapatkan kejelasan. Namun hingga kini belum mendapatkan balasan. Ia mengharapkan Pemkab Batubara yang turut ia perjuangkan dalam pemekarannya ini memberikan kebijaksanaan yang terbaik terhadap anaknya Dahlia. (a31)

Ratusan Pembangunan Ruko Di Rantauprapat Tetap Berlanjut Bupati: Baru 25 IMB Yang Ditandatangani RANTAUPRAPAT(Waspada): Ratusan bangunan rumah toko (Ruko) masih terus berjalan pembangunannya, padahal Bupati Labuhanbatu akui baru menandatangani Izin Mendirikan Bangunan (IMB) setelah beliau menjabat sebagai Bupati Labuhanbatu yang dilantik 19 Agustus 2010. Hal ini dikatakan Bupati Labuhanbatu dr H Tigor Panusunan Siregar, Sp.PD, Jumat (8/10) di Kantor Bupati. “Sejak saya menjadi Bupati, saya baru teken 25 IMB dan kita sudah rencanakan kedepannya setiap bangunan yang hendak dikerjakan harus memiliki plank IMB yang dipajang dibangunan yang didirikan” Ucapnya. Katanya lagi, kita akan menindaklanjutinya dan hal ini baru saja dibahas guna mencari solusi apa yang akan dilakukan selanjutnya, secepatnya akan ditertibkan, ujar Tigor. Dalam waktu yang bersamaan, Kepala Dinas Cipta Karya dan Tata Kota Mahini Rizal, Dinas Cipta karya hanya mengeluarkan rekomendasi teknis saja sesuai dengan permohonan dari pihak pengusaha. Setelah itu pihaknya melaporkan ke bagian pemerintahan guna diterbitkan IMBnya, kalau mengenai IMB tak terbit tapi bangunan tetapdilakukan,itubukanwewenangkami,ungkap Mahini Rizal. Katanya lagi, mengenai banyaknya rekomendasiteknisyangdibuatpihaknyaadadataakuratnya, jangankan hanya di bulan September dan Okober saja, sejak Januari pun masih ada, aku Kadis Cipta Karya.

Terkait bangunan ruko di Lingkungan Aek Tapa Kelurahan Ujung Bandar yang akan dibangun sebanyak puluhan pintu, pihaknya mengakui masih menyiapkan sepuluh rekomendasi teknis dan telah disampaikan kepada Kepala Bagian Pemerintahan guna diterbitkan IMBnya, padahal ruko yang akan dibangun hampir 20 pintu. “ Kita hanya mengeluarkan rekomendasi teknis saja, yang selanjutnya diteruskan kepada Kabag Pemerintahan, jadi mengenai bangunan ruko yang di Aek tanpa kita baru keluarkan 10 rekomendasi saja,” katanya. Ketika hendak dikonfirmasi, Kabag Pemerintahan Labuhanbatu Sarbaini melalui selular tidak ada jawaban dan ketika dicoba melalui pesan singkat SMS juga tidak memberikan jawaban. BegitusebaliknyadenganSekdakabLabuhanbatu H Hasban Ritonga tidak menjawab. Kemudian, guna mengetahui tindakan Pemkab dalam rangka penertiban bangunan liar tersebut, Kasat Pol PP Labuhanbatu Poppar Simanjuntak ketika konfirmasi wartawan melalui selular di hari yang sama juga tidak mau mengangkat dan ketika dicoba melalui pesan singkat SMS juga tidak memberikan jawaban. Menyikapi hal itu Ketua Front Putra Daerah (Fropuda) Labuhanbatu Zainul Arifin Hasibuan, sangat menyesalkan tentang ketertutupan jajaran Pemkab kepada insane pers dan berharap agar Bupati Labuhanbatu menindak tegas bawahannya yang tidak mau terbuka kepada insan pers. (c01)

TS Diduga Manfaatkan Situasi Bupati Labuhanbatu RANTAUPRAPAT(Waspada):Sejak dilantiknyadr H Tigor Panusunan Siregar SpPD sebagai Bupati Kabupaten Labuhanbatu dan Suhari Pane, SIP selaku wakilnya, 19 Agustus 2010, tudingan miring terus menerpa dua tokoh muda yang ingin melakukan pembaharuan itu. Pasalnya, sejumlah elemen masyarakat pernghasil karet dan sawit tersebut menilai bahwa orang-orang disekeliling mereka sebahagian adalah pecundang. Visi dan Misi membuat ‘Perubahan Untuk Kemajuan’ diperkirakan tidak akan berjalan mulus karenaadanyaoknum-oknumyangmenghambat proses itu berjalan apalagi di saat musim paket lelang proyek dengan modus menjual-jual nama bupati untuk mendapatkan paket proyek, artinya TSdidugamemanfaatkansituasi,BupatiLabuhanbatu jadi ‘korban’. Kita yakin niat baik Tigor-Suhari sulit tercapai, jika masih ada oknum-oknum yang mencari keuntungan pribadi dibelakangnya. Perjuangan yang akhirnya menjadi kemenangan warga Labuhanbatu waktu Pilkada lalu seakan tidak dihargai,” kata Koordinator Labuhanbatu CorruptionWatchIndonesia(LCWI) ZulhamAbdul Patah kepada Waspada, Jumat (8/10). Dijelaskan Patah, pemimpin Labuhanbatu masa bhakti 2010-2015 itu harus mampu meng-

ambil sikap membina dan mengarahkan kerabatnya untuk tidak melakukan tindakan yang akan menimbulkan opini buruk di tengahtengah masyarakat yang tidak baik. Di sejumlah Satuan Kerja Perangkat Daerah (SKPD) yang ada, tekanan dan ancaman selalu dilontarkan kerabat bupati. “Pengakuan pejabat yang masih duduk, mereka seperti tidak difungsikan sesuai dengan tupoksinya dengan optimal. Karena masih ada oknum datang ke kantor membawa pesanpesan dan berbagai macam permintaan, padahal program bupati sangat bertentangan dengan hal itu.Tanpa memikirkan dampaknya, oknumoknum itu dengan seenaknya meminta proyek atau lainnya,” terang Patah. Tim pemenangan Tigor-Suhari yang juga Sekretaris Forum Masyarakat Labuhanbatu (Formal) Sugianto menjelaskan, jika ada oknum yang berbuat seperti itu, mereka adalah bukan tim Tigor-Suhari. “Jika memang ada orang-orang seperti itu, mereka adalah bukan karakternya orang-orangnya Tigor-Suhari, itu hanya mencari kesempatan. Sampai kini tidak pernah kita melakukan hal buruk itu,” tegas Sugianto melalui telefon seluler.(c01)

Abdi Karo Gelar Kampanye Perdana

Waspada/Nurkarim Nehe

Bupati Asahan Taufan Gama Simatupang berpose dengan Putra Asahan Perantau DR.M.Evri (BPPT Jakarta), H.Anhar Darwis SE.Ak (staff KPK) dan Ir.H.Nazri Elisda Lubis MM (GM anak perusahaan Mitsubishi) di sela halal bi halal K3 (Kerukunan Keluarga Kisaran) Jakarta Minggu (10/10) di gedung Nyi Ageng Serang Kuningan Jaksel ke Jakarta,” ujar Taufan. Taufan memberi contoh kedatangannya ke Jakarta tanpa didampingi pejabat Pemkab Asahan, untuk efisiensi anggaran, hanya membawa istri yang Ketua TP PKK Asahan untuk bersilaturahmi dengan warga perantau. “Saya mencatat semua masukan,baikpotensidanpermasalahan, untuk diterapkan dalam gerak pembangunan di Asahan,” tandasnya. Taufanjugamohonpengawasan tokoh Asahan di perantauan

terhadap kepemimpinannya, sehingga obsesinya memajukan Asahanbisaberjalanbaik,terukur, dan mampu memenuhi kebutuhan masyarakat sesuai program mewujudkanmasyarakatreligius, sehat, cerdas dan mandiri. “Koreksi membangun kami tampung dan laksanakan demi kemajuan Asahan,” ujarnya. DalamkesempatanituBupati menepungtawari Syahrizal Siregar/istri dan Endang Ramli/ suami yang akan menunaikan ibadah haji. (a10)

KABANJAHE(Waspada):Kampanyeperdana Calon Bupati dan CalonWakil Bupati Karo periode 2010-2015 Kol Inf Abet Nego Sembiring dan wakilnya Ir Sanusi Surbakti yang diadakan di Jambur Lige Kabanjahe, Minggu (10/10) memukau para simpatisan yang hadir dari seluruh desa di Kabupaten Karo hingga mencapai lima belas ribu orang. Sebelum berkumpul di Jambur Lige, simpatisanberkumpuldiAbetNegoCenterdiJalanVeteran Kabanjahe tepatnya di depan Kantor DPRD Karo. Start dari centre, secara beriring-iringan dengan menggunakan puluhan kendaraan roda empat dan roda dua, calon bupati dan calon wakil bupati nomor urut 5 tersebut, beserta simpatisannya berkeliling di Kota Kabanjahe sambil berorasi. Dalam pidato politiknya, Abet Nego didampingi istrinya Ita Rasta Elvinasari Br Sukatendel serta wakilnya Sanusi Surbakti juga didampingi istri Ir Pinta Muli BrTarigan, sesuai dengan tujuan utama visi dan misinya menuju masyarakat Karo Sejahtera, dengan slogan “Suruhlah Kami

Pesikapsa” (suruhlah kami memperbaikinya). Sesuai pengalamannya, Abet Nego melihat mental aparat Pemerintah Karo selama ini tidak dapat melayani rakyatnya, malahan minta dilayani. Maka Abet mengharapkan pilihlah Abdi Karo agar dapat melayani dan mensejahterakan serta menghindarkan rakyat Karo dari penderitaan. “MengingatTanahKarodijuluki“TanahKanaan Tanah pilihan Tuhan karena kesuburannya, sangat potensial untuk mensejahterakan rakyat Karo. Untuk itu, tiada istilah petani Karo rugi dan melarat kalau saya nantinya terpilih memimpin Karo ini,” papar Abet di depan para simpatisannya. PantauanWaspada di lapangan, massa berdesakan mendengarkan dengan serius dan sesekali meneriakkan hidup Abdi Karo.Walaupun kapasitas jambur sudah membludak ditambah lagi hembusan angin bercampur debu di bawah sengatan terik matahari, simpatisan tetap setia mendengarkan pidato politik Abdi Karo. (cmm/ a17)

Lions Club Siantar-Medan Host Adakan Operasi Katarak Gratis TARUTUNG (Waspada): Sebagai wujud kepedulian sosial terhadap masyarakat, Lions Club Siantar dan Lions Club Medan (Host) bekerjasama dengan Pemkab Tapanuli Utara mengadakan operasi katarak secara gratis di RSU Tarutung, Sabtu (9/10). Operasi katarak ini dibuka oleh Sekdakab Tapanuli Utara Sanggam Hutagalung didampingi Presiden Lion Club Siantar Djohan Cakra Surja dan ketua tim kordinator operasi Binsar Panggabean.

Tim dokter spesialis mata yang sengaja disiapkan Lions club dari Medan, Siantar dan RSU Tarutung melakukan operasi katarak gratis terhadap 59 pasien katarak dari berbagai kecamatan dan desa di Tapanuli Utara. Proses pelaksanaan operasi langsung dipantau Sekdakab Tapanuli Utara Sanggam Hutagalung, Kadis Kesehatan Tapanuli Utara Jumaga Nainggolan, Asisten I HP Marpaung dan Direktur RSU Tarutung dr Soriady Panjaitan didampingi pengurus Lions Club. (c12)

Aceh

WASPADA Senin 11 Oktober 2010

C9 Sekdes Kabur, Kades Masuk Bui

Abrasi Dan Pasang Purnama Mengganas Di Jangka

GEUDONG, Aceh Utara (Waspada): JLN, oknum Sekretaris Desa (Sekdes) Kampong Baro, Kec. Samudera, Aceh Utara, dilaporkan telah kabur ke luar kota sejak setahun lalu karena diduga terlibat kasus penipuan. Sementara MNS Kepala Desa Kampong Baro, yang merupakan atasan JLN, kini mendekam di bui Polsek Samudera— Geudong, karena kasus sama. Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kapolsek Samudera Iptu Sartono, kepada Waspada, Jumat (8/10) menjelaskan, Sekdes Kampong Baro JLN diduga kuat telah menipu dengan modus gadai tanah. Tersangka menggadaikan sepetak tanah sawahnya untuk enam orang sekaligus dengan cara menggandakan surat gadai. Dengan modus itu, tersangka berhasil mengambil puluhan mayam perhiasan emas dari para korban dengan nilai mencapai puluhan juta rupiah. Kepala Desa Kampong Baro, MNS, ikut terseret karena turut menandatangani surat gadai. Kasus ini mencuat setelah salah seorang korban membuat pengaduan resmi ke Mapolsek Samudera, Jumat (24/9) lalu. Menurut Kapolsek, korban yang melapor bernama Darwati, 50, penduduk Desa Blang Pria, Kecamatan Samudera. Perempuan ini mengaku telah menyerahkan puluhan mayam emas kepada tersangka pada tahun 2008, untuk menggadai sepetak sawah seluas 500 meter persegi. Ketika itu, tersangka menjanjikan akan membagi hasil panen padi, namun tersangka JLN ingkar janji dan belakangan terungkap sawah tersebut ternyata juga digadaikan untuk lima orang lainnya. Para korban atau penggadai, rata-rata menyerahkan lebih dari 10 mayam emas kepada tersangka JLN. “Kasus ini sempat dicoba diselesaikan secara kekeluargaan di Desa Kampong Baro. Tapi gagal,” kata Kapolsek seraya merincikan, lima korban lainnya masing-masing, Baharin Syah, 43, asal Desa Asan, Rusli, 50, asal Desa Krueng Baroe Langkahan, Badin, 50, asal Desa Krueng Baroe Langkahan, Asmawati, 28, anak kandung Darwati, asal Desa Tanjong Hagu, dan Nazaruddin, 32, asal Desa Kampong Baro. Kapolsek menambahkan, tak lama setelah mendapat laporan dari Darwati, pihaknya langsung turun ke lokasi menangkap pelaku. Sayangnya tersangka JLN sudah keburu kabur ke luar kota sejak setahun lalu. Dari hasil pengembangan selanjutnya, sambung Kapolsek, diketahui Kepala Kampong Baro, MNS, juga terlibat karena turut menandatangani surat gadai itu. Alhasil, MNS pun terpaksa diamankan di Mapolsek Samudera—Geudong. “Rencananya, dalam waktu dekat, M Nasir akan segera kita titipkan ke Polres Lhokseumawe, guna menjalani proses penyelidikan lebih lanjut. Kita juga akan terus memburu tersangka JLN sampai tertangkap,” tandas Iptu Sartono.(cmus)

BIREUEN (Waspada): Abrasi pantai dan pasang purnama di Desa Alue Buya Pasie, Kecamatan Jangka, Bireuen saat ini kian mengganas, sehingga warga desa itu terancam kehilangan tempat tinggal. Menurut sejumlah warga desa itu kepada Waspada, Sabtu (9/10), desa mereka terancam tenggelam jika abrasi terus-terusan menghantam permukimannya. Buktinya, beberapa waktu lalu bibir pantai dengan rumah jaraknya mencapai 100 meter, namun kini hanya sekitar 30 meter lagi. Sehingga puluhan hektar kebun warga telah ditelannya. “Bila tak segera ditanggulangi abrasinya akan tambah parah kami ikut kehilangan tempat tinggal dan mata pencaharian,” kata Syahril seorang warga desa setempat. Camat Jangka, Murdani secara terpisah membenarkan hal itu. “Kami sudah berupaya menampung aspirasi masyarakat pesisir itu dengan memberitahukan kepada atasan baik secara lisan maupun melalui proposal untuk dibangun tanggul pemecah ombak di desa itu, namun belum terealisasi,” katanya sembari menambahkan. pihak dinas terkait dari provinsi sudah meninjau lokasi abrasi itu, namun belum juga realisasi sama sekali.(amh)

Baru Direhab, Jalan Kembali Rusak JANGKA, Bireuen (Waspada) : Sejumlah warga Desa Desa Pulo Iboeh, Kec. Jangka, Kab. Bireuen, mengungkapkan, sekitar 30 meter jalan desanya yang belum lama ini diperbaiki kini rusak dan berlubang kembali. Akibatnya, kini mereka kembali kesulitan melintasinya dan kerap terjadi lakalantas karena kondisi jalan seperti itu. Menurut warga di sana, jalan desa mereka yang sekarang rusak kembali itu sudah diperbaiki dan diaspal beberapa waktu lalu. Mereka menduga karena kurang padatnya badan jalan atau diperbaiki kurang maksimal, sehingga kembali rusak dan berlubang. “Menurut kami lihat jalan ini diperbaiki atau diaspal kurang padat sehingga kembali seperti ini (rusak-red),” kata Amir seorang warga dibenarkan sejumlah temannya saat itu, seraya beharap kepada pemerintah supaya segera memperbaiki kembali jalan itu karena jalan itu juga rawan terjadinya kecelakaan lalulintas. (cmus)

Taiwan Siap Tampung Mahasiswa Aceh

Petugas Parkir Langgar Qanun Akan Ditindak BIREUEN (Waspada) : Pihak rumah Sakit Umum Daerah (RSUD) dr. Fauziah Bireuen akan menindak petugas parkir di kompleknya bila menaikkan tarif parkir roda dua melebihi ketentuan yang telah ditetapkan dalam qanun (Perda). Demikian Kepala Tata Usaha (TU) RSUD dr Fauziah Bireuen, Salahuddin, SH, kepada wartawan kemarin.”Bila ditemukan adanya kenaikan tarif parkir di luar peraturan Qanun Daerah Nomor 8 tahun 2009, maka petugas parkir akan ditindak tegas,” katanya. Menurutnya, tarif parkir di rumah sakit masih tetap Rp1000untukrodadua,sedangkanrodaempatRp2000untuk sekali parkir, seesuai qanunnya. “Jika ada yang menaikkan harga, kita akan menindak tegas pelakunya,” ulangnya. Sebelumnya sejumlah pasien JKA berobat jalan, Askes, Jamkesmas serta sejumlah keluarga pasien mengaku kecewa atas ulah petugas parkir yang menaikkan tarif parkir di RSU Bireuen itu senilai Rp2000 untuk kendaraan roda dua.(amh)

Tata Kelola Ekonomi Aceh Utara Jalan Di Tempat ACEH UTARA (Waspada): Robert Endi Jaweng, External Relations Manager Komite Pemantauan Pelaksana Otonomi Daerah Regional Autonomy Watch, Kamis (7/10) menyebutkan, tata kelola ekonomi Kabupaten Aceh Utara jalan di tempat. Buktinya, hasil survei tahun 2008, posisi kinerja Pemkab Aceh Utara berada di urutan ke delapan dari 23 kabupaten/ kota di Provinsi Aceh, dan hasil survei pada tahun 2010, kinerja Pemkab Aceh Utara juga masih pada urutan ke delapan. “Apa yang menyebabkan, posisi kinerja Pemkab Aceh Utara jalan di tempat, kita belum tahu persis. Ada banyak kemungkinan di sini, salah satunya, sarana jalan antar kecamatan dominant rusak parah, birokrasi terlalu panjang, pengurusan izin usaha yang sulit. Akibatnya, investor enggan berinvestasi di sini. Selain itu, komunikasi kepala daerah dengan berbagai pihak yang kurang baik,” katanya. Selain itu, Robert juga mengatakan, tidak sinergi antara pengusaha di Aceh Utara dengan Pemda setempat, atau mungkin akibat tidak mendukungnya dana ABPK, sehingga banyak hal yang belum dapat dibenahi. “Halhal yang seperti ini harus segera diperbaiki, agar tata kelola ekonomi Aceh Utara membaik, sehingga kemakmuran masyarakat dapat diwujudkan,” katanya. (cmun)

Terkait Pembangun Jalan Section IV KPBS Dukung Ketegasan USAID BANDA ACEH (Waspada): Hingga kini, lintas barat selatan Aceh masih sulit dilalui. Hal ini disebabkan masih ditemukannya kendala dalam pembangunan jalan Banda Aceh-Calang yang didanai Pemerintah Amerika Serikat (USAID). Dengan dalih pembebasan tanah yang tak kunjung selesai, beberapa pihak yang mengaku pemilik tanah sempat memblokade jalan tersebut. Tentu hal ini berdampak pada pembangunan kawasan barat selatan Aceh. Terkait itu, Kaukus Pantai Barat Selatan (KPBS) Aceh melalui jurubicaranya, TAF Haikal, memberikan apresiasi kepada pihak USAID yang telah berani bersikap tegas. Komentar Team Leader Pembangunan Jalan USAID, Roy R Ventura Jr PE, untuk menghentikan proyek itu, respon yang tepat. “Tinggal bagaimana sikap dari Pemerintah Aceh dan Kabupaten Aceh Jaya dalam mengatasi persoalan pembebasan tanah tersebut,” ujar TAF Haikal di depan sejumlah wartawan di Banda Aceh, Kamis (7/10). Menurut KPBS, masyarakat kawasan Barat Selatan seperti Aceh Barat, Nagan Raya, Abdya, Aceh Selatan, Simeuleu, Subulussalam dan Singkil, sudah cukup bersabar. (b07)

Ketibaan (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 398 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *

FireFly

Keberangkatan (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta

16:30

11:15 JT 397 Medan/Jakarta 16:00 JT 307 Jakarta 19:50 JT 399 Medan/Jakarta

07:20 11:55 16:35

12:50 SJ011 Medan/Jakarta

13:20

12:20 AK 306 Kuala Lumpur *

FY 3401 Penang 13:50 FY 3400 Penang * Setiap Senin, Rabu, Jumat dan Sabtu.

12:45 14:20

Waspada/Abdul Mukthi Hasan

Seorang warga melihat abrasi Pantai Desa Jangka Alue Buya Pasie, Bireuen, Sabtu (9/10) yang semakin parah dan mengancam rumah warga.

Komisi VI DPR-RI Panggil Tim Likuidator Aset PT AAF ACEH UTARA (Waspada): Ir. Muhammad Azhari, SH.MH, anggota Komisi VI DPR-RI dari Partai Demokrat, Minggu (10/10) pagi kepada Waspada mengatakan, pihaknya dalam waktu dekat akan memanggil Kementerian BUMN, PT. AAF dan Tim Likuidator untuk membahas persoalan penjualan aset perusahaan itu. Informasi yang diterima Azhari, Tim Likuidator sedang berusaha menjual berbagai aset PT. AAF, seperti 300 unit rumah mantan karyawan. Menurut Azhari, sesuai prosedur hukum, tindakan Tim Likuidator telah menyalahi aturan. Seharusnya, sebelum menjual, Tim Likuidator meminta izin DPR-RI, khususnya Komisi VI yang membidangi BUMN. “Mereka sama sekali belum minta izin dari DPR-RI untuk menjual aset ini. Ini memang sudah aturan, setiap penjualan aset BUMN harus melalui DPR-

RI, tidak boleh melalu Menkeu atau Presdien. Tim Likuidator telah salah langkah. Maka mereka harus dipanggil,” kata Ir. M. Azhari. Jika ada aset PT. AAF yang telah lebih dulu dijual, maka Tim Likuidator harus segera mengambalikan menjadi aset negara. Apabila Tim Likuidator menolak, maka persoalan itu harus diselesaikan sesuai hukum yang berlaku. Secara pribadi Azhari berpendapat, sebaiknya Pemerintah Republik Indonesia segera menghidupkan kembali PT. AAF demi kemakmuran dan kesejahteraan hidup masyarakat, khususnya masyarakat di Provinsi Aceh. Selain PT. AAF pemerintah juga harus menghidupkan PT. Kertas Kraf Aceh yang telah lama vakum. Padahal, kondisi PT. KKA masih prima dan siap digunakan kapan saja.

“Kami di DPR-RI, khususnya Partai Demokrat berkomitmen untuk berjuang agar ke dua proyek vital itu hidup kembali, sehingga angka pengangguran dapat ditekan perlahan-lahan,” sebut salah seorang putra terbaik Aceh itu. Seperti diberitakan sebelumnya, jika Tim Likuidator nekad akan menjual aset rumah mantan karyawan PT. AAF. Masyarakat mantan pemilik tanah berjanji akan menghalangi tim tersebut. Masyarakat berharap, pemerintah dan DPRRI segera turun tangan untuk menyelesaikan persoalan itu. “Kami tidak rela, aset PT. AAF dijual. Kalau aset itu dijual, maka Tim Likuidator harus berhadapan dengan masyarakat. Masyarakat berharap, proyek vital itu dihidupkan kembali,demi kesejahteraan rakyat,” kata TS. Sani, salah seorang tokoh masyarakat Dewantara. (cmun/b03)

Ghufran Zainal Abidin Kembali Pimpin PKS Aceh BANDA ACEH (Waspada): Tgk. H. Ghufran Zainal Abidin kembali memimpin Partai Keadilan Sejahtera (PKS) Aceh periode 2010-2015. Sedangkan Tgk Bustanul Arifin dan Tgk. Ismunandar Badruzzaman didaulat menjadi Ketua Majelis Pertimbangan Wilayah (MPW) dan Sekretaris MPW. Ghufran yang juga anggota DPRA itu terpilih kembali dalam Musyawarah Wilayah ke 2 PKS Aceh yang berlangsung di Anjong Monmata, Banda Aceh sebagai Ketua Umum Dewan Pengurus Wilayah PKS Aceh. Lalu, Moharriadi Syafari, ditetapkan sebagaiWakil Ketua Umum DPW. Di posisi Sekretaris Umum H. Saifunsyah, SE.,M.SiAk., dan Bendahara Umum DPW Alfi Rahman. Pelantikan pengurus baru tersebut dilakukan DPP PKSWilayah

Dakwah Sumatera, H. Muhammad Ihsan diikuti dengan pernyataan sikap politik Muswil ke 2 PKS Aceh. Dalam pidatonya, Ghufran Zainal Abidin menegaskan, pihaknya siap berperan positif dan konstruktif bagi kemajuan pembangunan di Aceh.“PKS akan mendukung setiap langkah Pemerintah Aceh yang berorientasi pada kerja keras dan bersamasama,” ujar dia. Katanya, Pemerintah Aceh juga harus mampu membangun dan mencontohkan kekompakan dan hormonisasi jalannya rodapemerintahan.Disampingitupemerintah Aceh didesak untuk secara luas melibatkan banyak pihak terutama dari kalangan ulama dan poros-poros penting masyarakat. “Pemerintah Aceh dan seluruh elite politik harus bersatu padu dan menghin-

dari munculnya permusuhan, pertikaian dan konflik baru yang horizontal di Aceh,” tutup Ghufran mengakhiri pidatonya. Sementara dalam pernyataan sikap politik yang berisi enam poin itu dibacakan oleh Tgk. Rasmanudin H. Rahamin, Ketua DPD PKS Simeulue. Pernyataan itu antara lain mendesak Pemerintah Pusat mempercepat Peraturan Pemerintah terkait kewenangan pelaksanaan Undang Undang No 11 tahun 2006 tentang Pemerintahan Aceh dengan menghormati isi perjanjian (MoU) Helsinki. “PKS dukungan dan berperan aktif dalam usaha menjaga dan memelihara perdamaian di Aceh serta mendorong Pemerintahan Aceh dan semua pihak untuk terciptanya good governance dan clean government,” sebut dia.(b05)

Penasaran Lihat Jakarta, Siswa Kelas 1 SMA Nekad Kabur Ongkos Pergi Ditabung Selama Dua Tahun MADAT, Aceh Timur (Waspada): Setelah sempat dilaporkan menghilang sekitar dua pekan, Munawar (foto), siswa kelas 1 SMAN-1 Pantonlabu asal Desa Paya Naden, Kec. Madat Aceh Timur, akhirnya kembali ke rumah, Sabtu (9/ 10) malam. Remaja itu mengaku pergi ke Jakarta, hanya karena memenuhi rasa penasarannya yang sudah bertahun dipendam. “Saya terpaksa tidak pamit sama ibu dan ayah karena takut dilarang pergi. Saya benar-benar penasaran melihat wajah ibukuta Jakarta di televisi. Sudah sejak SMP saya ingin ke sana. Saat pergi, saya bawa uang Rp850 ribu. Uang itu saya tabungselamaduatahundarisisauangjajan,” kataMunawarditemanikakeknyaMYakob, 60, kepada Waspada, Minggu (10/10). Munawar menceritakan, meski tidak pernah pergi jauh, demi memenuhi rasa penasarannya ia memberanikan diri pergi ke Jakarta via Medan. Putra sulung dari dua bersaudara itu berangkat dari terminal Pantonlabu—sekitar 5 Kilometer arah barat rumahnya— dengan Bus Kurnia trayek Lhokseumawe-Medan, Rabu (29/9) malam. Setiba di Medan, Munawar beristi-

rahat beberapa jam di gudang bus, lalu dengan menumpang angkutan kota (angkot) ia pergi ke Bandara Polonia Medan. Munawar sempat tersesat di Medan karena salah naik angkot. Singkat cerita, Munawar akhir-nya berhasil membeli tiket pesawat dan Kamis (30/9) petang, ia mendarat selamat di Bandara Soekarno Hatta, Jakarta. “Begitu turun pesawat di Bandara Soekarno Hatta, saya gembira, tapi bingung harus kemana. Setelah berjalan kaki sekitar

dua kilometer, lalu saya naik metro mini dengan tujuan tak pasti. Saya turun di kawasan Pondok Indah dan sempat tidur di salah satu mushalla kawasan itu selama dua malam. Setelah itu saya dijemput dan diajak ke rumah Bang Agam, yang belakangan saya ketahui berasal dari desa saya (Paya Naden-red) dan ia sudah lama tinggal di Jakarta,” imbuhnya. Munawar mengisahkan, setelah dua malam berada di Jakarta, ia mengirim pesan singkat ke salah seorang temannya di kampung. Dalam pesan singkat itu, Munawar memberitahukan dirinya berada di Jakarta. Ia juga minta orang tuanya tidak susah dan sedih karena dirinya sehat wal afiat serta akan pulang hari raya Idul Adha nanti. Berdasarkan sms ini, keluarga Munawar menelfon Bang Agam dan meminta bantuannya untuk melacak Munawar. “Saya dibawa keliling Jakarta oleh Bang Agam, termasuk di bawa ke Taman Mini Indonesia Indah (TMII) dan asrama mahasiswa Aceh— Wisma FOBA (Fonds Oentoek Bantoen Atjeh), di kawasan Setiabudi Jakarta. Setelah puas keliling kota, saya baru pulang dengan ongkos kiriman dari kampung,”tandas Munawar.(cmus)

BANDA ACEH (Waspada): Dirjen Perguruan Tinggi Taiwan Tony Lin menyatakan, Taiwan siap menampung putra-putri Aceh yang ingin melanjutkan studi S1, S2 dan S3 di negara itu. “Ini perlu kami lakukan untuk mengembangkan UniversitasTaiwan ke berbagai negara,” kata Tony Lin yang juga pimpinan rombongan 38 universitas di Taiwan saat menghadiri jamuan makan malamWagub Aceh Muhammad Nazar di Meuligo Gubernur Aceh, Sabtu (9/10). Disebutkan, pihaknya amat berterma kasih kepada Pemerintah Aceh dan Universitas Syiah Kuala serta Komisi Beasiswa Aceh yang telah memberikan layanan untuk perguruan tinggi di negerinya melakukan Pameran Universistas dan Ilmu Pengetahuan di Unsyiah. Sementara itu, Wagub Aceh Muhammad Nazar berharap, 38 universitas dari Taiwan yang melakukan pameran berbagai bidang studi di Aceh dapat membantu memperkenalkan potensi investasi di Aceh kepada kalangan dunia usaha di negara itu. Wakil Gubernur juga berharap, kerjasama yang dilakukan tidak hanya bidang pendidikan dan perguruan tinggi, tetapi hendaknya diperluas sampai ke sektor perdagangan, industri, pariwisata, pertanian dan perikanan. Menurut Wagub Muhammad Nazar, antara Taiwan dengan Aceh sebenarnya memiliki beberapa kesamaan terutama suku Gayo dan Alas. Kesamaan itu antara lain bahasa, seni, dan budaya. “Tahun lalu ada sekitar 50 warga Taiwan yang berkunjung ke Aceh Tengah yang dilanjutkan dengan kunjungan balasan oleh masyarakat Gayo ke Taiwan. Dari 20 kata yang mereka ucapkan, 12 di antaranya memiliki kesamaan dalam hal lafaz dan arti,” tutur Muhammad Nazar. Pada jamuan makan malam yang dihadiri sejumlah pejabat Provinsi Aceh itu, juga dipagelarkan sejumlah tari tradisional seperti Tari Saman yang sudah kesohor ke manca negara. (b09)

Warga Bangladesh Ditangkap BIREUEN (Waspada): Muhammad Qabir bin Hasan Ali,36, asal Desa Amir Abbas, Kota Daka Ibukota Bangladesh, ditangkap warga Desa Kareung, Kuala, Kab. Bireuen, lalu diserahkan kepada jajaran Polres Bireuen lalu diserahkan ke Imigrasi Lhokseumawe, Jumat (8/ 10) malam. Menurut keterangan Waspada peroleh Sabtu (9/10), warga asing itu sudah merantau jadi pekerja sebagai buruh di Malaysia semenjak usia 15 tahun. Setelah itu dia menikah dengan Murni Rauf, 35, wanita asal Desa Kareung dan kembali bersamanya ke desa itu. Kemudian ditangkap warga dan diserahkan kepada pihak anggota Polres. Kapolres Bireuen AKBP H.R Dadik Junaedi S.H melalui Kasatreskrim AKP Khairul Saleh SH Sik, mengatakan, Muhammad Qabir ditangkap jajaran Polres Bireuen lantaran tidak memiliki dokumen lengkap di kawasan Desa Kareung Kecamatan Kuala Bireuen. Dia berada di desa itu karena menikahi Murni Rauf di Malaysia 2005 lalu, saat sama-sama bekerja di negeri jiran itu. Selang dua bulan setelah isterinya kembali ke Desa Kareung 2009 lalu, Muhammad Qabir datang ke Aceh melalui Tanjung Pinang, Kepulauan Riau dengan boat dan turun di Kuala Peureulak, Aceh Timur, kemudian menuju Bireuen dengan menumpang bus umum. Muhammad Qabir, bekerja di Masjid Agung Bireuen, itu selama ini tinggal di rumah mertuanya. Sebulan terakhir dia membuat ulah di desa itu, istrinya yang sudah mengaruniakan seorang anak itu diceraikan dan Qabir mau menikah lagi dengan perempuan lain. Resah dengan tingkah pria asing itu, warga Desa Kareung menangkapnya lalu diserahkan ke Polsek Jeumpa Bireuen. Ternyata Qabir sama sekali tidak punya dokumen, baik paspor, visa juga KTP. “Wajah dia itu mirip sekali orang Aceh karena tinggal pinggir laut jadi tidak ada yang curiga dia warga negara asing,” kata Kasat Reskrim AKP Khairul Saleh. Sebelum diserahkan ke polisi, lanjutnya, dia sempat dipukuli warga. “Karena tidak memiliki dokumen lengkap Muhammad Qabir setelah itu kita serahkan ke Kantor Imigrasi Lhokseumawe,” jelasnya. Sementara itu, Muhammad Qabir yang telah menguasai Bahasa Indonesia walaupun bercampur dengan logat Malaysia ketika ditanya wartawan di Mapolres Bireuen mengaku, paspor miliknya tidak ada lagi karena sudah ditahan majikannya di Malaysia. “Ndak ada apaapa saya, semua sudah ditahan di sana (Malaysia-red),” katanya. Sementara itu, Kepala Kantor Imigrasi Lhokseumawe melalui Seksi Pengawasan, Penindakan Keimigrasian, Sukarna yang didampinggi didampingi Sukantono, selaku staf kantor Imigrasi kelas II Lhokseumawe saat menjemput Muhammad Qabir di Polres Bireuen mengatakan, Muhammad Qabir dikirim ke Lhokseumawe untuk diperiksa. “Kita bawa dulu dia untuk diperiksa,” katanya.(amh)

Waspada/Abdul Mukthi Hasan

Kasat Reskrim Polres Bireuen, AKP Khairul Saleh (kiri) mendapingi Muhammad Qabil bin Hasan Ali asal Bangladesh di Maplres Bireuen, Sabtu (9/10), saat akan berangkat Lhokseumawe.

Aceh 2.800 Rumah Korban Gempa Belum Dibangun

C10

WASPADA Senin 11 Oktober 2010

Krisis Listrik Di Simeulue Harus Segera Diatasi

Waspada/Muhammad H. Ishak

AL QUR’AN RAKSASA: Sekum Panpel MTQ XXXI Aceh Timur, Tgk. Amiruddin, S.Ag, tengah memperhatikan Al Qur’an raksasa yang tengah dipersiapkan untuk malam pembukaan MTQ kabuupaten di Kecamatan Julok, Senin (11/10) malam. Foto diambil, Minggu (10/10).

Malam Ini MTQ XXXI Aceh Timur Dibuka JULOK, Aceh Timur (Waspada): Malam ini, Senin (11/10) sekira pukul 20:00Wib, Bupati Aceh Timur, Tgk. Muslim Hasballah, direncanakan akan membuka Musabaqah Tilawatil Qur’an (MTQ) Ke XXXI Kabupaten Aceh Timur yang dipusatkan di halaman Masjid Al Kubra Kuta Binjei, Kecamatan Julok. Dalam pembukaan, unsur muspida plus bersama kepala dinas, badan dan kantor dalam lingkungan Kabupaten Aceh Timur, dipastikan ikut hadir dalam menyukseskan ajang keislaman, sehingga para peserta dapat lebih meningkatkan potensi dalam bertarung selama lima hari hingga malam berturut-turut. Demikian Ketua Umum Papel MTQ XXXI Aceh Timur, Syaifanur, SH, MM, melalui Sektaris Umum, Amiruddin, S.Ag, kepada Waspada, Minggu (10/10). Menurutnya, MTQ yang digelar kali ini lebih meriah dari pada tahun lalu. Bahkan, untuk mengantisipasi membludaknya pengunjung, lokasi MTQ dibagi dua tempat, yakni dalam pekarangan Pondok Pesantren Dayah babuk Khairi Julok dan halaman Masjid Al Kubra Julok.

Amiruddin yang juga Kabag Keistimewaan Aceh Setdakab Aceh Timur, lebih lanjut menyebutkan, dalam MTQ XXXI, akan memperlombakan 8 cabang yang meliputi 39 jenis dan 17 golongan yang akan dipertarungkan oleh 554 peserta. Para peserta mulai masuk pemondokan di beberapa lokasi dalam Kecamatan Julok, Senin (11/10) hari ini sekira pukul 08:00. Sementara pawai ta’aruf, lanjut Amiruddin, yang akan dilepas Sekda Aceh Timur, Syaifannur, dimulai pukul 15:00 siang dengan ruta mengelilingi Kuta Binjei. “Persiapan untuk MTQ XXXI sudah sangat maksimal, bahkan sampai hari ini (Minggu pagi kemarin—red) kesiapan sudah 90 persen,” ujar alumni IAIN Ar Raniry Banda Aceh, itu. Camat Julok, Amiruddin NN, SH, secara terpisah mengaku, kafilah Julok (tuan rumah— red) mengaku, siap mengambil alih juara umum dari tangan Kecamatan Idi Rayeuk. Dalam keikutsertaan kafilahnya, segala sesuatu telah dipersiapkan dalam menghadapi lawannya dari 23 kecamatan lainnya di Aceh Timur, “Kita target juara umum,” katanya singkat.(cmad)

TNI Berkewajiban Selamatkan Umat Manusia LANGSA (Waspada): Tugas dan tanggung jawab Tentara Nasional Indonesia (TNI) tak hanya sebatas menjaga keutuhan bangsa dan negara. Lebih dari itu, TNI juga berkewajiban penuh menyelamatkan umat manusia dari berbagai kemungkinan buruk. “Tak terkecuali, atas deraan penyakit yang menghimpitnya,” tegas Danyonif 111/KB Tualang Cut, Letkol Inf. Muhammad Ali kepada wartawan setelah sehari melakukan donor darah di Puskesmas setempat, Minggu (10/10). Donor darah dan serangkaian kegiatan bakti sosial dalam rangka HUT ke-65 TNI ini disebut sebagai upaya penyelamatan umat manusia. “Donor darah yang kita laksanakan ini adalahbagian dari misi kemanusiaan, mengingat kebutuhan akan darah semakin hari semakin tinggi, menyusul berbagai deraan penyakit dan keceakaan, sementara stock

darah minim di sana—sini,” ungkap Muhammad Ali. Muhammad Ali mengatakan, donor darah yang melibatkan 250 orang prajurut TNI dari Yonif 111/KB Tualang Cut, Aceh Tamiang ini sedikit banyaknya telah membantu masyarakat yang membutuhkan darah atas berbagai jenis penyakit atau kecelakaan yang semakin hari juga semakin tinggi. “Walau kegiatan ini telah menjadi rutinitas tahunan pada setiap HUT TNI, namun dalam setiap tiga bulan sekali kami selalu melakukan donor darah ini,” ungkapnya seraya menandaskan, hal itu cukup memberi manfaat tidak hanya bagi umat manusia yang membutuhkan darah juga terhadap kesehatan pendonor itu sendiri. Untuk itu dia mengajak segenap masyarakat agar mendonorkan darahnya.(b23)

Proyek TPA Terbengkalai, Ratusan Ton Sampah Berserakan LANGSA (Waspada): Menyusul terbengkalainya pengerjaan proyek pembangunan Tempat Pembuangan Akhir (TPA) di kawasan Desa Jamur Labu Kecamatan Birem Bayeun, Aceh Timur, mengakibatkan ratusan ton sampah yang dihasilkan masyarakat Kota Langsa, berserakan di luar lokasi TPA. ”Ya, terpaksa kami tumpuk di luar Tempat Pembuangan Sampah (TPS) karena TPA sampai kini belum juga rampung pembangunannya,” ungkap Kepala Dinas Kebersihan, Pertamanan dan Lingkungan Hidup Kota Langsa, Drs. Syafrizal, kepada Waspada saat meninjau lokasi TPA tersebut, Kamis (7/10). Belum selesainya pembangunan TPA ini, sehingga terpaksa armada pengangkut sampah melakukan pembongkaran di luar TPA pada radius sekitar 200 meter dari lokasi pembangunan dimaksud. Syafrizal mengungkapkan, Kota Langsa yang setiap hari memproduksi sampah tak kurang dari 60 ton ini telah memberi dampak buruk karena tempat pembuangannya yang tak kunjung selesai. ”Apa yang bisa kita lakukan bila kondisinya seperti ini dan bayangkan selama setahun terakhir sejumlah sampah tersebut menumpuk di sini yang akhirnya jadi berserakan,” pungkasnya seraya menandaskan, jumlah sampah yang mulai ’menggunung’ ini selain merugikan

warga sekitar juga menimbulkan asumsi negatif terhadap pemerintah itu sendiri. Menurut Syafrizal, kalau tumpukan sampah ini terus dibiarkan berada di lahan terbuka sebagaimana berlangsung setahun terakhir ini dikhawatirkan dapat terjadinya pencemaran lingkungan dan polusi udara serta bau tak sedap. ”Apalagi lokasi tumpukan sampah tidak jauh dari lintasan jalan umum di Desa Jamur Labu, yang acap dilalui masyarakat petani yang lahannya tidak jauh dari lokasi tumpukkan sampah tersebut,” ujarnya. Disinggung rekanan dan mulai dibangunnya TPA itu, Syafrizal mengatakan, pembangunan TPA ini mulai dikerjakan tahun 2008 oleh BRR Aceh-Nias. ”Namun saya tidak tahu kendalanya, sehingga sampai kini pembangunan tersebut belum juga rampung,” cetusnya seraya menandaskan, berdasarkan informasi yang diterima pihaknya tentang pembangunan TPA itu rencananya akan dilanjutkan pengerjaan dan perampungannya tahun 2011 mendatang. Pengamatan Waspada di lokasi TPA, sejumlah pipa pengairan limbah kini sudah mengalami kerusakan, demikian halnya lapisan plastik hitam sebagai alasnya sudah banyak terkelupas. Sedangkan benteng atau penahan limbah juga sudah hancur dengan kondisinya terbelah.(b23)

Waspada/Agusni AH

PROYEK TPA TERBENGKALAI: Inilah proyek pembangunan Tempat Pembuangan Akhir (TPA) Kota Langsa di Jamur Labu, kini menjadi terbengkalai, sehingga ratusan ton sampah terpaksa dikonsentrasikan di lokasi lain dalam keadaan ruang terbuka. Foto direkam Kamis (7/10).

BANDA ACEH (Antara): Sekitar 2.800 unit rumah bagi korban bencana alam di Kabupaten Simuelue, Provinsi Aceh hingga kini belum dibangun, kata bupati Darmili. “Rumah korban gempa itu tersebar di seluruh gampong (desa), namun terbanyak di daerah pedalaman yang belum sempat dibangun pada masa rehabilitasi dan rekonstruksi Aceh lalu,” katanya di Sinabang, Sabtu (9/10). Pernyataan itu disampaikan bupati Darmili dalam pertemuan dengan anggota DPD asal Aceh dan muspida Simeulue di Sinabang, Jumat (8/10) malam. Sekretaris Komisi C DPRK Simeulue Rahmad mengutip laporan bupati menyebutkan rumah bagi korban gempa itu belum sempat dibangun oleh Badan Rehabilitasi dan Rekonstruksi (BRR) Aceh-Nias, dan Badan Keberlanjutan Rekonstruksi Aceh (BKRA). Pulau Simeulue berada sekitar 100 mil laut dari pesisir pantai barat Aceh termasuk dalam kategori daerah rawan bencana alam gempa bumi di Indonesia. Pulau berpenduduk sekitar 80 ribu jiwa itu berhadapan dengan perairan laut Samudera Hindia. Simeulue pernah dilanda tsunami yang dalam bahasa masyarakat disebut “smong” puluhan tahun silam dan beberapa kali gempa kuat menggun-

cang daerah itu, yakni pada 2002, 26 Desember 2004 dan 28 Maret 2005. Pemerintah dan legislatif Simeulue mengharapkan perhatian serius dari berbagai pihak mendorong pembangunan infrastruktur dan rumah warga korban gempa yang belum terbangun di daerah tersebut. “Anggota DPD asal Aceh Ahmad Farhan Hamid, Tgk Abdurrahman BTM dan Teuku Bachrum Manyak, memberi apresiasi dan akan berjuang agar berbagai infrastruktur yang belum terbangun bisa mendapat perhatian pemerintah di masa mendatang,” kata Rahmad. Selain itu, warga yang belum memperoleh rumah bantuan juga tersebar di pedalaman, sehingga luput dari pendataan ketika negara donor atau BRR masih ada di Aceh, kata dia menjelaskan. Krisis Pada kesempatan yang sama,Wakil Ketua MPR RI Ahmad Farhan Hamid minta pemerintah dan perusahaan listrik negara (PLN) segera mengatasi masalah krisis energi listrik di Kabupaten Simeulue dan sejumlah kabupaten/kota lainnya di Provinsi Aceh. “Kami berharap masalah itu bisa segera diatasi, sehingga masyarakat kepulauan tersebut benar-benar tidak lagi hidup dalam serba kekurangan akibat terbatasnya energi listrik,” kata-

nya di Sinabang, Sabtu pekan lalu Dalam kunjungan kerja di pulau penghasil udang lobster terbesar di Aceh itu, Ahmad Farhan Hamid didampingi dua anggota DPD RI yakni Teuku Bachrum Manyak dan Tgk Abdurrahman BTM. Sekretaris Komisi C DPRK Simeulue Rahmand mengatakan,Wakil Ketua MPR RI sempat berdialog dengan GM PT PLN Aceh melalui sambungan telepon seluler terkait masalah krisis listrik yang belum teratasi di Simeulue. Anggota DPRK Simeulue menyebutkan terdapat sekitar 25 ribu Rumah Tangga daerah yang pernah menjadi sentra produksi perkebunan cengkih sekitar 1980-an itu tidak memperolehsambunganlistriknegara. Pihak PLN kepada anggota DPD asal Aceh itu berjanji akan mengatasi krisis listrik yang dialami masyarakat di pulau yang pernah mengalami kerusakan parah akibat gempa bumi pada 2002. Pascagempa 2002, Simeulue juga tidak luput terkena dampak akibat tsunami pada 26 Desember 2004. Kemudian bencana alam gempa kembali menghancurkan bangunan dan rumah penduduk Simeulue pada 28 Maret 2005. Rahmad menyebutkan pihak PLN berjanji akan membangun Pembangkit Listrik Tenaga Gas dan Batu bara (PLTGB) di Simeulue, untuk me-

BKSDA Aceh Siapkan 5 Gajah Jinak Di Aceh Timur Peunaroen Titik CRU, Rp1 M Per Tahun IDI, Aceh Timur (Waspada): Guna mengantisipasi amukan gajah yang kian mengganas disejumlah kecamatan dalam Kabupaten Aceh Timur, Balai Konservasi Sumber Daya Alam (BKSDA) Aceh, pekan depan akan menurunkan lima ekor gajah jinak. Sementara Kamp sementara (CRU) akan dibangun di Kecamatan Peunaroen. Dalam jangka satu tahun operasi gajah di Aceh Timur, diperkirakan akan menelan Rp1 miliar. Untuk itu semua pihak diminta mendukung program ini. “Paling lama dua pekan lagi mahon (pawang gajah—red) bersama gajahnya akan tempati kamp sementara di Peunaroen,” ungkap Kepala BKSDA Aceh, Abubakar, menjawab Waspada, Kamis (7/10). Melalui telefon genggamnya, Abubakar mengakui, dalam mengantisipasi amukan gajah di pantai timur Aceh, pemerintah setempat di bawah kepemimpinan Bupati Tgk. Muslim

Hasballah – Nasruddin AB, dinilai telah punya komitmen, meski anggaran untuk itu baru dapat dialokasikan 2011 mendatang. Abubakar juga menyinggung, untuk menjalankan sebuah program penggiringan gajah dari perkebunan ke hutan adalah pekerjaan yang membutuhkan pikiran dan perencanaan yang matang. Selain mempersiapkan gajah jinak bersama mahon distanbaykan di CRU dalam jangka waktu setahun, pihaknya juga harus mencari lokasi yang sesuai dan tepat untuk sebuah perkemahan. “Kamp sementara untuk kita tempatkan gajah dan beberapa personel sudah kita siapkan dalam beberapa pekan terakhir, tinggal lagi gajah dan mahonnya kita gerakkan kesana,” kata Abubakar lagi seraya menambahkan, setelah kesiapan sudah sempurna, pihaknya langsung melakukan penggiringan secara berangsur ke

habitatnya. Ketika disinggung penyebab gajah mengamuk di Aceh Timur? Abubakar mengaku, dalam hal itu pihaknya mengatakan, semua pihak bersalah, baik masyarakat maupun pemerintah. “Semua salah dalam hal ini, sebab konsep dasarnya salah. Artinya, pemerintah membuka lahan berdasarkan izin pemerintah, makanya ke depan ini semua harus ditata kembali,” katanya. Dia mengharapkan, masyarakat dan pemerintah setempat untuk mendukung program penggiringan gajah di Aceh Timur, dimana notabenya telah bertahun-tahun meresahkan masyarakat, seperti di Peunaroen, Lokop, Indra Makmur, Ranto Peureulak, Sungai Raya, Julok dan Banda Alam. “Dua pekan lagi kita akan jalan program penggiringan gajah liar ke habitatnya di Aceh Timur,” tandas Kepala BKSDA Aceh, Abubakar. (cmad)

nghasilkan energi listrik sebesar empat megawatt (4 MW). “Pihak PLN akan melakukan proses pembangunan tahun ini, dan berjanji proyek PLTGB tersebut ditender pada 2011,” kata dia menjelaskan.

Namun, anggota DPRK Simeulue itu berharap masalah krisis listrik di Simeulue itu bisa teratasi hingga akhir 2010.“Kami mendorong agar realisasinya tercapai pada akhir 2010 ini,” katanya menambahkan.

Waspada/M. Rapyan

BELUM DAPAT BANTUAN: Anggota DPD RI asal Aceh Dr. Farhan Hamid yang juga Wakil Ketua MPR-RI bersama dua rekannya, Tgk. Abdurrahman BTM, T. H.Bachrum Manyak didampingi Bupati Darmili paling kiri dan anggota DPRK Simeulue Rahmad saat melepas lelah di pekarangan SMUN 1, Malasin, Kecamatan Simeulue Barat yang rusak berat akibat gempa, 7 April dan 9 Mei 2010. Darmili melaporkan sekolah itu belum mendapat bantuan dari pihak manapun, khususnya provinsi, padahal akibatnya cukup fatal. Foto direkam Sabtu (9/10).

HMI Desak Aktivitas Pendangkalan Akidah Dibrantas BIREUEN (Waspada): Pengurus Himpunan Mahasiswa Islam (HMI) Cabang Bireuen, mendesak pemerintah setempat, melalui pihak terkait yaitu MPU, Dinas Syariat Islam, dan polisi untuk terus memberantas segala aktivitas pendangkalan aqidah dan penyebaran aliran sesat yang terjadi Kecamatan Peusangan yang selama ini telah meresahkan masyarakat. “Pemerintah harus mengambil sikap dan tindakan walaupun mereka telah kembali disyahadatkan MPU, namun mereka harus waspada dan memantau aktivitas mereka nanti,” kata Pj. Ketua Umum HMI Cabang Bireuen Ridwan Syamsuddin melalui rilisnya yang diterima Waspada pekan lalu. Menurut Ridwan, dirinya mengkalim masih banyak lagi jaringan aliran sesat yang tersebar di Bireuen yang belum terungkap. Maka, pihaknya menghimbau kepada seluruh lapisan masyarakat untuk tetap waspada terhadap pengaruh yang dapat mendangkalkan akidah dan segera melapor kepada pihak berwajib apabila ada kegiatan-kegiatan yang mencurigakan dalam masyarakat.(amh/cb03)

Belasan Kerbau Bantuan Provinsi Mati REDELONG (Waspada): Baru beberapa hari disalurkan kepada kelompok tani di Kampung Rata Mulia, Kemukiman Samar Kilang, Kec. Syiah Utama, belasan ekor kerbau bantuan dari tingkat satu (Provinsi Aceh-red) tahun anggaran 2010 dari dana Migas mati. Menurut keterangan sejumlah warga Bener Meriah, kerbau bantuan itu tidak melalui karantina terlebih dahulu, sehingga puluhan kerbau yang baru tiba di Kabupaten Bener Meriah, langsung disalurkan kepada kelompok tani. Akibatnya, baru beberapa hari penyerahan kerbau bantuan itu mati hingga 15 ekor. Terkait hal itu Kabid Peternakan Dinas Pertanian Tanaman Pangan, Peternakan dan Perikanan (Distanakkan) Bener Meriah Ridwan yang ditemui Waspada di ruangan kerjanya Jumat (8/ 10) mengatakan, kematian belasan ekor kerbau bantuan pihak Provinsi Aceh itu lantaran diduga karena kelelahan. “Kerbau ini dari Provinsi Lampung dan dikarantina selama sepuluh hari di Blang Jorong, mungkin lantaran jauh jarak tempuh mengakibatkan kerbau untuk kelompok tani itu mati akibat kelelahan,” jelas Ridwan.(cih)

Kabar Kelam Dari Warga Pesisir Selat Malaka Kabupaten Aceh Tamiang terdiri dari 12 kecamatan dan sepertiga (1/3) dari wilayah Kabupaten Bumi Muda Sedia itu adalah daerah pesisir yang berlokasi tak jauh dari bibir pantai Laut Selat Malaka. Praktis masyarakat yang berdomisili di daerah pesisir di Kec. Manyak Payed, Bendahara, Banda Mulia dan Seruway sebahagian besar menggantungkan hidupnya di sektor perikanan (nelayan/bertambak), mencari kayu bakau dan ada juga yang bertani sebagai petani penggarap lahan milik orang lain serta bidang lainnya. Namun berdasarkan pantauan dan keterangan yang dihimpunWaspada, pekan lalu, ternyata saat ini potret wajah kehidupan masyarakat pesisir di sana benar-benar terpuruk dengan potret wajah dan cerita duka yang kelam. Untuk bertahan hidup, selain sebagai nelayan tradisional dan ada juga yang mencari kepiting di lahan tambak yang ‘nganggur’ belum digunakan, di alur sungai atau paluh-paluh yang masih tersisa, dan dan berbagai aktivitas lainnya, tetapi tak sedikit warga di sana yang kini menganggur, terutama warga yang sebelumnya bergerak membakar arang kayu sudah hampir setahun kehilangan mata pencahariannya dan belum ada solusi jelas atau kebijakan dari Pemkab setempat. Informasi yang diperoleh Waspada di daerah itu, nasib masyarakat perajin arang semakin kelam di Aceh Tamiang. Pasalnya, arang yang telah terlanjur diproduksi pera-jin di empat kecamatan yaitu Kec. Manyak Payed, Bendahara,

Banda Mulia dan Seruway sejak Januari s/d Oktober 2010 telah menumpuk sebanyak 3.825 ton karena tidak bisa dipasarkan. Kondisi itu dibenarkan salah seorang tokoh masyarakat di Gampong Mesjid, Manyak Payed, Juned kepada Waspada. Akibat semakin kelamnya perekonomian masyarakat di daerah pesisir Aceh Tamiang itu, menurut informasi masyarakat di sana menyebutkan empat Datok Penghulu Kampung di Kecamatan Manyak Payed telah melaporkan permasalahan mereka masing-masing kepada Camat Manyak Payed, Bustamam, SE. “Perekonomian warga terpuruk akibat arang kayu bakar tidak bisa lagi dipasarkan. Otomatis warga kehilangan mata pencarian, sehingga untuk mendapatkan biaya hidup dan anak-anak sekolah, warga sudah ada yang pergi ke Malaysia. Bahkan ada juga warga yang sudah stress gara-gara arang tidak bisa dipasarkan lagi ke luar Aceh. Buktinya 3.825 ton arang kayu yang siap dipasarkan, kini menumpuk di 4 kecamatan yang ada di pesisir Aceh Tamiang,” kata mantan Keuchik Gampong Mesjid,Juned. Menurut Juned, arang sebanyak itu menumpuk di Kecamatan Manyak Payed, Banda Mulia, Bendahara dan Seruway karena tidak bisa dibawa ke luar Provinsi Aceh.“Kehidupan warga yang selama ini berusaha di bidang arang kayu bakar benarbenar terpuruk,” kata Juned mendeskripsikan goni untuk tempat arang itu juga sudah bolak-balik koyak dan diganti. “Ini karena ada larangan dari pemerintah Aceh arang tidak

boleh dibawa ke luar Aceh. Hal ini pukulan berat bagi masyarakat,” sebutnya. Bukti keterpurukan perekonomian itu menguat saat puluhan warga Manyak Payed yang berdomisili di Gampung Meurandeh dan Gampung Mesjid pergi merantau ke Malaysia. “Ada 80 warga ke Malaysia mengadu nasib,” sebut Juned yang dibenarkan Razali, salah seorang tokoh pemuda di sana. Katanya, tidak sedikit warga merantau ke daerah lain, baik ke Banda Aceh dan kota lainnya untuk mencari nafkah. Kembali ke upaya empat datok penghulu (kepala desa) da-

lam surat pernyataan bersama yang diteken pada 2 Oktober 2010 lalu disebutkan, sejak Januari 2010 warga di empat kampung itu tidak lagi melakukan kegiatan menebang hutan bakau sebagai bahan baku arang kayu. Keempatnya memohon kepada Camat Manyak Payed agar mengeluarkan surat keterangan arang kayu yang terlanjur diproduksi itu benarbenar milik warga empat desa tersebut. Surat keterangan yang dimaksud amat dibutuhkan sebagai salah satu syarat administrasi dalam rangka menghadap Gubernur Aceh oleh perwakilan masyarakat pekerja

arang kayu guna mencari solusi yang terbaik. Camat Manyak Payed, Bustamam, SE membenarkan permohonan keempat datok penghulu,yaitu Datok Penghulu Gampong Mesjid,Datok Penghulu Meurandeh, Datok Penghulu Seuneubok Cantek dan Datok Penghulu Meunasah Paya.“Hal ini memang dilematis yang menyebabkan nasib warga perajin arang semakin kelam dan perlu dicari solusi terbaik mengatasi permasalahan ini,” tandas Bustamam yang prihatin dengan kondisi tersebut. Muhammad Hanafiah

Waspada/Muhammad Hanafiah

MENGANGGUR: Sejumlah warga Kampung Mesjid, Kec. Manyak Payed,Aceh Tamiang yang kehidupan perekonomiannya kian terpuruk akibat kehilangan pekerjaan atau menganggur tampak duduk di salah satu warung kopi di sana.

Aceh

WASPADA Senin 11 Oktober 2010

C11 Ribuan Warga Agara Ikuti Peringatan Hari Jalan Kaki Sedunia

Polisi Ciduk Bandar Shabu LHOKSUKON, Aceh Utara (Waspada): Satuan reserse dan kriminal (Reskrim) Polres Aceh Utara berhasil menciduk seorang bandar narkotika jenis shabu-shabu (SS), dalam satu drama transaksi di Simpang Poin A, Kec. Nibong, Aceh Utara, Sabtu (9/10) sekira pukul 22:00 WIB. Tersangka AGM, 29, asal Desa Bidari, Kec. Geureudong Pase, Aceh Utara. Sehari-hari, tersangka bekerja di salah satu bengkel di Keude Nibong. Dari tersangka, polisi juga menyita sejumlah barang bukti, antara lain satu paket besar SS seberat 12,07 gram, 20 paket kecil dengan harga masing-masing Rp100 ribu dan 4 paket sedang senilai Rp250 ribu per paket. Kapolres Aceh Utara, AKBP Farid Bachtiar Efendi melalui Kasat Reskrim, AKP Erlin Tangjaya, kepada Waspada, Minggu (10/10), menjelaskan, tersangka sudah lama jadi target operasi (TO) polisi. AMG dilaporkan sebagai bandar SS muda yang terbilang sukses dalam dunia narkoba. Wilayah ‘jajahannya’ meliputi empat kecamatan yakni Nibong, Matang Kuli, Pirak Timu, dan Kecamatan Paya Bakong. “Tersangka berhasil kita tangkap saat bertransaksi dengan petugas yang menyamar sebagai pembeli. Untuk pemeriksaan lebih lanjut, tersangka dan barang bukti langsung kita giring ke Mapolres Aceh Utara. AGM akan kita periksa intensif supaya semua jaringannya terbongkar,” tandas AKP Erlin Tangjaya.(cmus)

Akbid Bustanul Ulum Wisuda 162 Sarjana LANGSA (Waspada): Akademi Kebidanan (Akbid) Bustanul Ulum Langsa mewisuda 162 orang sarjana ahli kebidanan Kamis pekan lalu di kampus Akbid Gampong Tualang Teungoh, Kecamatan Langsa Kota. Dalam sambutannya Direktur Akbid, Sofyan AR, mengatakan 162 sarjana ahli kebidanan ini lulusan Akbid Bustanul Ulum dari jalur umum dan khusus, mereka bagian dari 469 orang ahli kebidanan yang telah dihasilkan Akbid Bustanul Ulum selama ini. Turut hadir dalam acara pelantikan itu, Wakil Walikota Langsa Saifuddin Razali dan kepala Dinas Kesehatan Kota, Junaidi serta para unsur Muspida Kota Langsa. (b25)

Bantu Pasien Miskin, Polisi Siagakan Ambulance Gratis LHOKSUKON, Aceh Utara (Waspada): Menanggapi keluhan masyarakat miskin terkait ketidak mampuan memakai jasa ambulance dari rumah sakit, Sat-Lantas Mapolres Aceh Utara, Jumat (8/10) meluncurkan program jasa ambulance gratis. “Peluncuran program ini sama sekali bukan untuk mengambil alih tugas dari Dinas Kesehatan Aceh Utara. Program ini muncul akibat rasa keprihatinan terhadap masyarakat miskin yang tidak sanggup membayar jasa ambulan untuk kebutuhan rujukan,” kata AKBP Farid Bachtiar Efendi SIk, melalui Kasat Lantas AKP Siswara Hadi Chandra kepada para wartawan. Menurut Siswara, sarana ambulan gratis itu disiagakan 1x24 jam setiap harinya. Bagi warga yang membutuhkan diminta untuk menghubungi nomor online 0852 6100 1010. Selain untuk masyarakat miskin, ambulan gratis ini disediakan untuk korban laka lantas yang terdapat di wilayah hukum Mapolres Aceh Utara. “Kita tidak akan pungut biaya sepeser pun,” kata Siswara.(cmun)

Alih Fungsi Lapangan Merdeka Hilangkan Nilai Sejarah LANGSA (Waspada); Alih fungsi lapangan Merdeka Langsa yang menjadi taman kota dinilai menghilangkan nilai-nilai sejarah yang dimiliki lapangan itu. Kendati program alih fungsi ini dinilai berguna bagi masyarakat kota, namun di mata Zuhdi Madjid salah seorang tokoh masyarakat Kota Langsa, pembangunan itu langkah yang salah kaprah. “Kita mendukung pembangunan tersebut, tetapi penataannya harus sesuai hati nurani masyarakat, jangan hanya melihat kepentingan suatu kelompok yang menguntungkan bagi kelompok itu sendiri,” ungkapnya, Jumat pecan lalu. Mantan anggota DRPK Kota Langsa ini menambahkan boleh saja dilakukan pembangunan atau penataan terhadap lapangan Merdeka tersebut, akan tetapi jangan sampai mengubah nilai-nilai sejarah yang telah tertulis di setiap catatan memori para generasi atau masyarakat Langsa, sejak zaman para pemimpin daerah ini sejak puluhan tahun silam.(b25)

Sekolah Laskar Pelangi Ada Di Aceh ACEH UTARA (Waspada): Zulfan Nukman, Pemimpin Bank Indonesia Lhokseumawe, Jumat (8/10) siang di ruang kerjanya mengatakan, sekolah seperti yang difilmkan dalam film ‘Laskar Pelangi’jugaadadiProvinsiAceh,tepatnyadiDusunSukaMakmur, Gampong Jamuan, Kec. Bandar Baroe, Aceh Utara. Kondisi Sekolah Madrasah Tsanawiyah Swasta (MTs) berkonstruksi kayu yang satu ini cukup memperihatinkan. Hampir seluruh dinding ruang belajar bolong-bolong karena papan didingnya telah berjatuhan akibat dimakan usia. Sekolah agama itu juga telah oleng. Begitupun, kegiatan belajar mengajar terus berlangsung dengan jumlah murid seadanya. Takjubnya,paraguruyangmengabdidisekolahagamatersebut tetap bertahan walaupun dengan honorium Rp300 ribu. “Semangat pengajar dan murid cukup tinggi. Mereka tidak peduli dengankondisisekolahyangakanrobohitu.Niatmerekalillahita’ala untuk mencerdaskan umat. Karena alasan inilah, kami dari BI Lhokseumawe merasa terpanggil membantu pembangunan fisik sekolah dimaksud,” kata Zulfan Nukman.(cmun)

Pemkab Aceh Singkil Salurkan Bantuan Masa Panik SINGKIl (Waspada): Pemerintah Kabupaten Aceh Singkil melalui Dinas Sosial sejak kemarin sudah menyalurkan bantuan masa panik kepada warga korban banjir di daerah itu. Bantuan berupa 10 ton beras dari Bulog Subulussalam, 480 dus mi instan, 550 liter minyak goreng, 400 kg gula pasir, 6000 bungkus garam, 920 botol kecap ABC dan 3000 butir telur. Demikian Kepala Dinas Sosial naker dan Transmigrasi Aceh Singkil Drs. Rahmi Syukur MM melalui sekretarisnya Drs. Hendry Silalahi yang dihubungi via ponsel, Kamis (7/10). Menurut Hendry saat ini pihaknya juga sedang menunggu bantuan serupa yang telah dijanjikan pemerintah Aceh untuk masyarakat korban banjir Aceh Singkil.(cb02)

Pelayanan Kesehatan Aceh ‘Lumpuh’ BANDA ACEH (Waspada): Ketua Lembaga Advokasi Buruh Nelayan Aceh (LABNA), Zainuddin Salam, menilai, pelayanan kesehatan di Aceh ‘lumpuh’. Tetapi kondisi itu dikhususkan terhadap masyarakat Aceh yang berobat dengan Jamkesmas dan Jaminan Kesehatan Aceh (JKA) di sejumlah Rumah Sakit (RS) milik pemerintah di Provinsi Aceh. Menurut Zainuddin Salam, lumpuhnya institusi pemerintahan itu tidak terlepas dari buruknya manajemen di sebuah lembaga. Sehingga pimpinan dinilai gagal dalam memenej bawahannya selaku mitra kerjanya. Buruknya pelayanan kesehatan di Aceh, menjadi sorotan publik dalam lima tahun terakhir di Aceh. Tak hanya rumah sakit di daerah kabupaten/kota, lanjut Zainuddin Salam, namun buruknya kinerja tenaga medis juga disorot tajam hingga ke Rumah Sakit Umum Daerah (RSUD) Zainoel Abidin di Banda Aceh. “Pasalnya, tenaga medis bekerja bukan lillahita’ala, tapi semata-mata karena uang,” cetus Zainuddin Salam. (cmad)

Waspada/Ali Amran

JALAN KAKI: Ribuan warga Agara terlihat tengah berjalan kaki memperingati hari jalan kaki sedunia yang dimulai dari halaman parkir Stadion H. Syahadat Kutacane, kemarin.

Partai Nasional Bukan Oposisi Pemerintah Aceh ACEH UTARA (Waspada): Partai Kebangkitan Bangsa (PKB) yang merupakan salah satu partai nasional, bukanlah partai opoisi dalam Pemerintah Aceh. Kendati provinsi ini miliki partai lokal, namun PKB tetap mendukung pemimpin yang memperhatikan kepentingan rakyat. Ketua Dewan PimpinanWilayah (DPW) PKB Aceh, Irmawan di Lhokseumawe, Minggu (10/10) menegaskan, partai yang dipimpinnya tidak pernah menjadi oposisi pemerintah. Sepanjang pemimpin tersebut masih berpihak pada rakyat,

PKB siap mendukung. “Pemimpin kedapan juga kita harapkan benar-benar yang memperhatikan masyarakat,” tegas Irmawan usai acara Musyawarah Cabang (Muscab) PKB Aceh Utara. Selama ini, menurut dia, PKB dianggap oleh masyarakat hanya partai milik segolongan orang saja. Kurangnya dukungan untuk PKB di Aceh selama ini, menurut dia akibat kurang membuka diri. Sehingga dia mengingatkan kepada Ketua DPC PKB Aceh Utara, Tgk.Idris harus membuka diri. Apabila, setelah memimpin tidak terjadi

perubahan, ketua harus iklas mundur. “Hal ini bukan hanya untuk ketua DPC, namun juga untuk berlaku ketua DPW PKB Aceh,” tegasnya di hadapan peserta Muscab DPC Aceh Utara di Hotel Lido Graha Lhokseumawe. Anggota Komisi-C DPR Aceh ini juga menegaskan, selama ini pemerataan pembangunan masih belum tercapai. Sehingga ke depan PKB di Aceh akan mendukung pemimpin yang tidak mengabaikan kepentingan masyarakat. Pemerataan pembangunan dalam pandangan Irmawan, tidak harus

dibagi sama. Namun setiap pembanunan tersebut harus sesuai dengan kebutuhan. “Karena kebutuhan antara masyarakat nelayan dengan masyarakat pedalaman tentunya harus berbeda,” tegasnya. Sementara Ketua DPC PKB Aceh Utara terpilih, Idris menambahkan, prioritas pada Pemilu legislatif ke depan, partai ini minimal harus mampu meraih tiga kursi seperti pada priode lalu. Oleh sebab itu, membuka diri seperti ditegaskan ketua DPW menurutnya harus segera dilakukan. (b17)

Sistem Pengelolaan Laut Aceh Diusulkan Untuk Dunia BANDA ACEH (Waspada): Sistem pengelolaan laut berbasis ekosistem yang diterapkan di Aceh, diusulkan bisa diterapkan di seluruh dunia. Karena sistim dengan kearifan lokal dan dikelola secara lestari itu, sumber daya perikanan dunia bisa berkelanjutan serta memihak kepada rakyat kecil. “Sistem pengelolaan laut secara bersama (co management) pertama kali diterapkan di Aceh tahun 2007 di Aceh Besar, Aceh Jaya, Aceh Barat dan Nagan Raya,” sebut M. Adli Abdullah dalam pernyataannya kepada Waspada, usai pembukaan rapat konsultasi UNFAO di Bangkok, Thailand, Rabu (6/10). Daerah-daerah yang menerapkan sistem pengelolaan laut secara bersama di Aceh itu, yakni Lampuuk (Aceh Besar), Lamno dan Rigaih (Aceh Jaya), Meureubo (Aceh Barat) dan Nagan Raya yang melibatkan seluruh pemangku kepentingan yang ada di kawasan tersebut. Adli menyebutkan, sistem co management yang dilaksanakan di Aceh itu dikemukakan dalam pertemuan UN FAO Regional Consultatative workshop on Securing Sustainable Small Scale Frisheries: Bringing Together Responsible Fisheries and Social Development di

Thailand, 6-8 Oktober 2010. Kegiatan itu dihadiri 18 negara mewakili Asia. Sementara dalam pertemuan sebelumnya pada 13 - 17 Oktober 2008, Aceh—satu-satunya perwakilan dari Indonesia mengusulkan nelayan tradisional yang terdampar di negara lain diselesaikan secara diplomatis. “Kini kita mengusulkan model pengelolaan laut berbasis co managemet yang sudah diterapkan di Aceh bisa dijadikan model dalam pengelolaan laut berkelanjutan berbasis ekosistem,” ujar Adli Abdullah

mantan Sekretaris Umum Lembaga Hukum Adat Laot/Panglima Laot Aceh ini. Dikatakannya, forum bergengsi itu dibuka RolfWillmann, Senior Fisheries Planning Officer UN FAO Rome. Pada kesempatan ituWillmann mengatakan perlu perjuangan memasukkan kebijakan perlindungan perikaanan kecil. Mengutip penelitian yang dilakukan oleh UNFAO, Willmann mengungkapkan dunia ini terdiri dari 45 juta nelayan kecil, 120 juta jiwa adalah petani tambak kecil dengan lebih 500

juta penduduk dunia tergantung hidup pada hasil usaha para perikanan berkala kecil. Ia mengharapkan forum itu melahirkan rekomendasi perlindungan terhadap nelayan dan petani kecil sedunia menghadapi industri perikanan yang menguasai modal dan jaringan yang kuat. “Usaha kecil perikanan terbukti mampu mengatasi krisis ekonomi dunia, dan kita harus aktifmembelahak-hakperikanan berskala kecil ini dan salah bentuk menjamin sumber pangan dunia,” kata Willmann/ (b04)

BKN Jakarta Data Kembali Keabsahan Tenaga Honor LANGSA (Waspada): Dalam menindak lanjuti pendataan tenaga honorer katagori I, pengangkatan sebagai honorer 1 Januari 2005 sebagaimana dikirimkan ke Badan Kepegawaian Negara (BKN) Pusat di Jakarta, Tim Verifikasi dan Validasi BKN di Jakarta akan melakukan keabsahan data yang dikirim Badan Kepegawaian Daerah (BKD), baik provinisi maupun kabupaten. Demikian Kepala Badan Kepegawaian Pendidikan dan

Pelatihan (BKPP) Kota Langsa, Syahrul Taib melalui Kabid Pengembangan, Zulfiqar, kepada wartawan sekaitan turunnya tim verifikasi dan validasi pusat terkait pendataan tenaga honorer itu, Kamis (7/10). Menurutnya, pihak BKPP Kota Langsa, telah menerima surat dari BKN pusat di Jakarta. Isinya hari ini 11 Oktober 201, tim verifikasi dan validasi pusat akan mendatakeabsahandatahonorer wilayah Kota Langsa, AcehTimur dan Aceh Tamiang, seluruhnya

akan dipusatkan di Idi Rayeuk, Kabupaten Aceh Timur. Dia menyebutkan, dalam surat itu bukan hanya dilakukan pendataan nama-nama tenaga honorer, melainkan juga akan diminta surat keputusan pertama sebagai tenaga honorer. “Minimal pengangkatan mulai tahun anggaran 2004/2005. Lalu bukti asli dokumen pembayaran honorium tenaga honorer yang bersumber dari APBN atau APBK sertadokumenasliabsensitenaga honorer,” sebutnya.(cmad/b22)

KUTACANE (Waspada): Ribuan warga Aceh Tenggara (Agara) yang berasal dari berbagai instansi dan sekolah, Minggu (10/10), mengikuti peringatan hari jalan kaki sedunia yang dipusatkan di halaman parkir Stadion H.Syahadat Kutacane. Bupati Agara, H. Hasanuddin B, melalui Sekdakab Drs. Hasanuddin Darjo MM dalam arahannya mengatakan, meski dilaksanakan dengan cara yang sederhana dan menggunakan rute yang tidak terlalu jauh, namun peringatan hari jalan kaki sedunia sangat bermanfaat bagi kesehatan. Adapun isntansi yang mengikuti hari jalan kaki sedunia di Agara tersebut , kata Darjo, diantaranya dari Setdakab Agara, Dinas Dikpora , Dishutbun, Distan, Bepeluh, Dinas Kesehatan, Dinas Keuangan, Inspektorat, BPMD, Bappeda, Perhubungan, Dinas Bina Marga Cipta Karya, Dinas Syariat Islam, BPD Aceh Cabang Kutacane, Kodim 0108/Agara, STIKes, SMA,SMK dan beberapa instansi vertikal lainnya. Untuk mendorong dan memotivasi semangat peserta , panitia yang terdiri dari pemkab Agara dan BPD Aceh Cabang Kutacane, juga memberikan hadian undian lucky draw kepada puluhan peserta yang memenangkan undian jalan kaki, dilanjutkan dengan pemberian hadiah undian utama kepada nasabah BPD Aceh Cabang Kutacane. Terima Hadiah Mobil Avanza Untuk hadiah kedua pemenang Gebyar Simpeda Tahap XI Periode 01-10-2009 -31-07-1010, berupa mobil Avanza yang diterima nasabah atas nama Sri Santi Dahlia, diserahkan langsung oleh ketua tim penggerak PKK kabupaten. Sedangkan pemenang ketiga yang mendapat hadiah berupa empat unit sepeda motor Honda Revo maupun hadiah lainnya berupa paket modal usaha mikro, TV.LCD Plasma 32 Inc dan paket beasiswa, secara bergiliran diserahkan Sekdakab Drs. H. Hasanuddin Darjo.MM, Pimpinan Cabang BPD Kutacane, Jasri SE dan pejabat lainnya.(b27)

Musim Hujan, Suplai Air Bersih Menurun ACEH UTARA (Waspada): Tingkat kekeruhan air sungai di Aceh Utara mencapai 1.500 NTU mengakibatkan kualitas dan kuantitas air bersih PDAM menurun. Bahkan di wilayah Kota Lhoksumawe pendistribusian air bersih terhambat karena kerusakan pompa di dasar sumur (deepwell) akibat hujan deras, Jumat (8/10). Direktur PDAM Tirta Mon Pase Aceh Utara , Zulfikar Rasyid, SE mengakui, selama musim hujan sumber air baku keruh. Krueng Keureuto yang menjadi sumber air baku bercampur dengan tanah. Tingkat kekeruhannya mencapai 1.500 NTU. “Padahal, standarnya hanya 500 NTU,” tambah Zulfikar didampingi Staf Ahli Teknik, Syafrizal. Akibat air baku keruh, proses untuk menghasilkan air bersih butuh waktu lama. Selain itu, penggunaan tawas juga lebih tinggi mencegah agar air yang disuplai kepada masyarakat tidak ikut keruh. Sungai mengalami kekeruhaan yaitu Krueng Keureuto yang menjadi air baku untuk WTP Meunasah Asan dan WTP Menasah Reudeup. Sementara Krueng Pase menjadi air baku WTP Paya Terureubang. Sedangkan Krueng Mane, air baku untuK WTP Gledagang. Zulfikar juga menjelaskan, sebenarnya kekeruhan air dapat diantisipasi dengan pasilitas Prasendimen. “Namun kita baru mengajukan untuk dibangun, saat ini belum ada,” jelasnya. Prasendimen mampu mengendapkan lumpur, sehingga tingkat kekeruhan air baku bisa ditekan. Sementara itu hujan yang mengguyur wilayah Kota Lhokseumawe juga mengakibatkan pompa di dasar sumur Simpang Alue Lim rusak. Menurut Kepala Cabang PDAM Kota Lhokseumawe, Fachrurazi kerusakan itu juga mengganggu suplai air ke kawasan kota. Di antaranya, untuk warga Cunda, Jeulikat, Panggoi dan sekitarnya. Kerusakan pompa diprediksi akan terjadi sampai Seminggu. “Soalnya, harus dipesan dari Jakarta,” jelasnya. Selama pompa dasar sumur di Simpang Alue Lim, menurut dia, suplai air ke kawasan kota menurutn drastic.(b17)

Terkait Vonis Bebas Terdakwa Kasus Korupsi GeRAK Surati Mahkamah Agung BANDA ACEH (Waspada): Gerakan Anti Korupsi (GeRAK) Aceh melayangkan surat ke Ketua Mahkamah Agung RI di Jakarta terkait vonis bebas sejumlah terdakwa kasus korupsi di Aceh. Dalam surat bernomor 184/B/G-Aceh/X/2010tertanggal 6 Oktober 2010 yang ditandatangani Koordinator GeRAK Aceh, Askhalani, SHI, itu disebutkan, dinamika peradilan oleh PN dan PT dalam wilayah hukum Provinsi Aceh, ditemukan trend peningkatan terhadap jumlah vonis bebas atas terdakwa kasus tindak pidana korupsi. Selama kurun waktu dari tahun 2007 hingga tahun 2010, kata Askhalani, GeRAK Aceh mencatat sebanyak 19 vonis bebas di Aceh, masing-masing 5 kasus pada tahun 2009 dan 8 kasus pada tahun 2010. Vonis bebas ini telah ditetapkan di beberapa PN dan PT terhadap para terdakwa kasus korupsi di Provinsi Aceh. Menurutdia,dataitumenunjukkanmajelishakimyangmenangani kasus tindak pidana korupsi telah gagal mentranspormasi hukum secara bijak. Khususnya lagi, terlihat majelis hakim masih belum tepat dalam menafsirkan perkara-perkara indikasi korupsi yang diadili sehingga vonis bebas semakin sering terjadi di Aceh. Mereka berpendapat, bahwa kecenderungan vonis bebas atas terdakwa korupsi tersebut disebab kan lemahnya pemahaman majelis hakim dalam memahami Undang Undang No. 31 Tahun 1999 Jo Undang Undang No. 20 Tahun 2001 tentang Pemberantasan Tindak Pidana Korupsi. Surat yang ditujukan kepada Ketua Mahkamah Agung RI ini juga ditembuskan kepada Komisi Pemberantasan Korupsi (KPK) di Jakarta, Kejaksaan Agung di Jakarta, Komisi Judisial di Jakarta, Satuan Tugas (Satgas) Anti-Mafia Hukum di Jakarta, serta media di Aceh dan Nasional. (b07)

Desa Tertinggal Garap Mulai Digarap GARAP sebuah desa tertinggal di pedalaman Kecamatan Plimbang Bireuen. Kemah Kerja Bakti Mahasiswa KopertisWilayahI Sumut-Aceh dibuka Wagub Aceh Muhammad Nazar S Ag, 6 Oktober baru lalu menggarap dan membenah pembangunan di desa tertinggal dinilai tepat sasaran. Desa Garap luasnya 1.850 hektar dihuni 42 KK (178 jiwa) merupakan salah satu dari 12 desa tertinggal di Kecamatan Plimbang. Geuchiek Gampong Garap Ramli Ali didampingi Sekdes Nurmawati dalam percakapan dengan Waspada di sela-sela pembukaan kegiatan Kemah Kerja Bakti Mahasiswa mengatakan, selama 65 tahun merdeka masyarakat desa Garap belum merasakan nikmat kemerdekaan. Perhatian pemerintah terkesan terlupakan. Buktinya, hingga kini desa Garap masih menyandang status desa tertinggal. Fasilitas air bersih (sumur bor) belum ada masyarakat terpaksa mengonsumsi air alur. Bides sudah ada, tapi sarana kesehatan Poskesdes belum ada sehingga Bides tidak bisa menetap tinggal di desa. Selaim itu kondisi sarana jalan desa untuk menunjang ekonomi pertanian rakyat ke lokasi pertanian dan perkebunan masih memprihatinkan. Buntutnya, terkendala mengangkut hasil pertanian dan perkebunan. Padahal Desa Garap potensial sebagai penghasil padi, kedelai, kelapa, sawit, pinang, cabai merah dan hasil hutan lainnya. Tak ayal, Pemkab Bireuen mencadangkan 1.000 hektar lahan di Desa Garap untuk pengembangan pertanian kaum duafa. Tak heran, Program Kemah Kerja Bakti Mahasiswa Kopertis Wilayah I Sumut-Aceh keempat tahun 2010 dilaksanakan Mahasiswa Uniersitas Al Muslim Bireuen dan Mahasiswa Perguruan Tinggi lainnya pekan lalu yang menurunkan 120 mahasiswa mendapat sambutan antusias masyarakat. “Pelaksanaan program ini telah menghadirkan sejumlah pejabat Pemerintahan Aceh, pejabat Kabupaten dapat melihat langsung kondisi pembangunan desa tertinggal di pedalaman Kecamatan Plimbang, setidaknya telah mendapat perhatian membebaskan status desa Garap di Kecamatan Plimbang yang masih tertinggal,” papar Geuchiek Ramli Ali.

Wagub Muhammad Nazar S Ag saat membuka pelaksanaan Kemah Kerja Bakti Mahasiswa kepada para pejabat kabupaten antara lain mengingatkan, saat ini beberapa kabupaten/kota di Aceh mengalami krisis dana, diminta penyusunan anggaran pembangunan harus efisien. Program pembangunan jangan salah kaprah hanya memenuhi selera pejabat atau golongan. Jangan sempat terjadi program yang tidak perlu dilaksanakan, sedangkan pembangunan yang sangat penting dan bermanfaat bagi kepentingn masyarakat diabaikan. “Pelaksaaan pembangunan harus merata ke pedesaan dalam upaya menuju masyarakat thaiyibatun warabbul ghafur,” pinta Wagub. Ketua KopertisWilayah I Sumut-Aceh Prof DR Zainuddin pelaksanaan program Kemah Kerja Bakti Mahasiswa Kopertis Wilayah I Sumut-Aceh ke-4 tahun 2010 dipusatkan di Universitas Al Muslim Bireuen bertujuan mengajak mahasiswa membantu kehidupan masyarakat pedesaan terutama masyarakat desa tertinggal. Selain itu melalui Keja Bakti ini para mahasiswa akan memiliki ilmu kewirausahaan. Program yang dilaksanakan mahasiswa Kopertis Wilayah I Suut-Aceh hendaknya akan menjadi suatu kenangan indah bagi masyarakat desa tertinggal di Kabupaten Bireuen. Rektor Unimus Drs H Amiruddin Idris SE,M Si beserta seluruh akademika sangat berterima kasih kepada Kopertis Wilayah I Sumut-Aceh, yang telah memberikan kepercayaan kepada Unimus untuk melaksanakan Kemah Kerja Bakti Mahasiswa di desa Garap sebuah desa tertinggal di Bireuen. Rektor juga sangat berterima kasih kepada Camat Plimbang Dra Anisah bersama seluruh stafnya yang sangat antusias membantu pelaksanaan program kerja bakti mahasiswa Kopertis Wilayah I Sumut-Aceh berjalan mulus dan sukses. Kegiatan kerja bakti mahasiswa selama seminggu dengan tunjangan dana sebesar Rp 300 juta dari KopertisWilayah I SumutAceh akan membangun 2 unit rumah permanen tipe 36 dan 33 unit WC dan beberapa fasilitas lainnya untuk kaum du’afa desa Garap. Hasil riset mahasiswa, dari 22 desa di Kecamatan Plimbang, 12 desa diantaranya masih tergolong desa tertinggal, yakni desa

Garap, Jambo Dalam, Bale Daka, Paloh Pupu, Matang Kule, Lancok Bungo, Cot Glumpang, Seuneubok Nalan, Uteuen Sikumbong, Teupin Panah, Seuneubok Aceh dan Seuneubok Punti. Menurut Anisah masih terbelenggunya 12 desa sebagai desa tertinggal akan menjadi ”PR” baginya harus bekerja extra keras dan bertekad secara bertahap ke-12 desa tersebut dapar terbebas sebagai desa tertinggal, ujarnya. H AR Djuli

Waspada/H. AR Djuli

TEKEN PRASASTI : Wagub Aceh Muhammad Nazar S Ag dan Ketua KopertisWilayah I Sumut Aceh Prof DR Zainuddin sedang menanda tangani prasasti Pembukaan Kemah Kerja Bakti Mahasiswa Kopertis Wilayah I Sumut-Aceh di Desa Garap Plimbang (6/10). disaksikan Rektor Unimus Drs H Amiruddin Idris,SE Msi, Bupati Bireuen, Nurdin Abdul Rahman dan Muspida plus.

Ekonomi & Bisnis

C12 Inspirasi Bisnis

WASPADA Senin 11 Oktober 2010

Pengamat & Praktisi Manajemen

Cahyo Pramono

Dinamika Bisnis Shopping Mall “Yang kecil membesarkan yang sudah besar” HARGA sewa lokasi di Shopping Mall itu biasanya sangat mahal, dihitung per meter persegi, kadang dalam hitungan kurs dolar dan dengan aturan yang sangat banyak. Tetapi apakah anda percaya bahwa tidak semua penyewa disana membayar dengan mahal? Dan juga tidak semuanya direpotkan oleh pemilik bangunan? Mereka yang dimudahkan adalah para pemilik merek terkenal yang berpotensi mengundang banyak pembeli datang. Mereka sangat yakin memiliki daya tarik yang sangat tinggi sehingga pembeli akan datang kepada mereka, dimana pun mereka membuka bisnisnya. Bagi pengelola gedung pusat perbelanjaan itu, mereka tadi adalah pemanis dan pelaris yang bisa membuat lokasi mereka ramai dikunjungi pembeli. Dengan jumlah pembeli yang banyak, tentu akan berakibat terhadap penjualan di toko-toko kecil yang mereka sewakan. Mereka yang jadi idola itu biasanya justru malah mengatur dan menuntut pemilik shopping mall itu dengan berbagai standard sesuai kebutuhannya. Mulai dari alokasi luas ruangan, posisi lantai yang strategis, lebar koridor, setting kamar mandi umum, daya listrik, daya tampung parkir dan akses ke lokasi dari parkir, arus penerimaan barang, hingga standard keamanan dan kelengkapan keselamatannya. Masih banyak lagi aturan yang dituntu oleh sang idola, termasuk jam operasional dan masih banyak lagi. Tentu saja mereka sangat “berkuasa” menentukan harga sewa lokasi tersebut. Dengan kondisi yang demikian, tidak sedikit pemilik shopping mall bahkan sudah berusaha merayu sang idola diatas jauh-jauh hari sebelum propertinya berdiri. Begitu kesepakatan terjadi, pemilik shoppig mall akan menggunakan merek sang idola sebagai pemanis yang juga akan mempengaruhi para pebisnis yang berpotensi membeli/menyewa lokasi-lokasi kecil lainnya. Tentu saja pemilik atau pengelola shoppig mall itu akan mematok biaya yang lebih tinggi dengan ketentuan yang lebih ketat kepada para penyewa yang kecil-kecil. Ibaratnya merekalah yang menjamu para bintang, para idola yang dianggap lebih berjasa mengundang pembeli. Adil ? Saya tidak bisa berkomentar, apakah ini adil atau tidak, tetapi setahu saya begitulah cara kerja bisnis yang semakin kapitalis. Saya kadang merasa bahwa orang miskin malah berpotensi membayar lebih daripada orang kaya. Contohnya, untuk ke kamar mandi umum, orang miskin yang berada diareal publik yang tidak elit, malah harus membayar untuk menggunakan fasilitas itu, sedang orang kaya di areal umum yang elit malah tidak membayar sama sekali. Sudah membayar, bukan berarti fasilitasnya bagus dan bersih. Beda dengan fasilitas untuk orang kaya yang gratis, tetapi bersih dan bagus. Persis seperti mata rantai makanan; cacing yang kecil dimakan anak ayam, anak ayam dimakan kucing hutan, kucing hutan dimakan harimau dan harimau dimakan manusia. Tapi saya sekarang sedang tidak ingin menilai itu adil apa tidak, Cuma yang saya tahu, begitulah keadaan kita sekarang ini. Yang kecil membesarkan yang besar. Menjadi besar Tentu saja untuk medapatkan kemudahan seperti para

pemilik merek idola, kita harus berkembang menjadi besar, menjadi bintang dan menjadi idola seperti mereka. Karena setahu saya mereka juga tidak serta merta datang langsung besar, mereka juga berkembang membesar dari kecil, dan waktu mereka masih kecil, mereka juga membesarkan yang sudah besar seperti aturan yang berlaku kini bagi mereka. Jadikan merek anda merek yang besar dan idola. Tentu saja kiat-kiat ini banyak dibahas dibanyak tulisan saya terdahulu. Pastikan anda berinfestasi membesarkan merek anda. Hingga suatu saat nanti merek yang anda miliki bernilai lebih mahal dibanding produk dan aset yang anda miliki. Pada saat itulah anda akan berposisi diatas, orang lain bisa bersimpuh memohon kesidaan anda untuk bekerjasama. Dalam kontek kemudahan saat menyewa atau membeli ruangan di Shopping Mall, merek besar yang diminati adalah merek yang mengundang pengunjung. Bukan sekedar terkenal dan mahal, tetapi merek yang digunakan dan diidolakan banyak orang. Artinya karena merek itulah mereka datang berbondongbondong. Pihak Shopping Mall Jika anda dalam posisi pemilik shoppig mall. Selain dari penyewa kecil-kecil, anda masih banyak akan mendapatkan pintu-pintu datangnya uang. Sebutlah areal atrium atau yang sering disebut lobby utama. Pada bagian ini, anda dapat menyewakan dengan harga lebih mahal kepada orang-orang yang ingin berpameran dalam waktu yang singkat. Lagi-lagi kuncinya adalah jaminan pengunjung yang banyak akan mengundang penyelenggara pameran lebih banyak juga. Areal pameran tidak harus di lobby utama, tetapi areal-areal lain yang banyak kerumunannya juga potensial dijual. Anda tinggal membuat kelas harga yang disesuaikan dengan tingkat strategisnya lokasi yang anda miliki. Jumlah pengunjung yang banyak selalu memberi kesempatan datangnya uang. Lokasi-lokasi strategis bisa saja anda jual untuk papan promosi. Biasanya tidak perlu tingkat luas, tetapi hanya membutuhkan dinding-dinding yang kosong saja. Areal parkir sudah jelas sumber uang tunai yang tiada putusnya. Bahkan puncak bangunan sekalipun bisa dijual. Para penyelenggara telekomunikasi selular dan operator radio membutuhkan tempat untuk pemasanan antena, jelas mereka membutuhkan tempat yang tinggi. Termasuk mereka jugaberkepentingan agar layanan mereka tetap bangus diareal yang banyak pengunjungnya itu. Jasa perbankan juga memerlukan tempat untuk meletakkan mesin uangnya di lokasi anda. Jelas anda bisa mengenakan biaya yang tidak sedikit untuk mereka. Jikapun di lokasi shooping mall anda ada banyak lokasi yangdianggap kurang strategis dan jarang di kunjungi orang. Anda masih bisa menawarkan kepada pengusaha play station, pijat refleksi, warung jamu, karaoke atau usaha hiburan lainya. Karakter bisnis itu lebih dicari orang meskipun berada di lokasi pojokan yang tidak cukup terlihat. Yang terakhir, ruang publik sudah semakin sempit, tak ada lagi tempat rekreasi untuk orang kota. Lalu orang modern semakin malas dan lebih suka belanja. Jadi shopping mall adalah kail yang tepat untuk ditebarkan di kerumunan ikan yang banyak. Konsultasi & Pelatihan; tj@cahyopramono.com

Wing’s Air Buka Akses Perekonomian Kawasan Danau Toba TARUTUNG (Waspada): Peluncuran pesawat Wing’s Air jenis ATR 72-500 dengan kapasitas penumpang sebanyak 72 orang di Bandara Silangit-Taput, pada rute perjalanan SilangitPolonia Medan, Medan PoloniaSilangit, Jumat (8/10), disambut baik masyarakat Bonapasogit serta didukung oleh kabupaten kawasan Danau Toba. Dalam waktu dekat pesawat Wing’s ATR 72-500 akan beroperasi dengan jadwal penerbangan 2 x seminggu pada hari Jumat dan Minggu, SilangitPolonia dan Polonia-Silangit. Khusus untuk Natal Desember 2010 dan tahun baru tahun 2011 rute perjalanan akan ditambah menjadi 4 x seminggu. Demikian Kepala Bandara Silangit Martinus Hutasoit pada acara peluncuran perdana pesawat itu, Jumat (8/10). Menurut Martinus, kehadiran Wing’s Air punya prospek baik bagi masyarakat Bonapasogit kawasan Danau Toba untuk berpergian keluar daerah. Sebaliknya akan memberikan peluang bagi anak perantau Bonapasogit untuk dapat mudik kampung pada saat libur. Sebab perjalanan antara Medan-Silangit hanya memakan waktu 40 menit. Dan untuk Medan-Jakarta, Jakarta-Medan memerlukan waktu perjalanan sekira 2 jam. Bandara Silangit didirikan sejak tahun 2005 oleh Presiden RI , telah didarati pesawat jenis Merpati 325, Susi Air. Saat ini pesawat Wings akan membuka penerbangan perdananya untuk dapat didukung dan dinikmati masyarakat Bonapasogit kita. Saat sekarang, jelas martinus, Bandara Silangit berkapasitas dengan panjang landasan 2250 M, lebar 30 meter. Dengan dilengkapi dua terminal/efron yaitu A dan B. “Pada bulan Desember tahun 2010 nanti, Bandara Silangit dijadwalkan Presiden RI SBY juga akan launching di Bandara Bonapasogit Silangit, dengan jenis pesawat Boeing 307-500. Dan perlu untuk diketahui pesawat terbesar sudah mendarat di Bandara Silangit adalah jenis Fokker 100 . Secara ekonomis kehadiran pesawat Wing’s Air ATR 72-500 juga dapat dijangkau oleh masyarakat kawasan Danau Toba. Sebab ongkos hanya sebesar Rp 370.000, tambahnya.

Waspada/Hamdani

KARET MENTAH : Sejumlah pekerja mengangkat getah karet mentah untuk kemudian diolah ke pabrik, di areal perkebunan karet, Desa Ujung Silau, Kabupaten serdang Berdagai, Minggu (10/10). Harga karet dijual seharga Rp 9000/ kg.

OPEC: Pertumbuhan Ekonomi Dunia Lambat WASHINGTON (Antara): Organisasi Negara-negara Pengekspor Minyak (OPEC) mengungkapkan adanya bukti perlambatan pertumbuhan ekonomi dunia. Berbicara di depan forum pertemuan pejabat ekonomi dunia di Washington, Sabtu, Sekjen OPEC Abdalla Salem El-

Badri mengatakan, sudah terlihat tanda-tanda lambannya pertembuhan ekonomi global. Banyak negara juga menghentikan upaya stimulus ekonomi mereka. “Dampak pemulihan ekonomi yang melambat terhadap permintaan minyak bumi juga sudah terlihat,” katanya. Pertumbuhan konsumsi minyak bumi pun berkurang di sejumlah negara, katanya. “Tahun depan, situasinya diperkirakan tidak membaik. Kenyataannya, pertumbuhan ekonomi dunia diperkirakan

Acara peluncuran dihadiri oleh empat pimpinan/muspida, tokoh masyarakat kabupaten kawasan danau Toba antara lain Bupati Taput Torang Lumbantobing, ketua DPRD Taput FL. Fernando Simanjuntak, Bupati Humbang Maddin Sihombing, Wakil Bupati Tobasamosir, Bupati Samosir Mangindar Simbolon. Kapolres Taput AKBP. IKG Wijatmika, Kapolres Humbang, Kapolre Tobasa dan didampingi masingmasing pimpinan SKPD. Secara khusus dalam rombongan PT Wing’s Air, juga turut hadir tokoh masyarakat asal Sumut Parlindungan Purba yang juga DPD, anggota DPRRI Anton Sihombing, Sanggam SH Bakkara dan sejumlah wartawan\bertugas di kota Medan. D i r e k t u r Um u m d a n Keuangan Wing’s ATR 72-500 Edward Sirait dalam peluncuran perdana di Bandara Silangit mengatakan, dengan beroperasinya pesawat Wing’S Air jenis ATR 72-500 akan berpelung besar untuk membuka akses perekonomian bagi pertumbuhan masyarakat empat kabupaten di kawasan Danau Toba dan secara umum untuk

Provinsi Sumut. Edwart Sirait pada kesempatan itu mengemukakan, pesawatWing’s Air 72-500\ hadir di Bandara Silangit produksi baru dari negara Prancis dan belum pernah beroperasi. ”Pesawat jenis itu kita beli sebanyak 30 unit. Selain rute Silangit-Medan, juga akan beroperasi Bandara MedanMenado, dengan waktu tempuh selama 6 jam,” pungkasnya. Edwar menginformasikan, pesawat jenis Wing’s Air 72-500 telah berhasil mengangkut penumpang sebanyak 70 ribu jiwa di beberapa penerbangan di Indonesia. Namun Edwart mengeluhkan infrastruktur Bandara Silangit belum maksimal. Hal itu dibuktikan dengan belum tersedianya mobil pengangkut di Bandara Silangit. Akibatnya para penumpang kewalahan dan tidak terlayani dengan prima. Bupati Taput mewakili unsur pimpinan daerah kawasan Danau Toba, menyambut dengan baik beroperasinya pesawat Wing’s Air ATR 72-500 di Bandara Silangit. Diungkapkan, empat daerah kabupa-

ten kawasan danau Toba, telah sepakat untuk menampung biaya promosi penerbangan Wing’s Air dan akan ditampung dalam APBD. Gubsu, diwakili Kepala dinas Perhubungan Propsu Baharuddin Naharuddin Dalimunthe, menyatakan, transportasi darat, laut dan udara penunjang pembangunan di Sumatera Utara, khususnya untuk daerah kawasan Danau Toba, akses pembangunan ekonomi secara luas. Untuk infrastruktur pembangunan Bandara Silangit akan lebih ditingkatkan secara berkelanjutan. Biaya pembangunan infrastruktur akan diupayakan bersumber dari APBN. Acara peluncuran perdana pesawat Wing’s Air 72-500 di Bandara Silangit diwarnai dengan pemberian cendramata dari tokoh masyarakat Taput, Tobasa, Humbang dan Samosir. Cendramata berupa Ulos diterima Direktur Umum dan Keuangan Wing’s Air Edward Sirait, Kapten Wing’s Air, Kepala operasi, para pramugari dan sejumlah rombongan lainya. Acara ditutup dengan doa. (c12/ a13)

beberapa negara Timur Tengah dan Amerika Latin. El-Badri mengatakan, harga minyak mentah dunia juga relatif stabil dalam setahun terakhir, yakni di kisaran 70-85 dolar AS per barel. Tahun sebelumnya terjadi volatilitas luar biasa terhadap harga minyak mentah dunia. Tekanan terhadap harga minyak itu sudah terlihat akibat ketidakpastian pemulihan ekonomi global dan fundamental pasar minyak yang lemah, katanya dilaporkan oleh AFP.

Dolar AS Melemah, Emas Bertahan Tinggi MEDAN (Waspada): Harga emas kualitas 99,99 persen di perdagangan lokal dalam sepekan terakhir bertahan tinggi setelah melemahnya nilai tukar dolar AS terhadap berbagai mata uang internasional termasuk rupiah saat ini dalam posisi Rp8.920 per dolar AS. Pantauan Waspada di toko emas Siregar Jaya Jalan AR Hakim No I Medan, Jumat (8/10), dampak dari bertahan tingginya harga emas telah mempengaruhi transaksi emas di perdagangan lokal sehingga lebih banyak masyarakat menjual emas perhiasannya ke pedagang. Menurut Rusdi Nasution pemilik toko emas Siregar Jaya, dalam perdagangan hari tersebut perbandingan masyarakat yang menjual emas ke pedagang berkisar 60 persen, sementara itu 40 persen lagi membeli dalam bentuk perhiasan. Bertahan tingginya harga emas tersebut tidak dipengaruhi

perdagangan lokal namun terdorong oleh tingginya permintaan emas di perdagangan internasional akibat melemahnya nilai tukar dolar AS terhadap sebagian besar mata uang negaranegara asia dan eropa, ujarnya. Harga emas di pasaran internasional saat ini telah mencapai 1.335 dolar AS per ounce, namun disbanding kemarin harga tersebut telah menurun karena sempat melambung naik ke posisi 1.358 dolar AS per ounce. Lemahnya nilai tukar dolar AS terhadap mata uang negara lain mendorong investor mengalihkan investasinya dalam bentuk emas guna menjaga nilai asetnya agar tidak ikut terjerembab ke mata uang dolar AS, ujarnya. Ketika disinggung tentang bertahannya harga emas tersebut di level tertinggi sepanjang beberapa tahun terkahir Rusdi belum dapat menjelaskan dan

Masuk BICT Wajib Mengenakan Id Card Unsur Muspida Taput,Tobasamosir,Samosir dan Humbang Hasundutan foto bersama di Bandara Silangit -Taput dengan direkturWing’s Air 72-500 dan sejumlah rombongan dari Medan,usai peluncuran perdana pesawat Wing’s Air 72-500

lebih rendah dari tahun ini.” “Karenanya, pertumbuhan permintaan minyak bumi tahun 2011 diperkirakan hanya sekitar satu juta barel per hari atau tingkat pertumbuhannya sama dengan tahun ini,” katanya. Dalam pertemuan tahunan Dana Moneter Internasional (IMF) dan Bank Dunia di Washington DC itu, ia lebih lanjut mengatakan, kebanyakan permintaan minyak datang dari negara-negara berkembang seperti China, India serta

MEDAN (Waspada): Mulai saat ini setiap orang memasuki kawasan Pelabuhan Belawan International Container Terminal (BICT) wajib mengenakan tanda pengenal (Id Card). Peraturan yang diberlakukan tanpa pandang bulu ini dijelaskan Manajer Manajemen Mutu, Faat Talambanua, Jumat (7/10). PT Pelabuhan Indonesia I yang mengoperasikan Belawan International Container Terminal (BICT) ini harus tertib dan lancar agar operasional bongkar muat barang untuk mendukung perekonomian di Sumatera Utara ini dapat berjalan lebih baik lagi, jelas F Telambanua. Menurut Faat, kebijakan yang hasilnya dapat meningkatkan kinerja ini diharapkan dapat ditaati dan dukungan semua pihak baik sipil maupun militer, karena tanpa dukungan itu, kebijakan ini tidak akan ada artinya. ‘’Kami tidak mempersulit setiap orang masuk ke kawasan BICT, namun yang masuk itu harus jelas apa tujuannya serta dari mana dianya. Id Card ini dapat diperoleh di pintu masuk dengan cara menukarkan terlebih dahulu kartu identitas.’’ Sebelum melakukan penertiban, pihaknya jelas Faat, lebih dahalu melakukan penertiban ke dalam (intern) hasilnya, sudah hampir 95 persen, seluruh pegawai pengelola terminal peti kemas terbesar di luar Pulau

Jawa ini sudah melaksanakannya, karena pelanggaran dari kewajibkan mengenakan tanda pengenal ( Id Card) pasti akan mendapat sanksi tegas. Setelah berhasil melakukan penertiban di pegawai Pelindo I BICT, Manajer Manajemen Mutu F Telaumbanua selanjutnya mewajibkan pengguna jasa yang melakukan aktivitas di BICT mengenakan Id Card. Jika tidak maka yang bersangkutan tidak dibenarkan memasuki kawasan BICT oleh petugas security yang kini melakukan penjagaan di pintu masuk terminal peti kemas yang telah bertaraf internasional ini. Gebrakan Manajer Manajemen Mutu BICT F Telaumbanua yang baru seminggu bertugas di BICT ternyata tidak mudah karena ternyata paling banyak melanggar pengenaan Id Card selama ini justru dari intansi pemerintah. Selama ini para pengguna jasa terlalu bebas lalu-lalang di BICT tanpa mengenakan/ memiliki tanda pengenal. Melihat ini mantan Manajer Pelindo I Cabang Sibolga itu segera melakukan penertiban mengingat BICT sudah lolos ISPS Code yang merupakan sertifikat dunia. Humas Pelindo I BICT Suratman SSos membenarkan seluruh pegawai BICT diwajibkan mengenakan tanda pengenal yang memang sudah dimiliki.(m35)

memperkirakannya, karena faktor yang mendorong hal tersebut terkait iklim perekonomian internasional. Sementara itu beberapa pedagang emas di Pasar Petisah mengatakan sangat resah dengan naiknya harga emas saat ini karena akan terpengaruh terhadap iklim usaha perdagangan emas yang harganya

berada di atas kemampuan sebagian besar masyarakat. Pembeli emas saat ini semakin terbatas, hanya dari kalangan masyarakat ekonomi menengah ke atas saja karena harganya sangat tinggi, pihaknya juga tidak dapat memperkirakan apakah akan kembali ke kisaran normal, tuturnya.(m40)

Menteri BUMN: Stok Beras Mencapai 1,2 Juta Ton PADANG (Antara): Menteri Negara BUMN, Mustafa Abubakar menyatakan, stok beras yang ada di gudang Bulog secara nasional tahun 2010 ini mencapai 1,2 juta ton. Hal ini dikatakan Meneg BUMN, Mustafa Abubakar, saat kunjungan untuk melakukan pengecekan stok beras d Gudang Bulog Sumbar, Sabtu (9/10). “Stok beras yang berada di gudang Bulog secara nasional pada tahun 2010 sebanyak 1,2 juta ton,” kata Menteri Negara BUMN, Mustafa Abubakar, di Padang. Menurutnya, masyarakat tidak perlu khawatir jika terjadi kelangkaan beras bulog, stok masih mencukupi hingga bulan Januari 2011 mendatang. “Kita menjamin ketersedian beras bulog untuk memenuhi kebutuhan penduduk Indonesia hingga bulan Januari 2011

mendatang,” katanya. Dia menambahkan, jumlah tersebut sudah termasuk cadangan pemerintah dan beras miskin (raskin) bagi rumah tangga miskin (RTM). “Pihak Bulog sudah menyalurkan beberapa ton raskin bagi rumah tangga miskin di Indonesia,” katanya. Dia mengatakan, idealnya beras Bulog secara nasional tidak boleh kurang dari 1,5 juta ton, agar dapat memenuhi kebutuhan sampai 6 bulan ke depan. “Bulog kekurangan 300.000 ton. Itu artinya memperbesar peluang impor beras,” katanya. Dia menambahkan, Impor merupakan salah satu cara yang dapat dipilih terlebih mengingat stok beras yang tidak mencapai target. “Hal ini dilakukan untuk memperkuat cadangan beras di gudang Bulog secara Nasional,” katanya.

XL Resmikan BTS Ke 21.650 MEDAN (Waspada): PT XL Axiata, Tbk mengoperasikan BTS (Base Transceiver Station) ke 21.650 di Kecamatan Pacet, Cianjur , Jawa Barat menandai 14 tahun kiprahnya di industri telekomunikasi Indonesia. Peresmian BTS di Cianjur sangat berguna untuk mendukung layanan telekomunikasi seluler di daerah Cianjur, khususnya berada di wilayah terpencil dan perbukitan dalam menggerakkan roda perekonomian masyarakat, ujar Presiden Direktur XL, Hasnul Suhaimi Jumat (8/10) dalam sambutan tertulisnya di usia 14 Tahun PT XL Axiata, Tbk. Saat ini, katanya, XL telah melayani lebih dari 35,2 juta pelanggan dan memiliki infrastruktur handal juga didukung kabel serat optik memanjang dari Sumatera, Jawa, Bali, Lombok, Sulawesi dan Kalimantan. Melalui satelit, jaringan XL juga menjangkau kepulauan Maluku, Nusa Tenggara Timur dan Papua.

Disebutkannya, komitmen yang kuat memberikan layanan terbaik bagi masyarakat serta kreatifitas yang tertanam pada diri karyawan, mendorong XL selalu mampu melahirkan inovasi layanan seluler yang bermanfaat tinggi. Hasnul Suhaimi juga menyebutkan, sejak 2007, XL menjadi pelopor tarif murah untuk berbagai layanan, baik voice, SMS, maupun data dan internet. Sementara melalui program tanggung jawab perusahaan CSR, mampu mempeloperi program yang komprehensif berbasis pemanfaatan teknologi informasi untuk mendukung pendidikan anak-anak Indonesia di semua wilayah nusantara. Menurutnya, selama 14 tahun berkiprah di industri komunikasi, XL ikut membuka akses informasi sekaligus mendukung pembangunan di daerah, agar masyarakat bisa memanfaatkan layanan seluler untuk meningkatkan kualitas kehidupannya.(m09)


Waspada, Senin 11 Oktober 2010