{' '} {' '}
Limited time offer
SAVE % on your upgrade.

Page 1


Two-Day Auction:

Asian Art Discoveries Thursday, February 27th 2020, at 12:00 pm CET (Japanese & Korean Art) Friday, February 28th 2020, at 10:00 am CET (Chinese & Southeast Asian Art) CATALOG AK0220

VIEWING www.zacke.at

IN OUR GALLERY Preview: 10. 2. – 28. 2. 2020 Monday to Friday 10 am - 6 pm 27.2 – 10 am - 12 pm 28.2 – 9 am - 10 am and by appointment

GALERIE ZACKE MARIAHILFERSTR ASSE 112 1070 VIENNA AUSTRIA Tel +43 1 532 04 52 Fax +20 E-mail office@zacke.at


IMPORTANT INFORMATION

According to the general terms and conditions of business of Galerie Zacke Vienna, Founded 1968, SZA Versteigerungen & Vertriebs GmbH, 1070 Wien, online at www.zacke.at ABSENTEE BIDDING Absentee bids are carried out under the regulations of the terms of business of Galerie Zacke, SZA Versteigerungen & Vertriebs GmbH, which requires written submission of your purchase limit. Orders without purchase limits cannot be processed. Only the submitted lot number of the auction lot is binding for the processing of the absentee bid. The place of jurisdiction is Vienna, Austrian Law and Austrian jurisdiction are exclusively applicable for all legal questions arising from the business relationship. Absentee bids for this auction will be accepted until the day of auction by 10:00 a.m. We regret that absentee bids received after the time stated above will not be processed until after the auction. PLEASE SEND ABSENTEE BIDS FOR THIS AUCTION TO: Fax: +43 1 532 04 52 20 or Email: office@zacke.at or Mail: Galerie Zacke, Mariahilferstrasse 112, Stiege 1, 2. Stock, 1070 Wien, Austria, Europe WE ACCEPT THE FOLLOWING METHODS OF PAYMENTS: Č? &DVK Č? &HUWLILHGRUSHUVRQDOFKHFN Č? %DQNWUDQVIHU SOHDVHLQTXLUHWRUHFHLYH our bank account information) Č? &UHGLWFDUG 9LVD0DVWHU&DUG$PH['LQHUV&OXE

TELEPHONE BIDDING It is generally possible to bid by telephone during the auction. Please fill out the absentee bidding form enclosed in this catalogue and include your telephone number at which you can be reached during the auction. In the “bid in euro� column please write “TEL� and then send us the completed absentee bidding form. We will contact you by telephone during the auction, whereby you will be able to bid directly. Please keep in mind that such telephone bids are always classified as a bid equivalent to the estimate. Should no other person bid for the specified lot, you will automatically win the bidding and the respective lot will be knocked down at the estimate price. ESTIMATES AND STARTING PRICES The auction will begin with the starting price and written bids will be accepted only with a minimum amount equivalent to the starting price. SHIPPING AND TRANSPORT INSURANCE For domestic shipping Galerie Zacke (hereinafter called “the company�) charges in average EUR 15,- to EUR 50,- per item, depending on size and weight. These fees cover the costs of packing and shipping. Fees for bulky or fragile items, or international shipping will be quoted upon request. The purchased goods are transported at the risk of the customer following handover of the packaged item to the post office or another carrier which the customer agrees to through his/her submission of the purchase order. According to the specific wish of the customer, the auctioned goods may be insured for the value of the purchase price (highest bid and all surcharges). This insurance fee is 3% of the purchase price. For any lots with purchase prices exceeding EUR 350,the transport insurance will be automatically arranged by the company if it does not expressively receive the purchaser´s written denial of this service. Payments due to the company under the insurance contract will be charged to the customer. The company is also entitled to assign claims under the insurance contract to the customer providing the terms of the insurance contract do not prevent this. In any case, the company is only required to make payment to the customer specifically if payment has effectively been received from the insurance company.

COLOR AND CONDITION Auction lots will be exhibited for viewing prior to the auction, thus offering all interested customers the opportunity to examine the quality and condition of the works exhibited. The catalogue illustrations are intended to assist customers during such preview. In illustrations, printed colors do not correspond exactly to the originals. The printed catalogue images are not representative for the condition of the illustrated pieces. Flaws and damages are therefore always indicated in the catalogue. The illustrations in the online catalogue can be strongly magnified, so that damages and restorations are usually well recognizable. ENDANGERED SPECIES / CITES INFORMATION Some items in this catalogue may consist of material such as for example ivory, rhinoceros-horn, tortoise shell, coral or any rare types of tropical wood, and are therefore subject to the Convention on International Trade in Endangered Species of Wild Fauna and Flora [CITES]. Such items may only be exported outside the European Union after an export permit in accordance with CITES has been granted by the Austrian authorities. We would like to inform you that such licenses are typically not granted. For Objects which have a low ivory content or have been proven beyond doubt to be in the EU before 1982 please contact our office for more information on how to obtain a CITES license. COMPLAINTS At its auctions, Galerie Zacke sells consigned lots on behalf of third-party consignors. For this reason, any complaints related to purchased lots must be reported to Galerie Zacke within 6 weeks after the receipt of such lot. Our complete general terms and conditions of business can be found on our website www. zacke.at THE ART LOSS REGISTER All items starting above 2.000,- EUR have been checked by the Art Loss Register. FURTHER IMAGES More images of all lots can be found at: www.zacke.at


ABSENTEE BIDDING FORM FOR THE AUCTION ASIAN ART DISCOVERIES AK0220 ON DATE FEBRUARY 27 TH & 28 TH, 2020, AT 12 PM AND 10AM CET RESPECTIVELY

LOT NR.

LOT TITLE

%Ζ'Ζ1(852

PLEASE CALL ME WHEN A HIGHER %Ζ'7+$10Ζ1(+$6%((15(&(Ζ9('

3/($6(5$Î&#x2013;6(0<%Î&#x2013;'%<21(%Î&#x2013;''Î&#x2013;1* INCREMENT (ca. 10%) IF NECESSARY

IMPORTANT NOTICE: %LGVGRQRWLQFOXGHEX\HUvVSUHPLXPDQGRU9$7

MY PHONE NUMBER

TELEPHONE BIDS: Î&#x2013;I\RXOLNHWRELGE\WHOHSKRQHSOHDVHVWDWHÈ&#x2020;7(/È&#x2021;LQWKHÈ&#x2020;%Î&#x2013;'Î&#x2013;1(852È&#x2021;FROXPQLQVWHDGRID(XURDPRXQW*DOHULH=DFNHZLOOFDOO\RXRQWKHGD\ of the auction, on the telephone number provided, 5 lots before the lot you are bidding on and the bidding will commence at the starting price, as stated in the catalog. If Galerie Zacke cannot reach you during the auction, Galerie Zacke will bid up to the estimate on your behalf. TERMS OF PAYMENT, SHIPPING AND COLLECTION:

EMAIL

NAME ADRESS

POSTCODE

With the signature on this form, the client instructs the auctioneer to bid on his behalf. The Euro amount up to which the auctioneer shall bid on behalf of the client is either stated in this form or will be communicated to the auctioneer via telephone during the auction. All absentee bidding shall be governed by the terms and conditions [AGB] of Galerie Zacke. The client agrees with his signature that he has read, understood and fully accepted the AGB of Galerie Zacke. Galerie Zacke, founded 1968, is a registered brand of SZA Versteigerungen & Vertriebs GmbH, Vienna, Austria.

PHONE NUMBER

DATE & SIGNATURE

CITY, COUNTRY

CREDIT CARD PAYMENT PLEASE CHECK THE DESIRED CARD COLLECTION BY CLIENT WITH PAYMENT ON THE PREMISES IN CASH, BY CERTIFIED CHEQUE OR CREDIT CARD INVOICE PAYMENT VIA BANK WIRE AFTER RECEIPT OF INVOICE SHIPPING AFTER RECEIPT OF PAYMENT EXPRESS PARCEL SERVICE REQUIRED (ACCORDING TO TERMS AND CONDITIONS OF GALERIE ZACKE)

AMEX

DINERS

MASTERCARD

VISA

NAME

ADDRESS

CARD NUMBER

EXPIRY DATE

SECURITY CODE

SHIPPING INSURANCE REQUIRED (ACCORDING TO TERMS AND CONDITIONS OF GALERIE ZACKE)

GALERIE ZACKE Mariahilferstrasse 112, 1070 Vienna, Austria Email: office@zacke.at Tel: +43-1-532 04 52 Fax: +43-1-532 04 52 20

IMPORTANT NOTICE: At its auctions, Galerie Zacke sells consigned lots on behalf of third-party consignors. For this reason, any complaints related to purchased lots must be reported to Galerie Zacke within 6 weeks after the receipt of such lot.


ABSENTEE BIDDING FORM FOR THE AUCTION ASIAN ART DISCOVERIES AK0220 ON DATE FEBRUARY 27 TH & 28 TH, 2020, AT 12 PM AND 10AM CET RESPECTIVELY

LOT NR.

LOT TITLE

%Ζ'Ζ1(852


50 YEARS GALLERY ZACKE

GÜR el ürt erg

ofgasse

Schmalzh

U3

asse

Webg

asse

Mittelgasse

Zieglergasse

raße

raße

perg

ria hilf

112

Mariahilferst

Stum

Ma

GALERIE ZACKE

Schottenfeldgasse

U6

Kaiserst

U3

TEL

Westbahnhof

Neubaugürte

l

HOW TO FIND US ON MARIAHILFERSTRASSE: Apollogasse

BY PUBLIC TRANSPORT: 2-3 minutes from the U3 station ZIEGLERGASSE 3-5 minutes from the U3/U6 station WESTBAHNHOF BY CAR: %HVWURXWHWDNHWKH*¾UWHOWRWKH:HVWEDKQKRIDQG turn onto Mariahilferstraße; house number 112 is just after the Kaiserstraße. Access is possible by car, with loading and unloading all day as well as short term parking. Multiple garages directly nearby. ADDRESS: Mariahilferstr. 112 1070 Vienna STAIRCASE 1, 2nd FLOOR (ELEVATOR)

Further images of all lots at: www.zacke.at


TERMS OF AUCTION

§ 1) The auction shall be carried out in accordance with the provisions of the rules of procedure of GALERIE ZACKE ©, SZA VERSTEIGERUNGEN UND VERTRIEBS GMBH, MARIAHILFERSTRASSE 112, 1070 WIEN (hereinafter referred to as the company) as well as in accordance with sections 244-246 of the GEWERBEORDNUNG [Industrial Code] of 1994. The auction shall be carried out on commission. The auctioneer shall be entitled to withdraw lots exceptionally, to conduct the auction deviating from the order of the catalogue numbers and to offer lots jointly. In the event of any dispute concerning a double bid or if the auctioneer has missed a bid, the auctioneer shall be entitled to revoke acceptance of a bid and to continue auctioning the item. The figures stated in the catalogue shall be the highest bid in Euro (€) expected by the respective expert. As a rule, the bid shall be increased by 10% of the last bid. (See table of the bidding increments). § 2) The acceptance of a bid shall be granted to the highest bidder unless a hidden reserve has been agreed upon with the consignor of the item in question. Such a hidden reserve (also called limit or just reserve) shall be the minimum price under which the item will not be sold during the auction. This reserve will be disclosed upon request only and may exceed the estimate. The auctioneer will in this case bid on behalf of the seller against all other bidders until the reserve has been reached. If a reserve is not reached during the auction, the auctioneer will knock down the item to the highest bidder at the final bid, but the sale will be conditional of the acceptance of this final bid by the seller. In this case the highest bidder shall be bound to his/her last bid for a term of 8 days starting with the day of the knockdown. If the winning bidder does not receive a written cancellation notice within this term of 8 days, the knockdown becomes unconditional and the sale is final. Typically, only a minority of all items in an auction have a hidden reserve. § 3) All items shall be subject to differential taxation. A uniform surcharge of 22% plus the value added tax applicable to the surcharge to the amount of 20% shall be added to the achieved highest bid (final and highest bid). Thus, the surcharge shall be 26.4% of the final and highest bid in total. § 4) In the event of sales abroad, the value added tax will be repaid if the item is sold to a country which is not a member country of the European Union (third country), the legal requirements are met, and the proof of exportation is provided. The value added tax shall not be shown separately on the invoice. § 5) The auction buyer must pay the purchase price immediately upon acceptance of the bid (final and highest bid plus 22% surcharge, plus the value added tax applicable to the surcharge to the amount of 20%). However, the company may grant the auction buyer a respite for the payment of the purchase price in whole or in part in individual cases. If a respite is refused, the acceptance of the bid may be revoked, and the item may be reoffered. In the event of revocation of the acceptance of the bid, the company shall be entitled to accept the last bid from the underbidder. § 6) In the event of respite in whole or in part, the company shall be entitled to charge default interest (12% p.a.) as well as storage charges (2.4% pf the final and highest bid per month commenced) after 14 days upon acceptance of the bid. The item purchased at auction shall be handed over exclusively upon full payment of the purchase price including all costs and charges accrued since the acceptance of the bid. § 7) The buyer can take acquired items in possession, as far as possible, immediately or after the end of the auction. Items which have been fully paid for shall be handed over in our show rooms in GALERIE ZACKE, MAIAHILFERSTRASSE 112, 1070 VIENNA. If a deferred purchase price is not paid within the set period, the company shall be entitled to auction the item again in order to recoup its claim from the defaulting auction buyer. In this case, the defaulting auction buyer shall be liable to the company for the total loss of commission incurred by the company due to the re-auctioning as well as for any default interest and storage charges.

§ 11) If a customer is not able to participate in an auction personally, the company shall accept purchase orders. These orders may be placed in writing, via email or fax. In the case of a purchase order placed by phone or orally, the company shall reserve the right to make the performance dependent on a confirmation from the principal communicated in writing, via email or fax. Furthermore, the company shall not be liable for the performance of purchase orders. Purchase orders with equal top bid limits will be considered in the order of their receipt. Bids which are only one increment above the starting price shall be exhausted totally. Bids which do not correspond to the increments determined by the company (see bidding increment) in tabular form will be rounded up to the next higher increment. The table of these increments can be sent upon request. In the case of lots auctioned “without any limits”, bids below the estimated price shall be exhausted totally. The written bid (purchase order) must include the item stating the catalogue number and the offered top bid limit which is quoted as the amount of the acceptance of the bid without buyer´s commission and without value added tax. Ambiguities shall be carried by the bidder. A purchase order which has already been placed may only be cancelled if the written withdrawal is received by the company at least 72 hours prior to the beginning of the auction. § 12) The company may refuse to process a purchase order without explanation until offering or make this dependent on payment of a deposit. In the event of an unsuccessful order, such a deposit will be reimbursed by the company within 5 working days. Processing of purchase orders is free of charge. § 13) Every contributor shall in principle be entitled to withdraw the items offered for auction until the start of the auction. Therefore, it is impossible to assume liability or to give warranty for the actual offering. § 14) Items paid must be collected within 30 days of payment. Items which have not been collected may be delivered without further communication at a starting price from the recent auction reduced by 50% after 30 days from the respective auction date. Items which have not been collected within 3 (three) working days after the auction or for which the company does not receive any proper shipping instructions stating the type of shipping and the address of dispatch (independent of a possibly placed purchase order) within 3 (three) working days after the auction shall be stored at the owner´s risk. Furthermore, the company shell be entitled to store item which have been purchased at auction and paid but not collected at the buyer´s risk and expense, including the costs for an insurance, with a forwarding agency. It shall be understood that the provision concerning the re-auctioning of unpaid and paid but not collected items must also apply to items not exhibited or stored on the premises of the company. The ownership shall be transferred the buyer at the time of handing over the delivery note. § 15) In the case of mixed lots with a starting price of less than EUR 350.00, the company shall not warrant for the completeness or correctness of the individual items within a mixed lot. § 16) A registration for a bid by telephone for one or several items shall automatically represent a bid at the starting prices for these items. If the company cannot reach the bidder by telephone, it will bid on behalf of the bidder by phone up to the starting price when the respective auction lot is called. § 17) Payments made to the company by mistake (through the payer´s fault) (e.g. due to miscalculation of the exchange rate by the payer) or payments made to the company for the same invoice several times shall be compensated in form of a credit note for goods for an indefinite period of time. The repayment of such payments in cash shall be excluded.

§ 8) The company shall be entitled to a lien on all items of the buyer irrespective of whether the buyer bought them within the scope of an auction or in free sale or the company secured ownership of these items otherwise. This lien shall serve to secure all current and future, qualified, limited and unmatured claims to which the company is entitled and which result from all legal transactions concluded with the buyer.

§ 18) In the case of individual auction lots, it may happen that they are delivered several times. In such a case, the auctioneer may accept a second or third etc. bid from the underbidder(s) In this case, the text om the catalogue and not the illustration in the catalogue shall also be exclusively binding with regard to the warranty (relating to these auction lots).

§ 9) The items received for auction will be exhibited and may be viewed prior to the auction. In doing so, the company shall give everyone the opportunity to check the nature and the condition of the exhibited items to the extent deemed possible within the scope of the exhibition. Every bidder shall be deemed to act on its own behalf uncles it provides a written confirmation saying that it acts as a representative of a well-known principal. The company may refuse bids; this shall particularly apply if a bidder who is unknown to the company or with whom the company has no business connections yet does not provide security by the beginning of the auction at the latest. However, in principle there shall be no claim to accept a bid. If a bid has been refused, the previous bid shall remain effective.

§ 19) When making a bid, whether personally, in writing or by telephone, the bidder shall acknowledge these terms of auction, the AGB (General Terms and Conditions) as well as the rules of procedure and the schedule of fees (as amended) of the company.

§ 10) The company’s experts evaluate and describe the items received for auction and determine the starting prices uncles otherwise stated in the catalogue or expert opinion. The information concerning production technique or material, state of preservation, origin, design and age3 of an item is based on published or otherwise generally accessible (scientific) findings concluded by the company’s expert with the necessary care and accuracy. The company shall warrant to the buyer according to §22 of the AGB (General Terms and Conditions) that properties are correct provided that any possible complaints referring to this are made within four weeks upon their taking into possession. Subsequent complaints shall be excluded in principle. The company shall not be liable for any further information in the catalogue and expert opinion as well. This shall also apply to illustrations in the catalogue. The purpose of these illustrations is to guide the potential buyer during the preview. They shall not be authoritative for the condition or the characteristics of the pictured item. The catalogue and the expert opinions shall only mention defects and damage affecting the artistic or commercial value significantly. Complaints concerning the price shall be excluded upon acceptance of the bid. The company reserves the right to amend catalogue information prior to the auction. These amendments shall be made either by a written notice at the place of auction or orally by the auctioneer immediately prior to offering of the respective item. In this case, the company shall be liable for the amendment only. All items offered may be checked prior to the auction. These items are used. Any claims for damages exceeding the liability named above and resulting from other material defects or other defects of the item shall be excluded. When making the bid, the bidder confirms that it has seen the item prior to the auction and has made sure that the item corresponds to the description.

6

§ 20) The place of performance of the contract brought about between the company on the one hand and the seller as well as the buyer on the other hand shall be the place of business of the company. The legal relationships and contracts existing between the company, the sellers and the buyers shall be subject to the Austrian substantive law. The company, the sellers and the buyers shall agree to settle all disputes resulting from, concerning and in connection with this contract before the territorially competent court of Vienna. § 21) The export of art objects from Austria, when indicated, shall require a permit from the Bundesdenkmalamt [Federal Monuments Office]. In any event, the company shall orally provide information about art objects for which an export permit will probably not be granted at the beginning of the auction. § 22) The company reserves the right to assign to the customer all rights and obligations resulting from the contractual relationship between the company and the contributor by a way of a respective declaration, as well to assign to the contributor all rights and obligations resulting from the contractual relationship between the company and the customer by way of a respective declaration, in each case in terms of a complete assignment of contract with the result that the contractual relationship-following the submission of the aforementioned declarations by the company – shall exclusively be between the contributor and the customer, which is in accordance with the basic model of the commission agreement. Customers and contributors shall already now give their explicit consent to this contract assignment.


CONTENT

AUCTION DAY 1 Thursday, February 27th at 12:00 PM CET JAPANESE & KOREAN ART Lots 1 to 387 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Page 10

AUCTION DAY 2 Friday, February 28th at 10:00 AM CET CHINESE & SOUTHEAST ASIAN ART Lots 388 - 857 . . . . . . . . . . . . . . . . . . . . . . . . . . . Page 124

7


FURTHER IMAGES OF ALL LOTS AT â&#x20AC;¦

www.zacke.at

8


DAY 1

Japanese & Korean Art

Lots 1 to 387

9


1 |

A LARGE AND SPECTACULAR SILVER AND GOLD INLAID KORO (INCENSE BURNER)

Japan, 18th century, Edo period (1615-1868)

7KHHODERUDWHVHFWLRQDOERG\bFRQVLVWLQJRIPDQ\ bronze pieces. The top-section which holds the incense shows a confronting tiger and dragon on one side, and two confronting phoenixes on the other. The koro is held by a rock and sits on a four-legged stand with phoenix heads, finally the whole group stands upon an octagonal bronze base. The lid of the Koro is surmounted by a figure of Kirin. The entire bronze is worked in silver wire and inlays of rich gold and shows various fine figures of animals and clams â&#x20AC;&#x201C; the bronze is also covered with many tiny inlaid barnacles. HEIGHT c. 53 cm WEIGHT 10.5 kilograms Condition: Good age-related condition, wear, some elements are loose and the Kirin figure has been reattached. Provenance: Old Austrian private collection. Estimate EUR 2.000,Starting price EUR 1.000,-

2 |

MIYAO EISUKE: A BRONZE â&#x20AC;&#x2DC;SAMURAIâ&#x20AC;&#x2122; CANDLESTICK

%\0L\DR(LVXNHRI<RNRKDPDVLJQHG0L\DRZLWK seal Ei Japan, Meiji period (1868-1912)

Signed MIYAO on a gilt rectangular reserve with seal Ei. The heavily cast, gilt and incised bronze figure stands on its en suite lacquered wood stand. The Samurai is dressed in a palatial robe with various gilt family crests over a large apron with thick tassels at the bottom that looks like a kesho-mawashi, normally worn only by sumo wrestlers. A tanto is tucked through his sash as he holds the removable blossom-shaped candleholder. HEIGHT 30.3 cm (including the stand) WEIGHT 1823.7 grams (including the stand) Condition: Superb condition with only minor wear and traces of use. The stand with some abrasions, minute chipping and age cracks. The warrior may have once held something in his proper right hand, which is now missing. Provenance: From an English private collection. Estimate EUR 1.500,Starting price EUR 750,-

10


3 |

A BRONZE FIGURAL GROUP

Japan, Meiji period (1868-1912)

Consisting of 4 pieces: The base finely casted with JUDVVHVDQGSODQWVWKHWZR%LMLQVWDQGLQJQH[W to a tree that culminates in a large flower which serves as a container. HEIGHT 36 cm WEIGHT 7.5 kilogram Condition: Worn condition, two hands and one leaf restored, one foot and one leaf lost. Provenance: Hungarian private collection. Estimate EUR 700,Starting price EUR 350,-

4 |

A BRONZE SCROLL WEIGHT OF KINKO SENNIN

Japan, Meiji period (1868-1912)

Cast to depict Kinko Sennin holding down a seabream. LENGTH 7 cm WEIGHT 204 grams Condition: Good condition. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 150,Starting price EUR 75,-

5 |

A CHARMING BRONZE OF HOTEI

Japan, Meiji period (1868-1912)

The bronze figure with a subtle maroon patina and mounted to an oval plinth with a slightly recessed base. The lucky god is shown in traditional manner with his outsized bare belly, carrying a huge sack on his back. HEIGHT 19.5 cm WEIGHT 2926 grams Condition: Excellent condition with only minor wear. Provenance: American private collection. Estimate EUR 500,Starting price EUR 250,-

11


6 |

GENRYUSAI SEIYA: A MONUMENTAL â&#x20AC;&#x2DC;PRIDE OF LIONSâ&#x20AC;&#x2122; BRONZE VASE

Japan, Meiji period (1868-1912)

Finely cast with six lions in high relief, neatly applied incision work and unctuous patina. The base with an artistâ&#x20AC;&#x2122;s seal mark reading GENRYUSAI SEIYA zo. Despite the prideâ&#x20AC;&#x2122;s large scale and striking appearance as a group, each lion is rendered with scientific exactitude, remarkably brisk and spirited by its own. The depiction hence attains a degree of naturalism, monumentality, and dignity normally found only in the works of the next generation of animal VFXOSWRUVQRWDEO\5HPEUDQGW%XJDWWL   HEIGHT 48.5 cm WEIGHT 12.1 kilograms Condition: Good condition with some stains, dents, old wear and traces of use, the original base reinstated. Provenance: From an English private collection. Estimate EUR 800,Starting price EUR 400,-

7 |

INOUE: A LARGE BRONZE DISH

%\Î&#x2013;QRXHRI.\RWRVLJQHG.\RWRÎ&#x2013;QRXHVHLDQGVHDOHG)XVDKLUR Japan, Meiji period (1868-1912)

The backside is signed â&#x20AC;&#x2DC;Kyoto Inoue Seiâ&#x20AC;&#x2122; and inlaid with the golden artist seal â&#x20AC;&#x2DC;Fusahiroâ&#x20AC;&#x2122;. Very finely decorated in bronze, silver, copper and gilt takazogan with a pair of sparrows perched on a bamboo pole supporting a snow-covered rice-stook next to which several peonies are growing. Part of the image is executed in Katakiri technique. The scene is enclosed within a circular inlaid band of leafy bamboo. The lobed rim shows a golden meander inlay. DIAMETER 30.5 cm WEIGHT 1363 grams Condition: Superb condition with hardly any wear, some staining to patina on the backside. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Auction comparison: Compare with a plate by the same maker at Christies, in â&#x20AC;&#x2DC;Edo to Post-War: 500 Years of Japanese Art and Designâ&#x20AC;&#x2122; on November 15th, 2017, lot 5. Estimate EUR 1.000,Starting price EUR 500,-

8 |

RINSHOSAI: A PEAR-SHAPED BRONZE VASE

%\5LQVKRVDLVLJQHG5LQVKRVDL Japan, Meiji period (1868-1912)

The vase finely patinated to a deep olive-brown tone and with a sprawling neck and foot. The recessed base with a neatly incised artist signature corresponding to RINSHOSAI and a cursive inscription. The sides cast in high relief with three fish swimming amid jakago (breakwater) and tree stumps. HEIGHT 31.8 cm WEIGHT 2933 grams Condition: Excellent condition with only minor wear and traces of use. Provenance: From a private estate in the United Kingdom. Estimate EUR 600,Starting price EUR 300,-

12


9 |

A SUPERB IRON AND GOLD DISH WITH DARUMA

Japan, Meiji period (1868-1912)

The iron dish stands on three feet and is decorated in the front with DQDPXVLQJLPDJHRIWKH=HQSDWULDUFK'DUXPD %RGKLGKDUPD  Daruma looks out from a grated window, the bars inlaid in gold and silver, and a wasp descends from a finely inlaid spiderweb and lands on Darumaâ&#x20AC;&#x2122;s head. He has been woken from his meditation DQGSXOOVDQDPXVLQJJULPDFH+HLVKROGLQJDKRVVX %XGGKLVW fly whisk) and is contemplating to swat the wasp â&#x20AC;&#x201C; this comical indecision is masterfully executed in his distorted facial expression. Darumaâ&#x20AC;&#x2122;s face is inlaid in sentoku and his robe is made from rich JROG%HORZWKHLPDJHDUHOHDI\YLQHVLQODLGLQVLOYHUJROGDQG copper. The rim is fitted with a silver ring. DIAMETER 31 cm WEIGHT 1546 grams Condition: Excellent condition with associated wear. The iron has developed a fine rust patina. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 3.000,Starting price EUR 1.500,-

10 |

A SMALL SILVER INLAID BRONZE VASE

Japan, 19th century

The baluster-shaped vase with silver inlays depicting plovers above waves, the plovers inlaid in gold. The base with incised artist signature. HEIGHT 11.5 cm WEIGHT 502 grams Condition: Worn condition, rusty areas, spots, loss of patina and two small dents to body. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920. Estimate EUR 200,Starting price EUR 100,-

11 |

A SUPERB KOMAI IRON DISH

%\WKH.RPDL&RPSDQ\RI.\RWR Japan, Meiji period (1868-1912)

Seal mark inlaid in gold to backside reading â&#x20AC;&#x2DC;Nihonkoku Kyoto no ju Komaiâ&#x20AC;&#x2122; beneath a dragonfly. Extremely fine inlay work in gold and silver with microscopic incision work depicting Sankin-kotai. A Daimyo in a palanquin is accompanied by an entourage of noblemen, soldiers and servants. DIAMETER 18.3 cm WEIGHT 248.7 grams Condition: Perfect with only very minor wear. Provenance: French private collection. Estimate EUR 1.000,Starting price EUR 500,-

13


13 |

A RARE KABUTO PILL BOX

Japan, Meiji period (1868-1912)

12 |

SIX SLVER ITEMS, 19TH CENTURY

China and Japan. Comprising three sake bowls with incised decorations, one of them showing Mt. Fuji, with hallmarks on the underside, two miniature litters (jiao) with old collectorâ&#x20AC;&#x2122;s labels and hallmarks and a finely incised miniature table with old hallmarks. (6)

The small box made of silvered bronze in the shape of a Samurai helmet with fine dĂŠcor in high relief as well neatly applied incision work to the sides depicting a Karako playing with a trained mouse on a leash. LENGTH 6.5 cm WEIGHT 104.3 grams

Condition: Good condition with old wear, some slightly bent, the bowls in excellent condition. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920. Weight: 249.1 g in total. Dimensions: Diameter 8.2-10.7 cm (the bowls). Length 11.7 cm each (the litters). Height 3.7 cm (the table).

Condition: Excellent condition with some old wear and some traces of use. The lid with its original hinge, well moving, and leaving a two-millimeter-gap when closed. Provenance: Austrian private collection. Estimate EUR 500,Starting price EUR 250,-

Estimate EUR 600,Starting price EUR 300,-

14 |

ICHIEI: A SILVER CIGARETTE CASE

%\Î&#x2013;FKLHLVLJQHGÎ&#x2013;FKLHLWR Japan, Meiji period (1868-1912)

The cigarette case is made from 95 % pure silver and is decorated with an idyllic scene of two bijin (beauties) next to a maple tree and beside a bridge, the sea, rockwork and a pavilion visible in the background. The details are inlaid in copper. The inside shows the same scene, though mirrored, and shows some gold details. Signed ICHIEI to (made by) in the reverse. LENGTH 11.2 cm WEIGHT 115 grams Condition: Minor surface wear and scratches. Generally, in good condition. Provenance: Zagreb private collection. Estimate EUR 400,Starting price EUR 200,-

15 |

A JAPANESE KOMAI STYLE CIGARETTE CASE

Japan, Meiji period (1868-1912)

A Japanese Komai cigarette case with gold and silver inlaid decoration depicting a lake scene with mount Fuji in the distance. The inside with seal mark â&#x20AC;&#x2DC;DENâ&#x20AC;&#x2122;. SIZE 8.5 x 9 cm WEIGHT 82 grams Condition: Good condition, minor loss to inlay and rubbing. Provenance: Austrian private collection. Estimate EUR 300,Starting price EUR 150,-

14


17 |

A SHISHI BRONZE SCROLL WEIGHT

Japan, 18th century, Edo period (1615-1868)

Cast in openwork and neatly incised miniature bronze sculpture depicting two playful Shishi, mother and cub, with a brocade ball. LENGTH 6 cm WEIGHT 79.5 grams Condition: Excellent condition with fine patina. Remainders of old mounts to bottom. Provenance: Austrian private collection. Estimate EUR 200,Starting price EUR 100,-

16 |

A RARE INLAID IVORY MOONFLASK

Japan, Meiji period (1868-1912)

The body of the miniature vase is carved from ivory with pine EUDQFKHVLQKLJKUHOLHI%RWKVLGHVEHDUDFLUFXODU6KDNXGRSODTXH with high relief inlays in gold, silver, Shibuichi and copper. One side shows the popular theme of tiger and dragon and the other portrays Kinko Sennin riding on his carp. HEIGHT 9 cm WEIGHT 74.5 grams Condition: Fine condition with a few small natural age cracks and one microscopic associated loss. Good old patina. Provenance: Austrian private collection. Acquired before 1990 in the local auction market. Estimate EUR 300,Starting price EUR 150,-

19 |

A SMALL COMPASS & MINIATURE OKIMONO

Japan, Meiji period (1868-1912)

The first item in this lot of two is a miniature geta sandal carved from ivory with a small metal thong and a microscopic fly. The second is a pendant in the shape of a lucky god with a lute, made of silver with gilding, with extremely fine incision work. It holds a functioning compass on the backside underneath a crescent moon. HEIGHT 2 cm (the sandal) and 2.5 cm (the length of the compass) WEIGHT 5 grams in total

18 |

A GOLD AND SILVER INLAID SENTOKU BOX

Condition: Excellent condition with only minor wear. Provenance: Austrian private collection.

Japan, Meiji period (1868-1912) Estimate EUR 150,Starting price EUR 75,Miniature mixed metal pill box with fine inlays in high relief depicting quails, swallows and deer amid millets and peonies. Extremely fine incision work. Rounded corners. The inside with fire-gilding. The convex lid with a minuscule knob. SIZE 3.7 x 3.1 x 3.1 cm WEIGHT 47.1 grams Condition: Excellent condition with some old stains to patina and wear. Hinge in fine working condition. Provenance: Austrian private collection. Old labels to bottom with inventory number and date of acquisition “February 93”, price at the time – 3.600 Austrian Schillings. Estimate EUR 500,Starting price EUR 250,-

15


20 |

TWO PLACEMENT CARD HOLDERS

Japan, Meiji period (1868-1912)

The card holders of mixed metal inlaid with precious metals and shaped as vases with blooming flowers. SIZE 5 x 6 cm Condition: Good condition. Provenance: From the collection of a Corsican seafarer. Estimate EUR 150,Starting price EUR 75,-

21 |

TOZAN: A PLACEMENT CARD HOLDER OF BENKEI

%\7R]DQVLJQHG7R]DQ Japan, Meiji period (1868-1912) b 0DGHIURPVLOYHUHGVHQWRNXDQGGHSLFWLQJ%HQNHLGXULQJ NDQMLQFKRUHDGLQJIURPD%XGGKLVWVXEVFULSWLRQOLVWVLJQHG TOZAN in the back. b HEIGHT 9.9 cm b Condition: Minor wear to silver. Good condition. Provenance: Old Zagreb private collection. Estimate EUR 200,Starting price EUR 100,-

22 |

TWO PLACEMENT CARD HOLDERS AND ONE HAIRPIN

Japan, Meiji period (1868-1912)

The two cardholders of mixed metal with inlays of precious metals, one depicting a samurai and another a fan with birds and flowers. The hairpin finely inlaid to depict a bird amongst leaves and flowers. SIZE card holders 5 x 6 cm, HEIGHT samurai 4.6 cm, TOTAL LENGTH hairpin 9 cm Condition: Good condition. Provenance: Old Zagreb private collection. Estimate EUR 200,Starting price EUR 100,-

23 |

A PAIR OF FAN-SHAPED PLACEMENT CARD HOLDERS

Japan, Meiji period (1868-1912)

A pair of mixed metal fan-shaped card holders, both inlaid in precious metals to depict birds amongst flowering trees. SIZE 8 x 5.5 cm each Condition: Good condition. Provenance: Old Zagreb private collection. Estimate EUR 300,Starting price EUR 150,-

16


25 |

A PAIR OF MENUKI WITH BIRDS

Unsigned Japan, Edo period (1615-1868)

24 |

THREE COPPER KOZUKA

Unsigned Japan, late Edo period (1615-1868)

%RWKSLHFHVDUHPDGHIURPDFRSSHUDOOR\DQGVKRZVPDOOELUGV flying amid clouds. One piece also shows a full moon. LENGTH 4.1 cm each Condition: Good condition. Provenance: From a Hungarian private collection.

The first kozuka depicting a wayfarer with a walking cane in high relief looking up towards two birds flying in the sky. At the top there is bamboo growing. The reverse shows a long inscription in cursive and abbreviated sosho. The second kozuka depicts a man sweeping with a broom in takazogan relief. Above him the silver crescent moon. The third completely gilt kozuka shows three horses in motion, with different poses.

Estimate EUR 150,Starting price EUR 75,-

LENGTH c. 9.7 cm Condition: All in good condition. The first with minor areas of discoloration on the reverse, the second with minor wear and small nicks and the third with signs of wear and some scratches on the surface. Provenance: German private collection. Estimate EUR 300,Starting price EUR 150,-

26 |

TWO BRONZE MENUKI, EDO PERIOD

Unsigned Japan, Edo period (1615-1868)

%RWKSLHFHVGHSLFWIHURFLRXVO\URPSLQJ6KLVKL9HU\OLYHO\DQG densely crafted execution. The bronze is painted black while the eyes of the Shishi are gilt. In wooden box. LENGTH 3.2 to 3.4 cm Condition: Minor associated wear. Very good condition. Provenance: From a Hungarian private collection.

27 |

Estimate EUR 150,Starting price EUR 75,-

Unsigned Japan, Edo period (1615-1868)

TWO FUCHI-KASHIRA

The first very finely worked in shakudo depicting flowers with gold, silver and copper. The second of bronze with a stippled surface. LENGTH each 4 cm Condition: Very good with minor wear and oxidation to the bronze fuchi-kashira. Provenance: Austrian private estate. Estimate EUR 400,Starting price EUR 200,-

17


28 |

A MINO WAKIZASHI IN KOSHIRAE

Japan, c. late 16th to 17th century

The blade: Shinogi-zukuri and iori mune, the hamon is a finely pronounced gunome with a partial slight tendency towards sugi. The unsigned tang is ubu with one mekugi-ana, the tip is kurijiri, the yasurime is o-sujikai. The Japanese Toen-Sha expertise attributes this blade to a â&#x20AC;&#x2DC;successorâ&#x20AC;&#x2122; of Kanemoto.

The mounting: Oval-round tsuba with two hitsu and openwork, motifs showing lotus leaves. The fuchi in silver takazogan with some gilding shows a lively shishi, while the kashira shows a large blossom utilizing the VDPHWHFKQLTXH%RWKPHQXNLLQEODFNVKDNXGRZLWKVRPHJROGDOVR show shishi. The saya with lustrous black lacquer has an ishime structure. NAGASA 39.1 cm, total LENGTH 61 cm Condition: The blade in very good condition with minor wear and imperfections. The saya shows extensive wear. Provenance: From a Hungarian private collection; with certificate in Japanese from Toen-sha from 1976 issued by the president Murakami Kosuke. Estimate EUR 1.500,Starting price EUR 750,-

29 |

NORIMITSU: A WAKIZASHI WITH HORIMONO IN KOSHIRAE

%\1RULPLWVXVLJQHG:DVKXMX1RULPLWVXVDNX Japan, late Edo period (1615-1868)

The blade: Shinogi-zukuri and iori mune, with decorative horimono on both sides. The hamon is wide and mostly suguha with some notare. The horimono show a long-scaled dragon chasing a flaming pearl as a main motif, the rear side shows dragon claws amid clouds. The tang is ubu with one mekugi-ana. The signature reads Washu ju NORIMITSU saku.

The mounting: The tsuba with a Chinese sage in high relief admiring the gorgeous flowers on a porch. Partly gilt, the background pattern with nanakoji. Fuchi-kashira with finest nanakoji, the floral decorations in gold zogan. The kozuka handle shows party gilt clams on nanakoji ground. The black-lacquered saya with densely speckled particles of mother-of-pearl. NAGASA 51.7 cm, total LENGTH 73.7 cm Condition: The blade is in good condition with minor surface wear and corrosion below the dragon, as visible in the catalog illustration. The saya is in excellent condition with extremely minor wear. Provenance: From a Hungarian private collection. Estimate EUR 2.000,Starting price EUR 1.000,-

18


30 |

A SAMURAI ARMOR WITH KABUTO

Japan, Edo period (1615-1868)

A samurai armor including the helmet, or kabuto, lacquered in “rusted iron” tone with two-part red lacquered iron plates shikoro and gold lacquered maedate. The facemask with four lame yodarekake (throat guards) lacquered in gold. The shoulder pads sode are crafted of four strips connected by fabric bands. On the brown lacquered do (breastplate), which can be opened on the side, hangs the five lame kasazuri. The Safeguard hai-date with several arranged rectangular iron plates; the forearm and handguards all similarily arranged in kusari with iron plates, gilt iron bands and gusoki (chain mail). The thigh coverings and shin-guards are missing. With a wood box. HEIGHT c. 125 cm Condition: With signs of aging, tears to fabric, wear, cracks to lacquer, rust and material loss. Provenance: Hungarian private collection. Estimate EUR 4.000,Starting price EUR 2.000,-

31 |

AN IRON KABUTO (HELMET)

Japan, Edo period (1615-1868)

A black lacquered iron kabuto with three-part shikoro and leather mae-zashi. The Fukigaeshi shows the maru ni katabami crest symbol. HEIGHT c. 20 cm Condition: Worn condition, crackling and losses. Generally, very well preserved. Provenance: Hungarian private collection. Estimate EUR 2.000,Starting price EUR 1.000,-

32 |

SAMURAI ARMOR WITH KABUTO

Japan, Edo period (1615-1868)

A rare and impressive complete samurai armor including the helmet, kabuto, with open kiku shaped tehen no kanamono and four-part lacquered iron plates shikoro with sugake odoshi. The very impressive maedate front piece in the form of a ferocious mask with Kuwagata horns. The face-mask hanbo made of iron with three lame yodare-kake (throat guards). The chest protector is a do-maru, which can be opened on the side. The shoulder pads, sode, are crafted of six lacquer panels with sugake odoshi strings– the top piece is gilded. Mounted to the do are the kusazuri, in six parts, each made of 5 panels hung on long fabric bands. The kote arm and hand guards as well as the haidate thigh guards are made of colorful brocade with protective iron onsets. With an old wood storage box with large mon crests and a modern presentation stand. HEIGHT approx. 155 cm Condition: This set of armor is entirely complete. With signs of wear and use appropriate for its age, especially tears to fabric and cracks as well some material loss to lacquer or metalwork. Provenance: From a Hungarian private collection. Estimate EUR 5.000,Starting price EUR 2.500,19


34 |

A JINGASA WITH A GENTIAN EMBLEM

Unsigned Japan, late Edo period (1615-1868)

Of conical form. The interior is smooth with red lacquer, the wickerwork covered with black lacquer shows three decorative elements painted with gold lacquer on the exterior, with gentian blossoms and leaves. The gentian or rindo is an old aristocratic emblem, used among others by branches of the important Minamoto. DIAMETER 41.8 cm Condition: Chips and other damage, padding and bands in good condition. Provenance: From a Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

33 |

A KUSARI KATABIRA (CHAIN-MAIL JACKET)

Japan, Edo period (1615-1868)

2IVKRUWVOHHYHVDQGYHU\KHDY\bPDGHRIEOXHIDEULFZLWKVHZQ linked iron rings. SIZE c. 75 x 105 cm Condition: With signs of aging, tears to fabric, wear, rust and material loss. Provenance: Hungarian private collection. Estimate EUR 700,Starting price EUR 350,-

36 |

A JINGASA WITH TWO MON

Japan, late Edo (1615-1868) to Meiji period (1868-1912)

Lustrous roironuri on the exterior and red lacquer on the interior. Two mon are painted with gold lacquer on the exterior, the hexagonal one shows a crane, a symbol of long life and a popular emblem among the warrior class while the round one shows a stylized character Hayashi for â&#x20AC;&#x153;forestâ&#x20AC;?. DIAMETER 42 cm Condition: Age-related damages, including old padding. Provenance: From a Hungarian private collection.

35 |

A JINGASA WITH A RARE MON

Unsigned Japan, late Edo (1615-1868) to Meiji period (1868-1912)

Lustrous roironuri on the exterior and interior, the shape of the hat like the slight slope of a small hill. The mon painted in gold lacquer on the exterior shows three square frames or kaku â&#x20AC;&#x201C; rare for a mon but has long been in use. DIAMETER 42 cm Condition: Age-related damages, especially chips on the rim. Provenance: From a Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

20

Estimate EUR 300,Starting price EUR 150,-


38 |

A JINGASA WITH A MON

Unsigned Japan, late Edo period (1615-1868)

Of lightly conical form, black lacquer painted with gold and silver, showing three vines, each with a bird, as well as a lustrous heraldic mon on the front side showing three stylized geese within a wide circle. Several tsurugi blades at the point as a symbol of war but executed in the style of the Chinese ken. There is no padding on the red-lacquered interior and the bands are new. DIAMETER 40.5 cm Condition: Chips and other damage. Provenance: From a Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

37 |

A JINGASA WITH A MON

Unsigned Japan, late Edo period (1615-1868)

Of relatively small size, black on the exterior and with red lacquer on the interior, and rather flat shape. The gilt symbol on the exterior meaning igeta (puteal). Lacing on the interior. DIAMETER 34.7 cm Condition: Chips and other damage. Provenance: From a Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

40 |

A JINGASA WITH PHOENIXES

Unsigned Japan, Meiji period (1868-1912)

An interesting piece with a slightly more curved rim, but especially with its depiction of two ho-o (phoenixes), one male and the other female. There is no difference between them on the surface, both flying with beautiful tail feathers and symbolizing imperial power. These ho-o are not painted on the hat but executed in a lightly raised relief with lacquer and gilt. A silver mounting in the form of a chrysanthemum at the point of the hat, with an opening to insert possibly a bush or flowers. Red lacquer on the interior.

39 |

A JINGASA WITH A MON

Unsigned Japan, late Edo period (1615-1868)

Coated with black lacquer on the interior and exterior. The lightly gilt emblem interestingly shows a bolt of lightning, taken from ancient China, of martial significance and used by several aristocratic families as a mon during the Edo period. The padding and padded bands are one piece.

DIAMETER 39.3 cm Condition: The padding and bands are missing. The gilt is worn. Provenance: From a Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

DIAMETER 38 cm Condition: Age-related damage. Provenance: From a Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

21


41 |

A YASUYUKI STYLE CLOISONNĂ&#x2030; VASE

Japan, early Meiji period (1868-1912)

The vase with an appealing amphora shape and original bronze mountings. The central part is finely enameled with swallows and wisteria above a bright blue ground. The midnight blue, almost black neck with its various butterflies is highly reminiscent of some early works by the famous Namikawa Yasuyuki. The base shows spuming waves and water birds. HEIGHT 25 cm WEIGHT 575.9 grams Condition: The lip slightly warped and with very small, associated losses. Very few small, hardly visible hairlines here and there. Overall good, well-presentable, condition. Provenance: Austrian private collection. Estimate EUR 500,Starting price EUR 250,-

42 |

A LIDDED CLOISONNĂ&#x2030; VASE

Japan, Meiji period (1868-1912)

%DOXVWHUVKDSHGYDVHZLWKDVOLPERG\FLUFXODUEDVHDQGOLG7KH top section is decorated with scrolling vines and floral motifs in FLUFXODUUHVHUYHV%HORZDUHVKLHOGVKDSHGUHVHUYHVZLWKDOWHUQDWLQJ designs of stylized phoenixes and dragons. The rims with a brocade pattern, all against a beige-grey ground. The lid with the same scrolling vine dĂŠcor and a pink knob. HEIGHT 14 cm Condition: Good condition with two small hairlines around the mouth. Provenance: Austrian private collection. Estimate EUR 400,Starting price EUR 200,-

43 |

A FINE CLOISONNĂ&#x2030; ENAMEL VASE IN THE MANNER OF HAYASHI KODENJI

Japan, Meiji period (1868-1912)

The faceted vase shows a midnight blue ground and is decorated with silver wire and colored enamels to depict a tranquil scene of two sparrows perched on a branch beneath hanging wisteria and above a dense composition of flowers including morning glory, peonies and iris blossoms. Another sparrow is depicted in flight next to the wisteria. The mouth and base with a silver-applied rim. HEIGHT 25 cm Condition: Small imperfections and faults, minor fritting, minor surface scratches and minor surface wear. One larger area where the enamel has been damaged and sealed above the third sparrow in flight. Generally, in good condition. Provenance: Austrian private collection acquired at the local Viennese art market. Estimate EUR 500,Starting price EUR 250,-

22


44 |

A PAIR OF SMALL CLOISONNÉ VASES

Japan, Meiji period (1868-1912)

Each vase baluster-shaped and decorated with silver wire and colored enamels on a midnight blue ground and depicting a sparrow in flight amongst wisteria and iris blossoms. HEIGHT each 12 cm Condition: Miniscule surface wear. Very good condition. Provenance: Austrian private collection acquired at the local Viennese art market. Estimate EUR 400,Starting price EUR 200,-

45 |

A PAIR OF CLOISONNE ENAMEL VASES WITH BUTTERFLIES

Japan, Meiji period (1868-1912)

A pair of bulbous vases with a fine dark green ground and decorated in colored enamels with many butterflies. The underside shows gilding to the copper and the rim of the mouth is raised, thick and circular. HEIGHT each 16 cm Condition: Minor expected surface scratches. One of the vases with a damaged area near the neck next to several scratches. Otherwise good condition. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920. Estimate EUR 400,Starting price EUR 200,-

46 |

TWO CLOSONNÉ VASES

47 |

A PAIR OF SMALL CLOISONNÉ VASES

Japan, Meiji period (1868-1912)

Japan, Meiji period (1868-1912)

One cloisonné vase depicting a lady holding a flower in her hand, the other a crane.

%RWKYDVHVKDYHRYRLGVKDSHVDQGHYHUWHGOLSV7KHIORUDO composition on a deep black-blue background is rather free and very lively in a decorative way, showing tangled branches of the plum tree (ume) but also other blossoms and leaves, including lotus.

HEIGHT 12 cm each Condition: Overall in good condition, the vase with the lady with chipping and a few cracks. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920. Estimate EUR 300,Starting price EUR 150,-

HEIGHT 14.7 cm Condition: Good condition, the first with two tiny nicks, the second with a crack. Provenance: From an Austrian private collection, formerly collection Doblhoff. Estimate EUR 1.000,Starting price EUR 500,-

23


48 |

11-PART SIGNED SATSUMA TEA SET

Japan, Meiji period (1868-1912)

Signed Nikko and with the Shimazu crest on the underside. Masterful hand painting with polychrome enamels and gold. Depicted are blooming flower meadows and butterflies. The set consist of 4 cups and saucers, a lidded milk jug, a sugar box and a tea pot both also with their original lid. HEIGHT of the teapot 17 cm, DIAMETER of one saucer 12 cm and HEIGHT of one tea cup 4.5 cm Condition: Perfect condition with only minimal traces of age. Provenance: From an Austrian private collection. Estimate EUR 600,Starting price EUR 300,-

49 |

A LIDDED SATSUMA BOWL

Japan, Meiji period (1868-1912)

A three-legged lidded satsuma ceramic bowl elaborately painted with diverse flowers and birds. On the bottom the signature within a black square. DIAMETER 8 cm, HEIGHT 4.3 cm Condition: Some rubbing to the enamel, the lid with three chips. Provenance: Austrian private collection. Estimate EUR 200,Starting price EUR 100,-

50 |

VERY LARGE SATSUMA CHIKUSAI VASE

Japan, Meiji period (1868-1912)

Signed Satsuma Chikusai and with the Shimazu mon crest on the underside. Masterful hand painting in high relief polychrome enamels and gold. Depicted are various flowers such as peonies, chrysanthemum or mallows as well as misty golden clouds. HEIGHT approx. 46.5 cm WEIGHT 8.9 kilograms Condition: Perfect condition with only minimal traces of age. Provenance: From a German private collection, by repute in the same family since the early 1900s. Compare with a related vase of the same workshop and dating to the same period sold at Christieâ&#x20AC;&#x2122;s, Japanese Art and Design, London, South Kensington, 10 November 2010, lot 271. Estimate EUR 800,Starting price EUR 400,-

24


52 |

A SATSUMA CERAMIC VASE

Japan, Meiji period (1868-1912)

51 |

A SAKE STORAGE BOTTLE IN THE STYLE OF AOKI MOKUBEI, MEIJI OR LATER

Japan, Meiji period (1868-1912) or later

The globular bottle vase with a cylindrical neck and lipped rim, enameled and gilt with a group of Chinese immortal sages and karakos, including Taoist Immortal Kinko riding a giant carp, amid SLQHWUHHVÎ&#x2013;QVFULEHG.87$1Î&#x2013;02.8%(Î&#x2013;WRWKHEDVH

$EDOXVWHUVKDSHGYDVHGHFRUDWHGZLWKDQLPDJHRI%LMLQDQG boys arranged in a reserve. The base with artist signature. HEIGHT 22.5 cm Condition: Good condition. Provenance Swiss private collection. Estimate EUR 400,Starting price EUR 200,-

HEIGHT 27.3 cm Condition: Excellent condition with minor wear, intentional crackling. Provenance: From the collection of Georg Weifert (1850-1937). Thence by descent in the same family. Weifert was a Serbo$XVWULDQLQGXVWULDOLVWDQGWKHILUVWJRYHUQRURIWKH)HGHUDO%DQNRI the Kingdom of Serbia, Croatia and Slovenia. Estimate EUR 1.000,Starting price EUR 500,-

54 |

A JAPANESE NORITAKE PORCELAIN VASE

Japan, 20th century

The baluster-shaped vase with a hand painted landscape of trees and mountains, executed in various shades of greens, yellows DQGUHGV7KHXQGHUVLGHPDUNHG125Î&#x2013;7$.(%21(&+Î&#x2013;1$ NIPPON TOKI KAISHA. HEIGHT 29 cm

53 |

A JAPANESE PAINTED CERAMIC KUTANI VASE

Japan, Meiji period (1868-1912) to Taisho period (1912-1926)

Of ovoid shape and slightly everted lip, hand-painted to depict a scene of court nobles and calligraphy within reserves. The base with a Kutani mark.

Condition: Good condition. Provence: Swiss private collection. Estimate EUR 800,Starting price EUR 400,-

HEIGHT 17.5 cm Condition: Good condition. Provenance: Swiss private collection. Estimate EUR 500,Starting price EUR 250,-

25


56 |

A CERAMIC OKIMONO OF FUGEN BOSATSU

Japan, Meiji period (1868-1912)

55 |

FOUR JAPANESE PORCELAIN PLATES AND BOWLS

Japan, 19th/20th century

Smallest DIAMETER 19 cm, largest DIAMETER 27 cm Condition: All in good condition. Provenance: Old Austrian private collection acquired before 1930.

The deity depicted on top of an elephant, wearing flowing robes leaving the chest bare, jewels and holding a nyoi-scepter. HEIGHT 19 cm Condition: Multiple restorations, the fingers of one hand, a part of the hairband and the tips of both elephant horns missing. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 300,Starting price EUR 150,-

Estimate EUR 150,Starting price EUR 75,-

57 |

A GROUP OF SIX JAPANESE OBJECTS

Japan, Meiji period (1868-1912)

58 |

A GLAZED CERAMIC FIGURE OF DARUMA

Japan, Taisho period (1912-1926) to Showa era (1926-1989) Consisting of one small vase, one lacquered comb and tray, a set of two lacquer containers of decreasing size placed inside of each other and a cloisonné teapot.

Depicted is Daruma standing in a long robe and holding a basket RISHDFKHV%HDXWLIXOFRORUVRIWKHJOD]H

HEIGHT 9 – 14.5 cm HEIGHT 21 cm Condition: Overall good condition, the teapot and two containers with few chips and cracks; one container restored. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920.

Condition: Wear and firing imperfections, both hands with a restoration. Provenance: Croatian private collection.

Estimate EUR 200,Starting price EUR 100,-

Estimate EUR 200,Starting price EUR 100,-

26


59 |

A PORCELAIN KUTANI DOUBLE GOURD TOKKURI WITH POLYCHROME PAINTING

60 |

A FABRIC DOLL OF A GEISHA

Japan, Taisho period (1912-1926) to Showa era (1926-1989) Japan, 19th century, Edo period (1615-1868)

Waisted middle section and narrow, cylindrical neck. The wall decorated with geometrical ornaments, landscapes, as well as flower and tendril décor. The middle section contrasted with a meander border. Fuku mark. HEIGTH 16.5 cm Condition: Very good condition; the painting is minimal rubbed in places. Provenance: Old European collection. Estimate EUR 150,Starting price EUR 75,-

The Geisha wearing a brocade silk kimono, the hands and face SDLQWHGLQILQHODFTXHUΖQDPRGHUQVKRZFDVHb HEIGHT 27 cm Condition: Good condition with minor wear, the two thumbs missing, and a finger restored. Provenance: Austrian private collection. Estimate EUR 200,Starting price EUR 100,-

62 |

A HAGOITA PADDLE

Japan, c. 1900, Meiji period (1868-1912)

61 |

A CERAMIC VASE WITH PLAYING BOYS AND BATS

Japan, 19th century

$SDLQWHGZRRGbKDJRLWDbSDGGOHZLWKDWKUHHGLPHQVLRQDOFROODJHG woman in embroidered silk. Stamp and sticker on the backside. HEIGHT 47 cm

Well-formed vase with attractive smudged green glaze depicting two playing boys amongst bats. HEIGHT 21 cm Condition: Metal rim chipped, otherwise good condition. Provenance: Old Austrian private collection acquired before 1930.

Condition: Good age-related condition, a chip to the wood and minimal damage to the silk. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 300,Starting price EUR 150,-

Estimate EUR 150,Starting price EUR 75,-

27


63 |

FUJITA: A CHERRYWOOD AND IVORY PANEL OF KIKUJIDO

Signed Fujita Japan, Meiji period (1868-1912)

Finely inlaid with carved and incised ivory, root wood and motherRISHDUOWKLVSDQHOGHSLFWVWKH&KU\VDQWKHPXP%R\UHDGLQJDERRN while seated on the trunk of a gnarly plum tree, with a pair of flying suzume above and chrysanthemum flowers (kiku) at his feet. Artist signature FUJITA within an inlaid square seal. Note the fine patina and unctuous surface of the cherry (sakura) wood. SIZE 77 x 47 cm Condition: Excellent condition with some old wear, minor natural warping to some inlays and few traces of use. No losses to inlays! 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.200,Starting price EUR 600,-

64 |

A FINE WOVEN BAMBOO HYOTAN HANAKAGO

Japan, 20th century, Meiji period (1868-1912) or Showa era (1912-1926)

The hanakago (flower basket) made from woven bamboo in the form of a double-gourd (hyotan) and with an opening for the formal presentation of flowers (ikebana). The hanakago is mounted onto a burlwood stand giving it a unique appeal - the natural burlwood twisting and turning around the bamboo hyotan. HEIGHT 38 cm Condition: Very good condition. Miniscule losses and expected surface wear. Provenance: French private collection. Estimate EUR 600,Starting price EUR 300,-

65 |

FINE IVORY AND SHIBAYAMA GAME COUNTER

Japan, Meiji period (1868-1912)

7KHORYHO\ZRRGHQJDPHFRXQWHUILQHO\FRDWHGZLWKUÄ?LURQXUL Precisely painted depictions of flowers and leaves in hiramaki-e gold lacquer against a black background in the center. Ivory counters are decorated with mother of pearl and other natural stones inlays in charming forms of birds and insects. Pair of golden hiramaki-e flowers on the sides. HEIGHT 6 cm, LENGTH 9.5 cm Condition: Very good condition with some minor wear to the lacquer surface and some minor losses. Provenance: English private collection. Estimate EUR 150,Starting price EUR 75,-

28


66 |

MASAMITSU: A FINE SILVER FILIGREE AND SHIBAYAMA DISH

%\0DVDPLWVXVLJQHG0DVDPLWVX Japan, Meiji period (1868-1912)

The reverse shows four silver filigree feet and a central panel with dense nashiji and signature MASAMITSU â&#x20AC;&#x201C; a known Meiji artist who worked in Shibayama, lacquer and silver. DIAMETER 28.1 cm

Of foliate form and finely worked in openwork with silver filigree and inset with eight ivory petal-shaped panels decorated in gold takamaki-e and hiramaki-e with images of flowers and plants. The octagonal center with a gold lacquered kinji ground with Shibayama inlays showing a flower arrangement set on a red-lacquered table.

67 |

Condition: Excellent condition. Miniscule wear to lacquer. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 3.000,Starting price EUR 1.500,-

A FINE MINIATURE IVORY AND SHIBAYAMA DISPLAY CABINET

Japan, Meiji period (1868-1912)

Finely worked as a miniature display cabinet (shodana) ideal for the display of miniature objects such as netsuke. The cabinet stands on four flared feet and has two storage drawers carved with celestial dragons in high relief grasping a tama (which forms the knob), their eyes inlaid in mother of pearl. The mid-section allows for display space and one side is finely inlaid in Shibayama style with flowers and butterflies. The top section consists of two sliding doors and another door with a knob. The sides and top as well are decorated in Shibayama style with flowers, birds and butterflies. The inlays are horn and mother of pearl amongst fine incision work. SIZE 15.4 x 14.2 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.500,Starting price EUR 750,-

29


68 |

LENGTH of handle 25 cm, overall LENGTH 96 cm

MASAYUKI: A RARE IVORY AND SHIBAYAMA PARASOL

%\0DVD\XNLVLJQHG0DVD\XNL Japan, Meiji period (1868-1912)

The ivory handle finely inlaid in mother-of-pearl and tortoiseshell to depict wisteria amid other flowers, vines and leaves. The artist signature incised into a mother-of-pearl cartouche.

Condition: The handle in fine condition with only few tiny age cracks to ivory and a nice naturally grown patina. The pink silk parasol with traces of use an several large tears, hence in unusable condition (silk needs to be repaired or replaced). The expansion mechanism of the parasol is in fine working condition. The wrapper is original to the parasol and also comes in fine condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

70 |

A RARE JAPANESE STAG ANTLER â&#x20AC;&#x2DC;DRAGON AND TIGERâ&#x20AC;&#x2122; SCROLL CASE FOR A BUDDHIST SUTRA

Japan, late 19th century, Meiji period (1868-1912)

69 |

AN IVORY CIGAR HOLDER

Japan, Meiji period (1868-1912)

Fine incision work depicting a peacock standing amid bamboo on a craggy rock. Superb natural patina!

30

Finely carved stag antler in high relief with roller ends made of dark horn. The case is made in the form of a scroll, openable in the middle. Depicted is a celestial dragon, finely carved amidst clouds, the scales and ILHUFHH[SUHVVLRQSDUWLFXODUO\GHWDLOHG%HORZ the dragon is a tiger snarling at the dragon, naturalistically carved with sprays of waves around him. The antler has been carved with great skill, somewhat simulating ivory. LENGTH 16 cm

LENGTH 11 cm

Condition: Very good condition, one tiny age crack, a minor imperfection around the edge of the opening and a tiny chip on the edge. Provenance: Old Austrian private collection.

Condition: Perfect. Provenance: Austrian private collection.

Tiger and dragon represent the earth and VN\DQGSURWHFWWKH%XGGKLVWWHDFKLQJVWKDW would be stored inside this scroll.

Estimate EUR 200,Starting price EUR 100,-

Estimate EUR 600,Starting price EUR 300,-


71 |

AN IVORY BIWA LUTE BOX

Japan, Meiji period (1868-1912)

The instrument is finely carved of two pieces forming the base and the lid. The strings and some elements of dĂŠcor are inlaid in silver and neatly incised with swastika and other emblems. The ivory has patinated nicely to a golden-yellow tone. LENGTH 13.5 cm Condition: Superb condition with minor wear and one silver string slightly loose. Provenance: From an English private estate. Estimate EUR 600,Starting price EUR 300,-

72 |

A CARVED IVORY SEVEN MICE BOWL

Japan, 19th century

The sides of this lovely miniature bowl are neatly carved in high relief and with fine incision work to depict a group of seven mice dancing around a Daikoku hammer. Their eyes are finely inlaid in black horn LENGTH 4.5 cm Condition: Good condition. Some natural age cracks. Two of the inlaid eyes have been replaced with black staining. Provenance: Austrian private collection. Estimate EUR 600,Starting price EUR 300,-

73 |

AN IVORY WALKING CANE HANDLE

Japan, Meiji period (1868-1912)

An ivory walking cane handle carved depicting a group of rats, all eyes inlaid. WIDTH of handle c. 13 cm Condition: Overall good condition. Provenance: From the collection of Alexander Popov in Novi Sad, Kingdom of Serbia, acquired between 1900-1920. Estimate EUR 200,Starting price EUR 100,-

74 |

FINE IVORY CIGARETTE CASE WITH DRAGON

Japan, Meiji period (1868-1912)

A rectangular cigarette case with rounded edges, hinged lid and two metal mountings to the sides. Fine carving depicting ferocious coiled dragons amongst swirling clouds. HEIGHT 7 cm, LENGTH 10 cm Condition: Good condition with some wear and traces of use like staining and natural age cracks to the sides and back. Nice, old patina. Small traces of an old restoration. Provenance: Old Zagreb private collection. Estimate EUR 300,Starting price EUR 150,-

31


75 |

AN IVORY AND SHIBAYAMA OKIMONO OF A THICK GOURD

76 |

A RARE IVORY AND SHIBAYAMA EROTIC OKIMONO

Japan, Meiji period (1868-1912)

Japan, Meiji period (1868-1912)

An ivory okimono in the shape of a thick gourd with a short naturalistically textured stem, while the ivory is smooth and polished to a high luster. Most finely and precisely inlaid in Shibayama with nine different insects, executed in mother-ofpearl, horn, lacquer and coral. Artist signature in red color.

An ivory okimono in the shape of a gourd with a long stem, however resembling a female body with supple breasts and buttocks and revealed female genitalia. The body is adorned with insects inlaid in Shibayama style with inlays of mother-of-pearl, horn, lacquer and coral. Artist signature in red color.

HEIGHT 10.1 cm

HEIGHT 10.1 cm

Condition: Very good condition with age cracks. Provenance: German private collection.

Condition: Very good condition with age cracks. Provenance: German private collection.

Estimate EUR 1.500,Starting price EUR 750,-

Estimate EUR 1.800,Starting price EUR 900,-

77 |

78 |

A SHIBAYAMA INLAID IVORY OKIMONO OF A GOURD

A SHIBAYAMA INLAID IVORY OKIMONO OF A PEAR

Japan, Meiji period (1868-1912)

Japan, Meiji period (1868-1912)

A naturalistically carved gourd inlaid in shibayama style with eleven various insects and signed.

A naturalistically carved pear (nashiji) inlaid in shibayama style with eight various insects and signed.

HEIGHT 6 cm

HEIGHT 8 cm

Condition: Very good condition with few expected age cracks. Provenance: German private collection.

Condition: Very good condition. Provenance: German private collection.

Estimate EUR 1.500,Starting price EUR 750,-

Estimate EUR 1.500,Starting price EUR 750,-

32


79 |

A FINE IVORY AND SHIBAYAMA OKIMONO OF A PEAR

80 |

AN UNUSUAL IVORY AND SHIBAYAMA EROTIC OKIMONO OF A POD

Japan, Meiji period (1868-1912)

Japan, Meiji period (1868-1912)

The carving in the shape of a pear with a long, naturalistically textured stem, while the ivory is smooth and polished to a high luster. Most finely and precisely inlaid in shibayama with nine different insects, executed in mother-of-pearl, horn, lacquer and coral. Artist signature in red color.

An ivory okimono in the shape of a pod opening in the front to reveal the seeds, subtly resembling female genitalia. The surface of the finely polished ivory is adorned with insects inlaid in Shibayama style with inlays of mother-of-pearl, horn, lacquer and coral. Artist signature in red color.

HEIGHT 8.6 cm

HEIGHT 10.1 cm

Condition: Very good condition with age cracks. Provenance: German private collection.

Condition: Very good condition with age cracks. Provenance: German private collection.

Estimate EUR 1.500,Starting price EUR 750,-

Estimate EUR 1.500,Starting price EUR 750,-

81 |

82 |

AN IVORY CARVING WITH SHIBAYAMA INLAID INSECTS

A SHIBAYAMA INLAID IVORY OKIMONO OF A FRUIT

Japan, Meiji period (1868-1912)

Japan, Meiji period (1868-1912)

The pear-form carving with a long, naturalistically textured stem, while the ivory is smooth and polished to a high luster. Most finely and precisely inlaid in Shibayama with nine different insects, executed in mother-of-pearl, horn, lacquer and coral. Artist signature in red color.

A naturalistically carved fruit partially peeled to reveal its pods, inlaid in shibayama style with thirteen various insects and signed. LENGTH 10.5 cm

HEIGHT 8.6 cm

Condition: Very good condition with few expected age cracks. Provenance: German private collection.

Condition: Very good condition. Provenance: German private collection.

Estimate EUR 1.500,Starting price EUR 750,-

Estimate EUR 1.500,Starting price EUR 750,-

33


83 |

A SHIBAYAMA STYLE INLAID IVORY GLOVE STRETCHER

84 |

A SHIBAYAMA STYLE INLAID IVORY TOOTHPICK CASE

Japan, Meiji period (1868-1912)

Japan, Meiji period (1868-1912)

The glove stretchers inlaid in shibayama style with horn, precious stones and mother of pearl depicting beetles. With inscribed initials ‘SH’.

The toothpick case inlaid in shibayama style with horn and precious stones, depicting beetles on the lid. LENGTH 9 cm

LENGTH 21.5 cm Condition: Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

86 |

AN IVORY OKIMONO OF A CAT AND RAT

Unsigned Japan, late 19th century, Meiji period (1868-1912)

An ivory okimono of a housecat, wearing a bell-collar, holding down a rat and preparing to strike it. The rat is struggling and screeching with opened mouth and visible teeth. Its tail curls up around to the cat’s side and it is pulling on its fur. The cat has a playful and confident expression and its body is slightly contorted as it lifts one paw up high, ready to attack. The paws are carved especially well and naturalistic. The eyes of the cat and rat are inlaid with reddish and black horn, respectively. HEIGHT 5.5 cm, LENGTH 9.5 cm Condition: Very good condition, minor discoloration in some areas of the ivory. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

85 |

A SMALL IVORY OKIMONO OF AN OLD TREE TRUNK

Japan, Meiji period (1868-1912)

HEIGHT 8 cm Condition: Expected age cracks, the top plate restored and with missing parts. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 200,Starting price EUR 100,-

34


87 |

AN AMUSING AND EXCELLENT IVORY OKIMONO OF A KAPPA WITH CUCUMBER BY MUNEHARU

%\0XQHKDUXVLJQHG0XQHKDUX Japan, late 19th century, Meiji period (1868-1912)

A very well detailed and amusing okimono depicting a kappa pulling a huge cucumber, the favourite food of the kappa, with a rope. The aquatic creature has its head tilted to the left with squinting eyes, inlaid in dark horn, and is exclaiming as the large cucumber is probably very heavy. The rope is carved very precisely and ties around the cucumber several times. The cucumber is also carved realistically with the spiny surface stippled and the characteristic â&#x20AC;&#x2DC;dotsâ&#x20AC;&#x2122; inlaid in horn. The signature MUNEHARU is found in a rounded reserve under the cucumber. HEIGHT 5 cm, LENGTH 9.5 cm Condition: Very good condition with no restorations, only the tip of the cucumber branch has a small chip. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

88 |

AN IVORY OKIMONO OF A CORNCOB

Unsigned Japan, Meiji period (1868-1912)

Finely and naturalistically carved as a corncob, its skin partially peeled revealing the individual kernels. The leaves in the back finely incised and flowing towards the frontside. LENGTH 14 cm Condition: Expected age cracks, imperfections, minor wear. Very good condition. Provenance: French private collection. Estimate EUR 300,Starting price EUR 150,-

90 |

AN IVORY OKIMONO OF A RECUMBENT OX BY GOYOSAI

%\*R\RVDLVLJQHG*R\RVDL Japan, late 19th to early 20th century, Meiji period (1868-1912)

An unusual ivory okimono depicting a jolly ox, the eyes double inlaid in reddish and dark horn. The ox has its head slightly lifted and tilted to the left with a very curious expression and a wide smile showing both rows of his teeth and the tongue. The details are well-carved â&#x20AC;&#x201C; such as the rope halter through the nose, the bulky horns and the saddle cloth which shows an incised zig-zag pattern. The underside is equally accomplished with the expressive skin-fold of the neck and tucked-in legs, as well as the unusually large, smooth and round genitals. The signature is in a wavy reserve reads GOYOSAI. LENGTH 11.2 cm Condition: Several age cracks and the stained ivory is worn in some areas â&#x20AC;&#x201C; generally in good and complete condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

89 |

AN IVORY OKIMONO OF A PEELING BANANA WITH SILVER MOUNT

Japan, Meiji period (1868-1912)

The banana peeling from two separate sections to reveal the fruit. Silver mount at the end for suspension. LENGTH 10.5 cm Condition: Good condition; age cracks. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

35


91 |

RYUKO: A LARGE AND SPECTACULAR TOKYO SCHOOL IVORY OKIMONO OF A SLEEPING BIJIN

%\5\XNRVLJQHG5\XNR Japan, Tokyo, Meiji period (1868-1912)

A large and impressive okimono depicting a serenely sleeping bijin (beauty), her head rested on a basket. The girl has fallen asleep after a harvest and she is in a deep slumber. The artist has mastered both her exhaustion and beauty impeccably â&#x20AC;&#x201C; a delicate balance of subtle nuances. Her wrist bends over the edge of the basket, her mouth is slightly opened, and her expression is sunken. Her facial features are crafted sensitively, showing her sublime

92 |

beauty, and one wonders what she might be dreaming. The garment folds are carved incredibly well, almost coming to life. Her hair is incised precisely and tied up at the back. One striking detail is the sandals she is wearing, one of them gently coming off her extended foot. The shape of the okimono is elegant, further underlining her beauty. An exceptional masterpiece from the Tokyo school. The base with two floral mon and the signature in sosho RYUKO. LENGTH 18.6 cm Condition: Excellent condition, expected minor age cracks. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 3.500,Starting price EUR 1.750,-

TOMOKAZU: A LARGE MUSEUM QUALITY IVORY OKIMONO OF AN EAGLE WITH TWO FOXES HEIGHT 11 cm, LENGTH c. 17 cm

%\2NDGD7VXQHNLFKL 7RPRND]X VLJQHG7RPRND]X Japan, Tokyo, Meiji period (1868-1912)

A dynamic and powerful scene of a large eagle grappling a fox between its talons, the wild beast letting out an agonizing scream, as the eagle looks determined to one side, with large inlaid eyes of mother of pearl. Another smaller fox is escaping, its body shape dynamically captured, as it scurries away, turning around to bite the eagle in its tail. The carving is incredibly detailed all around with masterfully carved plumage and fur. The talons and beak of the eagle are quite terrifying and carved with fabulous realism. The eyes of both foxes are inlaid in shimmering mother of pearl. The surface of the ivory has developed an appealing yellowish patina over time. Signed in typical style of the artist in high relief TOMOKAZU with seal.

36

Condition: Two paws of the smaller fox are reattached. Otherwise excellent condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Okada Tsunekichi, who used the art name Tomokazu, was a gifted carver of okimono who participated in and received several prizes at the carving competitions organised by the Tokyo Chokokai (The Tokyo Carverâ&#x20AC;&#x2122;s Association). Auction comparison: For a similar okimono attributed to Okada 7RPRND]XDQGRIVPDOOHUVL]HVHH%RQKDPV)LQH-DSDQHVH$UW November 2017, London, lot 167. Estimate EUR 4.000,Starting price EUR 2.000,-


93 |

A MASTERFUL AND MONUMENTAL SECTIONAL IVORY OKIMONO OF A COCKATOO

Japan, Meiji period (1868-1912)

The feathery bird is perched on a black burlwood stand, its talons tightly gripping a branch. The bird is crafted with superior naturalism, the plumage is masterfully carved and threedimensional with neatly incised lines. The cockatoo has its head slightly lowered and the large eyes are lacquered in black with inlaid silver rings for the pupils. The defining attributes of this exotic bird are the long tail feathers and the crest on the back of its head. HEIGHT 62 cm with stand, 29 cm without stand Condition: Very good complete and original condition. Minor wear and natural age cracks and very minor losses and chipping to the edge of some feathers. 3URYHQDQFH%ULWLVKFROOHFWLRQ The cockatoo is not native to Japan and was probably introduced by the Dutch. It became a popular theme in Japanese art, perhaps most famously treated by the woodblock print artist Ohara Shoson (1877-1945). This monumental sculpture was probably intended for a Japanese World Fair during the Meiji period. Auction comparison: Compare to a near identical example sold at %RQKDPV$VLDQ$UW-XO\(GLQEXUJKORW Estimate EUR 18.000,Starting price EUR 9.000,-

94 |

A MONUMENTAL AND RARE STATUE OF A WHITE GYRFALCON

Japan, Meiji period (1868-1912)

The majestic Falco Rusticolus is departing from a T-shaped landing pole, which itself rests on a mahogany stand with four feet. The bird of prey is carved from wood and embellished overall with neatly incised ivory feathers. The eyes are inlaid in dark horn and mother-of-pearl. The landing pole is entirely covered with ivory segments, all carved to imitate the natural wood grain. HEIGHT 77 cm Condition: Excellent and fully original condition with some old wear, minor natural warping to some inlays and few traces of use. Very minor losses to inlays and some age cracks. Small repair where the pole connects to the stand. 3URYHQDQFH%ULWLVKFROOHFWLRQ The gyrfalcon is a bird of prey and the largest of the falcon species. It breeds in Japan and is a resident there also, but some gyrfalcons disperse more widely after the breeding season, or in winter. Individual vagrancy can take birds for very long distances. Its plumage varies with location, with birds being colored from all-white, like the present one, to dark brown. These color variations are called morphs. Like other falcons, it shows sexual dimorphism, with the female much larger than the male. For centuries, the gyrfalcon has been valued as a hunting bird in Japan. Typical prey includes the ptarmigan and waterfowl, which it may take in flight. It also takes fish and mammals. Estimate EUR 15.000,Starting price EUR 7.500,-

37


96 |

TOSHIMUNE: A FINE IVORY OKIMONO OF A RESTING MAN

%\7RVKLPXQHVLJQHG7RVKLPXQHDQGNDNLKDQ Japan, Meiji period (1868-1912)

95 |

KOZAN: AN IVORY OKIMONO

%\.R]DQVLJQHG.R]DQ Japan, Meiji period (1868-1912)

The okimono consisting of three parts and depicting a resting man holding a parasol and lying on a bed. His robe is finely decorated, and his expression is very well crafted. In front of him is a smoking and tea set. Signed in a mother of pearl plaque TOSHIMUNE with kakihan on the underside of the man. Entire composition HEIGHT 9.5 cm, LENGTH 10.3 cm

Finely carved depiction of father and son standing behind two buckets with fish. Good natural patina. Two-character artist signature KOZAN engraved to base. HEIGHT 10.5 cm

Condition: The handle of the parasol has been reattached. Otherwise excellent original condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ7RVKLPXQHZDVDILQHRNLPRQR maker. His name is recorded in the Tokyo Sculptorsâ&#x20AC;&#x2122; Society from 1904 to 1910.

Condition: Fine condition with small loss to brush in fatherâ&#x20AC;&#x2122;s hand and some tiny age cracks. Provenance: From an English private estate.

Auction comparison: Compare to another okimono by the artist LQVLPLODUVW\OHVROGE\%RQKDPV$VLDQ:RUNVRI$UW$XJXVW 2011, San Francisco, lot 6465.

Estimate EUR 300,Starting price EUR 150,-

Estimate EUR 800,Starting price EUR 400,-

97 |

98 |

A MONKEY AND CRAB IVORY OKIMONO

Japan, Meiji period (1868-1912)

Humorous and detailed carving of a monkey crying out in pain as he is unexpectedly tweaked by two crabs, while trying to grab a large lotus plant. The okimono references the legendary battle between the monkey and crab. Note the finely inlaid eyes of the monkey.

SADAMASA: AN IVORY OKIMONO OF AN ARCHER

%\6DGDPDVDVLJQHG6DGDPDVD Japan, late 19th century, Meiji period (1868-1912)

A small and expressive carving with fine incision work. Depiction of an archer preparing a set of arrows. His work is almost completed as he is sharpening the last arrow from a group of 36. Note the focused expression on his face. Signature SADAMASA to the base.

LENGTH 6 cm HEIGHT 5 cm Condition: Superb condition with only minor wear and minimal age cracks. Good natural patina. Provenance: From an English private estate.

Condition: Perfect condition. The ivory with a good natural patina. Provenance: From an English private estate.

Estimate EUR 400,Starting price EUR 200,-

Estimate EUR 400,Starting price EUR 200,-

38


99 |

SEIDO: IVORY OKIMONO OF A RAT CATCHER WITH BIJIN

%\6HLGRVLJQHG6HLGR Japan, Meiji period (1868-1912)

Highly detailed carving enhanced by fine incision work. Depiction of a rat catcher holding a cage while the rat, subject of the hunt, is escaping across his shoulder. A noble lady, probably the client, is watching in despair. Artist signature SEIDO to base. HEIGHT 7.5 cm Condition: Good condition with only minor wear and one small loss. Fine natural patina. Provenance: From an English private estate. Estimate EUR 800,Starting price EUR 400,-

100 | GYOKUDO: AN IVORY OKIMONO OF A FAMER WITH BOY %\*\RNXGRVLJQHG*\RNXGR Japan, late 19th century, Meiji period (1868-1912)

An ivory okimono of a farmer holding a bundle of flowers over his shoulder and standing next to a boy who is holding another bundle and has his hand stretched out to receive a flower from his father. The two figures are separately carved and inset into the base. The signature GYOKUDO is found on the underside. HEIGHT 14.5 cm Condition: Excellent condition with minor natural imperfections. Provenance: Austrian private collection. Auction comparison: Compare to another okimono by the DUWLVWVROGDW%RQKDPV$VLDQ$UWLQFOXGLQJSRUFHODLQIURP7KH Fiorentini Collection, 2 July 2014, Edinburgh, lot 19. Estimate EUR 700,Starting price EUR 350,-

101 | MASAKAZU: A LARGE IVORY OKIMONO OF KANNON AND DRAGON %\0DVDND]XVLJQHG0DVDND]X Japan, second half of the 19th century, Meiji period (1868-1912)

Finely carved of several pieces of ivory, the goddess stands on a lotus base, holds a lotus flower and wears long flowing robes surrounded by heavenly bands. Her face bears a benevolent expression with downcast eyes. Note the elaborately carved jewelry on her breast, skirt and ears, the inlays to the jewelry and eyes of the dragon and the small Arhat figure on top of her head. The artist signature MASAKAZU is found on a tsuishu lacquer cartouche neatly inlaid to the base. Matching wood base. HEIGHT 35 cm (excluding base) and 39.5 cm (the ensemble) Condition: Excellent condition with some wear and minor age cracks. Provenance: English private collection. Estimate EUR 1.000,Starting price EUR 500,-

39


102 | AN IVORY NETSUKE OF A RAT ON A LARGE CHESTNUT Unsigned Japan, probably Kyoto, early 19th century, Edo period (1615-1868)

An ideally shaped ivory netsuke of a rat lying on top of an overexaggeratedly large chestnut. The ribbed texture of the chestnut is well pronounced, as is the top section with its stippled surface. The rat’s eyes are inlaid in black horn, himotoshi in the reverse and the ivory with a very good honey patina. HEIGHT 2.5 cm, LENGTH 4.6 cm Condition: Very good condition, with expected age cracks. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

103 | TWO WOOD NETSUKE OF A CAT AND A RAT The second signed Japan, 19th century

The first depicting a resting cat with a collar and the second a rat on a beanpod, signed. LENGTH 4 cm Condition: The second with chipped ears, otherwise good worn condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

104 | A WOOD NETSUKE OF A RAT WITH CHESTNUT Unsigned Japan, 19th century, Edo period (1615-1868)

A charming study of a rat (nezumi) holding a large chestnut. The rat has full chubby cheeks, large eyes inlaid in horn and the ears are in an alert position. The fur is neatly incised and the thick, finely carved tail curls around over the rodent’s back. The underside with himotoshi through the chestnut. HEIGHT 3.2 cm, LENGTH 4 cm Condition: One plus-shaped crack to the side of the rat. Otherwise very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

40


105 | TWO IVORY NETSUKE OF TWO PIEBALD RATS AND TWO PUPPIES Unsigned Japan, late 18th and 19th century, Edo period (1615-1868)

The rats very much in the style of Ikko. HEIGHT 2.3 and 3 cm Condition: The puppies in good condition with expected age cracks. The rats with missing end of the tails and a small chip to one ear. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

106 | TWO WOOD NETSUKE OF A RAT AND A DOG Unsigned Japan, 19th century

LENGTH 3.5 - 4 cm Condition: Few surface scratches, the rat with a tiny chip to the eye and the dog with a larger chip. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

107 | AN IVORY NETSUKE OF A RECUMBENT OX SIGNED TOMOTADA Signed Tomotada Japan, Kyoto, late 18th to early 19th century, Edo period (1615-1868)

HEIGHT 2 cm Condition: With surface scratches, otherwise good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

108 | TWO IVORY NETSUKE Unsigned Japan, 19th century, Edo period (1615-1868)

The first of an immortal with a large gourd next to a horse on a base, the second of a boy with ox on a base. HEIGHT 3.3 and 2.8 cm Condition: The second with a section of the rope attached to the ox lost. Otherwise good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

41


109 | TOMOTADA: AN IVORY NETSUKE OF A RECUMBENT COW AND CALF Signed Tomotada Japan, Kyoto, late 18th to early 19th century, Edo period (1615-1868)

An ivory netsuke of a recumbent cow with her head tilted to the right and her sensitively carved young nestling up to her. The rope halter which attaches to the nose ring passes over the back. Her pupils are inlaid, and the muscular body is expressed very well. Finely carved hooves and large himotoshi through the underside above the signature TOMOTADA in a rectangular reserve. LENGTH 5.7 cm 3URYHQDQFH%ULWLVKFROOHFWLRQ Condition: The ivory slightly worn with a good patina on the underside. Good condition. Estimate EUR 1.000,Starting price EUR 500,-

110 | AN IVORY NETSUKE OF AN OX WITH BOKUDO Unsigned Japan, early 19th century, Edo period (1615-1868)

A finely carved ivory netsuke set on an irregular base with a singular himotoshi. The bokudo (ox herder), with inlaid tufts of hair, is gleefully playing on his flute while the ox (ushi) is turning around towards him and listening to the tune. The thin legs of the ox are carved extraordinarily well. Finely carved fur, worn in some areas, with spots of fine honey patina shining through. HEIGHT 3 cm Condition: A section of the rope halter and the inlaid eye on the less visible side of the face of the ox is lost. Otherwise good condition with excellent patina. Some remnants of red paint on the underside. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

111 | KOJIMA TOSHINAGA (JUEI): AN EXQUISITE IVORY NETSUKE OF BOKUDO WITH OX AND WOMAN %\.RMLPD7RVKLQDJD -XHL VLJQHG.RMLPD7RVKLQDJD Japan, early 19th century, Edo period (1615-1868)

The group set on a base with singular himotoshi, the bokudo is gleefully playing on his flute while riding an ox, beside them a woman holds the reigns. The elaborate details are carved extraordinarily well with spots of fine honey patina shining through. HEIGHT 4 cm Condition: Very good condition. 3URYHQDQFH3ULYDWH-DSDQHVHFROOHFWLRQRI0UV%DFTXLUHGDW$GHU Picard Tajan auction of March 1973 lot 277. Estimate EUR 700,Starting price EUR 350,-

42


112 | AN EARLY IVORY NETSUKE OF AN OX HERDER Unsigned Japan, mid-18th century, Edo period (1615-1868)

An ivory netsuke of an ox herder seated on a recumbent ox, one hand placed on his lap and the other placed on his head pensively. The sickle is visible on the back and is attached to the herderâ&#x20AC;&#x2122;s obi (belt). The ivory shows considerable wear and a beautiful warm patina and is set on a base, as is usual for this type of early netsuke, with very large and well-hollowed out himotoshi. HEIGHT 4.2 cm Condition: Good condition â&#x20AC;&#x201C; expected age cracks and wear. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

113 | TWO IVORY NETSUKE Unsigned Japan, 18th- early 19th century, Edo period (1615-1868)

This lot consists of two unsigned ivory netsuke. One GHSLFWLQJ%RNXGRZLWKDQR[ and the other Karako leaning RQ+RWHLČ&#x2021;VEDJ%RWKVKRZD fine patina. HEIGHT 3.2 â&#x20AC;&#x201C; 3.4 cm Condition: The karako in worn condition with a deep patina. Chipping to one horn and one ear of the ox. Deep and worn patina on the back of the ox. Signs of age with a few age cracks and surface scratches. Provenance: Old Zagreb private collection. Estimate EUR 1.000,Starting price EUR 500,-

114 | MASASHIGE: A WOOD NETSUKE OF AN OX HERDER %\0DVDKLJHVLJQHG0DVDKLJH Japan, Ise-Yamada, 19th century, Edo period (1615-1868)

The ushidoji (ox-boy) playing his flute is seated next to an ox. The content facial features are very finely carved, while the oxâ&#x20AC;&#x2122; fur pattern is very precise. The ox also has a nose ring with a rope attached to it. Himotoshi on the underside between the delicately executed ox legs and signed MASASHIGE on one of the hind legs. WIDTH 4.1 cm Condition: Good, complete condition; one tiny dent to the side of the face of the boy. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

43


115 | A WOOD NETSUKE OF A TIGER Unsigned Japan, early 19th century, Edo period (1615-1868)

Though a quite simple netsuke, the tiger comes across incredibly powerful. The eyes are enigmatically inlaid in pale translucent horn and the tiger opens its mouth, baring its teeth, as if it was about to let out a menacing growl. The hairwork is sparsely incised and the tail is curling up the side of the tiger. The wood has a very good color and a fine patina, showing wear in all the right places. Natural himotoshi between the legs. HEIGHT 3.8 cm Condition: Fine and very good condition, excellent patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

116 | AN IVORY NETSUKE OF A RABBIT Unsigned Japan, 20th century, Meiji period (1868-1912)

An almost white ivory seated rabbit with its head looking down and with long ears attached to its body. One of the paws is raised to the mouth as it cleans itself and both eyes are inlaid in black. HEIGHT 3.9 cm Condition: Good worn condition with expected age cracks. Provenance: European private collection. Estimate EUR 400,Starting price EUR 200,-

117 | A RARE WOOD NETSUKE OF CHINNAN SENNIN Unsigned Japan, 19th century, Edo period (1615-1868)

Chinnan Sennin is depicted seated holding his vessel, which he used to conjure the dragon lying next to him, up high. He has a grim facial expression while the dragon has a somewhat mischievous one. The dragon was up to no good and Chinnan is fed up and calling him back into his vessel. Dark patina of the wood and small himotoshi on the underside. HEIGHT 2.9 cm, LENGTH 4.2 cm Condition: Very good condition. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

118 | A FINE IVORY HANDLE FINIAL OF A TIGER Unsigned Japan, 19th century

%HDXWLIXOO\DQGFRPSDFWO\FDUYHGWRGHSLFWDWLJHULWVKHDGWLOWHG backwards, and the eyes inlaid in lustrous black horn. The tiger is seated on a rock with finely carved bamboo leaves draping over his back. This filial was likely the end of a parasol handle or cane. HEIGHT 4.8 cm Condition: Age cracks, otherwise in good condition. Provenance: French private collection. Estimate EUR 600,Starting price EUR 300,-

44


119 | TWO WOOD NETSUKE OF A HORSE AND A DOG WITH BALL The first signed Japan, 19th century

HEIGHT 3.4 - 4 cm Condition: Good condition with fine patina, the dog with few surface scratches to the base. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 500,Starting price EUR 250,-

120 | MUNEMITSU: AN IVORY NETSUKE OF A HORSE ON A HORSESHOE Signed Munemitsu Japan, 20th century, Meiji period (1868-1912)

The ivory is smooth and shows a good patina, the horse is lying on a horseshoe base and the hair and bushy tail are finely carved. The underside with himotoshi and signature MUNEMITSU. LENGTH 4.5 cm Condition: Good worn condition. Provenance: European private collection. Estimate EUR 400,Starting price EUR 200,-

121 | NOBUKAZU: AN IVORY NETSUKE OF A SNAKE WITH FROG, SANSUKUMI

122 | AN IVORY NETSUKE OF A RABBIT & MONKEY WRESTLING

%\1REXND]XVLJQHG1REXND]X Japan, 19th century, Edo period (1615-1868)

Unsigned Japan, 20th century, Meiji period (1868-1912)

Amusingly carved as a coiled snake with a comical expression. A little frog is seated in an opening of the winding body of the snake, which is about to close and crush the poor amphibian. Natural himotoshi which allow the netsuke to perfectly hang on the obi, so that both the frog and the looming snake are visible. 6LJQHG12%8.$=8LQDVOLJKWO\IDGHGUHVHUYH

Humorous carving of the two companions of the golden boy Kintaro, the rabbit and monkey shown engaged in a wrestling match. The rabbitâ&#x20AC;&#x2122;s eyes inlaid in red and the monkeyâ&#x20AC;&#x2122;s painted in black. Note the neatly incised detail of the monkeyâ&#x20AC;&#x2122;s fur.

HEIGHT 4.1 cm

Condition: Good condition with few expected age cracks. Provenance: European private collection.

Condition: The ivory slightly worn. Good condition. Provenance: Hungarian collection.

HEIGHT 4.3 cm

Estimate EUR 900,Starting price EUR 450,-

Estimate EUR 1.000,Starting price EUR 500,-

45


123 | A FINE IVORY NETSUKE OF A RECUMBENT GOAT IN THE MANNER OF YOSHINAGA

124 | A FINE WOOD NETSUKE OF A MONKEY EMERGING FROM A CHESTNUT

Unsigned Japan, Kyoto, 19th century, Edo period (1615-1868)

Unsigned Japan, 19th century, Edo period (1615-1868)

Expressively carved as a recumbent goat with large horns and shaggy fur, parted in the middle and draping down the sides, all finely carved. The goat has a charming expression with inlaid pupils and a flowing trifurcated beard which touches the front legs. Large asymmetrical himotoshi through the underside. The carving is very much in the manner of Yoshinaga of Kyoto (see auction comparison).

Finely carved, the wood attractively stained, and depicting a monkey emerging from a chestnut. The monkeyâ&#x20AC;&#x2122;s pupils inlaid in bone. Good asymmetrical himotoshi through the under- and backside.

HEIGHT 3 cm, LENGTH 5.5 cm

HEIGHT 3.6 cm Condition: Good, worn condition. The monkeyâ&#x20AC;&#x2122;s arm with some surface wear and minor chipping. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: Good, worn condition with some discoloration to the fur. One inlaid pupil is replaced. Expected, minor age cracks. Provenance: European collection.

Auction comparison: An almost identical netsuke sold at Lempertz, Asiatische Kunst, 7 December 2018, Cologne, lot 342.

Auction comparison: Compare to a similarly executed goat by Yoshinaga sold by Zacke, Exhibition 1987, Vienna, no. 97.

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 2.000,Starting price EUR 1.000,-

125 | SHUGYOKU: IVORY NETSUKE OF A MONKEY WITH SAKE BOWL AND CUP

126 | AN AMUSING STAG ANTLER NETSUKE OF A SMALL MONKEY CARRYING A LARGE MUSHROOM Unsigned Japan, 19th century, Edo period (1615-1868)

%\6KXJ\RNXVLJQHG6KXJ\RNX Japan, 19th century A humorous depiction of a smiling monkey bending under the weight of a huge mushroom associated with two chestnuts. Depicting a monkey seated gripping a double gourd between its legs and balancing a full cup of sake on its head. Signature SHUGYOKU in an oval reserve on the bottom. Natural himotoshi.

HEIGHT 7.6 cm

HEIGHT c. 5.3 cm

Condition: Good worn condition. Provenance: French private collection.

Condition: Minor wear, very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 600,Starting price EUR 300,-

46


127 | AN ASAKUSA STYLE INLAID WALRUS IVORY RYUSA MANJU NETSUKE WITH MONKEY

128 | A GROUP OF THREE WOOD NETSUKE OF MONKEYS

Unsigned Japan, Asakusa, mid to late 19th century

Unsigned Japan, 19th century

A well-carved walrus ivory ryusa-manju depicting many pine trees and grasses with an inlaid silver-gilt long-armed monkey in the center. The reverse with rocks, a waterfall and further pines, and FHQWUDOULPPHGKLPRWRVKL%HDXWLIXOFRORURIWKHPDWHULDODQG natural structure of the walrus tooth.

Comprising a seated monkey eating a flea; a monkey on a large mushroom and a monkey looking for fleas, inlaid eyes.

DIAMETER 4.2 cm, WIDTH 2.5 cm Condition: A small section of a branch on the side has been restored and the metal inlay is not original. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

129 | A WOODEN NETSUKE OF A MONKEY STUCK IN A MIKAN Signed …yuki Japan, 19th century, Edo period (1615-1868)

The fruit is neatly carved, on top a small spider and a branch with long leaves. In the inside a monkey tears the skin of the fruit, trying to get out. The underside with fine, large himotoshi and signed …YUKI within a reserve. LENGHT 4 cm Condition: Very good condition. Provenance: European private collection.

HEIGHT 4 – 4.5 cm Condition: Age-related condition, few chips and age cracks, the third with a restored leg. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

130 | KOGYOKU: AN IVORY NETSUKE OF A MONKEY WITH A GIGANT PERSIMMON Signed Kogyoku Japan, Meiji period (1868-1912)

A finely carved netsuke of a monkey hugging a gigantic persimmon (kaki). The monkey has a relaxed expression and the eyes and other details are accentuated with black ink. The persimmon branch makes the base of the netsuke. Natural himotoshi through the stem and signature KOGYOKU. LENGHT 4.2 cm Condition: Very good condition. Provenance: European private collection. Estimate EUR 700,Starting price EUR 350,-

Estimate EUR 800,Starting price EUR 400,-

47


131 | MASANAO: A RARE IVORY NETSUKE OF TWO GROOMING MONKEYS Signed Masanao Japan, Kyoto, late 18th/19th century, Edo period (1615-1868)

A fine ivory netsuke depicting a large male monkey picking fleas off a smaller monkey, which is lying on its stomach, lying straightened out, and visibly enjoying his grooming. Their feets are touching and the overall composition of their bodies is very amusing. Natural himotoshi, very good patina and signature in an oval reserve MASANAO. HEIGHT 3.3 cm, LENGTH 4.1 cm Condition: Considerable wear and age cracks, the two hands of the smaller monkey have been restored and one hand and the tail of the larger monkey is reattached (please consult further images for more details), one or more eyes are replaced. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

132 | AN AMUSING AND RARE IVORY NETSUKE OF THE SANBIKI SARU Unsigned Japan, 18th century, Edo period (1615-1868)

An ivory netsuke of the three wise monkeys, also known as sanbiki saru, shown here as a large monkey with two of its young. The larger monkey is holding the mouth of the young monkey on his shoulder and the eyes of the other child to his right. In return, the monkey on its shoulder is holding his ears, thus completing the representation of the three wise monkeys, which embody the proverbial principle of â&#x20AC;&#x2DC;speak no evilâ&#x20AC;&#x2122;, â&#x20AC;&#x2DC;hear no evilâ&#x20AC;&#x2122; and â&#x20AC;&#x2DC;see no evilâ&#x20AC;&#x2122;. A charming and unusual netsuke with a beautiful honey-patina and good, large himotoshi to the reverse and side. HEIGHT 5.9 cm Condition: Good condition, expected age cracks. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sothebyâ&#x20AC;&#x2122;s, by Neil K. Davey, dated 1974 & 1984, inventory no. 85. Estimate EUR 500,Starting price EUR 250,-

133 | IKKOSAI: AN IVORY NETSUKE OF A MONKEY GROOMING HIS YOUNG %\Î&#x2013;NNRVDLVLJQHGÎ&#x2013;NNRVDL Japan, Tokyo, late 19th century

An idiosyncratic and popular model by Ikkosai depicting a male monkey picking fleas of his sleeping young which he holds firmly against his body. Natural himotoshi and signature in a polished reserve IKKOSAI. HEIGHT 3.1 cm Condition: Some expected horizontal age cracks, the stained ivory is slightly worn. Generally, in very good and complete condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

48


134 | IKKOSAI: A FINE IVORY NETSUKE OF A MONKEY WITH OCTOPUS %\Î&#x2013;NNRVDLVLJQHGÎ&#x2013;NNRVDL Japan, Tokyo, late 19th century

A superbly detailed and finely polished ivory netsuke depicting a monkey quarreling with an octopus which is seated on a bellshaped vessel. The octopus is wearing a shirt and is holding a mallet up high menacingly, while the monkey is gripping its tentacles. The netsuke references a legend in which the octopusphysician to Ryujin, the Dragon King of the Sea, prescribes a monkeyâ&#x20AC;&#x2122;s liver to heal the Kingâ&#x20AC;&#x2122;s daughter. Natural himotoshi and the signature IKKOSAI in a polished reserve. HEIGHT 4.3 cm Condition: The ivory slightly worn in some areas, some age cracks, generally in good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

135 | IKKOSAI: A FINE IVORY NETSUKE OF MONKEYS MOUNTING A HORSE %\Î&#x2013;NNRVDLVLJQHGÎ&#x2013;NNRVDL Japan, Edo, late 19th century, Meiji period (1868-1912)

An animated study, more a miniature okimono than a netsuke, of lively and finely carved monkeys mounting the horse Onikage, which is balancing on a go-board. Immaculate staining. The underside with four silver floral studs and signature IKKOSAI. HEIGHT 4.2 cm Condition: The reigns of the horse show some wear and have possibly been restored. Minor chip to the rattle one monkey is holding. Otherwise excellent condition. Provenance: Austrian private collection. Estimate EUR 1.000,Starting price EUR 500,-

136 | IKKOSAI: A RARE IVORY NETSUKE OF THE SAMBIKI SARU %\Î&#x2013;NNRVDLVLJQHGÎ&#x2013;NNRVDL Japan, Edo, late 19th century, Meiji period (1868-1912)

The three wise monkeys are placed closely together, the fur minutely incised and eyes inlaid. The manner of the carving is very close to Kaigyokusai. Signature IKKOSAI in a polished reserve and central natural himotoshi. HEIGHT 3.2 cm Condition: Very good condition, one age crack to the base and some overall wear. Provenance: Austrian private collection. Estimate EUR 1.500,Starting price EUR 750,-

49


137 | A WOOD NETSUKE OF A PLAYFUL DOG Unsigned Japan, 19th century, Edo period (1615-1868)

A netsuke of a puppy dog raising his front paws whilst looking back. Wearing a collar, with inlaid eyes and his tail curled upon his back. LENGTH 4 cm Condition: A chip to the collar, otherwise good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ

138 | AN IVORY NETSUKE OF A MONKEY WITH LOQUATS AFTER OKATOMO Signed Okatomo Japan, Kyoto, first half 19th century, Edo period (1615-1868)

The monkey with finely incised fur is depicted holding a branch of loquats, the stems of the fruit inlaid in dark horn. His expression is naturalistic, the eyes are inlaid in black horn. Natural himotoshi, and the signature is found in a rectangular reserve on one leg OKATOMO ᛂƤ. A good and detailed work from the Okatomo school. HEIGHT 2.8 cm, LENGTH 4.5 cm

Estimate EUR 800,Starting price EUR 400,-

139 | A FINE IVORY NETSUKE OF A MONKEY CARRYING A LARGE MUSHROOM Unsigned Japan, 19th century, Edo period (1615-1868)

The seated monkey is carrying a large shimeji mushroom on his back, the radial gills well expressed and with a smooth cap with a beautiful honey patina. His exhaustion is so great that he is contracting his toes, trying to lift the slipping mushroom. The eyes inlaid in pale translucent horn and the himotoshi in the smooth mushroom cap. HEIGHT 3.7 cm Condition: Very good condition, minor imperfection to one eye, and a gorgeous patina. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 1.000,Starting price EUR 500,-

50

Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

140 | A FINE WOOD NETSUKE OF THREE MONKEYS WITH FRUITS Unsigned Japan, 19th century, Edo period (1615-1868)

Depicted is a large female monkey holding her two young, while one climbs over her back, the other reaches for a fruit. A lively scene with fine details and expressions. The backside with himotoshi. LENGHT 5.5 cm Condition: A crack to one leg, otherwise very good condition. Provenance: European private collection. Estimate EUR 1.000,Starting price EUR 500,-


141 | A RARE MARINE IVORY NETSUKE OF THREE WISE MONKEYS Signed Japan, Meiji period (1868-1912)

The three wise monkeys, or sanbiki no saru, embody the principle â&#x20AC;&#x153;see no evil, hear no evil, speak no evilâ&#x20AC;?. Here pictured sitting in line on a base. The underside with small himotoshi and signature. LENGHT 4.5 cm Condition: A crack to the base, otherwise good age-related condition. Provenance: European private collection. Estimate EUR 500,Starting price EUR 250,-

142 | KOICHI: A WOOD NETSUKE OF A MONKEY PICKING FLEA %\.RLFKLVLJQHG.RLFKL Japan, 19th century

Finely carved to depict a monkey picking fleas, with inlaid eyes, natural himotoshi through the legs and signature in a polished reserve KOICHI. HEIGHT 3.4 cm Condition: Good condition, one fine crack through one of the legs, probably reattached. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

143 | A GROUP OF THREE WOOD NETSUKE OF MONKEYS The second signed Yoshinobu Japan, 19th century, Edo period (1615-1868)

Two netsuke of monkeys holding fruits, and one of a monkey covering its ears and signed <26+Î&#x2013;12%8 HEIGHT 3.3 - 4 cm Condition: Overall good worn condition with few small chips. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

51


144 | A WOOD NETSUKE OF A DOG WITH A BALL Unsigned Japan, 19th century, Edo period (1615-1868)

The dog is sitting and has his left paw placed on a ball, wears a collar with hanging bells and shows a friendly expression, eyes inlaid in black horn and smooth polished surface. HEIGHT 4.8 cm Condition: Good worn condition, a chip to one paw. Provenance: European private collection. Estimate EUR 700,Starting price EUR 350,-

145 | KOGYOKUSAI: AN IVORY NETSUKE OF CHICKENS, WAR DRUM AND RABBIT %\.RJ\RNXVDLVLJQHG.RJ\RNXVDL Japan, Tokyo, Meiji period (1868-1912)

The composition set on a rock showing a war drum with a cockerel, hen and two chicks, one of them amusingly bursting through the skin of the drum. The sides of the drum are inlaid with rows of horn buttons. Next to the drum is a little rabbit, with inlaid eyes of bright orange coral. Signature KOGYOKUSAI in a wavy reserve on the underside of the rabbit. Natural himotoshi. HEIGHT 3.8 cm Condition: Good condition, the ivory slightly worn. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

146 | KOKU: A STAG ANTLER CHUBBY DOG NETSUKE Signed Koku Japan, second half of 19th century

A rustic and old stag antler netsuke with worn-down features and nice patina. The chubby dog is seated and shows an amusing expression. The underside shows the himotoshi, one of them cleverly used to represent the signature Koku, for Kokusai. LENGTH 4 cm Condition: Good condition with stunning patina and wear. Provenance: European private collection. Estimate EUR 400,Starting price EUR 200,-

52


147 | FOUR IVORY NETSUKE OF DOGS Unsigned Japan, 19th century, Edo period (1615-1868)

HEIGHT 2.3 – 3.4 cm Condition: All in good condition. The rope in the mouth of the fourth dog is chipped. Some minor expected age cracks. 3URYHQDQFH%ULWLVK collection. Estimate EUR 800,Starting price EUR 400,-

148 | AN AMUSING WOOD NETSUKE OF A DOG Unsigned Japan, first half of 19th century, Edo period (1615-1868)

Carved from a grainy dark wood and depicting a dog, not your usual dog, but rather a somewhat frightening wolf-like creature. The dog is seated and looking downwards, its mouth is voraciously opened revealing the teeth, and the bulging eyes are inlaid in ivory with horn pupils. The fur is sparsely incised, the grain of the wood adding to the texture, its tail is curling, and the spine and rib cage are well-expressed. Very good, large himotoshi through the underside and side. HEIGHT 3.6 cm Condition: Very good condition with a nice glossy patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 500,Starting price EUR 250,-

149 | ONE SILVER AND THREE IVORY NETSUKE OF DOGS The first signed Hakuo, The fourth signed Mitsuo, the others unsigned Japan, 19th century, Edo period (1615-1868)

HEIGHT 3.4 – 6 cm Condition: All in good condition. Some minor expected age cracks. 3URYHQDQFH%ULWLVK collection. Estimate EUR 800,Starting price EUR 400,-

53


151 | A KYOTO SCHOOL IVORY NETSUKE OF A DOG WITH BALL Unsigned Japan, Kyoto, early 19th century, Edo period (1615-1868)

150 | TWO IVORY NETSUKE OF A DOG AND A RAT IN A BASKET Unsigned Japan, 19th century, Edo period (1615-1868)

An ivory netsuke, carved in distinct Kyoto style, of a dog with its finely carved paws on a large and smooth ball. The dog (inu), the eleventh animal of the zodiac, is looking backwards with unusually large inlaid eyes of black horn. Minutely incised fur and large himotoshi through the underside and side.

LENGHT 5 and 6.3 cm

HEIGHT 3.6 cm

Condition: The first in good condition, the second with superficial scratches and a restoration to the edge of the basket. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: Expected age cracks, good patina. Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ6RWKHE\È&#x2021;VE\1HLO.'DYH\ from 1974 & 1984, inventory no. 120.

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 400,Starting price EUR 200,-

152 | A FINE AND RARE HIRADO PORCELAIN NETSUKE OF TWO DOGS ON A BASKET

153 | AN IVORY NETSUKE OF A MAN WEARING A MASK AND A DOG

Unsigned Japan, Hirado, 19th century, Edo period (1615-1868)

Unsigned Japan, 19th century, Edo period (1615-1868)

Two puppies playing about, one climbing on top of the other, and the other with a string from the basket in its mouth and holding an awabi shell with one paw. Puppies symbolize good health while dried awabi strips were a popular gift representing a long life. This netsuke is made from pure white porcelain, with a beautiful shimmering glaze and an oily feel to it. Hirado netsuke of this quality are rare to find.

A man seated on the ground, a dog sitting on his feet. The man is hiding his face behind a mask, which shows a peaceful smile. 7KHGRJRQWKHRWKHUKDQGVKRZVDUDWKHUJULPH[SUHVVLRQ%RWK are looking forward. A finely stained and polished work with large himotoshi through the underside and back.

HEIGHT 4 cm

Condition: Excellent condition, fine patina. Provenance: The 40-Year Collection of a London Gentleman.

Condition: Good condition, possibly a small chip to the rope in the mouth of one the puppies. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 800,Starting price EUR 400,-

54

HEIGHT 3.2 cm

Estimate EUR 500,Starting price EUR 250,-


154 | AN IVORY NETSUKE OF A DOG ON A MAT Signed Japan, 19th century, Edo period (1615-1868)

An ivory netsuke of a dog (inu) on a straw mat, with chubby paws and scratching his ear. The dog has a charming expression with finely inlaid eyes and is wearing a collar. Himotoshi on the underside and the signature on an inlaid mother of pearl tablet. HEIGHT 3.5 cm Condition: Several age cracks, otherwise good condition. Provenance: The 40-Year collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

155 | A FINE IVORY NETSUKE OF A PUPPY WITH WARAJI BY RANICHI %\5DQLFKLVLJQHG5DQLFKL Japan, Kyoto, 19th century, Edo period (1615-1868)

A fine and compact stained ivory study of a puppy with beady inlaid eyes heartily chewing on a sandal (waraji). The dog (inu) is the eleventh sign of the zodiac. Himotoshi through the waraji and under one of the legs and signature RANICHI, a pupil of the well-known Hogen Rantei, who showed individual character in his compositions, and made mainly carvings of animals, though netsuke of dogs are rather rare. HEIGHT 2.5 cm, LENGTH 3.8 cm Condition: One nerve channel on the back of the puppy, smaller expected age cracks, the ivory slightly worn. Generally, in very good condition. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 600,Starting price EUR 300,-

156 | FIVE IVORY NETSUKE OF DOGS Unsigned Japan, late 18th to 19th century, Edo period (1615-1868)

HEIGHT 2 â&#x20AC;&#x201C; 4.8 cm Condition: All in good condition with minor expected wear and age cracks. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

55


157 | A FINE KYOTO SCHOOL IVORY NETSUKE OF A DOG WITH AWABI Unsigned Japan, Kyoto, 18th century, Edo period (1615-1868)

A relatively large and finely carved ivory netsuke of a dog holding an awabi shell between its paws â&#x20AC;&#x201C; a symbol of good health and long life. The dog has a whimsical expression with large inlaid eyes of black horn. The fur is neatly incised and characteristically worn, and the patina is a beautifully changing hue of yellow to deep orange honey. The tail of the dog neatly curls upwards and the paws are carved crisply. The underside with the himotoshi â&#x20AC;&#x201C; one through the characteristically soft underside of the awabi and the other through the belly of the dog. HEIGHT 4 cm, LENGTH 4 cm Condition: Very good condition with expected age cracks and fine and appealing patina. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 1.000,Starting price EUR 500,-

158 | AN IVORY KYOTO SCHOOL NETSUKE OF A DOG WITH A BALL Unsigned Japan, Kyoto, first half of the 19th century, Edo period (1615-1868)

The dog is carved in the style of the Kyoto school, its small head turned backwards and both front paws on a ball, note the beautiful details of the paws. The dog is wearing a collar around its neck, its fur, ribs and spine are precisely executed. Its small head is carved in a very lively manner, with lustrous black inlaid eyes. Natural himotoshi between the legs and ball. The dog (inu) is one of the twelve signs of the Japanese zodiac. HEIGHT 3.4 cm, LENGTH 4.2 cm Condition: The tail has been chipped. Otherwise good condition with a beautiful honey patina. Provenance: The 40-Year Collection of a London gentleman. Estimate EUR 1.000,Starting price EUR 500,-

159 | TOMONOBU: A WOOD NETSUKE OF A BITCH AND TWO PUPS %\7RPRQREXVLJQHG7RPRQREX Japan, 19th century, Edo period (1615-1868)

A charming study of a reclining bitch with two pups, one nestling up to her underneath her head and the other climbing onto her back. The wood of a very good color, with a fine dark red hue, especially YLVLEOHRQWKHXQGHUVLGH6LJQDWXUH720212%8QH[WWRWKHXGGHUV of the female dog on the underside. LENGTH 4.5 cm Condition: One leg of the reclining puppy is chipped. Otherwise good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Probably the Tomonobu mentioned as from the Tomochika school, however the tone of the wood could suggest Nagoya school, which could make it a very unusual subject by Arima Tomonobu. Estimate EUR 600,Starting price EUR 300,-

56


160 | TANETOSHI: A CHARMING AND FINE IVORY NETSUKE OF A DOG WITH PUP

161 | AN IVORY NETSUKE OF A RECLINING SHAGGY DOG

%\7DQHWRVKLVLJQHG7DQHWRVKLZLWKDUWLVWVHDO Japan, 20th century

Unsigned Japan, early 19th century, Edo period (1615-1868)

A masterfully animated group of finely crafted figures. The quality of this work is that of Kaigyokusai or Rantei. The dog is wearing a collar, its anatomy is executed very precisely, the costal arch, fine fur, dark inlaid eyes. Its tail is coiled, the younger dog is lying on its back between his front legs and is being held down E\WKHIDWKHU%RWKH[SUHVVLRQVDUHFKDUPLQJQDWXUDOLVWLFDQG masterfully executed. Underneath the signature TANETOSHI with seal. The artist is the son of Meigyokusai, a Japanese contemporary artist from the lineage of Gyokuzan.

An unusual and compact study of a shaggy dog lying down on a rounded rectangular base. A lot of care has been taken to express the ragged hair of the animal. The dog is the eleventh sign of the zodiac and is considered a friend. Large inlaid eyes of deep-black horn and himotoshi on the underside. HEIGHT 2.4 cm, LENGTH 4.3 cm

HEIGHT 3.5 cm

Condition: Good condition with many age cracks and fine yellowish patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ

Condition: Very good condition, beautiful patina. Provenance: Austrian private collection.

Estimate EUR 300,Starting price EUR 150,-

Estimate EUR 1.500,Starting price EUR 750,-

162 | AN IVORY NETSUKE OF A JUMPING BOAR

163 | DERKACHENKO: A BOXWOOD NETSUKE OF A PUPPY WITH FEATHER

Unsigned Japan, 19th century, Edo period (1615-1868)

%\$OH[DQGHU'HUNDFKHQNRVLJQHG Ukraine, 2019

The boar (inoshishi) is a symbol of daredevilry and the bravest of all animals as well as one of the signs of the Japanese zodiac. This boar has its head raised upwards and its front legs tucked up, creating the appearance of the boar being about to jump. Dense fur pattern, the animalâ&#x20AC;&#x2122;s muscles are accentuated, its wild expression captured well. Himotoshi on the belly.

This work was inspired by an inro Alexander Derkachenko saw in the International Netsuke Society Journal depicting a cat with feather. The design is very much executed in the manner of the Ise-Yamada coiled rat netsuke and shows a coiled puppy with amusingly large inlaid eyes, holding a large feather in its mouth and lifting its right hindleg to scratch its ear. The feather is carved over the back of the puppy and cleverly merges with the fur. Large himotoshi next to the inlaid artistâ&#x20AC;&#x2122;s signature.

LENGTH 3.4 cm HEIGHT 4 cm Condition: One hoof is chipped, otherwise good condition. Provenance: Private collection of London-based gentleman.

Condition: Excellent condition.

Estimate EUR 400,Starting price EUR 200,-

Estimate EUR 1.000,Starting price EUR 500,-

57


164 | FIVE WOOD NETSUKE, THREE SIGNED The first signed Minko, the second Shuzan and the third Hokei Japan, 19th century

The first an ebony netsuke of a dog, signed MINKO, the second a boy with a puppy, signed SHUZAN, the third a rat catcher, signed HOKEI, the fourth a boy holding a dog and the fifth a skinny wolf with a skull, the eyes inlaid in ivory. HEIGHT 2.8 â&#x20AC;&#x201C; 4.9 cm Condition: Overall good worn condition with fine patina, the second with a chip. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

165 | A WOOD NETSUKE OF KANZAN WITH A SCROLL Unsigned Japan, 18th century, Edo period (1615-1868)

The netsuke shows Kanzan with a scroll. Very good large himotoshi on the back. HEIGHT 7 cm &RQGLWLRQ%HDXWLIXOZRUQSDWLQDDQGVLJQVRIDJH*RRGFRQGLWLRQ 3URYHQDQFH%ULWLVK&ROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

166 | FIVE IVORY NETSUKE OF KARAKO The first signed Masahiro, the second signed %XQVHLWKHWKLUGVLQJHG7DGDFKLNDWKHIRXUWK signed Homin, the last unsigned Japan, mid-19th century, to Meiji period (18681912)

Consisting of a karako with daruma snowman, a boy pulling the skin off a drum, two karako playing horse riding, two karako fishing in a bowl and two karako playing with a tengu mask. HEIGHT 2.9 â&#x20AC;&#x201C; 4.8 cm

167 | A GROUP OF THREE WOOD NETSUKE 7KHVHFRQGVLJQHG%RNXWDNXGR0RNNXWKHWKLUGVLJQHGLQVHDOIRUP Japan, 19th century

The first depicting a boy holding a hozuki fruit inlaid in coral, the second a boy with a PRNXJ\RWHPSOHEHOOZLWKIXOOVLJQDWXUH%2.87$.8'202..8 DSXSLORI0LZD DQG the third another boy making the bekkanko gesture. HEIGHT 3.4 â&#x20AC;&#x201C; 4.4 cm Condition: Very good condition, the third with a tiny chip to one eye. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

58

Condition: All in good condition with expected wear or age cracks. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-


168 | FIVE WOOD NETSUKE Unsigned Japan, 19th century, Edo period (1615-1868)

The first a street entertainer, the second depicting Hotei with a karako WRKLVOHIWbDQGZLWKUHPQDQWVRIZRUQ Negoro lacquer, the third Kanzan and Jittoku standing side by side, the fourth a boy peeling a hozuki fruit inlaid in coral and the fifth of Hotei with bag. HEIGHT 3.5 – 5.8 cm Condition: The second with a foot slightly chipped and worn off lacquer, the third with worn features and a drilled hole, the fourth with a natural flaw to the coral, the fifth with chipped feet. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

169 | A VERY RARE 17TH CENTURY IVORY NETSUKE OF TWO CHINESE BOYS WITH HOTEI’S SACK Unsigned Japan, 17th century, Edo period (1615-1868)

This netsuke shows a popular theme, adopted from China, and used for some of the earliest Japanese netsuke which derived from Chinese toggles. Depicted are two Chinese boys, their facial expressions executed very much in the style of the Ming dynasty, dressed in Chinese robes and holding a fan together DERYHDWLHGVDFNȂDQDOOXVLRQWRWKHOXFN\GHLW\+RWHL LQ&KLQHVH%XGDL  HEIGHT 3.5 cm, LENGTH 4.6 cm Condition: Worn condition, very appealing patina, age cracks and the fan is slightly chipped. Provenance: Austrian private collection. Estimate EUR 400,Starting price EUR 200,-

170 | AN IVORY NETSUKE AND AN IVORY OKIMONO The first signed Tomokazu, the second unsigned Japan, mid to late 19th century, Edo period (1615-1868)

The first depicting a Chinese boy (karako) holding down a fan, presumably trying to catch a butterfly. Signature TOMOKAZU in a rounded reserve on the underside. The second a finely carved and attractively stained okimono of a Chinese boy holding a puppy with finely carved fur and a charming expression. HEIGHT 3.4 – 5 cm &RQGLWLRQ%RWKLQJRRGFRQGLWLRQ7KHILUVWZLWKH[SHFWHGDJH cracks and minor soiling near the himotoshi. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ7KHVHFRQGZLWKWZR valuations from Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 135. Estimate EUR 600,Starting price EUR 300,-

59


171 | DERKACHENKO: A SET OF SHICHI FUKUJIN MAMMOTH IVORY NETSUKE %\$OH[DQGHU'HUNDFKHQNR signed Derkachenko Ukraine, contemporary

Derkachenko has always had a special talent for carving faces, evident in this set. In this work, he has carved the Shichi Fukujin, the Seven Lucky Gods of Japan. Hotei is laughing happily, as is Ebisu, the god of fishermen, who is holding a big fish he just caught. Fukurokuju, the god of wisdom and longevity, with the typical elongated forehead, and Daikoku, the god of wealth, naturally also appear happy. On the other hand, Jurojin, next to a crane, and the PDUWLDO%LVKDPRQDSSHDUUDWKHU morose. The only female Lucky *RG%HQWHQLVSOD\LQJWKHOXWH HEIGHT 3.3 - 4.1 cm Condition: Excellent condition. Estimate EUR 6.000,Starting price EUR 3.000,-

173 | A WOOD NETSUKE OF DAIKOKU WITH KARAKO Signed Gengensai Japan, mid-19th century, Edo period (1615-1868)

Daikoku, one of the seven gods of good fortune is represented here with his characteristic flat beret and holding a buddhist temple bell (mokugyo) which he hits with a mallet, his mouth wide open as if calling for prayer; the boy besides him raises his hand in a gesture of offering. Good patina and signed GENGENSAI under the himotoshi on the back. HEIGHT 4.6 cm

172 | THREE FIGURAL IVORY NETSUKE AND TWO WALRUS NETSUKE The first signed Tomomasa, the fifth signed on an inlaid mother-of-pearl tablet, the others unsigned Japan, 19th century

The first a rare and fine walrus ivory Ebisu holding down a sea bream, the second an ivory netsuke of a woman polishing the floor and the third a walrus ivory netsuke of Kinko sennin. The fourth depicting two oni being pelted by roasted beans during Setsubon, the last a mask carver taking a smoking break. HEIGHT 3.3 - 4.3 cm Condition: All in good condition, one minor age crack through the polishing lady. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 700,Starting price EUR 350,-

60

Condition: Very good worn condition. Provenance: French Private collection acquired in 1995 from an antiques dealer in Italy, by repute. Estimate EUR 800,Starting price EUR 400,-


174 | HIDE: AN IVORY NETSUKE OF FUKUROKUJU %\+LGHPDVDVLJQHG+LGH Japan, 19th century, Edo period (1615-1868)

Osaka school. Very nice representation of the god of longevity leaning on a small stool and holding a hossu (buddhist â&#x20AC;&#x2DC;fly swatterâ&#x20AC;&#x2122;). Skillfully executed details and signed HIDE, most likely abbreviated for Hidemasa. HEIGHT 4.6 cm Condition: Very good condition. Provenance: French-German private collection acquired in late 2000. Estimate EUR 600,Starting price EUR 300,-

175 | A LARGE KUROGAKI WOOD NETSUKE OF JUROJIN Unsigned Japan, 18th to 19th century, Edo period (1615-1868)

A beautifully balanced and large wood netsuke representing Jurojin holding a staff and a fan, fine patina and natural mottled wood. HEIGHT 7.8 cm Condition: Expected age cracks and a chip to the lower area, otherwise good worn condition. Provenance: French Private collection acquired in 1995 from an antiques dealer in Italy, by repute. Estimate EUR 500,Starting price EUR 250,-

177 | TOMOCHIKA: AN IVORY NETSUKE OF DAIKOKU AND ONI AT SETSUBUN 176 | A LARGE AND RARE WOOD NETSUKE OF BENTEN AND BISHAMON

%\&KLNX\RVDL7RPRFKLNDVLJQHG7RPRFKLND Japan, mid-19th century, Edo period (1615-1868)

Unsigned Japan, 18th century, Edo period (1868-1912)

7KHWZROXFN\JRGVGHSLFWHGULGLQJDFORXG%RWKDUHUDUHLQ netsuke art.

A scene from the oni-yarai festival (also known as setsubun). Daikoku is gleefully throwing kuromame (roasted beans) to drive away the oni, who kneels fearfully at his feet. Himotoshi through the back and signature TOMOCHIKA.

HEIGHT 5.5 cm, LENGTH 5.7 cm

HEIGHT 4 cm

Condition: Good worn condition. Provenance: French private collection.

Condition: Very good condition with expected age cracks. Provenance: French private collection.

Estimate EUR 1.200,Starting price EUR 600,-

Estimate EUR 600,Starting price EUR 300,-

61


178 | MASAKAZU: A FINE IVORY NETSUKE OF FUKUROKUJU %\0DVDND]XVLJQHG0DVDND]X Japan, early 19th century, Edo period (1615-1868)

A fine carving showing the lucky deity Fukurokuju with a large and smooth-shiny head, gleefully laughing. His robes are finely adorned, and the backside shows good himotoshi and an appealing patina. The underside with the MASAKAZU signature in a typical reserve. HEIGHT 5.5 cm Condition: Good condition with expected wear and age cracks. Possibly some old minor damage to the edge of his foot. Provenance: French-German private collection acquired in late 2000. Estimate EUR 1.200,Starting price EUR 600,-

179 | A GROUP OF FOUR NEGORO LACQUER NETSUKE Unsigned Japan, 19th century, Edo period (1615-1868)

The first depicting a boy wearing a lion mask, as is used for the traditional Chinese lion dance known as Shishimai - when peeking inside the mask one can see the boy´s face. The second depicting a Karako leaning on a bamboo basket, the third Daikoku, one of the Seven Lucky Gods of Japan, dragging a daikon radish. The fourth depicting a Shishi sitting on a rectangular two-leveled base with four legs. HEIGHT 2 - 3 cm Condition: Good age-related condition with expected wear and discoloration to lacquer. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 900,Starting price EUR 450,-

180 | KIYOCHIKA: A STAG ANTLER NETSUKE OF A BOY WITH ONI MASK Signed Kiyochika Japan, late 19th century, Meiji period (1868-1912)

Nicely carved and depicting a teasing boy hiding an oni mask behind his back, the hair is accentuated with black ink, his expression is playful and his tongue movable. The mask has inlaid eyes and the underside is signed KIYOCHIKA within a mother-of-pearl inlaid cartouche. HEIGHT 4 cm Condition: One finger is chipped, otherwise good condition. Provenance: French-German private collection acquired in late 2000. Estimate EUR 500,Starting price EUR 250,-

181 | FIVE WOOD NETSUKE, TWO SIGNED The second signed Shinzan, the fourth signed ..Tei Japan, 19th century to Meiji period (18681912)

The first depicting Hotei on an armchair, the second Okame in a bathtub, signed SHINZAN, the third Hotei with bag, the fourth a fisherman wearing only a loincloth, which is partly stuck in the hamaguri clam, trying his best to break free, and the fifth a worker. HEIGHT 4 â&#x20AC;&#x201C; 4.5 cm Condition: Overall good condition, the first with a chip to the fan, the second and fifth with a crack. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,62


182 | FIVE IVORY NETSUKE The second signed Yoshinobu, the third signed Tomotsugu, the fourth signed Gessan, the fifth signed Tomonobu, the first unsigned Japan, 19th century

&RQVLVWLQJRID%LMLQZLWKDEDOODVKXQJD netsuke of a man paying a Geisha (with visible genitals on the underside), a woman VFUXEELQJWKHIORRU%HQWHQZLWKER\DQG rabbit and Hotei with boy. HEIGHT 2.9 â&#x20AC;&#x201C; 4.5 cm Condition: All in good condition with expected wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

183 | FIVE WOOD NETSUKE The first signed Masamitsu Japan, 19th century

The first depicting a Shojo dancing, signed MASAMITSU, the second a yawning daruma with inlaid eyes, the third a meditating Daruma, the fourth a boy holding a coin and the fifth two skeletons wrestling on a lotus leaf. HEIGHT 3.5 â&#x20AC;&#x201C; 4.7 cm Condition: The first with two chips and red stains, the second with a crack, missing an eye inlay and with restored arms; the third and fourth in good worn condition and the fourth with a chip and crack to the lotus leaf. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

184 | FIVE WOOD NETSUKE Unsigned Japan, 19th century

The first depicting Tenaga and Ashinaga, the second a repenting Oni, the third a blind masseur working his skills on a seated clientsâ&#x20AC;&#x2122; shoulders, the fourth Daikoku and Ebisu and the fifth a temple servant washing a bell. HEIGHT 3.2 â&#x20AC;&#x201C; 5.5 cm Condition: The first, third and fifth in good, worn condition, the second with chipped feet and the fourth with red stains to base, otherwise good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

185 | A GROUP OF SIX BONE AND STAG ANTLER NETSUKE Unsigned Japan, 18th to 19th century, Edo period (1615-1868)

The first depicting an octopus on a pile of various leaves, the second the god of longevity and scholarly success, Jurojin, the third a candle, the fourth a recumbent ox, the fifth a fox (kitsune) as a monk, the sixth a dutchman and. HEIGHT 2 â&#x20AC;&#x201C; 8.5 cm Condition: Good age-related condition with natural â&#x20AC;&#x2DC;flawsâ&#x20AC;&#x2122; in the material. The fifth with a chip to the staff´s tip. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,63


187 | A TALL IVORY NETSUKE OF CHOKARO SENNIN Unsigned Japan, 18th century, Edo period (1615-1868)

186 | FIVE WOOD NETSUKE, ONE SIGNED The second signed Dai Hyuga Japan, 19th century to Meiji period (1868-1912)

Chokaro Sennin, recognizable by the gigantic gourd attached to his back, is smiling and looking upwards to his right and holding his very large flowing beard in his hand. He is wearing a mugwort leaf cloak with flowing folds. Himotoshi in the backside. HEIGHT 8.8 cm

The first a depiction of Okame washing herself, the second an ebony Sanbaso dancer, signed DAI HYUGA, the third a pressed horn netsuke of a street performer - â&#x20AC;&#x2DC;sneezerâ&#x20AC;&#x2122; - who uses a stick to make himself sneeze, the fourth netsuke of Jurojin, the lucky god, and a boy and the fifth showing a man applying moxa, with movable head. HEIGHT 3.7 â&#x20AC;&#x201C; 5.4 cm Condition: Overall good, worn condition with few surface scratches, the second with a crack and a chip to one foot, the third with age cracks and the fourth with a restored foot. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: The ivory slightly worn, minor age cracks, very attractive yellowish patina on the backside. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

Estimate EUR 1.000,Starting price EUR 500,-

188 | NAGAMICHI SHUZAN: TWO POLYCHROME WOOD NETSUKE %\1DJDPLFKL6KX]DQWKHVHFRQGVLJQHG6KX]DQ Japan, 19th century

189 | MINKO: A TALL WOOD NETSUKE OF TEKKAI SENNIN Signed Minko Japan, 18th century, Edo period (1615-1868)

One depicting Tobosaku Sennin and another depicting a Chinese official. %RWKEHDULQJROGFROOHFWLRQODEHOVDQGWKHVHFRQGVLJQHG6+8=$1 HEIGHT 5.5 cm Condition: Good age-related condition, the second with a chip. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

Dynamically and boldly carved as Tekkai Sennin with an amusing expression, leaning on his cane. One arm is swinging upwards and one foot is raised. A hyotan is tied to his obi. Good himotoshi, one cleverly placed in the opening of his sleeve. The underside shows the signature MINKO. HEIGHT 8.1 cm Condition: Very good age-related condition. Appealing patina, minor surface wear, remnants of black lacquer. Provenance: Sold at %RQKDPV)LQH-DSDQHVH Works of Art, 19 March 2013, New York, lot 2182. Estimate EUR 600,Starting price EUR 300,-

64


190 | TWO INLAID EBONY NETSUKE AFTER HASEGAWA IKKO Unsigned, after Hasegawa Ikko Japan, early 19th century, Edo period (1615-1868)

Depicting two Chinese sages wearing a cloak carved from ebony, the second with the face, hands, feet and staff inlaid in ivory; the first inlaid in boxwood and ivory. HEIGHT 6.6 – 7.5 cm Condition: Good age-related condition, few chips and wear. The first missing the staff. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

191 | AN EBONY WOOD NETSUKE OF TEKKAI SENNIN Unsigned Japan, 19th century, Edo period (1615-1868)

A finely crafted ebony wood netsuke of Tekkai Sennin leaning on a cane and holding his beard. His facial features are expressive, with a wide grin as he looks up into the heavenly skies towards Lao Zi. Well-carved garment folds of the mugwort leaf cloak and himotoshi through the back. HEIGHT 6.5 cm Condition: Loss to the top of one foot. Signs of age and use, otherwise in good condition. 3URYHQDQFH%ULWLVK&ROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

192 | AN IVORY NETSUKE OF GAMA SENNIN WITH LARGE TOAD Unsigned Japan, 19th century, Edo period (1615-1868)

A charming ivory netsuke depicting Gama Sennin, dressed in a mugwort leaf cloak and with a bag draped over his shoulder, holding a large toad by the ‘hand’. The bulky toad with huge inlaid eyes of dark horn has a slightly dumbfounded expression, while the Sennin is gleefully smiling. Himotoshi through the back. HEIGHT 4.2 cm Condition: The sleeve of the Sennin with a chip, otherwise good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

65


193 | AN IVORY NETSUKE OF A CHINESE SAGE Unsigned Japan, 18th century, Edo period (1615-1868)

A man standing on a large, rectangular, decoratively executed base, with his right hand on his right ear to hear better, his facial expression also showing heightened attentiveness. He is wearing a Chinese garment and a Daoist cap on his head; he could be one of the Seven Sages of the %DPERR*URYHQDPHO\.HLNRZKRLVGHSLFWHGZLWKWKLVKDQGSRVLWLRQ7KH large pedestal beside him, possibly a box, is decorated with a landscape and plants. Himotoshi in the sageâ&#x20AC;&#x2122;s back.

194 | MASAMORI: AN IVORY NETSUKE OF GAMMA SENNIN %\0DVDPRULVLJQHG0DVDPRUL Japan, early 19th century, Edo period (1615-1868)

Kyoto/Yoshi School. A classical representation of Gama Sennin standing, a three-legged toad over his right shoulder and holding a blooming peach branch. Good patina and signature MASAMORI.

HEIGHT 5 cm

HEIGHT 7.2 cm

Condition: Good condition with an attractive patina; age cracks. Provenance: The 40-Year Collection of a London Gentleman.

Condition: Good worn condition with expected age cracks. Provenance: French-German private collection acquired in late 2000s.

Estimate EUR 500,Starting price EUR 250,-

Estimate EUR 1.200,Starting price EUR 600,-

195 | FIVE WOOD NETSUKE, TWO SIGNED 196 | AN IVORY NETSUKE OF GAMA SENNIN The first signed Jissai, the third signed Ryumin Japan, 19th century

Unsigned Japan, Meiji period (1868-1912)

The first depicting a blind stone lifter, signed JISSAI, the second a Sennin with gourd, the third depicting three carpenters - one is movable, signed RYUMIN, the fourth a meditating Hotei and the fifth a street vendor with kid.

A skillfully carved netsuke of Gama Sennin carrying a huge toad on his back. Well-achieved expressions and good movement.

HEIGHT 3 â&#x20AC;&#x201C; 8.5 cm

HEIGHT 4.2 cm

Condition: The first, second and fourth with a tiny chip, otherwise good worn condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: Good condition. Provenance: French German private collection acquired in late 2000s.

Estimate EUR 1.000,Starting price EUR 500,-

Estimate EUR 600,Starting price EUR 300,-

66


198 | A GOOD IVORY NETSUKE OF CHINNAN SENNIN Unsigned Japan, early 19th century, Edo period (1615-1868)

197 | KOHOSAI: A FINE IVORY NETSUKE OF A CALLIGRAPHIST %\8HGD.RKRVDLVLJQHG.RKRVDL Japan, Osaka, late 19th century, Meiji period (1868-1912)

Very finely carved and beautifully stained, depicting a calligraphist, his finely carved bony fingers holding a quill with an amusingly pensive expression. Extraordinarily detailed flowing robes with the natural himotoshi cleverly hidden in a fold. The underside with the signature KOHOSAI.

Chinnan Sennin is shown wearing a mugwort leaf cloak with long flowing robes, clenching one fist next to his cheek and holding a vessel up high with his other hand. He uses this vessel to conjure a dragon, which is about to emerge from the vessel with all its might. The Sennin is visibly excited with wide-opened eyes and mouth. Good, irregular and large himotoshi on the backside. HEIGHT 9 cm

Condition: One plugged nerve channel at the back of the head, very minor discoloration of ivory, generally in very good condition. Provenance: The 40-Year Collection of a London Gentleman.

Condition: Good condition. The stained ivory is worn with some age cracks, minor areas of soiling around the left side of the face and in the crevices near the vessel. Provenance: The 40-Year Collection of a London Gentleman.

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 400,Starting price EUR 200,-

199 | AN EARLY IVORY NETSUKE DEPICTING A CHINESE SAGE ON A DECORATED BASE

200 | A RARE IVORY NETSUKE OF A SENNIN WITH MONKEY

HEIGHT 4 cm

Unsigned Japan, early to mid-18th century, Edo period (1615-1868)

An early ivory netsuke of a Chinese sage wearing a cap, gently smiling and leaning on a Chinese table, his robe incised with scrolling vines. The entire composition is set on a large and thick hexagonal base with incised floral and wave motifs. Very large and hollowed out himotoshi through the underside and back. HEIGHT 4.1 cm Condition: Good condition with age-related wear and very appealing patina, as well as expected age cracks. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

Unsigned Japan, early to mid-18th century, Edo period (1615-1868)

A slender and rather tall ivory netsuke of a Sennin holding a monkey (saru). The monkey is small and tugging on the beard of the Sennin, who is wearing the characteristic mugwort leafcloak, adorned with swirling clouds. He is holding a taming stick in his left hand. Probably he is the precursor to the peddling sarumawashi (monkey trainer). The ivory has taken on a beautiful golden honey patina over many years of handling. Very good himotoshi in the back. HEIGHT 8.3 cm Condition: Very good condition, expected minor age cracks. Provenance: French private collection. Estimate EUR 800,Starting price EUR 400,-

67


202 | DERKACHENKO: OKAME WITH TENGU MASK MAMMOTH IVORY NETSUKE %\$OH[DQGHU'HUNDFKHQNRVLJQHG'HUNDFKHQNR Ukraine, 2018

Alexander Derkachenkoâ&#x20AC;&#x2122;s vision of the famous subject â&#x20AC;&#x153;Okame with Tengu maskâ&#x20AC;?. Carved from colored mammoth ivory with heavy shunga undertones â&#x20AC;&#x201C; a playful and fun Okame. HEIGHT 5.2 cm Condition: Excellent condition. Estimate EUR 1.200,Starting price EUR 600,-

201 | TWO IVORY NETSUKE, ONE SIGNED One signed Tomonaga, the other one signed Japan, Meiji period (1868-1912)

This lot consists of two ivory netsuke, one depicting Okame brushing her hair, while an oni sneaks out of her loincloth, signed. The other one shows the scene of Kanshin forced to crawl away between the legs of two brigands, signed TOMONAGA. Himotoshi through the back. HEIGHT of each netsuke c. 4.3 cm Condition: The netsuke of the Kanshin scene with a worn patina and a crack through the arm of one of the brigands and thin age cracks. The other netsuke with a worn patina and a chip to one foot of the oni. Provenance: Old Zagreb private collection. Estimate EUR 600,Starting price EUR 300,-

203 | A RARE HIDA SCHOOL ITTOBORI SHUNGA NETSUKE Unsigned Japan, 19th century, Edo period (1615-1868)

Depicting a mother nursing a young child, carved from wood and using the ittobori technique (using one knife). The underside shows the shunga-aspect of this netsuke. Himotoshi through the back. HEIGHT 3.7 cm

204 | A RARE IVORY NETSUKE OF OKAME ON A PILLOW Unsigned Japan, 19th century, Edo period (1615-1868)

The Shinto goddess Okame is lying on top of a large pillow, armed with a knife. She is cheekily smiling, and her robes are ornately decorated. Large himotoshi and beautiful honey patina on the underside.

Condition: Excellent condition with minor expected surface wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ

HEIGHT 2.1 cm, LENGTH 3.5 cm

Estimate EUR 300,Starting price EUR 150,-

Condition: Expected age cracks, the ivory slightly worn, very good patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

68


205 | HOGEN: A FINE WOOD NETSUKE OF A YAWNING OKAME Signed Hogen Japan, 19th century, Edo period (1615-1868)

Exquisitely carved as Okame, also known as Otafuku, kneeling bare-chested with her supple, delicately carved breasts shown. She is yawning and stretching her arms up high â&#x20AC;&#x201C; in the manner of Daruma during his nine-year meditation â&#x20AC;&#x201C; therefore this depiction is also referred to as Onna Daruma (â&#x20AC;&#x153;Woman Darumaâ&#x20AC;?), which is also slang for a courtesan. Her features are delicate and sensitive. Himotoshi through the back and signature HOGEN, which is an honorary title. HEIGHT 4.6 cm Condition: Excellent patina. Minor surface wear, notably on the right foot. Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

206 | KEIMIN: AN IVORY AND LACQUER NETSUKE OF OKAME WITH A SAKE CUP %\.HLPLQVLJQHG.HLPLQ Japan, late 19th century, Meiji period (1868-1912)

The large head of Okame is carved separately and inserted into the body. The hair is black lacquer and her hairpin is inlaid with red coral. Her garments show ribbons and floral decorations in fine gold takamaki-e. The legs are bare, she is kneeling on the ground and holding a small cup with sake, the swirling liquid inlaid in pale horn, in front of her. The good and irregular himotoshi are in a somewhat naughty place next to the signature KEIMIN. HEIGHT 3.8 cm Condition: Good condition, one crack through the back and possibly a small loss or an imperfection to the top of the hair. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

207 | A WOOD NETSUKE OF A LADY WITH BOOK AND UMBRELLA Japan, 1st half of 19th century, Edo period (1615-1868)

The courtly robe, noble features and book indicate that this netsuke possibly depicts the waka poet Ono no Komachi, who lived in the 9th century and is the best-known among the Rokkasen, the six greatest waka poets of the early Heian period, who was a figure surrounded by legends. Powerful patina, himotoshi on the reverse. HEIGHT 6.1 cm Condition: Excellent condition with good patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

69


208 | A POWERFUL AND LARGE BONE NETSUKE OF KAN’U Unsigned Japan, 18th century, Edo period (1615-1868)

An exceptional netsuke depicting the god of war Kan’U. The patina is a striking, glossy honey color. The god of war is stroking his beard whilst maintaining a fierce expression, his eyes inlaid. The other hand holds his characteristic halberd. Large himotoshi through the back.

209 | A FINE WOOD NETSUKE OF KAN’U Unsigned Japan, 19th century, Edo period (1615-1868)

Depicting the god of war Kan’u standing proudly with a slightly arched back, stroking his beard and holding his halberd behind his back. Good himotoshi. HEIGHT 6.1 cm Condition: Very good condition with minor associated wear. 3URYHQDQFH%ULWLVK collection.

HEIGHT 12.5 cm Condition: Excellent agerelated condition with a stunning patina. 3URYHQDQFH%ULWLVK collection.

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 2.000,Starting price EUR 1.000,-

210 | A BOXWOOD NETSUKE OF KAN’U Unsigned Japan, early 19th century, Edo period (1615-1868)

The god of war standing and holding a halberd in one hand and clutching his beard with the other. %HDXWLIXOO\FDUYHGUREH and fine, differently sized himotoshi to the back.

211 | TOYO: A RARE WOOD NETSUKE OF AMATERASU Signed Toyo Japan, 19th century, Edo period (1615-1868)

The sun-goddess is depicted standing and wearing flowing robes with wide sleeves. The back is flattened and shows the himotoshi and signature TOYO.

HEIGHT 7.7 cm HEIGHT 6.7 cm

70

Condition: A chip to the hat tip and cheek, otherwise good condition. Provenance: European private collection.

Condition: Very good worn condition. Provenance: European private collection.

Estimate EUR 500,Starting price EUR 250,-

Estimate EUR 400,Starting price EUR 200,-


212 | A WOOD NETSUKE OF KIKUJIDO Unsigned Japan, 18th century, Edo period (1615-1868)

Carved as the chrysanthemum boy seated on a dense bundle of kiku (chrysanthemum) blossoms, appearing like a cloud, on which he floats. Draped over his shoulder is a blossoming kiku branch, DSSHDULQJOLNHD%XGGKLVWQ\RLVFHSWHU+HLVELWLQJKLVWHHWKDQG his glaring eyes are inlaid with dark horn. A compact, functional netsuke with large, hollow himotoshi â&#x20AC;&#x201C; the smaller one cleverly hidden behind one kiku flower. HEIGHT 5.5 cm Condition: Excellent worn condition, the himotoshi show wear showing this netsuke was worn. Provenance: Formerly Helen and Jack Mang collection, then Luxembourg private collection acquired at Quinnâ&#x20AC;&#x2122;s auction galleries, 7 December 2012, lot 553. Estimate EUR 600,Starting price EUR 300,-

213 | A WOOD NETSUKE OF DARUMA Japan, late 19th century, Meiji period (1868-1912)

$ZHOOURXQGHGbQHWVXNHRID'DUXPDWKHILUVWSDWULDUFKRI=HQ %XGGKLVPKHUHZLWKVPDOOH\HVVWXEEOHGEHDUGDQGVFUHDPLQJLQ agony. HEIGHT 4 cm Condition: Good condition. Provenance: European private collection. Estimate EUR 700,Starting price EUR 350,-

214 | HOZAN: A WOOD NETSUKE OF A PUMPKIN DARUMA %\+R]DQVLJQHG+R]DQ Japan, 19th century, Edo period (1615-1868)

A wood netsuke of daruma yawning and stretching after his nineyear meditation, also known as Menpeki Kunen. Amusingly, his body is in the shape of a pumpkin â&#x20AC;&#x201C; a popular caricaturistic motif in netsuke art. Darumaâ&#x20AC;&#x2122;s expression is finely carved with minutely inlaid eyes. The underside with an offset base and signature in a wavy reserve HOZAN. Irregular himotoshi in the backside. HEIGHT 5.2 cm Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

71


215 | FIVE WOOD NETSUKE, TWO SIGNED The second signed Tomichi, the third signed Somin Japan, 19th century

216 | AN OLD IVORY NETSUKE OF AN ONI Unsigned Japan, 17th century, Edo period (1615-1868)

The first depicting a rat catcher with a rat on his back, both with inlaid eyes, the second Shoki with a bag full of oni, signed TOMICHI, the third a boy with a Shishi mask, signed SOMIN, the fourth an eggplant and the fifth a Shishi with ball.

This old and worn ivory netsuke shows an oni seated on a rock. Good himotoshi through the back and the base. Stunning patina.

HEIGHT 2 – 4.5 cm

HEIGHT 4.5 cm

Condition: Overall good worn condition, the first with a microscopic chip and the fifth with chips to mouth and paw. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: Signs of age and wear. Deep honeycolored patina; age cracks and chipping. Provenance: Old Zagreb private collection.

Estimate EUR 1.000,Starting price EUR 500,-

Estimate EUR 700,Starting price EUR 350,-

217 | THREE IVORY NETSUKE

218 | AN IVORY NETSUKE OF AN ONI WITH THE HAND OF RASHOMON

The third signed Hidekazu, the others unsigned Japan, late 18th to 19th century, Edo period (1615-1868)

Consisting of Kiyohime with the bell of Dojo-ji, a Rakan seated on a rock, and Raijin banging a large drum amongst clouds, the sides of the drum inlaid with horn buttons; signed HIDEKAZU. HEIGHT 2.9 – 4.1 cm Condition: All in very good condition with the ivory slightly worn and minor age cracks. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

Unsigned Japan, 19th century, Edo period (1615-1868)

A weeping oni, with one clawed hand over his face and the other holding a rosary, is lamenting the severed hand of the demon Rashomon. The world of demons went into deep despair after Watanabe no Tsuna severed Rashomon’s arm in the year 976. This event is parodied in netsuke art, as really it was only a ‘drop in the ocean’. The demon’s muscular arm is clenched into a fist, showing its might. Small himotoshi through one of the buttocks of the oni. HEIGHT 3 cm Condition: The rosary is chipped, one minor age crack, fine yellowish patina to the backside. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

72


219 | A MINUTELY CARVED IVORY NETSUKE OF ONI, KAPPA AND MONK SIGNED TENMIN Signed Tenmin Japan, 19th century, Edo period (1615-1868)

An unusual ivory netsuke, minutely carved and depicting an amusing scene of an oni trying to lift the tea-kettle shell off a kappa, next to a gesticulating monk. The details of this small and fragile carving are incredibly precise. All set on a stippled and thin base. Singular himotoshi on the underside as well as the signature TENMIN in a jar shaped reserve. HEIGHT 2.6 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

220 | AN AMUSING IVORY NETSUKE OF SHOKI AND ONI Unsigned Japan, 19th century, Edo period (1615-1868)

A fine and amusing ivory netsuke of the demon hunter Shoki, with drawn ken-sword, pulling an elusive oni by the hand which is hiding on top of Shokiâ&#x20AC;&#x2122;s wide-brimmed hat. Himotoshi through the back. HEIGHT 6.4 cm Condition: Excellent condition, the ivory bearing a fine yellowish patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

221 | TOMOCHIKA: AN IVORY NETSUKE OF A DEMON WITH ATTENDANT AND ONI IN A BOAT %\&KLNX\RVDL7RPRFKLNDVLJQHG7RPRFKLND Japan, early 19th century, Edo period (1615-1868)

'HSLFWHGLVDGHPRQZLWKDIHPDOHSRVVLEO\%HQWHQSRXULQJ sake into the sakazuki he is holding - accordingly he has a slightly GUXQNHQH[SUHVVLRQ%HKLQGWKHPLVDQRQLZKRLVJOHHIXOO\ rowing the boat. Finely carved waves on the sides. Himotoshi and signature TOMOCHIKA on the underside. LENGTH 5 cm Condition: Minor age-related wear and a crack through the underside. Generally, in good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

222 | TOMOCHIKA: SMALL IVORY NETSUKE OF TRAVELERS IN A BOAT Signed Tomochika Japan, Meiji period (1868-1912)

Depicted is a group of travelers on a boat with finely carved waves on the sides. Himotoshi and signature TOMOCHIKA on the underside. LENGHT 4.5 cm Condition: Very good condition with only a small chip to base. Provenance: European private collection. Estimate EUR 400,Starting price EUR 200,-

73


223 | TWO IVORY NETSUKE, ONE BY SHINKEISAI MASATOSHI The first signed Shinkeisai, the second unsigned Japan, 19th century, Edo period (1615-1868)

The first finely carved as a rocky pavilion landscape, signed SHINKEISAI. The second as Sennin Koreijin with tiger. HEIGHT 3.2 and 4.6 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

224 | A WOOD NETSUKE OF TRAVELERS IN A SHIP ATTRIBUTED TO KAGETOSHI Unsigned, attributed to Kagetoshi Japan, 19th century

Carved from a dark reddish wood and depicting a ship with carved dragon on its bow, on board a group of people and a horse. The addition of the horse is very rare. Attributed to Kagetoshi. LENGTH 4.5 cm Condition: Very good age-related condition. Provenance: European private collection. Estimate EUR 1.000,Starting price EUR 500,-

225 | A RARE IVORY NETSUKE OF A CRAFTSMAN Unsigned Japan, late 18th to early 19th century, Edo period (1615-1868)

A rather large and rare depiction of a craftsman, wearing an apron adorned with sunflowers, and pushing down on a box. His facial features are finely crafted â&#x20AC;&#x201C; he visibly takes joy in his work. His almost naked body is smooth with a very appealing honey patina in the back. Large himotoshi through the underside and back. HEIGHT 4.2 cm Condition: Some age cracks (one large one through the left hand), imperfections and one foot reattached. Age-related and good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

226 | MASA: A WOODEN NETSUKE OF A MASK CARVER Signed masa with Kakihan Japan, 19th century, Edo period (1615-1868)

The carver is working on a large Tengu mask with a chisel and a hammer. The underside with himotoshi and signature MASA with Kakihan. LENGHT 5.2 cm Condition: Good condition, few surface scratches. Provenance: European private collection. Estimate EUR 400,Starting price EUR 200,-

74


228 | TWO IVORY NETSUKE, SIGNED The gourd signed Ryoji, the farmer signed Shounsai Japan, Meiji period (1868-1912)

This lot consists of two ivory netsuke. One depicting a man carrying a large gourd, signed RYOJI and small himotoshi on the base, the other one a farmer holding a sycle and sitting in front of a basket, signature SHOUNSAI (Joryu) and himotoshi through the base. HEIGHT 3 – 4 cm

227 | AN IVORY NETSUKE OF A DANCER, A MUSICIAN AND A MONKEY Unsigned Japan, Meiji period (1868-1912)

Condition: The hand of the gourd-carrier restored; remnants of glue. Signs of age and minor chipping. The farmer with age cracks and signs of age and wear. Provenance: Old Zagreb private collection. Estimate EUR 500,Starting price EUR 250,-

The ivory netsuke shows a festive scene with one dancer and a musician holding a drum. A monkey is sitting on the bag of the musician, pulling the ear of the dancer with one and the hat with the other hand. HEIGHT c. 4.5 cm Condition: The feet of the musician and the top of the feet of the dancer reattached. One chip to the rope that runs along the monkey and the bag. Signs of age and use. Provenance: Old Zagreb private collection. Estimate EUR 500,Starting price EUR 250,-

229 | AN AMUSING WOOD NETSUKE OF A NOODLE EATER

230 | FOUR IVORY NETSUKE WITH ‘SCENES FROM DAILY LIFE’

Unsigned Japan, 19th century

The first unsigned, the second signed Homin with kao, the third unsigned, the fourth signed Ono Ryoko Japan, Meiji period (1868-1912)

This amusing netsuke is made from wood and shows a seated man with a satisfied expression eating noodles with chopsticks. Natural himotoshi.

Consisting of a Shishimai group, a street performer with boy, a boy with dog, and a man with boy, tortoise and dog.

HEIGHT c. 3.6 cm

HEIGHT 3.5 – 4.7 cm

Condition: The end of the chopsticks with a chip. Otherwise fine condition. Provenance: Old Zagreb private collection.

Condition: Generally, in good condition with minor expected wear. The third netsuke with a reattached paw of the dog. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 600,Starting price EUR 300,-

75


231 | A GROTESQUE IVORY NETSUKE OF A KABUKI ACTOR

232 | AN IVORY NETSUKE OF CHORYO AND KOSEKIKO

Unsigned Japan, 18th century, Edo period (1615-1868)

Unsigned Japan, early 19th century, Edo period (1615-1868)

The kabuki actor is standing in a dancing posture, with one leg raised above the other, wearing an eboshi and holding two mallets next to his face, on which he wears a grotesque mask from a Kabuki play. The apron is carved in relief with a dragon, with inlaid eyes, whose expression is amusingly very much like that of the mask. Good patina and large himotoshi in the back.

The netsuke shows the famous scene of Choryo and Kosekikoâ&#x20AC;&#x201C; the proud Choryo, with one foot on a dragonâ&#x20AC;&#x2122;s head, is presenting the shoe to Kosekiko who is mounted on a horse atop a bridge. According to legend Choryo used the teachings RI.RVHNLNRDVDPLOLWDU\DGYLVHUWR/LX%DQJIRXQGHURIWKH+DQ Dynasty. Natural himotoshi.

HEIGHT 8 cm

HEIGHT 7 cm

Condition: Very good condition with good patina. Provenance: Luxembourg private collection.

Condition: Very good condition, the ivory slightly worn. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ

Estimate EUR 800,Starting price EUR 400,-

Estimate EUR 500,Starting price EUR 250,-

233 | AN IVORY NETSUKE OF AN OIL THIEF

234 | A FINE WOOD NETSUKE OF A NOH ACTOR

Unsigned Japan, early 19th century, Edo period (1615-1868)

Showing Taira no Tadamori grabbing the oil thief from behind. Tadamoriâ&#x20AC;&#x2122;s expression is serious, while he grabs the oil thief by the arm and robe, the thief is holding an ewer and has a foot lifted. Himotoshi to the back.

Unsigned Japan, 19th century, Edo period (1615-1868)

A finely caved and stained wood netsuke depicting a seated Noh-actor wearing a mask and holding a fan. The wood is of a very attractive color â&#x20AC;&#x201C; the natural grain of the wood is used to full effect. Himotoshi through the underside and back.

HEIGHT 5 cm HEIGHT 3.9 cm Condition: Worn condition with expected age cracks, a foot and the sandal have been restored. Provenance: European private collection.

Condition: Excellent condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ

Estimate EUR 1.500,Starting price EUR 750,-

Estimate EUR 400,Starting price EUR 200,-

76


235 | TWO WOOD NETSUKE OF BLIND MEN APPLYING MOXA

236 | GYOKKEI: A FINE INLAID WOOD NETSUKE OF A STONE LIFTER

Unsigned Japan, 19th century, Edo period (1615-1868)

%\*\RNNHLVLJQHG*\RNNHL Japan, late 19th century, Meiji period (1868-1912)

%RWKGHSLFWLQJEOLQGPHQDSSO\LQJ0R[DILQHSDWLQDRQHZLWKDQ inlaid eye.

A fine and compact netsuke depicting a stone lifter. His blinded eye and teeth are inlaid in ivory. Large himotoshi through the underside and signature GYOKKEI on an inlaid ivory tablet.

HEIGHT approx. 3.7 cm HEIGHT 3.5 cm Condition: Good worn condition, the first with a restored foot, the second with a chip on the cheek. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: Excellent condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Estimate EUR 400,Starting price EUR 200,-

Estimate EUR 400,Starting price EUR 200,-

237 | MIWA: A DARK WOOD NETSUKE OF A BOY WITH SHISHIMAI MASK

238 | GYOKUZAN: A WOOD NETSUKE OF HANASAKA JIJI

%\0LZDVLJQHG0LZD Japan, early 19th century, Edo period (1615-1868)

%\*\RNX]DQVLJQHG*\RNX]DQ Japan, 19th century

Carved from a dark-stained wood showing an appealing patina and depicting a boy wearing a festive Shishimai mask, banging on a drum before him. The boyâ&#x20AC;&#x2122;s face is carved minutely on the inside. The underside shows the characteristically large himotoshi and signature MIWA.

A wood netsuke of Hanasaka-jiji sitting on his resurrected tree stump, in his hands a basket of ashes with which he uses to revive the dead trees, here shown by the ivory inlaid flowers on the tree trunk. The underside shows the himotoshi, the smaller ringed in green-stained ivory and the signature inlaid in ivory GYOKUZAN.

HEIGHT 3.1 cm

HEIGHT 3.8 cm

Condition: Good, worn condition. No damages. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: Very good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Estimate EUR 400,Starting price EUR 200,-

Estimate EUR 400,Starting price EUR 200,-

77


239 | A GOOD TALL IVORY NETSUKE OF A STANDING SARUMAWASHI WITH MONKEY

240 | A RARE IVORY NETSUKE OF A SARUMAWASHI WITH TWO MONKEYS

Unsigned Japan, 18th century, Edo period (1615-1868)

Unsigned Japan, 19th century, Edo period (1615-1868)

Published:%DUU\'DYLHV2ULHQWDO$UW1HWVXNHDQGÎ&#x2013;QURIURP European Collections (London, 2002), no. 100, & Galerie Gemini & Ichimonji Art (Munich, 2004), no. 199.

An ivory netsuke of a sarumawashi (monkey trainer) standing and laughing with large glaring eyes inlaid in black lustrous horn. He is wearing a cap with an incised peach branch, has a food basket tied to his obi in front of him and is holding a taming stick in one hand and the monkeyâ&#x20AC;&#x2122;s paw in the other. The monkey is seated on his shoulder, mischievously holding his mouth as if he was about to laugh. The backside with a very good patina and angular himotoshi. HEIGHT 8.8 cm

A humorous ivory netsuke of a sarumawashi (monkey trainer) with his trained monkey climbing on his back and holding the arm of a large wild monkey. The proportions of the monkey and sarumawashi are very amusing. Furthermore, the monkey appears to be blind. The present netsuke appears to be a variant of Kintaro with two monkeys motif, though with a humorous twist. Good himotoshi through the underside and side. HEIGHT 3.1 cm Condition: Very good condition, appealing patina. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

Condition: Good, worn condition with expected age cracks and good patina. A section of the taming stick with an old and worndown loss. 3URYHQDQFH%DUU\'DYLHVWKHQ*DOHULH*HPLQL Î&#x2013;FKLPRQMLDUW then Luxembourg private collection.

242 | A FINE IVORY NETSUKE OF A SLEEPING SARUMAWASHI WITH MONKEY

Estimate EUR 800,Starting price EUR 400,-

Unsigned Japan, 18th century, Edo period (1615-1868)

241 | SHUNZAN: A WOOD NETSUKE OF YORIMASA KILLING THE NUE Signed Shunzan Japan, 19th century

The Sarumawashi (monkey trainer) was a street artist who performed tricks with his monkey. In this netsuke the monkey trainer is depicted sleeping, with a serene facial expression, while the normally obedient monkey is grabbing the basket of the food behind his back. The ivory bearing a very good patina and the large himotoshi on the underside. LENGTH 5.1 cm

Finely carved and depicting a Yorimasa in full armor holding down a large nue while ramming his sword into the legendary beastâ&#x20AC;&#x2122;s head; standing by side, his servant Ino Hayata stays alert.

Condition: Minor expected age cracks, the ivory slightly worn very good condition. Provenance: The 40-Year Collection of a London Gentleman.

LENGTH 4 cm Condition: Good condition. Provenance: European private collection. Estimate EUR 1.200,Starting price EUR 600,-

78

Estimate EUR 400,Starting price EUR 200,-


243 | FIVE WOOD NETSUKE, TWO SIGNED The second signed Tomotada, the fifth signed Tomoyuki Japan, 19th century to Meiji period (1868-1912)

The first depicting a rat in a basket of mushrooms, the second a recumbent ox, signed TOMOTADA, the third a tiger, the fourth a snail on a bamboo stalk with octopus tentacles and the fifth a standing frog wearing a pair of geta and carrying a lotus flower, inlaid eyes and signature TOMOYUKI.

HEIGHT 2.5 â&#x20AC;&#x201C; 5.4 cm Condition: The second with small damages, a crack and a restored paw, the fourth missing a snailâ&#x20AC;&#x2122;s tentacle and with a thin crack and the fifth with a tiny chip to the eye. The other two in good, worn condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

244 | ANRAKU: AN IVORY NETSUKE OF A MAN AND WOMAN WITH TIGER %\$QUDNXVLJQHG$QUDNX Japan, Osaka, 19th century, Edo period (1615-1868)

A rather large ivory netsuke depicting a man and woman dressed in elaborately decorated clothes, holding a large tiger. The tiger is finely carved with a well-expressed fur pattern, curling tail and snarling expression with inlaid pupils of dark horn. The woman is holding the tiger, while the man is looking at a food basket and scratching his head in confusion. Possibly they are wondering what to feed the tiger. Himotoshi on the underside and signature on an inlaid mother of pearl tablet ANRAKU. HEIGHT 4 cm, LENGTH 4.5 cm Condition: Very good condition, minor imperfections to material. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

245 | AN UNUSUAL AND EARLY IVORY NETSUKE OF A CHINESE SAGE WITH TIGER Unsigned Japan, 18th century, Edo period (1615-1868)

A large ivory netsuke set on a large, thick and quadratic base with sizable and well-hollowed out himotoshi. Depicted is a Chinese sage with a bemused facial expression as the little tiger in front of him is lying on his side, baring his genitals and scratching his ear with a mischievous grin. The immortal is wearing a cap and Chinese robes DQGLVOHDQLQJRQDQRUQDWHO\FDUYHGWDEOH%HDXWLIXO\HOORZLVKDQG honey patina. HEIGHT 4.7 cm Condition: Excellent condition, expected age cracks, remnants of red painting on the underside. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

79


246 | THREE FINE IVORY NETSUKE Unsigned Japan, 19th century, Edo period (1615-1868)

7KHJURXSFRQVLVWLQJRI.LQWDURD'XWFKPDQDQGD%LMLQZLWKFKLOG HEIGHT 4.4 â&#x20AC;&#x201C; 5.2 cm Condition: All in very good condition with expected wear, the Dutchman with some age cracks. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

247 | TWO IVORY NETSUKE, ONE OF A DUTCHMAN Unsigned Japan, 19th century, Edo period (1615-1868)

HEIGHT 5 and 5.2 cm Condition: Minor age cracks and surface scratches, overall good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

248 | FOUR WOOD NETSUKE The fourth signed Tomokazu Japan, 19th century to Meiji period (1868-1912)

The first depicting a boy with a Shishi mask, the second a boy pulling an ox, the third a tall netsuke of a Dutchmen with rooster and the fourth Jurojin with crane, the craneâ&#x20AC;&#x2122;s eyes inlaid, signed TOMOKAZU. HEIGHT 3.2 â&#x20AC;&#x201C; 9 cm Condition: The second and third in very good condition, the first and fifth with a restoration and the third with a tiny chip. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

249 | TWO IVORY NETSUKE OF BLIND MEN FIGHTING Unsigned, one with inlays Japan, Meiji period (1868-1912)

HEIGHT 3 and 4.6 cm Condition: The first with half of the cane missing, the second with three minor losses to the inlays. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

80


250 | TWO IVORY NETSUKE The first signed Hoshinsai, the second signed Kisei Japan, Meiji period (1868-1912)

The first of two Shojo drinking sake, signed HOSHINSAI, and the second of a carpenter taking a break eating rice, signed KISEI. HEIGHT 3.9 and 3.6 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

251 | AN AMUSING IVORY NETSUKE OF A MAN WITH MUSHROOM BASKET Unsigned Japan, 19th century, Edo period (1615-1868)

An amusing ivory netsuke of man, naked except for a loincloth, painfully exclaiming as his hand is stuck under a gigantic mushroom on top of a basket. His expression is quite ambiguous as he is happy about his find, however he is also obviously in pain. The weave pattern on the basket is very well carved. Large himotoshi through the underside. HEIGHT 3 cm, LENGTH 5 cm Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

252 | TWO FIGURAL IVORY NETSUKE The first unsigned, the second signed Ungai Japan, mid-19th century to Meiji period (1868-1912)

7KHILUVWRI%HQWHQDQGDWWHQGDQWVDQGWKHVHFRQG7RPRFKLND VFKRRORID%LMLQZLWKER\V HEIGHT 3.2 and 4.1 cm Condition: The first one with some discoloration to ivory and a repaired foot. The second in very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

253 | TWO IVORY NETSUKE, ONE MARINE IVORY Unsigned Japan, 19th century, Edo period (1615-1868)

Consisting of a reclining farmer on a mat of bamboo holding a sycle, and a marine ivory islander holding a sycle and fish. LENGTH 5.6 cm and HEIGHT 6.7 cm Condition: The farmer with some discoloration to the underside. Generally, both in very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

81


254 | FIVE WOOD NETSUKE, ONE SIGNED The third signed Randa Japan, 19th century to Meiji period (1868-1912)

The first two small netsuke depicting a man with an ox, the third a kappa seated next to a tent-like lotus leaf with a tiny frog inside, signed RANDA, the fourth Hanasaka-jiji and the fifth a kid with a dog. HEIGHT 3.3 – 3.8 cm Condition: The first three in good condition, the fourth with a crack and a chip and the fifth with a restored paw of the dog. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

255 | FIVE WOOD NETSUKE The second signed Gyokko, the fourth signed Masanao and the fifth signed Ryugyoku Japan, 19th century

The first depicting a blind stone lifter, his one open eye and two teeth are inlaid in ivory, the inlaid Gyokkei signature is missing, the second depicting Hanasaka-jiji with a basket of ashes sitting on his resurrected tree stump, ivory inlaid signature GYOKKO, the third a farmer sleeping, the fourth a blind masseur working his skills on a seated client’s shoulders, signed MASANAO, and the fifth a Nio on a giant sandal, signed RYUGYOKU. HEIGHT 2.5 – 4 cm Condition: The first missing the inlaid signature and with minor chips to feet, the second with a hardly noticeable chip and worn patina, the third with a crack, scratches and tiny chips, the fourth with a small chip and the fifth in good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

256 | FIVE WOOD NETSUKE, TWO SIGNED The first signed Masatomo, the fourth signed Hokei Japan, 19th century

The first a comical netsuke of the well-known subject of the blind masseur working his skills on a seated client’s shoulders, signed MASATOMO, the second a temple servant in flowing robes holding a lantern and a parasol, the third a man kneeling and polishing the floor, the fourth a carpenter signed HOKEI, and the fifth a Sambaso dancer, the feet and head in ivory and with movable tongue. HEIGHT 3.5 – 6.7 cm Condition: Overall good condition with expected wear, the fifth with a drilled hole to base. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

257 | A GROUP OF FOUR IVORY NETSUKE The first signed, the fourth signed Masayuki Japan, Meiji period (1868-1912)

The first and third depicting carpenters, the first signed. The second finely carved as Hotei and two boys playing a board game and the fourth a bell maker, signed MASAYUKI. HEIGHT 2.3 – 6 cm Condition: The first missing an object that he had between both feet. The second with a chip to base and expected age cracks. The third with cracks and a restored hand. The fourth in good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

82


258 | FIVE WOOD NETSUKE The fourth signed Hakugyoku Japan, 19th century

The first of a temple servant in flowing robes holding a lantern and a parasol, the second depicting Jurojin - the lucky god - with a boy, the third a man kneeling and polishing the floor, the fourth Kan’U holding a halberd, signed HAKUGYOKU, and the fifth a carpenter. HEIGHT 3.5 – 6.5 cm Condition: Overall good condition with expected wear, the second with a chip and a small restoration and the fourth with chips and red stains to base. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

259 | A GROUP OF THREE IVORY NETSUKE The third signed Ryoji Japan, 19th century to Meiji period (1868-1912)

The first a good netsuke of a Shishi with young, its mouth wide open with a loose ball inside, the second two boys playing with a mask, the mask’s eyes inlaid in metal; the third depicting Ashinaga and Tenaga working together to play a drum, signed RYOJI (a pupil of Ono Ryomin). HEIGHT 3.2 – 5.2 cm Condition: Overall good condition with expected age cracks, the third with a restored leg. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

260 | FIVE WOOD NETSUKE The first signed Ohara, the third signed illegibly Japan, 19th century

The first a netsuke of a Shishi with bell on a base, signed OHARA, the second depicting a frog, the third a boy wearing a Shishi mask, the fourth a recumbent ox and the fifth a rat on a basket, inlaid eyes. HEIGHT 1.2 – 3.5 cm Condition: All generally in good condition, few surface scratches. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.000,Starting price EUR 500,-

83


261 | THREE IVORY NETSUKE OF SHISHI Unsigned Japan, late 18th to early 19th century

HEIGHT 2.8 – 3.9 cm Condition: All in good condition with expected wear. The signature on the fourth Shishi is illegibly worn. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 700,Starting price EUR 350,-

262 | AN IVORY NETSUKE OF A SHISHI WITH BALL Unsigned Japan, probably Osaka, early 19th century, Edo period (1615-1868)

An amusing ivory netsuke of a Shishi with inlaid pupils of dark horn and a wide grin with an opened mouth and a loose ball inside. The fur is finely incised, and the curls all over his body form little smooth balls. Himotoshi through the large ball and underside of the lion dog. HEIGHT 3.7 cm Condition: Good condition, some age cracks and two teeth inside the mouth are chipped. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

263 | A GOOD IVORY NETSUKE OF FOUR SHISHI Unsigned Japan, 19th century, Meiji period (1868-1912)

An animated group depicting four Shishi, the adult Shishi is lying down and the three smaller ones try to get on his back. The bushy curls of the three Shishi are expressively carved. Small himotoshi through the underside and good honey patina. LENGHT 4.6 cm Condition: Good worn condition with expected age cracks, two microscopic chips to one paw. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ

264 | AN IVORY NETSUKE OF THREE FIGHTING SHISHI Unsigned Japan, Kyoto, 18th century, Edo period (1615-1868)

An animated group depicting three fighting Shishi. The adult Shishi on the bottom is being ambushed by another adult and young. The young bites into his bushy tail, while the adult climbs on top of him, ferociously snarling. The poor lion dog tries to defend himself, as he is visibly frightened, kicking the jaw of his attacker. The two adults both have a loose ball inside their mouths. Large, asymmetrical himotoshi through the underside. HEIGHT 3.3 cm, LENGTH 4 cm Condition: One old, smooth chip to the edge of the lower Shishi’s left front paw. Otherwise very good condition with an appealing patina. Provenance: French private collection. Estimate EUR 600,Starting price EUR 300,-

84

Estimate EUR 400,Starting price EUR 200,-


265 | FOUR IVORY NETSUKE OF SHISHI The fourth signed illegibly, the others unsigned Japan, late 18th to early 19th century

HEIGHT 3.1 â&#x20AC;&#x201C; 3.8 cm Condition: All in good condition with expected wear. The signature on the fourth Shishi is illegibly worn. 3URYHQDQFH%ULWLVKSULYDWH collection. Estimate EUR 800,Starting price EUR 400,-

266 | AN IVORY NETSUKE OF TWO FIGHTING SHISHI Unsigned Japan, 19th century, Edo period (1615-1868)

A rather large ivory netsuke of two fighting Shishi forming an ideally rounded composition. Each lion dog is fiercely biting into the opponents hindleg. Finely carved curls, inlaid pupils and natural himotoshi. LENGTH 5.5 cm Condition: Good condition, fine patina on the underside. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

267 | AN IVORY NETSUKE OF A SHISHI STATUE SIGNED TOMOKAZU Signed Tomokazu Japan, Meiji period (1868-1912)

An amusing ivory netsuke of a Shishi statically standing upright OLNHWKHVWDWXHVWKDWIODQNWKHHQWUDQFHVRI%XGGKLVWVKULQHVDQG temples. The guardian lion has its mouth opened, and a curly mane and bushy tail accentuated with ink. Natural himotoshi and signature TOMOKAZU in a wavy reserve in an unusual place near the tail. HEIGHT 5.4 cm Condition: Very good condition, minor age cracks. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 400,Starting price EUR 200,-

85


268 | A WOOD NETSUKE OF A SHISHI ROLLED INTO A BALL

269 | MASATOMO: A POWERFUL WOOD NETSUKE OF A SHISHI WITH BALL

Unsigned Japan, 19th century, Edo period (1615-1868)

%\0DVDWRPRVLJQHG0DVDWRPR Japan, 19th century, Edo period (1615-1868)

The netsuke is carved from wood and the ball, which resembles a tama (magical pearl), is made from ivory. The expression is grim with double-inlaid ivory eyes. Natural himotoshi, loose ball inside the mouth, and another opening on the underside, as to be mounted on a cane.

Nagoya school. Depicted is a seated roaring Shishi with bared fangs, eyes with inlaid pupils and dense finely carved bushy curls covering its tail, beard and head. The Shishi holds a brocade ball between two paws and has its head turned. The underside with natural himotoshi and signature MASATOMO within a rectangular reserve.

HEIGHT 2.7 cm HEIGHT 3.5 cm Condition: Good condition with few smaller cracks in the wood. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 500,Starting price EUR 250,-

270 | A LARGE POWERFUL WOOD NETSUKE OF A SHISHI ON A ROCK Unsigned Japan, 18th century, Edo period (1615-1868)

A powerfully carved composition of a Shishi seated on a rock and looking backwards. Himotoshi to the underside. HEIGHT 4 cm, LENGTH 6 cm Condition: Good condition, remnants of black and red lacquer 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

Condition: A small part of the base has been restored, otherwise very good condition. Provenance: French Private collection acquired in 1995 from an antiques dealer in Italy, by repute. Estimate EUR 1.200,Starting price EUR 600,-

271 | NAKATSUGU: A LARGE WOOD NETSUKE OF A SHISHI WITH BALL Signed Nakatsugu with kakihan Japan, 19th century, Edo period (1615-1868)

A large and powerful wood netsuke of a Shishi with a comical expression, enhanced by large eyes inlaid in pale horn. The Shishi lets out an enigmatic snarl and places one paw firmly on a smooth round ball. The underside shows the very large himotoshi (the other through its side) and the signature inside a rectangular reserve NAKATSUGU with kakihan. HEIGHT 4.5 cm, LENGTH 5.5 cm Condition: Good condition. The surface is slightly worn and there is one thin crack by the right front leg. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

86


272 | A WOOD NETSUKE OF A SHISHI ATTRIBUTED TO TOMOCHIKA

273 | A WOOD NETSUKE OF A SHISHI IN TAMETAKA STYLE

Unsigned, attributed to Tomochika Japan, 19th century, Edo period (1615-1868)

Unsigned Japan, Nagoya, early 19th century, Edo period (1615-1868)

Depicting a Shishi with a slightly crazed expression, placing one paw firmly on a smooth ball in front of it. The bushy mane and tail are well-carved. Natural himotoshi.

The Shishi is firmly clutching a ball and looking to the side with a whimsical expression, eyes inlaid. Well-carved curls and excellent himotoshi to the underside. In the manner of Tametaka.

HEIGHT 4.1 cm

HEIGHT 3.7 cm

Condition: Excellent condition with minor surface wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ

&RQGLWLRQ([FHOOHQWFRQGLWLRQ%HDXWLIXOSDWLQD Provenance: Austrian private collection.

Auction comparison: Compare to a related model attributed to 7RPRFKLNDVROGE\%RQKDPV)LQH-DSDQHVH$UW0D\ London, lot 40.

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 800,Starting price EUR 400,-

275 | TWO FINE WOOD NETSUKE The eggplants by Masanao of Ise Yamada, signed Masanao Japan, 19th century

274 | A RARE AND LARGE INLAID WOOD NETSUKE OF A SHISHI Unsigned Japan, 19th century, Edo period (1615-1868)

The first depicting a fine group of five eggplants (nasubi), signed MASANAO, the second a fine netsuke of a Shishi with ball. HEIGHT 2.5 â&#x20AC;&#x201C; 3.5 cm

The lion dog has its hind paw raised to scratch its chin. The eyes and individual swirls covering its body are inlaid in mother-ofpearl. HEIGHT 5.3 cm, LENGTH 6 cm

Condition: Very good condition. Provenance: French private collection. Estimate EUR 600,Starting price EUR 300,-

Condition: Minor surface wear. Good condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

87


276 | TWO IVORY NETSUKE OF A TANUKI WITH RABBIT The first signed Tomoyuki, the second signed Hogyoku Japan, Meiji period (1868-1912)

HEIGHT 3.4 and 4 cm &RQGLWLRQ%RWKLQH[FHOOHQWFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ

277 | HIROMITSU: RARE BRONZE AND IVORY NETSUKE DEPICTING THE BUNBUKU CHAGAMA

Estimate EUR 400,Starting price EUR 200,-

%\+LURPLWVXVLJQHG+LURPLWVX Japan, 19th century, Edo period (1615-1868)

An unusual netsuke consisting of a bronze bowl and a rectangular ivory plate with a himotoshi loop in the back. The ivory plate depicts WKHOHJHQGIURP-DSDQHVHIRONORUHRIWKH%XQEXNX&KDJDPD)LQHO\ carved in shishiabori (sunken relief), the man is visibly delighted holding the tanuki tea kettle. Signature HIROMITSU in the front. LENGTH 4 cm Condition: Very good condition, the bowl with some oxidation on the inside. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sothebyâ&#x20AC;&#x2122;s, by Neil K. Davey, dated 1974 & 1984, inventory no. 167. Estimate EUR 300,Starting price EUR 150,-

278 | SHORAKU: AN IVORY AND MIXED METAL KAGAMIBUTA OF THE BUNBUKU CHAGAMA FOLKTALE Signed Raku Japan, 19th century

The bowl is made of ivory and the lid of iron with gold details GHSLFWLQJWKHOHJHQGRIWKH%XPEXNX&KDJDPD EDGJHUWHDNHWWOH  According to Japanese folklore, a poor man sets a tanuki free, which in return transforms into a kettle, so that the man can perform with it on the street and become wealthy. DIAMETER 4 cm Condition: A crack to the ivory, otherwise good worn condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ

279 | A FINE MARINE IVORY NETSUKE OF A NAMAZU WITH MAN Unsigned Japan, 19th century, Edo period (1615-1868)

The namazu is a mythological creature, a giant catfish that causes earthquakes when it moves. The only way to calm it is by using a magical double-gourd (hyotan). This netsuke also shows a man, naked except for a loincloth and without the hyotan, his hands laid on the fish, evidently attempting to calm it, but without the gourd a futile endeavor. The namazuâ&#x20AC;&#x2122;s eyes are inlaid with dark horn, large and appear lurking. Himotoshi on the underside. LENGTH 4.6 cm Condition: Good condition, beautiful patina, possibly one eye replaced. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

88

Estimate EUR 300,Starting price EUR 150,-


280 | WAHEI: A RARE PORCELAIN NETSUKE OF A TANUKI Sealed Wahei Japan, 19th century, Edo period (1615-1868)

In the shape of a tanuki holding a gourd-shaped flask in front of him and wearing a wide-brimmed hat. Sealed on the underside WAHEI. HEIGHT 4 cm Condition: Very good condition with minor wear to glaze. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 700,Starting price EUR 350,-

281 | HOGYOKU: A FINE IVORY NETSUKE OF A TANUKI PRIEST %\+RJ\RNXVLJQHG+RJ\RNX Japan, Edo, mid-19th century, Edo period (1615-1868)

A fine and precisely carved work with dark brown contrasting staining of the ivory. The old crouched man has a monkey-like face, but that is not all. He is wearing a full-length garment, his hair in a bun, and is operating a barrel with one finely carved â&#x20AC;&#x153;handâ&#x20AC;?. A peak on the underside however reveals paws and a thick tail, which is not a monkey tail but that of a tanuki, which has the ability to shapeshift and could transform into a priest. Small himotoshi on the side and the signature on the underside of the barrel HOGYOKU. The artist was a student of the great Hojitsu from Edo/Tokyo. HEIGHT 4 cm Condition: Very good condition, small nerve channel visible in the back. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

282 | A TALL WOOD NETSUKE OF A FOX PRIEST Unsigned Japan, 18th century, Edo period (1615-1868)

Kitsune (fox) are creatures imbued with a lot of mythological meaning, as they can change forms, like a tanuki, and are believed to be animated by devils. In this netsuke the fox with a sly expression is disguised as a priest wearing the corresponding flowing robes and leaning on a cane, the paw that is visible is that of DIR[%HDXWLIXOSDWLQDDQGJRRGLUUHJXODUKLPRWRVKLVKRZLQJVLJQV of wear through the back. HEIGHT 8 cm Condition: Old and smooth chip to the hem of the robe, otherwise good condition with a very good patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQVWRUHGLQDEDQNYDXOWIRU years, collection no. 82. Estimate EUR 600,Starting price EUR 300,-

89


283 | A POWERFUL WOOD NETSUKE OF A WOLF WITH A SKULL Unsigned Japan, 18th century, Edo period (1615-1868)

The wolf is large as well as finely and expressively carved, the reddish wood polished to a shine and with black staining for contrast. “Okami” for wolf is homophonous to Okami, meaning “great god”, as the wolf used to be called out of respect for the animal. Natural himotoshi between the legs and through the skull. A powerful and early netsuke. HEIGHT 3.6 cm, LENGTH 5.5 cm Condition: One of the lower incisors is chipped otherwise good condition with minor wear and a good patina. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 105. Estimate EUR 800,Starting price EUR 400,-

284 | AN EBONY WOOD NETSUKE OF A SKULL Unsigned Japan, late 19th century

An anatomically quite accurate skull, a symbol of mortality. Large staring eyes and well-carved individual teeth in the upper jaw. LENGTH 3.5 cm Condition: Good worn condition with few surface scratches. Provenance: European private collection. Estimate EUR 800,Starting price EUR 400,-

285 | A VERY RARE HORNBILL IVORY NETSUKE OF A COCKEREL AND HEN Unsigned Japan, late 19th century

Hornbill ivory netsuke (from the helmeted hornbill or rhinoplax vigil) are very rare. The shape of the beak is recognizable in this netsuke, with the tapering end being wafer-thin, and the red section of the bill being expressed on the sides. The two birds are huddled side by side looking askance at each other. The plumage is very well carved, himotoshi on the reverse and the eyes inlaid with the red material from the horn. HEIGHT 5 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

90


286 | FURAI: A WOOD NETSUKE OF TENGU NO TAMAGO Signed Furai Japan, 18th century

Depicting a tengu hatching from its egg, both wings spread over the shell. The mythical creature wearing a tokin cap, the underside is signed â&#x20AC;&#x153;FURAI, eighty-two years oldâ&#x20AC;?. LENGHT 4 cm Condition: Very good condition. Provenance: European private collection. Estimate EUR 400,Starting price EUR 200,-

287 | TWO IVORY NETSUKE The first signed Shungyoku, the other unsigned Japan, 19th century, Edo period (1615-1868)

The first an ivory netsuke of a monkey on top of a large and flat fish. Finely carved and the fish with finely inlaid eyes. The second of the luck deity Ebisu with puffer fish. HEIGHT 2.2 and 3 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQZLWKH[SHFWHGZHDUDQG minor age cracks. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

288 | DERKACHENKO: A BOXWOOD NETSUKE OF TENGU NO TOMAGO %\$OH[DQGHU'HUNDFKHQNRVLJQHG'HUNDFKHQNR Ukraine, 2018

Finely carved from stained boxwood and depicting a tengu hatching from an egg. Finely carved details, such as the feather work, expression and crisply carved claw visible on the underside. Himotoshi in the back next to the inlaid artistâ&#x20AC;&#x2122;s signature. HEIGHT 3 cm Condition: Excellent condition. Estimate EUR 400,Starting price EUR 200,-

289 | TWO WOOD NETSUKE OF A FROG AND A MINOGAME Unsigned Japan, 19th century

The first depicting a frog on a lotus leaf and the second a minogame on an awabi, both the â&#x20AC;&#x153;straw raincoat-turtleâ&#x20AC;? PLQRJDPHbDQGWKHDZDELVKHOODUHV\PEROVRIORQJHYLW\ LENGTH 4 - 4.7 cm Condition: Overall good condition, the first with minor losses to webbed feet, the second with two tiny chips. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 900,Starting price EUR 450,-

91


290 | RANSEN: AN IVORY NETSUKE OF A STAG ON BASE %\5DQVHQVLJQHG5DQVHQ Japan, Kyoto, late 19th century

The deer has its head titled backwards and is looking downwards with beautifully double-inlaid eyes in black and pale-translucent horn. Its body is contorted and supported on finely carved thin legs. The entire composition is set on a stippled base, smooth on the underside where also the two small himotoshi are located as well as the signature RANSEN in a rounded reserve. School of Hogen Ranten of Kyoto. HEIGHT 3.7 cm Condition: Very good condition, four age cracks through the body and some wear to the black coloring across the spine. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

291 | A FINE IVORY NETSUKE OF A RECUMBENT DEER Unsigned Japan, first half of the 19th century, Edo period (1615-1868)

A very sensitive, animated and finely elegant depiction of a spotted deer (shika). The deer has its head turned back with a friendly face with black inlaid eyes and long curved antlers attached on the back. The leg composition on the underside is appealing. Good himotoshi on the underside. HEIGHT 2.7 cm, LENGTH 4.4 cm Condition: Very good condition, the surface of the ivory slightly worn, and one eye is not original. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 1.500,Starting price EUR 750,-

292 | AN IVORY NETSUKE OF A RECUMBENT SHIKA DEER Unsigned Japan, 19th century, Edo period (1615-1868)

An elegant depiction of a spotted deer (shika). The deer has its head turned back, the eyes inlaid in black and with its tongue sticking out. LENGTH 5 cm Condition: Good condition with expected age cracks. Provenance: European private collection. Estimate EUR 1.200,Starting price EUR 600,-

92


294 | A RARE IVORY NETSUKE OF A CAT AND A SMALL MONKEY Unsigned Japan, first half of the 19th century, Edo period (1615-1868)

293 | AN EARLY AND FINE IVORY NETSUKE OF A PIEBALD CAT ON STRAW BROOM Unsigned Japan, mid-18th century, Edo period (1615-1868)

An early ivory netsuke with an incredibly rich honey patina depicting a domesticated piebald cat lying densely curled up on a straw broom. The surface on the broom is very well carved and the himotoshi are on the underside and exactly as they should be. LENGTH 4.5 cm

The large, recumbent cat (neko) forms a circle, its long tail does so as well. It is wearing a collar and appears to be quite pleased. A small monkey, tiny compared to the cat, is climbing on its back, and holds a peach in its paw, a symbol of longevity. Very wellrounded composition, fine patina, very large himotoshi on the underside. HEIGHT 2.1 cm, LENGTH 3.8 cm Condition: One paw reattached, otherwise good condition with few age cracks and stunning patina, especially on the underside. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 33. Estimate EUR 600,Starting price EUR 300,-

Condition: Several age cracks, very fine patina. The stem of the broom has been lost. It appears that the cat is carved separately as a metal screw on the underside holds in place. Another metal screw has previously held the stem of the broom in place as well. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 159. Estimate EUR 400,Starting price EUR 200,-

296 | A WOOD NETSUKE OF A CAPARISONED ELEPHANT ON A BASE Unsigned Japan, 19th century, Edo period (1615-1868)

A wood netsuke depicting a caparisoned elephant with a jovial expression standing on a base. The ornately decorated saddle is well-carved, as are the many skin folds and clawed feet. Singular central himotoshi through the base.

295 | A WOOD NETSUKE OF A SLEEPING PIEBALD CAT ON A FAN Unsigned Japan, early 19th century, Edo period (1615-1868)

The well-fed piebald cat (neko) is lying curled up on a large fan with its head resting on the crossed paws in front of it. The eyes are closed, and its expression is the epitome of calmness with a hint of fatigue. The underside with the finely carved ribbed surface of the fan and perfectly crafted, asymmetrical himotoshi.

HEIGHT 3.6 cm Condition: Very good and original condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 106. Estimate EUR 400,Starting price EUR 200,-

HEIGHT 2.2 cm, LENGTH 4.8 cm Condition: Very good condition. Miniscule age-related nicks and wear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sotheby’s, by Neil K. Davey, dated 1974 & 1984, inventory no. 133. Estimate EUR 600,Starting price EUR 300,-

93


297 | A LARGE WOOD SASHI NETSUKE OF A DRIED SALMON (WITH IVORY) Unsigned Japan, 19th century, Edo period (1615-1868)

The large dried fish carved from lightly colored wood and accentuated with black lacquer. A fish market scene carved with an incredibly sense of realism. The scaly body is desiccating with different levels of elevation on the surface. With a large inlaid ivory tablet reading Ç&#x2022;á¶&#x20AC;, relating to the origin of the salmon. LENGTH 15.5 cm Condition: Very good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ

298 | A FINE IVORY NETSUKE OF A BAMBOO STALK VESSEL

Estimate EUR 400,Starting price EUR 200,-

Unsigned Japan, 19th century, Edo period (1615-1868)

A finely polished, elegant netsuke of a vessel made from a EDPERRVWDONWKHLQVLGHKROORZHGRXWYHU\ZHOO%DPERR WDNH  is a symbol of loyalty and longevity, as it is flexible and tough but of a poetic appearance. The bamboo leaves in high relief on the front evoke this idea particularly well. Singular himotoshi on the reverse. HEIGHT 3.6 cm Condition: Excellent condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQZLWKWZRYDOXDWLRQVIURP Sothebyâ&#x20AC;&#x2122;s, by Neil K. Davey, dated 1974 & 1984, inventory no. 57. Estimate EUR 600,Starting price EUR 300,-

299 | A RARE HAKO PEACH PIT NETSUKE OF A CRAB, FISH AND LOBSTER Unsigned Japan, 19th century, Edo period (1615-1868)

300 | AN UNUSUAL AND LARGE STAG ANTLER AND WOOD HAKO NETSUKE WITH LOTUS AND CRAB PEONY Unsigned Japan, 19th century, Edo period (1615-1868)

The netsuke consists of two parts, the top section shows the crab shell (carapace). The base shows the underside and pincers and at the bottom a fish and a lobster. The cord attachment is provided through a loop on the inside of the top section. LENGTH 3.5 cm Condition: Minor wear and a thin crack, otherwise good condition. Provenance: European private collection. Estimate EUR 800,Starting price EUR 400,-

A rare and functional hako netsuke. The bowl in the form of a lotus leaf, the veiny structure visible on the underside, and the top section decorated with many clouds. The inside is hollowed out, with the natural bony structure of the inside of the material visible, and was used to store something, most likely medicine or herbs. The lid is carved from kokutan (ebony) and incised with a crab peony on the top. The lid is hinged with metal fittings and screws and opens and closes perfectly. The himotoshi through a carved looped handle on the underside. DIAMETER 6 cm Condition: Excellent condition. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 300,Starting price EUR 150,-

Two views

94


302 | A WOOD NETSUKE OF A GROUP OF COINS Unsigned Japan, 19th century, Edo period (1615-1868)

Five piles of five coins each on top of each other with a square hole in the center, except for one group with a circular hole. Different line patterns are neatly incised, and the wood is colored. Natural himotoshi. LENGTH 6.1 cm Condition: Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQROGLQYHQWRU\QXPEHU Estimate EUR 400,Starting price EUR 200,-

303 | TWO WOOD NETSUKE OF A FRUIT AND A GOURD Unsigned Japan, 19th century

The first a fine netsuke of a group of fruits, the largest partly peeled and attached to a stalk and leaf, the inside showing an inlaid fruit. The second a rustic depiction of a gourd. LENGTH 3.5 â&#x20AC;&#x201C; 4.5 cm

301 | RYUSAI: A LARGE ASAKUSA SCHOOL OBIHASAMI STAG ANTLER NETSUKE WITH REISHI %\5\XVDLVLJQHG5\XVDLZLWKVHDONRNX Japan, Tokyo, Asakusa School, second half of 19th century

Condition: The first in very good condition, the second with a restoration and few chips. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

A large obi-hasami (inserted into the belt) stag antler netsuke in the form of a long growth of eight reishi mushrooms, attached to one thick stem, beautifully and elegantly intertwining with each other. Reishi fungus are a symbol for longevity, and the number eight is considered lucky â&#x20AC;&#x201C; making this an emblem of long life and luck. Signed RYUSAI with seal koku. School of Ozaki Kokusai. HEIGHT 22.8 cm Condition: A section (roughly 2.5 cm) of a stem of one reishi has been restored. Otherwise excellent condition. 3URYHQDQFH%ULWLVKFROOHFWLRQSUHYLRXVO\RIIHUHGDW%RQKDPV Fine Japanese Art, 10 November 2016, lot 327. Estimate EUR 1.200,Starting price EUR 600,-

95


305 | AN IVORY MANJU NETSUKE AND AN IVORY BELT BUCKLE Unsigned Japan, 19th century to Meiji period (1868-1912)

Two views

304 | A RARE, UNUSUAL AND LARGE IVORY MANJU NETSUKE WITH CALLIGRAPHY LISTING 62 OF 69 STATIONS OF THE KISO KAIDO ROAD

The lot consists of an ivory manju netsuke and an ivory belt buckle. The manju depicts a crab-fishing boy surprised by the appearance of a female crab with many eggs on top. The belt buckle showing a courtesan with a man behind her. DIAMETER manju c. 5.3 cm, SIZE belt buckle 3.2 x 3 x 0.7 cm (H x L x W)

Unsigned Japan, 19th century, Edo period (1615-1868)

Condition: The manju and belt buckle with age cracks and minor surface scratches. Complete condition. Provenance: Old Zagreb private collection.

This rare and unusually thick manju has a very good feel in the hand and is stained to great effect. Inscribed meticulously in 62 rectangular reserves are 62 of 69 stations of the Kiso Kaido road, which originates from a series of woodblock prints titled ‘the sixty-nine stations of the Kiso Kaido’ created by Utagawa Hiroshige and Keisai Eisen. 62 of these 69 stations are inscribed on both sides of this manju next to a serene drawing of a bird and flower. On the reverse the inscription “sixty-nine stations” and “Tsugi”. Himotoshi through the center with a peg to tie the cord.

Estimate EUR 500,Starting price EUR 250,-

DIAMETER 4.8 cm, HEIGHT 1.6 cm Condition: An approximately 2.5 cm wide crack is faintly visible on both sides; otherwise in very good condition. Provenance: Collection of Sam Felton with CITES permit no. 18US59513C/9. Purchased from Norman L. Sanfield on 18th August 1979 (old invoice available). Estimate EUR 400,Starting price EUR 200,-

307 | SHUNGYOKU: AN UNUSUAL INLAID EBONY WOOD INLAID NETSUKE WITH TEA MERCHANT Signed Shungyoku Japan, 19th century, Edo period (1615-1868)

An ebony wood two-part manju, carved in the front with a smoking tea merchant carrying his wares suspended from his neck and with an ivory-inlaid parasol next to him. The pipe’s smoke is amusingly depicted with bubbles inlaid in ivory and mother of pearl. The backside shows a carved crawling infant, the signature SHUNGYOKU and central floral himotoshi. DIAMETER 4 cm

306 | TWO CIRCULAR FINE PRESSED HORN MANJU NETSUKE The second signed Japan, 19th century

DIAMETER 4.3 and 4 cm &RQGLWLRQ%RWKULPVZLWKFKLSVDQGH[SHFWHGFUDFNOLQJ 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

96

Condition: Minor nicks, surface wear, discoloration. Good worn condition. Provenance: European private collection. Estimate EUR 600,Starting price EUR 300,-


308 | KOJU: IVORY MANJU NETSUKE WITH FISHING KARAKO %\.RMXVLJQHG.RMXZLWKNDNLKDQ Japan, Edo/Tokyo, mid-19th century

An ivory two-part manju carved in shishiabori (sunken relief) depicting two karako fishing in a basin. One has his hands entirely submerged inside the basin while the other, visibly delighted, is pulling out a small fish. One of the boys is wearing a peculiar cape with engraved turtle shell patterns. The reverse finely incised with a scarecrow, votive tablet (ema) and crane inside a bonseki (miniature landscape). Central hole for himotoshi and signed KOJU with characteristic red kao. DIAMETER 4.7 cm Condition: Very good condition, minor discoloration around the himotoshi. Provenance: Ex Herbert Mew Collection, Dorset UK (1881-1946). Estimate EUR 600,Starting price EUR 300,-

309 | A WOOD MANJU NETSUKE OF A WARRIOR Unsigned Japan, 19th century, Edo period (1615-1868)

A two-part wood manju netsuke showing a warrior against an asanoha-ground. The backside shows a finely carved chrysanthemum. This manju was likely supposed to be lacquered in tsuishu red. DIAMETER c. 5 cm Condition: Good condition, remnants of black lacquer. Provenance: Austrian private collection. Estimate EUR 500,Starting price EUR 250,-

311 | KAZUMASA: A WOOD TWO-PART MANJU NETSUKE Signed Kazumasa Japan, 19th century, Edo period (1615-1868)

Carved in high relief with an image of a fierce warrior holding a staff. The backside with finely engraved tumbling waves and signature KAZUMASA. DIAMETER c. 4.7 cm Condition: Minor associated wear. Provenance: French private collection.

310 | AN INLAID WALRUS TUSK IVORY RYUSA MANJU DEPICTING RIHAKU

Estimate EUR 500,Starting price EUR 250,-

Unsigned Japan, Asakusa, mid to late 19th century

A beautiful choice piece of walrus tusk ivory carved into a luscious ryusa manju depicting leafy stalks of bamboo, a thatched hut and many clouds. The center is inlaid with a silver-gilt figure depicting WKHSRHW5LKDNX LQ&KLQD/L%DL QH[WWRDKXJHGRXEOHJRXUG filled with sake (the drink of the immortals). Central himotoshi in the back. DIAMETER 4.1 cm, WIDTH 2.3 cm Condition: Very good condition, the facial features on the inlay slightly worn. Provenance: Austrian private collection. Estimate EUR 800,Starting price EUR 400,-

97


313 | RYUMIN: AN IVORY AND SHIBUICHI KAGAMIBUTA %\6HUL]DZD5\XPLQVLJQHG5\XPLQZLWKNDR Japan, 19th century, Edo period (1615-1868)

The shibuichi plate depicting two women harvesting rice. The background shows finely incised mountains and ships. Set in an ivory bowl. Signed RYUMIN with kao. DIAMETER 4.4 cm Condition: The ivory bowl with a crack. Otherwise fine condition. Provenance: European collection.

312 | THREE KAGAMIBUTA NETSUKE

Estimate EUR 500,Starting price EUR 250,-

Unsigned Japan, 19th century, Edo period (1615-1868)

The first kagamibuta netsuke of an actor playing as Kamakura Gongoro Kagemasa in the kabuki play Shibaraku. The second showing a mandarin duck on a rock underneath a Fuji tree with hanging blossoms and a peony blossom in front of the duck. The third of Shoki, his face showing a characteristically grim expression, and a horned oni close beside him with a gleeful expression, its head made from copper. DIAMETER 3.5 - 4.6 cm Condition: The ivory bowl of the first with some discoloration and cracks and the inside area of the bowl with some glue residue; the lid with greenish patina. Generally, in good condition. The second in excellent condition. The third ivory bowl with a crack, and missing the central section at the back, otherwise good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 300,Starting price EUR 150,-

315 | A MECHANICAL KUROGAKI WOOD MASK NETSUKE OF A SHISHI Unsigned Japan, 19th century, Edo period (1615-1868)

314 | TWO IVORY NETSUKE OF MASKS The first signed Mitsuyuki, the second unsigned Japan, 19th century, Edo period (1615-1868)

The Shishi head carved with movable floppy ears and a jaw. The tama on its head is used to control the movable parts. HEIGHT 4.6 cm

HEIGHT each 4.3 cm &RQGLWLRQ%RWKLQYHU\JRRGFRQGLWLRQ 3URYHQDQFH%ULWLVKFROOHFWLRQ

Condition: Good condition. The mechanical part is stiff and not fully working, though the individual parts are still movable. 3URYHQDQFH%ULWLVKFROOHFWLRQ

Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 400,Starting price EUR 200,-

98


316 | HAKUUNSAI: AN IVORY RYUSA MANJU NETSUKE OF A MULTITUDE OF NOH MASKS %\+DNXXQVDLVLJQHG+DNXXQ Japan, c. mid-19th century, Edo period (1615-1868)

This netsuke shows a multitude of different Noh masks, one next to the other around the entire work, all from Japanese theatre and folklore. Natural himotoshi through the openwork, signed on a flat bottle gourd HAKUUN, for Hakuunsai, a master of dense mask compositions. WIDTH 3.5 cm Condition: The ink and red paint is slightly worn, very good condition. Provenance: The 40-Year Collection of a London Gentleman. Estimate EUR 300,Starting price EUR 150,-

317 | A BONE NETSUKE OF A HANNYA MASK Unsigned Japan, 19th century, Edo period (1615-1868)

This bone netsuke depicts Hannya. Himotoshi through the central bridge on the back. HEIGHT c. 5 cm Condition: Good, worn condition. Provenance: Old Zagreb private collection. Estimate EUR 300,Starting price EUR 150,-

318 | FIVE IVORY AND MIXED METAL KAGAMIBUTA NETSUKE The first signed and by Naohiro, the second signed and by Ryumin, the third unsigned, the fourth signed Nagatsune and the manju signed Chisei Japan, 19th century, Edo period (1615-1868)

The first kagamibuta netsuke of a large and flawless ivory bowl with the lid depicting Kanzan and Jittoku. Very fine work from an important metalwork school â&#x20AC;&#x201C; signed NAOHIRO. The second depicting Omori Hikoichi carrying the witch after the battle of Minatogawa. Signed RYUMIN with kao. A student of Tenmin. The third depicting the wind god Futen amongst billowing clouds. The fourth kagamibuta depicting a monkey with young. The backside of the lid signed NAGATSUNE and saku with a long inscription relating to a painting. The ivory manju with a village scene carved in shishiabori. Signed CHISEI and to (made). DIAMETER 4.6 - 5.3 cm Condition: The first in excellent condition; the second with some wear to the side of the lid - the mid-section on the backside of the ivory bowl has been glued. The third with several cracks on the bowl glue residue on the inside. The fourth kagamibuta with age cracks but generally in very good condition. The manju with some soiling and missing the peg in the middle. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 500,Starting price EUR 250,-

99


319 | A GROUP OF FIVE MASK NETSUKE Two by the Deme family, one signed with a kao, one signed Tamamaru, one signed Hozan-o (Hozan Takahashi). Japan, 19th century, Edo period (1615-1868)

Depicting Hannya, Okame and two grimacing faces. HEIGHT 3.6 – 4.8 cm Condition: All in good condition with traces of use and wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

320 | A GROUP OF FIVE WOOD MASK NETSUKE One signed Gyokuzan and another signed Seisen Japan, 19th century, Edo period (1615-1868)

Depicting Ikkaku Sennin and Jo. HEIGHT 4.7 – 5.7 cm Condition: Expected traces of use and wear. The Gyokuzan Ikkaku Sennin with a chip to the back. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 800,Starting price EUR 400,-

321 | TWO MINIATURE WOOD MASKS Signed Masamichi and Masaharu Japan, 19th century, Edo period (1615-1868)

Each finely carved as a grimacing man sticking out his tongue. The earholes were probably used for suspension. Signed in gold lacquer on the back. HEIGHT 5.2 cm Condition: Very good condition. The right mask with a tiny chip to the right side of the head. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 400,Starting price EUR 200,-

322 | A GROUP OF FOUR MASK NETSUKE Two by the Deme family, and one signed Gyokko

Depicting Ran-Ryo, Hannya and a grimacing man with goldlacquered eyes. HEIGHT each ca. 5 cm Condition: Good, used condition. One Hannya mask with a lost horn and the Ran-Ryo mask with repaired crack to the bridge in the back. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

100


323 | $/27:Î&#x2013;7+7:(/9(Î&#x2013;925<12+0$6.6b Japan, Meiji period (1868-1912)

All twelve miniature masks with accentuated staining and openwork carving at the eyes, nostrils and mouths. Depiction of various FKDUDFWHUVVXFKDV+RWHL'DLNRNX%HQWHQ%LVKDPRQRU2NDPH HEIGHT 2.5 cm each Condition: All twelve masks (!) are in excellent condition with hardly any wear. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ&ROOHFWHGSULRUWR Estimate EUR 400,Starting price EUR 200,-

324 | A LACQUERED BUGAKU MASK OF BATO Japan, Meiji period (1868-1912)

The mask lacquered in red and with gilded eyes, fierce expression and large nose. Signed and stamped on the back. SIZE ca. 27.5 x 22.5 cm Condition: Age-related condition, minor wear to pigments and a few cracks. Provenance: Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

325 | A LACQUERED TENGU CEREMONIAL MASK Japan, Meiji period (1868-1912)

Carved in wood with its characteristic long nose, lacquered in red and with remnants of gilding. SIZE ca. 20.5 x 15 cm Condition: Age-related condition, wear to pigments and restored nose. Provenance: Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

101


327 | A FOUR-CASE LACQUER INRO WITH COCKEREL AND LACQUER MANJU NETSUKE %\7RNRVDL0DVDKLJHDQG7RVKXVDLVLJQHG Tokosai Masashige and kao, and Toshusai Japan, early 19th century, Edo period (1615-1868)

A four-case inro showing on one side a cockerel in front of a bamboo stalk, decorated in fine togidashi-e and hiramaki- e on matt gold fudame, depicting a cockerel next to bamboo on one side and a hen with a small bird and more bamboo on the other. Gold nashiji on the interior of the cases. Signed TOKOSAI MASASHIGE and KAO on the underside, a well-known lacquer artist. Very small characters EISHIN and (possibly) KAO, which could however also mean â&#x20AC;&#x153;fame and loyaltyâ&#x20AC;?, next to the cockerel.

326 | A STAG ANTLER KISERUZUTSU DEPICTING KAPPA Unsigned Japan, 19th century, Edo period (1615-1868)

The pipecase of senryu-zutsu type carved in the form of an elongated ape-like kappa, holding one hand as if he was picking fleas, and the other hand near his crotch. His expression is curious, looking downwards with a piercing gaze. Perhaps a humorous and hidden meaning is that the pipe would go through his head, where the kappa keeps his vital fluids â&#x20AC;&#x201C; though he does not seem to mind. Animal hair is used for the hair on the kappaâ&#x20AC;&#x2122;s head and the natural structure of the antler is used replicate the scaly skin on the creatureâ&#x20AC;&#x2122;s arm. HEIGHT 19.4 cm Condition: Good condition, losses to animal hair. Provenance: European private collection.

328 | A FINE LACQUERED FOUR-CASE INRO Japan, 18th century, Edo period (1615-1868)

The image on both sides is executed in gold lacquer and colored togidashi-e and depicts a phoenix in a hibiscus tree branch. The inside lacquered in black with fine gold flakes.

With a two-part manju netsuke decorated in takamaki-e with gold, depicting a hut under a pine tree in front of a stream, signed TOSHUSAI, another well-known lacquer artist. Spherical ojime made from aventurine glass.

HEIGHT 7 cm

HEIGHT inro 8.4 cm, DIAMETER manju netsuke 4.2 cm

Estimate EUR 400,Starting price EUR 200,-

Condition: Minor wear to the edges and surface wear â&#x20AC;&#x201C; generally, in very good condition. Provenance: American private collection.

Condition: The inro with many surface scratches and some wear to lacquer, the netsuke with losses to lacquer takamaki-e. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 600,Starting price EUR 300,-

329 | A LACQUER FOUR-CASE INRO Japan, 18th/19th century, Edo period (1615-1868)

The four-case inro depicting an underwater scene lacquered in brown, gold and green takamaki-e and hiramaki-e with fine silverinlaid clams and conch shells. The inside with dense nashiji and the top case with an inscription/signature. HEIGHT 6.3 cm

Auction comparison: Compare to an obi-hasami of a kappa sold at Van Ham, Asiatische Kunst, Cologne, 14 June 2018, lot 2297.

Condition: Worn condition, the lacquer work is damaged, cracked and unattached from the wood in some areas. Provenance: Austrian private collection.

Estimate EUR 800,Starting price EUR 400,-

Estimate EUR 400,Starting price EUR 200,-

102


330 | A FOUR-CASE LACQUER INRO Japan, 17th/18th century, Edo period (1615-1868)

An inlaid lacquer inro showing a farm scene with various tea utensils, lacquered in gold takamaki-e with inlaid mother of pearl details. With an inlaid cloisonnĂŠ ojime and an ivory and metal kagamibuta depicting Hotei. HEIGHT inro 6 cm, DIAMETER netsuke 4 cm

331 | A RED LACQUER CIRCULAR TWO-CASE INRO Japan, 19th century, Edo period (1615-1868)

The red ground lacquered with numerous chrysanthemum blossoms LQJROGbWDNDPDNLH with a metal ojime and a lacquered wood QHWVXNHbFDUYHGDVD performer. HEIGHT inro 4.5 cm, LENGTH netsuke 6 cm

Condition: Age-related condition, cracks, minor nicks â&#x20AC;&#x201C; general wear. Provenance: Old Zagreb private collection.

Condition: Worn age-related condition, the inro chipped. Provenance: Old Zagreb private collection.

Estimate EUR 400,Starting price EUR 200,-

Estimate EUR 500,Starting price EUR 250,-

333 | A FINE THREE-CASE LACQUER INRO Japan, 19th century, Edo period (1615-1868)

332 | A FOUR-CASE LACQUER INRO Japan, 18th century, Edo period (1615-1868)

A four-case inro showing a boat scene decorated in takamaki-e with inlaid mother of pearls details. Together with a Meiji period ivory netsuke of a street drummer.

Fine lacquer work designed in gold takamaki-e, KLUDPDNLHDQGbNLULJDQHbZLWK a scene of a waterway, pavilions and classic landscape designs. The inside covered in nashiji and together with a small floral metal ojime and an ivory netsuke depicting a boy with turtle. HEIGHT inro 5.5 cm, LENGTH netsuke 3.5 cm

Condition: Worn age-related condition, the inro with few chips and the netsuke with minor restorations. Provenance: Old Zagreb private collection.

Condition: Good agerelated condition, the inro has a few thin cracks and related wear, only one is visible from the outside, and discoloration along the borders. The netsuke with a chip to the edge of one foot and missing one inlaid eye. Provenance: Old Zagreb private collection.

Estimate EUR 500,Starting price EUR 250,-

Estimate EUR 600,Starting price EUR 300,-

HEIGHT inro 6.5 cm, LENGTH netsuke 4.5 cm

103


334 | A LARGE LOT OF VARIOUS LACQUER OBJECTS, LATE MEIJI TO TAISHO

DIAMETER 6.8-15.2 cm (the cups and bowls), LENGTH 10.2-17.5 cm (the spoons)

Japan, late Meiji to Taisho period, 1900-1940

Condition: Good condition and minor wear, as visible on the images online on www.zacke.at. Provenance: Austrian private collection.

Comprising cups, bowls, and spoons of various sizes, with red, black, and gilt lacquer painting. (24)

Estimate EUR 200,Starting price EUR 100,-

336 | A LACQUERED WOOD INRO WITH NETSUKE Japan, Edo period (1615-1868)

The lacquered two-case inro depicting a minimalistic landscape on one side and a shishi on the other. With a wood octopus netsuke. HEIGHT INRO 7 cm, HEIGHT NETSUKE 5 cm Condition: Worn condition, few chips and cracks. Provenance: Austrian private estate. Estimate EUR 200,Starting price EUR 100,-

335 | A LACQUERED KOGAI AND A COMB Japan, Meiji period (1868-1912)

The group consisting of a set of a lacquered Kogai (hairpin) with a comb in original wood box, both covered in roiro-nuri lacquer with gold hiramaki-e and inlays of mother of pearl depicting floral motifs – both signed Ikko. Kogai LENGTH 13.1-13.6 cm, Comb LENGTH 10.3 cm Condition: Good condition, minor wear to the lacquer on the edges. Provenance: Galerie Zacke archive. Comes with another Kogai, the mid-section lacquered in roironuri and the end sections lacquered in gold with gold takamaki-e and hirame flakes depicting various leaves – an autumn scene. Signed. Estimate EUR 200,Starting price EUR 100,-

104


337 | A RARE LACQUERED KOGO DEPICTING ONO NO KOMACHI Japan, Edo period (1615-1868)

The Kogo (incense box) is decorated on the lid with matt gold and silver takamaki-e depicting the beautiful poet Ono no Komachi (c. 825 â&#x20AC;&#x201C; 900), one of the Rokkasen (the sixth best poets of the early Heian period). She is wearing courtly robes and is writing a poem, her facial expression serene and deeply focused. The entire surface of the kogo is covered in dark-red lacquer sprinkled with nashiji. Interestingly there is also a thin inlaid layer of copper under the poetess, as spots of green oxidation are visible. Old Japanese label on the base.

338 | A RARE JAPANESE LACQUER TABAKO-BON (SMOKING SET)

HEIGHT 2 cm, LENGTH 9. 1 cm, WEIGHT 7.7 cm Japan, Edo period (1615-1868) Condition: Good condition with minor wear to lacquer and spots of green oxidation to the surface. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 200,Starting price EUR 100,-

The display stands on a flat base and has three storage drawers, one of them containing a match holder. At the top is the cylindrical brazier with matching lid and handle. All sides are precisely decorated with carved and incised mother-of-pearl inlays. The front fits a kiseru (pipe). SIZE 21 x 15.5 x 16.5 cm

339 | A MINIATURE LACQUER DINING SET Japan, 19th century, Edo period (1615-1868)

The set consists of a table, a pitcher, two small trays, two lidded vessels and a bowl. It is overall covered in red and brown lacquer with finely painted golden dĂŠcor.

Condition: The lacquer partially warped, chipped and with some of the inlay work missing. Provenance: Austrian private estate. Estimate EUR 800,Starting price EUR 400,-

SIZE 12 x 12 x 7 cm (the table) Condition: Superb condition with only microscopic losses and minor traces of use. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. It is rare to find such a complete and well-preserved miniature set, which most likely was made for a doll house. Estimate EUR 400,Starting price EUR 200,-

340 | A GOLD LACQUERED COMB Japan, Meiji period (1868-1912)

The comb covered in gold lacquer and carved to depict a floral design. LENGTH 9 cm Condition: Worn condition, discoloration and with a missing inlay. Provenance: Austrian private estate. Estimate EUR 200,Starting price EUR 100,-

105


341 | A VERY FINE SHIBAYAMA AND LACQUER FOUR-CASE INRO DEPICTING URASHIMA TARO Unsigned Japan, late 19th century, Meiji period (1868-1912)

A finely inlaid four-case lacquer inro on a gold lacquered ground, with inlays of ivory, mother of pearl, coral, stained horn and tortoiseshell. Urashima Taro, depicted as an old man, is shown kneeling and looking at the opened box from which a turtle emerges. A crane descends above him. The reverse decorated with a leafy blossoming peony branch, one budding flower inlaid in coral, below three flying butterflies. The inside with dense nashiji. HEIGHT 8 cm, WIDTH 6.2 cm Condition: Some surface scratches, miniscule loss to the inlay of the mat underneath the box. Good condition. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Estimate EUR 3.000,Starting price EUR 1.500,-

342 | A RARE IVORY INRO BY SHIBAYAMA YASUNOBU %\6KLED\DPD<DVXQREXVLJQHG Shibayama Yasunobu Japan, Meiji period (1868-1912)

The four-case inro is carved from ivory and densely embellished on either side with neatly incised inlays of coral, horn, stained ivory and malachite in high relief, creating a vivid circumferential scene with five sparrows in a peach tree. Signed on an inlaid mother RISHDUOFDUWRXFKH6+Î&#x2013;%$<$0$ <$6812%8 HEIGHT 8.2 cm, WIDTH 5.6 cm Condition: Excellent condition with hardly any wear. Even after 150 years not a single inlay is missing! Two natural age cracks to lowest case. 3URYHQDQFH%ULWLVKSULYDWHFROOHFWLRQ Collected prior to 1980. Estimate EUR 1.000,Starting price EUR 500,-

106


343 | A FINE PAIR OF LACQUERED WOOD AND SHIBAYAMA VASES WITH RAKAN Japan, Meiji period (1868-1912)

A pair of vases of cylindrical shape and supported on three leafy bamboo feet made from shakudo. Decorated with a circumferential scene of a group of Rakan set on a gold kinji ground, the details in takamaki-e, kirikane, nashiji and with inlays of ivory and mother of pearl. The Rakan are surrounded by a blossoming tree and many sparrows. 2QHVKRZVWKH5DNDQ%XNDQ=HQVKL next to his tiger companion viewing D%XGGKLVWUHOLTXDU\KHOGE\DQRWKHU Rakan. The other shows one Rakan pointing and the other reading from a scroll. HEIGHT 26.1 cm Condition: One loss to the edge of one sparrowâ&#x20AC;&#x2122;s wing. Generally, in good condition with minimal wear around the inlays and edges. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 1.500,Starting price EUR 750,-

344 | AN IMPORTANT SHIBAYAMA CHARGER %\WKH*\RNXVKR)DPLO\ Japan, late 19th century, Meiji period (1868-1912)

Designed in polychrome takamaki-e, hiramaki-e and inlaid ivory, motherof-pearl, and tortoiseshell, with a scholar and an immortal admiring a handscroll, the figures accompanied by birds, butterflies and flowers, the background kinji and the rim decorated with a formal border of birds, dragons, floral patterns and cherry blossoms on water, the reverse nashiji. Signed Dai Nihon koku Gyokushodo san and with a kakihan. DIAMETER 45 cm Condition: Excellent condition with some wear and traces of use. Three small and a few microscopic losses. Two small hairlines to background lacquer. The suspension screw at the backside is a later addition. 3URYHQDQFH%RQKDPČ&#x2021;V1HZ<RUN)LQH Japanese Works of Art, March 20th, 2012, lot 2210. Thereafter Austrian private collection. Estimate EUR 2.000,Starting price EUR 1.000,-

107


345 | A LACQUER TRAY WITH SAMBASO ACCOUTREMENTS

346 |

A LARGE RYOSHIBAKO LACQUER DOCUMENT BOX

Japan, Meiji period (1868-1912) to Taisho period (1912-1926)

Japan, later Edo period, 18th - mid-19th century

The large rectangular tray decorated in gold and red hiramaki-e and takamaki-e with accoutrements for the Sambaso Noh play, the rim decorated in gold lacquer, the underside signed â&#x20AC;&#x201C; all on a lustrous roiro-nuri ground.

Elaborately painted in gold lacquer to depict two playful shishi below a pine tree, enhanced with mother-of-pearl inlays, all above a silver nashiji ground. The sides with two more shishi amid peonies, the inside with further peonies on a gold nashiji ground.

SIZE 33.5 x 48.5 x 5.5 cm SIZE 42 x 32 x 15 cm Condition: Few chips and scratches, overall good age-related condition. Provenance: Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

347 | A JAPANESE LACQUER BOX

Condition: Extensive wear, fine age-related cracks, minor losses and some touch-ups mostly to edges. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 700,Starting price EUR 350,-

Japan, Meiji period (1868-1912) to Taisho period (1912-1926)

348 | A LARGE LACQUER TRAY MOUNTED AS A WALL PANEL A wooden box with beveled corners standing on four short legs. The top lid decorated in gold and orange hiramaki-e and nashiji with a plum tree branch and a fan, the corners decorated in gold hiramaki-e to depict scrolling vines. The interior and the base ZLWKQDVKLMLbODFTXHUDOORQDOXVWURXVURLURQXULJURXQG SIZE 25.5 x 27.5 x 12 cm Condition: Good condition, minimal wear to pigments and a crack to the base. Provenance: Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

Japan, Taisho period (1912-1926) to Showa era (1926-1989) b The large tray mounted as a wall panel and decorated in gold and red Takamaki-e with three Noh masks, a lacquer box and a fan ZLWKDGHSLFWLRQRIDPLQRJDPHRYHUDOOYHU\JRRGODFTXHUZRUNb b SIZE 54.5 x 104 cm b Condition: Worn condition, cracks, material loss and few restorations. The tray has not been examined out of the frame. Provenance: Austrian private collection. Estimate EUR 1.000,Starting price EUR 500,-

108


349 | A GOLD LACQUER TRAY Japan, late 19th century, Meiji period (1868-1912)

Finely painted with a scene depicting a Samurai and his attendant assisting a Geisha crossing a small river, the waves designed in classic Japanese style and highlighted with gold nashiji. The background with kids at play. SIZE 29 x 29 x 3.7 cm Condition: Excellent condition with only minor wear. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Remainder of old collector paper label to backside. Estimate EUR 400,Starting price EUR 200,-

350 | SHIBATA ZESHIN: A RARE AND FINE KORO OF A TEMPLE BELL %\6KLEDWD=HVKLQ  VLJQHG=HVKLQ Japan, late 19th century, Edo period (1615-1868) or Meiji period (1868-1912)

The lidded koro (incense burner) in the shape of a temple bell and brilliantly lacquered in sabiji-nuri to imitate the patinated iron of the old bell. This imitation is enhanced by the reddish hues shown on the surface. The handle is in the shape of two confronting fishes and shows pierced holes underneath for the smoke to escape. The inside is lined with metal to hold the burning incense. The sides DUHILQHO\GHFRUDWHGZLWKIO\LQJWHQQLQ %XGGKLVWDQJHOV DUUDQJHG in rectangular reserves. The base and interior with fine and dense gold nashiji. Signed ZESHIN next to one of the reserves containing the flying tennin. HEIGHT 9.4 cm Condition: Excellent original condition with no restoration or polishing whatsoever! Minor wear and very few traces of use, tiny natural age cracks at the handle. Provenance: Acquired at Christieâ&#x20AC;&#x2122;s Japanese & Korean Art, 23 March 2011, New York, lot 802 (Hammer price 30.000 USD). Shibata Zeshin (March 15, 1807 â&#x20AC;&#x201C; July 13, 1891) was a Japanese lacquer artist and painter of the late Edo period and early Meiji era. He has been called â&#x20AC;&#x153;Japanâ&#x20AC;&#x2122;s greatest lacquererâ&#x20AC;?. He was known for his techniques in imitating various materials such as bronze or iron â&#x20AC;&#x201C; such as shown in the present piece. Estimate EUR 5.000,Starting price EUR 2.500,-

109


351 | NANMEI: A SPECTACULAR IVORY FOLDING FAN WITH FINE PAINTINGS %\+DUXNL1DQPHL  VLJQHG1DQPHLZLWKVHDO Japan, early Meiji period (1868-1912)

is being collected for the impending cold season. The other side shows a dense composition of a bamboo forest with a large group RIVSDUURZVVRPHIO\LQJDQGVRPHVWLOORQEUDQFKHV%RWKSDLQWLQJV are signed and show a red seal, corresponding to Haruki Nanmei. With string, tassles and a very fine satsuma gilt ojime.

An elaborately and very finely crafted folding fan or ogi in 30 segments, each carved from ivory and some with a wavy shape. The two exterior segments are partly painted with gold lacquer and show fine Shibayama style inlays with a bird, beetle, butterfly, vines and fruit. The main side shows a large, dense landscape with a stream and very many pines, through which the snow-covered Mount Fuji shines in the center. An elderly man and two young %RNXGR R[KHUGHUV DUHVKRZQHDFKSOD\LQJWKHIOXWHDQGZRRG

HEIGHT 27 cm, WIDTH 50 cm when opened

352 | A FINE LACQUERED IVORY FAN

together by a silver fitting with a tasseled cord attached to it and mounted with an ivory and Shibayama inlaid ojime.

Condition: Superb condition with expected minor creases from folding the fan. Provenance: From the private collection of a Corsican seafarer. Estimate EUR 800,Starting price EUR 400,-

Japan, Meiji period (1868-1912) MAXIMUM SPAN 46 cm Consisting of twenty leaves and lacquered in fine gold and silver takamaki-e with an image of a pheasant, butterflies and dragonfly amongst flowers, grasses and leaves on one side. The reverse shows butterflies amongst chrysanthemum and peony flowers. The guard is finely decorated with Shibayama inlays. The fan is held

110

Condition: Excellent condition with miniscule associated wear. 3URYHQDQFH%ULWLVKFROOHFWLRQ Estimate EUR 2.000,Starting price EUR 1.000,-


353 | A VERY LARGE AND IMPORTANT PAINTED WOODCUT PRINT DEPICTING THE DEATH OF BUDDHA (NEHANZU) -DSDQGDWHG %XQVHLWK year), Edo period (1615-1868)

A very large and elaborately crafted hand-painted woodcut print depicting Nehanzu (the GHDWKRI%XGGKD6KDN\DPXQL also known as paranirvana). The original woodcut was made by Matsubara Shogetsu in 1816 and was used as a template for this massive handcolored woodcut print. The coloring was commissioned by a group of eight votive donors (identified by name in an inscription to the back). The inscription in the lower center of the painting states that it is based on a treasure collection at the Sanâ&#x20AC;&#x2122;enji Temple which is better known as the Zojoji Temple, the Tokugawa shogunatesâ&#x20AC;&#x2122; family WHPSOH %RGDLMLLQ-DSDQHVH (GR (Tokyo). The two inscriptions in the back read: â&#x20AC;&#x153;the 16th of the Seventh month, the year of tiger, LQWKHWK\HDURIWKH%XQVHLHUD (1830). This is for the repose of the soul of the deceased (tsuizen kuyo in Japanese), Votive donorsâ&#x20AC;&#x2122; names listed: Myorin-in, Keirin-in, Shokenin, Keikyo-in, Shojaku-in, Kyosho-in, Seishin-in, Chigen.â&#x20AC;? The work is a masterpiece utilizing two very different techniques. A massive (or many) woodblock(s) was required to craft this print. There are so many incredibly detailed figures and inscriptions that it would be simply impossibly to do this entirely by hand. The painting, as well, is of the highest quality. The painting shows %XGGKDLQWKHFHQWHUVXUURXQGHG by beings from all dimensional SODQHVUDNDQV%RGKLVDWWYD heavenly beings, figures of the underworld and animals, all FRPLQJWRJHWKHUWRPRXUQ%XGGKD Shakyamuniâ&#x20AC;&#x2122;s death. Painting only SIZE 176.4 x 96.6 cm, With mounting SIZE 250.5 x 126.2 cm Condition: Very good age-related condition â&#x20AC;&#x201C; minor losses, creases, fading of colors, staining (as visible in the images provided). There are some water stains to the back, which are not visible in the front as the painting is backed on paper. Provenance: Collection of Irene and Wolfgang Zacke. Estimate EUR 4.000,Starting price EUR 2.000,-

111


354 | SESSON SHUKEI: A RARE PAINTING OF KINKO SENNIN Sealed Sesson and Shukei Japan, 16th century, Muromachi period (1336-1573)

A large and expressively painted image of Kinko Sennin (in Chinese Qin Gao) reading from a scroll and riding on a gigantic carp, the latter with a crazed expression with large eyes. The large dynamically painted tail of the carp swings above the head of the Sennin, as the pair emerge from the mist around them. Note the fine and wise expression of the immortal, and the finely painted fingers which hold the scroll. Framed under glass and set onto a European passe-partout. Satake Shukei (born Satake Heizo, 1504 – c. 1589) was a Japanese Zen Monk painter from the Muromachi period, also known as the last great Muromachi ink painter. His painting style is influenced by ink paintings imported from China, his works being some of the earliest examples of ink painting in Japan, infused with traditional subjects imbued with a power and originality, so unique to Japanese painting. He was known to have painted Sennin, and another Kinko Sennin is in the collection of the Kyoto National Museum, designated as a culturally important REMHFW -X\R%XQND]DL  One square seal to the lower right reading SHUKEI and another potseal (tsubo-in) reading SESSON. %RWKVHDOVDUHDFORVHPDWFKWRWKH artist’s seal repertoire, present on authenticated works in museum collections. SIZE (painting only) 130 x 53 cm, SIZE (with frame) 151.7 x 74 cm Condition: Very good age-related condition. The painting has been set onto a passe-partout. Expected creases, minor losses, fading coherent with the age and comparable works from the period. Provenance: German private collection acquired from Kunsthandel Klefisch in Cologne with an E-mail from Trudel Klefisch stating (translated from German): “A work with the signature of the ink painter Satake Shukei, who was known under his monk name Sesson, and lived between 1504-89(?). I have acquired the painting from Werner Funke in Cologne. Mr. Funke purchased the painting in 1975 from Henk Kouw, Prinzengracht 156, who had acquired it from a London collection.” Estimate EUR 10.000,Starting price EUR 5.000,-

112


355 | A â&#x20AC;&#x2DC;BAMBOOâ&#x20AC;&#x2122; SCROLL PAINTING

356 | JAPANESE SCROLL PAINTING WITH MOUNT FUJI Japan, 19th century

Japan, 19th century

Skillfully with black ink painted on paper, signed, one seal.

This fine Japanese painting shows the sacred Mount Fuji with its snow-capped peak as the central image. The artist signature and seal (Shunyo) is to be found at the lower left. TOTAL SIZE 111 x 50 cm, IMAGE SIZE 27 x 40 cm

SIZE c. 105 x 27 cm Condition: Creasing, soiling, some minor losses, overall still fair condition, the mountings with losses as well. Provenance: German private collection. Acquired during the 1980s.

Condition: Good condition with usual traces of wear and age such as few moldy spots and creases to the mount. Provenance: Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

Estimate EUR 200,Starting price EUR 100,-

357 | KANO EISHIN YASUNOBU: A SUMI-E DEPICTING GIBBONS %\.DQR(LVKLQ<DVXQREX  VLJQHG+RJDQ(LVKLQ+LWVX Japan, 17th century, Edo period (1615-1868)

The sumi-e (ink wash painting) depicts three animated gibbons, with their characteristically long arms, pointing and grasping at a waterfall which draws their attention. A leafy stalk of bamboo is seen to the right of the monkeys. Signed HOGAN EISHIN HITSU with seal. IMAGE SIZE 48 x 34 cm Condition: The painting in good condition with only minor white spots. Provenance: American private collection. Estimate EUR 600,Starting price EUR 300,-

358 | JAPANESE SCROLL PAINTING WITH A LANDSCAPE Japan, 19th century

A landscape depiction, with mountains in the background and trees in the front, a few flying birds. The artist signature and seal to the upper left, a second seal to the lower right. Artist signature at the back: Keigetsu. TOTAL SIZE 200 x 50 cm, IMAGE SIZE 131 x 32.5 cm Condition: Good condition with usual traces of wear and age such as few moldy spots and creases to the mount. Provenance: Hungarian private collection. Estimate EUR 300,Starting price EUR 150,-

113


359 | A GOOD LOT OF 5 CHINESE AND JAPANESE FANS

360 | A SMALL JAPANESE PAINTING Japan, 19th century

China, Japan, around 1900

Wood, paper and other partially organic materials, two with photo reprographies.

A small painting with some gold foil depicting a battle scene, fine detail work. Set onto a book page with printed calligraphy. Framed.

The largest HEIGHT c. 20 cm

SIZE c. 24 x 19 cm

Condition: Used, with some dents and losses here and there, patina, wear, soiling. Provenance: German private collection. Acquired in China around 1900. Thence by descent.

Condition: Worn condition, creases and material loss. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent.

Estimate EUR 200,Starting price EUR 100,-

Estimate EUR 200,Starting price EUR 100,-

362 | A JAPANESE PAINTING Japan, 20th century

361 | A SMALL JAPANESE PAINTING Japan, 19th century

6PDOOSDLQWLQJGHSLFWLQJD%LMLQZLWKODUJHUREHVOHDQLQJRQDURFN underneath a willow. Signed and sealed by the artist. Framed.

A small and charming square format painting depicting a court scene. Set onto a book page with printed calligraphy.

SIZE 34.5 x 28.5 cm (size of the painting)

SIZE 20 x 21 cm Condition: Worn condition, creases and material loss. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 200,Starting price EUR 100,-

114

Condition: Good condition with usual traces of wear such as stains and minimal creases. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 200,Starting price EUR 100,-


363 | UTAGAWA HIROSHIGE (1797-1858): A COLOR WOODBLOCK PRINT Japan

Tile Kilns and Hashiba Ferry, Sumida River (Sumidagawa Hashiba no Watashi Kawaragawa), No. 37 from One Hundred Famous Views of Edo. SIZE 35.5 x 25.5 cm Condition: Very good condition. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 400,Starting price EUR 200,-

364 | UTAGAWA HIROSHIGE (1797 â&#x20AC;&#x201C; 1858): COMPLETE SET OF 21 COLOR WOODBLOCK PRINTS Japan

This complete edition folder contains 21 tank size color reprints. All stamped and signed. Dimensions: SIZE of the folder 34 x 25.5 cm, SIZE of the prints 26 x 12 cm Condition: Very good condition. Provenance: Swiss Private Collection. Estimate EUR 1.500,Starting price EUR 750,-

365 | UTAGAWA HIROSHIGE (1797 â&#x20AC;&#x201C; 1858): A COLOR WOODBLOCK PRINT Japan

%HDXWLIXOULYHUVFHQHU\YLHZHUVRQWKHKLOOWRSHQMR\LQJWKHORYHO\ view of Fuji in the distance. Framed. SIZE ca. 35 x 24 cm Condition: Age-related condition, corrugated paper, browning and few creases. Provenance: Austrian private collection. Estimate EUR 600,Starting price EUR 300,-

For the remaining prints in the set see www.zacke.at

115


367 | KATSUSHIKA HOKUSAI (1760-1849): WINTER LANDSCAPE Japan

Winter landscape drawn showing the slope of Mount Fuji. SIZE 24.5 x 36 cm Condition: Stains and browning, restorations around the edges, fading. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent.

366 | KITAGAWA UTAMARO (1753-1806): 10 COLOR WOODBLOCK PRINTS

Estimate EUR 300,Starting price EUR 150,-

Japan, reprint from the Meiji period (1868-1912) to Taisho period (1912-1926)

369 | MIXED LOT OF 15 JAPANESE & CHINESE WOODBLOCK PRINTS )URPWKHVHULHV-RVKRNXNDLNRWHZD]DNXVDb :RPHQHQJDJHG in the sericulture industry). The set is almost complete, only the print number 1 and 8 are missing, each signed Utamaro hitsu and framed. SIZE oban tate-e: c. 37.2 x 25 cm each Condition: Very good condition, some colors faded and few silkworm holes. Provenance: Austrian private estate. Estimate EUR 900,Starting price EUR 450,-

368 | FUJISHIMA TAKEJI: SNOW AT IWASHIMIZU-HACHIMAN SHRINE Japan, Showa period (1926-1989)

The color woodblock print is titled in the lower margin “SNOW AT IWASHIMIZU-HACHIMAN SHRINE, KYOTO”. SIZE 26.6 x 40.5 cm Condition: Very good condition and colors with only minor losses along the edges. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 200,Starting price EUR 100,-

116

Japan and China

Comprising two monochrome Chinese prints and 13 Japanese color and monochrome prints. This lot offer various depictions of men and women, landscapes, animals and other nature motifs some show an artist seal and calligraphy. All framed. HEIGHT 15 – 23 cm, WIDTH 10 – 25 cm Condition: Fresh colors; very few creases and stains, otherwise in very good condition. Provenance: Austrian private estate. Estimate EUR 1.500,Starting price EUR 750,-


370 | TOYOHARA KUNICHIKA (1835 - 1900): A COLOR WOODBLOCK PRINT Japan, 1864

Depicting the Actor Ichikawa Kuzo; Signature: Kunichika ga and Toshidama-Seal; Publisher: Iseya, Censor: Aratame-Seal and date: 10th Month 1864. Framed.

372 | KATSUSHIKA HOKUSAI (1760-1849): A SURIMONO OF KINTARO Japan

A Surimono format color woodblock print depicting .LQWDUR *ROGHQ%R\  DbFKLOGbRIVXSHUKXPDQ VWUHQJWKbWRJHWKHU with his mother and playmates from Mount Ashigara. Framed.

371 | TWO JAPANESE COLOR WOODBLOCK PRINTS

SIZE 33.5 x 22.5 cm (size of the painting)

Japan

Condition: Very good condition and colors, few tiny holes. Provenance: Austrian private estate, acquired in 2008 in Galerie Zacke.

Two Japanese woodblock prints depicting a courtesan playing the VDPLVHQDQGDVDPXUDLUHVSHFWLYHO\%RWKIUDPHG

Estimate EUR 150,Starting price EUR 75,-

SIZE c. 35.5 x 24.5 cm each (size of the painting) Condition: Good condition and colors with expected age creases. Provenance: From an Austrian private collection. Kept in the same family since the first half of the 20th century and thence by descent. Estimate EUR 150,Starting price EUR 75,-

373 | TWO JAPANESE COLOR WOODBLOCK PRINTS Japan, 19th century

SIZE 20 x 18 cm Condition: Very good condition with minor browning. Provenance: Austrian private estate. Estimate EUR 500,Starting price EUR 250,-

%RWKFRORUZRRGEORFNSULQWVGHSLFWLQJDIHPDOHILJXUHDQGZLWK calligraphy. SIZE c. 39 x 27 cm each Condition: Very good condition. Provenance: Austrian private estate. Estimate EUR 300,Starting price EUR 150,-

374 | FOUR JAPANESE WOODBLOCK PRINTS Japan

Comprising two color woodblock prints depicting kabuki scenes, fine executed details and intricate robe designs; and two prints GHSLFWLQJ%LMLQVRPHVKRZDQDUWLVWVHDODQGFDOOLJUDSK\ HEIGHT 22 â&#x20AC;&#x201C; 28 cm, WIDTH 12 â&#x20AC;&#x201C; 21 cm Condition: Good condition. Provenance: Austrian private estate. Estimate EUR 200,Starting price EUR 100,-

117


375 | FUJIKAWA TAMENOBU: FOUR ORIGINAL COLOR WOODBLOCK PRINTS & TWO PRINTS BY KONO BAIREI %\)XMLNDZD7DPHQREX   Japan 19th century

Each framed in a passe-partout. A group of four prints showing scenes from WKHVWRU\7Ä?NDLGÄ?FKÄ­b+L]DNXULJHE\ Jippensha Ikku, about the misadventures RIWZRWUDYHOHUVRQWKH7Ä?NDLGÄ? the main road between Kyoto and Edo during the Edo period, 1918. Here depicting the Station Kuwana, Shimada, Fujikawa and Shirasuga. $QGWZRSULQWVE\.RQR%DLUHL  1895) from the series `One Hundred Chrysanthemums´, 1891. Dimensions: Approx. 36 x 25 cm Condition: Superb condition; fresh colors. Provenance: German Private collection. formerly sold in Lempertz Auction House. Estimate EUR 800,Starting price EUR 400,-

376 | KUNISADA I : SIX JAPANESE COLOR WOODBLOCK PRINTS Japan, 19th century

377 | KUNISADA I: SIX JAPANESE COLOR WOODBLOCK PRINTS Japan, 19th century

A group of six prints by Utagawa Kunisada I (1786-1865) each framed in a passe-partout; consisting of: 1 â&#x20AC;&#x201C; From the series â&#x20AC;&#x2DC;Scenes of famous places along the Tokaido Roadâ&#x20AC;&#x2122; 1863; 2 â&#x20AC;&#x201C; Three actors in a Kabuki performance; Signature: Ichigusai Toyokuniga; Stamp: Fuku n. Muramatsu; Publisher: Yamaguchin-ya Tobei, 1847/53; 3 â&#x20AC;&#x201C; Kabuki performance; Signature: Toyokiniga, 1860; 4 - From the series â&#x20AC;&#x2DC;live and bustle in the 36 most famous teahousesâ&#x20AC;&#x2122;; 1st month 1861; 5 â&#x20AC;&#x201C; Woman in a chrysanthemums pattern robe, 1854; 6 - Scene from the Hana dehon Chushingura play, Named: Ichiyusai Kunisada ga; Publisher: Shiba-ya Senichi, 6th month 1860. DIMENSIONS approx. 25 x 36.5 cm Condition: Very good condition; fresh colors and few stains. One with damaged borders. Provenance: German Private collection. Four prints formerly sold in Van ham and Lempertz Auctions. Estimate EUR 1.000,Starting price EUR 500,-

A group of six prints by Utagawa Kunisada I (17851865) each framed in a passepartout and including three prints with collaboration from other artists: 1 â&#x20AC;&#x201C; A scene from the play Č&#x2020;.DQDGHKRQ&KÄ­VKLQJXUDČ&#x2021; The Samurai Kakogawa +RQ]Ä?HQWHUVWKHKRXVH on the street his wife and daughter, in the distance the Fuji; Stamp: Aratame, 6th moth 1860. 2 â&#x20AC;&#x201C; A scene from the play Č&#x2020;.DQDGHKRQ&KÄ­VKLQJXUDČ&#x2021; the samurai trash a table, in the next room Oboshi Rikiya, who later kills him; Stamp: Aratame, 6th Month 1860; Publisher: Yamamotoya Heikichi. 3 â&#x20AC;&#x201C; A print from the series â&#x20AC;&#x2DC;The 36 outstanding Poemsâ&#x20AC;&#x2122;, the kabuki scene from Kunisada, above representation of Gengyo; Signature: Ichiyosai Toyokuni hitsu, Gengyo; Stamp: Aratame, 11th month 1856. 4 â&#x20AC;&#x201C; A print by Kunisada and Hiroshige II from the series â&#x20AC;&#x2DC;The Flowers of Edo: A Collection of Famous Placesâ&#x20AC;&#x2122;, here the actor Arashi Rikan or Arashi Hinasuke; Signature: Toyokuniga, Hiroshige hitsu; Stamp: Aratame, 1864, 2nd month. 5 - History of the prince Genji, from the series Murasaki Shikibuâ&#x20AC;&#x2122;s Genji Cards; 6LJQDWXUH%DLFKRUR.XQLVDGD Publisher: Tsutaju; Stamp: Aramate, 1857, 11th month. Č&#x201A;%\.XQLVDGDDQG+LURVKLJH II (1826-1869) from the series â&#x20AC;&#x2DC;Miracles of Kannonâ&#x20AC;&#x2122;, here a scene of oracle by shrine maiden and music, the landscape above by Hiroshige, 1859. DIMENSIONS approx. 25 x 36.5 cm Condition: Very good condition; fresh colors and few stains. One with damaged borders and other with a restoration to the border. Provenance: German Private collection. Five prints formerly sold in Van ham and Lempertz Auctions. Estimate EUR 1.000,Starting price EUR 500,-

118


378 | HIROSHIGE: FIVE JAPANESE COLOR WOODBLOCK PRINTS

379 | A MIXED GROUP OF FIVE JAPANESE COLOR WOODBLOCK PRINTS

380 | KUNICHIKA: A GROUP OF JAPANESE COLOR WOODBLOCK PRINTS

Japan, 19th century

Japan, 18th to 19th century

%\7R\RKDUD.XQLFKLND   Japan, 19th century

A group of five prints framed in a passepartout; two by Hiroshige I or Ando Hiroshige (1797-1858) from the famous series â&#x20AC;&#x2DC;One hundred famous views of Edoâ&#x20AC;&#x2122; consisting of: 1 - Pine tree on the Hakka coast, 1856; Publisher: VoEi; 2 - The Robe-hanging Pine at Senzoku Pond, reprint from the Meiji period. Two prints by Utagawa Hiroshige II (18291869) consisting of: 1- Ferries in Yoroi from the series â&#x20AC;&#x2DC;Views of famous places in Edoâ&#x20AC;&#x2122;; Stamp: Aratame 5 month 1863; Publisher: Fujiokaya Keijiro; Plate cutter: Horicho, 2- Procession in the Kanbara Station, Tokaido, Fuji on the background, 1863. The last print by Hiroshige III (1842-1894) ) from the series â&#x20AC;&#x2DC;Famous views from the new Tokioâ&#x20AC;&#x2122;, here a &KU\VDQWKHPXPbH[KLELWLRQ

Each framed in a passe-partout. &RQVLVWLQJRI È&#x201A;%\.DWVXVKLND Hokusai (1760-1849), from the series â&#x20AC;&#x2DC;Scenes on the banks of the Sumida Riverâ&#x20AC;&#x2122;, Edition: Meiji period (1868-1912). È&#x201A;%\8WDJDZD<RVKLWVX\D   Raid of a travel group in landscape ZLWKUDLQERZÈ&#x201A;%\.XQQL\RVKL (1798-1861), scene of a battle by the sea, probably Mongol invasion in the WKFHQWXU\È&#x201A;%\+DUXQREX6X]XNL (1724â&#x20AC;&#x201C;1770), two beauties taking a break from playing the Koto.

DIMENSIONS approx. 25 x 36 cm Condition: Very good condition; fresh colors, very few stains along the borders. Provenance: German Private collection. Four prints formerly sold in Van ham and Lempertz Auctions.

DIMENSIONS approx. 31 x 26 cm, 24 x 36 cm and 21 x 30 cm Condition: Very good condition; fresh colors and very few stains. Provenance: German Private collection, four formerly sold in Van ham Auction House.

Each framed in a passe-partout and consisting of: 1 â&#x20AC;&#x201C; A Triptych of a Kabuki scene in a teahouse by the riverbank, 1st Month 1868. 2 â&#x20AC;&#x201C; A Triptych with .DEXNLDFWRUV%DQGR0LWVXJRURDV0UV Otsunne, Nakamura Shikan as Domo QR0DWDEHLDQG%DQGRÈ&#x2020;.DPH]RDV7RVD Kiyomori, 10th Month 1869. 3 - Two women washing hands, signed Kunichika fude and Toshidama â&#x20AC;&#x201C; Ring, c. 1865. DIMENSIONS approx. 24 x 35 cm Condition: Very good condition; fresh colors and very few stains. Provenance: German Private collection. The Triptychs formerly sold in Van ham and Lempertz Auctions. Estimate EUR 600,Starting price EUR 300,-

Estimate EUR 800,Starting price EUR 400,-

Estimate EUR 1.000,Starting price EUR 500,-

For high resolution images of all lots see www.zacke.at

119


381 | MIXED LOT OF 12 JAPANESE WOODBLOCK PRINTS

382 | KAJITA HANKO (1870-1917): 20 INK DRAWINGS ON PAPER

Japan

Japan, late 19th to early 20th century, Meiji period (1868-1912)

These 12 woodblock prints depict various birds among trees and flowers. Few after Ohara Shoson, some show an artist seal and calligraphy. All framed.

A collection of 20 ink drawings on paper for book illustrations (kuchi-e). The depictions vary widely, showing landscapes, flowers and birds, other animals, trees, houses and figures.

HEIGHTS 20.5 – 35.5 cm, WIDTHS 12 – 29 cm

SIZE 19.5 x 27.3 cm each

Condition: Fresh colors; very few creases and stains, very good condition. Provenance: Austrian private estate.

Condition: Minor creases and damage around the edges; several sheets have small holes outside the images; overall good condition. Provenance: Galerie Zacke archive.

Estimate EUR 1.800,Starting price EUR 900,-

Estimate EUR 300,Starting price EUR 150,-

384 | HANABUSA ITCHO (1652-1724): A GROUP OF 45 FIGURATIVE DRAWINGS Japan, 17th to early 18th century, Edo period (1615-1868)

383 | SEVEN BOOKS WITH SHUNGA PRINTS, TAISHO OR LATER Japan, first half of the 20th century

The 45 drawings by Hanabusa Itcho (1652-1724) each show a figural depiction. Every drawing is irregularly cut and mounted. Ink and colors on paper, mounted on paper.

The books depicting various erotic scenes. (7)

SIZE incl. mounting 33.5 x 29 cm, SIZE approx. 10 - 20 cm

SIZE 18.3 x 12.0 cm (the five largest), 19.0 x 9.3 cm and 18.5 x 10.7 cm.

Condition: Very good condition, minor stains here and there. Provenance: Galerie Zacke archive; previously in the collection of Émile Javal (1839-1907), French ophthalmologist.

Condition: Wear, soiling and extensive traces of use. Provenance: Latvian private collection. Estimate EUR 500,Starting price EUR 250,-

120

Estimate EUR 300,Starting price EUR 150,-


385 | A SMALL PAINTING OF TAOIST FIGURES, 19TH CENTURY Japan, 19th century. Painted on paper depicting three Taoist figures, gilt mat and wooden frame.

Condition: Wear, tears, losses, and creasing. Provenance: Austrian private collection. Dimensions: Size incl. frame 33.7 x 63.6 cm. Image size 26.6 x 42.1 cm. Estimate EUR 200,Starting price EUR 100,-

386 | A KOREAN HARDWOOD CHEST, 19TH CENTURY Korea, 19th century. The chest with iron mountings, fittings, handles, and lock. Fine, naturally grown patina.

Condition: Good condition with minor wear, age cracks, traces of use and chipping. Provenance: Austrian private collection. Acquired locally, by repute before 1980. Dimensions: Size 53.0 x 102.3 x 47.6 cm. Estimate EUR 800,Starting price EUR 400,-

387 | A KOREAN PORTABLE ‘DOUBLE’ CABINET, LATE 19th CENTURY Korea. Solid wood with good patina and fully original brass fittings, made in the shape of butterflies and bats.

Condition: Good condition with some traces of use, patina, scratches and losses Provenance: Austrian private collection. Dimensions: c. 180 x 80 x 40 cm. Estimate EUR 1.000,Starting price EUR 500,-

121


IMPRINT

Publisher Galerie Zacke founded 1968 © SZA Versteigerungen & Vertriebs GmbH 1070 Wien Mariahilferstraße 112, Stiege 1, 2. Stock Austria, Europe Tel (0043-1) 532 04 52 Email: office@zacke.at Editors Lukas Zacke Marion Schor Experts Lukas Zacke Alexander Zacke Max Zacke Assistance with production Susanne Zacke Norbu Thondup Julia Pastor Photography Georg Bodenstein Design Hermann Kienesberger Printing Gröbner Druck, Oberwart Website www.zacke.at © GALERIE ZACKE Reproduction forbidden

Profile for zacke1664

Asian Art Discoveries / Japanese & Korean Art  

Asian Art Discoveries / Japanese & Korean Art

Asian Art Discoveries / Japanese & Korean Art  

Asian Art Discoveries / Japanese & Korean Art

Profile for zacke1644
Advertisement