Page 1

7ODEN 4OWN#ENTRE -!34%20,!.

!#4'OVERNMENT


©!USTRALIAN#APITAL4ERRITORY #ANBERRA^!PRIL

4HISWORKISCOPYRIGHT!PARTFROMANYUSEASPERMITTEDUNDERTHE #OPYRIGHT!CT NOPARTMAYBEREPRODUCEDBYANY PROCESSWITHOUTWRITTENPERMISSIONFROM!#40LANNINGAND,AND!UTHORITY '0/"OX #ANBERRA#ITY!#4

$)3#,!)-%2!NYREPRESENTATION STATEMENT OPINIONORADVICE EXPRESSORIMPLIEDINTHISPUBLICATIONISMADEINGOODFAITH BUTONTHEBASISTHATTHE!USTRALIAN#APITAL4ERRITORY ITSAGENTSANDEMPLOYEESARENOTLIABLEWHETHERBYREASONOFNEGLIGENCE LACKOFCAREOROTHERWISE TOANYPERSONFORANYDAMAGEORLOSSWHATSOEVERWHICHHASOCCURREDORMAYOCCURINRELATIONTO THATPERSONTAKINGORNOTTAKINGASTHECASEMAYBE ACTIONINRESPECTOFANYREPRESENTATION STATEMENT ORADVICEREFERRED TOABOVE

0RINTBY'OANNA0RINT $ESIGNBY-ARIANA2OLLGEJSER$ESIGN


7ODEN 4OWN -!34%20,!.

52"!.02/*%#43 !#40LANNINGAND,AND!UTHORITY #HALLIS3TREET $ICKSON!#4

4Q&QACTPLA ACTGOVAU

-AY

4OFOSTERTHEGROWTHOFANINNOVATIVE SAFEANDCOLLABORATIVELIVINGANDWORKING ENVIRONMENTTHATVALUESTHESOCIALAND PHYSICALHERITAGEOF7ODEN4OWN#ENTRE

!#4'OVERNMENT


I6

!#40,!..).'!.$,!.$!54(/2)49


!6)3)/.&/24(%7/$%.4/7. #%.42%).4(%34#%.4529

4OFOSTERTHEGROWTHOFANINNOVATIVE

SAFEANDCOLLABORATIVELIVINGANDWORKING ENVIRONMENTTHATVALUESTHESOCIALANDPHYSICAL HERITAGEOF7ODEN4OWN#ENTRE 7ODEN4OWN#ENTREISACOMPACTURBANCENTRETHATALREADYCONTAINSMANYOFTHEESSENTIAL FEATURES OF A CONTEMPORARY URBAN VILLAGE !N AREA OF ABOUT ONE SQUARE KILOMETRE PROVIDES OFFICE RETAIL AND SMALL BUSINESS EMPLOYMENT FOR ABOUT   PEOPLE -ANY THOUSANDS OF #ANBERRANS VISIT EACH WEEK TO ENJOY THE RANGE OF BUSINESS RETAILING AND ENTERTAINMENT FACILITIESTHAT7ODENPROVIDES !S7ODENMATURESTHE-ASTER0LANWILLHELPMANAGECHANGEINORDERTOPROTECTPHYSICALAND SOCIALFEATURESTHATARERECOGNISEDASBEINGIMPORTANT!TTHESAMETIMETHEREAREPROPOSALSTO INTRODUCEABROADERMIXOFUSESWITHINANDSURROUNDING7ODENTHATWILLEXTENDHOURSOFACTIVITY REDUCECARUSEANDDEVELOPASENSEOFOWNERSHIPBYAVARIED INVOLVEDANDSECURECOMMUNITY

7/$%.4/7.#%.42%^ MASTERPLAN

V


#/.4%.43 %XECUTIVE3UMMARY

VI

0!24! "!#+'2/5.$  ).42/$5#4)/.



 4HEIMPORTANCEOFTHE-ASTER0LAN



 2ESPONSEANDCOLLABORATIVEPROCESS



 ).)4)!,$%3)'.).4%.4!.$$%6%,/0-%.4()34/29



 -ETROPOLITANCONTEXT



 4HE#ANBERRA3PATIAL0LAN



 4OWN#ENTREDESIGNPHILOSOPHY



 4OWN#ENTREPLANS



 #522%.40,!..).'#/.3)$%2!4)/.3

 )NTRODUCTION



 3TATUTORYPLANNINGPOLICIES



 0OPULATION



 %MPLOYMENT



 2ETAIL



 #OMMERCIAL



 2OADNETWORK



 )NTERCHANGEANDBUSOPERATIONS



 0ARKING



 "ICYCLEANDPEDESTRIANCONNECTIONS



 %LEMENTSOFHERITAGEINTEREST



 #OMMUNITYFACILITIES



 0ARKSANDPUBLICPLACES



3PORTANDRECREATIONFACILITIES



 4OWN#ENTRELIVING



 0UBLICSAFETY



 &UTURE$EVELOPMENT$IRECTIONS

V)





 &ACTORSTHATAREDRIVINGCHANGEIN7ODEN



 'ROWTHOPTIONSFOR7ODEN



 ,IMITATIONSONGROWTH



!#40,!..).'!.$,!.$!54(/2)49


0!24" &5452%$)2%#4)/.3  )-0,%-%.4!4)/.!.$),,5342!4)6%#/.#%043



 )NTRODUCTION



 3USTAINABILITY



 &UTUREBUILTFORM



 #ONNECTIONSANDMOVEMENT



 !CTIVATINGTHEPUBLICDOMAIN



 4HENEWPOLICESTATION



 0UBLICTRANSPORT



 .EWOFFICEACCOMMODATION



 %XPANSIONOFRETAILING



 #AR0ARKING



 0ROVIDINGFORPEDESTRIANS



 #YCLENETWORKS



 !CCESSTOCOMMUNITYFACILITIES



 .EWRESIDENTIALDEVELOPMENT



 0ARKSPLACESANDSPACES



 'ATEWAYS



 3AFETYANDSECURITY



 0HILLIP/VALANDENTERTAINMENTACCOMMODATIONANDLEISUREPRECINCT



 #ONNECTIONSTOTHE0HILLIP-IXED3ERVICES!REA



 0HILLIP-IXED3ERVICES!REALANDUSES



 (ERITAGE



 'ENERALSTRATEGIES



 #/.#,53)/.4(%.%8434%03



 6ARIATIONSTOTHE4ERRITORY0LAN



 2ELEASEOF4ERRITORYOWNEDLAND



 &URTHERSTUDIESANDPLANNINGPROCESSES



 3500/24).'$/#5-%.4!4)/.



!PPENDIX!^,ANDRELEASEANDREDEVELOPMENTOPPORTUNITIES



!PPENDIX"^%XTRACTFROMEXISTING4ERRITORY0LAN



7/$%.4/7.#%.42%^ MASTERPLAN

V))


%8%#54)6%35--!29 7ODENSESSENTIALSTRUCTURALELEMENTSARETHESURROUNDINGARTERIALROADNETWORKFRINGINGTHE CORE LARGEAREASOFSURFACEPARKING RETAILACTIVITYINTHE0LAZA THECAMPUSSTYLEOFFICEPRECINCT BACKINGONTOTHEPEDESTRIANSPINEANDTHESPORTANDRECREATIONAREAONTHENORTHERNSIDEOF ,AUNCESTON3TREET4HISSTRONGPATTERNOFSINGLEPURPOSELANDUSESINHIBITSTHEEXTENTTOWHICH 7ODENEXPRESSESANINTEGRATEDANDLIVELYURBANQUALITYTHATCOULDREASONABLYBEEXPECTEDOF ATOWNCENTRESERVICINGAPOPULATIONOFALMOST PEOPLE 2ESEARCHCARRIEDOUTASPARTOFTHISMASTERPLANNINGPROCESSREVEALEDTHATTHECOMMUNITYS CONCERNSABOUT7ODENTODAYARESIMILARTOTHOSERAISEDIN*USTASTHEN PEOPLETODAY REMAINCONCERNEDABOUTTHEISOLATIONOFDIFFERENTSECTORS THELACKOFACTIVITYOUTSIDENORMAL BUSINESSHOURS THESEAOFCARSSURROUNDINGTHECORE ALACKOFCONVENIENTLYLOCATEDPARKING THE SENSE OF A @CONCRETE JUNGLE AND THE GENERAL ABSENCE OF A CIVIC ROLE THAT A TOWN CENTRE WOULDNORMALLYPLAYINTHELIFEOFTHECOMMUNITY 4HE RESTAURANT STRIP ALONG #ORINNA 3TREET WHERE THE 0LAZA OPENS OUTWARDS TO ENGAGE WITH THEPUBLICREALM ISANEWURBANDESIGNELEMENT4HISHASBEGUNTOBREAKDOWNTHEINACTIVE SPACES THAT HAVE CHARACTERISED 7ODENS DESIGN 4HIS NEW FEATURE IS WIDELY REGARDED AS A SIGNIFICANTIMPROVEMENTTO7ODENSCHARACTER 4RAFFIC CONGESTION AND DIFFICULTY WITH ACCESS TO COMMUNITY FACILITIES WERE CONSISTENTLY RAISED ASMATTERSOFCONCERNTHATHAVEBEENDEALTWITHINTHIS0LAN/THERRECOMMENDATIONSIMPROVE OPPORTUNITIESFORPEDESTRIANSANDCYCLISTSTOMOVEMOREFREELYTOTHEEASTANDWESTOFTHETOWN CENTRECORE &EDERAL 'OVERNMENT DEPARTMENTS ARE MAJOR STAKEHOLDERS IN 7ODENS FUTURE -UCH OF THE  M OFFICE STOCK IS  YEARS OLD AND DESIGNED TO A DIFFERENT SET OF REQUIREMENTS TO MODERN OFFICES 'OVERNMENT EMPLOYMENT ACCOUNTS FOR ABOUT HALF OF THE   WORKERS ANDTHE0LANRECOGNISESTHATTHEFUTUREPROVISIONOFAPPROPRIATEOFFICESPACEWITHLARGEOPEN FLOOR AREAS AND FIVE STAR ENERGY RATING WILL BE IMPORTANT IN PRESERVING 7ODENS SHARE OF THE GOVERNMENTEMPLOYMENTMARKET 4HE 0LAN PROVIDES A NUMBER OF OPPORTUNITIES TO MEET THE OFFICE NEEDS OF GOVERNMENT DEPARTMENTS )N ORDER TO REALISE THE FULL URBAN DESIGN POTENTIAL OF THIS NEXT GENERATION OF BUILDINGS THECOOPERATIONOFTENANTSANDBUILDINGOWNERSISREQUIREDTOFOSTERTHEINTRODUCTION OF MORE ACTIVE STREET FRONTAGES THAT WILL HELP BREAK DOWN THE SEGREGATED LANDUSE PATTERN 4HE STRUCTURAL CAUSE OF PERCEIVED PERSONAL SAFETY PROBLEMS AND SENSE OF ISOLATION CAN ONLY BE IMPROVED BY GREATER ACTIVITY ALONG THE CONNECTIONS BETWEEN THE LAND USES 4HIS SOLUTION INVOLVES RESIDENTIAL DEVELOPMENT IN THE TOWN CORE ACTIVE STREET FRONTAGES @HUMAN SCALE ARCHITECTURE AT GROUND LEVEL THAT INCLUDES AWNINGS AND COLONNADES MORE COMPACT PARKING ARRANGEMENTSANDBETTERPUBLICTRANSPORT

V)))

!#40,!..).'!.$,!.$!54(/2)49


4HEPOPULATIONOF7ODENAND7ESTON#REEKISEXPECTEDTOREMAINFAIRLYSTABLEOVERTHENEXT   YEARS AT ABOUT   4HE PROPORTION OF THIS POPULATION OVER AGE  IS EXPECTED TO INCREASETOABOUT INCREASINGTHENUMBEROFPEOPLEINTHISAGEGROUPBYALMOST  TOAROUND #ONSULTATIONABOUTTHESPECIFICNEEDSOFTHISINCREASINGPROPORTIONOFOLDER PEOPLEIDENTIFIEDTHEIRGREATESTNEEDTOBEIMPROVEDAMENITYFORPEDESTRIANSANDMOTORISED SCOOTERS&EATURESCONTRIBUTINGTOADDRESSINGTHISNEEDINCLUDEPUBLICTRANSPORTACCESSIBILITY QUALITY AND MAINTENANCE OF PAVING LIGHTING AND LANDSCAPING AND IMPROVED ACCESS TO ALL FACILITIESFORPEOPLEWITHMOBILITY SIGHTANDOTHERDISABILITIES 4HE%NTERTAINMENT !CCOMMODATIONAND,EISUREPRECINCTONTHENORTHERNSIDEOF,AUNCESTON 3TREETPROVIDESFACILITIESTHATARELARGELYMANAGEDBYTHEPRIVATESECTOR4HE0LANPROPOSESTO EXTEND THE RANGE OF PERMISSIBLE USES IN THE AREA TO ALLOW SOME RESIDENTIAL AND COMMERCIAL OFFICE DEVELOPMENT AT FIRST FLOOR LEVEL AND ABOVE 4HESE ADDITIONAL USES SHOULD HELP PROVIDE THENECESSARYCOMMERCIALBALANCETOENCOURAGEREFURBISHMENTOFSIGNIFICANTFACILITIESSUCHAS THESWIMMINGPOOLANDICESKATINGRINK)NTHEMEDIUMTERMATLEASTTHE0LANPROPOSESTHAT 0HILLIP/VALBERETAINEDASASPORTINGVENUEANDMANAGED IFNECESSARY BYTHE4ERRITORY4HIS WILLALLOWTIMETOFULLYEXPLOREOPPORTUNITIESTOATTRACTAMAJORNEWUSERTOTHEFACILITYWHILSTAT THESAMETIMEALLOWINGBROADERCOMMUNITYUSEOFFACILITIESSUCHASMEETINGROOMSANDTHE CREATIONOFMIXEDUSEDEVELOPMENTSFRONTING,AUNCESTON3TREET 2EDUCINGRELIANCEONCARCOMMUTINGANDINCREASINGBUSPATRONAGEISAKEYOBJECTIVE4HISIS ACHIEVEDBYNEWBUSSTATIONSTHATPROVIDEPATRONSWITHCOMFORTABLEANDSECUREFACILITIES4HE 0LANHASDEVELOPEDADESIGNCONCEPTTHATINTEGRATESANEWBUSSTATIONWITHFUTURECOMMERCIAL DEVELOPMENTONTHEEASTERNSIDEOFTHE4OWN#ENTRECORE4HECOSTOFPROVIDINGSUCHSIGNIFICANT NEWINFRASTRUCTUREISOFFSETBYDEVELOPMENTRIGHTSTHATARISEFROMRELOCATIONOFTHEEXISTINGPOLICE STATIONANDREDUCTIONINSIZEOFTHECURRENTINTERCHANGEPLATFORMREQUIREMENTS(OWEVER MORE WORKSTILLNEEDSTOBEDONEWITH!#4)/.ANDTHERETAIL OFFICEANDCOMMUNITYSECTORSTOENSURE THATSOUNDPRINCIPLESUNDERPINFUTURECHANGESTOTHEEXISTINGBUSARRANGEMENTS 4HE0LANRECOGNISESTHEOPPORTUNITIESTOBUILDONTHEWIDEVARIETYOFSERVICESCURRENTLYPROVIDED WITHIN THE 0HILLIP -IXED 3ERVICES !REA )NITIATIVES INCLUDE RENAMING THE AREA AS THE 0HILLIP "USINESS$ISTRICT THECREATIONOFANEWENTRANCEBYEXTENDING0ARRAMATTA3TREETTO!THLLON$RIVE AND RELEASING THE OLD DEPOT SITES FOR REDEVELOPMENT -IXED USE RESIDENTIAL OPPORTUNITIES ARE PROVIDEDBYPERMITTINGRESIDENTIALDEVELOPMENTATFIRSTFLOORLEVELANDABOVEINTHECENTRALCORE 3UCHCHANGESINLANDUSEWILLBESUBJECTTOPREPARATIONOF3ECTION-ASTER0LANSTHATRECOGNISE THEINTENTIONSOFALLAFFECTEDBUSINESSOPERATORSANDLESSEES 4HE-ASTER0LANISATIMELYMECHANISMFORBRINGINGBUSINESS COMMUNITYANDTHE'OVERNMENT TOGETHERTOBETTERREALISETHEEXPECTATIONSOFALLSTAKEHOLDERSINIMPLEMENTINGTHEGROWTHOFAN

INNOVATIVE SAFEANDCOLLABORATIVELIVINGANDWORKINGENVIRONMENTTHATVALUESTHESOCIALAND PHYSICALHERITAGEOF7ODEN4OWN#ENTRE

7/$%.4/7.#%.42%^ MASTERPLAN

I8


/2'!.)3!4)/./&4()3$/#5-%.4 4HEFORMATOFTHISREPORTISASFOLLOWS

0!24!"ACKGROUNDDEFINESTHESTUDYAREAANDITSRELATIONSHIPWITHBROADPLANNING OBJECTIVESFORTHE!#4)TEXPLORESTHEHISTORYOFDEVELOPMENTOF7ODEN4OWN#ENTRE ADDRESSES ISSUES RAISED BY THE COMMUNITY ANALYSES EXISTING URBAN STRUCTURE AND CULTURALFEATURES ANDESTABLISHESOBJECTIVESTOACHIEVEADESIREDFUTURECHARACTER

0!24 " 4HE -ASTER 0LAN ENCAPSULATES THE OBJECTIVES ESTABLISHED IN 0ART ! AND EXPRESSESTHEDESIREDFUTURECHARACTEROF7ODENINAN5RBAN3TRUCTURE0LAN4HE SECTIONTHENDESCRIBESANUMBEROFPOTENTIALMAJORPROJECTSTHATAREFUNDAMENTALTO IMPLEMENTINGTHEFUTUREVISIONFOR7ODEN4OWN#ENTREOVERTHENEXTnYEARS

X

!#40,!..).'!.$,!.$!54(/2)49


0!24!n"!#+'2/5.$



).42/$5#4)/.

 4HEIMPORTANCEOFTHE-ASTER0LAN 4HEBASICSTRUCTUREFOR7ODEN4OWN#ENTREWASESTABLISHEDYEARSAGOANDREMAINSLARGELY UNCHANGEDINITSBASICCONCEPT(OWEVER EXPANSIONOFTHE7ODEN0LAZA CONSTRUCTIONOFNEW OFFICEACCOMMODATION SALEOFSITESBYTHE&EDERAL'OVERNMENT REDESIGNOF#ALLAM3TREETTO ALIGNWITH!THLLON$RIVEANDPROPOSALSFORADDITIONALHOUSINGAREALLREALDEVELOPMENTISSUES THATINCREMENTALLYALTER7ODENSCHARACTER 4HEPURPOSEOFTHIS-ASTER0LANISTOREVIEWMANYOFTHEPLANNINGASSUMPTIONSTHATWEREMADE INTHESANDSANDCONSIDERFUTUREGROWTHOF7ODENINTHECONTEXTOFCONTEMPORARY PLANNING OBJECTIVES 4HESE OBJECTIVES INCLUDE MORE SUSTAINABLE DEVELOPMENT HIGHER QUALITY URBAN DESIGN CHANGING OFFICE ACCOMMODATION NEEDS OF MAJOR EMPLOYERS DEMOGRAPHIC CHANGES AND THE NEED FOR GREATER COMMUNITY INVOLVEMENT IN DEVELOPING 7ODENS PHYSICAL ANDSOCIALOUTCOMES &URTHER THE-ASTER0LANPROCESSISNOTABOUTDEVELOPINGASCHEDULEOF'OVERNMENTFUNDED CAPITALWORKS2ATHER ITISABOUTCREATINGAFRAMEWORKFORCHANGETHATASSISTSTHE'OVERNMENT ANDPRIVATESECTORSTOWORKINPARTNERSHIPTOADAPTQUICKLYTOCHANGINGCOMMERCIAL SOCIALAND ENVIRONMENTALREALITIES7ITHOUTTHISOVERVIEW INDIVIDUALPROJECTSOFTENFAILTOMATERIALISEDUETO THEDIFFICULTYOFDEALINGWITHALLTHEISSUESINTHEABSENCEOFANOVERALLCONTEXT -ASTER 0LANS SIT WITHIN THE STRUCTURE OF THE 4ERRITORY 0LAN THAT ALLOWS FOR SPECIAL PLANS AND CODES TO BE ADOPTED BY THE 0LANNING !UTHORITY !S SUCH THE -ASTER 0LAN WILL BE TAKEN INTO CONSIDERATION WHEN THE !#4 0LANNING AND ,AND !UTHORITY IS ASSESSING DEVELOPMENT APPLICATIONS

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%7ODEN4OWN#ENTRECIRCA 0(/4/'2!0(#/524%39.!4)/.!,#!0)4!,!54(/2)49 7ITHINYEARSOFBEGINNINGCONSTRUCTIONMOSTSITESARETAKENUPWITHCARPARKSANDSINGLEFUNCTION BUILDINGS#ITIESARENOTBUILTBYONEGENERATIONANDTHISWASNEVERIMAGINEDTOBE7ODENSENDSTATE

&)'52%7ODEN4OWN#ENTRE '%/&&#/-&/240(/4/'2!0(9 )NCREMENTAL CHANGES SINCE  ARE EVIDENT!REAS OF SURFACE PARKING HAVE BEEN COMPRESSED INTO STRUCTURESASDEMANDFORBUILDINGSITESINCREASED/THERCHANGESARECONSTANTLYINTHEPIPELINEANDA MASTERPLANNEEDSTOSETTHEFRAMEWORKFORTHENEXTPHASEOFCHANGE



!#40,!..).'!.$,!.$!54(/2)49


 2ESPONSEANDCOLLABORATIVEPROCESS 4HE 7ODEN4OWN#ENTRE-ASTER0LANISNOTSOLELYAPRODUCTOF!#40,!ANDTHECONSULTANT TEAM)TISACOLLABORATIVEEFFORTBETWEEN!#4'OVERNMENTAGENCIES REPRESENTATIVESOFPEAK COMMUNITYGROUPSANDTHEGENERALPUBLIC!CHIEVINGTHISCOLLABORATIONINVOLVEDANUMBEROF STEPS THAT ARE SUMMARISED IN &IGURE  THE #OLLABORATIVE 0LANNING 0ROCESS 4HE PROCESS OF COLLABORATIONDOESNOTSTOPWITHTHERELEASEOFTHISPLAN3EVERALSTATUTORYPLANNINGPROCESSES THAT WILL FLOW ON FROM THIS POINT INVOLVE PUBLIC CONSULTATION AND IN SOME CASES REVIEW BY THE ,EGISLATIVE !SSEMBLYS 0LANNING AND %NVIRONMENT #OMMITTEE 4HESE PROCESSES INCLUDE 4ERRITORY 0LAN 6ARIATIONS AND SEVERAL INTEGRATED PRELIMINARY ASSESSMENTS THAT DEAL WITH SIGNIFICANTGROUPSOFPROJECTSSUCHASTHEBUSINTERCHANGEANDASSOCIATEDRETAIL RESIDENTIALAND COMMERCIALDEVELOPMENT4HE-ASTER0LANWILLSTILLEVOLVEOVERTHECOMINGYEARSINRESPONSE TO COMMUNITY AND STAKEHOLDER DESIRES POLICY CHANGES POLITICAL DECISIONS ENVIRONMENTAL IMPERATIVESANDECONOMICCONSTRAINTS

&)'52%4HECOLLABORATIVEPROCESS #OMMUNITYBRIEFING

$ESIGNOPTIONSREPORT

$RAFT-ASTER0LAN

7ODEN4OWN#ENTRE -ASTER0LAN

Q

#OMMUNITYANDSTAKEHOLDER BRIEF

!UGUST

Q

&IRSTNEWSLETTERTORESIDENTS BUSINESSOPERATORSAND COMMERCIALPROPERTYOWNERS

$ECEMBER

Q

&IRSTCOMMUNITYAND STAKEHOLDERDESIGNWORKSHOP

&EBRUARY

Q

&IRSTEXHIBITIONPERIODOFDESIGN IDEASFORDISCUSSIONAND REFINEMENT

-ARCH

Q

3ECONDNEWSLETTER

!PRIL

Q

3ECONDCOMMUNITYAND STAKEHOLDERDESIGNWORKSHOP

-AY

Q

)SSUESPECIFICMEETINGSTO ADVANCEKEYAREASOFCONCERN

-AY *UNE

Q

3ECONDPUBLICEXHIBITIONPERIOD FOR$ESIGN/PTIONS2EPORT

-AY *UNE

Q

6ARIOUSSTAKEHOLDERWORKSHOPS ANDDISCUSSIONSESSIONS

*UNE 3EPTEMBER

Q

$RAFT-ASTER0LAN

Q

0UBLICEXHIBITIONOF$RAFT -ASTER0LANSTAKEHOLDER WORKSHOPS

Q

0UBLICPRESENTATIONONFINAL PLANPROPOSALS

Q

&INAL-ASTER0LAN

&EBRUARY !PRIL *ULY

$ECEMBER

!PRIL

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%7ODENgSMETROPOLITANCONTEXT

KM



!#40,!..).'!.$,!.$!54(/2)49




).)4)!,$%3)'.).4%.4!.$ $%6%,/0-%.4()34/29

 -ETROPOLITANCONTEXT 7ODEN WAS #ANBERRAS FIRST NEW TOWN DESIGNED IN THE S TO DISPERSE EMPLOYMENT AND RETAILACTIVITYAWAYFROMTHECENTRALAREA7ODENISPHYSICALLYSEPARATEDFROM BUTCONVENIENTLY RELATED TO CENTRAL #ANBERRA AND 4UGGERANONG AS DEMONSTRATED IN &IGURE  7ODEN WAS ORIGINALLYDESIGNEDASADISCRETEUNITOFSUBURBSBUTDEVELOPMENTOFTHEEIGHTSUBURBSOF 7ESTON#REEKINCREASEDTHEPOPULATIONTOALEVELWHEREALARGERTOWNCENTREWITHABROADER RANGEOFFACILITIESCOULDBESUSTAINED 7ODENS TOWN CENTRE ROLE WAS REVIEWED IN THE .ATIONAL #APITAL $EVELOPMENT #OMMISSIONS  -ETROPOLITAN 0OLICY 0LAN 4HE -ETROPOLITAN 0LAN RECONFIRMED THE HIERARCHY OF COMMERCIAL CENTRES AND INCLUDED CLEAR STATEMENTS ABOUT RESTRICTING 7ODENS METROPOLITAN ROLE4HE-ETROPOLITAN0LANSTATEDANEMPLOYMENTLEVELOF n INTHE7ODEN 4OWN#ENTRE

4HE#ANBERRA3PATIAL0LAN )NITSREPORT5RBAN2ENAISSANCEn#ANBERRA!SUSTAINABLEFUTURE THE/RGANISATIONFOR %CONOMIC#OOPERATION$EVELOPMENT/%#$ FOUNDTHAT

!NEFFECTIVESTRATEGICPLANTAKESALONGTERMPERSPECTIVEANDCOMBINESECONOMICAND SOCIALWITHSPATIALOBJECTIVES 4HE!#4'OVERNMENTHASRESPONDEDTOTHE/%#$SRECOMMENDATIONTOPREPAREA3TRATEGIC 0LANTHATINCLUDESASONEELEMENT4HE#ANBERRA3PATIAL0LAN4HE#ANBERRA3PATIAL0LANTHAT WAS RELEASED IN -ARCH  PROPOSES A PREFERRED DIRECTION WHICH WILL ACCOMMODATE AND PROVIDEFORTHESUSTAINABLEGROWTHOF#ANBERRAASACONTAINEDCITY 3OMEOFTHEPRINCIPLESUNDERPINNINGTHEPREFERREDDIRECTIONOF 4HE#ANBERRA3PATIAL0LANTHAT ARERELEVANTTOTHEBROADDIRECTIONOFTHE 7ODEN4OWN#ENTRE-ASTER0LANINCLUDE Q

)NTENSIFICATION OF RESIDENTIAL DEVELOPMENT WITHIN THE EXISTING URBAN AREA OCCURS PREDOMINANTLYWITHIN#ENTRAL#ANBERRAANDAROUNDTOWNCENTRES INCREASINGTHEPOPULATION INTHESEAREASANDTHEHOUSINGCHOICEFORPEOPLEWISHINGTOLIVECLOSETOPLACESOFWORK EDUCATION COMMUNITYSERVICESANDCULTURALACTIVITIES

Q

%XISTING CENTRES INCLUDING #IVIC WILL BE THE FOCUS OF EMPLOYMENT GROWTH WITH EXISTING EMPLOYMENTCORRIDORSBEINGREINFORCEDBYCLUSTERINGATNODESALONGTHECORRIDORS

Q

-AJORTRANSPORTCONNECTIONS INCLUDINGPUBLICTRANSPORT WILLLINKTHETOWNCENTRESANDTHE AIRPORTTO#IVIC

4HEPRINCIPLESUNDERPINNINGTHE7ODEN4OWN#ENTRE-ASTER0LANAREENTIRELYCONSISTENTWITHTHE PREFERREDDIRECTIONOFTHE4HE#ANBERRA3PATIAL0LAN

7/$%.4/7.#%.42%^ MASTERPLAN




4OWN#ENTREDESIGNPHILOSOPHY 4HELANDUSEPHILOSOPHYUNDERPINNINGTHEORIGINALMASTERPLANSFOR7ODENCLEARLYDIVIDESTHE TOWNINTOZONES4HEARTERIALROADNETWORKFRINGINGTHETOWN THERINGOFCARPARKS RETAILACTIVITY INTHE0LAZA THECAMPUSSTYLEOFFICEPRECINCTBACKINGONTOTHEPEDESTRIANSPINEANDTHESPORT AND RECREATION AREA ON THE NORTHERN SIDE OF ,AUNCESTON 3TREET REMAIN THE TOWNS ESSENTIAL STRUCTURALELEMENTSASILLUSTRATEDIN&IGURE

&)'52%7ODENgSSECTORBASEDLANDUSESTRATEGY.#$#!NNUAL2EPORT 



!#40,!..).'!.$,!.$!54(/2)49


3EGREGATION EXTENDED TO SEPARATING PEDESTRIANS FROM VEHICLES EITHER HORIZONTALLY THROUGH THECENTRALPEDESTRIANSPINEORVERTICALLYWITHELEVATEDWALKWAYSABOVETHESTREETS!LTHOUGH IDEALISTICINITSAIMTOPROTECTPEDESTRIANSFROMAPERCEIVEDDANGERPOSEDBYMOTORVEHICLES THE CONSEQUENCE IS THAT THE DESIGN OF STREETS FAVOURS VEHICLES AND PEDESTRIANS MUST FOLLOW ROUTESTHATHAVEPOORSURVEILLANCEANDAREOFTENDESERTEDOUTSIDENORMALOFFICEHOURS

&)'52%3EGREGATEDPEDESTRIANNETWORKUNDERPINNINGPLANNINGFOR7ODEN

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52% 7ODEN4OWN#ENTRE-ASTER0LAN 



!#40,!..).'!.$,!.$!54(/2)49

&)'52% 0HILLIP4RADES!REA3TRUCTURE0LANn


4OWNCENTREPLANS 4HEDEVELOPMENTOF7ODEN$ISTRICTBEGANINANDBY*UNETHEDISTRICTSPOPULATION WAS 4HEFIRSTMASTERPLANFORTHETOWNCENTREWASPREPAREDINANDCONSTRUCTION BEGANIN4HEBASICELEMENTSOFTHEFIRSTMASTERPLANWEREA Q

'OVERNMENTOFFICEPRECINCTWITH EMPLOYEES

Q

#OMMERCIALOFFICEANDENTERTAINMENTGROUPOF WORKERS

Q

3HOPPINGCENTREWITH EMPLOYEES

4HE DESIGN CONCEPT WAS TO LOCATE THE PRINCIPAL ELEMENTS IN A CRUCIFORM SHAPED PEDESTRIAN SYSTEM4HE-ASTER0LANREVISEDSOMEOFTHEBUILDINGSITINGANDDESIGNELEMENTSOFTHE PLANANDADDEDANENTERTAINMENTPRECINCTTOTHENORTHOFTHECORE 4HEREVIEWRECOGNISEDANEEDFORALARGEEMPLOYMENTBASEANDRECOMMENDED n  OFFICEEMPLOYMENTAND Mn MOFRETAILSPACEINTHETOWNCENTRECORE4HE STRUCTUREPLANINCLUDEDAS&IGUREEXPANDEDTHETOWNCENTRETOTHEEASTANDIDENTIFIEDSITES FORPARKINGSTRUCTURESASSURFACEPARKINGAREASWERETAKENUPBYNEWDEVELOPMENTS )N  THE &EDERAL 'OVERNMENT DECIDED TO OCCUPY ITS OWN OFFICE SPACE AND A NEW MASTER PLANWASPRODUCEDFOR7ODEN%ASTTOENABLETHECONSTRUCTIONOF MOFOFFICESPACEBY AND MBY/THERTHANTHEEXISTING#ALLAM/FFICESFORMERLYTHE#ANBERRA )NSTITUTEOF4ECHNOLOGY NOOTHEROFFICESHAVEBEENBUILTINTHISPARTOFTHETOWNCENTRE 4HE3ERVICE4RADES!REA34! WASPROPOSEDINTOCONTAINSITESFORMOTORSALES SERVICE AND REPAIR BUILDERS SUPPLIES WHOLESALING AND STORAGE WORKSHOPS AND DEPOTS 4HE  STRUCTUREPLANISINCLUDEDAS&IGURE 4HEFIRSTRELEASEOFSITESIN0HILLIPWASIN5SESWEREEXPANDEDINTOPERMITAWIDER RANGEOFRETAILACTIVITIES3OMEOFTHEREASONSFORTHISINCLUDED Q

4HEUNDERESTIMATIONOFTHEDEMANDFORRETAILINGINTHE4OWN#ENTRE

Q

2ELATIVELYLOWERRENTALS

Q

!BILITYTODRIVETOTHEDOOROFTHERETAILPREMISES

Q

!LLOWINGGREATERINDEPENDENCEFORRETAILERSTHROUGHFLEXIBLEOPENINGANDCLOSINGTIMES

4HELEASESHAVEBEENGRADUALLYEXPANDEDTORECOGNISE0HILLIPSMIXEDUSEROLE4HE4ERRITORY 0LAN IN THE EARLY S IDENTIFIED 0HILLIP AS 0RECINCT @C -IXED 5SE !REA AND THE POLICY PERMITSRETAILINGOTHERTHANTHESALEOFFOODWITHINSHOPSLARGERTHANM)TALSOPERMITS RESIDENTIAL DEVELOPMENT WITHIN A  PLOT RATIO AND  STOREY HEIGHT LIMIT 4HE NORTH FACING ASPECTSOVERTHELANDSCAPEDCOURTS FRONTANDREARACCESSANDMWIDEXMDEEPBLOCKS PROVIDECONSIDERABLEFLEXIBILITYFORADAPTIVEREUSEANDREDEVELOPMENT

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%%XTRACTOFTHE4ERRITORY0LANMAPFOR0HILLIP



!#40,!..).'!.$,!.$!54(/2)49




#522%.40,!..).' #/.3)$%2!4)/.3

 )NTRODUCTION 7ODEN LIKEMOSTTOWNS ISINACONTINUALSTATEOFEVOLUTION)TSFORMANDFUNCTIONTODAYMAY BEQUITEDIFFERENTINTENYEARSTIMEASMAYBETHEBUILDINGSREQUIREDTOSUPPORTITSFUNCTIONS ! NUMBER OF COMMERCIAL BUILDINGS WILL REQUIRE SUBSTANTIAL REFURBISHMENT SOME MAY BE CONVERTEDTORESIDENTIALANDMIXEDUSESANDSOMEMAYBEDEMOLISHEDANDREDEVELOPED.EW DEVELOPMENTOPPORTUNITIESWILLEMERGEANDNEWUSESWILLREQUIREDIFFERENTACCOMMODATIONTO WHATISCURRENTLYAVAILABLE #URRENTLYTHEGENERALURBANSTRUCTUREOFANINTEGRATEDCAMPUSSTYLEDESIGNLACKSTHELEGIBILITY ANDADAPTABILITYOFMORETRADITIONALSTREETBASEDTOWNS4HECOMMUNITYHASHIGHLIGHTEDSOME OF ITS CONCERNS AND THE ACTIONS OF BUILDING OWNERS MAJOR TENANTS AND GOVERNMENT NEED TO RESPONDINWAYSTHATHELP7ODENEVOLVEASAMOREVIBRANT WALKABLEANDLIVABLETOWN

 3TATUTORYPLANNINGPOLICIES $EVELOPMENTIN7ODEN4OWN#ENTREISMAINLYGOVERNEDBY4ERRITORY0LANPOLICIES ALTHOUGH THE.ATIONAL#APITAL0LANHASSOMERELEVANCE

4HE .ATIONAL #APITAL 0LAN .#0 CONFIRMS 7ODEN 4OWN #ENTRE AS A MAJOR EMPLOYMENT LOCATION )N ACCORDANCE WITH THE PROVISIONS OF 0ART  OF THE .#0 $EVELOPMENT #ONTROL 0LANS WILL ACT AS A STATUTORY FRAMEWORK AGAINST WHICH ANY DEVELOPMENT AND REDEVELOPMENT PROPOSALSFORFORMER.ATIONAL,ANDWILLBEASSESSED

4HE4ERRITORY0LANCOMMERCIALPOLICIESFORALLTOWNCENTRES INCLUDING7ODEN ARECONTAINED AT0ART"OFTHE4ERRITORY0LAN4HEOBJECTIVESOFTHE4OWN#ENTRE#OMMERCIAL@" ,AND5SE 0OLICIESARETO Q

0ROVIDETHEMAINFOCUSFORTHEDISTRICTPOPULATIONFORSHOPPING COMMUNITYANDCULTURAL FACILITIES ENTERTAINMENTANDRECREATION

Q

0ROVIDE OPPORTUNITIES FOR BUSINESS INVESTMENT AND EMPLOYMENT WHILST FACILITATING THE DECENTRALISATIONOFEMPLOYMENTFROMTHE#ENTRAL.ATIONAL!REA

Q

%NCOURAGEAMIXOFLANDUSES INCLUDINGRESIDENTIALUSES WHICHCONTRIBUTETOANACTIVE ANDDIVERSECHARACTER

Q

0ROVIDEANURBANSTRUCTUREWHICHISSIMPLE LEGIBLEANDFLEXIBLE

Q

-AINTAINANDENHANCEENVIRONMENTALAMENITYANDENCOURAGEASTANDARDOFURBANDESIGN CONSISTENTWITHTHEFUNCTIONOFTHECENTRE

Q

%NCOURAGEACTIVITIESPARTICULARLYATSTREETLEVEL WHICHCONTRIBUTETOPEDESTRIANACTIVITYAND SOCIALINTERACTION

7/$%.4/7.#%.42%^ MASTERPLAN




4!",%!GEPROJECTIONSOF7ODEN6ALLEYPOPULATION !GEYEARS

*UNE 

*UNE 

*UNE 

*UNE 

*UNE 

*UNE 

*UNE 

*UNE 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 







 

 

 

 



























4/4!,

-EDIANAGE

4OTALOVERAGE  

 

 

 

 

 

 

 















/VER AS7ODENPOP



    

       











3OURCE!#4'OVERNMENTDEMOGRAPHICPROJECTIONSn#HIEF-INISTERS$EPARTMENT

4!",% $ISTRIBUTIONOFPOPULATION RESIDENTWORKERSANDEMPLOYMENTBYDISTRICT

OF0OPULATION













"ELCONNEN













'UNGAHLIN













.ORTH#ANBERRA













3OUTH#ANBERRA













4UGGERANONG













7ODEN7ESTON#K































/THER !#4

OF2ESIDENT7ORKERS

3OURCE!"3AND#ENSUS%RRORSDUETOROUNDING



!#40,!..).'!.$,!.$!54(/2)49

OFTOTAL!#4%MPLOYMENT


4HE CURRENT .ATIONAL #APITAL 0LAN .#0 SETS OUT THE BROAD LAND USE STRUCTURE FOR THE !#4 INCLUDING 7ODEN 4OWN #ENTRE 4HE .#0 AT THE BROAD LEVEL AND THE 4ERRITORY 0LAN AT THE DETAILED LAND USE PLANNING LEVEL REINFORCE THE PRINCIPLES OF URBAN STRUCTURE ESTABLISHED IN EARLIERPLANSPRIORTOSELFGOVERNMENT 4HE 4ERRITORY 0LANS 4OWN #ENTRE 0OLICIES ALSO CONTAIN GENERAL CONTROLS AND !REA 3PECIFIC 0OLICIESAPPLYINGTOEACHPRECINCT4HECONTROLSMAINLYCONCERNTHENATUREOFDEVELOPMENT ADJACENTTOMAJORPEDESTRIANAREASANDROUTES THENEEDFORCONSISTENCYINDESIGNANDBUILDING MATERIALSANDCOLOURS ANDTHENEEDTOASSESSWINDIMPACTS%XISTING4ERRITORY0LANCONTROLS ARESUMMARISEDIN!PPENDIX"

 0OPULATION 4HEDISTRICTOF7ODEN7ESTON#REEKHADATOTALPOPULATIONOFABOUT IN*UNE/F THISABOUTWASINTHE AGEGROUP WASnANDWASINTHE AGEGROUP4HEDISTRICTPOPULATIONPEAKEDINATABOUT )TNEVERREACHEDTHELEVEL OF WHICHWASANTICIPATEDDURINGSPLANNING4ENYEARPOPULATIONPROJECTIONSFOR 7ODEN6ALLEYNOTINCLUDING7ESTON#REEK TO*UNEAREINCLUDEDAS4ABLE 4ABLESHOWSTHATBETWEENANDTHEPERCENTAGEOFTHE7ODENPOPULATIONOVER NEARLYDOUBLEDFROMTOANDISFORECASTTORISETOBY)NTERMSOFACTUAL NUMBERSINTHISAGECATEGORYTHEREWERE PEOPLEOVERINANDAFORECAST  IN ANINCREASEOF OR 4HESTAGEATWHICHTHEAGEDPOPULATIONREACHESAPLATEAUWILLDEPENDONTHEMOVEMENTOF PEOPLEINTOANDOUTOFTHEAREAANDTHEAGEPROFILEOFPEOPLEWHOMOVEINTOTHERE DEVELOPED ANDNEWDWELLINGS'ENERALLY THEPOPULATIONSOF7ESTON#REEKAND7ODEN6ALLEYHAVEBEEN RELATIVELY STABLE 4HAT LEADS THE EXISTING FORECASTS TO POINT TO BOTH THESE AREAS HAVING AGING POPULATIONS4HEMEDIANAGEOFTHE7ODEN6ALLEYPOPULATIONIN*UNEWASYEARSAND YEARSIN7ESTON#REEK"OTHWEREABOVETHE!#4MEDIANAGEOFYEARS 4HEDISTRICTHADABOUT PEOPLEINTHELABOURFORCEIN*UNE )N  THERE WERE  SCHOOLS INCLUDING  NON GOVERNMENT IN THE DISTRICT WITH A TOTAL OF  STUDENTSINNON GOVERNMENTSCHOOLS  4HE POSITION OF 7ODEN AND 7ESTON #REEK IN THE CONTEXT OF #ANBERRA WIDE POPULATION IS SUMMARISEDIN4ABLE

7/$%.4/7.#%.42%^ MASTERPLAN




 %MPLOYMENT !BOUT PEOPLEWEREEMPLOYEDINTHE4OWN#ENTREIN4HE7ODEN4OWN#ENTRE EMPLOYMENTSTUDYINTHROUGHASURVEYOFPRIVATEANDPUBLICESTABLISHMENTS FOUNDTHE TOTALEMPLOYMENTLEVELHADGROWNTO  AINCREASEFROMEMPLOYMENTLEVEL !CCORDINGTOTHE#ENSUSJOURNEYTOWORKRAWDATA THEREWERE PEOPLEWORKING IN0HILLIP!SSHOWNIN4ABLETRAVELLEDFROM4UGGERANONG FROM7ODENAND FROM7ESTON!FTERADJUSTINGTHECENSUSDATATHEEMPLOYMENTLEVELWASESTIMATEDATAROUND  IN!CCORDINGTOTHECENSUSDATAABOUTOF0HILLIPEMPLOYMENTWORKEDIN THE7ODEN#OREANDTHERESTINTHE0HILLIP-IXED3ERVICES!REA3ERVICE4RADES!REA 4HE %MPLOYMENT3TUDYINDICATEDASIMILARPROPORTION FOR0HILLIP 3INCETHEREHASBEENANUMBEROFNEWDEVELOPMENTSINCLUDING Q

$ISCOVERY(OUSE

Q

%XPANSIONOF7ODEN0LAZA

Q

0ITCHAND0UTTCOURSE

Q

.EWRETAILCLUSTERONTHECORNEROF(INDMARSH$RIVEAND"OTANY3TREET

Q

.EWRESTAURANTSINTHENORTHERNENTERTAINMENTPRECINCT

Q

.EWMOTELONTHECORNEROF-ELROSE$RIVEAND,AUNCESTON3TREET

4!",%7ORKTRIPSINTO7ODEN4OWN#ENTREAND            "ELCONNEN

7ODEN

7ESTON

4UGGERANONG 'UNGAHLIN

3OURCE!"3#ENSUS !"3 !"3



!#40,!..).'!.$,!.$!54(/2)49

.#ANBERRA 3#ANBERRA /THER2EGION


4!",%3UMMARYOFMAJOREMPLOYERSIN7ODEN4OWN#ENTRE %MPLOYER

!PPROXIMATENUMBEROFSTAFF

$EPARTMENTOF(EALTHAND!GEING

 

7ODEN0LAZA

 

0HILLIP"USINESS$ISTRICT-IXED3ERVICES!REA

 

)NTELLECTUAL0ROPERTY!USTRALIA



&AMILYAND#OMMUNITY3ERVICES



!BORIGINALAND4ORRES3TRAIGHT)SLANDER#OMMISSION



$EPARTMENTOF6ETERANS!FFAIRS



#ENTRELINK

 

#LUBSENTERTAINMENT



%DUCATION



/THER



4OTAL

 

3OURCE0!,-TELEPHONESURVEYn!UGUST

)N $ECEMBER  THE TOTAL !#4 RESIDENT EMPLOYMENT WAS   ACCORDING TO THE !"3 FIGURES "Y INCLUDING THE REGIONAL FLOWS THE TOTAL !#4 EMPLOYMENT WOULD RISE TO ABOUT   -AJOREMPLOYERSIN7ODENARESUMMARISEDIN4ABLE )N0HILLIP-IXED3ERVICES!REA THEDOMINANTEMPLOYINGINDUSTRYIS2ETAIL4RADE INCLUDINGTHE SALEOFCARS FOLLOWEDBY0ROPERTYAND"USINESS3ERVICES 7HOLESALE4RADEAND4RANSPORTAND 3TORAGE

 2ETAIL 3TAGE  OF THE 7ODEN 0LAZA   M WAS COMPLETED IN  AND INCLUDED A MAJOR DEPARTMENT STORE MINI DEPARTMENT STORE SUPERMARKET AND  SPECIALITY SHOPS 4HE ,OVETT -,# 4OWEROPENEDIN"YANOTHERSHOPSOPENEDANDTHEDEPARTMENTSTORE WASEXTENDED 4HERESULTSFOR0HILLIPOFTHECOMMERCIALFLOORSPACEAUDITUNDERTAKENBYTHE!#4'OVERNMENT IN*UNEARESHOWNIN4ABLESAND

7/$%.4/7.#%.42%^ MASTERPLAN




4!",%#OMMERCIALSPACEINVENTORY*UNE 7ODENCORE $ESCRIPTION

.OOFPREMISES

&LOOR!REAM

$EPARTMENTAND6ARIETY



 

&OOD 3UPERMARKET



 

&OOD /THER



 

#LOTHES3HOES



 





!PPLIANCE(ARDWARE



 

/THER2ETAIL



 

6ACANT



 

&INANCE)NSURANCE



 

2EST#AFES



 

(EALTH7ELFARE%DUCATION



 

"USINESS0ROPERTY4RAVEL







 





4EXTILE&URNITURE

/THER3ERVICES /FFICES 4OTAL7ODENCORE



 

3OURCE0!,-SURVEY

4!",%  #OMMERCIAL SPACE INVENTORY *UNE  n 0HILLIP -IXED 3ERVICES $ESCRIPTION

.OOFPREMISES

&LOOR!REAM







 

#LOTHES3HOES





4EXTILE&URNITURE



 

!PPLIANCE(ARDWARE



 

/THER2ETAIL



 

6ACANT



 

6ACANT ST,EVEL



 

&INANCE)NSURANCE





2EST#AFES



 

(EALTH7ELFARE%DUCATION



 

"USINESS0ROPERTY4RAVEL



 

/THER3ERVICES



 

0ETROL3TATIONS







 



 



 



 

&OOD 3UPERMARKET &OOD /THER

-OTOR /THER /FFICES /THERMANUFACTURINGETC 4OTAL 3OURCE0!,-SURVEY



!#40,!..).'!.$,!.$!54(/2)49


4HEAUDITIDENTIFIEDATOTALRETAILFLOORSPACEWITHIN7ODENCOREOF M!LARGEPROPORTION OFFLOORSPACEISCONTAINEDWITHINTHE7ODEN0LAZAAPPROXIMATELY M ANDTHECENTRE OPERATESINAREGIONALCAPACITY PROVIDINGCONVENIENCEANDCOMPARISONSHOPPINGOPPORTUNITIES FORTHESURROUNDINGCATCHMENTOFALMOST PEOPLE 4HE ROLE AND FUNCTION OF 7ODEN 0LAZA IS DEFINED BY THE TENANCY PROFILE WITH APPROXIMATELY  OF FLOOR SPACE IN NON FOOD RETAILING OFFERING DEPARTMENT AND VARIETY SHOPPING AND SPECIALTYSTORES#OLESAND7OOLWORTHSCOMPLEMENTTHENON FOODOFFERWITH M$AVID *ONESDEPARTMENTSTOREISTHEMAJORTENANTANDMAJORANCHORFORTHECENTRETAKINGUPABOUT  M /F THE  SPECIALTY STORES WITHIN THE CENTRE OVER  ARE NATIONAL BRAND TENANCIES ! VIBRANT RESTAURANT PRECINCT ALONG THE WESTERN EDGE OF THE 0LAZA COMPLEMENTS THE MAJOR RETAILINGFUNCTIONINTHETOWNCORE 0HILLIP-IXED3ERVICES!REAPROVIDESAPERIPHERALSALESFUNCTIONSUPPLYINGAGREATERCATCHMENT THANTHE7ODEN0LAZAWITHBULKYHOUSEHOLDGOODSANDSERVICESANDMOTORVEHICLEANDMOTOR PARTSSALES/FATOTALOF M ISTAKENBYMOTORTRADES/FTHEREMAINING M THEREWEREVACANCIESATFIRSTFLOORLEVELREPRESENTING M4WENTY TWOOTHERSITESWERE VACANT WITH A TOTAL AREA OF  M 4HE -IXED 3ERVICES !REA DRAWS ITS CUSTOMERS FROM A #ANBERRAWIDECATCHMENTASSHOWNIN4ABLE

4!",%,OCATIONOFCUSTOMERSTO0HILLIP-IXED3ERVICES!REA ,OCATIONOF#USTOMERS

0OSTCODES



#URTIN 'ARRAN (UGHES





#HIFLEY 0HILLIP





&ARRER )SAACS 0EARCE -AWSON 4ORRENS





7ESTON#REEK





 



3OUTH#ANBERRA

  



.ORTH#ANBERRA

   



"ELCONNEN

 



'UNGAHLIN

 







2EMAINDER



4OTAL



4UGGERANONG

1UEANBEYAN

3OURCE!USTRALIAN-ARKETINGAND2ESEARCH3ERVICES%RRORDUETOROUNDING 

7/$%.4/7.#%.42%^ MASTERPLAN




#OMMERCIAL 4HE3IRIUS"UILDINGWASTHEFIRSTOFFICEIN7ODENTHATWASOCCUPIEDBYTHE$EPARTMENTOF7ORKS IN4ODAY7ODENCONTAINSMORETHAN MOFOFFICESPACEASSHOWNIN4ABLE 4HEVACANCYRATEOFISVERYLOWSUGGESTINGDIFFICULTIESMAJORTENANTSAREEXPERIENCINGIN SATISFYINGTHEIROFFICENEEDS.OTETHATTHEVACANCYRATEDOESNOTINCLUDE3CARBOROUGH(OUSE THATHASBEENVACANTFORANUMBEROFYEARSANDSIGNIFICANTREFURBISHMENTHASONLYRECENTLY BEGUN

4!",%4OTALAVAILABLEOFFICESPACEIN7ODEN4OWN#ENTRE#ORE 0ERIOD

4OTALSTOCKM

6ACANTM

6ACANCY&ACTOR

*ANUARY



 

 



*ULY



 





*ANUARY



 

 



*ULY



 





*ANUARY



 





*ULY



 

 



*ANUARY



 





*ULY



 





!NAPPROXIMATEBREAKDOWNOFOFFICESPACEBYINDIVIDUALBUILDINGISSHOWNIN4ABLE7ITHTHE EXCEPTION$ISCOVERY(OUSETHEMAJORITYOFOFFICESPACEIN7ODENISAPPROACHINGYEARSOF AGE4HENEEDSOFMAJORTENANTSHAVECHANGEDOVERTHISTIMEWITHTHEADVENTOFGREENHOUSE GASEMISSIONSREPORTING DESIREFORLARGERFLOORPLATESTOIMPROVEEFFICIENCY LOCATIONOFLARGE GOVERNMENTAGENCIESWITHINADISCRETEBUILDINGCOMPLEXWITHASINGLECONTROLLEDACCESSPOINT ANDTHESALEOFGOVERNMENTOWNEDOFFICESTOTHEPRIVATESECTOR4HELATTERPOINTINPARTICULAR GIVES DEPARTMENTS FREEDOM TO NEGOTIATE IN THE OPEN MARKET FOR THE MOST ACCEPTABLE OFFICE ACCOMMODATIONARRANGEMENTS)NTHISREGARDAPPROPRIATEDEVELOPMENTANDREDEVELOPMENT OPPORTUNITIESMUSTBEIDENTIFIEDINORDERTOMAINTAIN7ODENSGOVERNMENTAGENCYEMPLOYMENT BASE



!#40,!..).'!.$,!.$!54(/2)49


4!",%3UMMARYOFOFFICESTOCKIN7ODEN "UILDINGNAME

!PPROX .ETT,ETABLE !REAM

$ISCOVERY(OUSE

3TOREYS /NSITE PARKING

9EAR BUILT

-AJORTENANT ASOF*ULY

 







)0!USTRALIA

!LEXANDER"UILDING

 







(!#ARE

!LEXANDER"UILDING

 







(!#ARE

!LBERMALE"UILDING

 







(!#ARE

!LBERMALE"UILDING

 







(!#ARE

&ISHBURN(OUSE

 







(!#ARE

3IRIUS"UILDING

 







)0!USTRALIA

#ALLAM/FFICES

 







!#4'OV

 







!43)#6!

3IR+EITH#AMPBELL#ENTRE

 







#ENTRELINK

#OSMOPOLITAN"UILDING

 







#ENTRELINK

"OWES0LACE

 







#ENTRELINK

"ONNER(OUSE

 







(!#ARE

#OMMONWEALTH"ANK"UILDING

 







#OMMONWEALTH"ANK

#HURCHES#ENTRE

 







#ENTRELINK

0ENRHYN(OUSE

 







(!#ARE

*ULIANA(OUSE

 







&!#3

"ORROWDALE(OUSE

 







0OSTOFFICE

3CARBOROUGH(OUSE

 







6ACANT

#ORINNA#HAMBERS

 





S

0RIVATE

')/(OUSE

 



S

0RIVATE

&RANCIS#HAMBERS

 





S

0RIVATE

'ADAL#HAMBERS

 



S

0RIVATE

.O#ORINNA3TREET

 



S

0RIVATE

,OVETT4OWER

3OURCE0!,-SURVEY*UNE

0ROPOSALTOENLARGEFLOORPLANSTOCREATEABUILDINGOFAPPROXIMATELY M

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%%XISTINGTRAFFICVOLUMES6EHICLESPERHOUR AFTERNOONPEAKHOUR



TREET #ALLAM3 









 

















MARS H $ R  IVE



 

(IND









BA



,AUN CESTON VE $RI 

-ELROSE$RIVE



M 9A

 





   













 











!THLLON$RIVE

TREET END3  4OWNS

 



   



!#40,!..).'!.$,!.$!54(/2)49





$R

IV

E


 2OADNETWORK 

42!&&)#6/,5-%3

&IGURESHOWSTHECURRENTAFTERNOONPEAKHOURTRAFFICVOLUMESONTHEMAJORROADSINTHE STUDYAREA4HETRAFFICVOLUMESHAVEBEENDERIVEDFROM$EPARTMENTOF5RBAN3ERVICESDATA ANDPREVIOUSTRAFFICANALYSESFORVARIOUSPROPOSALSWITHIN7ODEN 2/!$#!0!#)49 4HETOTALVEHICLENUMBERSFORTHEROADS SPREADACROSS ORLANESDEPENDINGONTHETYPE OFROAD CANBECOMPAREDWITHTHE3COTT7ILSON.AIRNTRAFFICMODELFOR#ANBERRATHATCODES ROADTYPESWITHTHEFOLLOWINGCAPACITIES 2OADTYPE

#APACITYVEHICLESHOURLANE

#"$STREET



,OCALSTREET

 

#OLLECTORROAD

 

!RTERIALROAD

   

0ARKWAY

   

4HE CAPACITY OF A ROAD IS REACHED WHEN TRAFFIC OPERATIONS BECOME IRREGULAR WITH STOP START MOVEMENTS SLOW SPEEDS AND MANY STOPS 4HESE CONDITIONS CAN APPEAR QUITE QUICKLY WITH ONLYMINORINCREASESINTRAFFICVOLUMES 7HENAROADISESTIMATEDTOHAVEAVOLUMETOCAPACITYRATIOOFABOUT ITWILLEXHIBITMANY OFTHEPROBLEMSASSOCIATEDWITHUNDERCAPACITY ,ANE CAPACITY IS ONE VARIABLE BUT ANOTHER IS INTERSECTION CAPACITY WITHIN THE SYSTEM 0UT SIMPLISTICALLYONELANEOFTRAFFICCANCARRYAPPROXIMATELYVEHICLESANHOUR)FTHATLANEIS HELDUPATTRAFFICLIGHTSFOROFTHETIMETHENTHEVOLUMEOFTHETRAFFICMOVINGCONTINUOUSLY ALONGTHELANEISREDUCEDBY(OWEVER INCREASINGTHELANESAPPROACHINGTHEINTERSECTION ALLOWSGREATERSTORAGEOFVEHICLESANDRESTORESSOMEOFTHEORIGINALCAPACITY &ORALLTHEAPPARENTCAPACITYIN7ODENSOVERALLROADNETWORKTHEREAREANUMBEROFCLEARLY IDENTIFIEDPOINTSOFCONGESTIONTHATLARGELYRELATETOACCESSTOTHERETAILAREACARPARKS4HESE SPECIFICPROBLEMSINCLUDE Q

3HORT QUEUING DISTANCES IN "ALL 3TREET BETWEEN (INDMARSH $RIVE AND #ORINNA 3TREET RESULTINGINTRAFFICBACKINGUPINTO(INDMARSH$RIVE

Q

(IGHTURNOVERINRETAILCARPARKRESULTINGINHIGHERTHANEXPECTEDVEHICLEMOVEMENTSATTHE BASEMENTROUNDABOUT

Q

"IAS TOWARDS NORTHBOUND ARRIVALS AND SOUTH BOUND DEPARTURES FROM RETAIL CAR PARKS ON #ALLAM3TREETRESULTINGINQUEUINGONBOTHLEFTANDRIGHTTURNSFROM(INDMARSH$RIVEINTO #ALLAM3TREET

7/$%.4/7.#%.42%^ MASTERPLAN






&%!452%3/&-!*/22/!$3

-AJORROADSIN7ODENGENERALLYFAILTOPROVIDEAQUALITYINTERFACEWITHLANDUSEBECAUSEOFTHE ROADSPHYSICALFORM THEPROMOTIONOFHIGHSPEEDTRAVELANDTHELACKOFACTIVITYANDFRONTAGE TOTHEROADS ,IMITED ACCESS TO ARTERIAL ROADS OFTEN HAS THE EFFECT OF FUNNELLING TRAFFIC TO RELATIVELY FEW LOCATIONS CREATINGTRAFFICCONGESTIONATINTERSECTIONS #HARACTERISTICSOFMAJORROADSARESUMMARISEDAS -%,2/3%$2)6% -ELROSE$RIVEFORMSTHEWESTERNBOUNDARYOFTHESTUDYAREA)TOPERATESASANARTERIALROAD ANDISCHARACTERISEDBY Q

'ENERALLY LANES WITHLANEWIDTHSGREATERTHANDESIRABLETOCREATEATOWNCENTRETRAFFIC SPEEDENVIRONMENT

Q

KPHSPEEDLIMITNORTHOF(INDMARSH$RIVEANDKPHBETWEEN(INDMARSHAND!THLLON $RIVES

Q

(IGHCAPACITYROUTEWITHMID BLOCKCAPACITYEXCEEDINGINTERSECTIONCAPACITY

Q

.OKERBSIDEPARKING

Q

.OON ROADCYCLINGFACILITIES

Q

,ONG PEDESTRIAN CROSSING PATHS AT BOTH CONTROLLED AND UNCONTROLLED INTERSECTIONS 3AFE MID BLOCKPEDESTRIANCROSSINGISONLYPOSSIBLEFORFITANDMOBILEPEOPLE

Q

$ETAILING OF TURNING LANES ENCOURAGES HIGH SPEED TURNS OFF THE MAIN ROAD INTO ADJACENT STREETSANDDRIVEWAYSWHICHINTURN DEGRADESTHEAMENITYOFADJOININGAREAS

Q

4HERE IS NO ACTIVITY ALONG FOOTPATHS TO CREATE SURVEILLANCE AND SECURITY AND THE LEVEL OF PEDESTRIANUSEOFTHEAREAISLOW

&)'52%-ELROSE$RIVECROSSSECTIONS











 M

!#40,!..).'!.$,!.$!54(/2)49










,!5.#%34/.342%%4 ,AUNCESTON3TREETOPERATESASACOLLECTORROADTHATDIVIDESTHESPORTSPRECINCTTOTHENORTHAND THECOMMERCIALOFFICESPACETOTHESOUTH)TSCHARACTERISTICSINCLUDE Q

3IXLANECROSSSECTION WITHAPPROPRIATELANEWIDTHS

Q

KPHSPEEDLIMIT

Q

.OKERBSIDEPARKING

Q

.OON ROADCYCLINGFACILITIES

Q

,ONGPEDESTRIANCROSSINGPATHS

Q

(IGHTRAFFICCAPACITYWITHMID BLOCKCAPACITYEXCEEDINGINTERSECTIONCAPACITY"OTHMID BLOCKANDINTERSECTIONCAPACITIESEXCEEDCURRENTORFUTUREDEMANDS &)'52%,AUNCESTON3TREETCROSSSECTION









 M









#!,,!-342%%4 #ALLAM3TREETOPERATESASANARTERIALROADANDISANORTH SOUTHLINKONTHEEASTERNSIDEOFTHE 4OWN#ENTRE)TSCURRENTCONFIGURATIONINCLUDES Q

 LANECROSSSECTION WITHAPPROPRIATEWIDTHTRAVELLANES

Q

KPHSPEEDLIMIT

Q

.OKERBSIDEPARKING

Q

.OON ROADCYCLINGFACILITIES

Q

,ONGPEDESTRIANCROSSINGDISTANCES

Q

(IGH TRAFFIC CAPACITY WITH MID BLOCK CAPACITY EXCEEDING INTERSECTION CAPACITY BUT BOTH MID BLOCKCAPACITYANDINTERSECTIONCAPACITYEXCEEDCURRENTORLIKELYFUTUREDEMANDS

Q

4HERE IS NO ACTIVITY ALONG FOOTPATHS TO CREATE SURVEILLANCE AND SECURITY AND LEVEL OF PEDESTRIANUSEOFTHEAREAISLOW &)'52%#ALLAM3TREETCROSSSECTION









 M









7/$%.4/7.#%.42%^ MASTERPLAN




().$-!23($2)6% (INDMARSH$RIVEISANARTERIALROADTHATDIVIDES7ODEN4OWN#ENTREAND0HILLIP-IXED3ERVICES !REA)TSCHARACTERISTICSINCLUDE Q

'ENERALLY SIX LANES WITH LANE WIDTHS GREATER THAN DESIRABLE FOR CREATING A TRAFFIC SPEED ENVIRONMENTCONDUCIVETO4OWN#ENTREACTIVITY

Q

(IGHCAPACITYROUTEWITHMID BLOCKCAPACITYEXCEEDINGINTERSECTIONCAPACITY

Q

.OKERBSIDEPARKING

Q

.OON ROADCYCLINGFACILITIES

Q

,ONG PEDESTRIAN CROSSING PATHS AT BOTH CONTROLLED AND UNCONTROLLED INTERSECTIONS WITH SAFEMID BLOCKPEDESTRIANCROSSINGONLYPOSSIBLEFORFITANDAGILEPEOPLEATMOSTTIMESOF THEDAY

Q

$ETAILING OF TURNING LANES ENCOURAGES HIGH SPEED TURNS OFF THE MAIN ROAD INTO ADJACENT STREETSANDDRIVEWAYSWHICHINTURNDEGRADESTHEAMENITYOFADJOININGAREAS

4/7.3(%.$342%%4 4OWNSHEND3TREETISACOLLECTORROADTHATFORMSTHEMAINROADTHROUGH0HILLIP-IXED3ERVICES !REA)TSCHARACTERISTICSINCLUDE Q

4WOLANECROSSSECTION APPROPRIATEWIDTHTRAVELLANES

Q

3OMEKERBSIDEPARKING

Q

.OON ROADCYCLINGFACILITIES

Q

-EDIANSASSISTPEDESTRIANCROSSINGPATHS

Q

&OOTPATHWELLFRONTEDINALLAREAS ALTHOUGHSOMELENGTHYGAPSANDACCESSDIFFICULTIES

!4(,,/.$2)6% !THLLON $RIVE IS AN ARTERIAL ROAD THAT FORMS THE SOUTHERN EXTENSION OF #ALLAM 3TREET )TS CHARACTERISTICSINCLUDE



Q

 LANECROSSSECTIONWITHAPPROPRIATEWIDTHTRAVELLANES

Q

KPHSPEEDLIMIT

Q

.OKERBSIDEPARKING BUTNOREALREASONTOPARK

Q

.OON ROADCYCLINGFACILITIES

Q

#REEKANDTRUNKCYCLEWAYCORRIDORONTHEEASTERNSIDE

!#40,!..).'!.$,!.$!54(/2)49


 )NTERCHANGEANDBUSOPERATIONS 

02/6)3)/.&/2"53%3

7ODENISTHEMAJORPUBLICTRANSPORTHUBWITHIN#ANBERRA BEINGEFFECTIVELYATTHEGEOGRAPHICCENTRE ANDONMANYOFTHEMAJORTRAVELROUTES7ODENISSERVICEDBYBOTHTRUNKANDLOCALBUSSERVICES)N ADDITIONTOTHE!#4)/.SERVICESOTHERBUSCOMPANIESPROVIDESCHOOLANDCHARTERSERVICES /N A TYPICAL WEEKDAY THERE ARE   SCHEDULED BUS MOVEMENTS THROUGH THE 7ODEN "US )NTERCHANGE 4HIS INCLUDES  THROUGH RUNNING SERVICES  TERMINATING SERVICES AND  ORIGINATING SERVICES 4HE ACTUAL NUMBER OF BUSES RUNNING THROUGH 7ODEN ON A WEEKDAY IS THEREFORE TOMAKEATOTALOF4HEBUSINTERCHANGEACCOMMODATESUPTOBUSES INTHEMORNINGPEAKHOUR WITHROUTESEITHERPASSINGTHROUGHORTERMINATINGAT7ODEN"USROUTES INTO7ODENAREDESCRIBEDIN4ABLEWHILEBUSROUTESOUTOF7ODENAREDESCRIBEDIN4ABLE !LLBUSROUTESOPERATINGTHROUGH7ODENUSETHEINTERCHANGE/THERSTOPSINCLUDE,AUNCESTON 3TREETATTHENORTHERNENDOFTHEOFFICEPRECINCT0HILLIP3WIMMING0OOL #ORINNA3TREETATTHE WESTERNENTRANCETOTHE0LAZA (INDMARSH$RIVE !THLLON$RIVEONTHEEASTERNSIDEOFTHE0HILLIP -IXED 3ERVICES !REA AND 4OWNSHEND 3TREET IN THE CENTRE OF THE -IXED 3ERVICES !REA 4HE NUMBEROFBUSESATEACHOFTHESTOPSINANDAROUND7ODENISSUMMARISEDIN&IGUREAND 4!",%$ISTRIBUTIONOFBUSSERVICESAROUND7ODEN 3TOP

4OTAL

7ODENSERVICES

 



,AUNCESTON3TREET





#ORINNA3TREET





0HILLIP-IXED3ERVICES!REA





4HROUGHRUNNING





 



7ODENINTERCHANGE

4ERMINATINGORIGINATING

.OTE0HILLIPINCLUDESSTOPSIN4OWNSHEND3TREET -ELROSEAND(INDMARSH$RIVES

&IGURESHOWSTHEHOURLYBREAKDOWNFORBUSMOVEMENTSTHROUGH7ODEN4HEGRAPHSHOWS TWO DISTINCT PEAKS A MORNING PEAK FROM AM TO AM AND AN AFTERNOON PEAK FROM PM TO PM4HEMORNINGPEAKISTYPICALLYHIGHERBECAUSEDURINGTHEMORNINGPEAKBOTHJOURNEYTO WORKANDJOURNEYTOSCHOOLOVERLAP(OWEVERDURINGTHEAFTERNOONPEAKTHESEUSESOCCURAT DIFFERENTTIMES /NE HUNDRED AND TWENTY MOVEMENTS OCCUR IN THE MORNING PEAK AND THESE SERVICES ARE DESCRIBEDAS Q

4RUNKn.ORTHBOUND



Q

4RUNKn3OUTHBOUND



Q

4ERMINATING



Q

7ESTBOUND



7/$%.4/7.#%.42%^ MASTERPLAN




4!",%"USROUTESINTO7ODEN 2OUTE

/RIGIN



0EARCE 3OUTHLANDS-AWSON



9ES

.O



0EARCE 4ORRENS 3OUTHLANDS-AWSON



9ES

.O



)SAACS &ARRER -AWSONCLOCKWISELOOP



.O

.O

.O

,OOP

.ORTH



-AWSON &ARRER )SAACSCOUNTERCLOCKWISE



.O

.O

.O

,OOP

.ORTH



7ESTON "LACKWOOD4CE #OOLEMAN#OURT



9ES

.O

.O

9ES

3OUTH



#OOLEMAN#RT 3TIRLING #HAPMAN 7ESTON



9ES

.O

.O

9ES

3OUTH



7ARAMANGA 2IVETT #OOLEMAN#OURT



9ES

.O

.O

9ES

3OUTH



"ARTON 0ARKES 2USSELL #AMPBELL0ARK



$EVONPORT3T $UFFY #OOLEMAN#OURT

0 

#ORINNA 3TREET

0HILLIP -3!

4ERMINATING

!PPROACH DIRECTION

.O

,OOP

3OUTH

9ES

,OOP

3OUTH

9ES

.O

.O

2USSELL

3OUTH

9ES

.O

.O

9ES

.ORTH



#URTIN &ORREST 2USSELL #ITY 'IRALANG



9ES

.O

.O

9ES

.ORTH



9ARRALUMLA 0ARKES #ITY 'IRALANG



9ES

.O

.O

9ES

.ORTH



#URTIN 9ARRALUMLA #ITY 'IRALANG



9ES

.O

.O

9ES

.ORTH



(OSPITAL 5NI 0ARLIAMENT(OUSE #ITY "ELCONNEN 

.O

.O

.O

9ES

3OUTH



#URTIN #ITY

0

9ES

.O

.O

9ES

.ORTH



.ARRABUNDAH +INGSTON #ITY $ICKSON



.O

.O

.O

9ES

.ORTH



"ELCONNEN

0

9ES

.O

.O

9ES

.ORTH



+AMBAH 4UGGERANONG



.O

.O

9ES

9ES

3OUTH



+AMBAH /XLEY 4UGGERANONG



9ES

.O

9ES

#ITY

3OUTH



%AST+AMBAH 4UGGERANONG



9ES

.O

9ES

9ES

3OUTH



"ARTON 0ARKES 2USSELL #AMPBELL0ARK

0

.O

.O

9ES

4UGGERANONG

.ORTH



7ANNIASSA -ONASH 4UGGERANONG



.O

.O

9ES

9ES

3OUTH



7ANNIASSA -ONASH 4UGGERANONG

0

.O

.O

9ES

4O#ITY

3OUTH



7ANNIASSA -ONASH 4UGGERANONG



.O

.O

9ES

9ES

3OUTH



&ADDEN )SABELLA0LAINS 4UGGERANONG



.O

.O

9ES

9ES

3OUTH



'OWRIE #HISHOLM 2ICHARDSON 4UGGERANONG



.O

.O

.O

9ES

3OUTH



&ADDEN #HISHOLM 2ICHARDSON 4UGGERANONG



.O

.O

.O

9ES

3OUTH



(UGHES -ANUKA 2AIL3TATION &YSHWICK



.O

.O

.O

,OOP

.ORTH



#ANBERRA(OSPITAL $EAKIN -ANUKA



.O

.O

.O

9ES

.ORTH



!'3/ &YSHWICK



.O

.O

.O

9ES

.ORTH



4UGGERANONG



.O

.O

.O

#ITY

3OUTH



#ITY



.O

.O

.O

4UGGERANONG

.ORTH



#ITY "ELCONNEN &LOREY ,ATHAM +IPPAX



9ES

.O

.O

9ES

.ORTH



#ITY "ELCONNEN (AWKER (IGGINS +IPPAX



9ES

.O

.O

9ES

.ORTH



#OOLEMAN#OURT 3TIRLING #HAPMAN7ESTON

0

9ES

.O

.O

#ITY

3OUTH



#ITY

0

9ES

.O

.O

7ESTON

.ORTH



7EST+AMBAH 4UGGERANONG

0

.O

.O

9ES

#ITY

3OUTH



#ITY

0

.O

.O

9ES

4UGGERANONG

.ORTH



#ITY

0

9ES

.O

9ES

4UGGERANONG

.ORTH



+AMBAH /XLEY 4UGGERANONG

0

9ES

.O

9ES

#ITY

3OUTH



%AST+AMBAH 4UGGERANONG

0

9ES

.O

9ES

#ITY

3OUTH



#ITY

0

9ES

.O

9ES

4UGGERANONG

.ORTH



&ADDEN 'OWRIE -ONASH

0

.O

.O

.O

#ITY

3OUTH



"ARTON 0ARKES 2USSELL #ITY

0

9ES

.O

.O

7ESTON

.ORTH



3TIRLING $UFFY (OLDER 7ESTON

0

9ES

.O

.O

#ITY

3OUTH



7ESTON "LACKWOOD4CE #OOLEMAN#OURT

0

9ES

.O

.O

#ITY

3OUTH



7ARAMANGA 2IVETT #OOLEMAN#OURT

0

9ES

.O

.O

#ITY

3OUTH



"ARTON 0ARKES 2USSELL #ITY

0

9ES

.O

.O

#ITY

3OUTH



"ARTON 0ARKES 2USSELL #ITY

0

.O

.O

9ES

4UGGERANONG

.ORTH



&ADDEN 'OWRIE )SABELLA0LAINS 4UGGERANONG

0

.O

.O

9ES

#ITY

3OUTH



&ADDEN #HISHOLM 2ICHARDSON 4UGGERANONG

0

.O

.O

.O

#ITY

3OUTH



"ARTON 0ARKES 2USSELL #ITY

0

.O

.O

.O

4UGGERANONG

.ORTH



4UGGERANONG 4HEODORE



9ES

.O

9ES

"ELCONNEN

3OUTH



"ELCONNEN -C+ELLAR %VATT



9ES

.O

9ES

4UGGERANONG

.ORTH



4UGGERANONG "ANKS



9ES

.O

9ES

"ELCONNEN

3OUTH



"ELCONNEN 0AGE 3CULLIN #HARNWOOD



9ES

.O

9ES

4UGGERANONG

.ORTH



4UGGERANONG "ANKS



9ES

.O

9ES

"ELCONNEN

3OUTH



TO"ELCONNEN &LYNN &RASER



9ES

.O

9ES

4UGGERANONG

.ORTH



4UGGERANONGTO $OWNARD3T 4HEODORE



9ES

.O

9ES

"ELCONNEN

3OUTH

 "ELCONNEN-ELBA 3PENCE  9ES !#40,!..).'!.$,!.$!54(/2)49

.O

9ES

4UGGERANONG

.ORTH

.IL



.!

.!

4OTAL +%9



7EEKDAY ,AUNCESTON SERVICES 3TREET





0 0EAKSERVICEONLY "OLDTYPE 4HROUGHRUNNINGROUTE 0HILLIP34!^)NCLUDESSTOPSIN4OWNSHEND3TREET -ELROSEAND(INDMARSH$RIVES

!#40,!..).'!.$,!.$!54(/2)49


4!",%"USROUTESDEPARTING7ODEN .OTETHAT THROUGHRUNNINGSERVICESAREINCLUDEDIN4ABLEANDHAVENOTBEENINCLUDEDASECONDTIMEINTHISTABLE

2OUTE /RIGIN

7EEKDAY

,AUNCESTON 3TREET

#ORINNA 3TREET

0HILLIP -3!

$EPART DIRECTION



0EARCE 3OUTHLANDS-AWSON



9ES

.O

.O

3OUTH



0EARCE 4ORRENS 3OUTHLANDS-AWSON



9ES

9ES

9ES

3OUTH



)SAACS &ARRER -AWSONCLOCKWISELOOP



.O

.O

.O

.ORTH



-AWSON &ARRER )SAACSCOUNTERCLOCKWISE



.O

.O

.O

.ORTH



7ESTON "LACKWOOD4CE #OOLEMAN#OURT



9ES

9ES

.O

3OUTH



#OOLEMAN#RT 3TIRLING #HAPMAN 7ESTON



9ES

9ES

.O

3OUTH



7ARAMANGA 2IVETT #OOLEMAN#OURT



9ES

9ES

.O

3OUTH



$EVONPORT3T $UFFY #OOLEMAN#OURT



9ES

.O

.O

.ORTH



#URTIN &ORREST 2USSELL #ITY 'IRALANG



9ES

.O

.O

.ORTH



9ARRALUMLA 0ARKES #ITY 'IRALANG



9ES

.O

.O

.ORTH



#URTIN 9ARRALUMLA #ITY 'IRALANG



9ES

.O

.O

.ORTH



(OSPITAL 5NI 0ARLIAMENT(OUSE #ITY "ELC



.O

.O

.O

3OUTH



#URTIN #ITY

0

9ES

.O

.O

.ORTH



.ARRABUNDAH +INGSTON #ITY $ICKSON



.O

.O

.O

.ORTH



"ELCONNEN

0

9ES

.O

.O

.ORTH



+AMBAH 4UGGERANONG



.O

9ES

9ES

3OUTH



%AST+AMBAH 4UGGERANONG



9ES

9ES

9ES

3OUTH



7ANNIASSA -ONASH 4UGGERANONG



.O

.O

9ES

3OUTH



7ANNIASSA -ONASH 4UGGERANONG



.O

.O

9ES

3OUTH



&ADDEN )SABELLA0LAINS 4UGGERANONG



.O

.O

9ES

3OUTH



'OWRIE #HISHOLM 2ICHARDSON 4UGG



.O

.O

.O

3OUTH



&ADDEN #HISHOLM 2ICHARDSON 4UGG



.O

.O

.O

3OUTH



(UGHES -ANUKA 2AIL3TATION &YSHWICK



.O

.O

.O

.ORTH



#ANBERRA(OSPITAL $EAKIN -ANUKA



.O

.O

.O

.ORTH



!'3/ &YSHWICK



.O

.O

.O

.ORTH



#ITY "ELCONNEN &LOREY ,ATHAM +IPPAX



9ES

.O

.O

.ORTH



#ITY "ELCONNEN (AWKER (IGGINS +IPPAX



9ES

.O

.O

.ORTH

4OTAL









.!

&)'52%(OURLYBREAKDOWNOFBUSMOVEMENTSTHROUGH7ODEN 

.OOF-OVEMENTS











 







































(OUROF$AY 7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%"USROUTESTHROUGH7ODEN



MINU

TE W A

LK

 M O RA  M IN UT E W AL K

 

A  M OR

  

 



"5334/0!.$).4%2#(!.'%-!.!'%-%.4

"US ROUTES EACH HAVE A SEPARATE SLOT FOR SET DOWN AND COLLECTION OF PASSENGERS WITHIN THE INTERCHANGE 7ITH THE NEW WESTERN ENTRANCE TO THE 0LAZA THE EXISTING INTERCHANGE IS CONSIDERED BY SOME USERSTOBELESSCENTRALALTHOUGHMAJORPASSENGERGENERATORSREMAINWITHINAMORMINUTE WALK OF THE INTERCHANGE 4HE APPARENT DISTANCE TO DESTINATIONS ON THE WESTERN SIDE OF THE )NTERCHANGE IS INCREASED BY THE M LEVEL CHANGE BETWEEN THE PLATFORMS AND THE 4OWN 3QUAREANDTHECONVOLUTEDRESOLUTIONOFTHISCONNECTION4HETREATMENTOFTHISLEVELCHANGE WITHANESCALATORANDIMPROVEDSIGNAGEWITHINORADJACENTTOTHE0LAZA DIRECTINGPEOPLETO THE)NTERCHANGE WOULDIMPROVECONNECTIVITYTOTHEPUBLICTRANSPORTNODE!TTHESAMETIME INCREASEDBUSSTOPCAPACITYONTHEWESTERNSIDEWOULDALLOWADDITIONALOUTGOINGSERVICESSUCH AS7ANNIASSA &ADDENAND'OWRIEROUTESTORUNTHROUGH#ORINNA3TREET



!#40,!..).'!.$,!.$!54(/2)49




02/&),%/&"5353%23

7ODENIS#ANBERRASBUSIESTBUSINTERCHANGE!WEEKDAYCOMMUTERSURVEYUNDERTAKENBY $ATACOLON4HURSDAY/CTOBERRECORDED PASSENGERSALIGHTING  PASSENGERS BOARDING AND   PASSENGERS PASSING THROUGH THE INTERCHANGE WITHOUT CHANGING BUSES 3OMEOFPASSENGERSARRIVINGATTHEINTERCHANGEBYBUS LEFTONANOTHERBUS4HESURVEY WASUNDERTAKENONAPUBLICSERVICEANDPENSIONPAYDAY ANDINTHEFIRSTWEEKOFTHEUNIVERSITY MIDSEMESTERBREAK 3URVEY DATA SHOWED THAT PASSENGER NUMBERS DECREASED RAPIDLY AFTER PM SUGGESTING THAT EVENINGLEISUREPURSUITSWEREACCESSEDVIAOTHERFORMSOFTRANSPORT4HEREWEREAGROUPOF PASSENGERSTOOWHOPUNCTUATEDTHEIRJOURNEYBETWEENPOINTOFORIGINANDDESTINATIONWITHA @STOPOVERAT7ODENTOMAKEUSEOFTHEFACILITIES 4HEMOSTFREQUENTLYREPORTEDPURPOSEFORTRAVELLINGBYBUSWASTOATTENDWORK .OT SURPRISING THEMAJORITYOFTHISACTIVITYOCCURREDBETWEENAM AMANDPM PM0EOPLE ATTENDING SCHOOL OR UNIVERSITY  COMPRISED THE NEXT LARGEST GROUP OF PASSENGERS 3TUDENTPASSENGERSWEREREPRESENTEDTHROUGHALLPEAKFLOWPERIODS%IGHTOFINTERCHANGING PASSENGERS INTENDED TO SHOP AT 7ODEN COMPARED WITH  OF ALL OTHER PASSENGERS WHO NOMINATED SHOPPING AS THE REASON FOR THEIR JOURNEY !BOUT  OF PASSENGERS CONDUCTED PERSONAL BUSINESS AT 7ODEN 2ECREATION WAS THE PURPOSE OF JOURNEY FOR  OF PASSENGERS &)'52%0URPOSEOFBUSTRIPSTHROUGH7ODEN  7/2+  3#(//,/25.)6%23)49  3(/00).'  0%23/.!,  "53).%332%#2%!4)/.

&)'52%!GEDISTRIBUTIONOFALLPASSENGERS  /&!,,0!33%.'%23

        5NDER

TO

TO

TO

&EMALE/&!,,0!33%.'%23!,,$!9

TO

TO



-ALE/&!,,0!33%.'%23!,,$!9

7/$%.4/7.#%.42%^ MASTERPLAN




4OGETHER YOUNGPEOPLEUNDERYEARS ANDOLDERPEOPLEOVERYEARS COMPRISED AROUNDOFALLPASSENGERS/VERALL YOUNGPEOPLEUNDERYEARS FORMEDTHELARGEST GROUP OF PASSENGERS AT 7ODEN BUS INTERCHANGE WITH FEMALES COMPRISING NEARLY  4HIS COHORTWASREPRESENTEDATTHE7ODENBUSINTERCHANGEATALLPEAKFLOWPERIODS %IGHTYEIGHTOFYOUNGPEOPLESURVEYEDTHOUGHTTHATTHE7ODENSHOPPINGCENTREWASYOUTH FRIENDLY 4HEY PARTICULARLY LIKE THE SHOPS ONE QUARTER OF YOUNG PEOPLE SHOP DAILY )SSUES AROUND SAFETY AND ANTISOCIAL BEHAVIOUR WERE THE PREDOMINANT NEGATIVE RESPONSES 4HEY THOUGHTTHATMOREYOUTHACTIVITIESANDSERVICES WOULDREDUCETHEPROBLEMSASWOULD COMMUNITY AND INDIGENOUS WORKERS  AN INDIGENOUS OUTREACH WORKER  AND A GREATERPOLICEPRESENCE  0ASSENGERSAGEDnYEARSTENDEDTOADOPTATYPICALEMPLOYMENTPATTERNOFLEAVINGFORWORK INTHEMORNINGANDRETURNINGINTHEEVENING4HEPEAKPERIODFORSHOPPINGANDCONDUCTING PERSONALBUSINESSWASBETWEENAMANDPM"ETWEENAMANDPM WOMENAGED USEDBUSESTIMESMORETHANTHEIRMALECOUNTERPARTS!SMALLPERCENTAGEOFPEOPLE OVERYEARSINTHELABOURFORCETRAVELTOWORKBYBUS -ANY PEOPLE IN THIS DEMOGRAPHIC UNDERTAKE COMPLEX JOURNEYS INVOLVING MORE THAN ONE PURPOSE &OR EXAMPLE THE JOURNEY TO WORK MAY INCLUDE DETOURS TO DROP OFF AND PICK UP CHILDRENATCHILDCARE ORMAYALSOINCLUDEATRIPTOTHESUPERMARKET)TWASFELTTHATSERVICES SUCHASACHILDCARECENTREANDCONVENIENCESHOPPINGSIMILARTOSEVENELEVEN DRYCLEANERS NEWSAGENCY HEALTHYTAKEAWAYMEALSORLATENIGHTPHARMACYADJACENTTOTHEINTERCHANGEWOULD ENCOURAGEPEOPLEINTHEWORKFORCETOUSEBUSES)NSTALLATIONOFAN!4-WASSUGGESTED 4HOSEAGEDBETWEENANDYEARSWEREREPRESENTEDINTHEBUSINTERCHANGETHROUGHOUTTHE DAY4WICEASMANYWOMENTHANMENINTHISAGEGROUPUSEDBUSESBETWEENAMANDPM WITHTHEREVERSEAPPLYINGBETWEENPM PM0ASSENGERSOVERYEARSWEREMOSTLIKELYTOUSE THE7ODENBUSINTERCHANGEBETWEENAMANDPM OFWHOMWEREFEMALE 0EOPLEWITHDISABILITIESOFTENFACEECONOMIC ASWELLASPHYSICALBARRIERSTOACCESSINGTRANSPORT ANDPARTICIPATINGINCOMMUNITYLIFE&ORMANYPEOPLEWITHADISABILITY PUBLICTRANSPORTISTHE ONLYCONVEYANCEOPTION



!#40,!..).'!.$,!.$!54(/2)49


 0ARKING #!20!2+).'#!0!#)49!.$$%-!.$ 4HETWOMAJORPARKINGDEMANDSIN7ODENAREFORLONGSTAYWORKFORCEPARKINGANDTHESHORT STAYUNDERTHREEHOURS VISITORANDCUSTOMERPARKING/THERDEMANDSINCLUDELONGSTAYPARK AND RIDE AND SERVICE VEHICLE DROP OFF AND PICK UPS 4HE SPLIT BETWEEN THE PRIVATE CAR AND OTHERTRANSPORTMODESWILLDETERMINEDEMANDFORLONGSTAYPARKING"ASEDON!"3DATA OFWORKERSTRAVELTO7ODENCOREBYCAR EITHERASDRIVERORPASSENGER

4!",%4RAVELTOWORKMODECHOICE CARDRIVERPASSENGER %MPLOYMENT,OCATION$ESTINATION 

#ARUSE





#IVIC





7ODEN4OWN#ENTRE#ORE





"ELCONNEN4OWN#ENTRE#ORE





4UGGERANONG4OWN#ENTRE





"ELCONNEN4OWN#ENTRESERVICE4RADES





$ICKSON





0ARKES





"ARTON





7ODEN4OWN#ENTRE3ERVICETRADES





.ORTHBOURNE!VE



n





&YSHWICK 3OURCE!"3AMD#ENSUS

#ARPARKLOCATIONSARESHOWNIN&IGURE#ARPARKINGSURVEYSWEREUNDERTAKENFROM4HURSDAY $ECEMBERTO3ATURDAY$ECEMBERANDTHERESULTSAREPROVIDEDIN4ABLE !DDITIONALSITESNOTINCLUDEDIN4ABLEBUTWHICHWERESURVEYEDATAM4HURSDAY .OVEMBERARESUMMARISEDBELOW

4!",%A#ARPARKINGSURVEY4HURSDAY.OVEMBER

$ESCRIPTION

3PACE

#ARS

/CC

 

0HILLIP/VAL



(ELLENIC#LUB









#ONST





0ENRYHN(OUSE,EVEL 









'RENVILLE#OURT7EST









'RENVILLE#OURT%AST









#OLBEE#OURT7EST











#OLBEE#OURT%AST







4OTALSITES 

 





$ESCRIPTION

3PACE

#ARS

/CC

0ROSPECT#OURT7EST







0ROSPECT#OURT%AST







$UNDAS#OURT7EST









$UNDAS#OURT%AST









"ELLONA#OURT7EST







0ARRAMATTA3TREET"ELLONA#OURT%AST 





7/$%.4/7.#%.42%^ MASTERPLAN




4!",%#ARPARKINGSURVEY^ 4HURSDAY$ECEMBERTO3ATURDAY$ECEMBER



.O

!REA



3QUASH#OURTS



















&OOTBALL0ARK





















#HILDCARE#ENTRE





















9AMBA3PORTS#LUB





















3LOVENIAN !USTRALIAN!SSOC





















"ASKETBALL3TADIUM

















 

)NVENTORY



4(523$!9TH  



&2)$!9TH  

3!452$!9TH  



3POERING3T

-ETERED

















0AY



0





)RVING3T





















0ATENTS"UILDING#ARPARK





















4RADESMAN5NION#LUB





















$!3GARAGE 3OUTHOF7ORGAN





















&URZER3TSURFACEPARKING





















3ENIOR#ITIZENS#LUB



















3ERVICE,ANEAREASAND





















&URZER3T





















%DISON0ARK





















7ORGAN3T





















7ODEN,IBRARY















(EALTH#ENTRE +ELTIE3T

0AY



















,OADING



2ESERVED 



3URFACESOUTHOFBASEMENT





















7ANG(OUSE 7EST#ORINNA





















(INDMARSH#ORINNA





















#ALLAM3TEAST





















-ULTI$ECK3OUTHOF.EPTUNE





















-ULTI$ECK.ORTHOF.EPTUNE





















0LAZA5NDERGROUND#ARPARK



















"OWES3TSURFACEPARKING















 



#ORINNA3T

3PACES

















,OADING





"RADLEY3T















#ALLAM3TOPPOSITE-ATILDA



















#ALLAM/FFICES



















#ANBERRA#OLLEGE



















%ASTY3TREET#HILDCARE



















%ASTY3TREETSOUTH















#LINTS(INDMARSH"OTANY3T





















0AULgS#ENTRE(INDMARSH$R





















3HOPSWESTOF0AULgS#ENTRE





















#AR9ARDS $IVINE#OURT





















"OTANY3TWEST4OWNSHEND





















!LTREE#RTSHORTSTAYPARKING





















!LTREE#RTLONGSTAY





















3ERVICE2OADON





















$IVINE#RT





















"OTANY





















3OUTHERN#ROSS#LUB





















.2-!(OUSE

3TAFF



















0













/FF STREETCARPARK #ORNER

0UBLIC























   

 

 

 

 

 

 

 

















#ORINNA3TAND"ALL3T

$ISABLED

/6%2!,,

4OTAL

5SAGE



!#40,!..).'!.$,!.$!54(/2)49




&)'52%%XISTINGPARKINGLOCATIONS 





 









  

 

 







 





 





   





 









 

 









      





7/$%.4/7.#%.42%^ MASTERPLAN




4HECARPARKINGSURVEYRESULTSSHOWTHATTHEMAXIMUMDEMANDOCCURREDAT&RIDAYLUNCHTIME WITHUTILISATION 4ABLE  SHOWS THE VARIATION IN TOTAL PARKING DEMAND THROUGH OUT THE SURVEY PERIOD WITHIN MAJORPARKINGPRECINCTS4HESERESULTSAREGRAPHEDIN&IGURESn4HEGROUPINGOFRESULTS SHOWTHATSHORTTERMPARKINGASSOCIATEDWITHRETAILUSESTYPICALLYPEAKAROUNDTHELUNCHTIME PERIOD WITH A USAGE IN THE ORDER OF   !S IS EXPECTED SHORT STAY PARKING DEMAND DURINGTHEEARLYMORNINGANDMIDAFTERNOONPERIODSISGENERALLYLESSTHAN 0EAKLONGSTAYPARKINGDEMANDVARIESFROM ONTHEWESTERNSIDEOFTHE4OWN#ENTRE TO  ON THE EASTERN SIDE OF THE 4OWN #ENTRE 4HIS IS EXPLAINED BY THE LONGER WALKING DISTANCETOOFFICESFROMTHECARPARKINGONTHEEASTERNSIDE PARTICULARLYTHEMOREREMOTECAR PARKSEASTOF9ARRALUMLA#REEK 4!",%6ARIATIONINPARKINGUTILISATIONTHROUGHPRECINCTS

:ONE

)NVENTORY

/6%2!,,

4OTAL

 

5SAGE

#LINTS+&#0HILLIP

4OTAL

5SAGE

3PORTS0RECINCT

4OTAL

5SAGE

,ONG4ERM0ARKINGWEST

4OTAL

OF4HE4OWN#ENTRE

5SAGE

3HORT3TAY0ARKING

4OTAL

AROUND4OWN#ENTRE

5SAGE

,ONG4ERM0ARKINGEAST

4OTAL

OFTHE4OWN#ENTRE

5SAGE

0HILLIP"USINESS$ISTRICT

4OTAL

5SAGE

3HORT3TAY0ARKING"ETWEEN

4OTAL

4OWN#ENTREAND0HILIP

5SAGE



4(523$!9TH  

    





&2)$!9TH  

3!452$!9TH  

 

 

 

 

 

 

















































































  

   

 



 





T















   

 

 

 

 



 



















 





































































































&)'52%4OTALPARKINGUTILISATION .//&0!2+).'30!#%3

 

 

V

V

 

Q Q

V

O

Q

  O  AM

Q

AM

AM

4(523$!9TH

AM PM 4)-%/&$!9

V

&2)$!9TH

).6%.4/29



!#40,!..).'!.$,!.$!54(/2)49

M

O

PM 3!452$!9TH


&)'52%0ARKINGUTILISATION^#LINTS+&#0HILLIP .//&0!2+).'30!#%3

.OTEnUTILISATIONFROMLUNCHTIMEONWARDS



Q V

Q

O

V

 

V

Q O



4)-%/&$!9 AM

V

AM

AM

AM

Q

4(523$!9TH

PM

M

&2)$!9TH

O

PM 3!452$!9TH

).6%.4/29

&)'52%0ARKINGUTILISATIONNORTHERNSPORTSPRECINCT .OTEAMPLECAPACITYTHROUGHOUTTHESURVEYPERIOD

 

.//&0!2+).'30!#%3

Q 

Q



V

V



V Q 

O

O

 4)-%/&$!9 AM

V

AM

AM

AM

Q

4(523$!9TH

PM

M

&2)$!9TH

O

PM 3!452$!9TH

).6%.4/29

&)'52%0ARKINGUTILISATION LONGTERMWESTOFOFFICES .OTEHIGHUTILISATIONFROMWEEKDAYSBUTAMPLEOVERFLOWPARKINGFORRETAILANDSPORTINGEVENTSONWEEKENDS

 

Q V

V

 

Q

.//&0!2+).'30!#%3

 

Q V

 

O O



4)-%/&$!9 AM

V

AM 4(523$!9TH

AM

AM

Q

PM

&2)$!9TH

M

O

PM 3!452$!9TH

).6%.4/29

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%0ARKINGUTILISATION TOTALSHORTSTAY .OTETHATPEAKUSAGEOFTHE  SHORTSTAYSPACESOCCURSATLUNCHTIME

 

.//&0!2+).'30!#%3

 

Q

Q V

 

O

V

V Q

  O  

4)-%/&$!9 AM

V

AM

AM

AM

Q

4(523$!9TH

PM

&2)$!9TH

M

PM 3!452$!9TH

O

).6%.4/29

&)'52%0ARKINGUTILISATIONLONGTERMEASTOFOFFICES .OTETHATINEXCESSOFSPACESAVAILABLEATPEAKTIMESALTHOUGHTHISSURPLUSHASBEENREDUCEDBYOF SPACES ASSOCIATEDWITH#ALLAM3TREETREALIGNMENTTHATOCCURREDAFTERTHESURVEYS4HEPOLICESTATIONWILLDISPLACEAFURTHEROF SPACESWHICHCANSTILLBETAKENUPONTHEEASTERNSIDEOF9ARRALUMLA#REEKANDELSEWHERE

     

.//&0!2+).'30!#%3



Q

Q

Q

 

V V

 O



4)-%/&$!9 AM

V

V

O AM

AM

AM

Q

4(523$!9TH

PM

&2)$!9TH

M

PM 3!452$!9TH

O

).6%.4/29

&)'52%,ONGSTAYPARKING 0HILLIP"USINESS$ISTRICT .OTECAPACITYISAVAILABLEALTHOUGH#ALLAM3TREETREALIGNMENTHASDISPLACEDSOMEPARKINGTO0HILLIP

.//&0!2+).'30!#%3

 

Q

V

O

 O 

 4)-%/&$!9 AM

V 

Q

V Q

V

AM 4(523$!9TH

AM

AM

Q

PM

&2)$!9TH

).6%.4/29

!#40,!..).'!.$,!.$!54(/2)49

M

O

PM 3!452$!9TH


 "ICYCLEANDPEDESTRIANCONNECTIONS !TRUNKCYCLEPEDESTRIANPATHTHATCONNECTS4UGGERANONGTO"ELCONNENVIA3CRIVENER$AM RUNSALONG9ARRALUMLA#REEK4HREEPEDESTRIANCROSSINGSAREPROVIDEDFROMTHISTRUNKROUTE OVER9ARRALUMLA#REEKTOFEEDINTOTHE4OWN#ENTREFROMTHEEASTERNSIDE0EDESTRIANCROSSING OF#ALLAM3TREETISPROVIDEDATSIGNALCONTROLLEDINTERSECTIONS!PRIMARYPATHFROMTHEHOSPITAL HAS RECENTLY BEEN UPGRADED WITH LIGHTING AND RUNS THROUGH 7ODEN %AST RESIDENTIAL AREA TO .EPTUNE3TREET 4HE $OWNER TO 7ODEN ON ROAD CYCLING PROJECT HAS RECENTLY BEEN CONSTRUCTED AND PROVIDES IMPROVEDACCESSANDSAFETYFORCYCLINGALONG9ARRA'LEN &ROMTHEWESTANUMBEROFPATHSFEEDINTOTHE-ELROSE$RIVEUNDERPASSTHATTHENREQUIRES CROSSING#ORINNA3TREETTOCONNECTTOTHEEASTWESTTRANSEPTOFTHEPEDESTRIANNETWORK !S PREVIOUSLY DESCRIBED THE CYCLE AND PEDESTRIAN PATH SYSTEM HAS GENERALLY NOT BEEN INTEGRATEDWITHSTREETFRONTAGEACTIVITYALONG#ALLAM3TREETOR(INDMARSHAND-ELROSE$RIVES %LSEWHERETHESTANDARDOFLIGHTINGANDLANDSCAPINGISVARIABLE 4HEPUBLICYACCESSIBLEPEDESTRIANBRIDGEFROM#ALLAM/FFICESTOTHEWESTERNSIDEOF9ARRALUMLA #REEK IS A SECURITY ISSUE FOR THE MAJOR TENANT OF THE BUILDING AND ALTERNATIVE LOCATIONS FOR ACCESSMAYNEEDTOBECONSIDERED

 %LEMENTSOFHERITAGEINTEREST 4HENAME7ODENWASGIVENTOTHE ACRESOFLANDBOUGHTBY$R*AMES-URRAYIN $R-URRAYWASACLASSICALSCHOLARANDITISTHOUGHTHENAMEDHISPROPERTY7ODENAFTERTHE .ORSE'ODOF7ARWHOWASALSOTHE0ATRONOF,EARNING 6ERYLITTLEOFTHEPRE %UROPEANANDEARLYSETTLERHISTORYREMAINSIN7ODENTODAY&OREXAMPLE THE3OUTHERN#ROSS9AMBA#LUBNOWOCCUPIESTHESITEOFTHE%DDISONHOME ANEARLYFARMING FAMILYIN7ODENWHOARECOMMEMORATEDTHROUGHTHEDISTRICTPARKTHATBEARSTHEIRNAME 4HESUBURBNAME0HILLIPISGIVENAFTER#APTAIN!RTHUR0HILLIP FIRST'OVERNOROF.37ANDLEADER OFTHEEXPEDITIONTOESTABLISHASETTLEMENTAT"OTANY"AY3IXOFTHEELEVENSHIPSINTHE&IRST &LEETARECOMMEMORATEDTHROUGHTHENAMINGOFBUILDINGSIN7ODEN NAMELY Q

3CARBOROUGH(OUSE

Q

!LEXANDER"UILDING

Q

3IRIUS"UILDING

Q

0ENRHYN(OUSE

Q

"ORROWDALE(OUSE

Q

&ISHBURN(OUSE 7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%#YCLEANDPEDESTRIANROUTES



4RUNK#YCLE2OUTE

0RIMARY0EDESTRIAN#YCLE2OUTE

:EBRA#ROSSING

3ECONDARY0EDESTRIAN2OUTE

3IGNALISED#ROSSING

3UGGESTED0RIMARY0EDESTRIAN2OUTE

!#40,!..).'!.$,!.$!54(/2)49


4HESIMPLEPLANNINGCONCEPTOFACRUCIFORMSHAPEWITHTHENORTHARMFOROFFICES SOUTHARM FORRETAILMALLANDCROSSARMSFORCOMMUNITYFACILITIESISCONSIDEREDIMPORTANTINILLUSTRATING PLANNINGPHILOSOPHIESADOPTEDATDIFFERENTSTAGESOF#ANBERRASDEVELOPMENT 4HE ARCHITECTURE IS GENERALLY NOT REGARDED AS SIGNIFICANT ALTHOUGH THE (ERITAGE #OUNCIL HAS RECENTLY ACCEPTED THE NOMINATION OF #ALLAM 3TREET /FFICES  *OHN !NDREWS /THER BUILDINGSTHATWARRANTFURTHERHERITAGEINVESTIGATIONINCLUDE Q

7ODEN ,IBRARY AND (EALTH #ENTRE   !NCHER -ORTLOCK AND 7OOLLEY A FINELY DETAILED COMPLEX OF CREAM CONCRETE BLOCK AND EXPOSED CONCRETE COLUMNS AND BEAMS 4HEBUILDINGSHAVEGENEROUSPUBLICSPACES EXCELLENTNATURALLIGHTANDARELATIVELYTIMELESS @3CANDINAVIANSTYLE

Q

$ISCOVERY (OUSE  7OODS "AGOT A FRESH AND INNOVATIVE CONTRIBUTION TO THE OFFICE COMPLEXTHATSUCCESSFULLYINTEGRATESINNOVATIVEFORM USEOFCOLOURANDMATERIALS

'UARDIAN(OUSE )AN-C+AY A#ANBERRA-EDALLIONWINNERFORANINNOVATIVEANDCREATIVE DESIGN WAS SOLD BY THE &EDERAL 'OVERNMENT FOR REDEVELOPMENT !N ENTRY TO THE )NTERIM (ERITAGE 0LACES 2EGISTER WAS NOTIFIED ON  $ECEMBER  AND ESTABLISHES THE FOLLOWING CONSERVATIONOBJECTIVES

 #ONSERVETHESIGNIFICANCEOF'UARDIAN(OUSE  2ECORD THE SIGNIFICANCE OF 'UARDIAN (OUSE SHOULD ITS CONSERVATION BE DEEMED BY THE !PPROVAL!UTHORITYNOTTOBEPRUDENTANDFEASIBLE

7/$%.4/7.#%.42%^ MASTERPLAN




3PACESOFMERITARETHE.ORTH7ALKAND4OWN3QUAREANDTHECOMPLEXOFPARKSTOTHEEAST INCLUDING Q

7ODEN4OWN0ARK

Q

!RABANOO0ARK

Q

%DDISON0ARK

!RTICLESOFPUBLICARTOFMERITARE Q

-ARGEL(INDERSALUMINIUMBOLDANDSCULPTURALFORMINTHETOWNSQUARE

Q

4HEWHIMSICAL,OLLIPOPADJACENTTO7ODEN#OMMUNITY3ERVICESIN#ORINNA3TREET

Q

-OSAICTILEARTWORKINTHEFOYEROFTHE#OMMONWEALTH"ANK"UILDING

4HEARCHITECTUREOFTHENORTHERNENTERTAINMENTSECTORAND0HILLIP-IXED3ERVICES!REAISOFNO OUTSTANDINGMERITALTHOUGHSEVERALBUILDINGSAREREASONABLYWELLRESOLVEDANDDETAILED



#ALLAM/FFICES

,OLLIPOPSCULPTURE

$ISCOVERY(OUSE

-ARGO(INDERALUMINIUMSCULPTURE

,IBRARYAND(EALTH#ENTRE

0EDESTRIANSPINE

!#40,!..).'!.$,!.$!54(/2)49


 #OMMUNITYFACILITIES 7ODENFULFILSADISTRICTROLEWITHTHEPROVISIONOFARANGEOFCOMMUNITYFACILITIESTHATINCLUDE Q

(EALTHCENTRE

Q

,IBRARY

Q

7ODEN#OMMUNITY3ERVICEAND7ODEN9OUTH#ENTRE

Q

7ODEN3ENIOR#ITIZENS#LUB

Q

#HILDCARECENTRESn%ASTY3TREET #ORINNA3TREETAND9-#!)RVINE3TREET

Q

#ANBERRA3ECONDARY#OLLEGEn0HILLIP#AMPUS

Q

#ANBERRA)NSTITUTEOF4ECHNOLOGYn7ODENCAMPUS

Q

7ODEN#EMETERY

+EYSERVICESARELOCATEDINTHE#OMMUNITY&ACILITIESLANDUSEPRECINCTONTHESOUTHERNSIDE OF THE #ORINNA 3TREET AND -ELROSE $RIVE INTERSECTION 4HIS PRECINCT ALSO CONTAINS A LARGE NUMBEROFPRIVATESECTORHEALTHPROVIDERSINCLUDINGPHYSIOTHERAPISTS MEDICALSPECIALISTSAND COUNSELLORS)SSUESOFCONCERNTOBOTHSERVICEPROVIDERSANDCUSTOMERSINCLUDE Q

)NADEQUATE CAR PARKING ON THE WESTERN SIDE OF THE TOWN THAT IS CLOSE TO COMMUNITY FACILITIES)NPARTICULARTHEREARETOOFEWDISABLEDANDSHORTTERMCARPARKS

Q

7ODEN#OMMUNITY3ERVICEOFFICEANDCHILDCARECENTREONTHEWESTERNSIDEOF7ODENHAS BEENWALLEDOFFFROM#ORINNA3TREETBYANARROWOFFICEBUILDINGANDCOMMUNITYDEMAND FORSERVICESHASOUTGROWNFACILITIES

Q

0ARTOFTHECOMMUNITYMEETINGSPACEAT7ODEN,IBRARYWASRECENTLYTAKENOVERBYTHE!#4 (ERITAGE,IBRARY REDUCINGOPPORTUNITIESFORLARGELOWCOSTMEETINGROOMS

Q

0ROVISION OF FACILITIES NEEDS TO RESPOND TO THE CHANGING POPULATION PROFILE )N PARTICULAR PARKINGSHOULDBEDESIGNEDTOBEEASILYNEGOTIATEDBYOLDERDRIVERS PEDESTRIANCONNECTIONS NEEDTOPROVIDEACCESSTOPEOPLEWITHSIGHTANDMOBILITYIMPAIRMENTSANDFACILITIESMAY NEEDTOEXPANDTOMEETGROWINGDEMAND

Q

4HELIBRARYHASSOMEFUNCTIONALLIMITATIONSINCLUDINGTHEABSENCEOFALOADINGDOCK

Q

%XTERNAL COURTYARDS HAVE POOR AMENITY ON WINDY DAYS BECAUSE OF DOWN FORCE EFFECTS CREATEDBYTHESTOREYOFFICETOWER

Q

#ORINNA 3TREET HAS BECOME BUSIER SINCE THE 0LAZA EXTENSIONS MAKING THE CONNECTION BETWEENCOMMUNITYFACILITIESMOREDIFFICULT

Q

#OMMUNITY SPACE NEEDS TO SUPPORT PUBLIC ASPIRATIONS FOR ARTISTIC AND CULTURAL DEVELOPMENT

3TRENGTHSOFTHECURRENTARRANGEMENTSINCLUDE Q

#ONVENIENCE CREATED BY THE COLOCATION OF GOVERNMENT COMMUNITY AND PRIVATE SECTOR FACILITIES

Q

0UBLICOWNERSHIPOFBUILDINGSTHATPERFORMCIVICFUNCTIONSANDCREATEPOINTSOFREFERENCE INTHETOWN

Q

0OTENTIALTOIMPROVEACCESSIBILITY STREETADDRESSANDRANGEOFSERVICES 7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%%XISTINGCOMMUNITYFACILITIESANDASSOCIATEDPRIVATESECTORSERVICES

*ULIANA (OUSE !LEXANDER "UILDING !LBERMARL "UILDING "OWES0L 7ODEN3ENIOR #ITIZENS#LUB

#OMMONWEALTH "ANK 7ODEN ,IBRARY

0OST /FFICE

!-&PIN BOWLING "US)NTERCHANGE

4OWN3QUARE 0OLICE

7ODEN (EALTH #ENTRE

LEVELCARPARK STRUCTURE

7ODEN #OMMUNITY 3ERVICES 7ODEN0LAZA

"ONNER (OUSE

0RIVATE(EALTH 3PECIALISTS #ORINNA #HAMBERS

#OMMUNITY&ACILITIES3PINE

#OMMUNITY&ACILITIES



!#40,!..).'!.$,!.$!54(/2)49


 0ARKSANDPUBLICPLACES 4HE5RBAN/PEN3PACELANDUSEPOLICY THATINCLUDESTHEHECTARE7ODEN#EMETERY COVERS ABOUTHECTARESOROFTHETOTALSTUDYAREAOFHECTARES/THERNATURALFEATURESAND ENTERTAINMENTFACILITIESLIKE9ARRALUMLA#REEKANDTHEPITCHANDPUTTGOLFADDSIGNIFICANTLYTOTHE GREENSPACE ANDTOTHESENSEOFOPENNESS%QUALLYIMPORTANTASTHEURBANOPENSPACEARETHE PUBLICAREASINANDAROUNDBUILDINGSTHATLINKTHEVARIOUSACTIVITIESWITHINTHE4OWN#ENTRE #OMMUNITY CONSULTATION IDENTIFIES A LEVEL OF DISSATISFACTION WITH ALL ELEMENTS OF THE PUBLIC REALM4HISDISSATISFACTIONISSUMMARISEDAS Q

$IFFICULTTOACCESS%DDISON0ARKBECAUSEOFPEDESTRIANBARRIERSINCLUDING ^ THECONFIGURATIONOFROADS ^ THESTORMWATERDRAIN9ARRALUMLA#REEK

Q

4HESMALLCARPARK

Q

,ACKOFCLEARCONNECTIONSTOITSPERIPHERALLOCATION

Q

#ONCERNSABOUTPERSONALSAFETYWHICHARERELATEDTO ^ LOWLEVELOFLIGHTINGANDVANDALISMOFTHEEXISTINGLIGHTS ^ LACKOFANEFFECTIVEPEDESTRIANLINKBETWEENTHEBUSINTERCHANGEANDTHEPARK ^ LACKOFPEDESTRIANACCESSTOTHECEMETERYTHOUGHTHEPARK ^ THEISOLATEDLOCATIONANDTHEFACTTHATPEDESTRIANCONNECTIONSLACKACTIVITY ^ INADEQUATEMAINTENANCE ^ A PERCEPTION OF ANTI SOCIAL BEHAVIOUR CREATED BY GRAFFITI VANDALISM AND POOR SURVEILLANCE

!RABANOO 0ARK HAS NO SURVEILLANCE AND IS PERCEIVED AS AN UNSAFE PLACE TO VISIT )T IS ALSO PERCEIVED AS HAVING POOR PEDESTRIAN ACCESS AND IS NOT LINKED TO %DDISON 0ARK 4HE 4OWN 3QUARE IS PERCEIVED AS A LARGE VACANT AND CURRENTLY UNDER UTILISED SPACE WITH LITTLE ACTIVITY AFTER BUSINESS HOURS )T WAS DESCRIBED AS BEING COLD AND WINDY AND AN INHOSPITABLE AND UNCOMFORTABLE PLACE TO SIT 4HE SQUARE IS NOT IDENTIFIED AS THE CENTRAL OR FOCAL POINT OF 7ODEN4OWN#ENTREBUTRATHERASAPLACEWHERETHESHOPSENDANDOFFICESSTART4HERECENT REDEVELOPMENTHASRESULTEDINMOREPEOPLEUSINGTHESQUAREBUTITISINCREASINGLYSEENASA WALKWAYBETWEENDIFFERENTPARTSOFTHECENTRERATHERTHANASADESTINATION 4HEINITIALDESIGNFOR7ODEN4OWN#ENTREINTENDEDTHE4OWN3QUARETOOPENONTOAFORECOURT EXTENDING TO #ALLAM 3TREET ,OCATED AROUND THIS FORECOURT AND DEFINING A STRONG EAST WEST LINKTOTHEEASTERNPARKLANDSWASAMIXOFPUBLICANDCOMMERCIALBUILDINGSINCLUDINGHOTELS #ONSTRUCTIONOFTHEBUSINTERCHANGETERMINATEDTHE4OWN3QUAREATTHEEDGEOFTHE0LAZA AND ALIENATEDTHELINKTOTHEPARKLANDS%VENTHECONNECTIONSBETWEENTHEINTERCHANGEANDTHE ELEVATED4OWN3QUAREAREPOORLYRESOLVED RESULTINGINCLUTTEREDANDPOORLYDEFINEDRAMPSAND STAIRSWHERESURVEILLANCEANDPERCEPTIONOFPERSONALSAFETYISUNSATISFACTORY

7/$%.4/7.#%.42%^ MASTERPLAN




 3PORTANDRECREATIONFACILITIES 7ODEN4OWN#ENTRECATERSFORARANGEOFENTERTAINMENTANDLEISURENEEDS 4HEREAREFIVEMAJORLICENSEDCLUBS Q

(ELLENIC#LUB

Q

3LOVENIAN!USTRALIAN#LUB

Q

#ANBERRA3OUTHERN#ROSS#LUB

Q

#ANBERRA4RADESMENS5NION#LUB

Q

9AMBA3PORTS#LUBABRANCHOFTHE3OUTHERN#ROSS#LUB

4HECLUBSPROVIDEFACILITIESSUCHASBARS DININGAREAS PERFORMANCEAUDITORIUMSANDMEETING AREASANDARESIGNIFICANTLANDMARKSINTHE4OWN#ENTRE 2ESTAURANTS CAFES TEN PIN BOWLING AND CINEMA COMPLEX ARE CENTRALLY LOCATED IN THE 4OWN #ENTRECORE 4HE0HILLIP3WIMMING0OOLAND)CE#ENTRE 0HILLIP/VAL 7ODEN9-#! SQUASHCOURTS 9AMBA 3PORTS #LUB BOWLING GREENS AND GYMNASIUM BASKETBALL CENTRE 0ITCH @N 0UTT COURSE AND AN EMERGING RESTAURANT AND CAFÏ PRECINCT ARE LOCATED IN THE PRECINCT TO THE NORTH OF THE COMMERCIAL CORE 4HE 7ODEN 0ARK ATHLETICS FIELD 0HILLIP DISTRICT ENCLOSED OVAL AND 0HILIP DISTRICTPLAYINGFIELDSARELOCATEDONTHENORTHEASTERNSIDEOFTHE4OWNCORE 4HERANGEOFRECREATIONACTIVITIESPROVIDEDINTHE4OWN#ENTREISTHEMOSTCOMPREHENSIVEIN THE!#44HESTYLEOFSOMEDEVELOPMENTSANDTHEIRLOCATIONWITHINTHETOWNLACKSANOVERALL COHESIVENESS AND PEDESTRIAN MOVEMENT BETWEEN FACILITIES IS NOT ALWAYS CLEARLY DEFINED )N ADDITION THE SWIMMING CENTRE ICE SKATING RINK AND SQUASH COURTS ARE SHOWING THEIR AGE ANDFROMTIMETOTIMESUFFERFROMCHANGESINPEOPLESSPORTINGPREFERENCES!GREATERMIXOF USESINTHEAREATHATRETAINSENTERTAINMENTANDLEISUREACTIVITIESATGROUNDLEVELBUTPERMITS OTHER ACTIVITIES AT FIRST FLOOR LEVELS AND ABOVE WILL HELP ATTRACT REINVESTMENT IN THE NORTHERN ENTERTAINMENTPRECINCT



!#40,!..).'!.$,!.$!54(/2)49


 4OWNCENTRELIVING 4HEORIGINALPLANNINGFORANDCONSTRUCTIONIN7ODENEXCLUDEDRESIDENTIALFROMTHETOWNCORE 7ALKINGDISTANCETOARANGEOFACTIVITIES ACCESSTOPUBLICTRANSPORT CHANGINGHOUSINGNEEDS WITHINTHECOMMUNITYANDGOODOUTLOOKSANDENVIRONMENTALAMENITYCREATECONDITIONSTHATARE CONDUCIVETOTHEINTRODUCTIONOFQUALITYAPARTMENTSWITHINANDAROUND7ODENSCORE )NADDITIONTOOPPORTUNITIESFORHOUSINGINMIXEDUSEINNERCOREDEVELOPMENTSRESIDENTIALAREAS ON THE EASTERN SIDE OF 9ARRALUMLA #REEK AND WEST OF -ELROSE $RIVE IN VACANT LAND IN ,YONS 3ECTIONS  PROVIDETHESETTINGSFORNEWHOUSINGCHOICESINANDAROUND7ODEN 4OWN CENTRE ACCOMMODATION IS AN INCREASINGLY POPULAR HOUSING CHOICE IN #ANBERRA )T NOT ONLYSATISFIESAMARKETNEEDBUTALSOREDUCESCARUSEANDINCREASESACTIVITYTOHELPENLIVEN THE TOWN  AND  CENSUS TRIP TO WORK DATA SHOWS THAT PEOPLE LIVING IN AND AROUND TOWNCENTRESARELESSLIKELYTOUSETHEIRCARTOTRAVELTOWORKANDTHISANALYSISISINCLUDEDAS 4ABLE  4!",%-ODECHOICEBYORIGINFROMSELECTEDSUBURBS 2ESIDENTIAL,OCATION

#AR5SE





"RADDON





4URNER





2EID





"ELCONNEN4OWN#ENTRE





!INSLIE





+INGSTON





0HILLIP





7ATSON





#HIFLEY





/XLEY





'RIFFITH





&RASER





,ATHAM





&ARRER





7ESTON





"ANKS





'REENWAY





3OURCE!"3#ENSUS

7/$%.4/7.#%.42%^ MASTERPLAN




 0UBLICSAFETY ! SAFETY AUDIT CARRIED OUT AS PART OF THE MASTER PLAN PROCESS INVOLVED A TOTAL OF  GROUPS MADE UP OF YOUNG PEOPLE OFFICE WORKERS AND OLDER PEOPLE )N GENERAL THE AUDIT RECORDED THAT PEOPLE FELT REASONABLY COMFORTABLE IN MOST PARTS OF 7ODEN 4OWN #ENTRE AT MOST TIMES DURINGDAYLIGHTHOURS!TNIGHTHOWEVER ANUMBEROFAREASSUCHASTHEBUSINTERCHANGE THE NORTHERNENTERTAINMENTAREAANDTHE4OWN0ARKWEREPERCEIVEDASBEINGUNSAFE4HEFOLLOWING RESPONSESTODIFFERENTLOCATIONSWITHINTHE4OWN#ENTREWERERECORDED

 "53).4%2#(!.'% 4HE MAJORITY OF PARTICIPANTS FELT REASONABLY SAFE IN THE INTERCHANGE DURING THE DAY BUT FELT UNSAFEATNIGHTDUEMAINLYTO Q

&EELINGSOFISOLATION

Q

0LACESFORPEOPLETOHIDEnSTAIRWELLS ALCOVES BENEATHRAMPSANDBEHINDCOLUMNS

Q

,ACKOFVISIBILITYTOACTIVEPUBLICAREASANDTOTHEPOLICESTATION

Q

)NFLUENCEOFALCOHOLANDDRUGSONTHEBEHAVIOUROFSOMEPEOPLE

Q

/CCASIONALTHREATENINGBEHAVIOURBYSOMEPEOPLEATTHEINTERCHANGE

Q

"USESDRIVINGTHROUGHATEXCESSIVESPEEDS

Q

'RAFFITIANDGENERALSIGNSOFNEGLECT

 4/7.315!2% 4HE MAJORITY OF PARTICIPANTS FELT REASONABLY SAFE DURING THE DAY BUT FELT UNSAFE AT NIGHT BECAUSE Q

4HE!4-SAREISOLATEDANDPEOPLECANBEFOLLOWEDTHROUGHLARGEVACANTSPACES

Q

4HEAREAISDANGEROUSLYWINDYATTIMES

 #/2)..!342%%4 4HE HIGH VISIBILITY AND LARGE NUMBER OF PEOPLE ADJACENT TO THE 0LAZA MADE THE MAJORITY OF PEOPLEFEELSAFEINTHISSECTIONOF#ORINNA3TREET#ONCERNSWEREEXPRESSEDABOUTPEDESTRIAN SAFETYDUETOPERCEPTIONSOF



Q

4OOMUCHTRAFFICFORTHENARROWSTREET

Q

$IFFICULTTOCROSSTHESTREETWITHTRAFFICANDLARGENUMBEROFHEAVYVEHICLES

Q

0EDESTRIANCROSSINGLOCATEDTOOCLOSETOTHECORNER

Q

0OORLYSITEDTAXIRANK

Q

!LCOVESAROUNDTHELIBRARYANDHEALTHCENTRE

!#40,!..).'!.$,!.$!54(/2)49


 #!20!2+3 0ARTICIPANTSFELTTHEMAJORITYOFCARPARKSWERESAFEDURINGTHEDAYBUTUNSAFEATNIGHT#ONCERNS ABOUTCARPARKSRELATETO Q

)NSUFFICIENTLIGHTING

Q

)SOLATIONOUTSIDEOFBUSINESSHOURS

Q

0EOPLELOITERINGANDPERCEPTIONOFTHREATENINGBEHAVIOUR

Q

/VERGROWNLANDSCAPINGOBSCURINGVISIBILITY

Q

#ROSSING 9ARRALUMLA #REEK TO CARPARKS ON THE EASTERN SIDE OF #REEK FELT PARTICULARLY THREATENINGBOTHDURINGTHEDAYANDNIGHT

 /&&)#%!2%!3 0ARTICIPANTSFELTSAFEINTHEOFFICEPRECINCTDURINGTHEDAYBUTFELTUNSAFEATNIGHT2EASONSFOR CONCERNABOUTNIGHTTIMESECURITYINCLUDE Q

0OORVISIBILITYFROMADJOININGBUILDINGS

Q

.OWHERETOGOFORASSISTANCE

Q

4OOFARFROMANYWHERE

Q

0OORQUALITYOFLIGHTING

 "2!$,%9342%%4 3OMEPARTICIPANTS PARTICULARLYYOUNGPEOPLEFELTSAFEAROUNDTHECINEMASBECAUSEOFPEOPLE ANDACTIVITYGENERATEDBY-C$ONALDS THECINEMASANDCAFES)NTHENORTHERNSECTIONHOWEVER CLOSERTOTHEBUSINTERCHANGEPEOPLEFELTLESSSAFEDUETOTHELACKOFVISIBILITYFROMTHEADJOINING STRUCTUREDCARPARKSANDBUILDINGS

 /0%.30!#%3 !TTITUDESTOWARDSSAFETYOFTHEOPENSPACESVARIEDDEPENDINGONTHEAREAVISITED 'ROUPSIN%DDISON0ARKFELTSAFEBOTHDURINGTHEDAYANDATNIGHT INCONTRASTTO!RABANOO0ARK THATFELTTHREATENINGANDUNSAFEATALLTIMESOFTHEDAYANDNIGHT4HISISLARGELYTHERESULTOF THEDENSEVEGETATIONANDLACKOFCLEARLINESOFSIGHTTOADJOININGLANDUSESTHATEXISTWITHIN !RABANOO0ARK4HE4OWN0ARKAND9OUTH#ENTREFELTSAFEDURINGTHEDAYDUETOTHENUMBER OFNEARBYACTIVITIES)TFELTREASONABLYSAFEATNIGHT

 315!3(#/5243 )#%2).+!.$37)--).'0//, !LL PARTICIPANTS FELT THIS AREA WAS UNSAFE AT ALL TIMES OF THE DAY AND NIGHT DUE TO THE POOR MAINTENANCEOFTHEAREA POORLIGHTING LACKOFACTIVITYANDISOLATION4HESURVEYPREDATESTHE OPENINGOFASUCCESSFULRESTAURANTONTHECORNEROF,AUNCESTONAND)RVING3TREETSANDITWILL BEINTERESTINGTOSEEIFTHEADDITIONOFTHISNEWACTIVITYHASCHANGEDPEOPLESPERCEPTIONABOUT THESAFETYOFTHEAREA 7/$%.4/7.#%.42%^ MASTERPLAN






&5452%$%6%,/0-%.4 $)2%#4)/.3

 &ACTORSTHATAREDRIVINGCHANGEIN7ODEN 4HEIMPETUSFORTHE 7ODEN4OWN#ENTRE-ASTER0LANCOMESFROMFACTORSTHATINCLUDE Q

4WENTYYEARSHASNOWELAPSEDSINCETHELASTCOMPREHENSIVEPLANNINGREVIEW

Q

4HECOMMUNITYISCONCERNEDTOIMPROVETHECENTRESACCESS SAFETY AMENITY CONVENIENCE SAFETYANDVIBRANCY

Q

! NUMBER OF SIGNIFICANT DEVELOPMENTS ARE IN THE PIPELINE AND NEED TO BE INTEGRATED TO MAXIMISETHEOVERALLBENEFITSTOTHE4OWN#ENTRE4HESEINCLUDE ^ ANEWPOLICESTATIONANDTHEAVAILABILITYFORREDEVELOPMENTOFTHEEXISTINGPOLICESTATION SITE ^ PRESSURETOIMPROVETHEBUSINTERCHANGE ^  MOFOFFICESPACEPROPOSEDFOR'UARDIAN(OUSEANDTHEADJOININGSITE3ECTION "LOCKS ^ REFURBISHMENTANDEXTENSIONOF3CARBOROUGH(OUSETO MTOREMOVEAVACANCY THATHASEXISTEDFORYEARS ^ NEWDEVELOPMENTON3ECTION"LOCK THEFORMER$!3GARAGE ^ REALIGNMENTOF#ALLAM3TREETTO!THLLON$RIVE EXPANSIONOFTHE3OUTHERN#ROSS#LUB ANDTHEPROPOSALFORARESIDENTIALTOWERONTHEEASTERNSIDEOFTHE#LUB

Q

$ECISIONSABOUTTHEFUTUREUSEOFVACANTANDUNDERUTILISEDLANDINTHETOWNCENTRENEED TOBETAKENINTHECONTEXTOFALONGTERMPLANNINGSTRATEGY

Q

!NUMBEROFBUILDINGSARENOWREACHINGANAGEANDCONDITIONWHEREREDEVELOPMENTMAY BE A VIABLE OPTION 4HE CHOICE BETWEEN REDEVELOPMENT CONVERSION TO OTHER USES AND REFURBISHMENT WILL DEPEND ON NEW PLANNING POLICY WITH REGARD TO DEVELOPMENT RIGHTS DEVELOPMENTINTENSITY PERMITTEDLANDUSEASWELLASTHENEEDSOFTHEMARKET

Q

/FFICETENANCYRELIESONSIX&EDERAL'OVERNMENTDEPARTMENTS!DECISIONBYONEORMORE DEPARTMENT TO CONSOLIDATE HEADQUARTERS OUTSIDE 7ODEN WOULD GENERATE RELATIVELY HIGH VACANCY RATES WITHIN THE EXISTING OFFICE SUPPLY 7HAT WOULD BE THE FUTURE USE OF THESE BUILDINGSIFTHATOCCURRED



!#40,!..).'!.$,!.$!54(/2)49


 'ROWTHOPTIONSFOR7ODEN 4HEFOLLOWINGTHREEGROWTHSCENARIOSHAVEBEENDEVELOPED



,/7'2/74(

4HIS SCENARIO CONSIDERS THAT OVER THE NEXT FIVE YEARS   JOBS RELOCATE TO OTHER CENTRES IN #ANBERRA !T THE SAME TIME 7ODEN CAPTURES ABOUT  OF THE   NEW EMPLOYMENT POSITIONSTHATAREGENERALLYCREATEDIN#ANBERRAEACHYEAR IEPOSITIONSAYEAR/VER YEARSTHISREBUILDSEMPLOYMENTIN7ODENTOITSCURRENTLEVELOF  2ESIDENTIALDEVELOPMENTISBASEDONNEWDWELLINGSAYEARFROM 'ROWTHINTHERETAILSECTOROCCURSWITHINCREASEDEXPENDITUREBYTHECATCHMENTSPOPULATION ANDTHELOCALWORKFORCE



-%$)5-'2/74(

4HIS SCENARIO CONSIDERS A NET LOSS OF   POSITIONS OVER FIVE YEARS )N ADDITION 7ODEN CAPTURES ABOUT  OF THE   NEW EMPLOYMENT POSITIONS THAT ARE GENERALLY CREATED IN #ANBERRAEACHYEAR IEPOSITIONSAYEAR/VERYEARSTHISMEANSANINCREASEIN7ODENS EMPLOYMENTBASEOF TO  2ESIDENTIALDEVELOPMENTISBASEDONNEWDWELLINGSAYEARFROM 'ROWTHINTHERETAILSECTOROCCURSWITHINCREASEDEXPENDITUREBYTHECATCHMENTSPOPULATION ANDTHELOCALWORKFORCE



()'('2/74(

4HIS SCENARIO CONSIDERS THAT NO MAJOR PUBLIC SERVICE RELOCATIONS OCCUR !T THE SAME TIME 7ODENCAPTURESABOUTOFTHE NEWEMPLOYMENTPOSITIONSTHATAREGENERALLYCREATED IN #ANBERRA EACH YEAR IE  POSITIONS A YEAR /VER  YEARS THIS MEANS AN INCREASE IN 7ODENSWORKFORCEOF TO  2ESIDENTIALDEVELOPMENTISBASEDONNEWDWELLINGSAYEARFROM 'ROWTHINTHERETAILSECTOROCCURSWITHINCREASEDEXPENDITUREBYTHECATCHMENTSPOPULATION ANDTHELOCALWORKFORCE

7/$%.4/7.#%.42%^ MASTERPLAN




4!",%,OW MEDIUMANDHIGHGROWTHSCENARIOSn0REDICTIONSFOR

0REDICTIONSFOR

'ROWTHINDICATOR

%XISTING

,OWGROWTH

-EDIUMGROWTH

(IGHGROWTH

7ORKFORCE

 

 

 

 

4OTALOFFICESPACEREQUIREMENT 4OWNCENTRERESIDENTIALDWELLINGS #ATCHMENTPOPULATION 2ETAILSPACE 4OTALCARPARKS 4RAFFICCAPACITY

 M

 M

 M

 M

.IL

 

 

 

 

 

 

 

 M

 M

 M

 M

 

 

 

 

!CHIEVED

!CHIEVED

!CHIEVED

!CHIEVED

.OTE!SSUMESNOCHANGEINMODALSPLIT

 ,IMITATIONSONGROWTH 4HE EXTENT TO WHICH THE HIGHER GROWTH SCENARIOS CAN BE ACHIEVED WILL RELY ON THE CAPACITY OF INFRASTRUCTURETOACCOMMODATETHEADDITIONALDEMANDS)NFRASTRUCTURECAPACITYISSUMMARISEDAS 

2/!$.%47/2+

5LTIMATE TRAFFIC VOLUMES HAVE BEEN CALCULATED ON A HIGHER LEVEL OF DEVELOPMENT THAN THAT DESCRIBEDUNDERTHEHIGHGROWTHSCENARIO"OTHINTERSECTIONANDMIDBLOCKCAPACITYCANDEAL WITHADDITIONALTRAFFICANDTHISDOESNOTTAKEINTOACCOUNTTHELOWERCARUSEASSOCIATEDWITH MIXEDUSEDEVELOPMENTS MODALSHIFTFROMCARTOPUBLICTRANSPORT WALKINGANDCYCLINGAND PEAKSPREADINGTHATOCCURSWHENCONGESTIONREACHESLEVELSTHATWILLDISCOURAGEPRIVATECARS FROMMAKINGDISCRETIONARYTRIPSATPEAKPERIODS



0!2+).'

0ARKINGSTRUCTURESAREGENERALLYASSUMEDTOBENEEDEDWITHINTHEOVERALLSITESFOREACHPOTENTIAL DEVELOPMENTASWELLASPROVIDINGREPLACEMENTPARKINGFORTHOSESPACESDISPLACEDBYTHENEW DEVELOPMENT7HERETHESITEAREAISLIMITED ONEORTWOFLOORSCANBEPROVIDEDFORPARKINGAND STRATEGIESIMPLEMENTEDTOCONTRUCTANDMANAGEPUBLICPARKINGSTRUCTURESFORSHAREDUSE



0%$%342)!.!-%.)49

5NDER THE HIGH GROWTH SCENARIO AN ADDITIONAL  M OF OFFICE PLUS   RESIDENTIAL APARTMENTS COULD BE BUILT OVER THE NEXT  YEARS 4HE GROWTH DOES NOT ENTAIL SUBSTANTIAL RESTRUCTURINGOFTHE4OWN#ENTREANDPROVIDEDATTENTIONISPAIDTOSTREETLEVELAWNINGPROTECTION STREET LEVEL ACTIVITY OVERSHADOWING BETWEEN  AND PM IN MID WINTER WIND TUNNEL EFFECTS AND UPGRADING PAVING RAMPS LIGHTING LANDSCAPE AND STREET FURNITURE PEDESTRIAN AMENITYWILLBEPRESERVEDANDENHANCEDBYINCREASEDACTIVITYANDSENSEOFSECURITY



!#40,!..).'!.$,!.$!54(/2)49




#/--5.)49!.$30/24).'&!#),)4)%3

5NDERTHEHIGHGROWTHSCENARIOANDGIVENTHEGENERALAGINGOFTHE7ODENPOPULATION SOME ENHANCEMENTS TO COMMUNITY CLUBS AND HEALTH SERVICES IS LIKELY 'ROWTH IN THESE AREAS CAN BEACCOMMODATEDANDCOULDINCLUDEUPGRADINGANDENCLOSINGTHESWIMMINGPOOL PROVIDING ADDITIONALCOMMUNITYMEETINGSPACEANDIDENTIFYINGASITEFORANARTSANDCULTURALCENTRE



3%7%2

!CTEW!',ANDPREDESIGNSTUDIESFOR7ODEN%ASTCONFIRMTHATCAPACITYEXISTSTOACCOMMODATE ADDITIONALDEVELOPMENTIN7ODEN4OWN#ENTREWITHOUTTHENEEDFOREXPENSIVEAUGMENTATION OFTHEEXISTINGSEWERAGESYSTEM



7!4%2

!CTEW!',HASCONFIRMEDTHEREARENOMAJORISSUESWITHWATERSUPPLY!COMBINATIONOFAND DIAMETERWATERMAINSMEETWATERSUPPLYANDFIREFIGHTINGDEMANDSFORFUTUREDEVELOPMENT PROPOSALSINTHEAREA 3ERVICINGINDIVIDUALDEVELOPMENTSTOTHEAREAAROUND9ARRALUMLA#REEKWILLREQUIREADDITIONAL SMALL LENGTHS OF PIPEWORK 4HE SUPPLY ZONE IS 7ODEN )NTERMEDIATE APPROX M !($  %XISTINGPRESSUREINTHEAREAISHIGHM ANDNOLOWFLOWPRESSUREISSUESAREEXPECTED



34/2-7!4%2

-AJORDEVELOPMENTPROPOSALSSHOULDBESEENASOPPORTUNITIESTOADOPTWATERSENSITIVEURBAN DESIGNPRINCIPLESTHATWILLCONTAINMORESTORMWATERRUNOFFWITHININDIVIDUALSITESORWITHINOFF LINEPONDSTHATCONTRIBUTETOAMORENATURALISED9ARRALUMLA#REEK



%,%#42)#)49

!CTEW!', HAS CONFIRMED THAT CAPACITY EXISTS TO ACCOMMODATE ADDITIONAL DEVELOPMENT IN 7ODEN 4OWN #ENTRE WITHOUT THE NEED FOR EXPENSIVE AUGMENTATION OF THE EXISTING ELECTRICITY RETICULATION



'!3

#APACITYEXISTSTOACCOMMODATEADDITIONALDEVELOPMENTIN7ODEN 4OWN#ENTREWITHOUTTHE NEEDFOREXPENSIVEAUGMENTATIONOFTHEEXISTINGGASRETICULATIONSYSTEM

 /0%.30!#% %XISTING PARKLANDS MAY BENEFIT FROM AN INCREASE IN THE RESIDENTIAL POPULATION OF THE 4OWN #ENTRE AND THE CURRENT AVAILABILITY OF OPEN SPACE WILL PROVIDE A BROAD RANGE OF OUTDOOR RECREATIONOPPORTUNITIES 7/$%.4/7.#%.42%^ MASTERPLAN






!#40,!..).'!.$,!.$!54(/2)49


0!24"n&5452%$)2%#4)/.3



)-0,%-%.4!4)/.!.$ ),,5342!4)6%#/.#%043

 )NTRODUCTION 4HEILLUSTRATIVECONCEPTFOR7ODENPRESENTEDINTHISPARTOFTHE0LANISAPPROACHEDFROMTHE PERSPECTIVEOFANUMBEROFMAJORPROJECTSTHATWILLINFLUENCEKEYOBJECTIVESOF Q

!CTIVATINGTHEPUBLICDOMAINLINKINGFUNCTIONALAREAS

Q

0ROVIDINGATTRACTIVEANDFUNCTIONALPUBLICTRANSPORTOPTIONS

Q

-ATCHINGCAPABILITYOFINFRASTRUCTUREWITHPROPOSEDNEWDEVELOPMENTS

Q

$EVELOPINGCULTURALANDCOMMUNITYFACILITIESINLINEWITHCHANGINGNEEDS

+EYPROJECTSWILLPROVIDETHEIMPETUSTOGENERATESTRUCTURALCHANGEIN7ODEN3OMEOFTHESE PROJECTSSUCHASRELOCATIONOFTHE0OLICE3TATIONWILLBEENTIRELYFUNDEDBYTHEPUBLICSECTOR /THER PROJECTS SUCH AS POSSIBLE REDEVELOPMENT OF THE BUS INTERCHANGE WILL RELY ON THE PACKAGING OF LAND RELEASES TO PROVIDE PUBLIC INFRASTRUCTURE IN CONJUNCTION WITH NEW PRIVATE INVESTMENTINTHERETAIL COMMERCIALANDRESIDENTIALSECTORS 0ROJECTSMAYTAKECONSIDERABLETIMEANDWILLBEDEPENDENTONOTHERSTEPSSUCHAS Q

-AJORTENANTSRESOLVINGFUTUREOFFICEACCOMMODATIONNEEDS

Q

!CQUISITIONOFLAND

Q

0REPARATION NEGOTIATION AND LODGEMENT OF DEVELOPMENT APPLICATIONS INCLUDING PUBLIC EXHIBITIONPERIODS

Q

0REPARATION NEGOTIATIONANDLODGEMENTOF0RELIMINARY!SSESSMENTSANDOTHERMANDATORY PLANNINGREQUIREMENTS

4HEOVERALLILLUSTRATIVECONCEPTFOR7ODENOVERTHENEXT YEARSISINCLUDEDAS&IGUREB B BAND4HEDETAILOFMAJORPROJECTSTHATWILLCONTRIBUTETOKEYELEMENTSOFTHE0LAN ARE THEN DESCRIBED IN SUBSEQUENT SECTIONS 4HE ILLUSTRATIVE CONCEPTS SHOW A RANGE OF LIKELY DEVELOPMENTOPPORTUNITIES4HEACTUALLEVELOFDEVELOPMENTOVERTHENEXTnYEARSWILLNOT TAKEUPALLPOSSIBLEOPTIONS3OMEDEVELOPMENTOPPORTUNITIESWILLBETAKENINORDERTOSATISFY MARKETDEMANDWHILEOTHERPOTENTIALDEVELOPMENTSWILLNOTOCCUR /THER PROJECTS THAT HAVE NOT BEEN FORESEEN AS PART OF THIS MASTER PLANNING PROCESS WILL INVARIABLY ARISE OVER THE PERIOD OF THE 0LAN 4HE -ASTER 0LAN MUST THEREFORE BE SUFFICIENTLY FLEXIBLE TO ACCOMMODATE UNFORESEEN DEVELOPMENTS WITHIN THE BROAD STRUCTURE THAT ACHIEVES THEBUILTFORM ECONOMICANDCOMMUNITYOBJECTIVESOFTHE0LAN

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%A .ORTHERNSECTIONOF7ODEN4OWN#ENTREIN3EPTEMBER '%/&&#/-&/240(/4/'2!0(9 4HEPERIPHERYOFTHE#ENTREHASALACKOFSTRUCTUREANDPOORURBANFORM

&)'52%B &UTURE DEVELOPMENT OPPORTUNITIES GIVE ACCENT TO PROMINENT ENTRANCES AND STREET EDGES TO CREATE A MORECONSOLIDATEDURBANFORM



!#40,!..).'!.$,!.$!54(/2)49


&)'52%A 3OUTHERNSECTIONOF7ODEN4OWN#ENTREIN*ANUARY '%/&&#/-&/240(/4/'2!0(9 4HEDEPOTANDMIXEDUSEBUILDINGSAREAPPROACHINGYEARSOLDANDMAYNOLONGERMEETFUTURENEEDS ,ANDSCAPEGENERALLYLACKSCOHESIVENESSANDMATURITYTHATWILLHELPPRODUCEANOVERALLCHARACTER

&)'52%B &UTUREOPPORTUNITIESFORTHESOUTHERNSECTIONOF7ODEN4OWN#ENTREIN*ANUARY &OURSTORYMIXEDUSERESIDENTIALDEVELOPMENTFRONTINGTHELANDSCAPEDCOURTSINTRODUCEANEWQUALITY OF DEVELOPMENT AND A BROADER RANGE OF ACTIVITY TO 0HILLIP "USINESS $ISTRICT -OTOR TRADE REMAINS THE ECONOMICANDPHYSICALANCHORAROUNDTHEWESTERNANDSOUTHERNPERIMETER

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52% 4HE-ASTER0LAN.ORTH



  



   



 







 



  





 



 



 





  











  

  



 

 







!#40,!..).'!.$,!.$!54(/2)49



 


7/$%.4/7.#%.42%-!34%20,!.^.ORTHOF(INDMARSH$RIVE ,%'%.$



.EWCARPARKSTRUCTURE



%XPANDEDEXISTINGCARPARKSTRUCTURE



3HORTSTAYCOMMUNITYFACILITIESCARPARK



2EDEVELOPEDEXISTINGCOMMERCIALBUILDING



.EWROADCONNECTIONTOEASETRAFFICCONGESTION



2EALIGNEDMAJORENTRYROAD



.EWCOMMERCIALMIXEDUSEBUILDING



.EWBUSSTATION



.EWRETAILDEVELOPMENT

 .EWPOLICESTATION  .EWPOCKETPARK  .EWENTRANCETO0LAZAANDACTIVEEDGESTO4OWN3QUARE  0OSSIBLENEWCOMMUNITYFACILITY  .EWRESIDENTIALBUILDINGS  .EWRESIDENTIALMIXEDUSE  .EWMARKERBUILDINGTODEFINEENTRANCETO7ODEN  &EATUREOFLOCALREGIONALHERITAGEVALUE  5PGRADEDANDENCLOSESWIMMINGPOOLANDICERINK  #OMMERCIALMOTELSERVICEDAPARTMENTSTOCOMPLEMENTTHESPORTINGPRECINCT  5PGRADED0HILLIP/VALWITHCOMMERCIALFRONTAGESTOSURROUNDINGSTREETS  !GEDPERSONSRESIDENTIAL  'YMNASIUMANDFITNESSCLUB  #LUB  )NDOORSPORTSHALL  ,AWNBOWLS  )NTER TOWNPUBLICTRANSPORTROUTE  .ATURALECOLOGICALFEATURESALONG9ARRALUMLA#REEK  $ISTRICTPARK

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52% 4HE-ASTER0LAN3OUTH



 











 

















 









 







  





 









 



 











!#40,!..).'!.$,!.$!54(/2)49


7/$%.4/7.#%.42%-!34%20,!.^3OUTHOF(INDMARSH$RIVE ,%'%.$



%XTEND!LTREE#OURTTO(INDMARSH$RIVETOCREATEALEFTINANDLEFTOUTINTERSECTION



-AXIMUMFOURSTOREYDEVELOPMENTPERMITTEDWITHTHEINTRODUCTIONOFRESIDENTIAL'ROUND FLOORCOMMERCIALWITHTHREESTOREYSOFRESIDENTIALABOVE



4ALLER CORNER ELEMENT 'ROUND FLOOR COMMERCIAL SPACE WITH THREE LEVELS OF RESIDENTIAL ABOVE,OFTPERMITTEDONTOPLEVELOFRESIDENTIAL



#OLBEE#OURTEXTENDEDTO!THLLON$RIVE



0ARRAMATTA3TREETEXTENDEDTO!THLLON$RIVE



"USLAYOVERFACILITIES



0UBLICCARPARK



3ECONDARYANDBULKYGOODSRETAILING



!UTOMOTIVEPRECINCT-AXIMUMTWOSTOREYDEVELOPMENT

 5PGRADEDLANDSCAPEDPUBLICSPACES  -IXED3ERVICESUSES

7/$%.4/7.#%.42%^ MASTERPLAN




3USTAINABILITY 3USTAINABILITYISABOUTPROVIDINGFORPEOPLE PROTECTINGOURPLACEANDCREATINGPROSPERITY NOW AND INTO THE FUTURE )T IS AN INTEGRATED APPROACH TO SIMULTANEOUSLY MEETING OUR SOCIAL ENVIRONMENTALANDECONOMICGOALS Q

#REATEACOMPACTAND@WALKABLETOWNTHATCOMBINESTHERETAIL COMMERCIALANDCOMMUNITY PRESENCE WITH A WIDE RANGE OF DWELLING TYPES FOCUSSED ON AN EFFECTIVE PUBLIC TRANSPORT SYSTEM

Q

2EDESIGN THE CURRENT BUS INTERCHANGE AS A MORE PEOPLE FRIENDLY FACILITY AND OPERATE A WIDERRANGEOFBUSSERVICESTOBOTHSIDESOFTHE4OWN#ENTRE

Q

)NTRODUCERESIDENTIALDEVELOPMENTTOTHECOREOFTHE4OWN#ENTREANDSURROUNDINGAREAS INCLUDINGVACANTLANDIN,YONS3ECTIONS  ANDGREENFIELDSDEVELOPMENTIN 7ODEN%AST

Q

0ROVIDEMIXEDUSESATSTREETLEVELTOCREATEMOREACTIVEANDSAFESTREETS

Q

0ROVIDE THE NECESSARY RANGE OF COMMUNITY FACILITIES TO SUPPORT A HEALTHY AND SECURE POPULATION

Q

%XPRESSASENSEOFCOMMUNITYANDINDIVIDUALCHARACTERFORTHETOWN

Q

#ONTRIBUTETOASENSEOFCIVICPRIDE STRENGTHANDCOHESION

Q

5PGRADE PEDESTRIAN ENVIRONMENTS WITH LEGIBLE CONNECTIONS AND WELL DESIGNED PAVING LIGHTING RAMPS SIGNAGEANDSTREETFURNITURE

4HESEBROADSTRUCTURALCHANGESTOTHEEXISTINGSEGMENTEDLANDUSEPATTERNWILLBEEXAMINED LATERINTHE0LANANDWILLCONTRIBUTETOMORESUSTAINABLEPLANNINGOBJECTIVES /THERPHYSICALIMPROVEMENTSTHATWILLCONTRIBUTETOSUSTAINABILITYOBJECTIVESINCLUDE Q

.ATURALISINGSECTIONSOF9ARRALUMLA#REEKWITHOFF LINEPONDS

Q

7ATERSENSITIVEURBANDESIGNINCLUDINGRAINWATERUSE

Q

3OLARORIENTATIONANDPROVISIONOFSUNLIGHTTOPUBLICANDPRIVATEOPENSPACE

Q

7ASTEMINIMISATIONANDREDUCTIONIN#/EMISSIONS

&)'52%3TRUCTURALCHANGES !MOREMIXEDUSEAND@WALKABLETOWNWILLCONTRIBUTETOMORESUSTAINABLEURBANDEVELOPMENT



!#40,!..).'!.$,!.$!54(/2)49


 Q

9!22!,5-,!#2%%+

)NVESTIGATE UPSTREAM RETENTION WORK TO RE INSTATE PARTS OF 9ARRALUMLA #REEK AS A MORE INFORMALWATERCOURSETHATWILLENRICHTHECHARACTEROF7ODEN

Q

7HEREPRACTICABLEANDSUBJECTTOENGINEERINGCONSTRAINTSUSEOFF LINEPONDING POOLSAND RIFLES MACROPHYTESANDSHALLOWZONESTOCREATEAMORENATURALCREEKSYSTEM

Q

#REATEALINEARPARKTOTHESOUTHOFTHE4OWN0ARKDEFINEDBYACREEKEDGEROADWITHNEW RESIDENCESPROVIDINGSURVEILLANCE

&)'52% 0OSSIBLEOPPORTUNITIESFOR9ARRALUMLA#REEKADJACENTTOTHE4OWN0ARK

&)'52%/#ONNORWETLANDS /PPORTUNITIESFOROFF LINEPONDINGON9ARRALUMLA#REEKWILLBEINVESTIGATED

7/$%.4/7.#%.42%^ MASTERPLAN






7!4%23%.3)4)6%52"!.$%3)'.

.EWDEVELOPMENTSSHOULDADOPTWATERSENSITIVEURBANDESIGNMEASURESTHATMAYINCLUDE Q

7ATER HARVESTING STORAGE AND DISTRIBUTION SYSTEMS TO REDUCE DEMAND ON POTABLE WATER SUPPLIESANDLOWERSTORMWATERDISCHARGE

Q

7ATER RETENTION SYSTEMS INCLUDING DOMESTIC RAINWATER TANKS INTO A SECOND CLASS WATER SERVICESUCHASTOILETSORIRRIGATION

Q

2ESTRICTINGTHEAMOUNTOFHARDPAVEDAREAANDUSEPOROUSPAVEMENTSTOREDUCERUNOFF ANDINCREASEINFILTRATIONONSITE

Q

%XPLORINGOPTIONSTOCARRYOUTRETENTIONORDETENTIONWORKSOFFSITE UPGRADING9ARRALUMLA #REEKWITHOFF LINEPONDSFOREXAMPLE ASANALTERNATIVETOONSITECONTROL

7!4%2-)3%2$%6%,/0-%.4 Q

$UALFLUSHSPLITCISTERN

Q

,OWFLUSHTOILETS

Q

,OWFLOWFAUCETSANDSHOWERHEADS

Q

$RIPIRRIGATIONSYSTEMS

Q

,OWPRESSUREHOTWATERSERVICE

Q

7ATERSAVERCYCLEONDISHWASHERANDWASHINGMACHINE

Q

)NSULATEDHOTWATERPIPESANDSHORTRUNSTOOUTLETS

Q

,OCALLYCOLLECTEDWATERFORTOILETFLUSHINGANDIRRIGATION

&)'52%7ATER3ENSITIVE5RBAN$ESIGN

2!).7!4%2 (!26%34).'

.UMBEROFHOUSESDISCHARGINGINTO COMMONTRENCHES

2OOFCATCHMENT SYSTEM

3/!+!'% INCREASESSOIL MOISTURETHEREFOREGROWTH

#OLLECTORSYSTEM

3TORMWATERRUNOFFFROMHOUSES

â–

â–

&ILTRATIONSYSTEM

â–

3TORAGESYSTEM

â–

2AINFALL

2AINWATERTANK

/VERFLOWTOSTREET 4RANSPIRATIONEVAPORATION

$ISTRIBUTIONSYSTEM

â–

3TORMRUNOFF 2ETENTIONTRENCH



!#40,!..).'!.$,!.$!54(/2)49




-)#2/#,)-!4%

0ROVIDEADEQUATESUNLIGHTTOADJOININGBUILDINGSANDPUBLICOPENSPACEANDAMELIORATE THEWINDEFFECTSFROMTALLBUILDINGS Q

/N SITES ADJACENT TO MAIN PEDESTRIAN AREAS OF THE PEDESTRIAN SPINE 4OWN 3QUARE AND PROPOSEDOPENSPACESNEWBUILDINGSSHALLBELIMITEDINHEIGHTTOENSURETHAT ^ -AINPEDESTRIANAREASREMAINSUBSTANTIALLYSUNLIT PARTICULARLYBETWEENNOONAND PMINMIDWINTER ^ !NATTRACTIVEENVIRONMENTISMAINTAINEDINTHESEAREAS

Q

)MPLEMENTCORRECTIVEMEASURESTOREDUCETHEUNDESIRABLEIMPACTSOFLOWLEVELAIRFLOWON THE4OWN3QUAREANDOTHERPUBLICSPACES4HISCANBEACHIEVEDBY ^ 0ROVIDING A  METRE WIDE CANOPY STRUCTURE EXTENDING FROM THE 0OST /FFICE TO THE SOUTH EASTERNCORNEROFTHE0LAZATOPROTECTPEDESTRIANSFROMTHEDOWNDRAFTSGENERATED BY,OVETT4OWER3OLIDPARAPETSWITHLOCALPERFORATIONSANDSEPARATERECTANGULARFORM RAILINGSONBOTHSIDESOFTHESTRUCTUREWILLHELPPROTECTPEDESTRIANSFROMANYLOCALWIND BUFFETING ^ 4REATTHEFACADEOF,OVETT4OWERTODEFLECTANDSLOWDOWNDESCENDINGAIRMOVEMENTS

&)'52% %XISTINGAIRMOVEMENTSANDREMEDIATIONMEASURESINTHE4OWN3QUARE

#OMMONWEALTH"ANK"UILDING

#OSMOPOLITAN "UILDING

0OST/FFICE 0REVAILING. 7WINDS

"US)NTERCHANGE

4OWN3QUARE

#HURCHES #ENTRE

,OVETT 4OWER

0LAZA

. %XISTINGCANOPIES

0ROPOSEDADDITIONALCANOPY

7/$%.4/7.#%.42%^ MASTERPLAN






&!#),)4)%3&/27!34%2%#9#,).'

%XPLORE NEW OPPORTUNITIES TO FACILITATE THE 'OVERNMENTS STRATEGY AND COMMUNITYS COMMITMENTTO.O7ASTE"Y Q

&AVOURADAPTIVEREUSEOVERDEMOLITION

Q

7HEREDEMOLITIONISREQUIREDSALVAGEMATERIALSTOMAXIMISERECYCLING

Q

0ROVIDESPACEFORCONTAINMENTOFALLWASTEANDRECYCLABLESWITHINLEASEDBOUNDARIESAND PROVIDEADEQUATECOLLECTIONVEHICLEACCESSINACCORDANCEWITHTHE $EVELOPMENT#ONTROL

#ODEFOR"EST0RACTICE7ASTE-ANAGEMENTINTHE!#4 Q

!VOIDSTORAGEOFWASTECONTAINERSONUNLEASEDLANDSUCHASVERGESANDLANEWAYS

 &UTUREBUILTFORMANDCHARACTER !SSIST IN ACHIEVING A BUILT FORM THAT IS PRIMARILY @MEDIUM RISE BUT WHICH ALLOWS TALLER MARKERBUILDINGSATDISCRETELOCATIONSTODEFINETHEENTRANCESTO7ODENANDTOREINFORCE THECHARACTEROF7ODENASACOMPACTURBANCENTRE /00/245.)4)%3 Q

%NSURETHATTHEPUBLICREALMISNOTADVERSELYAFFECTEDBYOVERSHADOWINGANDWINDSHEAR RESULTINGFROMINAPPROPRIATELYLOCATEDBUILDINGMASS

Q

$EVELOPBUILDINGSGENERALLYTOHEIGHTSINDICATEDIN&IGUREAND

Q

5SEBUILDINGMASSINGTOCREATEMARKERBUILDINGSATMAJORARRIVALPOINTSTHATEXPRESSTHE COMPACTURBANFORMTHATDIFFERENTIATES7ODENFROMOTHERTOWNCENTRES

Q

3ITETALLERBUILDINGSINAWAYTHATAVOIDSOVERSHADOWINGOTHERHABITABLEBUILDINGS

Q

'ENERALLYPODIUMLEVELSOFBUILDINGSWILLBEBUILTTOTHEPROPERTYLINE

Q

0ROVIDEAWNINGSANDCOLONNADESTOCREATESTREETLEVELPEDESTRIANPROTECTION

Q

%NSURETHATBUILDINGSAREAPPROPRIATELYARTICULATEDWITHABASE MIDDLEANDTOP

Q

)NRESIDENTIALDEVELOPMENTSDIRECTOVERLOOKINGOFINTERNALLIVINGAREASTOOTHERDWELLINGSAND OFFICESISTOBEMINIMISEDBYBUILDINGLAYOUT LOCATION DESIGNOFWINDOWSANDBALCONIES SCREENINGDEVICESANDLANDSCAPING

Q

#ORNER SITES AT STREET JUNCTIONS HAVE AN IMPORTANT STREETSCAPE FUNCTION AND CAN BE ENHANCED BY EXTRA HEIGHT #ORNER SITES OFFER MAXIMUM VIEWS CROSS VENTILATION AND SUNLIGHTTORESIDENTIALBUILDINGS



!#40,!..).'!.$,!.$!54(/2)49


&)'52% #ALLAM3TREETELEVATION

&)'52% (INDMARSH$RIVEELEVATION

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52% 7ODENHEIGHTCONTROLSn.ORTHOF(INDMARSH$RIVE



!#40,!..).'!.$,!.$!54(/2)49


&)'52% 7ODENHEIGHTCONTROLSn3OUTHOF(INDMARSH$RIVE

7/$%.4/7.#%.42%^ MASTERPLAN




 #ONNECTIONSANDMOVEMENT 0ROVIDE GREATER CONNECTIVITY BETWEEN SURROUNDING RESIDENTIAL AND OPEN SPACE AREAS ANDTHECOREANDENCOURAGEAGREATERLEVELOFPEDESTRIANANDCYCLEMOVEMENTBETWEEN SEPARATEDLANDUSES /00/245.)4)%3 Q

)MPROVEEAST WESTCONNECTIONSACROSS#ALLAM3TREETTOTHE2EGIONAL/PEN3PACE3YSTEM TOCATERFORPEDESTRIANS CYCLISTSANDMOTORVEHICLES

Q

)MPROVECONNECTIONSACROSS-ELROSE$RIVETOTHERESIDENTIALAREASTOTHEWEST

Q

)MPROVECONNECTIONSACROSS,AUNCESTON3TREETTOTHERECREATIONAREASTOTHENORTH

Q

)MPROVE CONNECTIONS ACROSS (INDMARSH $RIVE TO THE 0HILLIP -IXED 3ERVICES !REA TO THE SOUTH

Q

)MPROVE PEDESTRIAN CONNECTIONS ACROSS #ORINNA 3TREET PARTICULARLY IN THE VICINITY OF THE COMMUNITYFACILITIESANDHEALTHRELATEDSERVICESBYREDUCINGTRAFFICVOLUMESANDENHANCING PEDESTRIANPRIORITY

Q

0ROVIDENODESFORSECUREBICYCLEPARKINGANDINCLUDECYCLEPARKINGANDSHOWERSINALL NEWBUILDINGS

Q

2EFOCUS SEPARATED PEDESTRIAN MOVEMENT TO STREET VERGES WHERE A HIGHER LEVEL OF SURVEILLANCE CAN BE ACHIEVED &ACILITATE PEDESTRIAN MOVEMENT WITH WIDE CROSSINGS AT NECKEDVEHICULARROADWAYS

Q

#IRCULATEBUSESANDTAXISMOREWIDELYAROUND7ODENANDDROPPASSENGERSCLOSERTOTHEIR DESTINATIONS

Q

5PGRADEACCESSFORMOBILITYIMPAIREDTHROUGHOUTTHE#ENTREWITHSPECIALATTENTIONGIVENTO GRADES FOOTPATHLEVELCHANGES KERBCROSSOVERS PAVEMENTSURFACES BUILDINGENTRIESAND BUILDINGDESIGN

Q

!SSUMINGNOSIGNIFICANTTRAVELMODECHANGEANDULTIMATEDEVELOPMENTOUTCOMESAREAS IDENTIFIED IN &IGURES  AND  THE MODIFIED ROAD NETWORK CONTINUES TO OPERATE WITHIN ACCEPTABLESERVICELEVELS4HISISILLUSTRATEDIN&IGURE



!#40,!..).'!.$,!.$!54(/2)49


&)'52%@5LTIMATETRAFFICVOLUMESnVEHICLESPERDAY !FTERNOONPEAK

 

 











ET 3TRE

!THLLON$RIVE

SEND 4OWN

 

   





 





   



 

 

 



-ELROSE$RIVE







   



 

RIV E







 

 











(IND  M A RS H $ R  IVE



 3TREET #ALLAM 



BA $



 



,AUN CESTON VE $RI

M 9A

 





   





   





7/$%.4/7.#%.42%^ MASTERPLAN






-%,2/3%$2)6%

)MPROVETHEROADCROSSSECTIONANDLOWERTHESPEEDENVIRONMENTTOBETTERINTEGRATETHE RESIDENTIALAREALOCATEDTOTHEWESTOF-ELROSE$RIVEWITHTHERETAILANDOFFICEPRECINCTTO THEEAST Q

0RESERVETHEPRINCIPALTRANSPORTROLEOF-ELROSE$RIVEINTHE!#4ROADNETWORK

Q

"ETWEEN ,AUNCESTON 3TREET TO (INDMARSH $RIVE CONSIDER REDUCING THE SPEED LIMIT ON -ELROSE$RIVEFROMTOKPH

Q

#ONSIDER PROVIDING PARALLEL PARKING AND CYCLE LANES ALONG BOTH SIDES OF -ELROSE $RIVE /VERALL ROAD NETWORK EFFICIENCY IS CURRENTLY CONTROLLED BY INTERSECTION CAPACITY AND THE PROPOSALDOESNOTREDUCETRAFFICCAPACITYTOASIGNIFICANTEXTENT

Q

)MPORTANT PARKING FOR THE COMMUNITY FACILITIES IS PROVIDED TOGETHER WITH MUCH NEEDED ADDITIONALPARKINGONTHEWESTERNSIDEOFTHE4OWN#ENTRE

Q

,AND USE ALONG THE ROAD WILL FURTHER ALTER WITH REDEVELOPMENT OF VACANT LAND IN ,YONS 3ECTIONS  ANDTHEADDRESSOFTHISDEVELOPMENTTO-ELROSE$RIVEFURTHER VALIDATESAREORIENTATIONOF-ELROSE$RIVEASANURBANROAD

Q

&UTURESIGNALISATIONOFTHE#ORINNA 3TREET INTERSECTION PROVIDESANADDITIONALDESIGNATED PEDESTRIANCROSSING

Q

0OSSIBLE NEW EXIT FROM THE BASEMENT CAR PARK TO #ORINNA 3TREET PROVIDES GREATER PERMEABILITYTOANDFROMTHE4OWN#ENTRE

&)'52%+ERBSIDEPARKINGANDCYCLELANESON-ELROSE$RIVE

2EMODELLEFTTURN SLIPLANE

0ROVIDEPARALLELPARKING ANDBIKELANE

2EMODELLEFTTURN SLIPLANE

0ROVIDEPARALLELPARKING ANDBIKELANE

!DDITIONALROAD



!#40,!..).'!.$,!.$!54(/2)49




,!5.#%34/.342%%4

)MPROVE THE ROAD CROSS SECTION TO BETTER INTEGRATE THE RECREATIONAL AREA LOCATED TO THE NORTHOF,AUNCESTON3TREETWITHTHERETAILANDOFFICEPRECINCTTOTHESOUTH Q

0EAK PERIOD PEAK DIRECTION TRAFFIC FLOW IS CURRENTLY  VEHICLES PER HOUR WITH FULL DEVELOPMENTPOTENTIALLYINCREASINGTOAROUND VEHICLESPERHOUR!TMIDBLOCK ONE LANEONLYISNEEDEDTOACCOMMODATETHISVOLUMEOFTRAFFIC

Q

#ONSEQUENTTOFUTURETRAFFICMODELLINGANDBUSPRIORITYMEASURES,AUNCESTON3TREETCAN BERECONFIGUREDTOTHETYPICALMIDBLOCKCONFIGURATIONSHOWNIN&IGURE ANDPERMIT KERBSIDEPARKINGONBOTHSIDESOFTHEROAD

Q

4HECURRENTFOURLANECONFIGURATIONBETWEEN&URZER3TREETAND-ELROSE$RIVEISPROPOSED TOBERETAINED

&)'52%,AUNCESTON3TREET MIDBLOCKEASTOF&URZER3TREET

7/$%.4/7.#%.42%^ MASTERPLAN






#!,,!-342%%4"/5,%6!2$

2ECONSTRUCTIONOF#ALLAM3TREETTOALIGNWITH!THLLON$RIVECREATESAMAJORNEWBOULEVARD THATEXTENDSFROMTHESOUTHERNENDOF-ELROSE$RIVETO,AUNCESTON3TREET Q

4YPICALLY ONE LANE ON EACH CARRIAGEWAY IS USED AS A TURNING LANE AND THE GENERAL ARRANGEMENTPROVIDESTWOLANESFORTRAVELTHROUGHEACHINTERSECTIONINEACHDIRECTION

Q

4HERETENTIONOFTWOTHROUGHLANESINEACHDIRECTIONISIMPORTANTBECAUSE ^ FUTUREEXPANSIONOFTHE4OWN#ENTREWILLINCLUDEMOREPARKINGONTHEEASTERNSIDE WITH #ALLAM3TREETTHEPRINCIPALACCESSROUTE ^ FLEXIBILITY IN BUS OPERATIONS INCLUDING THE POTENTIAL FOR A BUS ONLY OR OTHER HIGH OCCUPANCYVEHICLELANEALONG#ALLAM3TREETISRETAINED

Q

4RAFFICSIGNALSSPACEDATAVERAGEINTERVALSOFMFACILITATEPEDESTRIANACCESSACROSSTHE ROAD

Q

!CHIEVEMOREEFFECTIVEACCESSTOANDEGRESSFROMTHERETAILCARPARKSTOREDUCEEXCESSIVE QUEINGFROMTHESOUTH

Q

4HE)NTER TOWN0UBLIC4RANSPORT2OUTEISINCLUDEDWITHINTHERESERVATIONANDPROVIDESEASY PEDESTRIANACCESSTOFUTUREBUSSTATIONLOCATIONS

Q

4HERELEASEOFLANDFORAPARTMENTLIVINGALONGTHEWESTERNEDGEOF9ARRALUMLA#REEKAND FRONTINGANEWEDGESTREETHELPSDEFINETHEENTRANCETO7ODEN

Q

'ENEROUSLYPLANTTHEREALIGNED#ALLAM3TREETWITHLARGEGROWINGTREESTHATAREOFAPPROPRIATE SCALEFORTHESIGNIFICANCEOFTHESTREET

Q

.ATURALISE9ARRALUMLA#REEK

Q

$EVELOPABUILTEDGEOFGENERALLYSIXTOEIGHTSTOREYS

&)'52%3TREETEDGEBUILDINGSTODEFINETHESTREET "UILDINGSCALERESPONDSTOTHEWIDTHOFTHESTREETTOSPATIALLYDEFINEAPLACE2ELOCATIONOFTHEBUS INTERCHANGEPROVIDESANOPPORTUNITYTOBUILDASIGNIFICANTNEWBUILDINGWITHAFRONTAGETO#ALLAM 3TREET



!#40,!..).'!.$,!.$!54(/2)49




"/7%3"2!$,%9342%%4

)MPROVETHENORTH SOUTHCONNECTIONALONG"OWESAND"RADLEY3TREETSTOCREATEAMOREACTIVE COUNTER BALANCETO#ORINNA3TREETANDCONTRIBUTETOAMORELIVELYANDSAFEHOURCENTRE Q

"UILD UPON THE ENERGY CREATED BY THE CINEMA DISTRICT THROUGH A MIX OF USES INCLUDING ACTIVERETAILANDRESIDENTIAL

Q

2EMODELTHEBUSINTERCHANGEANDASSOCIATEDSTRUCTURES

Q

#REATENEWBUILDINGSANDPUBLICSPACETOCONNECTTOTHE4OWN3QUARE

Q

0ROVIDEON STREETPARKINGANDTAXIRANKSTOCREATEANACTIVEMULTIPLEUSEPRECINCT

Q

!CTIVATETHESTREETWITHCAFES RESTAURANTSANDLIFESTYLERETAIL

&)'52% "OWES3TREET EXISTING )NACTIVESTREETFRONTAGES AVEHICLEORIENTATEDSTREETSYSTEM DOMINATEDBYTHEFUNCTIONALLAYOUTOFTHEBUSINTERCHANGEAND LITTLEPEDESTRIANAMENITYHASNOTCREATEDAPOSITIVEPLACEWITHIN THE4OWN#ENTRE

&)'52%"OWES3TREET FUTUREPOTENTIAL 7IDEFOOTPATHSWITHPEDESTRIANSHELTERINTHEFORMOFPOSTEDVERANDAHSANDAWNINGS STREETTREESPROVIDINGSHADE FREQUENTBUS STOPSANDAMIXOFENTERTAINMENT RETAILANDCOMMERCIALUSESCANFORMTHEBASISOFANEWNORTHSOUTHSPINE

7/$%.4/7.#%.42%^ MASTERPLAN






.%045.%342%%4%84%.3)/.

%XTEND.EPTUNE3TREETTOTHEEASTACROSS9ARRALUMLA#REEKANDPROVIDERETAIL COMMERCIAL ANDRESIDENTIALACTIVITYALONGTHESTREETTOCREATEAMAJORVEHICLE PEDESTRIANANDCYCLE CONNECTIONBETWEENRESIDENTIALDEVELOPMENTINTHEEASTANDTHE4OWN#ENTRE Q

0ROVIDEFORONROADCYCLING KERBSIDEPARKINGANDPEDESTRIANANDVEHICLELIGHTINGALONGTHE NEWSECTIONOFROAD

Q

0ROVIDEPEDESTRIANCYCLEPATHSONBOTHSIDESOF9ARRALUMLA#REEKBRIDGE

Q

)MPROVEPEDESTRIANCROSSINGATTHESIGNALISEDINTERSECTIONWITH#ALLAM3TREETWITHWIDENED PRAMRAMPS TACTILEPAVINGANDLIGHTING

Q

0ROVIDEPEDESTRIANCROSSINGSATTHEINTERSECTIONWITHTHEPROPOSEDNEWEDGESTREET

Q

2ETAINANDENHANCESTREETLEVELACTIVITYONTHENORTHERNSIDEOF"ONNER(OUSE

Q

0ROVIDEANADDRESSTOTHENEWPOLICESTATIONALONGWITHVISITORPARKING

Q

!TGROUNDLEVELPROVIDEGARDENAPARTMENTSWITHINDIVIDUALADDRESSTOTHESTREET

Q

0ROVIDEREASONABLEPRIORITYTOCYCLISTSATTHEINTERSECTIONOF.EPTUNE3TREETWITHTHENORTH SOUTHTRUNKCYCLEWAYTHATRUNSPARALLELWITH9ARRALUMLA#REEK

&)'52%.EPTUNE3TREETEXTENSIONPROVIDESAMAJOREASTWESTCONNECTION



!#40,!..).'!.$,!.$!54(/2)49




.%72/!$34/)-02/6%!##%33)"),)49

2ELIEVEPEAKTIMECONGESTIONBYCONSTRUCTINGADDITIONALROADSFROMTHEINNERCOREAREAS TOTHESURROUNDINGARTERIALROADSYSTEM 2EFERTOTHEPLANBELOWFORMODIFICATIONSTO7ODENSROADNETWORK

&)'52%/VERALLCHANGESTOTHEROADNETWORK

2EALIGNTOTHENORTH THECONNECTION BETWEEN&URZERAND #ORINNA3TREETS 

 #ONSTRUCTANEWROADPARALLELTO"RADLEY 3TREETTOCREATEANEWPOCKETPARK

 %XTEND"RADLEY3TREET THROUGHTO"OWES 3TREETSUBJECTTO MODIFICATIONOFTHE WESTERNEDGEOF "OWES3TREET

#ONSTRUCTANEW  ROADBETWEEN -ELROSE$RIVE AND#ORINNA 3TREETOPPOSITE THE#ORINNA3TREET ROUNDABOUT

 #ONSTRUCTANEWROADBETWEEN"OWESAND "RADLEY3TREETSPARALLELTO#ALLAM3TREET  "RADLEY3TREETMODIFICATIONS

 #ONSTRUCTANEWEASTWESTROADBETWEEN #ALLAMAND"RADLEY3TREETSTOTHESOUTH OF.EPTUNE3TREET  %XTEND"ALL3TREETTOGIVEDIRECT ACCESSTOTHEBASEMENTCARPARK NORTHOF#ORINNA3TREET

 %XTEND!LTREE#OURTTO (INDMARSH$RIVE

 %XTEND#OLBEE#OURTTO !THLLON$RIVE

 %XTEND0ARRAMATTA 3TREETTO!THLLON$RIVE

7/$%.4/7.#%.42%^ MASTERPLAN




 !CTIVATINGTHEPUBLICDOMAIN -ORE CONNECTIVE STREETS AND IMPROVED PUBLIC AMENITY WILL CREATE OPPORTUNITIES FOR ACTIVATINGTHEPUBLICDOMAIN Q

7IDEFOOTPATHS SIDEWALKCAFES STREETFRONTAGERETAILANDENTERTAINMENTOPPORTUNITIESCAN CREATEASAFER MOREATTRACTIVE MOREACTIVEANDMOREECONOMICALLYVIABLECENTRE

Q

5NDERTAKE PUBLIC DOMAIN IMPROVEMENTS TO THE 4OWN 3QUARE AND THE .ORTH 7ALK AND ENSUREFUTUREDEVELOPMENTPROVIDESANACTIVEFRONTAGETOTHESEIMPORTANTPLACES

Q

)MPROVETHERELATIONSHIPOFTHEBUSINTERCHANGEWITHTHEADJACENTCOMMERCIALDEVELOPMENTS ANDPUBLICOPENSPACE

Q

7HERE PRACTICABLE NATURALISE THE CREEK CORRIDOR TO PROVIDE NEW PARKLAND FOR THE TOWN WHICHISOVERLOOKEDBYPASSINGVEHICLESANDNEWRESIDENTIALDEVELOPMENT

Q

%NHANCETHE0HILLIP-IXED3ERVICES!REATHROUGHIMPROVEDLANDSCAPINGANDTHEOPPORTUNITY FORMIXEDUSEDEVELOPMENTFOCUSEDAROUNDTHECOURTSANDALONG4OWNSHEND3TREET

Q

/RGANISE MARKET DAYS AND OTHER EVENTS TO DRAW PEOPLE INTO THE KEY SPACES OF THE 4OWN

&)'52%!CTIVATINGTHEPUBLICDOMAINn4OWN3QUAREAND.ORTH7ALK 5NDERTHEGUIDANCEOFA@0LACE-ANAGERCOORDINATINGACTIVITIESANDEVENTS THE4OWN3QUAREAND .ORTH7ALKAREREVITALISED!WEEKLYMARKETDAYDRAWSTHECOMMUNITYTOGETHER



!#40,!..).'!.$,!.$!54(/2)49


 4HENEWPOLICESTATION #REATEASIGNIFICANTNEWPUBLICBUILDINGIN7ODENTHATGIVESAGREATERSENSEOFCOMMUNITY SAFETYANDSECURITYANDSTRENGTHENSTOWNSCAPEOPPORTUNITIESALONGTHEEASTERNSIDEOF THECORE Q

4HEPROPOSEDNEWPOLICESTATIONPROVIDESAPROMINENTFRONTAGETOANMETRELENGTHOFTHE EASTERNSIDEOF#ALLAM3TREETSOUTHOFTHE9OUTH#ENTRE

Q

!STRONGPUBLICADDRESSDIRECTLYOFF#ALLAM3TREETWITHAMPLESHORTSTAYPUBLICPARKINGINTHE VICINITYOFTHEPOLICESTATION

Q

0ROVIDEASTRONGCORNERELEMENTATTHEINTERSECTIONOF#ALLAM3TREETANDTHEFUTUREALIGNMENT OF .EPTUNE 3TREET THAT WILL EXTEND ACROSS 9ARRALUMLA #REEK TO CONNECT PROPOSED NEW RESIDENTIALAREASTOTHETOWN

Q

#REATE OPPORTUNITIES TO REDEVELOP THE EXISTING POLICE STATION SITE TO FRONT #ALLAM 3TREET AND SERVEASTHEIMPETUSTOSUBSTANTIALLYMODIFYANDIMPROVETHEBUSSTATION

&)'52% #ONCEPTDESIGNFORTHENEWPOLICESTATIONTOBELOCATEDONTHESOUTHERNSIDE OFTHE9OUTH#ENTRE

7/$%.4/7.#%.42%^ MASTERPLAN




 0UBLICTRANSPORT -ODIFY OR REPLACE THE EXISTING INTERCHANGE IN A WAY THAT CLEARLY DEMONSTRATES IMPROVEMENTS IN PASSENGER AMENITY BUS OPERATIONS AND FLEXIBILITY TO ADAPT TO FUTURE PUBLICTRANSPORTANDURBANDESIGNOPPORTUNITIES 

/6%2!,,"53.%47/2+)-02/6%-%.43

4HE 'OVERNMENTS POLICY TO ENCOURAGE GREATER USE OF PUBLIC TRANSPORT AS AN IMPORTANT COMPONENTOFITSSUSTAINABLETRANSPORTPLANWILLBEENHANCEDBYPROVIDINGSAFEANDCOMFORTABLE CUSTOMERFACILITIESTHATAREINTEGRATEDWITHOTHERRETAILANDCOMMERCIALACTIVITIES 4HEMODERNISATIONOFPUBLICTRANSPORTCUSTOMERFACILITIESIN7ODENWILL Q

-AKEPUBLICTRANSPORTUSAGEAMOREATTRACTIVECHOICEANDTHEREBYCONTRIBUTETOECOLOGICALLY SUSTAINABLEDEVELOPMENT

Q

!MELIORATE LIABILITY ISSUES THAT MIGHT ARISE FROM PERSISTING WITH THE CURRENT ARRANGEMENTS THATLACKTHERIGHTLANDUSEMIXTOOVERCOMEFUNDAMENTALPROBLEMS

Q

)MPROVE ACCESS AND SAFETY CONSISTENT WITH THE !#4S !CTION 0LAN FOR !CCESSIBLE 0UBLIC

4RANSPORT



Q

)MPROVETHEPUBLICDOMAINONTHEEASTERNSIDEOF7ODENANDSERVEASTHEIMPETUSFORTHE REVITALISATIONOFPUBLICANDPRIVATEINVESTMENTINTHEAREATOENHANCE7ODENASAN@URBAN VILLAGEANDSUPPORTTHE'OVERNMENTSSPATIALPLANNINGAGENDA

Q

%NCOURAGEPRIVATEINVESTMENTTHROUGHA@PARTNERSHIPAPPROACHWITHMAJORSTAKEHOLDERS

Q

!TTRIBUTEAHIGHERLEVELOFRESPONSIBILITYFORCLEANING MAINTENANCEANDSECURITYOFACORE @LOUNGEAREATOTHEPRIVATESECTORTOACHIEVEALEVELOFPRESENTATIONSIMILARTOTHATWITHINTHE COMMONAREASOF7ODEN0LAZA

Q

#REATETHEOPPORTUNITYTODEVELOPABUILTEDGETO#ALLAM3TREETOPPOSITE7ODEN4OWN0ARK INTHEFORMOFASIGNIFICANTRESIDENTIALOROFFICEMIXEDUSEDEVELOPMENT

Q

!SSISTTOCREATEANEWCOMMUNITYFACILITYTHATCOULDCOMPRISE7ODEN#OMMUNITY3ERVICE CHILDCARECENTRE !#4'OVERNMENTSHOPFRONT MEETINGROOMS ANUNLICENSEDCOMMUNITY CLUBANDPOSSIBLYACOMMUNITYARTSFACILITY

Q

%NHANCE THE PEDESTRIAN EAST WEST CONNECTION BY PROVIDING A LEGIBLE ACTIVE AND WELL LIT PEDESTRIANANDCYCLELINKFROMTHE4OWN3QUAREONTHEWESTERNSIDEOF#ALLAM3TREETTOTHE 4OWN0ARKANDNEWPOLICESTATIONTOTHEEAST

Q

)MPROVEPUBLICTRANSPORTINTHE-IXED3ERVICES!REABYRELOCATINGLONGERSTAYBUSLAYOVER FROMTHECOREOFTHE4OWN#ENTRETOTHEEXISTINGBUSDEPOTATTHESOUTHERNENDOF0HILLIP "USINESS$ISTRICT

Q

)MPROVESERVICESTOTHENORTHERNOFFICEPRECINCTBYCREATINGANEWSTOPATTHENORTHERNEND OF"OWES3TREETADJACENTTO0ENRHYN(OUSEFORLOCAL7ODENAND7ESTON#REEK3ERVICES

Q

#ONSIDER INCREASING BUS STOP CAPACITY ON THE WESTERN SIDE OF THE 4OWN #ENTRE TO ALLOW ADDITIONALOUTGOINGSERVICESSUCHAS7ANNIASSA &ADDENAND'OWRIEROUTESTORUNTHROUGH #ORINNA3TREET

Q

0ROTECT)NTERTOWN0UBLIC4RANSPORTCORRIDORSFORCURRENTANDFUTURETRANSPORTMODES

!#40,!..).'!.$,!.$!54(/2)49




02%&%22%$"53/04)/.

4HE PREFERRED INTERCHANGE CONCEPT IS ILLUSTRATED IN &IGURES  AND  4HE OPERATIONAL CHARACTERISTICSOFTHEPROPOSEDSOLUTIONARE &IVEGROUPSOFSTOPSASFOLLOWS Q

4HREEXLOCALSETDOWN

Q

4HREEXINTERTOWNNORTHBOUND

Q

4WOXINTERTOWNSOUTHBOUND

Q

4WOXLOCALNORTHBOUNDPICKUP

Q

4WOXLOCALSOUTHBOUNDPICKUP

4OTALOFBUSBAYSASOPPOSEDTOTHECURRENTARRANGEMENTOFAREREQUIRED&LEXIBILITYTO INCREASEBAYLENGTHTOACCOMODATEFRONTMOUNTEDBIKERACKSNEEDSTOBERETAINED 4WOOVERFLOWBAYSFORSCHOOLBUSES TOURBUSESAND1UEANBEYANSERVICESAREALSOPROVIDED ! SUMMARY OF THE PERFORMANCE OF THE PROPOSED BUS SOLUTION IS PROVIDED IN 4ABLE  4ABLE  SHOWS THAT SIGNIFICANT CAPACITY EXISTS TO EXPAND THE NUMBER OF SERVICES AND ACHIEVE THE OBJECTIVE OF THE 3USTAINABLE 4RANSPORT 0LAN OF INCREASING PUBLIC TRANSPORT COMMUTER TRIPS FROMTO7HERERELATIVELYHIGHUTILISATIONOFSOMERANKSISACHIEVEDINTHEBUSIESTFIVE MINUTEPERIODSOFTHEMORNINGANDAFTERNOONPEAKSMINORTIMETABLECHANGESCANEVENOUTTHE ALLOCATIONOFPLATFORMSPACEASDEMANDFORSERVICESINCREASESOVERTIME

4!",%0EAKUTILISATIONANDFUTURECAPACITY

!#4)6)49

-/2.).'0%!+

!&4%2.//.0%!+

n

n

n

n

















!VERAGEVEHICLETIME









!VERAGESTATIONDELAY

SEC

SEC

SEC

SEC

2!.+54),)3!4)/.

2ANK,OCALSETDOWN









2ANK.ORTHBOUNDTRUNK









2ANK3OUTHBOUNDTRUNK









2ANK,OCALPICKUP









2ANK,OCALPICKUP









,AYOVER









3CHOOLROUTES









4OTALBUSESDEPARTING 6EHICLEMINUTESATSTATION

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52% 0REFERREDBUSSOLUTIONnPLAN

&)'52% 0REFERREDBUSSOLUTIONnARTISTSIMPRESSION



!#40,!..).'!.$,!.$!54(/2)49


!SSUMING TARGET MODE SPLIT AND HIGH GROWTH SCENARIO THE PROJECTED MAXIMUM FIVE MINUTE PASSENGERFLOWSINTHEINTERCHANGEARESHOWNIN&IGURE 4HEGREENLINESREPRESENTFLOWSFROMBUSESTOTHETOWNCENTRE WHILETHEREDLINESREPRESENT FLOWSBETWEENBUSESSUCHASFROMLOCALSET DOWNTOTRUNKPICKUP 4HESEFLOWSCANBEUSEDINCONJUNCTIONWITH&RUINSPEDESTRIANLEVELSOFSERVICETODETERMINE MINIMUMSPACEREQUIREMENTSFORCIRCULATION

&)'52% 0ROJECTEDMAXIMUMPEDESTRIANFLOWSOVERAFIVEMINUTEPERIOD

,OCAL PICKUP









)NTERTOWN PICKUP DROPOFF

,OCAL DROPOFF

&OR THE PROJECTED PASSENGER FLOWS IN &IGURE  A MINIMUM CLEAR SPACE OF  TO M IS REQUIREDAT,EVELOF3ERVICE#4HISCLEARSPACEISINADDITIONTOANASSUMEDCMCLEARANCE FROMKERBSANDADJACENTSTRUCTURES!SAGENERALRULEAMINIMUMFOOTPATHWIDTHOFMHAS BEENESTABLISHEDINADDITIONTOONSTREETANDLOUNGEWAITINGAREAS4HESEMOVEMENTCORRIDORS SHALLBEPROTECTEDFROMTHEWEATHERASSUGGESTEDIN&IGURE )N CONSIDERING PEDESTRIAN SPACE REQUIREMENTS PASSENGER WAITING TIMES ARE USUALLY SHORTER ANDWAITINGSPACEREQUIREMENTSAREPROPORTIONALLYLOWERWHENBUSFREQUENCIESAREHIGHESTIN COMMUTER PEAK PERIODS (OWEVER INTERRUPTIONS TO SERVICES AT PEAK TIMES CAN LEAD TO RAPID INCREASESINPASSENGERNUMBERSONTHEPLATFORMSANDTHEPROPOSEDSOLUTIONHASTHEABILITYTO COPEWITHTHESEEVENTSBYINCORPORATINGON STREETANDOFF STREETCIRCULATIONAREAS

7/$%.4/7.#%.42%^ MASTERPLAN




5NDERNORMALINTERCHANGEOPERATIONS WAITINGPASSENGERACCUMULATIONSAREGENERALLYHIGHER INOFF PEAKTIMES ORINTHESHOULDERSOFTHEPEAKS WHENPASSENGERNUMBERSAREINCREASING BUTBUSFREQUENCIESARENOTATTHEIRHIGHEST !REASFORWAITINGPASSENGERSAREBASEDON&RUINSLEVELSOFSERVICEASAPPLIEDINRAILWAYSTATION AND BUS INTERCHANGE DESIGN !REAS FOR WAITING PASSENGERS ARE ASSUMED TO BE M PER PASSENGER STANDING 7AITINGAREASHAVEBEENDIFFERENTIATEDBETWEENPASSENGERSWITHSHORTERWAITINGTIMES SUCHAS TRUNKSERVICESDURINGTHEPEAKS WHEREPEOPLEMAYPREFERTOWAITONSTREETNEARTHETRUNKOR LOCALBUSPICKUPAREAS ANDTHOSEWITHLONGERWAITS WHOMAYPREFERTHEOFF STREETLOUNGE -INIMUMPEAKWAITINGAREASPACEREQUIREMENTS Q

4RUNKBUSPICKUPAREASnPEOPLE M

Q

,OCALBUSPICKUPAREASnPEOPLE M

Q

4OTALPEAKREQUIREMENTnAPPROXM

-INIMUM NON PEAK DAYTIME WAITING AREAS SHALL CATER FOR  PEOPLE AND INVOLVE A SPACE REQUIREMENTOFM -INIMUMNIGHTTIMEWAITINGAREASSHALLCATERFORPEOPLEANDINVOLVEASPACEREQUIREMENT OFABOUTM



Q

!##%33)"),)492%15)2%-%.43&/2"5334!4)/. )-02/6%-%.43

4HEKERBRAMPGRADIENTSHOULDBEINORMORE4HE!USTRALIANSTANDARDFORKERBRAMP GRADIENTSOFBETWEENINnINISCONSIDEREDINADEQUATE#URRENTKERBRAMPSAT 7ODENINTERCHANGEARETOOSTEEPFORPEOPLEINWHEELCHAIRS

Q

!DEQUATE COMFORTABLESEATINGWITHARMRESTSSHALLBEPROVIDED

Q

#LOCKS TIMETABLESANDPUBLICTELEPHONESSHALLBEATEYELEVELFORPEOPLEINWHEELCHAIRS OR THOSE WHO ARE STANDING 3IMILARLY STAFFED !#4)/. INFORMATION BOOTHS SHOULD BE ACCESSIBLETOPEOPLEINWHEELCHAIRSANDTHOSESTANDING

Q

0EOPLE WHO ARE VISION IMPAIRED SHOULD HAVE ACCESS TO ALL RELEVANT BUS INFORMATION IN AUDIBLEAND"RAILLEFORMATS

Q

!CCESSIBLE RESTROOMS WITH ADEQUATE SPACE TO TURN AROUND IN COMFORT n NOT JUST THE MINIMUMREQUIREMENTS2ESTROOMSSHOULDREMAINUNLOCKED

Q

/UTDOORBUSSHELTERSATTHEINTERCHANGESHOULDBEFULLYACCESSIBLEWITHADEQUATESPACE TOTURNAROUND4HECURRENTSHELTERSAT7ODENHAVEASINGLEENTRYPOINTANDINADEQUATE SPACEWITHINFORAPERSONINAWHEELCHAIRTOTURNAROUND



!#40,!..).'!.$,!.$!54(/2)49


Q

0EOPLE WITH HEARING IMPAIRMENT CANNOT HEAR WHAT IS BEING SAID OVER PUBLIC ADDRESS SYSTEMSATBUSSTATIONSANDREQUIREVISUALINFORMATION

Q

'ETTING INFORMATION AT BUS STATIONS CAN BE DIFFICULT FOR PEOPLE WHO ARE HEARING IMPAIRED BECAUSEOFTHEWAYTHEYARESETUP&OREXAMPLE AT7ODEN CUSTOMERSERVICESTAFFAREATA DIFFERENTLEVELTOCUSTOMERS4HISMAKESLIPREADINGDIFFICULT!HEARINGLOOPCOULDASSIST

Q

0EOPLEWITHAVISUALIMPAIRMENTCANNOTSEEBUSNUMBERSANDIDENTIFYBUSESBYTHETIMESAT WHICHTHEYARRIVE4HEPROPOSEDBUSINTERCHANGEWILLHAVEMULTIPLEBUSESUSINGTHESAME BUSSTOP MAKINGITMOREDIFFICULTTOIDENTIFYBUSES"USESWITHAUDIBLEIDENTIFICATIONOFBUS NUMBERSWOULDALLOWPEOPLEWHOAREVISIONIMPAIREDTODISTINGUISHTHECORRECTBUS

Q

4ACTILESURFACINGSHOULDBEPROVIDEDTHROUGHOUTTHEINTERCHANGEANDLOUNGE#URRENTLY BUSESDONOTALWAYSSTOPWITHTHEBUSDOORPARALLELTOTHETACTILEPAD

Q

4HERESHOULDNOTBEMULTIPLETYPESOFFLOORSURFACESATTHESTATIONTHATCOULDBECONFUSED WITHTACTILESURFACING

Q

#LEARDISPLAYOFBUSSTOPNUMBERSISREQUIRED



"5334!4)/.$%3)'.^2%30/.3%4/$%-/'2!0()# #(!.'%3

3OCIALPLANNINGFORTHE7ODENBUSINTERCHANGESHOULDACCOMMODATECHANGESIN#ANBERRAS DEMOGRAPHICPROFILEFORTHENEXTTOYEARS!LTHOUGHTHECURRENTPROFILEOFPASSENGERS USING 7ODEN BUS INTERCHANGE REFLECTS A YOUNG AGE STRUCTURE DEMOGRAPHIC TRENDS INDICATE SLOWPOPULATIONGROWTHANDINCREASINGNUMBERSOFMIDDLEAGEDANDOLDERPEOPLE#ANBERRAS POPULATIONISPROJECTEDTOGROWBY TO OVERTHENEXTYEARS)NTHATPERIOD THEPOPULATIONAGEDOVERYEARSISPROJECTEDTOGROWBY  WITH OFTHISBEING PEOPLEAGEDYEARSANDOVER 'IVENTHECURRENTPURPOSEOFJOURNEYFORMOSTPASSENGERS THEDEMOGRAPHICIMPLICATIONSFOR FUTUREPLANNINGOFTHE7ODENBUSSTATIONINCLUDE Q

4HEPRIMEWORKINGAGEPOPULATIONOFPEOPLEAGEDTOYEARSISPROJECTEDTOINCREASE BY OVERTHENEXTYEARS OFWHICHWILLBEPEOPLEINTHETOAGEGROUP "Y  THE PROPORTION OF THE #ANBERRA POPULATION IN THE WORKFORCE WILL FALL FROM THE CURRENTTO

Q

4HE NUMBER OF SCHOOL AGED YOUNG PEOPLE AGED BETWEEN  AND  YEARS IS PROJECTED TO DECREASEFROM INTOABOUT IN4HISAGEGROUPREPRESENTED OFTHETOTAL#ANBERRAPOPULATIONINBUTWILLREPRESENTONLYOFTHEPOPULATIONIN 4HEPROPORTIONOFYOUNGPEOPLEAGEDLESSTHANYEARSINTHE#ANBERRAPOPULATION WILL DECREASE FROM  IN  TO  IN  %VEN TWICE CURRENT FERTILITY LEVELS WOULDNOTPREVENTADOUBLINGOFTHEPOPULATIONAGEDYEARSANDOVER



$EMOGRAPHICS!#4*UNE !USTRALIAN#APITAL4ERRITORY0OPULATION0ROJECTIONSnANDBEYOND#HIEF -INISTERS$EPARTMENT!#4'OVERNMENTPAGES    

7/$%.4/7.#%.42%^ MASTERPLAN




(OWEVER #ANBERRA WILL CONTINUE TO HAVE A HIGHER PROPORTION OF YOUNG PEOPLE THAN THE NATIONALAVERAGEBECAUSETHEYAREATTRACTEDTOTERTIARYEDUCATIONINSTITUTIONSANDOFTENSTAY TOWORKINTHEEXPANDINGKNOWLEDGEBASEDLABOURMARKET

Q

4HEPROPORTIONOFPEOPLEWITHADISABILITYISCURRENTLYESTIMATEDTOBEABOUTPERCENTOF THEPOPULATIONNATIONALLY ANDISPROJECTEDTOINCREASETOPERCENTBY4HERATE OFDISABILITYINCREASESWITHAGEFROMPERCENTFORCHILDRENAGEDLESSTHANFIVEYEARSTO PERCENTFORTHOSEAGEDOVERYEARS)TISANTICIPATEDTHATFUTURELEVELSOFDISABILITYINTHE #ANBERRACOMMUNITYWILLBELESSTHANTHENATIONALFIGURE BUTITREMAINSAGUIDE



"5334!4)/.$%3)'.n"53,!9/6%2

4HE PROPOSED BUS STATION SOLUTION MINIMISES SHORT TERM LAYOVER AND ELIMINATES LONG TERM LAYOVERFROMTHECOREOFTHETOWNCENTRE4HISISACHIEVEDBY Q

#ONSTRUCTING A NEW NORTH SOUTH ROAD BETWEEN "OWES AND "RADLEY 3TREETS TO PROVIDE BOTH SHORT TERM BUS LAYOVER UP TO  MINUTES AND PRIVATE VEHICLE ACCESS TO PROPOSED NEW BUILDINGS

Q

4AKEUPLOCALSERVICE@FLOATBYCIRCULATINGLOCALBUSESFROMTHEMAINSTATIONTOANEWSTOP ATTHENORTHERNENDOF"OWES3TREETADJACENTTO0ENRHYN(OUSE4HISEXTENSIONTOLOCAL SERVICESALLOWSBUSESTOLAYOVERFORONEORTWOMINUTESOUTSIDEOFTHEBUSSTATIONPRECINCT ANDTIMETHEIRRETURNTOMEETTHESCHEDULEDDEPARTURETIMEOFTHEIRNEXTSERVICE

Q

2ELOCATELONGERSTAYBUSLAYOVERFROMTHECOREOFTHE4OWN#ENTRETOTHESOUTHERNEND OF 0HILLIP "USINESS $ISTRICT ADJACENT TO THE FORMER BUS DEPOT 4HIS ARRANGEMENT THAT IS ILLUSTRATEDIN&IGURE ALSOSUBSTANTIALLYIMPROVESPUBLICTRANSPORTINTHE-IXED3ERVICES !REAANDPROVIDESANOPPORTUNITYFOROVERNIGHTGARAGINGOFBUSESTOINCREASETHEEFFICIENCY OF7ODENAND7ESTON#REEKLOCALSERVICES

&)'52% "USLAYOVERIN0HILLIP-IXED3ERVICES!REA

BUSES

BUSES

.$2)6

%

&UELLING "USWASH 3ERVICE PITS $RIVER !MENTITIES

&UTURE #OMMERCIAL "UILDING 0UBLIC PARKING

0OSSIBLEBUS DEPOTBOUNDARY

0UBLIC PARKING



!#40,!..).'!.$,!.$!54(/2)49

0!22!-!44!342%%4

!4(,, /




4!8)3

2ELOCATETHEMAINTAXIRANKTOBETTERSERVICECUSTOMERSUSINGTHENEWPUBLICTRANSPORT STATION Q

2ELOCATETHEMAINTAXIRANKTOTHEWESTERNKERBOFTHENORTHERNSECTIONOF"RADLEY3TREET 4HEBENEFITSOFTHISLOCATIONARE ^ #APACITYISPROVIDEDFORCABSTHATALLHAVELINEOFSIGHTTOTHEHEADOFTHEQUEUE ^ 4HEARRANGEMENTPROVIDESALAYOVEROPPORTUNITYFORTAXIDRIVERSWITHTOILETSANDEATING FACILITIESLOCATEDINTHE0LAZA ^ #INEMAPATRONSAREBETTERSERVED ^ 3URVEILLANCE FROM THE RANK OVER THE NORTHERN END OF "RADLEY 3TREET AND ACROSS THE REDESIGNED BUS STATION GENERATES ACTIVITY AND IMPROVED SECURITY IN THE LINK FROM THE CINEMASTOPUBLICTRANSPORT ^ /THERPROPOSEDIMPROVEMENTSWITHINANDAROUNDTHENORTHEASTERNCORNEROFTHE0LAZA WILLMAKETHENEWRANKMOREACCESSIBLETOBOTHSIDESOFTHE0LAZA

Q

2ETAIN THE #ORINNA 3TREET SECONDARY RANK SOUTH OF "REWER 3TREET THAT SERVES THE PLAZA EXTREMELYWELL#ONSIDERHOWTHERANKCANBEEXTENDEDTOMORECONVENIENTLYSERVETHE COMMUNITYCENTREANDSENIORCITIZENCENTRE



).4%2 4/7.05",)#42!.30/24/00/245.)4)%3

4HE OPTION FOR A FUTURE PUBLIC TRANSPORT ROUTE THAT COULD BE LIGHT RAIL MODIFIED BUS VEHICLES AND FACILITIES OR SOME OTHER FORM WILL BE PRESERVED WITHIN THE #ALLAM 3TREET !THLLON$RIVE9ARRALUMLA#REEKRESERVATIONANDPROVIDEUNIMPEDEDPEDESTRIANACCESSTO THEEXISTINGORFUTUREBUSSTATION Q

,IGHT RAIL TYPICALLY REQUIRES A CORRIDOR WIDTH OF ABOUT EIGHT METRES FOR A DOUBLE TRACK INCREASINGATSTOPSANDWHEREPROVISIONFORINTERCHANGEISBEINGMADE4HISCORRIDORCAN BEINCORPORATEDINTHEEXISTINGMROADRESERVATIONOF#ALLAM3TREET

Q

#ONTINUITY OF THE ROUTE ALONG THE !THLLON $RIVE CORRIDOR TO THE SOUTH AND ALONG THE 9ARRALUMLA#REEKCORRIDORTOTHENORTHISPRESERVED

Q

!RANGEOFTRAVELMODESNEEDTOBEACCOMMODATEDWITHINTHECONCEPTOFTHEINTER TOWN TRANSPORTROUTE4HEFOLLOWINGSPATIALHIERARCHYISLIKELYTOBEAPPLIED ^ &IXEDROUTEFEEDERBUSES ^ /THERFIXEDROUTEBUSES ^ 4AXIANDFLEXIBLEROUTEPRIVATEBUSDROPOFF ^ 0RIVATEVEHICLEDROPOFF ^ "ICYCLEPARKING ^ 7ALKING ^ 0RIVATEVEHICLEPARKING

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%@'IVINGSOMETHINGTOTHESTREET 5PGRADINGREPLACINGEXISTINGBUILDINGSWITHINTHEEXISTINGCAMPUSSTYLEOFFICESTRUCTUREPRESENTS OPPORTUNITIESFORMORESTREETACTIVITYWITHINSMALLERSCALEOFFICEBUILDINGS(IGHERGRADEOFFICE ACCOMMODATIONCANSTILLBEACHIEVED

&)'52%-ONOLITHICSINGLEUSEBUILDING !SINGLE MOFFICEBUILDINGMAYSUITTHENEEDSOFAMAJORTENANTBUTWOULDRESULTINAMAJOR RESTRUCTURINGOFTHECOMMERCIALCORE!CHIEVINGAFINEGRAINEDATTRACTIVESTREETALSONEEDSMORE HAPPENINGATSTREETLEVELINORDERTOEXTENDTIMESOFACTIVITY



!#40,!..).'!.$,!.$!54(/2)49


 /FFICEACCOMMODATION 0ROVIDESITESFORNEWOFFICESANDPERMITREDEVELOPMENTOFEXISTINGBUILDINGSTOACHIEVE THENEEDSOFMAJORGOVERNMENTTENANTS Q

!CKNOWLEDGETHREEPENDINGPROPOSALSFORABOUT MOFFICESPACECOMPRISING ^ 'UARDIAN(OUSEREDEVELOPMENT ^ 2EFURBISHMENTANDEXTENSIONOF3CARBOROUGH(OUSE ^ /FFICEBLOCKONTHEOLD$!3GARAGEONTHECORNEROF&URZERAND7ORGAN3TREETS

Q

7HEREPOSSIBLEENCOURAGETHEREFURBISHMENTREPLACEMENTOFEXISTING'RADE#OFFICESPACE TO'RADE!AND"STANDARDWITHINTHEEXISTINGOFFICECAMPUSSTRUCTURE

Q

!VOID DISPERSING THE OFFICE CORE AND DIMINISHING THE EFFECTIVENESS OF COLOCATION WITH EXISTINGANDPROPOSEDPUBLICTRANSPORTOPTIONS

Q

)NCLUDEAMIXOFRETAILANDENTERTAINMENTACTIVITIESATGROUNDLEVELTOCREATETHEATTRACTIVE STREETSETTINGTHATISAPREREQUISITEFOR'RADE!OFFICESPACE

Q

)MPLEMENTOPPORTUNITIESFORDEDICATEDUNDERCOVERPARKINGBOTHONANDOFFSITETOSATISFY THENEEDSOFMAJORTENANTS

Q

)DENTIFY OFFICE REFURBISHMENT AND ROLLING OFFICE REPLACEMENTS THAT INCLUDE BUT ARE NOT LIMITEDTO ^ "ONNER(OUSE ^ *ULIANNA(OUSE ^ 3IRIUS"UILDING ^ !LEXANDERAND!LBERMARLE"UILDINGS ^ "OWES3TREET3IR+EITH#AMPBELL"UILDING ^ 3CARBOROUGH(OUSE

Q

!CHIEVE DEVELOPMENT OPPORTUNITIES AROUND THE EXISTING BUS INTERCHANGE AND REDUNDANT 0OLICE3TATION

Q

2ECOGNISETHEEFFICIENCIESTHATOCCURFORLARGEANCHORTENANTSSUCHASTHE$EPARTMENTOF (EALTHAND!GED#AREINHAVINGACENTRALRECEPTIONAREATHATSERVESTHEWHOLEDEPARTMENT RATHERTHANREPLICATINGRECEPTIONSERVICESATANUMBEROFBUILDINGS4HISMAYBEACHIEVABLE WITHINTHEEXISTINGCAMPUSSTRUCTUREBYBETTERLINKINGSEPARATEBUILDINGS

Q

#ONSIDERTHERELEASEOF"LOCK3ECTIONSURFACECARPARKBOUNDEDBY"OWES -ATILDA AND#ALLAM3TREETS FORASUBSTANTIALNEWOFFICEDEVELOPMENTONLYIFOFFICEACCOMMODATION NEEDSCANNOTBEMETTHROUGHOTHEROPTIONSDESCRIBEDABOVE

Q

%NCOURAGEADAPTATIONOFEXISTINGOFFICESTORESIDENTIALIFLONGTERMVACANCYOFOLDERSTYLE OFFICESBECOMESACONCERN

7/$%.4/7.#%.42%^ MASTERPLAN




 %XPANSIONOFRETAILING 7ODENS POSITION IN THE RETAIL HIERARCHY WILL BE SUPPORTED TO PROVIDE APPROPRIATE OPPORTUNITIES FOR RETAIL EXPANSION IN BOTH THE CORE AND THE -IXED 3ERVICES !REA 4HE SCALEOFRETAILDEVELOPMENTWILLBEBALANCEDTOENHANCETHEAREAASAWHOLEANDNOTTRAP EXPENDITUREINSIDETHE0LAZA Q

#REATEASIGNIFICANTNEWENTRANCEONTHENORTHEASTERNSIDEOFTHE0LAZATOGENERATEACTIVITY INTHISPARTOF"RADLEY3TREET3HOPSANDCAFESTOADDRESSTHESTREETANDCONNECTTHE4OWN 3QUARETOTHELOWERLEVELOF"RADLEY3TREET

Q

)NCLUDERETAILOPPORTUNITIESINMIXEDUSEDEVELOPMENTSINANDAROUNDTHECORE4HIS0LAN ASSUMES A TOTAL LENGTH OF SHOP FRONT OF M WITH AN AVERAGE RETAIL DEPTH OF M 4HIS PROVIDES  M RETAIL SPACE OUTSIDE THE 0LAZA TO HELP ADD ENERGY AND INTEREST TO THE STREETS

Q

6ARYTHE4ERRITORY0LANINACCORDANCEWITH&IGURETOFACILITATERETAILACTIVITYOUTSIDETHE 0LAZA PARTICULARLYATGROUNDFLOORLEVELWITHCOMMERCIALANDRESIDENTIALACTIVITYABOVE

Q

0ROMOTETHE-IXED3ERVICES!REAASARETAILPRECINCTINCLUDINGBULKYGOODSANDSECONDARY RETAILCLUSTERS

Q

!LLOWAPPROXIMATELY MRETAILINGTOINTEGRATEWITHTHEPROPOSEDNEWBUSSTATION

&)'52%

.EWCONNECTIONSTOTHE0LAZAAND4OWN3QUARE

)NDICATIVEEXPANSIONOFRETAILINGONTHE0LAZAgSNORTHEASTERNCORNERCANBETTERINTEGRATEPEDESTRAIN CONNECTIONSBETWEEN"RADLEY3TREETANDTHEELEVATED4OWN3QUARE



!#40,!..).'!.$,!.$!54(/2)49


&)'52%

0ROPOSEDEXTENSIONOFTHERETAILCORE0RECINCTgAg TO ENCOURAGEMIXEDUSEDEVELOPMENTOUTSIDETHE0LAZA

%8)34).'4%22)4/290,!.-!0

02/0/3%$,!.$53%-!0

,%'%.$ A2ETAILCORE

B"USINESSAREA

C-IXEDSERVICES

D#ARPARKING

7/$%.4/7.#%.42%^ MASTERPLAN




 #ARPARKING 0ROVIDEALEVELOFPARKINGTHATMAINTAINS7ODENSCOMMERCIALANDSOCIALCHARACTERWHILST RESPONDING TO MODAL CHANGES AND THE DESIRE TO BETTER INTEGRATE PARKING WITH THE BUILT ENVIRONMENT

 0!2+).'$%-!.$ 2%4!),$%6%,/0-%.43 4YPICALLYRETAILPARKINGDEMANDISINTHEORDEROFFOURTOSIXPARKINGSPACESPERMOFFLOOR AREA'IVENTHAT7ODENISWELLSERVICEDBYPUBLICTRANSPORTARATEOFFOURPARKINGSPACESPER MISAPPROPRIATE 3URVEYSINDICATETHATDURINGPEAKRETAILPERIODS SHORT STAYPARKINGISCLOSETOCAPACITYANDANY RETAILEXPANSIONWILLREQUIREBOTHTHEREPLACEMENTOFANYDISPLACEDPARKINGTHATMIGHTRESULT FROMDEVELOPMENTSWITHINEXISTINGCARPARKSPLUSADDITIONALSPACESATTHEMINIMUMRATEOFFOUR PERMOFNEWRETAILFLOORSPACE 4ABLEINDICATESTHENUMBEROFPARKINGSPACESREQUIREDASARESULTOFTHEPROPOSEDRETAIL EXPANSION

4!",%3PACESREQUIREDFORFUTURERETAILEXPANSION ,OCATION

%XISTING &LOOR!REAM 0ARKING3PACES TOBE2EPLACED

3TREET&RONTAGE

0ARKING 2ATE

4OTAL3PACES 2EQUIRED



 





 





0LAZA

#/--%2#)!,/&&)#%$%6%,/0-%.43 !DDITIONALOFFICEDEVELOPMENTWILLPROVIDEPARKINGATARATEOFONESPACEPERMFORTHE INNERCOREANDSPACESINTHEOUTERCORE .EW OFFICE DEVELOPMENTS WILL PROVIDE PARKING IN BASEMENTS AND IN ADJOINING STRUCTURES DEVELOPEDJOINTLYWITHOTHERSTAKEHOLDERS

2%3)$%.4)!,$%6%,/0-%.43 2ESIDENTIALDEVELOPMENTWILLPROVIDE FOR RESIDENT AND SOME VISITOR PARKING ON SITE /VERFLOW VISITORANDRESIDENTPARKINGCANBEMETONTHESTREET



!#40,!..).'!.$,!.$!54(/2)49


 !342!4%')#!002/!#(4/0!2+).'02/6)3)/.!.$ -!.!'%-%.4 !STRATEGICAPPROACHTOPARKINGHAS Q

)DENTIFIEDLOCATIONSFORSTRUCTUREDANDUNDERGROUNDPARKINGASSHOWNIN&IGURE

Q

0ROVIDEDAFINANCINGFRAMEWORKFORFUTUREPROVISIONOFSTRUCTUREDPARKINGTHATCANCAPTURE CONTRIBUTIONS FROM PRIVATE SECTOR DEVELOPMENTS THROUGH MAXIMISING CHANGE OF USE CHARGES

Q

-AXIMISEDPARKINGEFFICIENCYBY ^ 3HARINGPARKINGWITHDIFFERENTUSESTHATREQUIREPARKINGATDIFFERENTTIMESOFDAY ^ %FFECTIVEUSEOFEXISTINGPAVEMENTFORONSTREETPARKINGWHERETHISISAPPROPRIATE ^ 0ROMOTING THE EFFICIENCIES OF SHARED PUBLIC PARKING THAT CAN BE UTILISED FOR A LONGER TIME FRAME BOTH DURING THE WEEK AND ON WEEKENDS AND CAN ENCOURAGE PRACTICES SUCH AS @4HREE FOR &REE AND @0ARK AND 2IDE

Q

2EINFORCE THAT PUBLIC PARKING IS FOR GENERAL PUBLIC USE AND THAT IT CANNOT BE SPECIFICALLY ALLOCATED TO MEET VISITOR AND RESIDENT PARKING NEEDS



30%#)&)#0!2+).'02/0/3!,3

/PPORTUNITIESTOOPTIMISEPARKINGIN7ODENINCLUDE Q

!LLOWING DEVELOPMENTS THAT GENERATE MORE MIXED USE THUS CREATING GREATER SHARING OF PARKINGSPACESBETWEENTHEDIFFERENTUSES

Q

0ROVIDINGFUTURECARPARKINGATGRADEORINSTRUCTURES

Q

7RAPPING STRUCTURED PARKING BY OTHER USES INCLUDING RETAIL COMMERCIAL OR RESIDENTIAL 4HESEUSESPROVIDEANACTIVEBUILDINGFRONTAGETOTHESTREETRATHERTHANABLANKWALL

Q

%STABLISHINGADDITIONALLONGSTAYPARKINGINTHESOUTHERNPARTOF0HILLIP"USINESS$ISTRICT ON"LOCK3ECTION"ELLONA#OURT

Q

!LLOCATINGSPACESATTHESOUTHERNENDOF-ELROSE$RIVECARPARKTOSHORTSTAYPARKING )NTHELONGERTERM POSSIBLYASSOCIATEDWITHAMAJORREFURBISHMENTOFTHELIBRARY RELOCATE THESOUTHERNENDOF&URZER3TREETAWAYFROMTHELIBRARYTOCREATEADEDICATEDSHORTSTAY CARPARKTOSERVICETHECOMMUNITYFACILITIESPRECINCT ANDREMOVETHENEEDFORPEOPLETO CROSSTHEROADTOVISITTHE,IBRARYAND(EALTH#ENTRE

&IGURE  SHOWS LOCATIONS WHERE FUTURE STRUCTURED CAR PARKING COULD BE PROVIDED &ACTORS CONSIDEREDWHENLOCATINGSTRUCTUREDCARPARKSINCLUDE Q

0ROXIMITYTOLANDUSE

Q

)NTERNALROADCAPACITY

Q

!CCESSTOARTERIALROADNETWORK 7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%&UTURESITESFORSTRUCTUREDCARPARKING

,A UN CE STO N $ RIV E

#ALLAM $RIVE

$RI ROSE -EL VE (INDMARSH$RIVE

0OSSIBLE&UTURE3TRUCTURED#ARPARKS



!#40,!..).'!.$,!.$!54(/2)49


 -%,2/3%$2)6% 0ARALLELPARKINGANDCYCLELANESALONGBOTHSIDESOF-ELROSE$RIVEAREPOSSIBLESUBJECTTOA REDUCTIONINTHESPEEDLIMITFROMTOKPHANDAREORIENTATIONTOACTIVITYTOADDRESSTHE ROAD4HISDOESNTREDUCEROADWAYCAPACITYTOANYSIGNIFICANTEXTENTBECAUSETHEINTERSECTIONS CONTROL CAPACITY (OWEVER IT PROVIDES IMPORTANT PARKING FOR THE COMMUNITY FACILITIES AREA &URTHER THEPEDESTRIANCONNECTIONCANBECOMEACTIVATEDANDCONSEQUENTLYSAFER!BOUT ADDITIONALPUBLICPARKINGSPACESCANBECREATEDIN-ELROSE$RIVETHROUGHTHISSTRATEGY &)'52%-ELROSE$RIVEPARALLELPARKINGANDCYCLELANES

2EMODELLEFTTURN SLIPLANE

0ROVIDEPARALLELPARKING ANDBIKELANE

2EMODELLEFTTURN SLIPLANE

0ROVIDEPARALLELPARKING ANDBIKELANE

!DDITIONALCARPARKING

7/$%.4/7.#%.42%^ MASTERPLAN




 ,!5.#%34/.342%%4 +ERBSIDEPARKINGISPOSSIBLEFOR,AUNCESTON3TREETASILLUSTRATEDIN&IGURE4HEADDITIONOF ON STREETPARKINGIN,AUNCESTON3TREETPROVIDESANADDITIONALPARKINGSPACES &)'52%,AUNCESTON3TREETPARALLELPARKINGANDPEDESTRIANCROSSINGPOINTS



2%0,!#%-%.40!2+).'!33/#)!4%$7)4(&5452% (%,,%.)##,5"$%6%,/0-%.4

4HE(ELLENIC#LUBISREQUIREDTOPROVIDEREPLACEMENTPARKINGASPARTOFFUTUREDEVELOPMENTON THE(ELLENIC#LUBSITE4HISPARKINGWOULDIDEALLYBELOCATEDINASTRUCTURETHATCANBECOMEAN INTRA BLOCKELEMENTOFAFUTUREPERIMETERBLOCKDEVELOPMENT!NOUTWARDFACINGCOMMERCIAL OFFICEANDORRESIDENTIALDEVELOPMENTONTHEBLOCKBOUNDEDBY-ATILDA3TREET #ALLAM3TREET AND"OWES3TREETISPROPOSED



!#40,!..).'!.$,!.$!54(/2)49


 &52:%2342%%4 )N ORDER TO BETTER MEET THE NEEDS OF OFFICE WORKERS COMMUNITY PRECINCT SPORTING PRECINCT AND OVERFLOW RETAIL DEMAND A COMBINED PUBLIC CAR PARK OFFICE DEVELOPMENT AND MIXED USECOMMERCIALFRONTAGETO&URZER3TREETASILLUSTRATEDIN&IGUREISPROPOSEDFORBLOCK SECTION .EWCOMMERCIALBUILDINGSWILLPROVIDEDONSITEPARKINGATARATEOFONESPACEPER M WITH ADDITIONAL DEMAND SATISFIED IN A CENTRAL STRUCTURE THAT WILL ACCOMMODATE UP TO CARSINTHREESUSPENDEDDECKS

&)'52%)NTEGRATEDMIXEDUSEANDPUBLICCARPARKDEVELOPMENT

7/$%.4/7.#%.42%^ MASTERPLAN




 0ROVIDINGFORPEDESTRIANS 4HEREISAGROWINGWORLDWIDEMOVEMENTAIMEDATIMPROVINGTHEENVIRONMENTFORPEDESTRIANS SO THAT MORE JOURNEYS CAN BE SAFELY AND ENJOYABLY TAKEN ON FOOT 7ALKING IS THE GLUE THAT BINDSTHEURBANFABRICTOGETHER!LMOSTEVERYONEWALKS0EOPLEWITHDISABILITIESANDWALKING LIMITATIONSREQUIRETHESAMEFACILITIESASPEDESTRIANSnGOODFOOTPATHS GOODACCESSTOPUBLIC TRANSPORTANDURBANSPACES EASYACCESSTOBUILDINGSANDACTIVITYCENTRESETC 4HEFOLLOWINGPRINCIPLESTHATHAVEBEENTAKENFROM4OLLEYAPPLYTOTHECONSIDERATIONOF ALLDEVELOPMENTPROPOSALSFOR7ODEN4OWN#ENTRE  0ERSONAL SAFETY #RIME n OR THE PERCEPTION OF CRIME IS A MAJOR DETERRENT TO WALKING ESPECIALLYFORWOMENANDOLDERPEOPLE4HECOMMUNITYSAFETYAUDITCARRIEDOUTASPARTOF THE-ASTER0LANPROCESSSHOULDBEUSEDTOMAKEPLACESSAFERFORALLUSERS  2OADSAFETY2ATHERTHANRESTRICTTHEMOVEMENTOFPEDESTRIANSA@ROADDANGERREDUCTION APPROACHISPROMOTED WHICHSEEKSTOPROVIDEASAFERENVIRONMENTFORALLUSERS  (EALTHISSUES)NCREASINGOBESITYANDRELATEDHEALTHPROBLEMSCALLFORURBANENVIRONMENTS THATENCOURAGEACTIVITY4HE!USTRALIAN(EART&OUNDATION3%0!3USTAINABLE%NVIRONMENTS FOR0HYSICAL!CTIVITY 'UIDELINESAREREFERENCEDASAMODEL  3OCIALEXCLUSION4HISOCCURSWHENACCESSPROBLEMSAREBUILTINTOOURURBANDESIGN4HE SOLUTIONINVOLVESAMIXOFLANDUSEPLANNINGANDCAPACITYFORPEOPLETOACCESSWHATTHEY NEED PREFERABLYATLOWCOST INSAFEENVIRONMENTSANDONFOOT  7ALKINGADDSVALUETOOURENVIRONMENT0LACESTHATPROVIDEGOODWALKINGENVIRONMENTS ARE ATTRACTIVE TO PEOPLE AND IMPROVEMENTS TO WALKING CAN POSITIVELY IMPACT ON PROPERTY VALUES LIVEABILITY THEENVIRONMENTANDEFFICIENTLANDUSEPATTERNS  7ALKINGANDTHEPUBLICTRANSPORTSYSTEM!LLPUBLICTRANSPORTJOURNEYSBEGINANDENDWITH AWALKTRIP SOMEARESHORTANDSOMEARELONG4HELOCATIONOFSTOPS THEQUALITYOFWAITING SPACESANDSAFETYOFPASSENGERSATTHEIRSTOPSAREIMPORTANT0UBLICTRANSPORTSERVICESRELY ONASUPPORTIVEWALKINGENVIRONMENT  7ALKINGTOWORK4HEEXTENTOFWALKINGTOWORKCANBEINCREASEDTHROUGHCAMPAIGNSSUCH AS@WALKINTOWORKOUTAND4RAVEL3-!24  $ESIGN FOR DISABILITY /VER  OF THE POPULATION HAS SOME FORM OF DISABILITY AND GOOD DESIGN THAT ASSISTS PEDESTRIANS CAN GO A LONG WAY TO SATISFYING THE NEEDS OF THOSE WITH DISABILITIES7HENSPECIALNEEDSAREMET SUCHASPROVIDINGFORTHEVISUALLYIMPAIRED THE GENERALPOPULATIONBENEFITSASWELL  %NGINEERINGSTANDARDS2EMEMBERTHE#SCHECKLISTTOESTABLISHTHATWALKINGROUTESARE CONNECTED COMFORTABLE CONVENIENT CONVIVIALANDCONSPICUOUS



!#40,!..).'!.$,!.$!54(/2)49


 #YCLENETWORKS $EVELOPWELL LITANDSIGNPOSTEDCYCLEROUTESTOCATERFORBOTHCOMMUTERANDRECREATIONAL CYCLISTS /. 342%%4#9#,).',!.%3 3TREETDESIGNANDLANEALLOCATIONPROPOSALSADDON STREETCYCLINGLANESTO-ELROSE$RIVEAND ,AUNCESTON 3TREET ! MAJOR CAPITAL WORKS PROJECT WAS INCLUDED IN  TO DESIGN AND CONSTRUCTANON ROADCYCLEROUTEFROM$OWNERTO7ODEN ,).+).'-%,2/3%$2)6%0!2+).'4/#/--5.)49&!#),)4)%3 ! LIT FOOTPATH IS PROPOSED BETWEEN 7ODEN #OMMUNITY 3ERVICES TO THE SOUTH AND THE ')/ BUILDINGTOTHENORTH TOENABLEPEOPLETOPARKON-ELROSE$RIVEANDHAVESAFEANDCONVENIENT ACCESSTOTHECOMMUNITYSERVICESONBOTHSIDESOF#ORINNA3TREET #/..%#4)/.3!#2/33-%,2/3%$2)6% !DDITIONALTRAFFICSIGNALSATTHEINTERSECTIONOF#ORINNA3TREETWILLENHANCEPEDESTRIANCROSSING OPPORTUNITIES2EDUCEDSPEEDLIMITFROMTOKPHANDPARALLELPARKINGALONGTHEKERBSTO REDUCETHEWALKINGDISTANCETOTHEMEDIANWILLGIVEMID BLOCKCROSSINGOPPORTUNITIESFORTHOSE WHOMUSTDOSO #/..%#4)/.3!#2/339!22!,5-,!#2%%+ 4HEEXTENSIONOF.EPTUNE3TREETTOTHEEASTTOLINKNEWRESIDENTIALDEVELOPMENTWITHTHETOWN WILLPROVIDEAWELL LITPEDESTRIAN CYCLEANDVEHICLECORRIDOR4HISACTIVEANDMULTI USECORRIDOR SHOULDOVERCOMEMANYOFTHESAFETYCONCERNSTHATCURRENTLYINHIBITPEOPLESUSEOFTHEEASTERN PARKLANDSANDPEDESTRIANLINKAGESTO#ANBERRA(OSPITAL #)4AND7ODEN%ASTHOUSING4HE NEW ROAD WILL ALSO INTERSECT THE EXISTING .ORTH3OUTH CYCLEPATH AND APPROPRIATE PEDESTRIAN PRIORITYNEEDSTOBEPROVIDED ).4%'2!4%$42!),3934%-7)4()..%7(/53).'!2%!3 0ROVIDESLOWSPEEDROADSTHATAREATTRACTIVEFORCYCLISTSANDPEDESTRIANS)NCLUDESHADETREES ANDFOOTPATHSINTHEVERGES #/2)..!342%%44/"/4!.9342%%4 #REATE AN ACTIVE AND WELL LIT CONNECTION BETWEEN THE 3OUTHERN #ROSS #LUB AND PROPOSED DEVELOPMENTTOENHANCEPEDESTRIANANDCYCLECONNECTIONSBETWEENTHERETAILAREAANDTHE 0HILLIP"USINESS$ISTRICT -!73/.!.$37).'%2(),,#/..%#4)/.34/0(),,)0"53).%33$)342)#4 0ROVIDE CONNECTIONS ACROSS 9ARRALUMLA #REEK TO ENCOURAGE PEDESTRIAN AND CYCLE ACCESS BETWEEN0OWER3TREETANDTHEEXTENSIONOF0ARRAMATTA3TREETTO!THLLON$RIVE

7/$%.4/7.#%.42%^ MASTERPLAN




)-02/6%!##%33"%47%%.4(%"53).4%2#(!.'%!.$4(%4/7.315!2% )MPROVE STAIRS AND RAMPS AND INVESTIGATE MECHANICAL TRAVELATORS TO TAKE UP THE M LEVEL DIFFERENCE BETWEEN THE PAVEMENT OF "RADLEY 3TREET AND THE LEVEL OF THE 4OWN 3QUARE AND REDUCETHEAPPARENTDISTANCEBETWEENTHEWESTERNANDEASTERNSIDESOFTHE0LAZA

-/6%-%.4!#2/334(%./24(%2.0!24/&#/2)..!342%%4 #ONSIDER RAISED PEDESTRIAN CROSSINGS TO IMPROVE PEDESTRIAN ACCESSIBILITY BETWEEN THE COMMUNITYFACILITIESONBOTHSIDESOF#ORINNA3TREET

&)'52%)MPROVEDONROADCYCLINGANDPEDESTRIANROADCROSSINGS

4RUNK#YCLE2OUTE



0RIMARY0EDESTRIAN#YCLE2OUTE

:EBRA#ROSSING

3ECONDARY0EDESTRIAN2OUTE

3IGNALISED#ROSSING

!#40,!..).'!.$,!.$!54(/2)49


 !CCESSTOCOMMUNITYFACILITIES 4HE PROVISION OF COMMUNITY FACILITIES GOES BEYOND THE CONSTRUCTION OF FACILITIES )T ENCOMPASSES THE ELEMENTS REQUIRED TO BUILD STRONGER SOCIAL NETWORKS INTERACTION AND CULTURALDEVELOPMENT Q

)MPROVE PUBLIC TRANSPORT TO THE EXISTING COMMUNITY FACILITIES PRECINCT ON THE WESTERN SIDEOFTHECOREBYINCREASINGTHEBUSSERVICESONTHEWESTERNSIDEANDBYIMPROVINGTHE PEDESTRIANCONNECTIONTOTHEPROPOSEDINTERCHANGE

Q

3UPPORTADJACENTPRIVATESECTORHEALTHSERVICESALONGTHEWESTERNSIDEOF#ORINNA3TREET WITHCONVENIENTPARKINGANDGOODACCESSIBILITY

Q

)MPROVETHESUPPLYOFSHORTSTAYPARKINGINTHEVICINITYOFTHECOMMUNITYFACILITIESBY ^ )NTHEIMMEDIATEFUTURE ALLOCATESPACESATTHESOUTHERNENDOFTHE-ELROSECARPARK FORSHORTSTAYPARKING ^ )NTHELONGERTERM POSSIBLYASSOCIATEDWITHAMAJORREFURBISHMENTOFTHELIBRARYORNEW OFFICEDEVELOPMENT RELOCATETHESOUTHERNENDOF&URZER3TREETAWAYFROMTHELIBRARY TOCREATEADEDICATEDSHORTSTAYCARPARKPRIMARILYFORUSEBYLIBRARYANDHEALTHCENTRE VISITORS

Q

0ROVIDESAFERPEDESTRIANCONNECTIONSBETWEENBOTHSIDESOF#ORINNA3TREETINCORPORATING CONSTRICTIONS IN THE CARRIAGEWAYS RAISED CROSSING POINTS AND POSSIBLY A PEDESTRIAN CANOPY

Q

#REATE OPPORTUNITIES TO PROVIDE MORE MEETING AND FUNCTION SPACE THAT IS AFFORDABLE TO COMMUNITYGROUPS

Q

)DENTIFYOPPORTUNITIESFORAFUTURECOMMUNITYARTSCENTRE

Q

0ROVIDE A BETTER SENSE OF ADDRESS AND OPPORTUNITIES FOR EXPANDING 7ODEN #OMMUNITY 3ERVICESANDTHE3ENIOR#ITIZENS#LUB

Q

)DENTIFYSITESFORPOSSIBLEEXPANSIONOFCOMMUNITYFACILITIESTHATINCLUDE ^ $EVELOPMENTSITESADJACENTTOAMODIFIEDBUSINTERCHANGE ^ %ASTERNEDGEOF!RABANOO0ARKWITHFRONTAGETO%ASTY3TREET

7/$%.4/7.#%.42%^ MASTERPLAN




&)'52%"ETTERPEDESTRIANCONNECTIONSFORCOMMUNITYFACILITIES "OTHSIDESOF#ORINNA3TREETCANBEBETTERCONNECTEDFORPEDESTRIANS POSSIBLYWITHACANOPYTHAT EXTENDSTHEPEDESTRIANTRANSEPTTOTHEWEST

&)'52%)MPROVEDPARKINGFORCOMMUNITYFACILITIES

2EALIGN&URZER3TREET

%XISTING&URZER 3TREETALONGTHE NORTHERNEDGE OFTHE,IBRARY HELPSISOLATE THECOMMUNITY FROMCONVENIENT PARKING

 !#40,!..).'!.$,!.$!54(/2)49

3HORTSTAY PARKINGAREAWITH MORECONVENIENT PEDESTRIANACCESSTO COMMUNITYFACILITIES


 .EWRESIDENTIALDEVELOPMENT 4OWNCENTRELIVINGSHALLOFFERARANGEOFHOUSINGTYPESSUITABLEFORFAMILIES RETIREESAND YOUNGPEOPLE Q

4RUETOWNCENTRELIVINGMEANSHOUSINGPEOPLEINTHECOREOFBOTHTHE4OWN#ENTREAND THE -IXED 3ERVICES !REA 4HIS SHOULD BE ENCOURAGED THROUGH THE ADAPTIVE REUSE OR REDEVELOPMENTOFEXISTINGCOMMERCIALSITESIFVACANCIESINTHEOFFICESECTORINCREASE

Q

4HECORNERSITECREATEDBYTHEREALIGNMENTOF#ALLAM3TREETOFFERSVIEWSTOTHENORTHAND PROVIDESAGOODMIXED USEAPARTMENTLIVINGOPPORTUNITY

Q

4HEEXTENSIONOF.EPTUNE3TREETTOTHEEASTACROSS9ARRALUMLA#REEKOPENSUPANEDGE STREETFORAPARTMENTLIVING'ROUNDFLOORAPARTMENTSSHOULDINCLUDEPRIVATECOURTYARDSTHAT MAYSUITSOMESECTIONSOFTHEMARKET

Q

! MINIMUM  OF DWELLINGS SHOULD ACHIEVE REQUIREMENTS FOR ADAPTABLE HOUSING AND INCLUDEOPPORTUNITIESFORHOMEOFFICES4HEPERCENTAGEOFADAPTABLEHOUSINGANDTHELEVEL OFADAPTABILITYISLIKELYTOINCREASEWITHTIME

Q

)NCLUDEMIXED USEDEVELOPMENTSTHATENHANCEACTIVITYATSTREETLEVEL

Q

)NCLUDEMIXED USEDEVELOPMENTINTHE-IXED3ERVICES!REAWHEREINSOMERESIDENTIALWILL BEPERMITTEDATFIRSTFLOORLEVELSANDABOVESUBJECTTOAPPROVED3ECTION-ASTER0LANS

Q

2ESIDENTIALDESIGNNEEDSTOACCOMMODATEARANGEOFHOUSINGTYPESINCLUDINGGROUNDFLOOR COURTYARDDWELLINGSANDONE TWOANDTHREEBEDROOMAPARTMENTS

Q

,OWERSCALEATTACHEDANDSEMI ATTACHEDTOWNHOUSESSHOULDBEINCORPORATEDWITHAPARTMENTS ASHOUSINGDEVELOPMENTMOVESFURTHEREASTTOWARDSEXISTINGHOUSINGIN0HILLIP

Q

!FFORDABLEHOUSINGSHALLBEPROVIDEDINLINEWITHGOVERNMENTPOLICIESAPPLYINGATTHETIME )NITIATIVESCURRENTLYINCLUDE ^ !SSISTINIMPROVINGAFFORDABILITYWITHINITIATIVESTARGETEDTODEVELOPINGANDEXPANDING SOCIALHOUSING ^ %NCOURAGEFINANCIALDEVELOPMENTPARTNERSHIPSWITHTHEPRIVATESECTOR ^ 0ROMOTE EXPANSION OF PRIVATE RENTAL HOUSING TARGETED FOR LOW INCOME PEOPLE AND FAMILIES ^ 3UPPORTHOMEOWNERSHIP ^ )NCREASECOMMUNITYANDINDUSTRYAWARENESS

&)'52%%ASTERNRESIDENTIALPRECINCT !NEDGESTREETTO9ARRALUMLA#REEKANDASTRONGROADNETWORKESTABLISHESTHERESIDENTIALPATTERNON THEEASTERNSIDEOF#ALLAM3TREET




&)'52% 2ESIDENTIALMIXEDUSEHOUSINGMODELS

3(/04/0!0!24-%.4 0(),,)0-)8%$ 3%26)#%3!2%! /PPORTUNITIES EXIST WITHIN THE 0HILLIP -IXED 3ERVICES !REA FOR RESIDENTIAL APARTMENTS OR SHOP TOPHOUSINGABOVERETAILORCOMMERCIAL USES PARTICULARLYUPTOTHREESTOREYSAROUND THE COURTS AND ALONG 4OWNSHEND 3TREET $EMANDISUNKNOWNATTHISTIMEBUTBUILDING FORMSSHOULDCONTAINSUFFICIENTFLEXIBILITYFOR LATER CHANGE OF USE AS THE AREA MATURES )T IS IMPORTANT THAT BUILDINGS ARE BROKEN INTO MODULES OF  M IN ORDER TO CREATE A VERTICAL RHYTHM OF FACADES AND AVOID LONG UNBROKENFRONTAGES-INIMUMGROUNDLEVEL COMMERCIAL FLOOR CEILING HEIGHT SHALL BE M

'!2$%.!0!24-%.4 9!22!,5-,!#2%%+ 4HREETOEIGHTSTOREYGARDENAPARTMENTSALONG 9ARRALUMLA #REEK WILL PROVIDE RESIDENTIAL LIVINGOPPORTUNITIESCLOSETOTHE4OWN#ENTRE 4HE BUILDING IS SETBACK APPROXIMATELY M FROM THE FRONT BOUNDARY PROVIDING AN ENTRANCEGARDENWHILSTUPPERLEVELSCONNECT TOOUTDOORTERRACESCREATINGANOPENFACADE WITH GOOD DAYLIGHT 4HE MODULATION OF THE BUILDING SHOULD BE ARTICULATED WITHIN THE FACADE SO THAT THE BUILDING READS AS A COMBINATIONOFINDIVIDUALDWELLINGS

4/7.!0!24-%.4 #/2%!2%! &OURTOTENSTOREYSINHEIGHT WITHUPPERLEVELS STEPPED BACK TO MAINTAIN A @HUMAN SCALE STREETSCAPE APARTMENTBUILDINGSWITHINTHE 4OWN #ENTRE SHOULD ADOPT AN APPROPRIATE URBAN FORM /PPORTUNITIES SHOULD EXIST FOR RETAIL AND PROFESSIONAL UNITS AT THE STREET LEVEL WITH SEPARATE ENTRANCES OFF THE STREET TOTHERESIDENTIALAPARTMENTSABOVE!GAIN ITISIMPORTANTTHATTHEBUILDINGSAREBROKEN INTO MODULES OF  M IN ORDER TO CREATE A VERTICAL RHYTHM OF FACADES AND AVOID LONG MONOTONOUSSTREETSCAPES

 !#40,!..).'!.$,!.$!54(/2)49


&)'52%9ARRALUMLA#REEKRESIDENTIAL )NDICATIVEROADLAYOUTANDBUILDINGFORMFORRESIDENTIALDEVELOPMENTALONGTHEEASTERNEDGEOF 9ARRALUMLA#REEK

&ORAMLISETOWNPARKASEASTERN GATEWAY %NHANCECONNECTIONTO 7ODEN#EMETRY

.EWBRIDGEACROSS9ARRALUMLA#REEK TOBEDESIGNEDASADISTINCTIVEENTRY FEATURE 2ESIDENTIALAPARTMENTS DEFININGNEWPARKLAND

2EINSTATECREEKCREATINGA LINEARSWALEPARK

#REEKDRIVEPROVIDEACTIVE EDGETOPARKLAND

&)'52%!DAPTATIONOFEXISTINGBUILDINGS /LDERSTYLEOFFICEBLOCKSGENERALLYHAVELEASESTHATEXPIREAROUND)FREFURBISHMENTAS OFFICESPACEISNOTVIABLEEXISTINGBUILDINGSMAYBEADAPTABLEFORRESIDENTIALUSEORFORRESIDENTIAL REDEVELOPMENT

7/$%.4/7.#%.42%^ MASTERPLAN 


 0ARKSPLACESANDSPACES 7ODENSSTREETS PEDESTRIANAREAS 4OWN3QUAREANDPARKSARETOBELINKEDTHROUGHA NETWORKOFSTREETTREEPLANTING LIGHTING STREETFURNITUREAND WHEREPOSSIBLE EXTENDED ACTIVITYATSTREETLEVEL Q

#ONTINUE THE UPGRADING OF PAVING LIGHTING FURNITURE AND SIGNAGE THAT HAS OCCURRED ALONGTHEWESTERNSIDEOF#ORINNA3TREET INSIDETHE4OWN3QUAREANDALONGTHEVERGEOF ,AUNCESTONAND&URZER3TREETS

Q

0ROVIDE ROAD ACCESS ACROSS 9ARRALUMLA #REEK TO CREATE A LEGIBLE EAST WEST CONNECTION BETWEEN THE TOWN AND THE EASTERN PARKLANDS 4HE TREATMENT OF THE VERGE OF THE NEW ROAD SHOULD CLEARLY EXPRESS THE MULTIPLE USE FUNCTION AND MAKE ADEQUATE PROVISION FOR PEDESTRIANANDCYCLEUSEASWELLASVEHICLEUSE

Q

#ONNECTTHE4OWN3QUARETOTHELOWERSTREETLEVELWITHMOREGENEROUSRAMPS STAIRSAND POSSIBLYTRAVELATORSTOCREATEASAFE LEGIBLEANDINVITINGCONNECTIONBETWEENTHECOREAND THEEASTERNEDGE

Q

5PGRADESTREETTREEPLANTINGWITHMOREEMPHASISONNATIVESPECIES

Q

0ROVIDE A CANOPIED STAGE AREA IN %DDISON 0ARK TO SERVE AS A FOCUS FOR CEREMONIAL AND CULTURALEVENTS

Q

2EDUCETRAFFICINTHENORTHERNSECTIONOF#ORINNA3TREETTOCREATEAMOREIMPORTANTCIVIC SPACEONTHEWESTERNSIDEOFTHE4OWN#ENTRE

&)'52%&INGERSOFLANDSCAPETHROUGHOUTTHETOWN !NETWORKOFPUBLICLANDSCAPETHATUSESTREETS PATHSANDPUBLICSQUARESTOCREATECONTINUOUSGREENCORRIDORS

 !#40,!..).'!.$,!.$!54(/2)49


 'ATEWAYS #REATE LANDMARKS AT ENTRANCES TO 7ODEN THAT ASSIST ORIENTATION PROMOTE ACTIVITY AND PROVIDEASENSEOFARRIVAL Q

$EVELOPBOTHSIDESOFTHEINTERSECTIONOFTHEREALIGNED#ALLAM3TREETWITH(INDMARSH$RIVE #OMMERCIALRESIDENTIAL DEVELOPMENT TO THE WEST GENERALLY OF   STOREYS WITH A TOWER ELEMENTNOHIGHERTHAN3CARBOROUGH(OUSEANDRESIDENTIALAPARTMENTSOFGENERALLYn STOREYSONTHEEASTERNSIDE

Q

$EVELOPTHEEASTERNSIDEOFTHE-ELROSE(INDMARSH$RIVEINTERSECTIONWITHTHECOMMERCIAL AND RESIDENTIAL DEVELOPMENT OF GENERALLY n STOREYS BUT WITH A DISCRETE TOWER ELEMENT THATSHALLNOTEXCEEDTHEHEIGHTOF3CARBOROUGH(OUSE

Q

%XTEND0ARRAMATTA3TREETTO!THLLON$RIVEANDPROMOTETHESALEOFTERRITORYOWNEDLANDFOR SIGNIFICANTNEWANCHORDEVELOPMENTSIN0HILLIP"USINESS$ISTRICT

Q

5PGRADETHESWIMMINGPOOLANDICESKATINGRINKTOCREATEAMOREPROMINENTLANDMARK BUILDINGONTHENORTHERNSIDEOFTHE,AUNCESTON3TREETAND-ELROSE$RIVEINTERSECTION

Q

#ONSIDEROPPORTUNITIESFORNEWDEVELOPMENTSFLANKINGTHEINTERSECTIONOF#ORINNA3TREET WITH-ELROSE$RIVE

Q

)DENTIFYSITESFORPUBLICARTASPARTOFANOVERALLPUBLICARTSTRATEGY

&)'52%'ATEWAYSANDLANDMARKS #ORNERSITESPROVIDEGOODOPPORTUNITIESFORgLANDMARKgDEVELOPMENTSTHATHELPSERVEASREFERENCEPOINTSTOUSERSOFTHETOWN

7/$%.4/7.#%.42%^ MASTERPLAN 


 3AFETYANDSECURITY )MPLEMENT STRUCTURAL CHANGES TO INTEGRATE THE 4OWN #ENTRE FUNCTIONS AND REMOVE THE PERCEPTIONTHATSOMEAREASAREUNSAFE Q

)NTRODUCERESIDENTIALUSESTOTHECORETOPROVIDEAHOURPRESENCE

Q

0ROVIDEAMIXOFGROUNDFLOORACTIVITIESINEXISTINGANDNEWCOMMERCIALBUILDINGSANDA GREATERNUMBEROFENTRANCESTOTHESTREETANDTOTHEPEDESTRIANSPINE

Q

$EFINE SAFE ROUTES TO LINK THE TOWN TO THE SURROUNDING CATCHMENT AND INCLUDE MAJOR FACILITIESLIKE#ANBERRA(OSPITAL #ANBERRA)NSTITUTEOF4ECHNOLOGY %DDISON0ARKAND0HILLIP -IXED3ERVICES!REA

Q

)MPROVELIGHTINGTOALLPUBLICAREAS

Q

2EORIENTTAXIRANKSANDCARPARKACCESSONTHEEASTERNSIDEOFTHE4OWN#ENTRETOIMPROVE OUTOFHOURSSURVEILLANCEOVERTHEBUSINTERCHANGE

Q

2EDESIGNTHEBUSINTERCHANGETOMORECLOSELYINTEGRATEWITHSURROUNDINGLANDUSES

Q

2EMOVE SHRUB PLANTING AROUND CAR PARKS AND OTHER PUBLIC SPACES THAT BENEFIT FROM A GREATERLEVELOFSURVEILLANCE

Q

2EVIEW GENERAL PUBLIC ACCESS TO OFFICE BUILDINGS SUCH AS THE BRIDGE ACROSS 9ARRALUMLA #REEKTO#ALLAM/FFICES

&)'52%!CTIVITYSUPPORTSSAFETY -IXEDUSES LIGHTINGANDMULTIPLEENTRANCESAREALLESSENTIALINGREDIENTSTOCREATINGSAFERPUBLICSPACES .OTEHOWTHEREFURBISHED#ORINNA3TREETRESEMBLESTHESMODELOF+INGSTONS'REEN3QUARE

 !#40,!..).'!.$,!.$!54(/2)49


 0HILLIP/VALANDNORTHERNENTERTAINMENT ACCOMMODATIONANDLEISUREPRECINCT #REATEAPLANNINGFRAMEWORKTHATHELPSPRESERVEANDENHANCETHERANGEOFENTERTAINMENT ACCOMMODATIONANDLEISUREFACILITIESTHATAREANIMPORTANTPARTOF7ODENSSOCIALAND CULTURALLIFE Q

6ARY THE 4ERRITORY 0LAN FOR THE ENTIRE ENTERTAINMENT ACCOMMODATION AND LEISURE AND RESTRICTED ACCESS OPEN SPACE PRECINCT TO PERMIT OFFICE AND RESIDENTIAL DEVELOPMENT AT UPPERFLOORLEVELSONLY4HISWILLACHIEVETHEPRIMARYOBJECTIVESFORTHEAREABYRETAINING ACTIVITIESATGROUNDLEVELBUTPROVIDEANADDITIONALINCENTIVETOUPGRADEPUBLICINFRASTRUCTURE LIKETHESWIMMINGPOOL ICESKATINGRINK 0HILLIP/VAL RESTAURANTSANDSQUASHCOURTS

Q

0ROVIDE DEVELOPMENT OPPORTUNITIES ON THE PERIMETER OF 0HILLIP /VAL TO RETAIN A FULL SIZE !USTRALIAN 2ULES PLAYING SURFACE WITH A LARGE SEATING CAPACITY COMPLEMENTED BY APPROPRIATE COMMERCIAL ACTIVITY WITH A STREET FRONTAGE TO ,AUNCESTON 3TREET !NY DEVELOPMENT ON 0HILLIP /VAL SHALL ONLY OCCUR FOLLOWING PREPARATION OF AN AGREED MASTER PLANFORTHESITE

Q

5TILISE EXISTING FACILITIES AT 0HILLIP /VAL FOR BROAD COMMUNITY USE IF THE CURRENT LEASE IS SURRENDERED AND THE 4ERRITORY ASSUMES MANAGEMENT RESPONSIBILITY FOR THE OVAL AND ASSOCIATEDBUILDINGS

Q

!LLOW PRIVATE INVESTMENT TO ENCLOSE AND UPGRADE THE SWIMMING POOL INCREASE THE SIZE OFTHESKATINGAREAANDINCREASESPECTATORCAPACITY)NCORPORATEFIRSTFLOOROFFICESPACETO IMPROVEVIABILITYOFTHEFACILITY

Q

2ETAINPUBLICPARKINGCAPACITYTOSUPPORTTHESWIMMINGPOOLANDICESKATINGAREA SQUASH COURTS 0HILLIP/VALANDCLUBSANDRESTAURANTS

Q

)MPROVE PEDESTRIAN CONNECTIONS BETWEEN THE PRECINCT THE COMMERCIALRETAIL CORE WITH ADDITIONAL CROSSING POINTS ON ,AUNCESTON 3TREET AND BETTER PEDESTRIAN AMENITY ALONG "OWESAND"RADLEY3TREETS

Q

)MPROVEACCESSWITHONSTREETPARKINGANDBUSSTOPSON,AUNCESTON3TREET

&)'52%%NCOURAGEPRIVATEINVESTMENT %NCLOSINGTHEPOOLWILLEXTENDAFIVEMONTHSWIMMINGSEASONTOAYEARROUNDACTIVITY

7/$%.4/7.#%.42%^ MASTERPLAN 


&)'52%

%NHANCEMENTSTOTHENORTHERNENTERTAINMENTACCOMMODATION ANDLEISURELANDUSEAREA

RESIDENTIAL RESIDENTIAL GYM AGEDPERSONS RESIDENTIAL COMMUNITYUSES

COMMERCIAL RESIDENTIAL

CARPARK

BOWLING SPORT

BASKETBALL BOWLING

CLUB

TRANSPORT LINK

SWIMMING SKATING COMMERCIALRETAILRESIDENTIAL

WATER RECREATION RESIDENTIALRETAILCOMMERCIAL

 !#40,!..).'!.$,!.$!54(/2)49


 #ONNECTIONSTOTHE0HILLIP-IXED3ERVICES !REA -AXIMISETHECOMMERCIALPOTENTIALOFCHANGINGLANDUSESINTHE0HILLIP-IXED3ERVICES !REATHROUGHIMPROVEDCONNECTIONSANDFRONTAGESTOARTERIALROADS Q

)MPROVEEXPOSUREANDACCESSTOTHE VEHICLESADAYTHATUSE!THLLON$RIVETHROUGH THERECENTLYCOMPLETEDEXTENSIONOF0ARRAMATTA3TREETTOANEWINTERSECTIONWITH!THLLON $RIVE

Q

#ONTRIBUTETOTHE#ALLAM3TREET!THLLON$RIVEBOULEVARDBYREFOCUSSINGREDUNDANTDEPOT SITESONTO#OLBEE#OURTTOCONNECTWITH!THLLON$RIVE

Q

%XTEND!LTREE#OURTTOCONNECTWITH(INDMARSH$RIVE

Q

)MPROVE PEDESTRIAN AND CYCLE CONNECTIONS ACROSS (INDMARSH $RIVE AND ACROSS "OTANY 3TREET)MPROVETHEPEDESTRIANAMENITYALONG4OWNSHEND3TREETANDPROVIDESEATINGAND SHELTERSAT#OLBEE#OURTBUSSTOPS

Q

$EVELOPPUBLICPARKINGALONG0ARRAMATTA3TREETANDONTHEWESTERNSIDEOF"ELLONA#OURT TO PROMOTE NORTH SOUTH PEDESTRIAN MOVEMENT ALONG 4OWNSHEND 3TREET TO THE 7ODEN

&)'52%)MPROVEDCONNECTIVITY %XTEND0ARRAMATTA3TREETTO!THLLON$RIVEANDCREATEANEWEASTERNGATEWAYTOTHE0HILLIP"USINESS $ISTRICT

7/$%.4/7.#%.42%^ MASTERPLAN 


&)'52%#ONNECTIONSANDFUTURELANDUSE

.EWROAD

.EWROAD

.EWROAD

2ESIDENTIALMIXEDUSEZONE 5PGRADEDURBANOPENSPACE

 !#40,!..).'!.$,!.$!54(/2)49


 0HILLIP-IXED3ERVICES!REALANDUSES %NCOURAGE THE REJUVENATION OF THE 0HILLIP -IXED 3ERVICES !REA BY PERMITTING NEW LAND USESTHATSUPPORTGREATERACTIVITY SAFETYANDCIVICAMENITY Q

!LLOWFORTHEREDEVELOPMENTOFSITESTOPERMITRESIDENTIALACCOMMODATIONATFIRSTFLOORLEVELS AND ABOVE 2ESIDENTIAL OPPORTUNITIES SHALL BE RESTRICTED TO $UNDAS 0ROSPECT 'RENVILLE #OLBEEAND!LTREE#OURTSIINTHEAREADEFINEDIN&IGURE7ITHINTHESESECTIONSREMOVE PLOTRATIOCONTROLANDGENERALLYLIMITHEIGHTTOTHREESTOREYSWITHAMAXIMUMFOURSTOREYS PLUS LOFT ON CORNERS WITH 4OWNSEND 3TREET !LL RESIDENTIAL PROPOSALS SHALL BE PRECEDED BY PREPARATION OF A 3ECTION -ASTER 0LAN THAT ESTABLISHES THE INTENTIONS OF LESSEES AND BUSINESSOPERATORSANDENSURESCOMPATIBILITYOFRESIDENTIALUSEWITHOTHERACTIVITIESINTHE 3ECTION

Q

0ROVIDEGATEWAYSIGNAGEATENTRANCESFROM(INDMARSH -ELROSEAND!THLLON$RIVESTHAT BRANDSTHEAREAASAVIBRANTBUSINESSDISTRICTTOPASSINGTRAFFIC

Q

0ROMOTENEWBUSINESSCLUSTERSTHATINCLUDEPERIPHERALRETAILINGANDBULKYGOODS

Q

#OMPLETE AN ACCESS AUDIT AND IMPROVE ACCESS TO ALL PARTS OF 0HILLIP TO PEOPLE WITH DISABILITIES

Q

7ITH CHANGING LAND USES PROGRESSIVELY UPGRADE THE QUALITY OF THE PUBLIC DOMAIN IN PARTNERSHIPWITHADJOININGLESSEES2ETAINEXISTINGAREASOF5RBAN/PEN3PACE

Q

0ROMOTE NORTH SOUTH PEDESTRIAN MOVEMENT FROM PARKING AREAS IN THE SOUTH THROUGH TO MOREINTENSIVEPEOPLEORIENTEDACTIVITYINTHENORTH

Q

)NACCORDANCEWITHMARKETRESEARCHFINDINGS!-23*ULY FACILITATEREBRANDINGTHE AREAASTHE0HILLIP"USINESS$ISTRICT

&)'52%)LLUSTRATIVESECTION^ -IXEDUSEDEVELOPMENTINTHECOURTS

7/$%.4/7.#%.42%^ MASTERPLAN 


 (ERITAGE 2ECOGNISE AND PROMOTE 7ODENS HERITAGE TO HELP CREATE A MORE ENDURING SENSE OF COMMUNITYANDRETAINIMPORTANTCONNECTIONSWITHPASTGENERATIONS Q

0ERMANENTLYMARKSITESOFTHEORIGINALSOLDIERSETTLERSWITHINTERPRETIVEPLAQUES/NESUCH SITECOULDBETHEFORMER%DDISONHOME NOWOCCUPIEDBYTHE9AMBA#LUB)NSPIREVISITORS TOTHECLUBTOEXPLORE7ODENANDVISITOTHERSITES

Q

)NVESTIGATE THE HERITAGE VALUES OF SITES AND PRECINCTS WHERE INITIAL HERITAGE VALUES HAVE BEENIDENTIFIED)NVESTIGATIONOFHERITAGEVALUESWILLBECONDUCTEDTHROUGHANASSESSMENT OFTHEPLACESAGAINSTPROVISIONSOFTHE ,AND0LANNINGAND%NVIRONMENT !CT)NITIAL SITESFORINVESTIGATIONARE ^ 7ODEN#EMETERY ^ #ALLAM 3TREET /FFICES  *OHN !NDREWS NOMINATION ACCEPTED BY (ERITAGE #OUNCIL ^ 7ODEN,IBRARYAND(EALTH#ENTRE   !NCHER-ORTLOCKAND7OOLLEY ^ $ISCOVERY(OUSE 7OODS"AGOT ^ 7ODEN4OWN3QUAREANDPEDESTRIANSPINE ^ -ARGEL(INDERSALUMINIUMSCULPTURE ^ ,OLLIPOPLANDMARK ^ 7ODEN4OWN0ARK !RABANOO0ARKAND%DDISON0ARK ^ SIGNIFICANTMOSAICTILEARTWORKINTHEFOYEROFTHE#OMMONWEALTH"ANK"UILDING

Q

7HERESITESOFHERITAGEVALUEAREIDENTIFIEDBUILDONTHEIDENTIFIEDCHARACTERTOHELPCREATE A MORE ENDURING SENSE OF PLACE &OR EXAMPLE GREATER ACTIVITY FRONTING THE PEDESTRIAN SPINE FOCUSINGCOMMUNITYFACILITIESAROUNDTHE4OWN3QUAREANDIMPROVINGACCESSTOTHE EASTERNPARKLANDS

 !#40,!..).'!.$,!.$!54(/2)49


&)'52%!CKNOWLEDGE7ODENSHERITAGE ,OCATIONOFHOUSESANDPADDOCKSUPTOTHESOVERLAINWITHTHESROADLAYOUT$OUGLAS 

7/$%.4/7.#%.42%^ MASTERPLAN 


 'ENERALSTRATEGIES #OMPLEMENTTHESTRUCTURALCHANGESOFACTIVESHAREDSTREETSWITHANATTENTIONTODETAILIN THEPUBLICPLACESTHATCREATESACONSISTENTCHARACTERANDQUALITYTHROUGHOUTTHETOWN

&)'52%3TRUCTURALCHANGESACCOMPANIEDBYQUALITYPUBLICDOMAINDETAILS &IVEMETREWIDEFOOTPATHS BOULEVARDPLANTINGINCLUDINGTHEMEDIAN PARALLELPARKINGANDTHE OPPORTUNITYFORNEWSTREETEDGEBUILDINGSPROVIDEASENSEOFENCLOSURETHATWILLASSISTINCIVILISING TRAFFICALONGTHESTREETANDCREATINGAPLACEWHEREPEDESTRIANSANDCYCLISTSFEELCOMFORTABLE

 !#40,!..).'!.$,!.$!54(/2)49


 05",)#!24

#REATE FEATURES OF INTEREST THAT HELP ENRICH THE CHARACTER HERITAGE AND SENSE OF COMMUNITYWITHIN7ODEN Q

2EQUIREALLMAJORDEVELOPMENTSTOCONTRIBUTETOTHEPUBLICREALMTHROUGHTHEINSTALLATION OFAPPROPRIATEARTWORKS

Q

)N CONJUNCTION WITH THE COMMUNITY CULTURAL PLANNING GROUP ARTS!#4 AND A PUBLIC ART COORDINATOR DEVELOP A PUBLIC ART STRATEGY THAT SETS PRIORITIES FOR THE INSTALLATION OF PUBLIC ART

Q

)NCLUDE@7ODENMOTIFSANDBRANDINGINTHEDESIGNOFCOMMONSTREETFURNITUREELEMENTS LIKEPAVING SEATS BOLLARDS BINSANDSIGNAGE

Q

0OSSIBLETHEMESFORARTWORKINCLUDE ^ !BORIGINALCONNECTIONS ^ NOMENCLATUREBASEDONTHE&IRST&LEET ^ %UROPEANSETTLEMENTANDTHEPASTORALERAFROMSTOS ^ CONTRIBUTIONSOFTHE%DDISONFAMILYTO!USTRALIA ^ THE.ORDICCONNECTIONn7ODEN THE.ORDIC0ATRONOF,EARNING ^ 7ODENASTHEGEOGRAPHICCENTREOFTHE.ATIONAL#APITAL ^ 7ODEN@.EW4OWN

Q

0OSSIBLESITESFORPUBLICARTINCLUDETHENEWBUSINTERCHANGE NEWOFFICESFORMAJORTENANTS ANDPARKLANDDEVELOPMENT

&)'52%3ENSEOFPLACE $ESIGNEDINANDINSTALLEDIN-ARGEL(INDERSALUMINIUMSCULPTUREISANIMPORTANTSYMBOL OF7ODEN

7/$%.4/7.#%.42%^ MASTERPLAN 


 ,!.$3#!0%$%3)'.

%NHANCE7ODEN4OWN#ENTREASA@GREENTOWNWITHIMPROVEDANDWELLMAINTAINEDSTREET ANDPARKLANDPLANTINGSANDCOORDINATEDSTREETFURNITUREELEMENTS Q

0REPAREA0UBLIC$OMAIN-ANUALFOR7ODEN4OWN#ENTRETHATESTABLISHESANAPPROPRIATE SETOFSTANDARDDETAILSTHATINFORMDEVELOPMENTSBYBOTHTHEPUBLICANDPRIVATESECTORS ANDACHIEVESCONSISTENTOUTCOMES

Q

-AINTAINANDENHANCESTREETTREEPLANTINGSTOACHIEVESTRONGAVENUEEFFECTS

Q

)NCORPORATEAHIGHERPROPORTIONOFNATIVETREESWHEREOVERSHADOWINGANDSPACECONSTRAINTS ARENOTCRITICALISSUES

Q

)DENTIFY THE 0HILLIP "USINESS $ISTRICT AS AN AREA NEEDING @PRECINCT MANAGEMENT AND TARGETED LANDSCAPE IMPROVEMENTS 0AVING PLANTING LIGHTING AND STREET FURNITURE SHOULD BEINSTALLEDINAMANNERTHATCOMPLEMENTSEXISTINGANDCHANGINGLANDUSES

Q

)NCORPORATEEXITINGPLANTINGSINTODESIGNSANDRECOGNISETHEIMPORTANCEOFEARLYSTRUCTURE PLANTINGSSUCHASTHENATIVETREEBUFFERALONG-ELROSE$RIVE

&)'52%3TREETTREEPLANTINGS 4REESIMPROVETHEMICROCLIMATEFORPEDESTRIANANDGIVECHARACTERTOAPLACE

 !#40,!..).'!.$,!.$!54(/2)49


 !##%33)"),)49

!##%33MEANSTHEPROVISIONOFABARRIERFREEENVIRONMENTFORALLINCLUDINGTHOSEWITH DISABILITIES !$!04!"),)49 IS THE MEANS OF DESIGNING A BUILDING THAT ENABLES EASY ADAPTATIONTOMAKEITFULLYCOMPLYWITHACCESSSTANDARDS4HISISALSOSOMETIMESREFERRED TOAS@HOUSINGFORLIFE 0ROPOSALSWILLNEEDTOADDRESSACCESSSTANDARDSASDESCRIBEDINTHE"UILDING#ODEOF!USTRALIA ANDREFERENCEDSTANDARDS#OMMONPROBLEMSTOBEADDRESSEDINCLUDE "!22)%2

)335%3

#AR0ARKING

Q

#ONTROLS

Q

#ONTROLS SWITCHESTHATAREOUTOFTHECOMMONREACHZONE

%NTRY

Q

.ARROWDOORSANDINADEQUATECIRCULATIONSPACEEITHERSIDE &ORCEREQUIREDTOOPENTHEDOORTOOGREAT

&ACILITIES

Q

'RADIENT

Q

2AMPS

Q

3IGNS

Q

3TAIRS

Q

3TEPS

Q

,ACKOFDESIGNATEDACCESSIBLECARPARKING )NADEQUATESIZE Q $ISTANCEFROMTHEMAINBUILDINGENTRY Q

Q

,ACKOFVISUALANDAUDIBLESIGNAGE Q ,ACKOFSOUNDREINFORCEMENTWHEREPUBLICADDRESSFACILITIESAREPROVIDED

Q

2OUTESWITHGRADIENTSTOOSTEEP #ROSSFALLSWHICHAREGREATERTHAN 3TEEPANDLONGGRADIENTS INADEQUATEORNOLANDINGS LACKOFAPPROPRIATEHANDRAILS ANDLACKOFAPPROPRIATETACTILEGROUNDSURFACEINDICATORS

5SEOFNONINTERNATIONALSTANDARDSIGNS Q ,ACKOFTACTILESURFACEAND"RAILLE /PENRISERSANDLACKOFCONTRASTONNOSINGS ,ACKOFHANDRAILSORHANDRAILSONONESIDEOFSTAIRSONLY Q (ANDRAILSNOTEXTENDINGBEYONDTHEBOTTOMANDTOPOFSTAIRS Q ,ACKOFAPPROPRIATETACTILEGROUNDSURFACEINDICATORS Q

3TEPSINTHEPATHOFTRAVELFROMTHEPROPERTYBOUNDARYORTHECARPARKTOABUILDING ORENTRYINTOABUILDING Q !STEPISARISEGREATERTHANMMPROVIDINGATRIPHAZARD

4OILETS

Q

)NADEQUATECIRCULATIONSPACEWITHINTOILETS

&)'52%$ESIGNFORACCESSIBILITY 4ACTILEGROUNDSURFACEINDICATORS4'3) CONTRASTINGNOSINGSANDHANDRAILSHELPACHIEVEAMOREACCESSIBLEPUBLICREALM

7/$%.4/7.#%.42%^ MASTERPLAN 


 2%6)4!,)3!4)/.).#%.4)6%3 0ROVIDEGENERALANDTARGETEDASSISTANCETORESPONDTOCONTEMPORARYPRESSURESIMPACTINGON THECOMMERCIALPROPERTYSECTOR Q

2EMOVE DELAYS DUPLICATED COSTS AND UNCERTAINTY BY FOLLOWING UP THE -ASTER 0LAN WITH NECESSARY0RELIMINARY!SSESSMENTSAND4ERRITORY0LAN6ARIATIONS

Q

%NCOURAGETHECONSOLIDATIONOFLEASESTOASSISTINTHESTRUCTURALREDEVELOPMENTOFTHE4OWN #ENTRE

Q

-AINTAINTHEPUBLICPARKINGSUPPLYTOREDUCETHEBURDENONINDIVIDUALDEVELOPMENTSTO SUPPLYALLGENERATEDPARKING

Q

)FOFFICESPACEVACANCYRATESEXCEEDOFAVAILABLEFLOORSPACECONSIDERPARTIALORFULL CHANGEOFUSECHARGEREMISSIONSFORLEASEVARIATIONS CONSOLIDATIONSANDSUBDIVISIONS

Q

)F OFFICE SPACE VACANCY RATES EXCEED  CONSIDER OTHER FINANCIAL INCENTIVES THAT MAY INCLUDE ^ 7AIVEROFDEVELOPMENTAPPLICATIONFEES ^ /NCEONLYWAIVEROFSTAMPDUTYFORTHESALEORSUBLEASEOFRESIDENTIALUNITSCREATED THROUGH COMMERCIAL REDEVELOPMENT OR ADAPTIVE RE USE 4HE WAIVER IS FOR THE FULL VALUE OF STAMP DUTY UP TO   REDUCING TO ZERO FOR UNITS VALUED AT MORE THAN   ^ !DDITIONALDEVELOPMENTRIGHTSWHERETHECONSOLIDATIONOFLEASESENABLESREDEVELOPMENT TOOCCUR

 !#40,!..).'!.$,!.$!54(/2)49




#/.#,53)/.4(%.%84 34%03

 6ARIATIONSTOTHE4ERRITORY0LAN 4HE-ASTER0LANSITSWITHINTHESTRUCTUREOFTHE4ERRITORY0LANTHATALLOWSFORSPECIALPLANSAND CODESTOBEADOPTEDBYTHE0LANNING!UTHORITY!SSUCHTHE-ASTER0LANMUSTBETAKENINTO CONSIDERATIONWHENTHE!#40LANNINGAND,AND!UTHORITYISASSESSINGDEVELOPMENTPROPOSALS PROVIDEDTHEREISCONSISTENCYBETWEENTHETWOPLANS #ONSISTENCYFORSOMEOFTHEPROPOSALSINTHIS-ASTER0LANREQUIRESTHEFOLLOWINGVARIATIONSTO THE4ERRITORY0LAN Q

6ARY THE 4ERRITORY 0LAN FOR THE ENTIRE ENTERTAINMENT ACCOMMODATION AND LEISURE AND RESTRICTEDACCESSOPENSPACEPRECINCTIN0HILLIPTOPERMITOFFICESANDRESIDENTIALATUPPER FLOORLEVELSONLY4HISWILLACHIEVETHEPRIMARYOBJECTIVESFORTHEAREABYRETAININGACTIVITIES AT GROUND LEVEL BUT PROVIDE AN ADDITIONAL INCENTIVE TO UPGRADE EXPENSIVE INFRASTRUCTURE LIKETHESWIMMINGPOOL ICESKATINGRINK 0HILLIP/VALANDSQUASHCOURTSBYPERMITTINGA COMPONENTOFHIGHERORDERDEVELOPMENT

Q

2EMOVETHEPLOTRATIOINTHE0HILLIP-IXED3ERVICES!REAANDREPLACEWITHPERFORMANCE BASED ASSESSMENT THAT WILL NEED TO SATISFY URBAN DESIGN ON SITE PARKING AND AMENITY CONSIDERATIONS

Q

#ONTROLBUILDINGHEIGHTTOENSURETHEMAINPEDESTRIANSPINE 4OWN3QUAREANDOTHERPUBLIC SPACESREMAINSUBSTANTIALLYSUNLIT PARTICULARLYBETWEENNOONANDPMINMIDWINTER

Q

0ERMIT GENERALLY  STOREY WITH A MAXIMUM  STOREY WITH LOFT RESIDENTIAL DEVELOPMENT IN PARTSOF0HILLIP-IXED3ERVICES!REASUBJECTTOAPPROVALOFA3ECTION-ASTER0LAN

Q

0ERMITMAXIMUMSTOREYDEVELOPMENTONTHEWESTERNEDGEOFTHE"RESIDENTIALAREA ALONG9ARRALUMLA#REEK

Q

0ERMITGROUNDLEVELRETAILACTIVITYOUTSIDETHERETAILCORETOHELPACTIVATEAREAS

Q

#HANGE"LOCKSAND3ECTIONFROM4OWN#ENTRE0RECINCTDTOPRECINCTB

Q

%XTEND0RECINCTSAANDBASPERTHEFOLLOWINGPLAN&IGURE 

 2ELEASEOF4ERRITORYOWNEDLAND 4HE4ERRITORYHASCONTROLOVERANUMBEROFBLOCKSTHATARECENTRALTOIMPLEMENTATIONOFTHESTRATEGIES OUTLINEDINTHISPLAN4HERELEASEOF4ERRITORYLANDWILLHELPACHIEVETHEORDERLYIMPLEMENTATIONOF THISPLANASWELLASRESPONDTOMARKETINQUIRIESFORCHANGINGOPPORTUNITIES!SAMATTEROFPRINCIPLE ANYDEVELOPMENTONEXISTINGCARPARKSWILLREQUIRETHEPROVISIONOFDISPLACEDCARPARKSPACESAS WELLASPROVISIONOFCARPARKINGGENERATEDBYTHEPROPOSAL ! SCHEDULE OF AVAILABLE LAND AND AN INDICATION ABOUT TIMING OF THE RELEASE OF THE LAND IS INCLUDEDAS!PPENDIX!

7/$%.4/7.#%.42%^ MASTERPLAN 


&)'52%

0ROPOSEDEXTENSIONOFTHERETAILCOREANDREMOVALOFPRECINCTD

02/0/3%$,!.$53%-!0

,%'%.$ A2ETAILCORE

B"USINESSAREA

C-IXEDSERVICES

 !#40,!..).'!.$,!.$!54(/2)49

D#ARPARKING


 &URTHERSTUDIESANDPLANNINGPROCESSES 4HE -ASTER 0LAN PROVIDES AN OVERALL FRAMEWORK FOR THE DEVELOPMENT AND REVITALISATION OF 7ODEN4OWN#ENTRE)NORDERTOGAINEFFICIENCIESFROMTHE-ASTER0LANANDPROVIDEGREATER CERTAINTYTODEVELOPMENTSTHEFOLLOWINGPACKAGINGOF0RELIMINARY!SSESSMENTSFORKEYPROJECTS ISPROPOSED 

%ASTERNRETAILANDPUBLICTRANSPORTPRECINCT



%ASTERNRESIDENTIALPRECINCT



.ORTHERNENTERTAINMENTACCOMMODATIONANDLEISUREPRECINCT



3OUTHERN-IXED3ERVICES!REA

0RELIMINARY !SSESSMENTS WILL EXAMINE IN GREATER DETAIL THE POTENTIAL IMPACT OF PROPOSALS ON THE PHYSICAL HUMAN AND NON HUMAN BIOLOGICAL ENVIRONMENTS AND IDENTIFY POTENTIAL BENEFICIAL IMPACTS 4HE 0RELIMINARY !SSESSMENTS WILL INVOLVE ADDITIONAL INVESTIGATION AND DOCUMENTATIONTHATISNOTPOSSIBLETOACHIEVEINA-ASTER0LANANDWILLBESUBJECTTOAFURTHER ROUNDOFPUBLICREVIEW #ONCURRENTLY OR FOLLOWING 0RELIMINARY !SSESSMENTS WILL BE $EVELOPMENT !PPLICATIONS $! FOR INDIVIDUAL DEVELOPMENTS %ACH $! REMAINS SUBJECT TO PUBLIC NOTIFICATION AND APPEAL PROCESSES

7/$%.4/7.#%.42%^ MASTERPLAN 




3500/24).'$/#5-%.4!4)/.

4HE-ASTER0LANDRAWSONANUMBEROFSUPPORTINGDOCUMENTSTHATINCLUDE Q

44- #ONSULTING AND !NNAND !LCOCK 5RBAN $ESIGN -AY   7ODEN 4OWN #ENTRE -ASTER0LANn&EBRUARYWORKSHOPSDESIGNOPTIONSREPORT-ELBOURNE

Q

0URDON !SSOCIATES 0TY ,TD 3EPTEMBER   7ODEN 4OWN #ENTRE 3TAKEHOLDER AND #OMMUNITY"RIEF#ANBERRA

Q

!USTRALIAN -ARKETING AND 2ESEARCH 3ERVICES *UNE   0HILLIP "USINESS $ISTRICT 2ESEARCH0ROJECT3TAGEn3URVEYOFOPERATORSIN0HILLIP"USINESS$ISTRICT#ANBERRA

Q

$OUGLAS -ARION&IONA  .OTWITHOUTMYCORSETSn/RALHISTORIESOFTHEFAMILIES WHOFARMEDSOLDIER3ETTLERBLOCKSIN7ODEN6ALLEYFROM !RT'RAPHIC$ESIGN  !#4'OVERNMENT(ERITAGE'RANTS0ROGRAM 

Q

Q

!USTRALIAN -ARKETING AND 2ESEARCH 3ERVICES *UNE   0HILLIP "USINESS $ISTRICT 2ESEARCH0ROJECT3TAGEn3URVEYOFCUSTOMERSIN0HILLIP"USINESS$ISTRICT#ANBERRA !USTRALIAN -ARKETING AND 2ESEARCH 3ERVICES *ULY   0HILLIP "USINESS $ISTRICT

2ESEARCH0ROJECT-ARKETINGSTRATEGY-ELBOURNE Q

%RIC-ARTINAND!SSOCIATES*UNE  7ODEN4OWN#ENTRE(ERITAGE3TUDY

Q

44-#ONSULTING!UGUST  7ODEN4OWN#ENTRE-ASTER0LANn4RAFFICAND4RANSPORT 3TUDY-ELBOURNE

Q

0LANNING AND ,AND -ANAGEMENT *UNE   7ODEN 4OWN #ENTRE 0OLICY 2EVIEW

n"ACKGROUND0APER#ANBERRA Q

Q

0LANNING AND ,AND -ANAGEMENT *ULY   9OUR#ANBERRA9OUR&UTURE#HANGESAND #HALLENGESn4HE#ANBERRA3PATIAL0LAN#ANBERRA !CCENT$ESIGNS !ERODYNAMIC#ONSULTING3ERVICES.OVEMBER  7INDENVIRONMENT

ANALYSISOF7ODEN4OWN#ENTRE2EVESBY.37 Q

/RGANISATION FOR %CONOMIC #O OPERATION AND $EVELOPMENT /%#$   5RBAN RENAISSANCEn#ANBERRA!SUSTAINABLEFUTURE/%#$0ARIS&RANCE

Q

4ANIA0ARKES#ONSULTING/CTOBER 3OCIAL0LANNINGFOR0UBLIC4RANSPORT/PERATIONS IN7ODENDRAFT #ANBERRA!#4

Q

!#4)/.9OUNG 7OMENS &ILM 0ROJECT9OUTH #OALITION !UGUST  9OUTH 3URVEY 7ODEN"US)NTERCHANGE#ANBERRA

Q

4ANIA 0ARKES #ONSULTING -AY  %VALUATION OF THE !#4 !CTION 0LAN FOR !CCESSIBLE

0UBLIC4RANSPORT#ANBERRA

 !#40,!..).'!.$,!.$!54(/2)49


Q

$ATACOL2ESEARCH0TY,TD3EPTEMBER 2EPORTON7ODEN"US)NTERCHANGE0ASSENGER 3TUDY#ANBERRA

Q

0ARSONS"RINKERHOFF*ANUARY  #ONCEPTDESIGNn7ODEN"US)NTERCHANGE3YDNEY

Q

0ERKINS $R !LAN $ECEMBER   (OW SIGNIFICANT AN INFLUENCE IS URBAN FORM ON CITY ENERGY CONSUMPTION FOR HOUSING AND TRANSPORT 3TATE OF !USTRALIAN #ITIES .ATIONAL #ONFERENCE$ECEMBER0ARRAMATTA

Q

&RUIN** 0EDESTRIAN0LANNINGAND$ESIGN

Q

4OLLEY 2 *ULY   7ALK  0ROVIDING FOR PEDESTRIANS 0RINCIPLES AND GUIDELINES FOR IMPROVING PEDESTRIAN ACCESS TO DESTINATIONS AND URBAN SPACES $EPARTMENT OF )NFRASTRUCTURE 6ICTORIA

Q

!#4$EPARTMENTOF5RBAN3ERVICESn0LANNINGAND,AND-ANAGEMENT !USTRALIAN #APITAL4ERRITORY#RIME0REVENTIONAND5RBAN$ESIGN2ESOURCE-ANUAL#ANBERRA!#4

Q

!#40LANNINGAND,AND!UTHORITY-ARCH !#40LANNING'UIDELINESFOR!CCESSAND -OBILITY#ANBERRA!#4

7/$%.4/7.#%.42%^ MASTERPLAN 


!00%.$)8! ,ANDRELEASEAND REDEVELOPMENTOPPORTUNITIES 4%22)4/293)4%3&/2&5452%,!.$2%,%!3% ./

$%3#2)04)/.



%MERGENCY3ERVICES$EPOT



&ORMERMOTORCYCLETESTINGSURFACECARPARKANDGRASSEDUTILITIESEASEMENT



6ACANTSITE



3OUTHERNPORTIONOF!#4)/.BUSDEPOT



3URFACECARPARKS6ENUEFORWEEKENDCARBOOTSALE



3URFACECARPARK



.EWBLOCKCREATEDBY#ALLAM3TREALIGNMENT



5NDEVELOPEDSITE



3URFACECARPARKANDUNDEVELOPEDSITE



3URFACECARPARK



"USINTERCHANGEANDPOLICESTATION



3URFACECARPARK





3URFACECARPARK





3URFACECARPARK





3URFACECARPARK





5NDEVELOPEDSITE





3URFACECARPARKANDFUTURESITEFORWEEKENDCARMARKET





3URFACECARPARK





3URFACECARPARK





3URFACECARPARK



 !#40,!..).'!.$,!.$!54(/2)49

",/#+3%#4)/.         4"!    


0520/3%

02)/2)49

#OMMERCIAL

,OW

,ONGSTAYCARPARK

,OW

'ATEWAYANCHORDEVELOPMENT%XTEND0ARRAMATTA3TREETTO!THLLON$RIVE

(IGH

3UBDIVIDEFORBUSLAYOVERAREAANDBULKYGOODSBUSINESSCLUSTER 0ARRAMATTA3TREETEXTENSIONANDSERVICEROADPARALLELTO!THLLON$R

,OW

0ROVIDEOPPORTUNITIESTOEXTENDBOUTIQUEOFFICEBLOCKSFORUSEBYMEDICAL PRACTITIONERSANDTHELIKEINCLUDINGARESIDENTIALTOWER "ASEMENTMULTI DECKCARPARKWITHCOMMERCIALFRONTAGETO#ORINNA3TREET %XITROADFROMEXISTINGBASEMENTCARPARKAHIGHERPRIORITY

(IGH ,OW (IGHFORBASEMENTEXITROAD

%XTENDSTRUCTUREDCARPARKING CREATEANEDGETO#ALLAMAND#ORINNA3TREETS

-EDIUM

nSTOREYRESIDENTIALEDGETO9ARRALUMLA#REEK%XTEND"RADLEY3TREETACROSS 9ARRALUMLA#REEKTOJOIN%ASTY3TREETANDCONSTRUCTEDGESTREETTO9ARRALUMLA#REEK

(IGH

2ESIDENTIALINCLUDEDINSITEABOVE

(IGH

.EWPOLICESTATION

)MMEDIATE

.EWENTRANCETOTOWNSQUAREANDLINKTOEASTERNPARKLANDS .EWBUSSTATION%XTENSIONOF"RADLEYTO"OWES3TREET.EWPUBLICSPACE .EWACTIVEFRONTAGEANDEASTERNGATEWAYTO0LAZA!PPROX MCOMMERCIAL 2ELOCATEBUSLAYOVERTO0HILLIP$EPOT  MNEWOFFICESPACEWITHACTIVEFRONTAGETO"OWES3TREET#ARPARK STRUCTUREFORSHORTANDLONGTERMEXPANDEDTO WITHMAXIMUMNEWDEVELOPMENT 2ELOCATEBUSLAYOVERTO0HILLIP"USINESS$ISTRICT #ARPARKSTRUCTUREWITHCOMMERCIALDEVELOPMENT!TSOUTHERNEND PROVIDESHORTTERMPARKINGFORCOMMUNITYFACILITIES

(IGH

,OW

-EDIUM

#ARPARKSTRUCTUREWITHCOMMERCIALDEVELOPMENT

,OW

#ARPARKSTRUCTUREWITHCOMMERCIALDEVELOPMENT

,OW

0OSSIBLEFUTUREFIREANDAMBULANCESTATIONS

-EDIUM

#ARPARKSTRUCTURE

,OW

#ARPARKSTRUCTURE

,OW

/FFICEMIXEDUSESUBJECTTOFINALRESOLUTIONOFADDITIONALCONNECTIONFROM #ORINNA3TREETTO-ELROSE$RIVE

,OW

-IXEDUSERESIDENTIAL

,OW

7/$%.4/7.#%.42%^ MASTERPLAN 


&)'52%&UTURELANDRELEASEOPPORTUNITIES NORTHERNSECTION

BA

$

RIV

E

-

EL

RO

SE

$

RIV

E

9A M



,A UN CE STO N 3 TRE ET

9AMBA$RIVE

    % A S TY

3TREE T



T

#ALLAM

3TREE





 #ORIN



NA3T



RE ET

 



   (INDMARSH$RIVE

 !#40,!..).'!.$,!.$!54(/2)49


&)'52%&UTURELANDRELEASEOPPORTUNITIES SOUTHERNSECTION

(INDMARSH$RIVE

LON !TH E $RIV

T TREE ND 3 NSE 4OW

VE $RI ROSE -EL





 

7/$%.4/7.#%.42%^ MASTERPLAN 


!00%.$)8" %XTRACTFROMEXISTING4ERRITORY0LAN ""n4/7.#%.42%3#/--%2#)!,g"g ,!.$53%0/,)#)%3 /"*%#4)6%3 4HEOBJECTIVESOFTHE4OWN#ENTRES#OMMERCIAL{"g ,AND5SE0OLICIESARE Q

TOPROVIDETHEMAINFOCUSFORTHEDISTRICTPOPULATIONFORSHOPPING COMMUNITYANDCULTURAL FACILITIES ENTERTAINMENTANDRECREATION

Q

TO PROVIDE OPPORTUNITIES FOR BUSINESS INVESTMENT AND EMPLOYMENT WHILST FACILITATING THE DECENTRALISATIONOFEMPLOYMENTFROMTHE#ENTRAL.ATIONAL!REA

Q

TOENCOURAGEAMIXOFLANDUSES INCLUDINGRESIDENTIALUSES WHICHCONTRIBUTETOANACTIVE ANDDIVERSECHARACTER

Q

TOPROVIDEANURBANSTRUCTUREWHICHISSIMPLE LEGIBLEANDFLEXIBLE

Q

TO MAINTAIN AND ENHANCE ENVIRONMENTAL AMENITY AND ENCOURAGE A STANDARD OF URBAN DESIGNCONSISTENTWITHTHEFUNCTIONOFTHECENTRE

Q

TOENCOURAGEACTIVITIESPARTICULARLYATSTREETFRONTAGELEVELWHICHCONTRIBUTETOPEDESTRIAN ACTIVITYANDSOCIALINTERACTION ,%'%.$

#/.42/,3

A2ETAILCORE

,!.$53%

B"USINESSAREA

3UBJECT TO THE PROVISIONS OF THE #OMMERCIAL {"g

C-IXEDSERVICES

4OWN #ENTRES ,AND 5SE 0OLICIES BELOW LAND

D#ARPARKING

DESCRIBED ON THE -AP AS #OMMERCIAL {"g MAY BE USEDFORONEORMOREOFTHEPURPOSESLISTEDINTHE SCHEDULEBELOW4HECOLUMNSSHOWNASA B CAND DINTHESCHEDULEREFERTOTHEPRECINCTSIDENTIFIEDAT &IGURE

&)'52%4ERRITORY0LAN-AP 7ODEN4OWN#ENTRE  !#40,!..).'!.$,!.$!54(/2)49


3#(%$5,%n#OMMERCIAL@"4OWN#ENTRES ,ANDUSE

02%#).#43

,!.$53%

2ETAILCORE A

"USINESS!REA B

-IXED3ERVICES C

9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9

9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9

9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9 9

"ULKYGOODSRETAILING "USINESSAGENCY #AR0ARK #HILDCARECENTRE #IVICADMINISTRATION #LUB #OMMUNICATIONSFACILITY #OMMUNITYACTIVITYCENTRE #OMMUNITYTHEATRE #ORRECTIONFACILITY #RAFTWORKSHOP #ULTURALFACILITY $RINKESTABLISHMENT %DUCATIONALESTABLISHMENT %MERGENCYSERVICESFACILITY &INANCIALESTABLISHMENT &REIGHTTRANSPORTFACILITY &UNERALPARLOUR (EALTHFACILITY (OSPITAL (OTEL )NDOORENTERTAINMENTFACILITY )NDOORRECREATIONFACILITY )NDUSTRIALTRADES ,IGHTINDUSTRY -OTEL -UNICIPALDEPOT /FFICE /UTDOORRECREATIONFACILITY 0ARKLAND 0EDESTRIANPLAZA 0LACEOFASSEMBLY 0LACEOFWORSHIP 0LANTEQUIPMENTHIRE 0RODUCEMARKET 0UBLICAGENCY 0UBLICTRANSPORTFACILITY 2ECYCLABLEMATERIALSCOLLECTION 2ELIGIOUSASSOCIATEDUSE 2%3)$%.4)!,53% 2ESTAURANT 2ETAILPLANTNURSERY 3ERVICESTATION 3HOP 3TORE 4OURISTFACILITY 4RANSPORTDEPOT 6EHICLESALES 6ETERINARYHOSPITAL 7AREHOUSE

#ARPARKING D 9A 9 9 9

9A 9A

9A 9A 9

9A 9A 9A

9A 9A

9

9 9A 9A 9A 9A 9A 9A 9A

9 0URPOSESFORWHICHLANDMAYBEUSED -AYBESUBJECTTOMANDATORYPRELIMINARYASSESSMENTUNDERTHE,AND!CTSEE!PPENDIX)) A /NLYPERMITTEDWHEREASSOCIATEDWITHACARPARKINGSTRUCTURE  3UBJECTTO,AND5SE2ESTRICTIONSEECLAUSE .OTWITHSTANDINGTHEPROVISIONSOFTHISSCHEDULE LANDMAYBEUSEDFORTEMPORARYUSES MINORUSESANDUSESANCILLARYTOTHE PRINCIPALUSEOFTHELAND PROVIDEDTHEREISNOCONFLICTWITHTHEOBJECTIVESIN




$%0,%4)/./&#/--5.)49!.$2%#2%!4)/.53%3 0ROPOSALS WHICH WOULD HAVE THE EFFECT OF DEPLETING THE RANGE OF COMMUNITY OR RECREATIONAL FACILITIESAVAILABLEWITHINTHECENTREMAYBESUBJECTTOMANDATORYPRELIMINARYASSESSMENTIN ACCORDANCEWITH0ART)6OFTHE,AND!CTSEE!PPENDIX))  -!).0%$%342)!.!2%!3!.$2/54%3 Q

-AINPEDESTRIANAREASANDROUTESSHALLBERETAINEDUNLESSITCANBESHOWNTHATASPARTOF ANYCHANGE THEPEDESTRIANACCESSANDCIRCULATIONSYSTEMISADEQUATELYMAINTAINED

Q

4HEIMPACTOFANYINCREASEDOVERSHADOWINGOFTHEMAINPEDESTRIANAREASANDROUTESMAY BECONSIDEREDINASSESSINGDEVELOPMENTPROPOSALS

Q

2ETAIL USES DISPLAY WINDOWS SHOP FRONTS AND BUSINESS AGENCIES CLUBS DRINK ESTABLISHMENTS FINANCIAL ESTABLISHMENTS HOTELS INDOOR RECREATION FACILITIES INDOOR ENTERTAINMENT FACILITIES PUBLIC AGENCIES RESTAURANTS SHOPS COMMUNITY ACTIVITY CENTRES ANDSIMILARUSESSHALLBEENCOURAGEDALONGBUILDINGFRONTAGESTOMAINPEDESTRIANAREAS ANDMAINPEDESTRIANROUTES

$%3)'.#/.3)34%.#9 "UILDINGSANDOTHERPHYSICALELEMENTSSHALLREFLECTTHEDESIGNTHEMESOFTHECENTRE "5),$).'#/,/523!.$-!4%2)!,3 "UILDING COLOURS AND MATERIALS SHALL BE CONSISTENT WITH EXISTING DEVELOPMENT WITHIN THE PARTICULARTOWNCENTRE,ARGEAREASOFHIGHLYREFLECTIVEGLASSSHALLNOTBEPERMITTED 7).$4%34).' !SSESSMENT OF WIND EFFECTS SHALL BE REQUIRED FOR BUILDINGS HIGHER THAN M TO DETERMINE IF WINDTESTINGISNEEDED7INDTESTINGSHALLBEREQUIREDFORALLBUILDINGSHIGHERTHANM 2//&4/00,!.4 2OOFTOP PLANT INSTALLATIONS SHALL BE AN INTEGRATED PART OF THEBUILDING DESIGN SHALL GENERALLY BESETBACKFROMTHEBUILDINGFACADEANDSHALLBESCREENEDASMUCHASPOSSIBLEFROMPUBLIC VIEW 5.$%2'2/5.$).'/&%,%#42)#)49,).%3 !LLNEWPERMANENTORLONGTERMELECTRICITYSUPPLYLINESSHALLBEUNDERGROUND

 !#40,!..).'!.$,!.$!54(/2)49


!2%!30%#)&)#0/,)#)%3 4HE !REA 3PECIFIC 0OLICIES IDENTIFY SPECIFIC OBJECTIVES ANDOR CONTROLS RELATING TO SUB AREAS WITHINTHEOVERALL4OWN#ENTRES,AND5SE0OLICY!REA

02%#).#4g!g 2%4!),#/2% /"*%#4)6%3 Q

TOMAKEPROVISIONFORARANGEOFRETAILANDSERVICEOUTLETSACCESSIBLETOCONSUMERS

Q

TOMAKEPROVISIONFORANEFFICIENTDISTRIBUTIONOFRETAILFUNCTIONS

Q

TOPROMOTEEVENINGANDWEEKENDACTIVITY

Q

TOENCOURAGETHEPROVISIONOFANATTRACTIVEPEDESTRIANENVIRONMENT

Q

TOPROVIDESAFEACCESSTOSHOPSFORPEDESTRIANSANDFORCONSUMERSBYPUBLICANDPRIVATE TRANSPORT

#/.42/,3 Q

,AND5SE2ESTRICTIONS

Q

3ERVICESTATIONS

2ETAILSALESEXCLUDINGTHESALE HIREORDISPLAYOFAUTOMOTIVEGOODS MAXIMUMGROSSFLOOR AREASHALLNOTEXCEEDM

02%#).#4g"g "53).%33!2%! /"*%#4)6%3 Q

TOMAKEPROVISIONFOROFFICESANDBUSINESSSERVICESWITHINPLANNEDCOMMERCIALCENTRES

Q

TOMAKEPROVISIONFORAWIDERANGEOFOFFICEACCOMMODATIONSIZESANDLOCATIONINTHETOWN CENTRES

Q

TOMAKEPROVISIONFORARANGEOFBUSINESSANDPERSONALSERVICESWITHINEACHCENTRE

Q

TOENABLE#OMMONWEALTHGOVERNMENTDEPARTMENTSTOEFFICIENTLYCONSOLIDATEINTOWNCENTRES

Q

TOPROVIDECONVENIENTSERVICESFORTHELOCALWORKFORCE

#/.42/,3 Q

,AND5SE2ESTRICTION

3HOPS SHALL BE LIMITED TO A SCALE APPROPRIATE TO PROVIDING CONVENIENT SHOPPING AND PERSONALSERVICESFORTHELOCALWORKFORCEANDRESIDENTS

7/$%.4/7.#%.42%^ MASTERPLAN 


02%#).#4g#g -)8%$3%26)#%3!2%! /"*%#4)6%3 Q

TO MAKE PROVISION FOR A RANGE OF CONVENIENTLY LOCATED SERVICE AND RELATIVELY LOW RENT COMMERCIALACTIVITIES

Q

TOACCOMMODATERETAIL RELATEDUSESREQUIRINGLARGEFLOORAREAS

Q

TOPROVIDEFORAWIDERRANGEOFCOMMERCIALDEVELOPMENTINTHE-IXED3ERVICESPRECINCT PROVIDEDTHATTHISDEVELOPMENTDOESNOTUNDERMINETHEFUNCTIONOFTHERETAILCORESAND BUSINESSAREASOFTHETOWNCENTRESANDTHEVIABILITYOFTHECOMMERCIALHIERARCHY

#/.42/,3 Q

"UILDING(EIGHT

4HEHEIGHTOFBUILDINGSSHALLNOTEXCEEDSTOREYS

Q

0LOT2ATIO

4HEMAXIMUMPLOTRATIOSHALLBE

Q

)NTERNAL-ALLS

)NTERNALRETAILARCADESORRETAILMALLSSHALLNOTBEPERMITTED

Q

,AND5SE2ESTRICTIONS

3(/0

4HEMAXIMUMGROSSFLOORAREAOFASUPERMARKETORSHOPSELLINGFOOD OTHERTHANPRODUCE MARKETS ISMPERLEASE

3%26)#%34!4)/.

2ETAILSALESEXCLUDINGTHESALE HIREORDISPLAYOFAUTOMOTIVEGOODS MAXIMUMGROSSFLOOR AREASHALLNOTEXCEEDM

 !#40,!..).'!.$,!.$!54(/2)49


02%#).#4g$g #!20!2+).'!2%! /"*%#4)6%3 Q

TOENSURETHEREISSUFFICIENTOFF ROADPARKINGTOSERVEEACHCENTRE

Q

TOPROVIDECOMMONCARPARKINGAREASWHEREITISNOTFEASIBLEORAPPROPRIATETOREQUIRETHE FULLPROVISIONFORCARPARKINGWITHINALEASE

Q

TOPROVIDECOMMONCARPARKINGAREASONTHEPERIPHERYOFCENTRESTOIMPROVEPEDESTRIAN ACCESSANDSAFETYWITHINCENTRES

Q

TO ENSURE THAT OPPORTUNITIES FOR PARKING STRUCTURES ARE PROVIDED WHILST ALLOWING FOR COMPATIBLEDEVELOPMENT

#/.42/,3 Q

$EVELOPMENTIN#AR0ARKING!REAS

$EVELOPMENT WHICH WOULD DISPLACE EXISTING CAR PARKING AREAS SHALL ONLY BE PERMITTED WHEREITCANBEDEMONSTRATEDTHATOVERALLPROVISIONTOCARPARKINGTOMEETTHENEEDSOFTHE CENTREASAWHOLEISINACCORDANCEWITHTHE4ERRITORYgS0ARKINGAND!CCESS'UIDELINES

Q

,AND5SE2ESTRICTIONS

,AND USES IDENTIFIED IN SCHEDULE  AS ASSOCIATED WITH A CAR PARKING STRUCTURE MAY BE PERMITTEDONLYWHENTHEABOVEOBJECTIVESCANSTILLBEMET

3%26)#%34!4)/.

2ETAILSALESEXCLUDINGTHESALE HIREORDISPLAYOFAUTOMOTIVEGOODS -AXIMUMGROSSFLOOR AREASHALLNOTEXCEEDM

7/$%.4/7.#%.42%^ MASTERPLAN 


!#40,!..).'!.$,!.$!54(/2)49 #HALLIS3TREET $ICKSON 0/"OX#ANBERRA#ITY!#4 4%, &!8 !#40,! 7%"3)4% 777!#40,!!#4'/6!5

Woden Town Centre Master Plan 2004  
Read more
Read more
Similar to
Popular now
Just for you