Page 1

FREE

WORCESTER { news | arts | dining | nightlife

mag

March 3 - 9, 2011 worcestermag.com

Heroin

WORCESTER’S DIRTY, LITTLE SECRET

Lock in a low price until 2012! Call 1-888-GET CHARTER 2-year contract required; early termination fees apply. Restrictions apply. Call for details.

Charter TV™ in Digital

Charter Internet™

Charter Phone™ Unlimited


JOB LOT

Ocean State Holiday

2011 Flower & Vegetable Seeds

Perugina

Chocolates

Chocolates

3.1 - 4.1 oz

40% OFF

14 oz

2

50

4

$

15

Low Voltage Garden Lights

5ea

$

7

4

20

Comp. $59.99

Values to $59

BONUS:

FREE CASE!

10

7

$

Assorted sizes

Comp. $60

40

$ Assortment varies by store

115 Gallon Extra Large Composter • Easy opening spring loaded top • 4 doors for easy access • No tool assembly

Comp. $99.99

39

99

Latex Dipped Nylon Garden Gloves

Contour-Fit Knee Pads Black or green

Comp. $7

Comp. $12.97

Tops

Comp. $29 - $48

8

$

SAVE 70%-88%

89

Remanufactured

2

$

65

¢

3 $ 2 6”

2

Grove 10’x10’ Gazebo

13’x13’* Gazebo

• Rust resistant steel frame • Matching leg skirts * Measurede from eave to eave

• Decorative bamboo design • Vented double roof - Includes: Zippered mosquito netting

Comp. $200

Comp. $374

160

$

ASSORTMENT VARIES BY STORE

Regency 10’x12’* Gazebo

Gazebo

• Heavy duty powder coated steel roof • Full length side shelf • Wire grid for tools & accessories

• Rust resistant steel frame • Trellis design • Double roof construction • Includes mosquito netting

Comp. $400

Comp. $300

200

200

$

Microfiber Comforters

$

Heavyweight Microfleece Sheet Set

89

$

Remanufactured

Follow us on Facebook

Twin .....................................$15 Full/Queen ........................$18 King .....................................$20

Standard........................ $15 Down Alternative......... $20

Twin Comp. $50.............................$20 Full Comp. $60...............................$25 Queen Comp. $70........................ $30 King Comp. $80............................ $35

LOOK FOR MANAGER’S UNADVERTISED SPECIALS IN ALL OUR STORES EVERY WEEK!

Puppy Pads

The Doctors

Nightguard Classic

Comp. $12.39

Comp. $20

8

WORCESTERMAG.COM • MARCH 3, 2011

4

$ 14 Ct ..............

Gillette® Mach 3 Turbo Blades

®

$

9

$ 4 Count

Black Rice Skin Care

Dermasil Lotion

MADE IN ITALY Scrubs, cleansers & creams

16 oz Assorted

Comp. $3.49

Comp. $10-$15

2

$

3-$5

$

Stainless Steel Cookware • High quality 304 stainless steel • Thick encapsulated bottoms for uniform cooking • Commercial grade riveted handles • Dishwasher safe

Fry Pans $ 8”........Comp $21.99......... 10 $ 10”......Comp $28.99........ 15 $ 12”......Comp $39.99........ 18 Sauce Pans w/Lids $ 2 qt........Comp $25.99........ 15 $ 4 qt.......Comp $39.99........ 18 Dutch Ovens w/Lids $ 6 qt........Comp $49.99........ 22 $ 8 qt........Comp $64.99....... 27 11” Griddle Non-stick.............

8

$

We now accept Cash Benefit EBT Cards

VISIT OUR WEBSITE AT WWW.OCEANSTATEJOBLOT.COM FOR STORE LOCATIONS, MONEY SAVING COUPONS & COMING ATTRACTIONS!!

2

12

$

8”

Pagoda™

GrillTime™

50 ct 24”x24”

Built-in reservoir waters as needed for up to two weeks. Available in clay, ivory or green

50

130

Puppy Heavyweight Training Pads

Misco® Self Watering Resin Planters

$

25

$ Comp. $60

100% Biodegradable

25 ct

$

35”x44”x4” luxurious soft microtec cover

Seed Starting Pots 3" Round 8 Count

Seed Starting Pellets

1

Coral Fleece Blankets

Jumbo Jacquard Bed

Comp. $119

Spinscrub model Heats water

$

10

•1 3/4” sq. pots 50ct. •100% biodegradable

$

25

Comp. $50

$

4

20

$

Comp. $30

Seed Starting Strips

15

36” Pet Bed

Soft sherpa top with coordinating cording

Choose from 1/4 zip or full zip. 100% Polyester

50

8 Lbs Country Farms Potting Soil

$

Comp. $119

Mens & Ladies Winter Fleece Jackets

Seed Starting Kit

1

$

Self Propelled Vacuum

27”x36”

$

Comp. $40 Your Choice:

Eagle Canyon®

prefilled with high quality seed starting mix

50

Country Blend Mixed Seed 20 Lbs ................................. 7 $ Kaytee® Birder’s Blend Mixed 16 Lbs....................... 10

Steam Clean Carpet Cleaner

Reversible Paw Motif Bed

10

6 qt. New Era Seed Starting Mix

40 lbs or Nyjer Seed 25 lbs

Hoover®

3

$

3

Black Oil Sunflower Seed 50 lbs, Signature Mixed

Hoover®

Soft Luxurious Fur Top

27”x36” - 3” Gusset sides or

Pants

$

3

Your Choice:

Made in Turkey

Comp. $68 - $88

16 qt. Soilite Premium Potting Soil

$

4

$

179

Comp. $10

Tops & Pants

199

7'10”x 11'2” ... $250 6'7”x 9'6” ........ $180 5'3”x 7'7” ........ $100 3'11”x 5'7” ......... $60 2'7”x 5 '................ $36 5'3” Round ......... $80

99

Graphic Tees

(Longsleeve, 3/4 length & shortsleeve)

Assortment varies by store

Kashmir, Imperial, Silk Road & Persian Classics Collections

$

Famous Specialty Store

$

300 7’10”

®

Comp. $379 - $449

Sportsman Lifevest

Comp. $30

Workout Wear

Coleman® or Flex® Kayaks

20

15

8 Pk plastic or 6 Pk Stainless Steel

Curves

SAVE 65%-75%

Superior Quality 1 Million Point Area Rugs

9’x12’

$

6 piece Solar Accent Set

3/$

Pants, Capris, Leggings

$

$

$3.99 ea OR

$

• 36’ total length • Includes remote control

Comp. $20 - $30

Kayak Paddle Comp. $30........

Selection varies by store

Solar Stake Light Comp.$8 ea

Fabris Lane

6

2’4”x5’.........$30 3’3”x5’4”.....$40 2’2”x8’.........$50 5’5”x8’3”...$100 7’9”x11’6”.$200

Stainless steel or copper finish

8 piece Solar Umbrella Lights

640,000 Points of Yarn Per Sq. Meter

Made in Italy

Comp. $179.99

Westinghouse®

$

Made in Italy

Your Choice

Victoria Collection

25 Comp. $59.99 $ 8pc. Sets........................ 35 Comp. $89.99 to $109.99 $ 10pc. Sets...................... 45 $

6pc. Sets........................

$

Save 72 -90% on Designer Sunglasses!

2’x4’............$15 2’x7’3”........$25 3’3”x5’2”....$25 5’3”x7’3”....$50

Comp. $20-$25

10

Unisex Fashion Headwear

336,000 Points of Yarn Per Sq. Meter

Made in Turkey

Individual Lights

Famous Maker Heavyweight Sweatpants

Genoa Collection Area Rugs

New Rug Arrivals!

Save 58% to 75%!

High Intensity LEDS • Choose from dozens of styles & finishes!

$

$

3

200

$

REPEAT OF A SELLOUT!

$

Westinghouse®

Super Premium Full Zip Hooded Sweatshirt

Villager & Axcess Comp. $28

Comp. $6

5

$

Selling nationally for $400

Heavyweight, 100% cotton

$

Comp. $50 - $100

Beautiful wood rolling mantel

Pocket Ts

Comp: $30-$60

2 Famous Labels Swimwear

Electric Fireplace

Fruit of the Loom®

Solids, stripes, tipped collars

25

Claiborne

STORE HOURS! Mon-Sat 8am-9pm; Sun 9am-8pm Sale Dates: Thurs. March 3 - 9, 2011

Men’s Golf Shirts

$

Comp. $25

3

$

Outer Banks®

Comp. $100 - $250

Comp. $9-$24

*

*Mfg. Suggested Retails

Super Famous Label Swimwear

Comp. $35

3 Pk Readers

Comp. $8 - $10

R

We accept      


March 3 - 9, 2011

inside stories

Kirk A. Davis President Gareth Charter Publisher x153 Doreen Manning Editor x245 Jeremy Shulkin Senior Writer x243 Steven King Photographer x278 Brittany Durgin On-line Editor x155 Paul Grignon, C. Kelleher Harris, Janice Harvey, Janet Schwartz, David Wildman Contributing Writers Veronica Fish Contributor Tammy Griffin-Kumpey Copy Editor

eroin has always seemed like a drug only for shadowy alleys and condemned buildings, and the people who frequented such places. The type of people who had family, friends or acquainances who were addicts as well. Someone who didn’t have a house, or a car, or a steady job. That’s simply not the case. Heroin is prevalent all over the state in so many parts of society, especially in Worcester, and it’s rising. Users are younger and coming to the drug in untraditional ways. The city has seen the rising trend and tried to stem it, yet because heroin doesn’t receive the same recognition as alcohol, marijuana or cocaine, we’ve found that more could be done in Worcester to help those who need not only treatment, but understanding from their community.

H

Don Cloutier Production Manager x380 Kimberly Vasseur Art Director/Assistant Production Manager x366 Becky Gill x350, Morgan Healey x366, Stephanie Pajka x366, Stephanie Renaud x366, Bob Wellington x350 Graphic Artists Jennifer Shone Advertising Sales Manager x147 Lindsay Chiarilli x136, Joan Donahue x133, Aimee Fowler x170, Dawn Hines x131 Account Executives June Simakauskas Classified Manager x430 Carrie Arsenault Classified Advertising Specialist x250 Worcester Mag is an independent news weekly covering Central Massachusetts. We accept no responsibility for unsolicited manuscripts. The Publisher has the right to refuse any advertisement.

DISTRIBUTION: Worcester Mag is available free of charge at more than 400 locations, limited to one copy per reader. Additional copies may be purchased for $1 each at Worcester Mag offices. Unauthorized bulk removal of Worcester Mag from any public location, or any other tampering with Worcester Mag’s distribution including unauthorized inserts, is a criminal offense and may be prosecuted under the law. SUBSCRIPTIONS: $47 for one year, third class mail. First class mail, $125 for one year. Send orders and subscription correspondence to Worcester Mag, 101 Water St., Worcester, MA 01604. ADVERTISING: To place an order for display advertising or to inquire, please call (508) 749-3166. Worcester Mag (ISSN 0191-4960) is a weekly publication of The Holden Landmark Corporation. All contents copyright 2010 by The Holden Landmark Corporation. All rights reserved. Worcester Mag is not liable for typographical errors in advertisements.

EDITORIAL: 508.749.3166 SALES: 508.749.3166 CLASSIFIED: 508.755.1199 FAX: 508.749.3165 E-MAIL: editor@worcestermag.com Worcester Mag, 101 Water St. Worcester, MA 01604 worcestermag.com

March 25-27

Jeremy Shulkin | Senior Writer

4 4 8 9 9 10 11 19

City Desk 1,001 Words Worcesteria Our Turn Rosen Report/Zanzo Moxie People on the Street Cover Story Night & Day

23 25 29 30 36 47

Film Eat Beat Weekly Picks Venues/Clubs/Coffeehouses Classifieds 2 minutes with…

ABOUT THE COVER: Photo by Steven King Design by Kimberly Vasseur

19

Tony Award Winner! - BEST MUSICAL

Avenue Q has not been authorized or approved in any manner by The Jim Henson Company or Sesame Workshop, which have no responsibility for its content.

Discounts available for members, groups, kids, students, and WOO card holders. TheHanoverTheatre.orgˆ877.571.SHOW (7469) ˆ 2 Southbridge Street, Worcester, MA 01608 Worcester Center for the Performing Arts, a registered not-for-profit 501(c)(3) organization, owns and operates The Hanover Theatre for the Performing Arts.

MARCH 3, 2011 • WORCESTERMAG.COM

3


WOO-TOWN INDE X

A weekly quality of life check-in of Worcester

{ citydesk }

March 3 - 9, 2011 ■ Volume 36, Number 26

Worcester East Larger issues loom beyond the quick fixes C. Kelleher Harris

Seven Hills Charter School placed on probation for not meeting improvement benchmarks. Looks like they’re waiting for Superman, too. -2 Pizza delivery man shot in botched robbery. Not even desperate times call for those desperate of measures. -2 Increasing fines for pot smoking goes before the city council. The 1990s called, they want their ordinance back. -1 Clark University hosts Spanish playwright via Skype. Talk about learning without boundaries. +1 Ted Kennedy arranged to stay at a Chilean brothel in 1961. Slow news day. 0 Desmond Tutu to speak at St. Johns High School. That’s a collegelevel speaking score. +2 Boston to Worcester train makes trip in just under 3 hours on Monday. Worcester and the MBTA: an abusive relationship, and they’re the abuser. -2 This week: -5 Last week: -6 Year to date: -14

4

WORCESTERMAG.COM • MARCH 3, 2011

1,001 words

Nearly 30 protestors appear at the library to confront any North East White Pride members in case they arrived for a rescheduled meeting. Hasta luego, perdidos. +2

W

By Steven King

Another arbitrator rules in favor of reinstating embattled WPD officer David Rawlston. It might be time to invest some of the city’s legal money into shoring up the budget. -1

hen Worcester East Middle School originally opened in 1924, it was the first school east of the Mississippi to be designated specifically for use as a junior-high school. Almost 90 years later, the East Middle is among some two dozen schools that are in line to receive funds for much needed repairs. “Like any school that’s been steadily used for nearly a hundred years, Worcester East Middle School is due for internal upgrades and repairs; the bathrooms need attention, the paint needs work in some rooms, and there are places where floors and ceilings need work,” says Worcester School Committee member Tracy Novick. Teachers there agree too. “Our school’s always been overlooked,”

says art teacher Stacy Lord, calling the needed repairs safety issues and a matter of pride. “Much of the interior work depends on the roof being fixed,” Novick says. According to the school’s principal, Rose Dawkins, the roof has needed replacement for about six years. “If you drive by our school on the outside it looks awful,” Lord says defeatedly. The school has had work done before, recently $30,000 was spent to fix the gym’s roof, but the repairs leaked, rending half of one hallway “demolished.” “Our concern is for the safety of the kids,” says Lord. In April 2010, the city identified $70 million in needed repairs in Worcester Public Schools. City Manager Michael O’Brien announced that the city would

what?

give Worcester Public Schools $6 million during 2010-2011 in building rehabilitation funds. This is a 50 percent increase over previous annual allocations. An additional $3 million will be allocated every year for the next four years, totaling $18 million over five years. In addition to the $18 million, funds have also been allocated for projects including assistance from energyservice company, Honeywell. The city will work with Honeywell to make their schools more energy efficient, then bond the money they’ll save to pay for these capitol improvements. “I found out that what was a $1 million project by Honeywell is now a $3 million project,” Clancy said. “I want to know what the initial bids were and who made the initial bids.” Clancy went on to say that Honeywell


{ citydesk } Log onto Worcestermag.com & Vote us Best Yoga/Holistic/ Wellness Center Once again!

had given an initial estimate on the window replacement that was “not even in the ball park” of the present estimate. And that’s raised questions about the scope of the repairs. Not only does the roof need replacing, Dawkins is also concerned about the school’s windows. The school still contains the original frames and panes, which are almost 90 years old. “We need windows,” says Dawkins. “It’s very cold and drafty. And the windows rattle.” Dawkins initially thought that the windows would be replaced this year as well,

but apparently some confusion has developed. During a recent visit to Worcester East Middle School, District Three Councilor Paul P. Clancy said that windows could not possibly be replaced this year because of the excessive costs. At the Feb. 8 Worcester City Council meeting, Clancy raised questions about the cost and initial estimates. “Obviously East Middle isn’t going to get new windows,” Clancy said. “They are not happy, and I don’t blame them.” continued on page 7

D A M N E D LI E S and STATISTICS

96

Countries represented in the Worcester Public School system, according to a report from the mayor’s office. The US State Department recognizes 194 independent countries.

Tangled Salon Is a Full Service Hair Salon

Thinking About Becoming a Teacher? It’s not too late. Learn more aboutt Initial Teacher Licensure for Middle dle and Secondary Education.

Get the facts! Information night March 10th, 2011 at 6pm Please R.S.V.P. at 508-929-8787 to reserve and FIND YOUR PLACE!

~Goldwell Professional Hair Color~KMS~Pureology ~Awapuhi Wild Ginger Luxury Prouducts By Paul Mitchell~

We are currently seeking full and part time stylists

Please contact us @ 508-796-5601 373 Shrewsbury St., Worcester • 508-796-5601 tangledsalon.com • tangledinworcester@yahoo.com

worcester.edu/graduate MARCH 3, 2011 • WORCESTERMAG.COM

5


6

March 31st, 2011 Toll Free 1-800-639-2273

Miracle-Ear Center 800 Main Street #15A Holden, MA Local Testing Area

Sears Hearing Aid Center Auburn Mall

Miracle-Ear Center Twin City Plaza Leominster D Gross MA #4

WORCESTERMAG.COM • MARCH 3, 2011


LOG ONTO WORCESTERMAG.COM AND VOTE IN THE 2011 BEST OF WORCESTER POLL!

mag

ONLY ONE WEEK LEFT!

it’s time again for

WORCESTEcR ontest

{ citydesk } poetry

V E R BATI M There is a lot of good going on in our school and we would like to see the city hold up their end with the funding to address some of the major safety issues that currently plague our Worcester East Middle.�

— Stacy Lord, art teacher at Worcester East Middle School

{annual

With two categories (youth & adult) and a spread in our issue dedicated to the winners, this is a great opportunity for our community to celebrate the excellent work of our local word artists during National Poetry Month. First, second and third place winners will be showcased in the April 7th issue of Worcester Mag. Winners will be invited to read their winning entries during a Worcester Mag sponsored live showcase event at the WCUW 91.3 FM’s Front Room on April 22.

{

Rules • Submissions must be made electronically, sent via email as a Word attachment or pasted in an email. Send submissions to editor@worcestermag.com. Please put POETRY CONTEST in the subject headline. No paper submissions will be accepted. • Be sure to mark which category you are applying for: Adult (18+) or Youth (-18). • Entries due by March 25 • Word count: no more than 500 words. 2011 Judges: Alex Charalambides, 2011 Worcester Arts Council Fellowship Recipient Heather Macpherson of Ballard Street Poetry Journal John Hodgen, English professor at Assumption College and published poet

continued from page 5

Mayor Joseph O’Brien pointed out that while the decisions had already been set for the $18 million five-year plan, the planning and designation with Honeywell’s projects was “still being worked on.� “They are going to get a lot of great work,� O’Brien told Clancy. According to Dawkins other repairs that are slated for East Middle School this year are bathroom upgrades, a new science lab and replacing the cafeteria floor. Novick said that despite finished budgeting details, the window replacement had already been decided on. “I would certainly hope that the commitment to the capital spending would hold firm,� Novick said. “I know that the school committee and the school administration remain committed to these projects; I would hope that such would hold true for the city administration and the city council as well.� Dawkins remains hopeful that the money necessary to improve and enhance her school will eventually come through. “[The school] needs a lot of repairs, but it has good bones,� Dawkins said.

+HDGVKRXOGHUV NQHHV WRHVÂŤ With over 100 medical specialists, we have you covered head to toe.

You don’t need a Fallon Clinic primary care physician to see one of our world-class specialists! Fallon Clinic accepts most major insurances.

(800) AT-FALLON www.fallonclinic.org/specialties MARCH 3, 2011 • WORCESTERMAG.COM

7


L.B. Wheaton

Camara & Supplies • Top Quality Processing

259 Park Ave. Worcester 508-791-3308 lbwheaton.com

Mon-Fri: 10am-6pm Sat: 10am-5pm

The Annual Tucson Trunk Show Sat March 5th • 10-6 Raffles • Sales • Food • Festivities Don’t miss out on being the first to see the hundreds of semi-precious beads we brought back from the Tucson Gem and Bead shows.

1099 Pleasant St., Worcester • 508-754-0999 • open 7 days a week 57 East Main St., Westboro • 508-870-0022 • open 6 days a week

www.tatnuckbead.com

Start Your Year with a Bright Smile ZOOM

350

$

(A $700 value)

Affordable Dentistry Mass. Health Patients Welcome Caring, Qualified Staff • Preventive • Cosmetic • Restorative Crowns Extractions • Root Canal • Partial & Complete Dentures

Open Days, Evenings & Saturday

Brand New, High-Tech Dental Office! 101 Pleasant St., Rm. 106 • Worcester 508-770-1451 • www.artofdentistry.net Emergency Walk-ins Welcome • We Accept Most Insurances 8

THE NEWS ON THE SHREWS: It’ll be interesting to see if Shrewsbury Street buzzes with political intrigue next week, as long-time district 2 city councilor Phil Palmieri will find out as early as this Friday if he will have a challenger in the November election. While we can’t say who the potential candidate is yet, we will say that he does not have an Italian name in one part of the city where the ethnic vote still has some sway. Palmieri hasn’t had competition for his seat since the 2007 election … Speaking of rumors, as we’ve been listing names of potential candidates for council, unconfirmed rumors are that the School Committee will have at least three new challengers this year, including one that didn’t finish in the top six in 2009.

Jeremy Shulkin

ALMOST IN THE PUBLIC EYE: Last year’s Republican candidate for the district 13 state representative seat Paul Franco has been appointed to the Conservation Commission. Franco made it known during his concession speech to supporters last November that he’s still got the drive for politics, so this may be a way for him to stay in the public eye – even the minimal exposure that the Conservation Commission will offer.

NO JOKE: How do you know city

councilors have started to think about their re-election campaigns? A discussion that would have lent itself to joking around ended up drier than, well, cottonmouth. On Tuesday night the council heard from Main South Alliance member William Breault about increasing fines and forcing offenders to properly ID themselves to police officers writing marijuana possession tickets. With plenty of opportunities for councilors to throw in a pun or innuendo about the drug, motions stayed pretty straight-forward. Konnie Lukes brought up drug sales supporting cartels in Mexico and wanted information from the police department regarding drug-related violence. Mayor Joe O’Brien asked for the number of possession citations written by local police, while Barbara Haller asked for the number of complaints called into the WPD regarding public smoking of marijuana. Rick Rushton, noting that the decriminalization proposition passed in 2008 with 62 percent of the vote in Worcester, while a public policy question last November asking d-13 voters if medicinal marijuana should be legalized passed with 59 percent in favor, moved to file the motion immediately. Despite the council filing a similar measure in 2009, they changed course this year, voting 6 to 3 in favor of continuing discussion and sending it to subcommittee.

MORE CONTROVERSIAL THAN MARIJUANA: What topic on Tuesday night

Teeth Whitening

s ficate i t r e Gift C ilable Ava

{ worcesteria }

WORCESTERMAG.COM • MARCH 3, 2011

inspired more debate than local pot laws? Whether or not Kelley Square should be reengineered. In reference to the demolition of the Bumper to Bumper building that has opened up an area flush with Harding and Green streets. Lukes wondered if the time was right for some eminent domain “to reconstruct some of that confusion.” “What is Worcester without the madness of Kelley Square?” O’Brien then asked. City Manager Michael O’Brien called it a national landmark, but said his office could respond with a report. After Rushton pointed out the economic development potential of rebuilding on that parcel, O’Brien also added that earlier in the decade proposals were for a gas station to pop up there, which was “clearly not our vision for the community.”

USED AND ABUSED: Boston news outlets finally came out to Worcester this week for something that wasn’t a fire, a grisly murder or a story on snow removal. Unfortunately, it was about how Worcester-Framingham commuter line riders received the shaft from the MBTA twice in one day, with huge delays Monday morning and evening, including a 5p.m. express from Boston to Worcester that didn’t arrive to Union Station until well after 8p.m. The MBTA apologized, blaming the delays on old and faulty engines noted that new trains are on the way. A summer 2010 $114 million dollar deal for 20 new locomotives with Boise, Idaho company Motive Power, Inc. is a good start but they’re not slated to arrive here until 2013, presumably because if it takes 3.5 hours to get an MBTA train from South Station to Worcester, imagine how long it takes them to get a train from Boise to Boston. Follow Worcester Mag news daily and digitally at the Daily Worcesteria blog at Worcestermag.com. Got a tip? Call 749-3166 x243 or email it to jshulkin@ worcestermag.com. If you like your news and political gossip 140 characters at a time then follow @JeremyShulkin on Twitter.


The Rosen

Report

E

It’s time to fold ’em, Chief Gemme

vidently Worcester police chief, Gary Gemme, is unfamiliar with the song “The Gambler.” Kenny Rogers sings, “You got to know when to hold ‘em, know when to fold ‘em, know when to walk away and know when to run.” Well, chief, it’s long past the time for you to fold ’em. Even the Worcester School Committee wouldn’t give you a standing ovation for your work on the Rawlston case. It’s been almost four years since former Worcester patrolman, David Rawlston, while on injured-on-duty status, made the decision to confront three teenagers who were trespassing on his property and peering into the windows of his home in Tatnuck Square. Officer Rawlston’s actions that night have been branded by the chief of police and City Manager Mike O’Brien as police misconduct. Ten months later, Rawlston was fired with loss of pay and benefits. A 14-year veteran, Rawlston basically was accused of overreacting to the threat and danger posed to him, his family and neighbors by three young male prowlers under the cover of darkness. Evidently he had forgotten that some of his Quinn Bill pay-incentive classes had stressed the liberal way of cajoling, coaxing and coddling our youth who are just starting out on a life of crime. So much for tough love. Although understandable to many homeowners, Rawlston’s behavior that night appears to have been reckless. When the criminal element that he was so used to dealing with on Worcester’s streets came calling on his home and castle, his anger and resentment got the best of him. He ran out the door, pointed his loaded semiautomatic Glock handgun at the young unarmed intruders, pushed them to the ground and allegedly whacked one of them on the side of the head with his pistol. Officer Rawlston’s behavior warranted a reprimand, an extended cool-down period without

pay, some retraining and a reassignment of duties. However, the response of the police chief has been more unreasonable and unacceptable than Rawlston’s actions were on that April night before Easter in 2007. Chief Gemme is a smart, educated, tough cop and a capable administrator. He’s been good for the police department and good for the city. His emphasis on crime prevention and community policing, even while short-staffed, have kept Worcester residents safer. On the other hand, many police officers and union activists accuse the chief of being unyielding, hypocritical and vindictive. That has led to much anger, resentment and turmoil on the force. In the Rawlston case, City Manager O’Brien agreed with Gemme and concluded that Rawlston was a bad cop. However, according to the several avenues of due process and appeal used to date by Rawlston’s legal counsel, the city did not have just cause to fire him. The police chief’s own detective bureau and the district attorney’s office have both said that Officer Rawlston’s behavior was not criminal. Two experienced arbitrators and a Suffolk Superior Court judge have ruled against the city and demanded that Rawlston be reinstated with back-pay and benefits. One of the arbitrators even said that he did not find the three youths to be credible. In spite of these investigations and rulings, Gemme and O’Brien remain in denial. They continue to ignore all independent findings in this case while costing Worcester taxpayers well over $100,000 in outside legal fees. It’s time for the Rawlston saga to end. Chief Gemme and City Manager O’Brien must take off their blinders and immediately cut the city’s and taxpayers’ losses. To continue on their present path is sheer folly. Give patrolman Rawlston back his gun and his job.

commentary | opinions

slants rants& Ourturn Filling the void

H

His hair tangled around my fingers, my other hand traces the outline of his chest tattoo. The rest of the house is quiet but neither Levi nor I have any interest in the solidarity that comes with sleep. He shares college soccer-team stories that make me laugh; stories of adventures filled with risk that make me whip my head back in shock. I’m overcome with anticipation; my mind swirls with inspiration to have similar stories of my own. How could I have become jaded to the simple realization that we all have the time and opportunity to live a life of heart-pounding tales? I leave the bed that morning ready enjoy myself, ready to live. In that same room, months later, Levi is found dead on the floor, the needle in his arm telling the last story of his life. Even through the constant use of drugs and alcohol, Levi was still the most cognizant person I knew. At 24 years old, he knew what it was like to grab life and marvel in all its greatness, rather than simply getting by in it. Whether snapping his head of long black hair up and down while pounding out rock-and-roll power chords, or dancing to every song in the middle of a bar floor until closing time, Levi was always on a mission for the highest happiness possible. It was Levi’s death that brought the realization that from time to time, emotions and pain challenge our sense of being; sometimes it’s so intense that a hole forms, leaving us subconsciously searching for a filler. Some spend hours with alcohol, searching for liquid courage to overcome hardships. Some use food and often its expulsion to gain a sense of control over their disorderly situation. Heroin and other opiates rush physical and mental substitutes powerful enough to give a feeling of fulfillment, at least for a couple hours. For those who may feel a void within their lives, Worcester is a city of provoking people and movements, ready to rush into that space with inspiration and fulfillment. This community needs to recognize the vast amount and types of outlets it offers individuals to fill their hallow hearts. To be naive is to say early-drug-prevention discussions and addict therapy are the only answers. While both are necessary, let’s also embrace the alternatives available that don’t sacrifice the high or fulfillment that drugs can offer. Go to a Dirty Gerund show on Monday night and let your heart and mind pulsate with intimacy as your neighbors share their most personal thoughts through rhyme. See a live show at the Raven and hear an undiscovered local band playing music that turns your body into a spastic, sparking fuse. Walk the hall of any gallery with wall to wall art that shares thoughts on life just as motivating as those spoken to me by a man who didn’t have these opportunities. He didn’t have a city made of passionate people awakening the power to feel in all of us. We do. Jump into the city and watch it flow within you.

ONLY ONE WEEK LEFT! LOG ONTO WORCESTERMAG.COM AND VOTE IN THE 2011 BEST OF WORCESTER POLL! MARCH 9, 2011 • WORCESTERMAG.COM

9


EOPLE STREET ON T HE

Letters Commuter Rail Nightmare

I

woke up at 5:30 a.m. and prepared for my daily commute. I take the 6:55 a.m. P508 train from Union Station in Worcester all the way in to South Station in Boston. If the train runs on schedule, I’m sitting at my desk by 8:30 a.m. This is a rare occurrence. We left Union Station on time. After we reached Grafton, the first stop on our journey, we sat there for what seemed like forever. Finally, a conductor announced over the loudspeaker something that was inaudible in the car I was in. The speaker system seems to only work well in a select few cars. After another 15 minutes or so, a conductor came to our car and announced that we were having engine problems and were waiting for repairs. The repair took forever. People were frantically calling their places of employment, canceling meetings and trying to explain to their supervisors why they were going to be late once again. Finally, the train started moving, and I arrived at work at approximately 10:15 a.m. — nearly two hours late. I thought to myself, “This has to be as bad as it gets.” I was wrong. Later in the day, I went to South Station to take the 5:00PM P523 train home. If the train runs on schedule, I arrive at Union Station in Worcester around 6:20 p.m. and I’m home with my wife by around 6:30 p.m. The train left as scheduled, but promptly broke down not even four miles from South Station as we coasted near Newton. Here I sit at 6:50 p.m. Still in Newton. Still stranded. The last time I checked the MBTA web site, it said our train was delayed “25-30 minutes.” That would be great if it was true. Instead, here I sit in commuter rail hell as other outbound trains zip by us. My

laptop battery is almost dead and my cell phone battery died long ago, a casualty of the morning commute, so I’ll have to find my story when I get home…whenever that will be. Another train finally hooks on to us at the front of the train and pulls us on our way after 7:00 p.m. We have to make “double stops” at each station because the platforms aren’t long enough to accommodate a double-length train. This further delays the commute, and we roll into Union Station in Worcester at approximately 9:20 p.m. — three hours late. Upset passengers rushed to their cars, knowing that dinner is ice cold, the kids are in bed, and it’s nearly time get some sleep. Who knows what it in store for the morning commute? It could be another very long day. Unfortunately, delays like this are becoming more and more common on the Worcester-Framingham commuter rail line. If the executives at my professional services company ran their company like this, they would have been out of business long, long ago. Every transportation official I see on the television or in the paper these days cites the problem as “lack of communication.” They would have everyone believe that, as long as they are better about informing commuter rail passengers of delays, everything will be fine. That’s rubbish. They will also have you believe that these types of delays are rare. More rubbish. There is no money to fix the trains, so common sense would tell any somewhat intelligent individual that the trains will keep getting worse and more delays are eminent. Better communication is good, but until the mechanical issues are fixed the delays will continue to occur—and much more frequently as the machinery continues to deteriorate with each passing day. How many days can workers like me be late for work while employers look the other way? How many delays are commuters expected to bear?

Do you know anyone with a drug problem? AS K E D AT N U C AF E ON C H AN DL E R ST R E ET

Yeah, they had past drug problems.

Ivelisse Ruiz WORCESTER

Yes. It’s tough, it definitely affects everyone’s life around them.

Jenna Pearson BELLINGHAM

A cousin of mine. I know he got divorced, pretty much exiled … he would borrow money, then spend it on drugs, like cocaine.

Jim Farrell BOSTON No

Hoselito Rapi

J OH N B R A DY Worcester

WORCESTER

Tell us how you really feel Letters to the editor should be legible, signed and brief (preferably no more than 200 words). A daytime telephone number must be provided for verification. Worccester Mag reserves the right to edit letters for length, clarity, libelous or offensive material and style. Send letters to: Letters, Worcester Mag, 101 Water St., Worcester, MA 01604 or E-mail: editor@worcestermagazine.com, or fax: 508-749-3165 A preview of what you’ll find online at worcestermag.com this week

ONLINE EXTRA

• Behind the Story - Jeremy Shulkin speaks about writing this week’s feature story on heroin in Worcester • Not Fit for Print - Stephen DiRado’s short film showcases the city’s latest storm • WooTown Sounds – Heavy sounds from Omega Reign • Benedetti and Melican – The WoMag sponsored 508 duo debuts a new video to accompany our feature on heroin in the city • Best of Worcester - Your opportunity to vote for our biggest contest is coming to an end quickly, vote today!

Yeah … marijuana. People claim it’s the thing that causes them to be productive, but usually I’ve found that … it’s just one more way to procrastinate.

Alex Shapeton WORCESTER PHOTOS BY LISA AUBE

Cute Smiles DENTAL

FAMILY & COSMETIC DENTISTRY Dr. Kenny Lam, D.M.D. • Dr. Michelle Wilkerson, D.D.S. (Pediatric Dentist) 3UHYHQWDWLYH&DUH‡)LOLQJV‡([WUDFWLRQV‡5RRW&DQDOV‡/XPLQHHUVŠ &URZQV‡)XOO 3DUWLDO'HQWXUHV‡&RVPHWLF:RUN‡'LJLWDO;5D\V

10

WORCESTERMAG.COM

EXP. 3/31/11

$75 Cleaning

00

$179

00

(Reg. $400.00)

• MARCH 3, 2011

EXP. 3/31/11

Teeth Whitening Special

New Patient Special

$20 OFF

On Your First Restorative Work (Filling, Extract, Etc.) Cannot be combined with any insurance. Some restrictions apply. Call office for details.

EXP. 3/31/11

809 Grafton St., Worcester • 508-770-0800 Monday - Tuesday: 9-6, Wednesday: 9-7:30, Thursday - Friday: 9-6, Saturday: 9-5 ACCEPTING MASSHEALTH AND MOST DENTAL INSURANCES

DG N A IN R G EN OP


{ coverstory }

Cheap, prevalent and powerful NOW A STATUS DRUG, HEROIN REACHES NEW DEMOGRAPHICS Jeremy Shulkin

Inside of a black leather bag Gino (not his real name) carries a syringe, a needle, the bottom of a Coke can, and a spoon. Despite standing in the rain with two relative strangers, he’s talkative and open to sharing details about his heroin use.

“I had to work my way up to this,” he says, when asked if the half-gram baggie of white and brown-flecked powder is the amount he normally shoots. He puts it in a spoon, mixes in some Worcester rainwater and heats it up. Gino, in his 50s, has always battled drug addiction, but a daily craving for heroin started relatively recently. He’s been using for five or six years, but as he turns the syringe to his arm he points out that he still has the veins to inject into. (Long-time users’ veins often collapse.) It’s 9 a.m. and Gino, has done the equivalent of three bags. It cost him $50 (a “value pack,” he calls it). In an earlier conversation, he says sometimes he does as much as 1.5 grams per day. Heroin had an early hold over Baxter. He remembers as a kid on his way to school having to step over a neighbor strung out on the steps of his housing unit in Main South. That same neighbor made a habit of spraying his own bloody initials on the wall with recently used syringes. Years of physical and sexual abuse, compounded with depression and stress disorders increased his dependency on drugs. His daughter started using heroin 10 years before he did. A ruptured disc in his back led him to pain

pills, and he self-medicated with heroin in lieu of surgery. “I never thought of myself that I’d become an addict.” In a twist that shows the psyche of drug addicts and the strength of an addiction, as drugs distanced him from his family he decided to prove his worth: “I set out to be the best junkie I could be.” “They think of me like this,” he says, “well, I’m going to fucking show them.”

A RISE IN THOSE SEEKING TREATMENT “Worcester’s kind of known for its heroin use,” says Rodney Witkos, an UMass Memorial EMT with 20 years of experience. Witkos also runs a blog called Wormtown Medic. He says Worcester’s heroin use has remained steady over the years, and statistics from the past decade reiterate the city’s ups and downs. After huge decreases in heroin use, the number of users has ticked back up recently. In the past decade, admissions to treatment centers who reported their residence as Worcester peaked in 2001 with 4,369 referrals for heroin (compared to 4,066 for alcohol and 1,951 for cocaine), but that number decreased sharply to 2,275 by FY 2007. But in FY 2010, the number rose to 2,608. While the numbers have significantly decreased since the beginning of the decade, the percentages show the drug’s

comeback. Of the 4,460 admissions into substance abuse programs in Worcester in fiscal year 2007, 35 percent sought treatment for alcohol, while 47 percent arrived for heroin addictions – 11 percent higher than the state average in that same time-span. With nearly 500 more referrals in FY 2010, alcohol dropped to 32 percent, but heroin treatment rose to 54 percent. As the state average rose only 2 percent, in Worcester it jumped up by 7. It hasn’t gone unnoticed. Kristin Nolan, director of outpatient services at Spectrum Health Systems, a substance-abuse and mental-health treatment center that on average treats 1,100 users between two Worcester outpatient clinics, says outpatient care for opiate addiction has risen 10 percent within the last year. She also points out that only a fraction – about 1/10 – of those with an addiction seek treatment.

NEW ADDICTIONS One hypothesis for the increase in opiate users comes from the availability of prescription pain pills. In other words, doctors prescribe them so often and at such high quantities that they’re easy to find in medicine cabinets or from family members and acquaintances. Edward W. Boyer, a medical toxicologist at UMass Memorial Hospital who recently won a grant to research

continued on page 12

MARCH 3, 2011 • WORCESTERMAG.COM

11


{ coverstory } continued from page 11

prescribed opioid abuse and dependence, puts it this way: “You talk to enough people in drug treatment who see patients who were formerly on Percocet, then OxyContin, then heroin.� “If you take four Percocet four times a day, day after day, at some point if you then tried to stop that medication, you’d find out you get sick,� says Jay Broadhurst, an assistant professor at UMass Medical School and physician at UMass Memorial and Spectrum Health

Services. It’s a feeling – called “dope sick� – that heroin addicts know well. That sickness underlies the craving for another dose of the drug. “Klonopin, OxyContin, Vicodin, Percocet,� Baxter lists, “people who have them legitimately in their medicine cabinets don’t realize what they’ve got in there.� “It’s a good starter kit,� he adds. “Heroin has the same effect,� says Boyer of the pharmaceuticals. But heroin has two advantages over the prescription

Get Your Associate Degree in as little as 13 months! CLASSES ARE FORMING NOW FOR: Culinary Arts Medical Assisting Emergency Medical Technician Business Office Administration Legal Office Administration Medical Office Administration Accounting Massage Therapy - COMTA accredited Medical Billing and Coding Office Support Specialist t'JOBODJBMBJEBWBJMBCMFUPUIPTFXIPRVBMJGZ t%BZBOEFWFOJOHDMBTTFTBSFGPSNJOHOPX t$BSFFSQMBDFNFOUBTTJTUBODF

Call or Click Today!

888-569-9996 salter.edu

184 W. Boylston Street West Boylston, MA

A Private Two-Year College

drugs. “It’s cheaper than pills and faster than waiting in a waiting room.� One OxyContin pill on the street costs about $1 per milligram, generally falling somewhere between $80 and $100 each. (Because of the “80� mgs stamped on each one, they’ve developed the nickname “Jerry Rice’s.�) For the same amount of money, one could purchase nearly 50 bags of heroin. The relative cheapness of the drug coupled with the pharmaceutical drugs popular with a younger demographic have altered the population of those seeking opiate abuse treatment. Nolan, along with other treatment center directors, medical personnel and local law enforcement have all noticed an increase in younger users. “It’s a different demographic,� says Tim O’Connor, a former Worcester Police Department lieutenant. O’Connor left the WPD in 2009 after 20 years in the vice squad, and now teaches drug and criminal justice classes at Clark University, Quinsigamond Community College and the Massachusetts Criminal Justice Training Council. Teens who raided their parents’ medicine cabinet get hooked. When the pills run out, they can’t afford to pay $80 for one hit. “Most kids start snorting [heroin], saying they’ll never put a needle in their arm. Then they realize they’re not getting the same effect,� O’Connor suggests. Because of the younger users, heroin doesn’t have the stigma it once did. In fact, because they’ve been priced out of pills, heroin has become a de-facto status drug. “A lot of young people out here these days, they want to do it because they want the experience,� says Gino. “I’m amazed by it. “You don’t want to end up like me, do you? I say that to them.� “We are seeing users as early as teens, early 20s,� says Worcester District Attorney Joseph Early. “It’s the cheapest it’s ever been right now,� adding that it’s now easier to find too. The trend should worry local police.

DIVORCE MEDIATION If you can’t save your marriage, you can save your divorce.

Divorce can be expensive ‌ Mediation allows you to save, time and emotional energy. Protect your rights while preserving your family’s resources. Other Available Services: • Flat Fees • Expedited weekend & night appointments • Limited Issues Mediation

Since 1975 James F. Connors SUPER LAWYER

CertiÀed by AAML since 1991, Norfzeiger Institute since 1981 Education: St. Bernard High School, Assumption College, University of Paris; Sorbonne, Suffolk University Law School. Languages: English, French & Spanish Articles: Divorce and The Wheel of the Addiction, Demystifying Divorce. Instructor: ABA family law section, MBA family law section, WBA family law section, Massachusetts Supreme Court study on Addiction and the Court, Mt. Wachusett Community College, Law Education Institute. Member of: Fitchburg School Committee 2002-2010, Board of Directors; Montachusett Alcohol Council, Lawyers Concerned for Lawyers, Spectrum Health Services, Fay Club.

95 Elm Street, Worcester

12

508 -792-3006 WORCESTERMAG.COM

www.attyjfconnors.com • connorsesquire@gmail.com • MARCH 3, 2011

58 Oliver Street, Fitchburg

978 -345 -2671

Vice squad officers like O’Connor prided themselves on their connections, counting repeat arrestees as acquaintances and knowing who did what and went where. Generally, with addicts in their 30s, 40s and 50s officers had an easier time relating with them. Younger addicts, however, generally still rebel against arresting officers.

CHEAP AND POTENT Like any other business, the drug trade follows the free-market economy: supply versus demand determines the prices, and as heroin use rises statewide and citywide, prices have dropped. According to the Substance Abuse and Mental Health Services Administration, Massachusetts ranks 15th in population but 5th in number of people treated for opiate addiction. The state is also one of 16 where opiate-related deaths have eclipsed motor-vehicle fatalities.

According to Early, not only have dealer arrests risen in Worcester County, but as purity levels rise, so have overdoses. The Massachusetts Department of Public Health has quantified the trend. While statistics since 2008 aren’t available, Worcester has been among the top four cities in the state for fatal opioid-related overdoses, with 21 in 2006, 33 in 2007 and 25 in 2008. In that three-year period only Boston, with 224 fatal overdoses, outranks Worcester (87). Boston, however, has seen significant declines each year, dropping from 90 fatal overdoses in 2006 to 82 in 2007 and 52 in 2008. According to a recent Boston Herald article, the numbers continued to drop, slipping to 16 in 2009 and 21 in 2010. There have already been five this year. The Worcester Police Department counted 117 overdoses in 2010, seven of them fatal. So far in 2011 the WPD has responded to 15 overdoses, but did not say whether or not they’ve resulted in any deaths. “It’s very significant, very frightening,� says acting deputy director of Substance Abuse Services at the Department of Public Health, Hilary Jacobs, who notes that this reflects a national trend. “We’ve known basically since the late 1990s that very cheap, low-cost heroin has been available in Massachusetts,� says Michael Botticelli, the director of Substance Abuse Services at the


{ coverstory } Department of Public Health. Instead of buying bags, users have started buying by the gram. Today local law enforcement has seen an entire gram fetch $80, enough for 50 bags of heroin, and that’s before that amount is more than doubled when it’s cut with other chemicals. A kilogram, the Drug Enforcement Agency estimates, sells for

“I can tell certain things, but I can’t label them,” when asked if he knows what his heroin is cut with. Sometimes the high can vary. Cocaine has a “speedier” effect, while Valium is “mellow.” Methadone makes the high last longer, but it often just tricks users into thinking they’ve found great dope. “They think it’s great so they’ll go get

STEVEN KING

Tim O’Connor, twenty year veteran of WPD, now teaches drug and criminal justice classes at local universities and the Mass Criminal Justice Training Council.

between $50,000 and $80,000. That’s 50,000 bags of heroin before it’s cut. While relatively new heroin users want their drug purer as it’s easier to inhale, addicts whose craving for the drug requires direct injection into veins look for less pure batches. “Heroin is always cut with something,” says Boyer. He remembers a few years ago, thousands of deaths in the Midwest related back to a batch of heroin cut with fentanyl, a powerful drug used in pain management and cancer treatment. “What it’s cut with changes from time to time, place to place,” he adds. Cutting agents run from household items like flour, baking soda, powdered milk to baby powder. Sometimes suppliers or dealers use cocaine. More often than not, cringe-worthy chemicals find their way in. In Worcester alone, police and EMTs have seen mannitol, a baby laxative and glaucoma treatment in veterinary medicine; scopolamine, a drug for treating motion sickness and intestinal cramping; ketamine – or Special K – a recreational rave drug that doubles as an emergency surgery anesthetic in war zones; and strychnine, more commonly known as rat poison. The batch Gino had was cut with vitamin B. “Sometimes a lighter color means more cut,” Gino says, confidently estimating his most recent buy at 30 percent pure.

their friends and bring them to a [dealer] who has a bottle of methadone powder.” Purity levels in Worcester vary from anywhere between 23 percent to slightly less than 40 percent. The Worcester Police Department, at the behest of O’Connor years ago, began running monthly Quality and Quantity (called Q and Qs) tests on seized heroin to determine what other chemicals found their way in. Recent Q and Qs, have varied between 9 and 30 percent purity. According to law enforcement, this puts Worcester’s heroin on the purer side of the spectrum – a dangerous development for users from other areas accustomed to dirtier drugs, or addicts who have stopped using (normally due to jail time) and pick up their habit at the rate they used before. Those purity levels have an impact on the community. “Every couple of months to half a year [there’s] a spurt of serious overdoses,” says Witkos, who thinks one bad batch came to Worcester about two months ago. Another UMass EMT, who didn’t want his named used, agreed with that time frame. The length of time that it’s on the streets, however, depends on how much came in and when the dealers caught wind of how powerful it was. “If they package an entire kilo, all that goes out with the same toxicity,” he says. But once they hear it’s strong, then they may take what’s left and re-cut it.

FOLLOWING THE TRAIL Heroin in Worcester isn’t just a part of the “war on drugs” in the United States, it’s also part of the actual drug war – the one that’s raging in parts of South America. According to the Drug Enforcement Agency, 95 percent of heroin comes into the United States mainly from Colombia and over the Mexican border, either by car or by plane. The same groups that grow, harvest, cut and package cocaine – leftist Colombian rebels, FARC may be the most well-known – use the same routes for shipping heroin north. The drugs arrive in U.S. hub cities like New York and Atlanta already in blocks and ready for distribution (state-side suppliers and dealers often opt to cut the heroin even more, however). At that point, it makes its way up through New York state or Rhode Island, traveling over the Mass Pike, I-290, or even via FedEx into Worcester. “We’ve gotten good at detecting hides,” says Early. “What they (state-police detectives) have been doing is they just try and stay smarter than the guys who are dealing.” Recent busts on I-290 have come from state police using K-9 units to detect heroin in false bottoms in trunks, or welded underneath the car’s chassis. Sometimes it comes through in “fingers” – literally fingers of rubber gloves cut off, filled with five to ten grams of heroin, tied off at the end, lubed up and swallowed by a drug mule. When local dealers receive their product it’s normally cut again and divided up into smaller bags. Little coinshop stamps are used to identify which dealer has what, normally just a common symbol like a heart or a crown. Based on the batch, users tell each other which symbols to look for and which ones to avoid.

FINDING TREATMENT

with a morning dose of a drinkable, opiate copycat, which limits their cravings for heroin. Massachusetts has 36 methadone clinics, with three—AdCare, Spectrum, and Community Healthlink—in Worcester. (Community Healthlink opened a 23-bed residential co-ed treatment center in 2006 just for adolescents.) But methadone clinics still pose problems for addicts. Visitors often go there for a morning dose – to “get straight” – then, once among other heroin users end up with a craving for the actual drug. Three and a half years ago, the state funded 14 clinics in high-incident areas (including Worcester) that have treated 3,500 people with opiate addictions using a drug called Suboxone. Like methadone, but with an even stronger block on the nerve receptors that heroin and other opiates stimulate, users can hold off their addiction for up to eight days on only one pill. Since the drug covers over the receptor, the body doesn’t crave heroin, knowing there’s nowhere for it to reach the nervous system. Since Suboxone blocks receptors for a longer period of time, the drug’s secondary benefit takes users out of daily visits to methadone clinics – something the state has clued into. The state has started to look into integrating Suboxone into primary-care centers and doctors’ offices. Calling it office-based opiate treatment, the idea gives those seeking help with their addiction a closed-door office and personal visit with a physician. “If you walk into a community-health center, it’s not clear if you’re there for primary care or drug treatment,” says Botticelli. “In some ways, that’s how it should be.” But Suboxone has also continued on page 15

IT’S ALMOST HERE! ST. PATRICK’S DAY BASH AT

The most recognizable treatment for heroin addiction is methadone, a synthetic drug that provides Intersection of Rtes. 20 & 9, Northboro addicts 508-842-8420 www.jbag.biz

MARCH 3, 2011 • WORCESTERMAG.COM

13


14

WORCESTERMAG.COM

• MARCH 3, 2011


continued from page 13

made its way to the streets. Despite heavy safeguards and monitoring of Suboxone pills by prescribing doctors, users often sell theirs to others with expensive habits, who then use the pills to bring down their body’s tolerance. But even with those drawbacks, studies by the Department of Public Health show that methadone works. The state’s latest Methadone Quality Assurance Report from July 1 to September 30, 2010, showed that of 2,096 opiate addicts in methadone treatment for less than 12 months, 73 percent remained opiate-free since. For the 5,153 people who remained in treatment longer than 12 months, random drug testing found that 87 percent stayed opiate-free. Nolan says Spectrum Health Services has an 85 percent success rate, which means no toxins found in their patients’ systems (with an exception made for methadone) and they display “proper social behaviors.” At the state level, the Department of Public Health has turned to treatment and re-entry services for heroin addicts. “There’s been too much focus on supply-side issues. We have to pay equal attention to demand reduction,” says Botticelli. “How do we make sure those with addictions get adequate treatment?” The penal system is one starting point. “It’s much less expensive to provide addiction treatment than to incarcerate,” says Botticelli, and with treatment “you seriously reduce the rate of recidivism.” Botticelli estimates that nationwide, 70 to 90 percent of prisoners have some kind of substance-abuse issue. According to statistics from Derek Brindisi, director of public health for the city of Worcester, 13 percent of inmates will have an opiaterelated overdose within 72 hours of their release from the Worcester County Jail. The city has begun working with the jail to create a program that educates inmates on the danger of picking up a drug habit after months or years away from it and various treatment programs postrelease. “Since many are coming back to the community, how do we make sure they have re-entry services?” asks Botticelli. The first step is to get them there. Both at the state and local level there’s been a push to encourage users to call 911. According to Brindisi, 50 percent of Worcester’s fatal overdoses didn’t call 911 for fear of police involvement – a stat that leads him to believe there are actually a higher number of deaths than what’s been reported. This has led to coordination between health departments working with local police forces through a grant called Mass Call 2, which asks for federal funding to articulate to the community that users who call 911 for an overdose will not be arrested for possession of drugs or paraphernalia. Other charges, such as trafficking or any outstanding warrants, though, aren’t exempt. The WPD follows

{ coverstory }

STEVEN KING

these guidelines, and a similar “limited immunity” law may come through the state house.

WHAT MORE COULD BE DONE? Despite Worcester’s efforts that screen emergencyroom admissions for drug abuse and collect used needles, other communities in the Commonwealth have added more resources to cut down on drug abuse and overdoses. Nascent state and local programs have shown promise in cutting down on death and the transmission of disease, but public opinion regarding needle sharing and overdose treatment has been difficult to overcome. Outcry over installing needle deposit boxes in four locations in Worcester led to delays in the initiative’s debut, and even to this day local officials point out that it’s not a “needle exchange,” understanding the loaded terminology. While Brindisi says the bulk of used syringes deposited into the Yellow Boxes come from diabetics and not illegal drug users (Gino concurs), Joe McKee, executive

director of AID Project Worcester (APW) says a significant number of sharps collected at their drop-off point come from illegal drug users. McKee remembers the controversy the program stirred, rendering its success even more rewarding. “People argued about it, people said they would never be responsible.” Jesse Pack, director of prevention and education at APW hails the state’s 2006 syringe access law, allowing those over 18 years old to legally purchase clean needles from pharmacies. There’s been a marked reduction in new exposures to HIV/AIDS in Worcester via drug use. “[That] pharmacy bill is a huge public health success,” McKee praises. The Boston Public Health Department began distributing a powerful anti-opiate nasal spray naloxone (called Narcan) to addicts and their family members in 2006. When administered to an individual who has overdosed, the drug blocks opiate

receptors in the nervous system and helps them breathe again. UMass EMS carry Narcan, and Brinidisi says that despite data that shows distributing it to users and family members lowers rates of death related to overdose, local anti-Narcan sentiment has kept that from happening in Worcester. “There’s not enough readiness in the community right now,” Brindisi says diplomatically. EMTs have their own stories about administering Narcan. “We use it with an alarming frequency,” says Witkos. Witkos recites images from overdose scenes. EMTs will come in and find a user drenched in ice water or with ice cubes packed into their crotches, their company hoping the cold would be enough to wake them up. (It’s not.) Watching someone wake up from an overdose because of Narcan brings to mind the scene from “Pulp Fiction” where John Travolta and Eric Stoltz seemingly bring Uma Thurman back from the dead. Witkos calls it a “dramatic recovery,” but because the half-life of Narcan is shorter than the amount of time heroin stays in a person body trying to bind to their opiate receptors, the patient still needs further medical attention. This is often a challenge. Despite likely having just cheated death, users generally wake up raging that they’ve lost their high, leading to attacks against first responders. But Witkos doesn’t mind that Worcester hasn’t modeled a Narcan distribution system after Boston. continued on page 16

LEPRECHAUNS ARE HIDING AT JJ’S! MARCH 17! Intersection of Rtes. 20 & 9, Northboro 508-842-8420 www.jbag.biz MARCH 3, 2011 • WORCESTERMAG.COM

15


{ coverstory } STEVEN KING

continued from page 15

Citing quick EMT and fire-department response times, he says, “I don’t think anyone’s going to be hurt by not having Narcan.” He does suggest that addicts who shoot up alone do put themselves at more of a risk, though. The other EMT disagrees though. He’s working on creating safe needle exchanges that go beyond the already installed city Yellow Box needle drop-offs and other harm reduction programs. Gino admits he’s overdosed before and been saved by Narcan – he remembers one particularly bad batch that was cut with a horse tranquilizer. “It came with a warning from the dealer. I didn’t listen.”

PUSH FOR CHANGE

As unemployment remains high and the heroin junkie stigma fades away with younger users, these are not optimistic times for treatment centers and those suffering from addiction. Public misunderstanding about opiate-

Derek Brindisi, director of public health for the city addiction treatment has also held back the city’s effort to lower overdose rates. “There are some truly sick people out there who need help, but no one gives a fuck about them,” says one EMT.

While APW hails the gains made by the yellow boxes, the pharmacy act and local groups working with the city’s DPH to curb drug addiction and refer to treatment as “filling the gap,” personally, Pack

Parade Day Sunday

16

believes the city should have a full-blown needle exchange program. “A properly designed needle exchange in Worcester would be a major public health boon,” he says. Boston has had one for over a decade. “It’s a cruel stereotype we have of drug users, that they can’t take care of themselves,” says Pack, who argues that if the right tools are provided, addicts have better odds than people think. “I battle my addiction daily, but I’m not giving up on myself,” says Gino. He’s ready to overcome his addiction to heroin like he’s done previously with other drugs. He’s obtained two Suboxone pills and has a friend in a remote Massachusetts town willing to put him up for two months to get sober. He plans on going over the weekend. “It’s killing me. I’m literally sick of it.” But by 9:30 a.m. on Friday morning, he’s already shot up a bag. He might do it again two more times before he goes to bed. “I’ve never done a regimen before other than the heroin,” he says. “There’s always room for more education,” notes Nolan. “You don’t want to turn a blind eye to your community.”

March 13th Stop by our Food and Beer Tent from 11 a.m. - 3 p.m. featuring:

234 Chandler St. Worcester 508-459-4240 EVODINING.com

Bud Light on Tap Irish Bangers and Mashed Restaurant open with regular menu items Chad Clements performs 12 p.m. - 3 p.m.

Monday Closed, Tuesday - Thursday 11a.m. - 10p.m., Friday 11a.m. - 11p.m. Saturday 8a.m. - 11p.m., Sunday 8a.m. - 10p.m. * Kitchen closes 1 hour prior to closing WORCESTERMAG.COM

• MARCH 3, 2011


Paid Advertisement

$QWLFLSDWLRQ+LJKDV2KLR9DOOH\*ROGDQG6LOYHU5HĂ€QHU\ Opens for Business Next Week in Marlborough & Worcester! By DAVID MORGAN STAFF WRITER

Been following the gold and silver market lately? Well if you have a jewelry box or lock box full of gold or a coffee can full of old coins you should be according to Ohio 9DOOH\ 5HÂżQHU\ VSRNHVSHUVRQ -RKQ 0LOOHU “The gold and silver markets have not been WKLV VWURQJ IRU RYHU  \HDUV´ VDLG 0LOOHU Typically when the U.S. dollar is weak and WKHHFRQRP\LVĂ€DWJROGDQGVLOYHUPDUNHWV soar. “That’s good news if you are sitting on a few gold necklaces or an old class ring,â€? VD\V0LOOHU Next week, starting Tuesday at 9am and every day next week through Saturday, WKH2KLR9DOOH\5HÂżQHU\ZLOOEHVHWWLQJXS D VDWHOOLWH UHÂżQHU\ ULJKW KHUH LQ Worcester at the Best Western Royal Plaza Hotel & Trade Center and the Quality Inn & Suites in Marlborough. During their 5 day stay, anyone can bring gold, silver or platinum items and turn them in for immediate SD\PHQW H[SODLQV -RKQ 0LOOHU Âł-XVW DERXW everybody has some amount of gold or silver just lying around collecting dust and next week anybody can sell theirs direct WR RXU UHÂżQHU\ 7\SLFDOO\ VHOOLQJ GLUHFW WR D UHÂżQHU\ LV UHVHUYHG IRU ODUJHU ZKROHVDOH customers like jewelry stores, pawn shops, DQG ODERUDWRULHV´ VD\V 0LOOHU Âł:H DUH changing how business is done,â€? he explains. “We want to do business with everybody so we took our business to the streets. Our teams visits various cities around the country hosting 5 day events allowing the general public to take advantage of our services. The WXUQRXWKDVEHHQRYHUZKHOPLQJ´VD\V0LOOHU “Usually each day is busier than the previous day. It seems once people come to us and sell something, they are so amazed by what an old ring or gold coin is worth that they go home and start digging around for more and tell relatives, friends and neighbors. It’s like a feeding frenzy by the third day. People line up with everything from gold jewelry WR VWHUOLQJ VLOYHU Ă€DWZDUH VHWV WR ROG FRLQV I think during this bad economy everybody can use extra money but most people say they are taking advantage of selling direct to RXUUHÂżQHU\EHFDXVHRIWKHKLJKHUSULFHVZH pay.â€? During this special event anyone is welcome to bring all types of gold, silver DQG SODWLQXP WR WKH UHÂżQHU\ DQG WXUQ LW LQ

for instant payment. The types of items they will accept include: all gold jewelry, gold coins, gold ounces and dental gold. We also buy coins dated 1964 and before including: Silver Dollars, halves, quarters and dimes. Anything marked “sterlingâ€? is accepted LQFOXGLQJ Ă€DW ZDUH VHWV WHD SRWV VLOYHU bars, silver ounces and all industrial precious metals. What should you expect if you go to the event to sell your gold and/or silver? Just gather up all gold silver and platinum in any form. If you are not sure if its gold or silver, bring it in and they will test it for free. When you arrive at the event you will be asked to ÂżOORXWDVLPSOHUHJLVWUDWLRQFDUGDQGZLOOEH issued a number. Seating will be available. When your number is called you will be escorted to a table where your items will be examined, tested and sorted. This only takes a few minutes using their expertise and specialized equipment. Items will be counted and/or weighed. The value of the items will be determined based on up to the minute market prices. Live feeds will be available at the event displaying current market prices of all precious metals. If you choose to sell your items, they will be bagged and tagged and you will be escorted to the cashier to collect your payment. Waiting time to sell your items may range from just a few minutes to 1 hour so bring something to read. If you are the owner of a jewelry store, SDZQ VKRS GHQWLVW RIÂżFH RU D GHDOHU \RX are encouraged to call ahead to make an appointment with the smelt master to discuss their special dealer programs. You can call our venue to make an appointment at (217) 787-7767.  2KLR 9DOOH\ 5HÂżQHU\ ZLOO RSHQ IRU business Tuesday from 9am-6pm. The event continues every day through next Saturday. No appointment is needed.

Items we will accept include: Sterling Silverware Sterling Silver Tea Sets %FOUBM(PMEt4JMWFS%PMMBST All Coins Dated before 1964 4DSBQ+FXFMSZt*OEVTUSJBM4DSBQ All forms of Platinum

Above: Refinery representatives will be on hand next week starting Tuesday to purchase all gold, silver and platinum items, as well as coins. Public welcome!

Items of Interest: WE BUY 10¢ & 12¢ COMIC BOOKS!

Vintage Guitars: 0DUWLQ*LEVRQ)HQGHU1DWLRQDO 5LFNHQEDFNHU*UHWVFK0DQGROLQV Banjos and others. Pocket Watches: Hamilton, Illinois, Waltham, Patek Phillipe, Ball, Howard, South Bend, Elgin and others Wrist watches: Omega, Accutron, Longines, Hamilton, Breitling and many more. Old paper money: United States, Confederate States, Blanket Bills, $1000.00 bills and more. Antique Toys: Trains, 7LQZLQGXSV0HFKDQLFDO%DQNV Robots, Pressed Steel trucks, and many more. War Memorabilia: Swords, %D\RQHWV+HOPHWV*HUPDQ Confederate, Union, USA, and others.

7KH2KLR9DOOH\5HÂżQHU\LVIHDWXUHGLQORFDWLRQVWKLVZHHN

March 8th - 12th Marlborough:

Worcester:

Best Western Royal Plaza Hotel & Trade Center

Quality Inn & Suites

181 Boston Post Road West Directions: (508) 460-0700

50 Oriol Drive Directions: (508) 852-2800

FREE ADMISSION Tuesday-Friday: 9AM - 6PM Saturday: 9AM - 4PM MARCH 3, 2011 • WORCESTERMAG.COM

17


18

Paid Advertisement

Š‹‘ƒŽŽ‡›‡ϐ‹‡”›‹•—›‹‰Š‡•‡ –‡•‹‰Š– ‡”‡ ‘—”‘™Ǥ —†”‡†• ƒ˜‡Ž”‡ƒ†›ƒ•Š‡† ǡ‘ǯ–‹••‘—”’’‘”–—‹–›Ǩ

WHEAT CENTS UP TO $1,500*

LARGE CENT UP TO $3,800*

2 CENT PIECES UP TO $2,000*

3 CENT PIECES UP TO $2,500*

BUFFALO NICKELS UP TO $1,800*

WAR NICKEL UP TO $2,000*

V NICKELS UP TO $2,800*

SHIELD NICKELS UP TO $4,000*

CAPPED BUST HALF DIMES UP TO $10,000*

BARBER DIMES UP TO $2,800*

MERCURY DIMES UP TO $3,600*

50 CENT GOLD COIN UP TO $8,500*

$1 GOLD COIN UP TO $14,000*

TURBAN HEAD GOLD COIN UP TO $40,000*

INDIAN HEAD CENTS UP TO $500*

SEATED LIBERTY DIMES UP TO $6,500*

BARBER QUARTER STANDING LIBERTY QUARTERS UP TO $3,200* UP TO $4,400*

BARBER HALVES KENNEDY HALVES UP TO 8X FACE VALUE* UP TO $6,750*

FLOWING HAIR GOLD COIN UP TO $125,000*

1797 $1 UP TO $200,000*

1798 $5 UP TO $125,000*

$2.5 GOLD COIN UP TO $3,800*

$5 GOLD COIN UP TO $4,500*

WE PURCHASE SCRAP GOLD & SILVER!

LIBERTY HALVES UP TO $4,700*

PEACE DOLLARS UP TO $3,000*

MORGAN SILVER DOLLARS UP TO $100,000*

DRAPED BUST 1/2 CENT UP TO $5,000*

1832 1/2 CENT UP TO $80,000*

$10 GOLD COIN UP TO $5,500*

$20 GOLD COIN UP TO $6,800*

ΎdŚŝƐĂŵŽƵŶƚĚĞƉĞŶĚƐƵƉŽŶƌĂƌŝƚLJ͕ĐŽŶĚŝƟŽŶĂŶĚǁŚĂƚĐŽůůĞĐƚŽƌƐĂƌĞǁŝůůŝŶŐƚŽƉĂLJ

7KH2KLR9DOOH\5H¿QHU\LVIHDWXUHGLQORFDWLRQVWKLVZHHN

March 8th - 12th

We Also Purchase Silverware Sets Pocket Watches Sports Memorabilia Comic Books

1849C Gold Dollar

OFFERS BASED ON GREY SHEET PRICES

1932D Washington

       Ǩ

        Ǩ WORCESTERMAG.COM

• MARCH 3, 2011

Marlborough:

Worcester:

Best Western Royal Plaza Hotel & Trade Center

Quality Inn & Suites

181 Boston Post Road West Directions: (508) 460-0700

50 Oriol Drive Directions: (508) 852-2800

FREE ADMISSION Tuesday-Friday: 9AM - 6PM Saturday: 9AM - 4PM


night day& March 3 - 9, 2011

art | dining | nightlife

Talent and Tenacity at Dark World page 20

MARCH 3, 2011 • WORCESTERMAG.COM

19


night day &

{ arts }

Paul Grignon

Talent and Tenacity

On March 5, The Dark World Gallery at 179 Grafton St. once again plays host to yet another playful and precocious young artist, Keenan Cassidy. An exhibit of his wealth of techniques will be on display during the On Fire and Out of Control II show, a sequel to an earlier exhibit Keenan had at the Dark World in 2008.

This show will contain about 25 mixed-media pieces as the artist delves into a myriad of ideas from symbolism and the surreal, to the experimental side, and collage. Keenan incorporates a vast array of influences into his craft, notably contemporary artists such as Warhol, Rauschenberg and Basquiat, as well as a nod to Banksy, the more recent enfant terrible of the British underground. “I

Keenan has also silkscreened double anchors on the brim of the tricorne, a variation of the wellknown skull and crossbones. In the distance, a ghostly galleon plows the waters, reminiscent of the Flying Dutchman. In all, a superb commingling of disparate techniques highlighting the diverse talents of this confident young

admire the guerilla and street artists, as their collective force and energy in art is unparalleled,” Keenan observes. At the tender age of 16, Keenan has proved to be a force to be reckoned with, displaying both showmanship and marketing skills that rival those twice his senior. Combining savvy business acumen with sheer exuberance has allowed him to showcase his varied talents in numerous shows across Worcester and in Boston, as well as exhibiting his craft in publicart projects, and work in film. “I’ve been creating art forever!” he exclaims, and his enthusiasm is instantly contagious. “This show is a culmination of current and older work and functions as a crossroads of situations, characters and miscellany,” Keenan adds. “Shipwreck Zombie” is just such a hybrid creation, perhaps a macabre take on Hillenberg’s “Painty the Pirate.” With a combination of acrylic, gouache, and felt-tip marker, Keenan deftly utilizes this medley of mediums to portray this ghastly creature of the undead. Painted on canvas,

Voted Worcester’s Best Bakery 44 times! Help us add another to the list-log onto worcestermag.com and vote today!

TRY OUR EXTRAORDINARY DESSERTS Creme Anglaise Individual Pecan Tarts Chocolate Truffle Tarts Pear Frangipane Tarts Apricot Almond Tarts Creme Brulee Fruit Tarts Desserts in a Glass

WEDDING CAKE SPECIALISTS

Cookie & Pastry Trays for any Occasion Serving Worcester County since 1959

CROWN BAKERY

133 Gold Star Blvd., Worcester 508-852-0746 www.thecrownbakery.com Become a fan on Facebook!

20

WORCESTERMAG.COM

US

E

!! ME

!! T

E

AR

R HE

E!!

!!

2

$

CROWN BAKERY

OFF

any cake, torta or sheetcake w/ this coupon - Exp. 5/1/11 • MARCH 3, 2011

artist. In “Wheat Paste City,” Keenan attached Xeroxed pen sketches onto stretched canvas and collaged pages of a book denoting city themes. Here the influence of Raushcenberg’s “Combine” series is evident, as Keenan melds together multiple images, some found while spatters of paint cover text woven within the design. As cranes strain to construct, a raging caninelike creature wreaks havoc upon the urban scene, while billboards flash comfort foods along rooftops. The gargantuan and menacing dog, with the made-in-China insignia on its spine, possibly reveals the extent of that country’s immense control and influence over consumerism within the United States, a huge presence felt yet blithely ignored. “Sleepyhead,” an 18-by-22-inch painting, reveals a hint toward Chagall, as a winged and hooded gnome or dwarf peers out with a cryptic smile, perhaps enticing the viewer to partake in the bounty of herbs found cradled in a basket. In the distance, a goat-like silhouette cavorts, a harbinger of the effects of this mind-bending medicinal flora. Drips and splatters of ink, acrylic and spray paint punctuate the canvas, a diffusion of haze that echoes a dream-like state. The bewitching smile, coupled with a hypnotic stare, compels one to stand and stare, swallowed by the allure of some strange and exotic soporific. Keenan propels himself further with his 3-D designs, as an army of plastic monsters march in unison, their tiny yet troubling grins terrifying, a phalanx of plastic and mayhem on the move. “The real reason I’m doing this show is to bring the community together. Hopefully, my artwork will engage and entertain,” Keenan says. After one peruses his offerings, his mission is most certainly accomplished. “On Fire and Out of Control II” at the Dark World Gallery, 179 Grafton Street, Worcester. Opening Reception: March 5 from 7-10 p.m. For more info, contact darkworldgallery.com or the artist directly at keenancassidy.blogspot.com.


to the beholder, and how a particular toy relates to one’s life as the person gradually becomes an adult. As a child, one tends to dwell in make-believe, where entire worlds and characters are created and where sense and control can be attained. But what happens after a child has left the house to venture into the world as a grown-up? What becomes of that once-cherished toy, that threadbare lump destined to the dust heap, that still yearns to be touched once more? Twenty works are showcased here, an eclectic gathering of inventive bibelots and tchotchkes that speak to the respective artist in sundry ways. From painting to sewing, to photography and sculpture, to jewelry and animation, the art exudes a delight at recalling such bygone riches. Kidd Schall, with her “Blind Monster,”

{ arts }

recalls vivid memories of giving equal time to her multitude of stuffed animals, this piece representing that companionship. Here though, a plush, cuddly animal has been transmogrified into a leathery-winged and sightless creature, juxtaposing the soft lushness with something perhaps dredged from a childhood nightmare. The effect is startling, making one pause to ponder his or her own blind foray into adulthood. “I wanted to explore the relationship of childhood and creatures from myth and fairytales,” Kidd Schall says. “It’s a reflection of emotions, an attempt to identify with conflicts of youth and adulthood.” Richardson’s piece, “Hello Dolly,” is equally jarring, for she has employed a photograph of a simple doll, naked and exposed against the rough exterior of a wall. Skyclad and vulnerable,

Burman says, adding, “I now see her as a wizened old lady who came to college with me.” The black-and-white photo shows her beloved animal lying tattered and torn but comfortably upon a bedspread, one black-buttoned eye beseeching the viewer to stroke her ragged fur. “Re-Creation,” by Nathaniel Noton-Freeman, is an amazingly complex contraption that attempts to mimic movement in nature and how, ultimately, mankind fails to imitate such innate and internal machinery. “This piece serves to show how extraordinary and unique life on Earth is,” NotonFreeman says. Made of wood, metal and assorted wires, a crank is turned and with each revolution a suspended inanimate serpent rhythmically sways, an uncanny resemblance to a sidewinder. With childlike footfalls, one needs to wend their way slowly to fully appreciate and absorb these imaginative and re-invented toys in their entirety. “The Show About Toys” at the Clark University Gallery, 2nd Floor, 92 Downing Street, Worcester. Through March 25; Gallery hours: Mon-Thu: 9-8 p.m.; Fri: 9-4 p.m.; Sat-Sun: noon-5 p.m. Note: The gallery will be closed March 5-13. For more info, contact Amanda at 631413-2817 or Stephanie at 508-4514225.

TellTale Toys

ZA

IN

K.

CO

M

Paul Grignon

W. ZA

Amanda Kidd Schall and Stephanie Richardson, both seniors at Clark, curated this exhibit, along with a bevy of other students. The show brings together art work from students and professors at the university, and artisans from the Worcester environs. The theme of the exhibit is to explore the nature of toys, of their individual meaning

&

WW

Who cannot remember a particular toy from their childhood that did not allow one to feel safe and sound? Fleeting memories of playthings of the past conjure images of comfort, and the Clark University Gallery showcases such nostalgia with their latest exhibit, The Show About Toys, where a wistful smile or two can be elicited after glimpsing such treasured objects of youth.

night day

the little girl represents the Feminine and how, even in prepubescence, girls can be objectified. As Richardson explains, “What’s her story? Where did she come from? Was she loved or replaced and given to Goodwill?” Ingeniously, she used a Holga, a cheap toy camera to produce this enigmatic image, arresting in its stark portrayal of an unclothed child, altering perceptions of girls and dolls and how they relate in the construct of society. “Ruffles,” by Molly Burman, is perhaps the quintessential toy, a bedraggled stuffed dog that has been clutched and clasped for decades. “She’s been living STURBRIDGE with me since I was born,”

MARCH 18-20, 2011 HOST HOTEL

MARCH 3, 2011 • WORCESTERMAG.COM

21


night day &

{ music }

A Burncoat livingroom concert series

Doreen Manning

Fans of live music of all beats and rhythms often agree on one thing – the atmosphere and setting for a live gig can make or break a show. Comfort, sound, the buzz of a room, and solid tunes you can sink your teeth into all converge into the perfect musical experience. The same can be said for the mindset of a musician or band. Feeling the music flow in the right state of mind, connecting with your audience, letting the sounds envelop you and your listeners – when it’s right, it can be like jamming for the simple pleasure of playing music you love. For Worcester’s Andy and Linda Levy, this is what their Our Burncoat Living Room house concerts are all about; sweet music in a low-key setting: their living room.

Fans of local music but not of the late, crowded nights, the Levys learned of the myth of a home-grown concert through a fan newsletter of Boston singer songwriter Les Sampou. “The idea of listening to a musician perform up close in someone’s living room seemed incredible,” recalls Andy Levy. What set the stage for the first show was back in November 2009, when their

22

friend, Stu Esty of Dr. Gonzo’s All-Natural Condiments, who claims to have been playing the living-room circuit since he was performing piano recitals as a kid, set up stage in their living room for about 20 or so friends. “It’s just you and some friends sharing a few giggles, music and some delicious food,” explains Esty. STEVEN KING

Plus, “folks actually listening to and appreciating the lyrics with no distractions.” The idea blossomed after checking out local bluesman Jon Short’s summertime gigs at Vincent’s backyard space. “We got to hear live blues, up close, in a venue that was more like someone’s backyard than the space outside the back door of a bar. The fact that Jon’s performances began at five or six o’clock was big plus. Most of the decent music in Worcester seems to begin at 9 or ten o’clock at night. That’s about the time we think about going to

OPEN EVERY SUNDAY YEAR ROUND • 8AM - 4PM • RAIN OR SHINE Door Prizes • Hidden Treasures • Fun 1340 Lunenburg Rd, (Rte 70) • Lancaster, MA 01523 (across from Kimball Farms) 978-534-4700 • www.thelancastermarketplace.com

1 FREE ADMISSION

with one paid admission with this ad WORCESTERMAG.COM

• MARCH 3, 2011

bed,” admits Levy. After chatting with Short after one of the Vincent’s gigs, the suggestion of a house concert came into the conversation, and before they knew it, another Our Burncoat Living Room performance was scheduled. That evening, Short played two longs sets, each close to two hours a piece. “I might have told more stories than usual but the people and the room seemed responsive, and I was having a good time,” recalls Short. With a handful of

guitars that normally don’t make it out of the house, Short found those in attendance – about 30 – attentive and supportive to the blues songs that came forth that weekend, unscripted and impromptu. “There was a

good energy in the room.” Levy, who admits he gets quite the thrill from a live music performance, says it is he and his wife’s pure love of music that initiates the now monthly series. “It’s great having people over who share a love of the music, and it’s great getting to know new people … The pot luck dinner that goes along with our house concerts always provides an interesting and delicious dinner.” Plus, when you have access to the musicians before and after the concert, the performance is what Levy explains as up close and personal as you can get to the music at its source. The costs are minimal for the Levys – they pass the hat for performers and ask for a minimum donation of $10-15 per person (all proceeds go directly to the artist). They typically provide coffee, tea and soft drinks, prepare one dish and invite others to join in a pot luck of edible options. So far privacy hasn’t been a problem. “We don’t disclose our address until someone contacts us to RSVP,” explains Levy. Coming up next in the Levy living room on March 27 will be Joe’s Truck Stop, whom Levy describes as a group of Berklee School of Music Students who play authentic old-time Appalachian music with incredible skill and energy. Sound like a show you’d dig? Then RSVP at alev999@gmail.com, cook up a dish, pull up a chair and let the music take the floor.

Precious Furs Pet Resort Boarding, Daycare & Exceptional Grooming ming • Spacious indoor/outdoor runs gs • Heated ‘outdoor’ runs for small dogs • 1, 2 & 3 story cat condos • Veterinarian recommended • National Certified Master Groomerr • Toys, food & supplies

508.987.2927

13 Lovett Road, Oxford, MA 01540

www.preciousfurspetresort.com


night day &

{ 320 }

A town like no other Jim Keogh

Thank goodness for documentary filmmaking, because without it the story of Mark Hogancamp may never have made it to a screen — his saga is simply too strange for fiction.

What screenwriter would have the stones to pitch this to a studio exec: 10 years ago Hogancamp was beaten so viciously by five men outside of a bar that he wound up in a coma. When he awoke he’d lost his long-term memory, the ability to speak, walk and write ... but he’d been cured of his alcoholism. His recovery was painful and slow. Since he couldn’t afford a therapy regimen, he fashioned his own by constructing a miniature World War IIera “town” in his backyard, populated by U.S. soldiers, Nazis and femme fatales – all dolls at a one-sixth scale. An artmagazine editor heard of his work and helped land him an exhibit in a tiny Greenwich Village gallery. I’d also mention the cross-dressing, but then you’d never believe me. What a tale is Marwencol, told with love and patience by director Jeff Malmberg, and with courage by

Hogancamp, who opens himself up to a camera like few ever had. Marwencol, the name of the town that Hogancamp invents, is the only place that makes sense to him; it’s both a sanctuary and an ever-evolving piece of art by an artist so obsessive that he “walks” his miniature Army jeep for miles to roughen up the tires so they don’t look new. Hogancamp’s obsession becomes viable once you begin to get a handle on how thoroughly his life was interrupted by the beating. Malmberg peels the story back delicately, letting us learn about Hogancamp through his own narration (he was married, but can’t recall anything about his ex; he was a gifted illustrator with R. Crumb-like talent, but drank it away) and through the voices of his friends in the small town of Kingston, N.Y. Each of them is represented by a doll in Marwencol, and they “participate” in the various WWII tableaux he devises with painstaking detail and then photographs for posterity. Hogancamp’s own bomberjacketed avatar is the hero, of course, falling in love, getting into scrapes with the Nazis, even being subjected to torture. The disturbing visual detail in some of these scenarios, and the rescue fantasies associated with them, are clearly Hogancamp’s postfacto effort to exert the control over his personal journey that he lost outside that bar 10 years earlier. Marwencol is reminiscent of Lars and the Real Girl, the 2007 film about a troubled young man who believes that a blow-up doll is his girlfriend. His fellow townies not only indulge his delusion, they enhance it by treating the doll as a flesh-and-blood person. Here too, Hogancamp gets little push-back from the local community, save for one woman who is understandably creeped out by the attention he lavishes on her doll and his fumbling attempt to establish an emotional connection with her. Marwencol is one of the most unusual, affecting movies you’ll see this year. In retrospect, the pitch is easy: man plays with dolls; man finds a life. Marwencol will be shown Thursday and Saturday at 7:30 p.m., and Sunday at 1 and 2:45 p.m. in the Jefferson Academic Center at Clark University. The film is part of the Cinema 320 series.

March 18-20, 2011 Location Sturbridge Host Hotel 366 Main Street Sturbridge, MA 01566

Live Tattooing Body Piercing Apparel & Accessories

Hours: Friday, March 19 3PM-10PM

Live Music & Entertainment

Saturday, March 20 11AM-10PM Sunday, March 21 11AM-5pm

Tattoo Contest Special Guest: Lyle Tuttle

Ticket Prices: Day Pass: $15 Weekend Pass: $35

Featuring Artists such as Marshall Bennett, Khan, & Kyle Cotterman - just to name a few! Our Master of Ceremonies: Tyler Fyre Amazing Entertainment by the Lucky Daredevil Thrillshow Live Music from The Babe Pino Band Daily tattoo contests Apparel & accessories, body jewelry, artwork and so much more!!!

MARCH 3, 2011 • WORCESTERMAG.COM

23


night day &

{ film }

Low expectations and star quality mix well The Adjustment Bureau David Wildman

AD

HIS

F T ITH

OW F RV

ICE

(no t w/ to be oth co er mb off in ers ed )

$ E 3

Monday-Wednesday 10am-3pm Thursday-Saturday 9am-7pm

YS

66 Hamilton St.,Worcester 508-799-8983

AN

Fades • Designs • Blow-outs Kids Cuts • Shaves • Razor Line-ups p & much more!

If you’ve seen a movie in the last 30 years you’ve probably experienced one of Philip K. Dick’s plots. Chances are just as good that you’ve never read any of his books. The guy was borderline psychotic but a veritable idea machine back in the ’50s through the ’80s, and in a relatively short

period of time he cranked out a stream of numerous amphetamine-fired short stories and novels that long after his death have helped shape modern cinema. The reason Dick’s stories have been so popular for movies is that a lot of what he wrote was based around inspired gimmicks, weird and unusual but clever and pithy plot ideas in the sci-fi realm. This sort of thing is candy to Hollywood. Each of his stories can be described in a sentence or two, basically an elevator pitch. Tragically, he didn’t make much on these stories at the time and was relegated to underground publications, but that’s another rant entirely. This latest film takes the idea from his short story “The Adjustment Team,” where a hierarchy of bureaucratic angels who are running things on earth slip up and reveal themselves to a regular Joe who, it turns out, is supposed to have an important role in stopping World War III or something like that. This movie takes parts of that premise, dumps the whole dire world-changing theme and attempts to make us care about the fortunes of these two people

24

WORCESTERMAG.COM

• MARCH 3, 2011

Grade: B

who meet, but weren’t supposed to meet again because it wasn’t in “the plan” that the peculiar men in suits running around Manhattan are trying to adhere to. Matt Damon is the guy, but he isn’t such a regular Joe, he’s a “bad boy” senatorial candidate media star whose antics are catching up with him. Emily Blunt is the love interest, a ballet dancer that he meets in the men’s room after he’s just lost an election. She’s hiding there because the cops are chasing her for crashing a wedding. Apparently this is a serious crime. Anyhoo, there is instant attraction, he is energized, goes out and makes a great speech, and she disappears. The rest of the film is a battle between Damon and the Adjustment Bureau suits for control of his life and to win back his love. They’ve got nifty gadgets and the ability to buzz all around Manhattan by walking through magical doors, as long as they wear silly hats. The filmmaker/writer George Nolfi tries to make it all seem real by including the obligatory identifiable luminaries like John Stewart on the TV making comments about Damon’s career, but once they start with the Wings of Desire-gone-corporate stuff feasibility goes out the window. It was truly a gamble to put the whole thing on the shoulders of Damon and Blunt, and their interactions are very much romcom material. But it could have been much worse. Thank god (or “The Chairman” as he’s called in this case) that nobody like Shia LaBeouf or Nicholas Cage was at the center of this, because that would have rendered it unwatchable. Damon is likeable, and there is just enough chemistry between him and Blunt that I actually found myself caring what happened to the couple, despite all the feelgood Men In Black hoo ha surrounding them. It’s a thin string to hang an implausible plot on, but Nolfi has gambled well in this case (unlike his script for Oceans 12 which was inexcusable). The actors in the angels incorporated roles do a decent, pleasant job, sometimes warm, other times ominous, but they are all pretty one dimensional parts (even though they operate in another dimension). Bottom line: low expectations and star quality combine for a surprisingly enjoyable romantic sci-fi comedy thriller.


eat beat

night day

Chioda’s Trattoria FOOD ★★★1/2 AMBIENCE ★★★ SERVICE ★★1/2

&

A Franklin Street delight Michael Brazell

We have all been there: you and your two great friends Amy and Steve are cruising Shrewsbury Street after a long week of work, depressed by ceaseless winter, in dire need of a comfortable table and a warm plate. You pass by a handful of Italian haunts, you know the menus by heart, and, sadly, also know what sort of wait you can expect without a reservation. Shrewsbury Street soon runs out of real estate and you’re left aimlessly billowing down Plantation and Franklin streets. The three of you are filled with such dolor and regret that you almost pack it home, but suddenly, one of you makes a chance

discovery of Chioda’s Trattoria, a cozy Italian restaurant barely a half-mile from the strip. Chioda’s may be just off the beaten path, but the restaurant delights with a large menu of reasonably-priced Italian dishes, prompt service and nary any wait. Seated and greeted immediately, our group began with wine after noticing a limited beer menu. The wine lists had about a dozen reds and whites, priced slightly higher than we were expecting, with a Californian Pinot Noir at $8, and Shiraz at $7.50. Our appetizer of Bruschetta arrived quickly and looked delicious. Six hefty slices of baked Italian bread, smothered in garlic and olive oil, were adorned with chunks of ripe tomatoes and Romano cheese. The appetizer proved too large for the three of us, and held us over until our entrées arrived. In need of something greasy, I ordered one of the specials: Broccoli Rabe with Sausage, although I was given Broccoli Rabe with Chicken ($16). The wine must have done the trick because I had completely forgotten that I received the wrong meal until I was reminded midway

{ dining}

VALUE ★★★1/2

631 Franklin St., Worcester

STEVEN KING

through the meal. Nevertheless, the meal was tasty, with soft orecchietti pasta drenched in a lemon sauce that tasted predominantly of garlic. My co-diners both ordered haddock, Amy going with the haddock Florentine ($17) and Steve taking the baked haddock route ($15). Both marveled at the large pieces of fish, as well as an excellent, olive-oily rice pilaf that rounded out a medley of fresh vegetables. Portions were sized generously and provided enough to take home. Chioda’s features a large menu of Italian food, all reasonably priced in the mid-teens with only one or two items topping $20. While the meals are not served with house salads, all of our entrées were large and well prepared. A list of weekday dinner specials caught our eye that featured $10 select entrées from Tuesday to Thursday, which if

prepared as well as our meals were prepared, would be a good value. Even without the opportunity to order a mid-week special, the total for three of us, each ordering a glass of wine, sharing an appetizer, and entrées, was just about $80. Service at Chioda’s was prompt and thorough, despite the mistake of bringing out an entrée that wasn’t the one that had been ordered. While the exterior was unimpressive, the décor inside is warm and inviting, with plenty of tables to accommodate large groups or an intimate couple. A strong asset for our group was the ability to walk in on a Friday night and be taken care of immediately, something that would be a near impossibility at a restaurant just over the tracks on Shrewsbury Street, proving that diners do not need to be in one of Worcester’s typical dining neighborhoods to experience a good meal.

Come Check Out Our New Menu Additions

DAILY LUNCH & DINNER SPECIALS

E.B. Flatts Uniquely Casual Dining Experience

MONDAY-FRIDAY 5PM-7PM $6.99 ALL YOU CAN EAT PASTA CHOOSE ANY OF OUR DELICIOUS SAUCES

Also find us on Facebook

FREE

Valet Parking Fri. & Sat. 4:30pm-Close

Chef Gary Killeen, Formerly of Thymes Square on Hudson

PerfectGameWorcester.com 64 Water St., Worcester 508.792.GAME (4263)

Open Daily at 7am Serving Sun, Mon, Tues & Wed until 1:45pm Serving Thurs, Fri & Sat until 8:45pm

245 West Main St. (Rt 9) East Brookfield

508-867-6643 • ebflatts.com MARCH 3, 2011 • WORCESTERMAG.COM

25


night day &

{ bites }

Jen Ellis and Vanessa Formato

Fairway Beef Whole Boneless Top Butts $ 99

2

(Cut to your needs)

LB.

New York Sirloin Steaks, Spoon Roasts or Both

Boneless $ 49 Skinless LB. Chicken Breast

1

Listerine Mouthwash $

99

1 $ 19 1

Doz.

Meisterchef German Bologna

¢

99

Iberia Spaghetti or Elbow Macaroni

LB.

Krasdale Apple Juice $

¢

29

Tropical Fantasy Soda ¢ 21 Oz. Bottles

3/

$7.49 Case of 24

119 Shrewsbury St., Worcester

508-752-0558 • Complimentary Valet Parking

March Specials at the Inn! Dinner Specials Every Friday & Saturday in March Prime Rib 16 oz Choice Angus Beef $19.95 Baked Stuffed Haddock $17.95

A Bit O’ Irish Fare March 17-19 Special St. Patrick’s Day Menu Wear Your Green and Enjoy Entrees Starting at $8.95

For Reservations and Information:

978-874-2000 9 Village Inn Road, Westminster, MA www.wachusettvillageinn.com

Worcester Hibernian Cultural Centre 19 Temple Street • Worcester • 508-792-3700 • www.fiddlersgreen.com

1

64 Oz.

Blackboard Specials • Sautées • Beef Specials • BYOB Cherry Pepper Calamari • Homemade Meatballs • Kids Welcome

Fiddlers’ Green Irish Pub

79

16 Oz.

TRADITIONAL ITALIAN DISHES

Lunch Special: Chicken Parmesan Sandwich - $8.95

Cool Mint 50 Oz.

Jumbo White Eggs

Friday & Saturday 5-10pm

99

DINNER SPECIALS

THURSDAY: Irish Corned Beef & Cabbage ....... $8.99 FRIDAY: Margarita Salmon .............................. $8.99 SATURDAY: Blue Cheese & Walnut Tartlets........$6.99

EN ENTERTAINMENT

IN THE HALL FRIDAY: Lt. Governor Tim Murray’s St. Patrick’s Celebration IN THE PUB FRIDAY: Songs for Ceilidh SATURDAY: Karaoke with Outrageous Greg SUNDAY: Blue Grass Jam Session 4pm to 8pm

48 Grafton St.

DON’T FORGET!!! AOH/LAOH Irish Festival Saturday, March 5 12pm-11pm • Join your friends for a fun time!

508-756-8808

Hall available for Private Functions & Weddings • 508-795-0400

26

WORCESTERMAG.COM

• MARCH 3, 2011

Bordeaux Wine Event: If you love wine, then you will love being at KJ Barron’s on Saturday, March 5, where the highly regarded 2009 Bordeaux vintage will be featured. Up to 30 Bordeauxs will be tasted. Don’t miss out! KJ Barron’s, 220 Summer St, Worcester. 508-753-3400.

FAT Tuesday Party: Dig through your dresser and break out the Mardi Gras beads and be sure to head to The Citizen on March 8 to celebrate. They have been gearing up since their trip to New Orleans last summer. They are excited to showcase a true New Orleansstyle party featuring the very best cocktails and punches. They will do it FAT Tuesday style all night! Quick tip: Take Wednesday OFF! The Speakeasy at The Citizen, One Exchange Place, Worcester. 508-459-9090. Good Eats: Worcester vegetarians rejoice! The city will be welcoming another great vegan restaurant this March: Duck Yao. Duck Yao was formerly an underground vegan Chinese restaurant that sold affordable hot lunches at the Artichoke Food Co-Op, but they’re finally going official. The operation will be setting up as a take-out restaurant on Main Street in the Clark University area across from the Vietnamese sandwich shop. The menu will include everything from traditional rice cakes to sesame “chicken” to mochi. The owners are looking for input for the menu and décor, as well as volunteers to help out. Contact tycheng@gmail.com for more information.

{ recommended}

Boynton Restaurant and Spirits 117 Highland St., Worcester 508-756-8458 boyntonrestaurant.com It’s still a beautiful day in the neighborhood at this Highland Street classic. Despite modernizing, The Boynton still serves up home-style favorites - steaks, burgers, chicken, pasta, a decent selection of shellfish, plus comfort foods - in a friendly, bustling atmosphere. Lots of plasma TVs in the bar offer drinking or dining with ample views of the Sox or Patriots.

Brew City Grill and Brew House 104 Shrewsbury St., Worcester 508-752-3862 brew-city.com The menu covers all the brew-pub bases: steaks, ribs, fajitas, chicken, home-style favorites like meatloaf, pasta and seafood - with many recipes based on beers from Brew City’s world-class selection. In other cases, such as on the specials, beer pairings are offered. The atmosphere is an engaging faux-urban décor of industrial street lamps, brick and tin, wavy lines and ramps, and brushed steel skylines; and sports memorabilia that lines the walls throughout the dining room and adjacent bar. Credit cards accepted. Off-street parking in rear.

Bocado Tapas Wine Bar 86 Winter St., Worcester 508-797-1011 bocadotapasbar.com Bocado’s is Worcester’s first, and best, tapas restaurant, a five-star

continued on page 28


ONLY ONE WEEK LEFT! LOG ONTO WORCESTERMAG.COM AND VOTE IN THE 2011 BEST OF WORCESTER POLL!

25

Come discover...

On The Common Restaurant As seen on...

CHRONICLE New England’s Nightly News Magazine Program

Fireside Dining! It may be cold outside, It is warm and cozy inside! 25 Grafton Common, Grafton, MA

508-839-5931

Tu-Th 11:30-9 Fri & Sat 11:30-10 Sundays noon-8 Closed on Mondays

508.421.WING Delivery Available*

Limited area

PEOPLE ARE TALKING!

Featur Feat uring ing More Than 23 Flavors

“Glad you came back Don’t change anything”

Both Traditional & Boneless Available! All Fresh, not that processed frozen junk!

“Great Service” “My Turkey BLT & sweet potato fries were Great” Try us once and You will Be Back!

Live March 12th

Route ‘66

Classic Rock Band Music of the 50s, 60s & 70s

Grafton Inn Food • Drinks • Functions • Lodging

www.thegraftoninn.com

A.O.H./L.A.O.H.

Irish Festival Saturday, March 5, 2011 Noon - 11pm Our Lady of Mount Carmel Recreation Center 28 Mulberry St, Worcester

Want More? We also serve... Wraps • Sandwiches • St. Louis Style Ribs French Fries • Onion Rings • Macaroni Salad

Check out our Combo Packs! 1 Kelley Square, Worcester (Entrance on Water Street) wingsoverworcester.com

Hours: Sun. - Wed. 11am-1am Thur. - Sat. 11am - 2am

$5 Admission Free For Children 12 & Under

Irish Music • Dance • Raffles Corned Beef & Cabbage Irish Goods For Sale Fun For The Whole Family

VOTED #1

Help us win again! Log onto worcestermag.com to vote today! MARCH 3, 2011 • WORCESTERMAG.COM

27


Great Food & Entertainment Ta

Close to Home...

t ke-Ou

Keno

Karaoke Every Friday Night March 5 - Windfall • March 12 - Midnight Sun March 19 - Invaders • March 26 - Shake Down Street

Gift Certificates

Function Rooms

Sushi 176 Reservoir St. Holden • 508.829.2188 • www.wongdynasty-yankeegrill.com

30 WING FLAVORS!

NEVER FROZEN

28

night day &

{ recommended}

continued from page 26

tour through Spain’s appetizer-crazed cuisine. The food is varied, creative, fresh and refreshing; the all-Spanish wine list smart and equally creative; the service professional and attentive; the atmosphere is urbane and, yes, sexy. It’s trendy, but substantial. Credit cards accepted. Off-street parking. Full liquor bar. Moderate pricing. The Texas BBQ Company 309 Main St., Northboro 508-393-4742 texasbbqco.com Worth the trip for just the barbecue meats alone. Though the atmosphere is basic, the food quality, preparation and recipes are outstanding. The best meats, wood-smoked for 16 hours, produces the best barbecue ribs (pork, beef and baby back), chicken, pulled pork, brisket and Texas Hill Country sausage to be had in Central Massachusetts. Credit cards accepted. Full liquor bar. Off-street parking. Take-out available. Via Italian Table 89 Shrewsbury St., Worcester 508-754-4842 viaitaliantable.com To the venerable Sole Proprietor and its cross-town companion, The 111 Chop House, the Ahlquists have added Via Italian Table, a Tuscan-inspired Mediterranean restaurant. The renovation is substantial and sophisticated, and the rear terrace adds a new dimension to Worcester fair-weather dining: a gorgeous space to eat, drink, see, and be seen. Via runs the gamut of Mediterranean classics, like “Three Meatballs on No. 8 Spaghetti,” lasagna (Bolognese or three cheeses), shrimp scampi and salmon to spit-

Reserve now for

MADE TO ORDER

508-755-WING (9464)

The Irish Wake of Matty O’Malley

591 Park Ave. wingitupworcester.com

A Hysterical Dinner Show

Catering Available • B.Y.O.B

March 18, 2011

508-519-1905

Dine In, Free Delivery or use our Pick-Up Window. 43 West Boylston St., Worcester (parking in rear)

eatbeat

roasted chicken or pork loin chops to ragouts to gnocchi pie, pork shank osso buco, paella, and six varieties of grilled pizza. Free valet and off-street parking. Full liquor, beer and wine. Credit cards accepted.

Eighty Ates Bar & Grille 8 Airport Road, Dudley 508-949-8888 eightyates.com Wind your way through Webster and Dudley to Eighty Ates Bar & Grille, where trendy meets rural suburbia. Breeze past the tinted windows, and the décor is spare and slick, punctuated by vividly colored abstract paintings. Whether dressed up or dressed down, diners will find a creative and tasty spin on chicken, steaks, seafood and pasta, with fresh ingredients like feta and goat cheeses, sundried tomatoes, Portobello mushrooms and couscous. The same goes for desserts, like the homemade chocolate brownie sundae and raspberry white chocolate cheese brule. Open for lunch and dinner, all the prices end in “88 cents.” There’s even a kids’ menu. The bar sports flat-screens, a wine list with just enough variety and a fun martini menu.

Chuck’s Steak House 10 Prospect St. (Rte. 20), Auburn 508-832-2553 chucks.com Diners who look more than skin deep at Chuck’s will be rewarded with sumptuous, hand-carved steaks, a clean, varied soup-andsalad bar, seafood, and home-style sides. The building is dark, dated and funky, but the food and service are good. Moderate to expensive. Credit cards accepted. Off-street parking. Full liquor bar.

J.P.’s Restaurant and Pub Westmeadow Plaza, Rte. 9 Westboro 508-366-0627 A classic bar and grille type, J.P.’s serves possibly the best lobster roll around, a gargantuan portion at a meager price. For everyone else, they offer the usual complement of home-style dinners, steaks, chops, ribs, fried and broiled seafood, etc. Cash only. Plaza parking.

Country Elegance Nestled On Mt. Wachusett

$60pp e C o m O ur r o Sav Menu New

BREAKFAST • LUNCH • DINNER THURSDAYS All-you-can-eat Pasta and Meatballs $7.99 2 LG CHEESE PIZZAS for $11.99 +tax WORCESTERMAG.COM

2 LG, 1 TOPPING PIZZAS for $13.99 +tax

• MARCH 3, 2011

2 EGGS, 1 MEAT (sausage, bacon or ham)

For $3.25 & get a FREE Coffee

Beautiful Sprawling Lawns and Views RESTAURANT

PUB

BANQUET FACILITIES

Sun.-Thurs. 11:30am-9pm • Fri. & Sat. ‘til 10pm Closed Mon. 42 West Boylston St., (Rt. 12) West Boylston, MA 508-835-4722 • www.ourmanor.com

Picturesque Setting for Ceremonies & Receptions, Corporate Meetings & Dinners

Join us in Pub 42 for...

TEAM TRIVIA ON WEDNESDAY & THURSDAY

178 Westminster Road, Princeton, MA 01541

Keno • New Menu

978-464-5600 x224


weekly picks

&

{ opt }

Upload your Weekly Pick to our website. Visit worcestermag.com, click on the Night& Day button, then choose calendar to upload your event.

all jazzthat

All That Jazz benefiting Preservation Worcester

will feature New Orleans cuisine and music with the New Black Eagle Jazz Band. This band has been a fixture on the international jazz scene since 1971, and will bring the sounds of traditional New Orleans Jazz to Worcester’s Beechwood Hotel on Saturday, March 5. Please note that reservations cannot be accepted after Thursday, March 3. $55; Nonmembers $60; and Patrons $100 each. 6:30-10:30 p.m. Beechwood Hotel, 363 Plantation St. 508-754-8760, preservationworcester.org.

public art

Help plan Worcester Arts Council’s 2011 mural project by attending the Worcester Mural Project planning meeting on Thursday, March 3. It’s free, and a great way to get involved in this new wave of public art in Worcester. From 6-8 p.m. Worcester City Hall, Room 310B, 3rd Floor, 455 Main St.

lucky day

The Annual St. Patrick’s Irish Festival held on Saturday, March 5 features music and dancing, corned beef from Buggy Whip, imported Irish and American goods, beer and wine, face painting, hot dogs, soda, games, raffles and much more! Continuous Irish Music and dancing all day long. $5, under 13 free. Noon-11 p.m. Our Lady of Mount Carmel Recreation Center, 28 Mulberry St.

fair weather

night day

Enjoy a children’s celebration of the weather through the arts during the EcoTarium’s Jammin’ in Our Wellies on

Saturday, March 5. Students from the Seven Hills Charter Public School will be celebrating the weather through a wide variety of art displays. Students will also present songs about the weather, instrument presentations and dance performances. 1-3 p.m. EcoTarium, 222 Harrington Way. 508-799-7500, ecotarium.org.

Cela, flute; William Kirkely, clarinet; Peter Sulski, violin; Rebecca Thornblade, cello; Ian Watson, piano; Jeffrey Means, percussion; with Rohan Gregory, narrator. Free. 3-4 p.m. Mechanics Hall, 321 Main St. Call 508-7520888.

you go girl

In celebration of International Women’s Day, Greater Worcester Humanists invite you to join actress Lynne McKenney as she brings Clara Barton, the Founder of the American Red Cross and the Angel of the Battlefield, to life in a one-woman presentation on Tuesday, March 8. Clara H. Barton, (1821-1912), North Oxford native, earned the name Angel of the Battlefield for her limitless courageous and unfailing spirit in bringing supplies to the front lines of the Civil War. Lynne McKenney brings this inspirational woman to life in Follow

nosh and nibble education ball The Mardi Gras Ball, sponsored by the Worcester Educational Development Foundation, Inc., will be held on Saturday, March 5 and promises to keep your booty shimmying – all for a great cause – Worcester schools. Held at Wachusett Country Club, come dance the night away listening to the famous Zydeco Band “The Boogaloo Swamis,” enjoy delicious New Orleans cuisine, and support the WEDF at a silent auction of “must have” items. Tickets available by e-mailing Sandra.mayrand@ umassmed.edu or at any Worcester Credit Union. $50 donation. 6-11 p.m. Wachusett Country Club, 187 Prospect St., West Boylston. 508-799-3660.

manic marionette

Michael Gandolfis Pinocchio’s Adventures in Funland is a retelling of a few of the many adventures of Carlo Collodi’s manic marionette. The piece is designed to entertain and educate young audiences by introducing them to the riches of classical music. An adventure for the young and young at heart held on Sunday, March 6. Featuring Orlando

The Worcester Wine & Food Festival brings people together from the entire greater Worcester community and beyond to taste fine wines from both domestic and international winemakers and to sample signature dishes from some of the finest local restaurants, caterers and specialty food purveyors. Held on

the Cannon: A Reading of Clara Barton’s Civil War Letters. Free to public, donations welcome. 7-9 p.m. Unitarian Universalist Church of Worcester, 90 Holden St. 774-314-1494, meetup.com/worcesterhumanists.

Monday, March 7. For the ninth year, Austin Liquors is the Presenting Sponsor for the event. Proceeds of the Worcester Wine & Food Festival fund scholarships for youth programming at the Worcester JCC. 21+. $45 per person; four-pack of tickets, $170; block of 10 tickets, $400; young professional, $30 (must be 21-30 years old and show photo I.D. at purchase). 5:30-9 p.m. DCU Center Arena and Convention Center, 50 Foster St. 508-756-7109, worcesterjcc.org.

women in print

The Annual Women in Print is presented by Worcester Women’s History Project and held on Wednesday, March 9. Featuring local authors Eve Rifkah, Janette Greenwood, and Jessica Bane Robert. Free. 5:30-7 p.m. Worcester Public Library, Saxe Room, 3 Salem Square. 508-767-1852.

Irish drum

Musician Craig Harris will celebrate the music and rhythms of the Emerald Isle during Drum Away the Global Blues - Emerald Isle a multimedia, interactive program using songs, stories and video and held on Wednesday, March 9. Audience participation is encouraged. This program is perfect for teens and adults of all ages. Reserve your spot by stopping in at the front desk or calling the library at 508-634-2209. The Bancroft Memorial Library, 50 Bancroft St., Hopedale. Free. 7-8:30 p.m.

18th Annual February

Wine Sale

20% Off *

All Of Our Fine Wines

*does not include 1.5 - 3.5 liter bottles & over; no further discounts on sale itmes apply

2000 e! r e v O ilabl a v A s Wine

This Event Happens Only Once a Year for 6 Weeks!

402 West Boylston St. Worcester, MA 01606

508.853.1919

jimmy@oharaswines.com www.oharaswines.com

February 1st - March 14th

+RXUV0RQGD\6DWXUGD\DPSP6XQGD\SS

MARCH 3, 2011 • WORCESTERMAG.COM

29


night day &

Upload your listings at our redesigned website worcestermag.com. Click the Night & Day toolbar, then choose Calendar to place your event listing in both our print and online weekly calendar.

{ listings} music >Thursday 3

Sound

CHECK

with Vanessa Formato

The first weekend of March is upon us, which might not seem like a reason to celebrate. Allow me to disagree. We all need a healthy dose of revelry in our lives, and there’s no better time than right now. On Thursday, March 3 experimental indie/folk band The Smile Makers will be helping you celebrate at Beatnik’s with sweet, mellow tunes to lift your spirits. Half of the talented duo, Eric Donaldson, says the band’s name comes from a Shel Silverstein poem of the same name. “The poem ends with: ‘It sure can be hard work to make somebody smile,’” Donaldson says. “That statement resonated with us, and Shel’s distorted-creepy but emotionally honest illustration style fit the personality of our music.” Joining them will be Dusty Cobb. Check out Jediah at Perfect Game Sports Grill and Lounge for some laidback rock tunes, and James Keyes will be playing a great set at Vincent’s Bar at 10 pm sharp. If high-energy pop/ punk is what you’re looking for, though, head upstairs at The Palladium for an incredible show, as The Wonder Years (pictured) will be ready to get you up and dancing, along with Man Overboard and Handguns. Friday, March 4 will be another excellent night of live performances, starting with Big Jon Short at Smokestack Urban Barbeque. In addition to some fantastic Delta and Hill Country blues, there will be delicious food to fill up on. Catch AC/DC tribute band Touch 2 Much at Mill Street Brews in Southbridge for a rockin’ good time. Shows at the Lucky Dog Music Hall never disappoint, so check out The Riff Raffs with Merrick Section, Sheez Late and The Genre Whores. Each band will playing their own kind of rock ’n’ roll, with influences ranging from punk to folk. For something a little more low-key, check out the acoustic styling of Chris Reddy over at Flip Flops. If you’re one of the people that think you can never go wrong with Celtic music and a tall mug of beer, you’re in luck tonight: Songs for Ceilidh will be playing Fiddlers’ Green Pub & Restaurant long into the evening. Last but not least, make the trip to Ralph’s for a rowdy show with 7 Minute Stagger, Truth Ending Cycle, Army of None, Next to Nothing and InAeona. On Saturday, March 5 do it all over again, starting with another great lineup at the Lucky Dog Music Hall with Danny Pease & The Regulators, Doctor Doom Orchestra, Satellite Rockers and Rising Tribe. The featured bands have some pretty eclectic influences, making this a show for every music lover. There’s reggae, hip hop, rock, ska and soul in this mix, making it a truly unique show. Probable Cause claims to be Central Mass’s most popular rock cover band on their website, so check out their show at JJ’s Sports Bar and Grill to see if you agree. Blues lovers might want to go grab their seats at Vincent’s for the John Cate concert. Speaking of blues, the Cool Hand Blues Band will be playing into the wee hours of the morning at Beatnik’s. We only live once, right? Venture out and enjoy it!

30

WORCESTERMAG.COM

• MARCH 3, 2011

The Wonder Years with Man Overboard / Mountain Man @ The Palladium (upstairs). $10 adv., $12 door. Palladium, The, 261 Main St. 508-797-9696. DJ Roberta. DJ Roberta plays the music YOU want to hear! Dance to your favorite rock, classic rock, top 40 and country hits! 8:30 a.m. to 12:30 p.m. Days End Tavern, 287 Main St., Oxford. 508-987-1006. Good Times with Your Friend DJ Steve. Featured in the main bar area every Thursday, DJ Steve, friend to all, spins rock and roll nuggets from the 1950s to an hour ago. 9-2 a.m. Hotel Vernon - The Ship Room/Kelley Square Yacht Club, 1 Millbury St. Irish Music Session. Each week, a traditional Irish music session is held at Mulligan’s Taverne. The public are welcome to join in music, song, and camaraderie. No cover charge, all ages and talent levels welcome. Listeners welcome, too! 7:30-10 p.m. Mulligans Taverne-on-the-Green, 121 West Main St., Westborough. 508-344-4932 or westboroughsession.com. Open Mic Night W/ Bill McCarthy Free. 7:30-11:30 p.m. Junior’s Pizza Grille, 346 Shrewsbury St. 508-459-5800. MITCH WOJCIK Tom Bianchi Concert. Tom always puts on a great show. One of the very few “Singer/Songwriter/ Solo Bassists” in the country, Look for great songs improv, humor and bass guitar skills like you’ve never seen. $15. 7:30-10 p.m. Christ Episcopal Church, 1089 Stafford St., Rochdale. 617-480-0388 or hezstone.com. Acoustic Thursday w/ Johnny MAC. Just announced and back by popular demand, Johnny MAC will be performing at Halligan’s Sports Bar. Free. 8 p.m.-midnight Halligan’s Sports Bar and More, 889 Southbridge St., Auburn. 508-832-6793. Flock Of A-Holes w/ Neon Alley and Chatty Maddie!. $5. 8 p.m.-2 a.m. Lucky Dog Music Hall, 89 Green St. 508-3631888 or find them facebook. Open Mic Jam. All players and singers are welcome! Free. 8 p.m.-2 a.m. Mill Street Brews (@ The Artist Development Complex), 18 Mill St., Southbridge. 508-764-6900. Sean Fullerton. No cover. 8-10 p.m. Coppertop Lounge/ Wachusett Mountain Ski Area, 499 Mountain Road, Princeton. 978-464-2300 or wachusett.com. The Jazz Depot. 8 p.m.-1 a.m. Cafe Destare, 320 Main St., Fitchburg. 978-345-5734. The Smile Makers with Dusty Cobb. 8:30-11:30 p.m. Beatnik’s, 433 Park Ave. 508-926-8877. Audio Wasabi hosted by Brian Chaffee. 9 p.m.-1 a.m. Gardner Ale House, 74 Parker St., Gardner. 978-669-0122. Bobby Gadoury and a Happy B-Day Celebration for

Jeff Hubacz. No Cover!. 9 p.m.-2 a.m. Nick’s Bar and Restaurant, 124 Millbury St. 508-753-4030. Metal Thursday!. 9 p.m.-2 a.m. Ralph’s Chadwick Square Diner, 148 Grove St. 508-753-9543. Andy Cummings Live. $3. 10 p.m.-2 a.m. Hooligan’s, 29 Blossom St., Fitchburg. 508-272-5092. James Keyes. 10 p.m.-1 a.m. Vincent’s Bar, 49 Suffolk St. 508-752-9439.

>Friday 4 Shit Outta Luck, She Rides, Heelan Powers, Letterday, RAM. $5. The Raven, 258 Pleasant St. 508-3048133. X-Cess Fridays. DJ Patrick Allen BLU Ultralounge & Nightclub, 105 Water St. 508-756-2227 or blu-nightclub.com. Brian Chaffee. 6 p.m.-1 a.m. Black Sheep Tavern, 261 Leominster Road, Sterling. 978-422-8484. BBQ & Blues Fridays with Big Jon Short. Come out to enjoy some of the area’s best BBQ and some Delta and Hill Country Blues. bbqstack.com bigjonshort.com no cover. 7-10 p.m. Smokestack Urban Barbecue, 90 Harding St. Ed & Da Ve. Free. 7-11 p.m. Greendale’s Pub, 404 W Boylston St. 508-853-1350. Jazzed Up Trio At Lucianos Union Station. No Cover, dine, swing, dance, mingle, enjoy ! Great American Songbook classics featuring Joe D’Angelo on bass and vocals, John Murzycki on Drums, Mauro DePasquale, on Piano and vocals. JAZZED UP pays tribute to the makers of the finest and most romantic music ever while celebrating such artist as Gershwin brothers, Frank Sinatra, Tony Bennet, Johnny Mercer, Duke Ellington, Chet Baker, Louis Armstrong, ArtTatum, Charlie Parker, Antonio Carlos Jobim, Lennon and McCarthy, and others. wix.com/jazzedup/jazzed-up 7-10 p.m. Luciano’s Cotton Club, 2 Washington Square. 508-7556408. The Jonas Woods Band. Jonas is a full time touring recording artist based in New England. He is committed to full time ministry through the vehicle of music. Jonas is the former lead singer for the nationally signed band Farewell June and now tours leading worship and holding concerts coast to coast and overseas. 7-10 p.m. Mill Church Cafe, 45 River St., Millbury. 508-864-5658 or millchurch.org. Cradle Of Filth @ The Palladium. with Nachmystium / Turisas / Daniel Lioneye Upstairs Stage: Fate Worse Than Death Naegleria Necronomichrist Nemecide Scalpel Tickets $25 adv., $25 door. 7:30-11 p.m. Palladium, The, 261 Main St. 508-797-9696. AC/DC Tribute. Tribute band “Touch 2 Much” performs all of your favorite AC/DC tunes all night long!!! $10. 8 p.m.-2 a.m. Mill Street Brews (@ The Artist Development Complex), 18 Mill St., Southbridge. 508-764-6900. Boogaloo Swamis. Formed by Mickey Bones in 1984, this four time Boston Music Award winner “Rocks The House” with it’s Americana Roots, Swamp Rock, Cajun, Zydeco, Blues, and high energy Rock and Roll. One of the Northeast region’s favorite dance

CHILDREN’S DENTISTS of Worcester

bands, the Boston-based Boogaloo Swamis have been playing their unique blend of New Orleans influenced Rhythm and Blues for the past twenty-three years with five recordings and four Boston Music Awards to their credit. $14 advance; $20 day of show. 8-11:30 p.m. Bull Run Restaurant, Sawtelle Room, 215 Great Road, Shirley. 978-425-4311 or tickets.bullrunrestaurant.com. Pilgrim Soul Productions Presents Shirley Valentine. Pilgrim Soul Productions Presents Shirley Valentine by Willy Russell, directed by Matthew J. Carr. Information and reservations call 508-752-0224. $15. 8-10 p.m. Alternatives’ GB and Lexi Singh Performance Center, 60 Douglas Road, Whitinsville. 508752-0224. Riff Raffs w/ Merrick Section, Sheez Late, and The Genre Whores!. $6. 8 p.m.-2 a.m. Lucky Dog Music Hall, 89 Green St. 508-363-1888. The Town Green. Singer, and renowned songwriter, David Mallett is this month’s performer. Doors open at 7:15, reservations recommended. Fair trade coffee and unique deserts are also for sale. 8-10:30 p.m. First Congregational Church of Princeton, United Church of Christ, 14 Mountain Road, Princeton. 978-464-5414 or thetowngreen.org. The Wandas. No cover. 8-10 p.m. Coppertop Lounge/Wachusett Mountain Ski Area, 499 Mountain Road, Princeton. 978-464-2300 or wachusett.com. Bill McCarthy & His Guitar MySpace.com/ BadClownProductions Free. 8:30-11:30 p.m. Pepe’s Brick Oven, 274 Franklin St. 508-755-1978. Chris Reddy Acoustic Loops from Hell. 8:30 p.m.-12:30 a.m. Flip Flops, 680 Main St., Holden. Live Music in The Pub with ‘Songs for Ceilidh’. No Cover. 8:30 p.m.-12:30 a.m. Fiddlers’ Green Pub & Restaurant, 19 Temple St. 508-792-3700 or songsforceilidh.com. The Chris Piquette Band Live Music. 9 p.m.-2 a.m. Cindy’s Sports Bar, 1618 North Main St., Palmer. 413-271-0609 or FindNEWentertainment.com. 7 Minute Stagger, Truth Ending Cycle, Army of None, Next To Nothing, and InAeona!. 9 p.m.-2 a.m. Ralph’s Chadwick Square Diner, 148 Grove St. 508-753-9543. Auntie Trainwreck. 9 p.m.-1 a.m. Squire Whites Pub & Restaurant, 347 Greenwood St. 508-752-7544 or find them on facebook. DJ Pete the Polock. Yeh, he’s still here playing whatever he wants. The girls flash him for requests, sit on his lap, and listen to his same old jokes but still love him. He only plays to get out of the house away from his queen. Classic rock to the Blues. Large dance floor to shake it. Come see this Worcester legend. Free. 9 p.m.-2 a.m. 3-G’s Sports Bar, The Music Room, 152 Millbury St. 508-754-3516. DJ T Rich. 9 p.m.-2 a.m. Beemer’s Pub, 114 River St., Fitchburg. 978-343-3148. DJs & Dance Bands. 9 p.m.-2 a.m. Cafe Destare, 320 Main St., Fitchburg. 978-345-5734. Flock of Assholes. 9 p.m.-2 a.m. JJ’s Sports Bar and Grill, 380

Dr. Daniel Moheban

certified, American Board of Pediatric Dentistry

Dr. Manouch Darvish

www.childrensdentistofworcester.com 200 Lincoln St. • Worcester, MA 01605 • 508-756-6264 ★ Mention this ad and be entered to win a FREE iPod Touch! ★

Taking Care of All Your Little Things.


night day &

Southwest Cutoff, Northborough. 508-842-8420. I Love Fridays At Fusion With DJ B-Lo. Lounge opens at 9:00 pm - Dance Club opens at 10:30 pm. Coat Room available with attendant. 9 p.m.-2 a.m. Fusion, 109 Water St. 508-7562100. Jon Bowser. 9 p.m.-2 a.m. Cigar Masters, 1 Exchange Place. 508-459-9035. Jon Lacouture. Free. 9 p.m.-2 a.m. Art’s Diner, West Boylston st. Ladies Night - Top 40 Dance Party. Our Top 40 Ladies Night Dance Party returns to Speakers! Ladies (and Gent’s) come in and dance the night away with the hottest DJ in the MetroWest Area DJ Norm!!! FREE. 9 p.m.-2 a.m. Speakers Night Club, 19 Weed St., Marlborough. 508-480-8222 or speakersnightclub.net. Live Bands Every Friday. Every week its another great band and a good excuse to get out of the house FREE!!!!. 9 p.m.-1 a.m. Squire Whites Pub & Restaurant, 347 Greenwood St. 508-7527544 or squirewhites.com. Pete the Polak, DJ. 9 p.m.-2 a.m. 3-G’s Sports Bar, 152 Millbury St. 508-754-3516. Ric Porter and the Sons of the Soil $5. 9-11:59 p.m. Blue Plate Lounge, 661 Main St., Holden. 508-829-4566 or find them on facebook. The Obsession Band. 9 p.m.-1 a.m. Belfont Hotel, 11 South Main St., Millbury. 508-917-8128. Trina Vargas with The Bobby Gadoury Trio!. No Cover!. 9 p.m.-2 a.m. Nick’s Bar and Restaurant, 124 Millbury St. 508753-4030. Koliba. 10 p.m.-1:30 a.m. Beatnik’s, 433 Park Ave. 508-9268877. Scott Ricciuti and Friends. 10 p.m.-1:30 a.m. Vincent’s Bar, 49 Suffolk St. 508-752-9439.

>Saturday 5 From Here To Zanzibar, Only At Night, Soundoff, Alongside A War, Speaker For The Dead. $8. The Raven, 258 Pleasant St. 508-304-8133 or find them on facebook. A Celtic Celebration. Come join the Worcester Children’s Chorus for an afternoon of Celtic music featuring The Parcel of Rogues! In addition to the festive music, guests will have the opportunity to participate in a basket raffle, and enjoy some tasty treats. $10 for adults and $5 for children and seniors $10 general admission,$5 seniors and children. 4-6 p.m. Trinity Evangelical Lutheran Church, 73 Lancaster St. 508-753-2989 or find them on facebook. A Celtic Celebration with the Worcester Children’s Chorus. A Celtic Celebration with the Worcester Children’s Chorus and The Parcel of Rogues - Trinity Lutheran Church (73 Lancaster Street, Worcester) in Jepson Hall. $10 for adults and $5 for children and seniors.   $10 Adults $5 Seniors & Children 12 and under. 4-6 p.m. Trinity Evangelical Lutheran Church, Jepson Hall, 73 Lancaster St. 508-767-7077 or worcesterchildrenschorus.org. Classical Guitar Concert / Recital. Pakachoag faculty member Jeremy Milligan presents a classical guitar recital including music by J.S. Bach, Fernando Sor, Leo Brouwer, and Maximo Diego Pujol. Free. 4-5 p.m. Pakachoag Music School of Greater Worcester, The Great Hall at Pakachoag, 203 Pakachoag St., Auburn. 508-791-8159. Rock Your Face Off Festival!!! Ten Bands from 5pm till Close! Revocation, The Breathing Process , Widow Sunday, Burning Human, Orwell, Hivesmasher, Sirens, Tight Rope, Nemecide, and Pathogenic! rockyourfaceofffest.com for more information. Facebook keywords: The Rock Your Face Off Fest 2. Email: mdarcy@nefariousrealm.com for ticket information. $15 at Door. $13 in Advance.. 5 p.m.-2 a.m. Ralph’s Chadwick Square Diner, 148 Grove St. 508-753-9543. Dale LePage “Swinging & Singing” with The Bobby

Gadoury Trio. Free. No cover charge. 7-10 p.m. Nick’s Bar and Restaurant, 124 Millbury St. 508-753-4030 or dalearts.com. Manowar with HolyHell @ The Palladium. Tickets $75. 7-11 p.m. Palladium, The, 261 Main St. 508-797-9696. An Evening with Eilen Jewell. “Sometimes as darkly damaged as Lucinda Williams, at others as defiant and teasing as prime Peggy Lee and always authentically Americana in the Gillian Welch tradition....She’s mighty good.” (LA Daily News) $19 adults; $15 seniors, students, teachers. 7:30-9:30 p.m. Cultural Center at Eagle Hill, Abby Theater, 242 Old Petersham Road, Hardwick. 413-477-6746 or centerateaglehill.org. Brian and Captain. No cover. 8-10 p.m. Coppertop Lounge/ Wachusett Mountain Ski Area, 499 Mountain Road, Princeton. 978-464-2300 or wachusett.com. Concord Band Winter Concert. The Concord Band’s Winter Concert, “New & Blue,” will be a mix of recent pieces for concert band and jazz-influenced selections. The featured piece will be the Massachusetts premiere of “Twilight of the Gods” by Andrew Boysen, Jr. Twilight of the Gods depicts the story of Ragnarok, the end-of-the-world myth from Scandinavian mythology. The Concord Band joined with 26 university and community bands to commission this new composition. Other pieces on the program include Three Jazz Moods, Vaughan Williams’ Sea Songs, and selections from “Porgy and Bess.” $15 each ($5 for students and seniors). 8-10 p.m. Performing Arts Center at 51 Walden, 51 Walden St., Concord. 978-897-9969 or concordband.org. Danny Pease & The Regulators w/ Doctor Doom Orchestra, Satellite Rockers, and Rising Tribe!. $8. 8 p.m.-2 a.m. Lucky Dog Music Hall, 89 Green St. 508-363-1888 or facebook.com/dprsound. Jon Lacouture. Free. 8 p.m.-1 a.m. Brook’s Pub, Lincon st. Kung Fu. With special guests.. SuperSwank, Wolfman Conspiracy & SEED. 18+ $10. 8 p.m.-2 a.m. Mill Street Brews (@ The Artist Development Complex), Showcase Club, 18 Mill St.,

{ listings}

Southbridge. 508-764-6900. Liatino Night with DJ Pedro. 8 p.m.-1 a.m. Breakaway Billiards, 104 Sterling St., Clinton. 978-365-6105. Bill McCarthy & His Guitar MySpace.com/ BadClownProductions 8:30 p.m.-midnight Whistle Stop Bar & Grill, 85 Main St., Oxford. 508-987-3087. Chris Reddy. 8:30 p.m.-1 a.m. Celtic Tavern, 45 Belmont St., Northborough. 508-366-6277. Windfall, Worcester Finest Classic Rock Band. No Cover Charge. 8:30 p.m.-noon Wong Dynasty, 176 Reservior Road (Route31), Holden. 508-414-6362 or windfallrock.com. Auntie Trainwreck. We’ll be playing all the Classic Rock, Blues, New Country and Alt Rock tunes you love, and maybe some songs you have not heard from us before! Plus, Auntie Trainwreck T-Shirts will be available for only $10 9 p.m.-12:30 a.m. Admiral T. J. O’Briens, 407 Main St., Sturbridge. 508-347-2838. Crazy Eighties (80s Cover). $3 after 9:30pm (subject to change). 9 p.m.-2 a.m. Speakers Night Club, 19 Weed St., Marlborough. 508-480-8222. DJs & Dance Bands. 9 p.m.-2 a.m. Cafe Destare, 320 Main St., Fitchburg. 978-345-5734. Dubble D & The Khaos Junkies-LIVE. 9 p.m.-1 a.m. Wheelock Inn, 82 Wheelock Ave., Millbury. Girl Spot Saturdays. 9 p.m.-2 a.m. Club Gallery, 150 Point St., Providence. 401-751-7166 or myspace.com/girlspotri. Intolerance & Blame it on Clay. 9 p.m.-2 a.m. Red Onion Otter River Hotel, 29 Main St., Baldwinville. 978-939-7373 Probable Cause. 9 p.m.-2 a.m. JJ’s Sports Bar and Grill, 380 Southwest Cutoff, Northborough. 508-842-8420. Ric Porter & The Sons of the Soil 9-11:59 p.m. Hotel Vernon - The Ship Room/Kelley Square Yacht Club, 1 Millbury St.

BE PART OF THE FUN — EVERY FRIDAY AND YOUR DESTINATION FOR SATURDAY NIGHT LIVE MUSIC GREAT LIVE MUSIC! WITH THE AREAS BEST BANDS! MARCH LINE-UP Friday, March 4: FLOCK OF ASSHOLES Saturday, March 5: PROBABLE CAUSE Friday, March 11: USUALLY NORMAL Saturday, March 12: SPITSHINE Friday, March 18: Go Gadget Go 508-842-8420 Intersection of Rtes. 20 & 9, Northboro www.jbag.biz

Saturday, March 19: DUBBLE D AND THE KHAOS JUNKIES Friday, March 25: MINDRIFT Saturday, March 26: LACQUERHEAD MARCH 3, 2011 • WORCESTERMAG.COM

31


night day &

{ listings}

Reciprocal

Style.

a v intage fa s h i o n s h ow Join us for an evening of shopping, hors d’oeuvres, cocktails, raffles, and vintage fashion to benefit Abby’s House!

Tickets on Sale Now! Order tickets online at www.abbyshouse.org

Thursday, March 24, 2011 6:00 – 8:30 pm Ralph’s Diner, 148 Grove Street, Worcester, MA sponsor ed by leading sponsors

Milk Row Studio

Ralph’s Diner

Cash bar. You must be at least 21 years of age to attend. To order tickets by phone or for additional information please call Marjorie Ropp at 508.756.5486 ext. 21.

Worcester Mag... Always A Step Above

8 Donnelly Rd., Spencer 508-885-7200

“We really like the ad! Thank you! I have to tell you that our Worcester Mag ads are always a step (or two) above any other ads that we run! They always look fanastic and are very creative and fun. Thanks again!” - Cassandra Two Chefs

or find them on facebook. Ricky Booth Live Acoustic show. Free. 9 p.m.-midnight The Nines Neighborhood Bar, 136 Millbury St. 508-340-0318. Sean Fullerton. 9 p.m.-2 a.m. Cigar Masters, 1 Exchange Place. 508-459-9035. Seductive Saturdays with DJ Hydro & DJ Savas- Top 40. Fusion’s Lounge opens at 9:00 pm and Dance Club opens at 10:30pm. Coat room with attendant available. No Cover Charge. 9 p.m.-2 a.m. Fusion, 109 Water St. 508-756-2100. Trantrum Saturdays. 9 p.m.-2 a.m. BLU Ultralounge & Nightclub, 105 Water St. 508-756-2227 or blu-nightclub.com. VALVATROSS. BAND $5. 9 p.m.-1 a.m. Greendale’s Pub, 404 W Boylston St. 508-853-1350. Willie Smith and the T Bone Blues Band. T-Bone with his All-Star Blues Band returns to 3G’s for his monthly commune with the neighborhood. Why settle for hamburg when you can have T-Bone. Free. 9-1, 9 p.m.-1 a.m. 3-G’s Sports Bar, The Music Room, 152 Millbury St. 508-754-3516. DJ HappyDaze & FamilyBusiness508. HappyDaze will be turning the heat up! Hittin’ the Top 40 Playlist,Mixing and Mashing it up with ALL the Old Skool Hip Hop Beats! Familybusiness508. com Robert Mental aka X2 will be opening for Familybusiness $200 in cash prizes to the winners of the dance off at Midnight! 9:30 p.m.-1 a.m. Days End Tavern, 287 Main St., Oxford. 508-987-1006. John Cate. 9:30 p.m.-12:30 a.m. Vincent’s Bar, 49 Suffolk St. 508-752-9439. Cool Hand Blues Band. 10 p.m.-1:30 a.m. Beatnik’s, 433 Park Ave. 508-926-8877. Jubilee Gardens. 10 p.m.-1:30 a.m. Sahara Cafe & Restaurant, 143 Highland St. 508-798-2181 or jubileegardens.com.

>Sunday 6 Jazz Brunch Sundays. 10 a.m. to 2 p.m. Gardner Ale House, 74 Parker St., Gardner. 978-669-0122. Blue Grass Jam Session. No Cover (Worcester students earn WOO Points). 4-8 p.m. Worcester Hibernian Cultural Centre, 19 Temple St. 508-792-3700 or grassjam.org. Kicking Daisies @ The Palladium (upstairs). Tickets $10 adv.. 4-10 p.m. Palladium, The, 261 Main St. 508-797-9696. Ryan LaPearle. No cover. 4-6 p.m. Coppertop Lounge/ Wachusett Mountain Ski Area, 499 Mountain Road, Princeton. 978-464-2300 or wachusett.com. Blues Jam w/Jim Perry. Featured artists weekly Donations. 5-10 p.m. Greendale’s Pub, 404 W Boylston St. 508-853-1350. Open Mic with Jesse Garcia. Everyone gets 5-6 songs then followed with a jam session! Sign up by showing early or email aj239@msn.com. Free. 5-9 p.m. Belfont Hotel, 11 South Main St., Millbury. 508-917-8128. The Bobby Gadoury Trio, then Andy Cummings No Cover!. 5 p.m.-2 a.m. Nick’s Bar and Restaurant, 124 Millbury St. 508-753-4030.

WORCESTER

mag

Not your everyday newspaper.

32

WORCESTERMAG.COM

• MARCH 3, 2011

>Monday 7 Driftin’ Sam Politz at 7pm; then NEW!!! “Cocktails and Karaoke” w/ Anita!! 9pm to Close! Every Monday Night!. No Cover!. 7 p.m.-2 a.m. Nick’s Bar and Restaurant, 124 Millbury St. 508-753-4030. Blue Mondays - Live Blues. 8:30 p.m.-1 a.m. Gardner Ale House, 74 Parker St., Gardner. 978-669-0122.

>Tuesday 8 Sam James Live. 9-2 a.m. Perfect Game Sports Grill and Lounge, 64 Water St. 508-792-4263. Open Mic Night w /Bill McCarthy Open Mike!. OPENMCC@VERIZON.NET 7-11 p.m. Greendale’s Pub, 404 W Boylston St. 508-853-1350. Fat Tuesday Mardi Gras Party w/ The Black Sheep Dixieland Band!. No Cover!. 7:30 p.m.-2 a.m. Nick’s Bar and Restaurant, 124 Millbury St. 508-753-4030. Lou Borelli’s Black Sheep Jazz Band Dixieland

Haydn’sTHECREATION

www.worcestermag.com

{ news | arts | dining | nightlife

Vincent’s presents: Big Jon Short. Armed with a suitcase kick-drum, National Reso-phonic Guitar and Lowebow cigar-box hillharp, Big Jon Short’s high energy solo performances bring a foot-stomping show that taps into the heart of the songs, regional styles, and folklore of the Blues. bigjonshort.com 5-8 p.m. Vincent’s Bar, 49 Suffolk St. 508-752-9439. Dr. John & the Lower 911. $75 advance: $80 day of show. 8-10:30 p.m. Bull Run Restaurant, Sawtelle Room, 215 Great Road, Shirley. 978-425-4311 or tickets.bullrunrestaurant.com. Jojo & Patch. 8 p.m.-1 a.m. Cafe Destare, 320 Main St., Fitchburg. 978-345-5734. Tangents w/ Peyote Radio Theatre, Transient & Ashpark!. $10. 8 p.m.-2 a.m. Lucky Dog Music Hall, 89 Green St. 508-363-1888 or find them on facebook. The 70’s hits band Heavy Horses. The band’s members include Craig Rawding, Tom Hurley, Dawn Sweet, Ed Barnett, John Donovan, Roger Lavallee, Mike Warren, Ron Mominee and more! This is a FREE ‘open’ rehearsal. and it’s pretty interesting to see the ‘behind the scenes’ of one of these shows. Come on down! Free. 8 p.m.-2 a.m. Lucky Dog Music Hall, 89 Green St. 508-363-1888 or luckydogmusic.com. Dancing with DJ Cisco. 9 p.m.-1 a.m. Mirabar, 35 Richmond St., Providence. 401-331-6761 or mirabar.com/calendar.htm. Live At Amsterdam Sunday’s. Musicians and poets welcome! 21+ Hookah and Bar! Free!. 9 p.m.-1:30 a.m. Amsterdam Lounge, 27 Pleasant St. 508-615-1735 or find them on facebook. Sunday Theme Party 18+. 9 p.m.-1 a.m. Club Gallery, 150 Point St., Providence. 401-751-7166 or find them on facebook. Reggae Fusion Sundays with DJ Nick. Reggae, Hip Hop and Top 40 every Sunday. 10 p.m.-2 a.m. Fusion, 109 Water St. 508-756-2100. Sabrina Sundays at ENVY. 10 p.m.-2 a.m. ENVY Nightclub, 241 Southbridge St.

Friday MARCH 11, 2011 at 8 PM MECHANICS HALL Pre-concert Talk 7 PM The WORCESTER CHORUS, Chris Shepard, Artistic Director Kendra Colton, Soprano

Frank Kelley, Tenor

Tom Jones, Bass

Festival Orchestra

Call for discounts, groups $37, $34, $20 Students $15 at door

508.754.3231

www.musicworcester.org


mag

m estermag.co

R E T S E C R O W www.worc

| nightlife

{ news | arNts o| ditniyngour everyday newspaper.

MARCH 3, 2011 • WORCESTERMAG.COM

33


Worcester Chamber Music Society Presents a free family concert Michael Gandolfi’s

PINOCCHIO’S ADVENTURES IN FUNLAND For the Young and Young at Heart

Sunday, March 6 3:00 PM Mechanics Hall 321 Main Street,Worcester Free Admission

Double points.

en Op til Un m! 2a

34

VIP Limo Service Available

Pool Tables Darts

&

{ listings}

Celebration. Looking for something exciting to do this Mardi Gras? Come on down to Nick’s for an authentic Dixieland celebration! The Lou Borelli Black Sheep Jazz band will be playing a set of Dixieland ballads featuring the best local jazz musicians. There will be a New Orleans style fashion parade, so be sure to bring your best 1920’s outfit, or simply come on in jeans and mardi gras beads. Free. 7:30-10:30 p.m. Nick’s Bar and Restaurant, 124 Millbury St. 508-207-3788. Northboro Area Community Chorus. 7:30-9:30 p.m. Algonquin Regional High School, Bartlett St., Northborough. “Totally Tuesdazed!!!!!” Tunes in the Diner every Tuesday Night!. 8 p.m.-1 a.m. Ralph’s Chadwick Square Diner, 148 Grove St. 508-753-9543. Big Jon Short. Armed with a suitcase kick-drum, National Reso-phonic Guitar and Lowebow cigar-box hillharp, Big Jon Short’s high energy solo performances bring a foot-stomping show that taps into the heart of the songs, regional styles, and folklore of the Blues. bigjonshort.com no cover. 8-11 p.m. Armsby Abbey, 144 North Main St. 508-795-1012 or armsbyabbey.com . Scott Riccuiti, Michael Thibodeau & John Donovan. 8-11 p.m. Vincent’s Bar, 49 Suffolk St. 508-752-9439. Terry Brennan. 8 p.m.-midnight Banner Pub, The, 112 Green St. 508-755-0879 or terrybmusic.com. Bass Embassy & Rebirth Tuesdays. Every Tuesday Bass Embassy & ReBirth bring you the best Dubstep ,Jungle and Drum & Bass music in Central Mass. Doors open at 10 PM. 10 p.m.-2 a.m. Fusion, 109 Water St. 508-756-2100 or fusionworcester.com.

>Wednesday 9

For more information: 978-456-2730 or www.worcesterchambermusic.org

Keno

night day

Open Mic Night hosted by Sax Player Joe Ferreira. Dinner is served until 5-9pm. Reservations accepted. After Dark menu, desserts and cocktails until closing. http:// harvestcafeonline.com 978-567-0948 No Cover, Pass the hat for the host. 7:30-9:30 p.m. Harvest Café, 40 Washington St., Hudson. 978-567-0948. Open Mic Night with Bill McCarthy. MySpace.com/ OpenMicWorld. Free!. 7:30-11 p.m. Beatnik’s, 433 Park Ave. 508926-8877 or MySpace.com/OpenMicWorld. Acoustic Rock with Johnny R. Free. 8 p.m.-noon Brook’s Pub, 251 Lincoln St., Lincon st. 508-612-8128. Free Jukebox Night. 8 p.m.-2 a.m. Vegas Lounge, 5 Summer

St., Lunenburg. 978-400-7524. Vincent’s Presents: Tiki Night with Frank & Eric!. Frank and Eric will help you get over the hump every Wednesday with all of your favorite tropical drinks while soaking in special musical guests and movies. 8 p.m.-1:30 a.m. Vincent’s Bar, 49 Suffolk St. 508-752-9439. Wednesday night free concert series w/ Eric French & Mr. Hyde, Working the Corner, and Fighting the Influence!. Free!!!. 8 p.m.-2 a.m. Lucky Dog Music Hall, 89 Green St. 508-363-1888 or luckydogmusic.com. FLASH - 16+ Electro-Dance Party!. Umbrella Gallery & Free Idea Clothing bring you FLASH 16+ Electro-Pop/Hip-Hop Dance Parties every Wednesday night from 8:30-12:00! $7. 8:30 p.m.-midnight Umbrella Gallery, 639 Main St., Fitchburg. 978-7079684 or find them on facebook. Clayton Willoughby’s Traveling Vaudeville Show!. No Cover!. 9 p.m.-2 a.m. Nick’s Bar and Restaurant, 124 Millbury St. 508-753-4030.

art

Asa Waters Mansion, Admission: $3 for guided tour $7-10 for tea. 123 Elm St., Millbury. 508-865-0855 or asawaters.org College of the Holy Cross: Iris & B. Gerald Cantor Art Gallery, Art of Africa: Objects from the Collection of Warren Robbins, through March 31. Hours: closed Sunday, 10 a.m. to 5 p.m. Monday - Friday, 2-5 p.m. Saturday. 1 College St. 508-7933356 or holycross.edu Dark World Gallery, On Fire and Out of Control II: The Art of Keenan Cassidy, Saturday. Hours: closed Sunday, 9 a.m. to 7 p.m. Monday - Saturday. 179 Grafton St. darkworldgallery.com EcoTarium, Budding Scientists - Sense of Touch, Thursday; Turtle Travels, Through June 5; Preschool and Toddler Wednesdays, Wednesdays, through Dec. 31. Hours: noon-5 p.m. Sunday, closed Monday, 10 a.m. to 5 p.m. Tuesday - Saturday. Admission: $12 adults; $8 for children ages 2-18, college students with IDs & senior citizens. Children under 2 & EcoTarium members free. Additional charges apply for Tree Canopy Walkway, Explorer Express Train, planetarium programs & other special programs. 222 Harrington Way. 508-929-2700 or ecotarium.org Fitchburg State University: Hammond Campus Center, Landscapes, Wednesday. 160 Pearl St., Fitchburg. fsc. edu Higgins Armory Museum, Exhibit: Beyond Belief: The

OXFORD’S HOTTEST SPOT

FOR THE BEST LIVE ENTERTAINMENT! MARCH 5TH

DJ HappyDaze & FamilyBusiness508 Top 40, Old School & Hip Hop Beats! 9:30-1:30

MARCH 12TH

The ISSUES playing covers of your favorite Rock, Top 40 and Old School hits! • 9:30-1

MARCH 17TH St. Patty’s Day Corned Beef Sandwich buffet starting 4pm DJ Roberta • 9:30pm-1 MARCH 19

TH

Audio Nation Awesome Rock Cover band! • 9:30-1

MARCH 26TH

Overdrive • Classic Rock! • 9:30-1

Open To Everyone For All Your Intimate Needs

Lingerie • Novelties • Toys Lotions • Shoes • DVDs • and more WED - SAT • 11AM - 8PM SUNDAY 11AM - 5PM Pick a 10%-50% off nugget from the Pot O’ Gold and receive your discount on anything green on March 17th

287 Main Street • Oxford • 508-987-1006 WORCESTERMAG.COM

• MARCH 3, 2011

9 Walker Drive, Upton • Off Rte 140 508-529-3600 • desirees-desires.com


Upload your listings at our redesigned website worcestermag.com. Click the Night & Day toolbar, then choose Calendar to place your event listing in both our print and online weekly calendar. Curious Collection of Professor Rufus Excalibur Bell, Through June 20; WOO Card good at Higgins Armory Museum, Through Dec. 31. Hours: noon-4 p.m. Sunday, closed Monday, 10 a.m. to 4 p.m. Tuesday - Saturday. Admission: General Admission: $10 for Adults, $7 for Children (age 4-16), Children 3 and under are Free. 100 Barber Ave. 508-853-6015 or higgins.org. Mass Audubon: Broad Meadow Brook Conservation Center and Wildlife Sanctuary, Beauty In Excess on Display, Through Aug. 31. Hours: 12:30-4 p.m. Sunday, closed Monday, 9 a.m. to 4 p.m. Tuesday - Saturday. 414 Massasoit Ave. 508-753-6087 or massaudubon.org Museum of Russian Icons, Treasures from Moscow: Icons from the Andrey Rublev Museum, through July 25. Hours: closed Sunday - Monday, 11-3 a.m. Tuesday - Wednesday, 11 a.m. to 7 p.m. Thursday, 11-3 a.m. Friday, 9-3 a.m. Saturday. Admission: $5 adults, senior voluntary contribution, student and children free. 203 Union St., Clinton. 978-598-5000 or 978-598-5005 or museumofrussianicons.org Old Sturbridge Village, Dinner in a Country Village, Saturdays, through March 26; Maple Days and Maple Sugaring Weekends in March, Sundays, Saturdays, March 5 - March 27. Admission: $7 $20 charged by age. Children under 3 free. 1 Old Sturbridge Village Road, Sturbridge. 800-733-1830 or 508-347-3362 or osv.org Tower Hill Botanic Garden: Stoddard Education and Visitors Center, At Home in the 365-Day Garden - A Lecture and Book Signing with Margaret Roach, Saturday. 11 French Drive, Boylston. towerhillbg.org. Worcester Art Museum, Edouard Manet’s The Dead Toreador, Sept. 25 - March 31; Goya and the Bullfight, Dec. 18 - April 17; Zip Tour: Two Paintings in the Donnelly Gallery--Art Since the Mid-20th Century, Saturday; Sunday Public Tour, Sundays, Sept. 12 - May 22. Hours: 11 a.m. to 5 p.m. Sunday, closed Monday Tuesday, 11 a.m. to 5 p.m. Wednesday - Friday, 10 a.m. to 5 p.m. Saturday. Admission: Free for members, $10 adults, $8 seniors, free for youth 17 and under. Free for all Saturdays, 10am-noon. 55 Salisbury St. 508-799-4406 or worcesterart.org. Worcester Center for Crafts, Center Yourself: A Juried Photographic Exhibition through March 12. Hours: closed Sunday, 9 a.m. to 5 p.m. Monday - Thursday, 10 a.m. to 5 p.m. Friday, closed Saturday. 25 Sagamore Road. 508-753-8183 or worcestercraftcenter.org. WPI: George C. Gordon Library, A Celebration of Art and Writing, Through March 4; A Well-Documented Life : The Theo Brown Diaries, Through June 15. 100 Institute Road. wpi.edu.

poetry >Sunday 6

The Poets’ Asylum. Join Worcester’s longest running poetry series every Sunday night for an open mic reading followed by a featured poet and/or poetry slam. This week we hold the next open qualifying slam of the 2011 Worcester Slam season. We will also have a spotlight performance by Kim Johnson before the slam. One of the best things about

poetry slam is the range of poets it attracts. You’ll find a diverse range of work within slam, including heartfelt love poetry, searing social commentary, uproarious comic routines, and bittersweet personal confessional pieces. The qualifiers will consist of 2 3-minute rounds. The top finishers in each qualifier will take part in the Spring Semi-final Slam, tentatively scheduled for April 3rd. poetsasylum.org. No cover; donations accepted.. 7-10 p.m. WCUW 91.3 FM - Worcester’s Community Radio Station, 910 Main St. 508-753-1012.

>Monday 7 Worcester Women Poets, Fifth Annual Reading. The fifth annual Worcester Women Poets reading - in honor of International Women’s Day and Women’s History Month -featuring Patricia Youngblood, Eve Rifkah, Jina Ortiz, Judy Ferrara, Sarah Sapienza, and Kat O’Connor. Featured readers followed by an open mic. Snacks will be provided - featured poets will have books, etc. for sale. Free and Open to the Public. 7-9 p.m. Quinsigamond Community College: Harrington Learning Center, 109A & B, 670 West Boylston St.

theater/ comedy

Dick Doherty’s Beantown Comedy Escape Friday March 4th Corey Rodrigues Jono Zalay and Friends. March 5th Corey Rodrigues Jono Zalay and Friends. $20 pp. 8 p.m.-noon Biagio’s Grille, Comedy Room, 257 Park Ave. Call 800-401-2221 or visit dickdoherty.com. Open Mike Comedy - Saturdays, Saturday, July 24 - Sunday, November 11. Hosted by a variety of local comedians under the leadership of Andy Paquette. Worcester’s longest running open mic attracts regional talent and newcomers. 100’s of aspiring comedians have bared their wares in front of this supportive and sympathetic crowd. 7-9 p.m. 3-G’s Sports Bar, The Music Room, 152 Millbury St. Call 508-754-3516. The Sexiest Show in Town - Mondays. Come laugh with some of the best comics from the Worcester and New England area. Hosted by Shaun Connolly. Buy a pitcher, get a FREE pizza! Every 2nd and 4th Monday! FREE. 8-10 p.m. The Center Bar and Grille, 102 Green St. Wisecracks Comedy Club @ Jose Murphy’s This location is in Jose Murphy’s (2nd floor) every Saturday night.. $12 (All Woo card holders and active duty military is 2 for 1). 8-10 p.m. Jose’ Murphy’s, 2nd Floor, 97-103 Water St. Call 508-792-0900 or visit wisecrackscomedyclub.com. Shirley Valentine Through Saturday, March 5. Pilgrim Soul Productions presents Shirley Valentine with Betty Kristan. Directed by MAtthew J. Carr $15 Discount available for groups of 10+. 8-10:30 p.m. Alternatives Unlimited, Inc., Singh Performance Center, 50 Douglas Road, Whitinsville. Call 508-752-0224. Urinetown The Musical Thursday, March 3 - Saturday, March 5. Bancroft School presents Urinetown - a Broadway award winning

performance with plenty of exuberant musical moments, fun, and potty humor to go around. A hilarious satirical musical-comedy performed by a cast of 24 Bancroft actors, with an assortment of carefully choreographed singing and dancing scenes. In a city where all private toilets have been outlawed due to a water shortage, the masses are forced to pay to use public toilets that are controlled by a corrupt corporation. Urinetown explores real social issues of corporate control, corruption, environmental conservation, and eventually a public revolution all while making audiences laugh uncontrollably. $5. 7-9 p.m. Bancroft School: Harrington Theatre, 110 Shore Drive. Call 508-853-2640. “A Night in Elsinore”, by Richard Nathan - Friday, March 4. auditions Will be held at Barre Players Theater for A Night In Elsinore. The cast consist of 2 women and 14 men with an age range of 20 to 60. A copy of the script for perusal can be found at the Woods Memorial Library in Barre, MA. If further information is needed, please call the theater at 978-355-2096 and leave a message for the director, Charles Tower. 7-9 p.m. Barre Players Theater, 64 Common St., Barre. Call 978-355-2096 or visit barreplayers.homestead.com. Wisecracks Comedy Club @ The Old Groton Inn This location is in the Old Groton Inn in Groton, Ma the FIRST Friday of EVERY month. There’s a full bar and food menu in the showroom! Doors open at 8pm - show starts at 9pm. $12. 9-11 p.m. The Old Groton Inn, 128 Main St., Groton. Call 978-448-5614 or visit wisecrackscomedyclub.com. The Drowsy Chaperone - Friday, March 4 - Saturday, March 5. A modern day musical theatre addict drops the needle on his favorite LP - the 1928 musical comedy, The Drowsy Chaperone. From the crackle of his hi-fi, the musical magically bursts to life on-stage telling the tale of a pampered Broadway starlet who wants to give up show business to get married, her producer who sets out to sabotage the nuptials, her chaperone, the debonair groom, the dizzy chorine, the Latin lover and a pair of gangsters who double as pastry chefs. $20 for evenings; $15 for matinees; $10 for children. 8-10:30 p.m. Mount Wachusett Community College: Theatre, 444 Green St., Gardner. Call 978-632-2403 or visit theatre.mwcc.edu. All That Jazz benefiting Preservation Worcester Saturday, March 5. New Orleans Cuisine and Music Featuring the New Black Eagle Jazz Band Members $55, Non-members $60 and Patrons $100 each. 6:30-10:30 p.m. Beechwood Hotel, 363 Plantation St. Call 508-754-8760 or visit preservationworcester.org. Skinnygirl Night Out...A Conversation with Bethenny Frankel - Saturday, March 5. Join Bethenny Frankel, bestselling author and star of The Real Housewives of New York and Skating with the Stars for an evening of sass and fabulous fun at The Hanover Theatre! Full price tickets are $28.50 and $35.50, depending on seating location. Limited VIP tickets available for $75, which includes a post-show meet & greet. $5 discount available for members, groups of 15 or more, kids, students and WOO card holders.. 8-9:30 p.m. Hanover Theatre for the Performing Arts, 2 Southbridge St. Call 877-571-7469 or visit thehanovertheatre.org.

night day &

{ listings}

An Evening with Garrison Keillor - Sunday, March 6. True to his radio form, humorist celebrity speaker Garrison Keillor shares hilarious anecdotes about growing up in the American Midwest, the people of Lake Wobegon, and “late-life fatherhood.” With a wonderful, dry sense of humor, he captivates audiences and delivers with class, charisma, and wisdom. The UMASS Medical School Speakers Series features three acclaimed speakers - David Sedaris, Mitch Albom and Garrison Keillor; ticket buyers are eligible to receive a 10% discount when buying all three performances. $38-$68. 7:30-9:30 p.m. Hanover Theatre for the Performing Arts, 2 Southbridge St. Call 877-571-7469 or visit thehanovertheatre.org.

dance >Thursday 3

Ballroom Dance Foxtrot/Swing (full bronze). Learn with other couples and singles every Thursday in March. Foxtrot is one of the most popular social dances. It is a fun all purpose dance that can be performed to many different styles of music. No Partner or experience required. $10.00 drop in. $50 monthly membership includes all classes. 7-8 p.m. Poise Style & Motion Ballroom Studio, 97 Webster St. 508-752-4910 or psmdance.com. Argentine Tango Classes (Beg). Join other singles and couples. Argentine Tango is a social dance expressed through melodic instruments. Originated in the suburbs of Buenos Aires at the end of the 19th century. $50pp. 7-8 p.m. American Ballroom & Latin Dance Studio, Maironis Park, 52 South Quinsigamond Ave., Shrewsbury. 508-925-4537 or americanballroomlatin.com.

>Friday 4

Ballroom & Latin Dance Lounge - 50’s BEE BOP ! Dance Ballroom, Latin, Swing & Hustle, 50’s Style! All-levels EC SWING Lesson, Dance, Cash Bar & Refreshments, Door Prizes-Best Costume! $15pp. 7-11 p.m. American Ballroom & Latin Dance Studio, Maironis Park, 52 South Quinsigamond Ave., Shrewsbury. 508-925-4537 or americanballroomlatin.com. Hustle Classes (Beg). The Hustle is a fast moving, energetic dance characterized by its many turns. The lady spins almost constantly while her partner draws her close and sends her away. Although disco has come and gone, if you enjoy the nightlife, then Hustle is a must! $50pp. 6-7 p.m. American Ballroom & Latin Dance Studio, Maironis Park, 52 South Quinsigamond Ave., Shrewsbury. 508-925-4537 or americanballroomlatin.com.

>Saturday 5 Ballroom Dance Beginner Foxtrot/Swing. Foxtrot is one of the most popular social dances. It is a fun all purpose dance that can be performed to many different styles of music. No Partner or experience required. $10.00 drop in. $50 monthly membership includes all classes. 11 a.m.-noon Poise Style & Motion Ballroom Studio, 97 Webster St. 508-752-4910 or psmdance.com.

Turn Wasted Space Into Living Space The award-winning Owens Corning Basement Finishing System™ provides you with acoustic and thermal control, a durable surface and mold and mildew resistance* — call us today to learn more. Fast and mess-free installation Built to resist higher humidity levels and moisture Lifetime limited warranty ** Coupon not valid with other promotional offers or on previously scheduled projects. New customers only. Present coupon at time of appointment. Offer valid only on complete basement installation. THE PINK PANTHER™ & © 196402006 Metro-Goldwyn-Mayer Studios Inc. All rights reserved. *While the materials and design of the Owens Corning Basement Finishing System™ resist mold and mildew, the system cannot prevent or mitigate mold if the conditions necessary for mold growth otherwise exist in your basement. See actual warranty for complete details.

Call today for a FREE estimate.

With Coupon Only • OFFER EXPIRES 03/12/11

1-800-639-3008 1-800-639-2351 MARCH 3, 2011 • WORCESTERMAG.COM

35


EMPLOYMENT

AUTOMOTIVE

REAL ESTATE

SERVICES

MERCHANDISE

LOOK INSIDE ‌ TAX TIME 2011

Summer Camp Directory - NEW!

Reaching Over 90,000 Readers in Print and Online at

www.centralmassclass.com

HEALTH/MIND/BEAUTY Winter Bulletin Board

Online ads post immediately! New postings every day!

AUTO • LEGALS ONLINE: www.centralmassclass.com EMAIL: sales@centralmassclass.com PLACE ADS:

PHONE: 508-749-3166, ext. 430 FAX: 508-749-3165

SERVICES

AUCTIONS

ADOPTION/PREGNANCY

MAJOR ABSOLUTE SECURED CREDITOR’S PUBLIC SEALED BID AUCTION ON MARCH 12TH OF ALLCARE DENTAL ASSETS. We have been commissioned to sell by sealed bid Allcare Dental offices in your town! Sealed bid offers must be sent to Anderson Auction & Realty, 1843 Hertel Avenue, Buffalo, NY 14216 or faxed to 716.838.8228. Offers are for BULK, AS IS purchases of any complete office ready to open or be removed. Visit our website at www.andersonauctioneers.com for a listing of offices in your area! Bids must be received no later than 5:00 PM on March 12th. Highest bid will be approved on March 12th and must be paid for within 48 hours. Contact us at 716.838.8484. Sale by Anderson Auction & Realty

PREGNANT? CONSIDERING ADOPTION? Talk with caring agency specializing in matching Birthmothers with Families nationwide. LIVING EXPENSES PAID. Call 24/7 Abby’s One True Gift Adoptions 866-413-6293 ^ Pregnant? We Can Help in Worcester! Free abortion consultation, free pregnancy test, ultrasound available 888-310-7217 anytime or www.problempregnancy. org ADVERTISING

CLEANING SERVICES

FINANCIAL SERVICES

Housekeeping Inexpensive quality work. Call Elizabeth for a free estimate. References available. 508-755-3970

1st Choice Family Solutions Employed, Unemployed, Good credit, bad credit. Get Mortgage Relief with our free mortgage checkup. We heal “sick� mortgages. 888-8688721 firstchoicefamilysolutions.com

ADVERTISING 101 Consistency! Consistency in advertising! Get in the paper and stay in! Building your brand is important. If readers see your ad one day and look for you another and you are not there, you just missed out on a customer!

Make your ad stand out! ADD COLOR! Do you have a company logo? Add your logo to your ad! People trust what’s familiar to them! Call today to advertise! We can help! 508-755-1199 x430. Central Mass Classifieds, Your Trusted Local Source BUILDERS/ CONTRACTORS Steve Lange Contracting New Homes, Additions, Remodeling. No job too small! (508)450-4950

36

CONSTRUCTION/HOME IMPROVEMENT

Help Wanted ... and more!

0LOLWDU\+HURHV RIWKH:HHN Thomas Nicholas Fuller and Christian Adam Fuller of Rutland, MA 7KRPDV1LFKRODV´1LFNµ)XOOHUJUHZXSDQGDWWHQGHGJUDGHVFKRROLQ5XWODQG0$DQGZDVDQ(DJOH6FRXW+H JUDGXDWHGIURP%D\3DWK5HJLRQDOLQ&KDUOWRQLQZKHUHKHVWXGLHGZHOGLQJ+HKDGVWDUWHGZRUNLQJDVDQ DSSUHQWLFHIRUWKH/RFDO6WHHO:RUNHUV·8QLRQ+HZRUNHGLQWKH%RVWRQDUHDIRUDERXWD\HDUDQGDKDOIZKHQKH GHFLGHGWRMRLQWKH1DY\LQ1LFNVSHQWPRVWRIKLVWLPHDW-DFNVRQYLOOH1DYDO$LUEDVH-DFNVRQYLOOH)ORULGD )URPWKHUHKHZHQWWR$IJKDQLVWDQDQGZRUNHGZLWKWKH$UP\IRUPRVWRILQ%DJUDPDVDJXDUGDQGKHLVQRZ VWDWLRQHGDW7LQNHU$)%2NODKRPD+LVVSHFLDOW\LV)OLJKW6XSSRUW &KULVWLDQ$GDP´$GDPµ)XOOHUDOVRDWWHQGHGJUDGHVFKRROLQ5XWODQGDQGJUDGXDWHGIURP%D\3DWK5HJLRQDOLQ DQGDOVRZDVDQ(DJOH6FRXW+HKDGVWXGLHG$GYDQFHG$XWRPRWLYHDQGZHQWRQWR1HZ(QJODQG7HFKWR SXUVXHDQ$XWRPRWLYH'HJUHH+HGHFLGHGWRMRLQWKHVHUYLFHDIWHUPRYLQJWR)ORULGDWROLYHZLWKKLVEURWKHU1LFN :KLOH1LFNZDVUHDGLQJIRUGHSOR\PHQW$GDPPRYHGEDFNKRPHDQGSUHSDUHGWRMRLQWKH$UP\$GDPJUDGXDWHG ERRWFDPSRQ-DQXDU\IURP)RUW-DFNVRQ6&1RWRQO\ZDV$GDP·VJUDGXDWLRQDWWHQGHGE\KLVPRWKHU EURWKHUDQGDFRXSOHRIFORVHIULHQGV´7KH)LUVW/DG\µZDVDOVRSUHVHQW$GDPLVDWWHQGLQJ$,7VFKRRODW)76DP +RXVWRQ6DQ$QWRQLR7H[DVZKHUHKHLVVWXG\LQJWREHDPHGLF

“We could not be more proud of our sons’ decisions.�

HAS YOUR BUILDING SHIFTED? Contact Woodford Bros., Inc. for straightening, leveling, foundation and wood frame repairs at 1-800-OLDBARN, www.woodfordbros. com, MAHIC#155877; CTHIC#571557; RICRB#22078*

FLOORING/CARPETING

7KH&HQWUDO0DVV&ODVVLILHGVZRXOGOLNHWRWKDQNWKHVHEUDYHEURWKHUVIRUWKHLUVHUYLFHWRRXU&RXQWU\

C & S Carpet Mills Carpet & Linoleum. 30 Sq. Yds. $549 Installed with Pad. Free Metal Incl’d. Berber, Plush or Commercial. Call Tom 800-8615445 or 508-886-2624

Military Hero of the week is sponsored by:

ELECTRICAL

HEALTHCARE SERVICES

Charles Kach licensed electrician. No Job too small. Free estimates. Quality work. Lic #E35374. 508-755-4619.

IF YOU USED THE ANTIBIOTIC DRUG LEVAQUIN AND SUFFERED A TENDON RUPTURE, you may be entitled to compensation. Call Attorney Charles Johnson 1-800-535-5727*

FENCE & STONE Commonwealth Fence & Stone Your Complete Fence & Stone Company. All fence types- Cedar, Vinyl, Chain Link, Post & Rail, Ornamental, Pool. Hardscapes- Stone Wall, Walkways, Patios. Contact: 508-835-1644 for free estimate.

MARCH 3, 2011 • WORCESTERMAG.COM

HOME IMPROVEMENT Brad’s Home Improvement Quality Workmanship Reasonable Rates Licensed & Insured 508-829-7361/ 508-380-7453

0RPDQG'DG/LQGD7RNDU]DQG&KXFN&DU\

THANK YOU FOR YOUR SERVICE TO OUR COUNTRY RT. 9 EAST BROOKFIELD | 508-885-1000 | LAMFORD.COM

Is there a special service person in your life?

The Central Mass Classifieds would like to feature members of our Armed Forces on a regular basis. If you have a special service person in your life, please email jsima@holdenlandmark.com with some information, photo, brief summary of his/her service, and we will be happy to recognize them in the Central Mass Classifieds. The brave men and women of the United States Armed Forces should be remembered all year long. Call June at 508-755-1199 X430 or email jsima@holdenlandmark.com for more information. God bless our troops.


www.centralmassclass.com

CENTRAL MASS CLASSIFIEDS

HEALTHCARE SERVICES

HEALTHCARE SERVICES +V`V\OH]L[`WLKPHIL[LZHYLKLWYLZZLKHUK^HU[ [VPTWYV]L`V\YKPHIL[LZTHUHNLTLU[&:LLRPUN ZLKLU[HY`^VTLUMVYHZ[\K`H[<4HZZ4LKPJHS :JOVVS[VPTWYV]L[OLPYTVVKHUKKPHIL[LZTHUHNLTLU[ *VTWLUZH[PVUHUKNYV\WZ\WWVY[WYV]PKLK *HSS:\LH[ +VJRL[ ! 

Improve Your Diet and Possibly Lose Weight Men and women interested in committing to a dietary plan that impacts Diabetes & Heart Disease risk factors are needed for a UMMS research study. To be eligible you must not have diabetes or smoke, and be between the ages of 21 and 70. For more information call Don at

508.856.1518 Compensation provided (Docket H-130750)

SUBOXONE STUDY HEROIN, OPIATES & OXYCONTIN USERS

If you have a problem with opiates like heroin, Oxycontin or Percocets, you may be eligible to participate in a 3-month Suboxone research study to test medications for opioid abuse. This study is being conducted by the University of Massachusetts Medical School. We are currently seeking volunteers ages 18 to 25. If you are interested, please call Chelsea or leave a message at (508) 856-4566. All calls are confidential. Docket #13261.

HOME IMPROVEMENT CLEARVIEW HOME IMPROVEMENT does it all! Additions, windows, doors, siding, painting, finish basements. Fully Insured. HIC#286433. Call Paul 508-581-7803 HAS YOUR BUILDING SHIFTED OR SETTLED? Contact Woodford Brothers Inc, for straightening, leveling, foundation and wood frame repairs at 1-800-OLD-BARN w w w.wood fo r d b r os . com// Paulâ&#x20AC;&#x2122;s Remodeling. Kitchens, Bathrooms, Basements & Decks. Finish Carpentry. Repairs & Painting. Windows & Doors. Quality Workmanship Guaranteed. Lic#165875/Insured 508882-5265

PLUMBING

TRAILERS Pace, Haulmark, FeatherLite, Bigtex, Bri-Mar, Sundowner Exiss, CM Truck Bodies, Full Service Rentals, Delivery&Pickup. Open 6 days. CONNECTICUT TRAILERS, BOLTON, CT 877-8694118, www.cttrailers.com*

SCHULTZ PLUMBING 10% Off for new customers. Licâ&#x20AC;&#x2122;d & Insâ&#x20AC;&#x2122;d. #26981 Now accepting all major credit cards. D. Scott Schultz Jr. 508-735-3567 www. schultzplumbing.com

PAINT/WALLPAPER

SNOW PLOWING/ REMOVAL

JACK WASGATT PAINTING Interior painting and wallpapering. Wall and ceiling repairs. Extremely meticulous. One man operation. (No crews or subs) 29 years experience. Holden resident. Fully insured. Call 508-8520271

ALL SEASON SERVICES Plowing, sanding, snow blowing, small residential walkways to commercial parking lots. Low rates. Fully lic & ins. See our ad in the Professional Services Directory. 774-3121973, 508-304-9759. Email allseasonsrvcs@yahoo.com

MISCELLANEOUS

PAINTING

AMERICAN DIABETES ASSOCIATION Tour de Cure: Join the nation?s most adventurous ride! The New England Classic 150 & 500+ on July 9th, 2011! http://main. diabetes.org/nectourdecure*

Painting Unlimited Services Skilled, Reliable, Reasonable. Meticulous prep & workmanship. Interior/Exterior Painting/ Staining, Powerwashing. Free Estimates. Fully Insured. HIC #163882 Call Tim 508-340-8707

DIABETIC TEST STRIPS. Cash paid up to $10/box. Call Wayne at 781-724-7941*

LANDSCAPING

Visit us at the Home Show at the DCU Center March 11-13 Booths 20 & 21

Spring Clean-Ups

&RPSOHWH$TXDVFDSH:DWHU*DUGHQV 3RQGV :DWHUIDOO'HVLJQ  ,QVWDOODWLRQ Â&#x2021;1HZ/DZQVÂ&#x2021;/DZQ$HUDWLRQ Â&#x2021;3ODQW'HVLJQVÂ&#x2021;'UDLQDJH Â&#x2021;6KUXE 7UHH:RUN Â&#x2021;)XOO/DZQ0DLQWHQDQFH6HUYLFH Â&#x2021;:DOOV:DONV 3DWLRVÂ&#x2021;%REFDW:RUN Â&#x2021;6HDO&RDWLQJÂ&#x2021;5DLQZDWHU+DUYHVWLQJ Â&#x2021;/DQGVFDSH/LJKWLQJ

HOME REPAIR/ RESTORATIONS GENERAL REPAIRS Floors: ceramic, hardwood, vinyl; Painting, Roofs, Power Washing, Vinyl Windows, Remodeling, baths & kitchens. Handyman Services. ONE CALL DOES IT ALL! Lic# HIC154720/ CSL104667 J.D. RICHARDSON 508826-0941, 508-791-1594

MISCELLANEOUS

)UHH(VWLPDWHV )XOO\,QVXUHG <HDUV([SHULHQFH

ZZZEUXQHOOHDQGVRQVODQGVFDSLQJFRP

EMPLOYMENT BUSINESS OPPORTUNITIES CASH FAST $500+DAY Returning phone calls â&#x20AC;&#x153;my 1st 72 hours brought in $3,000â&#x20AC;? housewife Leanne CA 800925-7123*

(508) 749-3166 ext. 430

FOSTER PARENTING

)267(53$5(176:$17(' Come Visit Our Open House (YHU\UG:HGQHVGD\RIWKH0RQWKÂ&#x2021;SPSP 3OHDVH&DOOIRU'HWDLOV

6HHNLQJIDPLOLHVWKURXJKRXW &HQWUDO0DVVDFKXVHWWV ZKRDUHLQWHUHVWHGLQ LPSURYLQJDFKLOGÂśVOLIH &DOO12:WRHQUROOLQWKHQH[W)RVWHU3DUHQW7UDLQLQJ 6,*121%2186 &DOOIRU'HWDLOV

688 Main Street, Holden, MA Toll Free (877) 446-3305

www.devereuxma.org

CAREER TRAINING EARN $75 - $200 HOUR. Media Makeup Artist Training. Ads, TV, Film, Fashion. One week class.Stable job in weak economy. Details at http:// www.AwardMakeUpSchool. com 310-364-0665 ^ EMPLOYMENT Paid in Advance! Make $1000 a week mailing brochures from home. Guaranteed Income! FREE supplies! No experience required. Start immediately! www.homemailerprogram.net ^ REGIONAL MYSTERY SHOPPER Needed, You will be hired to conduct an all expenses paid surveys and evaluation exercises on behalf of BANNEST and earn $300.00 Per Survey. Our E-mail Address (j.colt14@ gmail.com)*

EMPLOYMENT OPPORTUNITIES AIRLINES ARE HIRING Train for high paying Aviation Career. FAA approved program. Financial aid if qualified. Job placement assistance. CALL Aviation Institute of Maintenance 877-202-0386. // â&#x153;ˇâ&#x153;ˇâ&#x153;ˇâ&#x153;ˇâ&#x153;ˇ A Reader Advisory: The National and Regional Advertising Associations we belong to may purchase classifieds in our publications. We advise that you determine the value of their service or product. In order to avoid misunderstandings, some advertisers do not offer â&#x20AC;&#x153;employmentâ&#x20AC;? but rather supply readers with manuals, directories and other materials designed to help establish mail order selling and other businesses at home. Some advertisers may require investment fees. Under NO circumstances should you send any money in advance or give the client your checking, license ID, or credit card numbers. All funds are based in US dollars. 800 numbers may or may not reach Canada. Fees for 900 numbers are listed in the ads. â&#x153;ˇâ&#x153;ˇâ&#x153;ˇâ&#x153;ˇâ&#x153;ˇ HELP WANTED Drivers-Owner Operators, average $1.68/mile. HOME EVERY WEEKEND! Weekly direct deposit. Requires CDL-A, 2 years recent verifiable experience. 888-301-5855. www.aduiepyle.com//

M A R C H 3 , 2 0 11 â&#x20AC;˘ W O R C E S T E R M A G . C O M

37


www.centralmassclass.com

CENTRAL MASS CLASSIFIEDS

HELP WANTED

HELP WANTED LOCAL

French Teens Need Families NOW Adopt a French teen for 3 weeks this summer. Great cultural experience. Families compensated $100/ week. Call Kim today! 1-800421-7217 facekimhill@gmail. com www.LEC-USA.com PLEASE HELP!//

Clinician Complete functional behavior assessments, write behavioral treatment plans and implement behavioral goals. Complete initial intake evals, incl psycho-social, mental status, and preliminary treatment planning for children/ adolescents with signif behavior disorders. Provide therapeutic interventions utilizing individual and/or co-joint/ family modalities. 40 hrs/ wk. Masterâ&#x20AC;&#x2122;s in Counseling, Psych, or rel fld. and 1 yr exp and current driverâ&#x20AC;&#x2122;s license. Mail resume: Counseling & Assessment Clinic of Worcester, LLC, 51 Union Street, Suite 104 Worcester, MA 01608.

$$$ HELP WANTED $$$ Extra Income! Assembling CD cases from Home! No Experience Necessary! Call our Live Operators Now! 1-800-4057619 EXT 2450 http://www. easywork-greatpay.com ^ TRUCK DRIVERS WANTED! 2011 PAY RAISE! UP TO $.52 PER MILE! HOME WEEKENDS! EXCELLENT BENEFITS! NEW EQUIPMENT! HEARTL AND EXPRESS! 1-800-441-4953 www.heartlandexpress.com// HELP WANTED LOCAL

HELP WANTED 6XUURJDWH 0RWKHUV1HHGHG %HSDUWRIDPLUDFOH 7KHUHZDUGVDUH PRUHWKDQÂżQDQFLDO 6HHNLQJZRPHQ QRQVPRNHUV ZLWKKHDOWK\ SUHJQDQF\KLVWRU\



ZZZUHSURGXFWLYHSRVVLELOLWLHVFRP

PUBLISHERS CIRCULATION FULFILLMENT, INC. NOW HIRING Part Time Distribution Generalists Opportunities in: Worcester, Dudley, Gardner and Spencer We have openings for delivery support team members in who are at least 18 years of age and have: â&#x20AC;˘ Valid driverâ&#x20AC;&#x2122;s license in state of residence â&#x20AC;˘ A driving record that demonstrates safe driving â&#x20AC;˘ Access to a vehicle that can be used at work â&#x20AC;˘ The ability to work the overnight shift in our distribution sites â&#x20AC;˘ The ability to maneuver 50 lb. bundles of newspapers â&#x20AC;˘ Apply online at www. pcfjobs.com for one of the open positions in your area. PCF is a drug-free workplace requiring drug-testing, driving records and background checks prior to employment.

38

Director of Pathology (Palmer, MA) sought by UMass Memorial Medical Group, Inc. to provide leadership over technology, oversight, medical practices, and the performance of testing personnel in laboratories. Requires MD and a 5 year residency in Pathology. Ref. #9846P and apply to Katherine Pryor, Sr. Physician Recruiter, UMMMG, 295 Lincoln Street, Suite 206, Worcester, MA 01605. No phone calls. DRIVERS NEEDED to deliver packages for FED EX home delivery. Min of 1 yr exp delivering in a cargo van in past 3 yrs is needed. Please contact me at Modarres61@yahoo.com or call 508-733-9726 Hospitalist (Worcester, MA). UMass Memorial Medical Group, Inc. seeks Hospitalist to cover non-ICU adult admissions at the UMass Memorial campuses in Worcester and ICU and adult admissions at Marlborough and Clinton Hospitals. Requires Mass license. Ref. #10516P and apply to Katherine Pryor, Sr. Physician Recruiter, UMMMG, 295 Lincoln Street, Suite 206, Worcester, MA 01605. No phone calls

HELP WANTED LOCAL

MERCHANDISE

ITEMS UNDER $2011

The Town of Millbury is seeking applicants interested in the position of Head Clerk in the ofďŹ ce of the Town Clerk. Duties include: performing a variety of clerical work, processing, maintaining, and preparing vital records, conducting elections, voter registrations and related customer service. This is a 19-hour position covered under a collective bargaining by and between the Town of Millbury and GEU Local #5. Copies of the job description and applications are available in the ofďŹ ce of the Town Manager 127 Elm Street, Millbury, MA 01527 or online at www.millbury-ma.org.

FOR SALE

53â&#x20AC;? Pioneer HDTV Projection RV. Runs great. Moving sale. $275.00 978-534-4810

We have an immediate opening for a driven multi-media advertising sales exec based in Worcester. You will inherit some active accounts, land lots of new ones! Work hard, play hard entrepreneurial culture. gcharter@worcestermag.com

Radiologist (Worcester, MA) sought by UMass Memorial Medical Group, Inc. Provide clinical service and coverage in Division of Body Imaging. Requires Mass license. Ref. #10332P and apply to Katherine Pryor, Sr. Physician Recruiter, UMMMG, 295 Lincoln Street, Suite 206, Worcester, MA 01605. No phone calls. Research Scientist (Chemistry) Worcester, MA. needed to synthesize chem. compounds for biological screening. Will maintain safe and organized laboratory environment, maintain detailed records of the research, and communicate with supervising Sr. Research Chemist. Requires BS Deg. in Org. Chem. or Med. Chem. & 5yrs rel. exp. or M.S. + 2 yrs exp. To apply Reference requ 10218G & res & cvr ltr to Kim Kapteyn, Admin. Asst., Microbiotix, Inc., One Innovation Drive, Worcester, MA 01605. No calls.

4FF.PSF 0O-JOF

â&#x20AC;˘ M A R C H 3 , 2 0 11

CHERRY BEDROOM SET Solid Wood, never used, brand new in factory boxes. English Dovetail. Original cost $4500. Sell for $795. Can deliver. Call Tom 617-3950373 // *\\ LEATHER LIVING ROOM SET in original plastic, never used. Original price $3,000, sacrifice $975. Call Bill 857453-7764* // \\ PRIVACY HEDGES Blowout Sale 6â&#x20AC;&#x2122; Arborvitae (cedar) Regular $129 now $59 Beautiful, Nursery Grown. Free Installation 518-536-1367 www.lowcosttrees.com Walk In Bathtubs with Jets $1495 www.FOYBS.com// ITEMS UNDER $2011 19â&#x20AC;? Dell flat screen monitor. Barely used. Retails for $169. Sell for $85. 508-8292674.

BIG BERTHA IRONS 4-Pw & Gw $200.00 or BO 978-840-1084 KIMBALL PIANO and Bench Excellent condition, Tuned yearly $1150 978-5378693. Living Room Sofa Lazy Boy type each end. Must be seen. $150. 508829-3853 Mother of the Bride pink gown w/ shawl. Size 14. $75. 508-829-6877. New Konica Minolta 2200 Printer Cartridges (Cyan & Magenta) orig pkg. $50 for both. 978-537-9900 X114. Playstation 3 w/ one controller, 3 games, HDMI cable. Orig box & manuals. $250 774-276-1593. RECLINER & swivel, Lazy Boy, blue, good condition $35. 508-756-1315 after 4 pm.

HELP WANTED LOCAL

XXXDFOUSBMNBTT DMBTTDPN WORCESTERMAG.COM

(508) 749-3166 ext. 430

Items Under

$2011

Treasure Chest ofCENTRAL FREE Ads! MASS CLASSIFIEDS

FR EE!

in the

SUBMIT ITEMS UNDER $2011 FOR FREE!

Hereâ&#x20AC;&#x2122;s all you need to do! 3 ways to submit... 1. Mail completed form to Central Mass Classifieds, 101 Water Street, Worcester, MA 01604 2. OR FAX the completed form to 508-749-3165 3. OR Email the info with name/address/phone number to sales@centralmassclass.com

NO PHONE ORDERS ACCEPTED FOR FREE ADS PLEASE PRINT CLEARLY... We are not liable for misinformation due to ad being illegible:

TREASURE CHEST - ITEMS UNDER $2011

Have you advertised in the Central Mass ClassiďŹ eds before? Please check one. ___ Yes ___ No Name ____________________________________________________________________________ Address __________________________________________________________________________ Town ______________________________ Zip ______________ Phone _______________________ Email Address (optional) ______________________________________________________________ Ad Text: (approx 20 characters per line includes letters, spaces, numbers, punctuation) _________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________ _________________________________________________________________________________

PLEASE R EA D THE RULES:

Maximum 4 lines (approx. 20 characters per line). We reserve the right to edit if ads come in that are too long. NO phone orders accepted. See ways to submit above. Merchandise Ads Only - NO autos, snowmobiles, RVâ&#x20AC;&#x2122;s, trailers, boats, ATVâ&#x20AC;&#x2122;s, etc. We have a special rate for these ads ($20 till it sells). NO business Ads accepted for this section. If we suspect the ads are being sent in by a business, we reserve the right to refuse. Limit 1 ad per name/address/phone number every 2 weeks. Ads will run for 2 weeks. Limit 1 item per ad (group of items OK if one price for all and under $2011) Price must be listed in ad.

DEADLINE FRIDAY 5 PM to begin following week â&#x20AC;˘ HAPPY TREASURE HUNTING!


Professional Services Call June at 508-755-1199 x430 to place your ad â&#x20AC;˘ ADVERTISE IN THIS DIRECTORY & REACHâ&#x20AC;Ś 30, 000 households each week! Add another Zone and reach 45,000 households! â&#x20AC;˘ Deadline: Monday, Noon.

Financial Services

Fence & Stone

Floor Covering

Home Improvement

Flooring

B RADâ&#x20AC;&#x2122;S HOME I MPROVEMENT

<HDUVLQ%XVLQHVV

Â&#x2021;$//)(1&(7<3(6&HGDU9LQ\O&KDLQOLQN 3RVWDQG5DLO2UQDPHQWDO3RRO 7HPSRUDU\6HFXULW\5HQWDOVÂŤ Â&#x2021;+$5'6&$3(66WRQHZDOOV:DONZD\V3DWLRV 3RRO'HFNV&RQFUHWH:RUN([FDYDWLRQÂŤ

(PSOR\HG8QHPSOR\HG*RRG&UHGLW %DG&UHGLW*HW0RUWJDJH5HOLHI ZLWK2XU)UHH0RUWJDJH´&KHFNXS¾ :H+HDO´6LFN¾0RUWJDJHV



& 6

â&#x20AC;&#x153;Over 30 Years Experienceâ&#x20AC;?

&DUSHW0LOOV CARPET & LINOLEUM 6T<GV,QVWDOOHGZLWK3DG %HUEHU3OXVKRU&RPPHUFLDO

Remodeling & Repairs Kitchens & Baths â&#x20AC;˘ Windows & Doors Finished Basements â&#x20AC;˘ Decks RooďŹ ng

508-829-7361

Free Metal Included Call Tom

800-861-5445 or 508-886-2624

Size Per Block 1.75 x 1.75 8 wks â&#x20AC;Ś $31.50/wk = $252 12 wks â&#x20AC;Ś $26.75/wk = $321 20 wks â&#x20AC;Ś $25.20/wk = $504 36 wks â&#x20AC;Ś $23.60/wk = $850 52 wks â&#x20AC;Ś $22/wk = $1144 Minimum commitment of 8 weeks. ASK about double blocks (size 3.75" x 1.75") and COMBO pricing into our other zone and reach 45,000 households in 26 towns in Central Mass each week. FREE line ad included with each block purchased.

IRUIUHHHVWLPDWH

ZZZILUVWFKRLFHIDPLO\VROXWLRQVFRP

Home Improvement

Home Improvement

Junk Removal

Plumbing

PAULâ&#x20AC;&#x2122;S

JUNK REMOVAL â&#x20AC;&#x201C; ALL SEASON SERVICES

Schultz Plumbing

&/($59,(: +20(,03529(0(17

ROOF SHOVELING

&DOO3DXO )UHH(VWLPDWHV )XOO\/LFHQVHG ,QVXUHGÂ&#x2021;+,&

Â&#x2021;:LQGRZVÂ&#x2021;'RRUVÂ&#x2021;5RRIVÂ&#x2021;

Â&#x2021;$GGLWLRQVÂ&#x2021;.LWFKHQVÂ&#x2021;%DWKVÂ&#x2021;

3DLQWLQJÂ&#x2021;+DQG\PDQ6HUYLFHVÂ&#x2021;6QRZSORZLQJ

6LGLQJÂ&#x2021;3RUFKHV 'HFNVÂ&#x2021;)LQLVKHG&HOODUV

ITEMS UNDER $2011 SKATE BOARD measuring 3 feet 4 inches. Brand new, never used. Asking $75. 978833-3805 MUSICAL INSTRUMENTS MUSICAL INSTRUMENTS CLARINET, FLUTE, VIOLIN, TRUMPET, Trombone, Amplifier, Fender Guitar, $69 each. Cello, Upright Bass, Saxophone, French Horn, Drums, $185 ea. Tuba, Baritone Horn, Hammond Organ, Others 4 sale. 1-516377-7907 *

$AVE

REMODELING Kitchens & Bathrooms Basements & Decks Finish Carpentry Windows & Doors Repairs & Painting Quality Workmanship Guaranteed

LIC#165875/INSURED

5088825265 OTHER

ANTIQUES DIRECTORY

â&#x20AC;&#x153;Oh My Goshâ&#x20AC;? Antiques & Collectibles Found at The Cider Mill

Licensed d

Call us to remove your trash! Large or small, we haul it all! Thereâ&#x20AC;&#x2122;s absolutely nothing to fear, the lowest prices are here! No hidden charges. We provide A#1 service at the best rate around in junk removal. We will beat any written estimates by competitors. We are the most economical option in junk removal & clean-out services. We are prompt, professional, and efďŹ cient. We show up as scheduled & clean up after the job is done. Donâ&#x20AC;&#x2122;t delay, call us today! Fully licensed & insured, locally owned & operated.

774-312-1973/508-304-9759 â&#x20AC;˘ allseasonsrvcs@yahoo.com

LICENSED & INSURED PLUMBING SERVICES

Please visit our website:

www.schultzplumbing.com Rutland, MA License # 26981

508.735.3567

a y

t

w

10% OFF FOR NEW CUSTOMERS

2011 Su m mer C a m p Directory y To Advertise Contact June or at C arrie 508-749-3166 x430

sales@centr al masscl ass.com

COME TO OUR OPEN HOUSE SUNDAY, MARCH 20 15 Waushacum Ave., Sterling 978-422-8675 Open 7 Days a Week 11 am to 5 pm Thursdays 11 am to 8 pm

SUMMER CAMP

DAY & RESIDENTIAL PROGRAMS 2011

JULY 3â&#x20AC;&#x201C;AUGUST 13

(Choose as many weekly sessions as you want)

FOR AGES 8â&#x20AC;&#x201C;16

EDUCATION AT TEND COLLEGE ONLINE from Home. *Medical, *Business, *Paralegal, Accouinting, *Criminal Justice. Job placement assistance. Computer available. Financial Aid if qualified. Call 888-216-1791 www.CenturaOnline.com //

CHILDREN CHOOSE ANY ONE OF THE FOLLOWING CORE PROGRAMS: Physical Science â&#x20AC;˘ Natural Science â&#x20AC;˘ Performing Arts â&#x20AC;˘ Adventure Challenge â&#x20AC;˘ Fine Arts CHARLTON, MA â&#x20AC;˘ FOR MORE INFO

1-800-433-8375

4(205. :<44,9: 4,469()3, -69 @,(9: :<44,9*(47 3,(95469,(;6<9 *(4767,5/6<:, :H[\YKH`4HYJO [O HT[VWT

*,5;9(3*644<50;@ )9(5*/@4*( 4HPU:[YLL[ >VYJLZ[LY4(  ^^^`TJHVMJTVYN

-PUHUJPHS(ZZPZ[HUJLPZ(]HPSHISL

M A R C H 3 , 2 0 11 â&#x20AC;˘ W O R C E S T E R M A G . C O M

39


www.centralmassclass.com

CENTRAL MASS CLASSIFIEDS

“Go Get Schooled”--some scholastic necessities. Los Angeles Times Sunday Crossword Puzzle

JONESIN’

Edited by Rich Norris and Joyce Nichols LewisJones - By Matt

“I BEFORE E’S” By JACK MCINTURFF

91 Barrage 92 “To Kill a Mockingbird” ACROSS Pulitzer winner Across 1 Like good jokes 93 Boston transit 1 Garlic unit 7 Night music syst. 11 5Focus at a 94 Londonderry’s Treasury agent, slangily boxer’s school? river 9 FDR’s dog 20 Brought out 95 R rating cause 21 13 GotDr. off Frankenstein’s 100 Mideastern go-to pastry dough 22 Source of a vital guy 103 Kurdish supply 23 14 Meek Jolly slave relative Feudal 104 Confectionery Roger 16 Form of quartz collectible crewmen? 105 Hair cover 25 17 Rear-ends, say passage Chimney 26 Theater aisles, 106 Cry of 18 Holodeck locale anticipation usually 109 Meryl as a 27 20 NASA’s “Go”college Some students coquette? 28 Some reality can’t go without it 112 Check before show winners 30 22 Flowery Mind reading?cutting 113 Stadium welcomes 23 Finish making payments stratum 31 R.E.M. hit, with “The” 114 Oriole Park at on 33 “Games People Yards 24 Examines the __ depths Play” author Eric 115 Words before 34 28 Hang behind an important Detergent brand in a pink 36 One-million link announcement package 37 Old strings 116 1974 CIA Once-homeless “Golden38 30 Sporty Italian spoof wheels 117 Hotel meetings, Voiced” Williams 42 Polish perhaps 33 Atlanta university protector? 45 Spent the cold 34 Reason for a siren season (in) helper 46 37 ProHired foe 48 How some 38 Some high school students soccer games can’t end go without it 49 41 N.J.Demeanor neighbor 50 Selection word “Listen up!” 51 42 Red-costumed actor in “Veggie Kerri 43 Gymnast Tales”? “___ (1998 Mat53 45 Moses sentPunk!” him into Canaan to movie) thew Lillard spy Spotsome in the 55 46 Misses of sea the“Old lecture,MacDonald” noise 50 perhaps Dictation stat, for short 56 52 Swedish city connected by a 54 The Diamondbacks, on bridge to scoreboards Copenhagen 57 55 Root vegetable Some elementary school 59 Take really short students can’t catnaps during a go without it Henny 59 They’re set by deadlines Youngman 62 Shakespeare’s “Poor me!” routine? 69 63 Failed flier Walkie-talkie word 70 Culture: Pref. Car, in Caracas 71 64 Collar victim 75 65 Spin-off starringmusic duo that Russian Valerie Harper teases that they’ll kiss 76 often Tiny nestling’s cry? onstage 81 Sets straight ___ Network” 83 66 Mil.“Onion spud duties 84 67 Paddled boats Backtalk 85 Raw rocks Miasma 86 68 Mineral involved in much Down litigation Hit the ground hard 88 1Ownership dispute? 2 Less hot 90 “Casey at the 3Bat” Lizard’s locale 4autobiographer La ___ Tar Pits 3/13/11

5 “The Vampire Diaries”

40

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 24

DOWN It’s not an original Water source Crooner Mel Giraffe relative Leaves alone Pres. during Brown v. Board of Education Chevy SUV Supermodel Wek Dessert choice French isl. south of Newfoundland Bean and Welles Ball girl Those, in Tenerife Obama, e.g.: Abbr. Form letters? Drug money? Zip Credit card name under a red arc Cupid’s counterpart Tropical grassland

29 Stowe novel subtitled “A Tale of the Great Dismal Swamp” 32 NBC newsman Roger 33 One way to get to Paris 34 Novelist Deighton 35 Prado pictures 37 Old strings 38 Boston department store founder 39 River of Tuscany 40 Nevada senator 41 Time to beware 42 Stone marker 43 Request to a dealer 44 Coming-out party? 45 Like Tom Jones, by birth 46 SDI weapons 47 Oscar winner Patricia 49 Missile with a feathery flight 52 Benedict XVI, e.g.

network 6 2006 ABC drama with Anne Heche 7 ___Vista (alternative to Google) 8 Wassailer’s song 9 How-to series with a distinctive yellow cover 10 Folk rocker DiFranco 11 Fleur-de-___ 12 Woodsman’s tool 15 Surround from all sides 19 Feature of a dirty desk 21 Tag shout 25 ___ and groan 26 Prison on a ship 27 Late Pink Floyd member Barrett 29 They’re dialed to send pages 31 Watercolor prop 32 They dry in the kitchen 35 Apt. ad stat 36 “Lost” actor Daniel ___ Kim 38 First name in Latin jazz legends 39 Gateway Arch architect Saarinen xwordeditor@aol.com 40 Fairy tale surname

53 Half a dance 54 Pen name 57 Proverbial sword beater 58 Occurring before: Abbr. 60 Block 61 ’60s Israeli prime minister 62 Some ’Vette coverings 63 Unites 64 Jazz __ 65 Dramatist Fugard 66 Dear, in Dijon 67 You can get down on one 68 Illegal payments 71 Class-conscious gps.? 72 Formerly, formerly 73 Bumpkin 74 Fund for hammer parts? 76 “Circle of Friends” author Binchy 77 __-European languages 78 Corn holder

79 80 82 84 87 88 89 91 94 95 96 97 98 99 100 101 102 103 104 107 108

110 111

Accomplish Bone: Pref. Certain NCO Orchestra members It may be taken in a parlor Popular shift Early communications satellite Put into groups Elizabethan expo Turns Ones against us Wikipedia policy Math subgroup Blissful settings Douglas and others Gangsta rap pioneer Tibetan priest Satyr’s kin Hunted Make lace Northwestern sch. where Cougar Gold cheese is made Inside info Pie chart fig.

41 Big newspapers and magazines, etc. 44 Score for the San Jose Earthquakes 47 Dipsy’s playmate 48 Fake 49 It may pop out of a box 51 Psych ending 53 Model actions 56 Doc blocs 57 Costa ___ 58 Eightfold ___ (Buddhist principle) 59 Boatload 60 “___ Been Everywhere” 61 Sound from a litter Last week's solution

©2011 Tribune Media Services, Inc.

©2010 Jonesin’ Crosswords (editor@jonesincrosswords.com) For answers to this puzzle, call: 1-900-226-2800, 99 cents per minute. Must be 18+. Or to bill to your credit card, call: 1-800-655-6548. Reference puzzle #0472.

WORCESTERMAG.COM

• M A R C H 3 , 2 0 11

(508) 749-3166 ext. 430

EDUCATION

REAL ESTATE

AVIATION MAINTENANCE AVIONICS. Graduate in 15 Months. FAA Approved; financial aid if qualified. Job placement assistance. Call National Aviation Academy Today! 1-800-292-3228 or NAA.edu * HEALTH & BEAUTY The Holistic Center Your local health products, herbal & homeopathic apothecary & wellness center. 53 East Main Street, W. Brookfield 508-867-3409 www.TheHolisticCenter. net INSTRUCTION Sculpting Classes Studio 36 4 classes for $160 508-397-2059 akconsulting@charter.net NOVENAS Prayer to St. Jude May the Sacred Heart of Jesus be adored, glorified, loved and preserved throughout the world now and forever. Sacred Heart of Jesus, pray for us. St. Jude, worker of miracles, pray for us. St. Jude, helper of the hopeless pray for us. Say this prayer 9 times a day for 9 days, by the 9th day your prayer will be answered even if you don’t believe. This novena has never been known to fail. Publication must be promised. Thank you St. Jude and God. DG

APARTMENTS

STUDIO APARTMENTS FOR RENT AVAILABLE IMMEDIATELY STUDIOS AT $560 PER MONTH INCLUDES HEAT AND HOT WATER. WALL TO WALL CARPETING, FULL BATH WITH KITCHEN, PARKING, SECURE ENTRY. PLEASE APPLY TODAY CALL 508-754-5339 VISIT OUR WEBSITE AT: www. theauroraapts.com BURNCOAT/ GREENDALE 1 bedroom, laundry, appliances & off street parking. From $650. 508-8526001. MILLBURY 1 BR waterfront, 3 rms, easy access to Rts 20/90/146, W/D included, $675/mo. 1st/last/sec. 508865-2877.

Please Recycle

This Newspaper

BOOKS

)VVRZ)VVRZ)VVRZ >LOH]LSP]LS`VSKIVVRZ H[;/,)662),(9 >LOH]LIVVRZMVY[OLZJOVSHY JVSSLJ[VYHUKNLULYHSYLHKLY 3VJH[LKVU9V\[L PU>LZ[ )YVVRMPLSKOHSM^H`IL[^LLU (TOLYZ[HUK>VYJLZ[LY6WLU KH`ZH^LLRHTWT

>,(3:6)<@)662 *633,*;065:30)9(90,: ,:;(;,: *HSSMVYPUMV VY JHSS;VSS-YLL  ^^^[OLIVVRILHYJVT


www.centralmassclass.com

CENTRAL MASS CLASSIFIEDS

HEALTH, MIND & BEAUTY

Dial-A-Friend Need a friend? Call Dial-AFriend. Inspirational messages recorded daily. Call 24 hours.

508-852-5242

ethod of Christâ&#x20AC;&#x2122;s m 508-852-5242 ll healing ca ur info after and leave yoional message. the inspirat

),

ay M , l i r p A , h c r a M ):3-< 576< 05

16/84 ) 6

IN ]TTKWTWZ V W \ V M U KM TI X  1VKT]LM [ ;<7+316;-:<     , 1, ; , 7 = *4 WVKMIUWV\P [ MZ X I X TT I V ] Z N]TT ?--3;7.  . 7 1+ 7 0 + ; \ 16+4=,MZILXTIKMUMV \P W Z W  a Z \W MK QZ ;MZ ^ QKM, WZM TQVMIL°IVLU M ZM N I [ M L ] KT 1V

Your local health products, Herbal & Homeopathic Apothecary & Wellness Center 53 East Main Street West BrookďŹ eld, MA 508-867-3409

5):+01; 31,6-A 576<0 Visit

www.kidney.org

Tue-Sat 11 AM to 6 PM Sun 12 Noon to 5 PM Closed Monday www.TheHolisticCenter.net

HOUSE FOR SALE

7/ : ) 5 >-:<1;16/8:

Holistic Center I n c

ur free co Send for yo try of Healingâ&#x20AC;? is in M he e â&#x20AC;&#x153;T contains th A book that e Great th wisdom of Physician.

<WIL^MZ\Q[MKWV\IK\2]VMWZ+IZZQM 

G N I L F G N I R SP

T H E

Are You Sick? py of

(508) 749-3166 ext. 430

!! LAND FOR SALE ARIZONA BIG BEAUTIFUL LOTS, $99/mo., $0-down, $0-interest. Golf Course, Natâ&#x20AC;&#x2122;l Parks. 1 hour from Tucson Intâ&#x20AC;&#x2122;l Airport. Guaranteed Financing. NO CREDIT CHECK! (800) 6318164 Code 4054 www.sunsiteslandrush.com ^

STERLING New construction. Town House. 2BD, 2.5BA, XL garage. Granite, SS appl. hw flrs. End unit. Luxury. $229,900 Call owner. 978807-9173

OFFICE SPACE FOR RENT Causeway Mall Rts. 12 & 110, West Boylston. Professional Office Suites, 1100 sq. ft. & 775 sq. ft. Great location. Ample parking. Handicap access. Avail. immediately. Also, shared office space avail. Call 508-835-6613

OFFICE SPACE FOR RENT Sonoma Square Rts. 2 & 140, Westminster. Medical suite avail. 3200 sq.ft. 2nd fl Office Space avail. 1600 sq.ft. Convenient location, ample parking. Call 508-962-7451 ROOMMATE ALL AREAS ROOMMATES.COM Browse hundreds of online listings with photos and maps. Find your roommate with a click of the mouse! Visit: http://www. Roommates.com.^

+):<776+76<-;<?166-:

)>)14 )*4- ; < 7 8 ;     76 4A ):+0< 0 5 16 4 , ) ,

@

0MI\PMZ5WWZM )3),MTI,WPMZ\a WN:]\TIVL

)6,8 : 1+16/ 7 . 6 1 : 7 5 : .7 IQT !!@WZMU NW        TT +I ZQV I[[KTI[[KWUNW TU I \Z V KM [( TM [I

! G N I R P S K N TH I 0WVWZIJTM5MV\QWV"2 0WVWZIJTM5MV\QWV"2IUM[)UWZMTTWWN2MNNMZ[WV M A R C H 3 , 2 0 11 â&#x20AC;˘ W O R C E S T E R M A G . C O M

41


www.centralmassclass.com

CENTRAL MASS CLASSIFIEDS

(508) 749-3166 ext. 430

W INTER B ULLETIN B OARD HOME SHOPPING

GARDEN EVENT

Blackstone Valley Gardeners Invites the Public to our Free Spring Event

+30&RQQHFWLRQ SHOP AT HOME FROM HOWIEâ&#x20AC;&#x2122;S WEB MALL 0DUNHWSODFHV â&#x20AC;˘ APPAREL â&#x20AC;˘ ELECTRONICS â&#x20AC;˘ BEAUTY â&#x20AC;˘ LIVING â&#x20AC;˘ SPORTS â&#x20AC;˘ TRAVEL

www.newweboutlets.com/hm1489 E-mail: howard92@ymail.com Phone: 508-579-1489 COUNSELING

â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s not therapy. It really works.â&#x20AC;? â&#x20AC;˘ Poor grades. â&#x20AC;˘ ConďŹ&#x201A;icts with teachers and adults. â&#x20AC;˘ Help applying to high school or university. Dedicated to helping one child and one family at a time. www.AffordableTherapy.info

Thur., Mar. 10, 6:30pm Alternatives Unlimited 50 Douglas Rd, Whitinsville, MA David Hughes, an instructor for University of Rhode Islandâ&#x20AC;&#x2122;s Master Gardener program, will present

â&#x20AC;˘ 2 0 1 1 â&#x20AC;˘

FO R TH E Y E A R 2 010 &203/(7(<($55281'7$;6(59,&(6

INCOME & BUSINESS TAX PREPARATION

Â&#x2021;7D[5HWXUQ3UHSDUDWLRQÂą3HUVRQDO&RUSRUDWH 3DUWQHUVKLS(VWDWHVDQG7UXVWV1RQ3URÂżWÂ&#x2021;)UHHHÂżOH Â&#x2021;%DFN7D[HV $XGLWVÂ&#x2021;,56 '255HSUHVHQWDWLRQ Â&#x2021;0XOWLSOH6WDWHVÂ&#x2021;3ULRU<HDU5HWXUQV

Abbey Road

/LFHQVHG,567D[3URIHVVLRQDOV Call Now - $15 OFF Any Tax Return Over $150 for New Clients MICHAEL D. CONRAD, EA

645 Chandler St., 2 ND Floor Worcester, MA 01602

â&#x20AC;&#x153;Sustainable Plants, Sustainable Gardens.â&#x20AC;?

David will share with us the basics necessary to make our gardens thrive and share his personal plant preferences for achieving a thoughtful balance between resources used and results gained. Refreshments will be served. EVENT IS FREE.

To advertise contact June or Carrie at

508-749-3166

ext 430

T hink Spring!

508-754-2665

www.strataccounting.com SOLAR & KILCOYNE Certified Public Accountants

Todd S. Solar, CPA John F. Kilcoyne, CPA INDIVIDUALS & BUSINESSES

Construction Manufacturing Non-Profits Trusts & Estates

$OEHUW1&HFFKLQL &3$($ 67 Millbrook St., Suite 216 Worcester, MA 01606 508-797-0077

Leominster, MA â&#x20AC;˘ 978-537-2929 Worcester, MA â&#x20AC;˘ 508-854-2900

â&#x20AC;˘ Year-round tax, accounting & consulting service. â&#x20AC;˘ Computerized State & Federal taxes, electronic filing. â&#x20AC;˘ Business & Individual returns.

www.solarkilcoyne.com

Day/evening by appointment

($*/(52&.),1$1&,$/,1& ,1',9,'8$/$1'60$//%86,1(667$;5(78516

â&#x2DC;&#x2026;â&#x2DC;&#x2026;â&#x2DC;&#x2026;â&#x2DC;&#x2026;â&#x2DC;&#x2026; CAPE HOUSE SOUTH DENNIS, MA Memorial Day Weekend avail ($100/night), All of June & Sept. avail ($850/wk); & July 9-16 ($975/wk in July) 3 bedrooms, (dbl., queen, 2 twins), on dead end street, screened porch w gas grill, outside shower, full kitchen with microwave, full bath, washer/dryer, 3 TV â&#x20AC;&#x2DC;s w/Cable, DVD. Close to golf, bike trail, shopping, theater, 10 minutes from bay side and ocean side beaches.Call Janet 508865-1583 after 6 pm or email junosima@hot mail.com for photos.

42

WORCESTERMAG.COM

VACATION RENTALS FOR RENT: One week at the largest timeshare in the world. Orange Lake is right next to Disney and has many amenities including golf, tennis, and a water park. Weeks available are in March, and April. $850 inclusive. Call Carol at 978-371-2442 for more information.* MOOSE WATCHING from lakefront log cabins in Jackman, Maine mountains. Remote, yet accessible, outdoor loverâ&#x20AC;&#x2122;s paradise! Fishing, canoeing, Kayaking, hiking and relaxing at The Last Resort. www.lastresortmaine. com 207-668-5091// Old Orchard Beach, 3 BR, 1 BA, across from beach, no smoking, no pets, walk to amusements, $1400/wk. Call 508-347-9804.

â&#x20AC;˘ M A R C H 3 , 2 0 11

20 YEARS EXPERIENCE

Your LOCAL & EXPERIENCED Tax Professionals

44 Meola Ave., Worc., MA 01606

(508) 856-0655

Your Individual or Business Tax Preparation

(20% Off For New Clients Only) (Current Clients Receive CMBC Discount)

And Always

FREE

E-Filing for Faster Refunds Coupon Never Expires Email: paulburgess@charter.net

CONVENIENT APPOINTMENTS â&#x20AC;˘ DAYS â&#x20AC;˘ WEEKENDS â&#x20AC;˘ EVENINGS â&#x20AC;˘ YEAR ROUND SERVICE

â&#x20AC;&#x153;Trouble Free Tax Preparationâ&#x20AC;?

774-578-1576

VACATION RENTALS

â&#x20AC;&#x153;Know the Credentials of Your Tax Proâ&#x20AC;?

Tax Service

20% OFF

12)((5(9,(:2)<28535,25<($56Âś7$;5(78516

6FRWW.DGLVK($0%$ 

Individual & Business

Tax Express Fast Accurate Dependable

â&#x20AC;˘ IRS Representation â&#x20AC;˘ Back Taxes â&#x20AC;˘ Small Business

Accounting â&#x20AC;˘ Rapid Refund

Ben Cee Mensah EA IRS Enrolled Agent

Tax Express â&#x20AC;˘ 166 Lincoln Street Worc., MA 01605 â&#x20AC;˘ 508-853-2767

www.taxexpressgroup.com

       

To Advertise In This Directory

Call June or Carrie @ 508.755.1199 x 430 or e-mail us at â&#x20AC;Ś sales@centralmassclass.com

          

+HOSLQJ:RUFHVWHUFRXQW\ WD[FOLHQWVVLQFH VFRWW#HDJOHURFNÂżQDQFLDOQHW ZZZHDJOHURFNÂżQDQFLDOQHW

VACATION RENTALS WARM WEATHER IS YEAR ROUND In Aruba. The water is safe and the dining is fantastic. March 25th to April available. Walk out to the beach. Sleeps 8. $3500. Call Carol at 978-371-2442 or email: carolaction@aol.com*

AUTOMOTIVE AUTO/RV 1999 Wilderness 28â&#x20AC;&#x2122; Single slide 5th wheel travel trailer. Rear kitchen. Queen bed. Sleeps 6. Awning. 1 owner. Exc. cond. Asking $8500.00 508-886-8820

AUTO/RV

AUTO/TRUCK

Patriots Tailgate RV 1989 Coachman 57k orig. miles. Good tires, runs well. Painted logos. Perfect for season ticket holders. $3500.00 508723-6258

1997 Ford 250 3/4 ton, 4WD, 85k mi, rear electric lift gate lifts 1250 lbs, new tires, runs good, $4500.00 978343-6546.

2008 Chevy Tahoe LT 5 drs. 8cyl. Silver ext., gray cloth int. 39k mi. 4wd. Exc. cond. Auto trans, extras. $24,950.00 508-829-9315 e.clecta@verizon.net

4FF.PSF 0O-JOF XXXDFOUSBMNBTT DMBTTDPN


To view current Real Estate Transactions, pick up a print copy of

The Landmark • The Community Journal Leominster Champion • Fitchburg Pride The Millbury-Sutton Chronicle • Worcester Mag And you will find them in the Central Mass Classifieds! Sponsored by…. Residential • CommeRCial • ConCRete

978-405-0017

• Exterior Painting & Staining • Decks & Deck Re-finishing • Interior Painting & Staining • Epoxy Coatings • Stamped Concrete & Overlays • Decorative Concrete Applications

Call for Free Estimates!

www.blackbearpainting.com


CENTRAL MASS CLASSIFIEDS

www.centralmassclass.com

Car For Sale? Truck for Sale? RV? SUV?

+LJKHVW3ULFHV3DLGIRU<RXU-XQN9HKLFOH

RUN YOUR AD UNTIL IT SELLS!! MARCH & APRIL SPECIAL!!

FOR SALE Subaru Mint Condition. Low miles. Garaged. New tires. New wipers. Need to see. Black with tan interior. Must see to believe. Call for appt. 555-555-5555

ONLY $20 FOR SIX LINES FOR ALL SIX PAPERS UNTIL IT SELLS! Reach 200,000 readers in print AND online! Call June at 508-755-1199 Or â&#x20AC;Ś Carrie at 508-749-3166 Ext. 250 Private Parties Only â&#x20AC;˘ Deadline Monday @ Noon (We monitor daily for scammers.)

Over 40 Acres! Over 3000 Vehicles! <:,+ 5,> (<;67(9;:

(508) 749-3166 ext. 430

MOTORCYCLES GOLDWING Honda 1989 GL 1500, excellent condition, many extras, only 26,000 miles, $4500. Call 978-5344314.

86 ( $87 ' 3$5 2 76

6,1&()$0,/<2:1(' )25<285-81.&$5Â&#x2021;+,*+(6735,&(63$,' &$//86/$6712+$66/(

$&$6+$ )RU\RXU $XWRPRWLYH 6FUDS0HWDO %DWWHULHV

,QWKH:RUFHVWHU$UHD&DOO



a y 6WDQGDUG$XWR:UHFNLQJ&RPSDQ\,QF &DOO7ROO)UHHÂ&#x2021;Â&#x2021; *UDQLWH6WUHHW:RUFHVWHU

ZZZVWDQGDUGDXWRLQFFRP

Ask Us about Charity Cars for Friendly House

TRAVEL

COSTA 995 RICA $

+ tax & fees

10 Day Guided Tour

Available at Caravan.com. 8 to 10 day guided tours of USA, Canada, Guatemala and Panama. All Priced between $995 - $1,295. Free 28 Page Brochure. Since 1952

Call 1-800-CARAVAN

com

-PPLJOHGPS UIBU4QFDJBM 4PNFUIJOH

+(@.<(9(5;,,

FREE Nationwide Parts Locator Service

ANSWERS TO TODAYâ&#x20AC;&#x2122;S PUZZLES ;Y\Z[\Z [VKVP[VUJL HUKKVP[YPNO[

+LWVZP[ZJVU]LUPLU[S` [HRLUV]LY[OLWOVUL

Â&#x2039;-VYLPNU +VTLZ[PJÂ&#x2039;,HYS` 3H[L4VKLS Â&#x2039;,UNPULZÂ&#x2039;;YHUZTPZZPVUZÂ&#x2039;5L^9HKPH[VYZ ;VSS-YLL1-800-992-0441 -H_508-882-5202 Â&#x2039;.HZ;HURZÂ&#x2039;>OLLSZÂ&#x2039;;PYLZÂ&#x2039;)HSHUJLYZ 6MM9[LÂ&#x2039;*VSKIYVVR9K Â&#x2039;,_OH\Z[4HUPMVSKZÂ&#x2039;>PUKV^4V[VYZ 6HROHT4( ^^^HTOLYZ[VHROHTH\[VJVT

Amherst-Oakham (<;69,*@*305.

>VYJLZ[LY5V

508-799-9969

We Buy Unwanted & Junk Vehicles SCRAP METAL ACCEPTED

44

$IFDLUIF$MBTTJžFET

ROTHERS BROOKS

USED AUTO PARTS

508-792-6211 Worcester, MA

ass m l a r t n e c the ed t n a w p l e h class e ad...vantag All Help Wanted display ads reach 125,000+ readers in 26 cities and towns, in five publications, in print and online on five websites for one price! Monday NOON is the deadline for that weeks' issues. Call June at 508-755-1199 X430 or email jsima@holdenlandmark.com for more information or to reserve space.

central mass class works! WORCESTERMAG.COM

â&#x20AC;˘ M A R C H 3 , 2 0 11

LEGALS/PUBLIC NOTICES TOWN OF MILLBURY MILLBURY FINANCE COMMITTEE PUBLIC HEARING NOTICE, in accordance with Section 6-7: Action on the Budget, of the Millbury Charter, the Finance Committee will hold a public hearing on the proposed Fiscal Year 2012 operating budget. The hearing will be held at the Millbury Municipal Office Building on Monday, March 14, 2011 at 7:00PM Michael Oâ&#x20AC;&#x2122;Connor, Chairman 3/3/2011 Town of Sutton Planning Board & Department Sutton Planning Board Public Hearing Notice In accordance with the provisions of Section VI.L of the Sutton Zoning Bylaw â&#x20AC;&#x201C; Accessory Apartments Bylaw, the Planning Board will hold a public hearing on the application of David Fields of 3 Wakefield Avenue, Webster, MA to add an 800 s.f. +/- accessory apartment on land owned by Kevin & Ann Harris, Sutton, MA at 458 Boston Road. The hearing will be held in the third floor meeting room at the Town Hall on Monday, March 14, 201 at 7:15 P.M. A copy of the plans and application can be inspected in the office of the Town Clerk during normal office hours. Tomm Connors, Chairman 2/24 & 3/3/11

LEGALS/PUBLIC NOTICES PUBLIC HEARING NOTICE Millbury Planning Board In accordance with the provisions of Chapter 40A of the Massachusetts General Bylaws, the Millbury Planning Board will hold a public hearing on Monday, March 14, 2011, at 7:30 p.m., at the Municipal Office Building, 127 Elm Street, Millbury, MA, on the application of Herb Chambers Latti Farm Road, LLC, property located at 2 Latti Farm Road, Millbury, MA, for a Modification to a Site Plan Review Special Permit under Article 1, Section 12.4 and 14.11 (l) of the Millbury Zoning Bylaw, originally granted by the Planning Board on November 13, 1995, and recorded with the Worcester District Registry of Deeds in Book 18158, Page 283. Applicant desires to modify the decision by modifying the parking plan and pavement striping. Plan is available for inspection in the Planning Department during normal business hours. Anyone wishing to be heard on this application should appear at the time and place designated above. Richard Gosselin Chairman 2/24 &3/3/2011


www.centralmassclass.com

L

CENTRAL MASS CLASSIFIEDS

EG A L SE RV L L A IC E OC DIRECTORY

&DOO)RU3ULFLQJ)5((DGZKHQ\RXVHQGXV\RXUOHJDOQRWLFHVIRUSXEOLFDWLRQ

S

)RUPRUHLQIRRUWRDGYHUWLVHLQWKLVGLUHFWRU\SOHDVHFDOO-XQHRU&DUULHDW

Daniels & Associates Counsellors At Law Gordie O. Daniels, Esquire

IMMIGRATION â&#x20AC;˘ DIVORCE 340 Main St. Suite 801 Worcester, MA 01608

508-754-7935 LEGALS/PUBLIC NOTICES DIVORCE SUMMONS BY PUBLICATION AND MAILING Docket No. WO10D2309DR Commonwealth of Massachusetts The Trial Court Probate and Family Court Felipe A. Angel vs. Jackelyn Melendez Worcester Probate and Family Court 225 Main Street Worcester, MA 01608 To the Defendant: The Plaintiff has filed a Complaint for Divorce requesting that the Court grant a divorce for irretrievable breakdown. The Complaint is on file at the Court. An Automatic Restraining Order has been entered in this matter preventing you from taking any action which would negatively impact the current financial status of either party. SEE Supplemental Probate Court Rule 411 You are hereby summoned and required to serve upon: Gordie Daniels Esq. Law OfďŹ ce of Daniels & Associates 340 Main St. Suite 801 Worcester, MA 01608 Your answer, if any, on or before 05/17/2011. If you fail to do so, the court will proceed to the hearing and adjudication of this action. You are also required to file a copy of your answer, if any, in the office of the Register of this Court. Witness, Hon. Denise L. Meagher, First Justice of this Court. Date: February 23, 2011 Stephen G. Abraham Register of Probate Court 03/03/11

find us on

LEGALS/PUBLIC NOTICES NOTICE OF PETITION FOR CHANGE OF NAME Docket No. WO11C0038CA Commonwealth of Massachusetts The Trial Court Worcester Probate And Family Court 225 Main Street Worcester, MA 01608 (508) 831-2200 In the matter of: Elaine Bradstreet Nellis Of: Sutton, MA To all persons interested in petition described: A petition has been presented by Elaine B Nellis requesting that Elaine Bradstreet Nellis be allowed to change her name as follows: Elaine Bradstreet IF YOU DESIRE TO OBJECT THERETO, YOU OR YOUR ATTORNEY MUST FILE A WRITTEN APPEARANCE IN SAID COURT AT: Worcester ON OR BEFORE TEN Oâ&#x20AC;&#x2122;CLOCK IN THE MORNING (10:00 AM) ON: March 15, 2011 WITNESS, Hon. Denise L. Meagher, First Justice of this Court. Date: February 16, 2011 Stephen. Abraham Register of Probate Court 3/3/11

Commonwealth of Massachusetts The Trial Court Probate and Family Court 225 Main Street Worcester, MA 01608 508-831-2200 NOTICE OF PETITION FOR PROBATE OF WILL Docket No WO11P0447EA In the Estate of: Paul K Burrows Late of Sutton, MA 01590 Date of Death: 12/30/2008 To all persons interested in the above captioned estate, a petition has been presented requesting that a document purporting to be the copy of the last will of said decedent be proved and allowed and that Lorin Burrows of Princeton, MA be appointed executor/trix, named in the will to serve Without Surety. IF YOU DESIRE TO OBJECT THERETO, YOU OR YOUR ATTORNEY MUST FILE A WRITTEN APPEARANCE IN SAID COURT AT Worcester ON OR BEFORE TEN Oâ&#x20AC;&#x2122;CLOCK IN THE MORNING (10:00 AM) ON: 03/22/2011 In addition, you must file a written affidavit of objections to the petition, stating specific facts and grounds upon which the objection is based, within (30) days after the return day (or such other time as the court, on motion with notice to the petitioner, may allow) in accordance with Probate Rule 16. WITNESS, Hon. Denise L. Meagher, First Justice of this Court Date: February 22, 2011 Stephen G. Abraham Register of Probate 3/3/11

(508) 749-3166 ext. 430

Commonwealth of Massachusetts The Trial Court Probate and Family Court 225 Main Street Worcester, MA 01608 508-831-2200 NOTICE OF PETITION FOR PROBATE OF WILL Docket No WO11P0441EA In the Estate of: Vincent M Stellman Late of Sutton, MA 01590 Date of Death: 01/07/2011 To all persons interested in the above captioned estate, a petition has been presented requesting that a document purporting to be the last will of said decedent be proved and allowed and that Janice M Berthiaume of Sutton, MA be appointed executor/trix, named in the will to serve Without Surety. IF YOU DESIRE TO OBJECT THERETO, YOU OR YOUR ATTORNEY MUST FILE A WRITTEN APPEARANCE IN SAID COURT AT Worcester ON OR BEFORE TEN Oâ&#x20AC;&#x2122;CLOCK IN THE MORNING (10:00 AM) ON: 03/15/11 In addition, you must file a written affidavit of objections to the petition, stating specific facts and grounds upon which the objection is based, within (30) days after the return day (or such other time as the court, on motion with notice to the petitioner, may allow) in accordance with Probate Rule 16. WITNESS, Hon. Denise L. Meagher, First Justice of this Court Date: February 17, 2011 Stephen G. Abraham Register of Probate 3/3/11 Commonwealth of Massachusetts Worcester, ss Superior Court Department of the Trial Court Civil Action No. 11-0237 To: Carrie L. Alward of the Town of Millbury, County of Worcester AND TO ALL PERSONS ENTITLED TO THE BENEFIT OF THE SOLDIERSâ&#x20AC;&#x2122; AND SAILORSâ&#x20AC;&#x2122; CIVIL RELIEF ACT OF 1940 AS AMENDED: Webster First Federal Credit Union, a banking institution with a usual place of business in Worcester, Worcester County, MA, claiming to be the holder of a mortgage covering property situated: 13 Middleton Street, Millbury, Worcester County, MA, given by Carrie L. Alward to Webster First Federal Credit Union dated January 4, 2007 and recorded in Worcester District Registry of Deeds, Book 40461, Page 170, has filed with said court a Complaint for authority to foreclose said mortgage in the manner following: by entry on and possession of the premises therein described and by exercise of the power of sale contained in said mortgage. If you are entitled to the benefits of the Soldiersâ&#x20AC;&#x2122; and Sailorsâ&#x20AC;&#x2122; Civil Relief Act of 1940 as amended, and you object to such foreclosure, you or your attorney should file a written appearance and answer in said court at Worcester in said County on or before the twenty-eighth day of March next or you may be forever barred from claiming that such foreclosure is invalid under said Act. Witness, Barbara J. Rouse, Esquire, Administrative Justice of said Court, this fourteenth day of February, 2011 Dennis P. McManus, Clerk 3/3/11

M A R C H 3 , 2 0 11 â&#x20AC;˘ W O R C E S T E R M A G . C O M

45


Do not choose a replacement window company before hearing this customer’s warning. an Andersen Company

“When we had windows put in by another company, they failed after just seven years!.” —Patricia A., Renewal by Andersen customer If you choose the wrong company, you may have to replace your windows yet again. Poor-quality windows lose their insulating capabilities when they expand and contract through the seasons. Our windows are custom built with our patented Fibrex® material, which is twice as rigid and stable as vinyl. Our Fibrex material is a composite that took us 18 years to research and perfect; 40% reclaimed wood fibers are combined with a thermoplastic polymer to form a material warranted not to rot, flake, blister, peel, crack, pit or corrode.† • Our High-Perfor High-PerformanceTM Low-E4® Glass is up to 45% more energy efficient.* • Our windows ar are custom-built with our own composite Fibrex material, which is twice as rigid and stable as vinyl. coatings keep 95% of UV rays outside, while keeping your home’s energy inside. • Our glass coatin • Our certified Expert Ex Installers have 10+ years of window installation expertise, and 9 out of 10 installers who apply to Renewal by Andersen are not hired.

SAVE 35% MORE THIS SPRING NO INTEREST1 SAVE $149 or Buy 5 and SAVE $110 per window And SAVE

FOR 5 YEARS!

$50 Instant Reb

a

te on every wind ow and door when yo u book your FREE window diagnosis before April 18th 1

$500 on any Andersen patio door1

“Renewal by Andersen windows are so energy-efÅcient, after we had them installed, the oil company called to ask if my meter was broken.” —Neil L., Renewal by Andersen customer Call for your FREE Window Diagnosis

1-866-384-5718 OldWindowFix.com

†See our Limited Warranty and Extended Limited Lifetime Labor Warranty for details. 1Offer not valid with any other offers or prior purchases. This offer and the Instant Rebate are only available on purchase of 5 or more windows and/or patio doors. 12 month no interest financing programs available on all products. Financing is O.A.C. and is not valid with other offers or on prior purchases. Minimum payments are required, but no Finance Charges will be assessed if (1) promo balance is paid in full in 60 months, and (2) all minimum monthly payments on account paid when due. Financing available locally with approved credit only. Financing subject to change without notice. Renewal by Andersen is neither a broker nor a lender. Financing provided by third-party lenders unaffiliated with Renewal by Andersen. Please consult your tax planner and review all IRS guidelines. Renewal by Andersen is not a tax advisor, and its affiliates are not tax advisors. These Renewal by Andersen locations are independently owned and operated retailers. MA Lic# 149601. PA Lic. # 001884. NJ Lic. # 13VH05055400. “Renewal by Andersen” and all other marks where denoted are marks of Andersen Corporation. ©2011 Andersen Corporation. All rights reserved. ©2011 Direct Impact Group Ltd. All rights reserved. The EPA Certification is for Renewal by Andersen operating in Massachusetts, New Hampshire, Pennsylvania, Delaware, Southern New Jersey and Colorado. *As compared to ordinary dual pane glass in the winter. Values based on comparison of RbA double-hung insert window SHGC to the SHGC for clear dual pane glass non-metal frame default values from the 2006 and 2009 International Energy Conservation Code.

46

WORCESTERMAG.COM • MARCH 3, 2011

A


Alina Eisenhauer

Cupcakes are in. Theyâ&#x20AC;&#x2122;re the perfect portable, adorable sugar rush â&#x20AC;&#x201D; so itâ&#x20AC;&#x2122;s no surprise that over the past few years there has been an explosion of specialty cupcake shops and dessert bars in cities across the country. Worcester is lucky enough to have a few of its own, and Sweet Pastry Shop & Dessert Bar is just one of them. Owner Alina Eisenhauer has gotten a pretty sweet gig as of recently: she will be appearing on Season 2 of Food Networkâ&#x20AC;&#x2122;s Cupcake Wars, a confectionary competition that pits chef against chef for a $100,000 prize and the opportunity to showcase their cupcakes at a swanky event. Will Worcesterâ&#x20AC;&#x2122;s own take the cake? How old are you and where are you from? Iâ&#x20AC;&#x2122;m 39. I was born in New York and spent half of my childhood there before my parents moved to The Berkshires, where I learned to cook.

How long have you been baking? I have been cooking and baking since I was about eight years old.

What inspired you to open Sweet? I began baking in a restaurant when I was 16 but it wasnâ&#x20AC;&#x2122;t until after I became pregnant with my son nine years ago that I decided to open my first pastry business.

Youâ&#x20AC;&#x2122;ve created so many cool cakes: whatâ&#x20AC;&#x2122;s your all-time favorite design? Itâ&#x20AC;&#x2122;s hard to pick just one! Recently I really had fun making a replica of a water skiing/wake boarding boat with the owner driving it. Generally speaking, my favorite cakes and the ones I think turn out the best are the

ones where the client gives us a theme and the creative license to run with it.

Whatâ&#x20AC;&#x2122;s your favorite Sweet cupcake ďŹ&#x201A;avor?  Iâ&#x20AC;&#x2122;d have to say our Margarita cupcake, which is loaded with key lime juice and tequila and has a sprinkle of sea salt and sugar on the top.

Tell us a bit about the process of getting a spot on Food Networkâ&#x20AC;&#x2122;s Cupcake Wars. The producers knew of me and my work and I was asked to submit a video and pictures. I was then called and interviewed on the phone and finally received a call telling me I had been selected to compete on the show. The whole process took about three weeks.

What do you think gives your cupcakes and your team an edge on the competition? We have a few things going for us: we make great-tasting cupcakes, use only the best ingredients, and weâ&#x20AC;&#x2122;re always thinking outside the box when coming up with new and

STEVEN KING

Two minutes with... different flavors. I also have the advantage of having a Marine (Shayla Vander Vliet) for my assistant. We both love competition and see it as a really crazy, really fun game that we want to win.

Did you have any crazy mishaps on set? We didâ&#x20AC;&#x201D;itâ&#x20AC;&#x2122;s even harder and crazier than it looks on TV, but youâ&#x20AC;&#x2122;ll have to watch to see what happens as we are sworn to secrecy. Even my staff doesnâ&#x20AC;&#x2122;t know what happened.

Who was your favorite of the judges? My favorite was Candice Nelson, the founder of Sprinkles Cupcakes.

I hear youâ&#x20AC;&#x2122;re having a viewing party for the episode â&#x20AC;&#x201D; tell us about that. We are having a viewing party at our store on Tuesday March 8, which is the night our episode will premiere. We are charging $10 per person, which includes a cupcake tasting of what

WHEN YOUR DOCTOR IS NOT IN... THIS DOCTOR IS IN!

we made on the show so that you can decide if you agree with the judges as the show progresses. We expect to sell out so we strongly recommend that people call or e-mail ahead to get on the guest list. To reserve your spot for Sweetâ&#x20AC;&#x2122;s viewing party, call 508-373-2248 or e-mail Eisenhauer at alina@sweetworcester.com. Sweet Pastry Shop & Dessert Bar, 305 Shrewsbury St., Worcester.

Next Camp: March 14 (Evening camps now being offered)

7!,+ ).-%$)#!,#%.4%2&/2-)./2!),-%.43 ).*52)%3-/2%

/LD&ASHION3ERVICE s -ODERN-EDICINE AFFORDABLE | ALL AGES WELCOME

TFSWJDFT

MOST VISITS $40

s5RINARY4RACT)NFECTIONS s2ASHES3KIN0ROBLEMS s-INOR3TITCHES s"OILS7ARTS s3PRAINS3TRAINS s%AR)NFECTIONS s#OUGHS#OLDS s3ORE4HROATS s"RONCHITIS s3INUS)NFECTIONS s*OINT0AIN"ACK3TRAIN s#ONJUNCTIVITIS2ED%YE s&OOT0AIN s3ICK.OTES0HYSICALS$/4 s%RECTILE$ISFUNCTION

Mon-Fri 5:30-9pm & Sat 10am-1pm Cash, Credit, Checks (no insurance)

the Doctor is T. Bryan Miller, MD

www.MDisinWorcester.com

4-

508.796.5477 237 PARK AVE, WORCESTER

Adventure Boot Camp Congratulates itâ&#x20AC;&#x2122;s team for winning the City of Worcesterâ&#x20AC;&#x2122;s Biggest Loser Challenge - Overall Team Winner and Individual Winner Streets/Parks Winner- Team Catergory Winner- Individual Over 180 lbs Lost Coached by Adventure Boot Camp -Alexis Rougas- Ermilio-

www.AdventureBootCampLLC.com 508.579.6064 coachalexis@charter.net MARCH 3, 2011 â&#x20AC;˘ WORCESTERMAG.COM

47


/\\]c\QW\UO\]bVS`

4@33



a^SSRW\Q`SOaST]` 1VO`bS`Qcab][S`a EO\bb]aWU\c^-

433: 4@33 Yet again, weâ&#x20AC;&#x2122;ve made our Internet speeds even faster, so that our customers can see, play, learn, share, and do more online than ever before. Donâ&#x20AC;&#x2122;t have Charter Internet? What are you waiting for? Sign up today!

1VO`bS`7\bS`\Sb3f^`Saa A^SSRac^b] ;P^a



'

'' ^S`[]\bV T]`![]\bVa

&%%'#&% QVO`bS`Q][T`SSTOab

Oa^O`b]T]c` GSO`>`WQS5cO`O\bSS

Š2011 Charter Communications. Fastest speeds per comScore, Inc., Throughput Report, Q3 â&#x20AC;&#x201C; 2010. Free speed increase for Charter Internet Express (going from 8 Mbps to 12 Mbps) and Plus (going from 16 Mbps to 18 Mbps) customers only. Modem replacement may be needed to experience the full beneďŹ t of the increased speed. Offer expires 4/30/11. *Early termination fees apply. Package rates apply in months 4-24. Standard rates apply after the promotional period ends. Installation, taxes, fees, surcharges, and equipment extra. Services not available in all areas. Restrictions apply.

48

WORCESTERMAG.COM

â&#x20AC;˘

MARCH 3, 2011

Worcester Mag March 3, 2011  

Worcester Mag March 3, 2011

Read more
Read more
Similar to
Popular now
Just for you