Page 1

THURSDAY, AUGUST 8, 2013

VOL. 91 | NO. 32 | $4.25

Growers beware Giant ragweed found in Manitoba | P. 5

Price dive ahead? SERVING WESTERN CANADIAN FARM FAMILIES SINCE 1923

|

WWW.PRODUCER.COM

An expected fall in U.S. corn prices could impact Canada | P. 7

YOU CAN’T PICK YOUR RELATIVES BUT YOU CAN PICK BERRIES WITH YOUR RELATIVES

Corey Kasa of Kasa Berry Farm drives the mechanical saskatoon harvester while his wife, Lyndel, parents, Maxine and Randy, and son, Marshall, sort through the berries as they are coming onto the conveyor belt. About 90 percent of the berries on the farm are machine harvested. The original trees were planted in 2000. | MARY MACARTHUR PHOTOS

WEATHER | FROST

u|xhHEEJBy00001pzYv$:#

Cold July revives frost fears Are crops at risk? | Long-season crops need some warmer weather before summer ends BY ED WHITE WINNIPEG BUREAU

It feels like there’s been no summer this year, yet the crops look great in most areas. However, farmers can’t get beyond the fear that frost is lurking underneath the unseasonable coolness, ready to snatch away this year’s bounty. “We need either a real warm finish to the season or a long fall without frost,” said Myron Krahn, president of the Manitoba Corn Growers Association (MCGA). “We need a lot of time in September without a frost.” Farmers with corn, soybeans, sunflowers and other long-season crops are anxiously counting their heat units and checking out their crops to see what the long stretch of cool weather in July and into August has meant to their crops’ development.

“Frost isn’t too much of a risk for our canola, but I’m more worried about our soybean fields,” said Brian Chorney of Selkirk, Man. The summer has been weird but OK for most traditional prairie crops such as wheat, barley, oats, canola and many special crops. Most farmers and agronomists report that crops are looking good, but it doesn’t remove the anxiety that many are feeling with the unseasonable chill in the midsummer air. “It was such a cool spring, then the temperature really cranked up at the start of July for a few days, which made everyone optimistic again, then so quickly summer seemed to end,” said Krahn. For canola, the cool conditions have been almost perfect for promoting an extended and bountiful flowering season. Farmers in many areas report high pod counts and little of the heat blasting of flowers that

reduced 2012’s yields. Most small grains are also helped by coolness in midsummer, especially when they are in the reproductive stages. “The growing conditions for most crops have been pretty good,” said Bruce Burnett of CWB. “But we’d certainly like to see a hot, dry finish.” Farmers and crop experts echo that sentiment. The cool weather has delayed crop development but also given them a better chance at big yields than would not have been possible without the coolness. It will even be good for long-season crops such as corn as long as fall frost can be avoided. “The cool weather is really good right now because we’re in pollination,” said MCGA agronomist Morgan Cott as she checked out a farmer’s field. “We don’t want it too hot right now.

This weather is actually very good.” What farmers will need is an August at least as warm as usual and a September that doesn’t contain early frost. Weather experts think they have a good shot at getting that kind of good luck. Drew Lerner of World Weather Inc. and David Phillips of Environment Canada think farmers will likely see cool temperatures for the first 10 days to two weeks of August, but then a normally warm spell for the last two weeks of August. And neither expects an early frost this year for the Prairies. “I don’t believe we’ll have any freezes in August and that we could run a little bit late in parts of Saskatchewan and Manitoba with our first frost and freeze this year,” said Lerner. SEE FROST FEARS, PAGE 2

»

The Western Producer is published in Saskatoon by Western Producer Publications, which is owned by GVIC Communications Corp. Publisher: Shaun Jessome Publications Mail Agreement No. 40069240

AUGUST 8, 2013 Return undeliverable Canadian addresses to: Box 2500, Saskatoon, SK. S7K 2C4


2

NEWS

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

INSIDE THIS WEEK

WEATHER | FROM PAGE ONE

Cold July revives frost fears

REGULAR FEATURES He expects Alberta and western Saskatchewan to have normal first frost dates. Neither expert thought prairie crops should be particularly far behind normal development in most areas because the weather has actually been, in terms of seasonal averages, quite normal, no matter how unusually cold it may seem. “Statistically, it will not be a remarkable year,” said Phillips about prairie weather since the spring. “It will not be memorable in terms of how cold it is. It’ll just be a wash.” The spring was late and cold, but June and the first week of July were hotter than average. Since then it has been cooler than average, but not by much, Phillips said. The daytime temperatures have been 1 1/2 to two degrees below average, but the nighttime temperatures are actually slightly above average. Both are within the normal range. Phillips said July has probably seemed particularly cool because it has been cloudier than normal. However, those cloudy skies also trap heat inside during the night, so growing degree days have not been significantly affected. Lerner said July contained remarkably cold events in numerous places

and almost no hot days, so the month seemed cold. However, it hasn’t been what a professional weather watcher would call cold. “I really don’t think it’s been that far off normal,” he said. Broker Mike Krueger of Fargo’s The Money Farm said crops in North Dakota generally look great, with small grains particularly enjoying the cool summer. However, farmers are becoming increasingly anxious about frost, with corn and soybeans now making up a large percentage of eastern North Dakota cropland. “We’re going to have to have a frostfree September,” said Krueger. “If we have a frost in early to midSeptember, we’re going to have issues with both corn and beans.” Burnett said the cool spell that settled over the Prairies from early July to early August was well-timed if the Prairies had to experience a dose of cool weather. “If this had come in late August, we could have had a lot of frost,” said Burnett. “If we get back to normal weather in the second half of August, I don’t think there’s going to be any big problem with where we’re at right now.”

Ag Stock Prices Classifieds Events, Mailbox Livestock Report Market Charts Opinion Open Forum On The Farm Weather

COLUMNS Sweep nets: Accurate sweep tests require good technique when checking for lygus bug levels. See page 78. | BARB GLEN PHOTO

NEWS

» KOCHIA TROUBLE: Tight »

Farmer fined for patent infringement

soybean rotations may be to blame for glyphosate resistant kochia in Manitoba. 5 PRIVATIZING CWB: Ottawa expects to receive a privatization plan from CWB by next year at the latest. 13

» MILLION SOYBEANS: » »

CANOLA | COURT ACTION

Manitoba producers planted more than one million acres of soybeans this year. 14 PRODUCER CARS: Volumes drop for a grain firm specializing in producer cars. 15 BENDING HINTED: A negotiator hints Canada may make supply management concessions at Pacific Rim talks. 16

LETHBRIDGE BUREAU

A farmer from Strathmore, Alta., f a c e s a f i n e o f a p p ro x i m a t e l y $544,000 in a default judgment for patent infringement of Roundup Ready canola. In a July 24 hearing in Federal Court in Toronto, the court ruled that Doug Van Verdegem and Bar V Farms Ltd. violated the terms of a contract with Monsanto for use of its Roundup Ready canola technology. Default judgments are issued when one party in the case fails to take action in the required manner and time. Van Verdegem said Aug. 1 that he has since retained Saskatoon lawyer Terry Zakreski, the same counsel who represented Saskatchewan farmer Percy Schmeiser against Monsanto in a late 1990s landmark case also involving the company’s Roundup Ready technology. Van Verdegem denies that he planted Roundup Ready canola in 2012, the year pertaining to the case. He said the test results from his 2012 canola were from volunteer plants taken from the road allowance and field edges. “The world is polluted, totally polluted with their crap,” he said of Monsanto’s genetically modified canola. “They should never have been able to patent living cells or organisms.” Van Verdegem said he grew Roundup Ready canola in 2008 and 2011, for which he signed the mandatory technology use agreements, but did not

plant it in 2012, a year in which he grew Liberty Link. Trish Jordan, public and industry affairs director for Monsanto, said Aug. 1 that Van Verdegem agreed to participate in the company’s field check program when he signed the agreement. Checks in 2012 revealed presence of the patented canola on 2,570 acres. “He had signed a TSA (technology stewardship agreement) in 2008 and he purchased Roundup Ready canola in 2011. He did not purchase Roundup Ready canola in 2012 and the original finding actually arose from our field check program in 2012.” Jordan said the company tried to resolve the matter before taking it to court, without success. “Generally we don’t prefer to go this route but we really had no other option to us because he wouldn’t engage in the process. He basically was quite evasive and non co-operative in the legal process,” she said. “He was presented with … all the materials. He clearly knew that we were moving ahead with this. Maybe he didn’t understand, but that was his prerogative, to either retain counsel or engage in discussions with us.” Jordan rejected Van Verdegem’s claim that the tests were from volunteer plants. “That’s just simply not correct.” She said field checks initially showed 1,570 acres of RR canola were being grown without a licence. CONTINUED ON NEXT PAGE

»

» LOCAL FOOTPRINT: A new »

report says local food consumption doesn’t necessarily save the environment. 17 WATCHING FOR RISK: Farm Credit Canada has a new chief risk officer. 18

» ROTATIONS: Researchers »

worry that cereal growers are pushing rotations and inviting disease problems. 19 SAFETY NET WARNING: Farm leaders warn that weaker farm programs may be felt now that prices are falling. 73

» CARINATA RECEPTION: A

new oilseed is proving itself in field trials, but buyers remain scarce. 74

Barry Wilson Editorial Notebook Hursh on Ag Market Watch The Bottom Line Speaking of Life TEAM Living Tips

10 11 11 9 85 23 30

CONTACTS Subscriptions Ph: 800-667-6929 Advertising Ph: 800-667-7770 Newsroom inquiries: 306-665-3544 Newsroom fax: 306-934-2401 Shaun Jessome, Publisher Ph: 306-665-9625 shaun.jessome@producer.com Joanne Paulson, Editor Ph: 306-665-3537 newsroom@producer.com Michael Raine, Managing Editor Ph: 306-665-3592 michael.raine@producer.com

MARKETS 6

» MALTING BARLEY: Farmers may regret turning down malting barley sales.

Monsanto filed suit | Company said Roundup Ready canola was improperly grown in field BY BARB GLEN

84 31 20 9 86 10 12 24 87

6

» LESS TRADING: A small grain trader is dis-

appointed with the lack of competition in the new open market. 8

FARM LIVING 21

» BIG HORSES: Heavy horses are king and »

queen on this Saskatchewan farm. 22 GARDEN BOND: To know someone, you need to work in her garden. To tend a friend’s garden is to form a bond. 23

» HEAVY VERTICAL TILL: This vertical tillage

machine is designed for the rigours of the heavy clay zone. 77 ROLLERS GET BIGGER: Larger rollers use four-way knuckles to get the job done. 79

LIVESTOCK 80

» IN PRAISE OF GRAZING: An international »

grazing expert says pastureland will die if livestock are removed. 80 COLT STARTER: A new contest gives horse trainers 60 days to take a horse from untried to under saddle. 83

AGFINANCE 84

» BUYERS AND SELLERS: Fourteen grain bro»

Paul Yanko, Website Ph: 306-665-3591 paul.yanko@producer.com Barbara Duckworth, Calgary Ph: 403-291-2990 barbara.duckworth@producer.com Mary MacArthur, Camrose Ph: 780-672-8589 mary.macarthur@producer.com Barb Glen, Lethbridge Ph: 403-942-2214 barb.glen@producer.com

PRODUCTION 76

»

Terry Fries, News Editor Ph: 306-665-3538 newsroom@producer.com

kers have received new licences in Canada in the last year. 84 MAPLE LEAF: Weak returns on raising pigs are blamed for Maple Leaf’s woes. 85

Karen Briere, Regina Ph: 306-359-0841 karen.briere@producer.com Ed White, Winnipeg Ph: 204-943-6294 ed.white@producer.com Ron Lyseng, Winnipeg Ph: 204-654-1889 ron.lyseng@producer.com Robert Arnason, Brandon Ph: 204-726-9463 robert.arnason@producer.com Barry Wilson, Ottawa Ph: 613-232-1447 barry.wilson@producer.com Canada Post Agreement Number 40069240 SEE INSIDE BACK COVER FOR ADVERTISING AND SUBSCRIPTION RATES AND OTHER INFORMATION


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

3

» CONTINUED FROM PREVIOUS PAGE Another 1,000 acres were discovered later, when the farmer was seen harvesting canola on another property. Samples were then taken from adjacent land on public rights of way, Jordan said in a later email. The judgment was made in Toronto because Monsanto wanted a ruling before harvest to avoid potential patent violation on the 2013 crop. Jordan said Toronto was the only place the company could get a meeting with a judge before harvest began. Fi n e s a ga i n s t Va n Ve rd e g e m include $339,240 in damages, more than $5,000 in pre-judgment interest, $50,000 in punitive damages and $150,000 in legal costs. As well, Van Verdegem is subject to an injunction against selling canola protected under Monsanto’s patent and planting its Roundup Ready canola in the future. Van Verdegem said he expects the judgment to be reversed, adding he felt intimidated by Monsanto and those it hired in the case. “They have totally destroyed our lives so far, with constant badgering and stuff,” he said. Jordan said Monsanto tries to treat farmers with respect and transparency, while also protecting its rights. “Farmers tell us that they expect us to keep the playing field level and that’s what we were doing in this case.”

IT’S A CLOSE RACE |

Three pony chuckwagon teams run in a heated battle to win the race during the annual fair in Vermilion, Alta., July 27. | ROBYN WHEAT PHOTO

CALGARY STAMPEDE | DRUG TESTING

Stampede disqualifies champion steer Tests positive for Banamine | Reserve champion now wins top prize and $10,000 BY MARY MACARTHUR CAMROSE BUREAU

The Calgary Stampede has disqualified the winning animal in its steer competition after it tested positive for the painkiller Banamine. Testing positive for drugs is in “contravention of the competition’s rules,” said a Calgary Stampede news release. “We are committed to animal care and welfare and we will continue to enhance rules, regulations and policies related to animal health and safety,” said Max Fritz, director of agriculture with the Stampede. Royden Anderson, co-owner of the Maine Anjou cross, admits the steer was given the painkiller Banamine before the show, but only after it was approved by a veterinarian at the Calgary Stampede. “They all heard the vet say it was good and now the Stampede is saying it’s all hearsay and there was nothing in writing,” said Anderson of Didsbury, Alta. “It’s a kid’s show. If they’re going to ask a vet if they can use a drug, no kid is going to get it in writing.” Tim Chalack, father of the steer’s co-owner, Riley, said he is frustrated that the Calgary Stampede veterinarian approved the drug and they are now being disqualified for its use. “The vets said it’s OK to use Banamine, and now they’re reneging on that,” said Chalack of Carstairs, Alta. “We didn’t do anything the vets didn’t tell us to do.” Banamine, a non-steroidal antiinflammatory from Merck, is a common painkiller. It is registered for use in cattle but has a six-day withdrawal period before slaughter.

I do know this is the first year they blood tested and I do know why, too. I know this is a vendetta thing. Somebody lost and is a poor loser. ROYDEN ANDERSON STEER CO-OWNER

The grand champion steer at this year’s Calgary Stampede is now at the centre of a controversy regarding drug tests. | SHOWCHAMPIONS LIVESTOCK PHOTOGRAPHY PHOTO

The animal has not been slaughtered and is at a veterinary clinic at Balzac, Alta. Blood tests were taken on the winning steer and the reserve champion owned by Nicona Brost, Fairland Cattle Co., Logan Chalack, Flewelling Cattle Co. and Deerview Meats. T h e He re f o rd s t e e r t hat w o n reserve will now be named grand champion and awarded the $10,000 prize. No third place winner was chosen in the ring and therefore no reserve champion will be named. In an email response, Calgary Stampede communications adviser Bonni Clark said the Stampede is “not in a position to publicly disclose

details surrounding someone else’s animal, and will not respond to speculation regarding the type of substance in question. The Stampede based our decision to disqualify this steer upon factual information and we stand by our decision.” According to the Stampede list of exhibitor rules: “Any products/solutions/liquids administered internally to alter the conformation or weight of the animal is prohibited.” Anderson said he believes they are being used as scapegoats in the steer competition and believes a disgruntled competitor insisted a blood sample be taken. “I know there are other people who

have done worse stuff than we did and they’re not making examples of them.” The Stampede does not routinely take drug samples of the winning animals, but reserves the right to do so. “I do know this is the first year they blood tested and I do know why, too. I know this is a vendetta thing. Somebody lost and is a poor loser,” he said. “It’s a competitive sport. People do things. I have been in the steer business for a while. People do give them things. They get old after awhile and get limping and stuff like that, but everything is given in accordance with the rules and regulations of medicine and slaughter.” Rick Jackson of Kansas City, Kansas, who sold the calf to Anderson, said the calf, bought for his son, Ryan, has had a rough life. At its first show in Ohio, the calf stepped on a show fluffing comb and seven teeth broke off in its foot. After removing the teeth, Ryan spent months icing the foot and caring for the animal between cattle shows. With only a water hose, a fan, a three-sided shed and a “great big heart,” Ryan nursed the animal back

to health, said Jackson. The family’s move from Vermont to Kansas meant the calf was no longer eligible for steer shows in either area and it was sent to Trausch Farms in Iowa for resale. It’s there Anderson bought the steer for Riley Chalack, with himself as co-owner. Jackson said his son’s log book estimated the steer travelled 11,000 kilometres to shows, including its trip to Calgary. The steer became lame at the Stampede, the same foot with the original injuries. Anderson and Chalack can appeal the Stampede’s decision. Clark also said the Stampede will be reviewing the entire situation. “The Stampede will continue to evaluate and will subsequently communicate any further actions associated with this situation. At this time we are not in a position to speculate on what may or may not come from the review,” she wrote. Calls to Dr. Don Miller, chair of the Calgary Stampede steer committee and a competitor in the class, were not returned. After the show, the steer was sent to Miller’s farm for two weeks before being moved to Balzac. Anderson said the animal should not have been sent to a competitor’s farm after the show. “No way it should have gone to Miller when he was competing against the steer,” said Anderson. Rob Lundego, vice-chair of the steer committee, said he has no opinion or comment on the test. As a steer committee member, he said he has no say on what happens now. “That would be the Calgary brass that has the power, not us as the committee.”


4

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

PARADE WITH A PURPOSE

ALTA. FLOODING | HIGH RIVER

High River museum tallies up flood losses BY BARBARA DUCKWORTH CALGARY BUREAU

Doug Rogers of Bentley, Alta., leads his steer, Wild West Willy, in the Big Valley Jamboree parade in Camrose. Camrose County reeve Don Gregorwich won the honour of riding the steer during a fundraising event for the Family Action Violence Society. | MARY MACARTHUR PHOTO

SOYBEANS | SOIL FERTILITY

Nutrients vital when growing soybeans Invest in fertilizer | Soybeans suck up phosphorus and potash, which need to be replenished BY ROBERT ARNASON BRANDON BUREAU

MELITA, Man. — A soil fertility specialist with Manitoba Agriculture says farmers shouldn’t count on soybeans providing nitrogen for next year’s crop. “Soybeans are pigs,” John Heard told the Westman Agricultural Diversification Organization field day July 30. “They make nitrogen but they cart 95 percent of it off to the elevator. So don’t think you’re going to cut your nitrogen in the following crop.” With the rapid expansion of soybean acres in Manitoba, a myth has developed that soybeans are selfsufficient when it comes to crop nutrients. Heard said the crop does produce its own nitrogen but some soybean growers aren’t doing enough to maintain soil fertility. “Growers are quite intrigued by this crop that survives on less than nothing,” Heard said. “(But) you can’t grow this crop with just inoculant.” For example, soybean plants remove .9 to one pound of phosphorus per bushel, which is similar to the removal rate for canola. Unlike canola, soybeans don’t respond to added phosphorus. Instead, the legume prefers to pull residual phosphorus out of the soil. H o w e v e r, p r o d u c e r s m i g h t assume it’s unnecessary to add the nutrient because soybeans don’t immediately react to a phosphorus application.

If you supplied (the crop) with fertilizer, that’s called being a sustainable farmer…. Otherwise you are Fort McMurray, you are just depleting the soil reserves. JOHN HEARD MANITOBA AGRICULTURE SOIL SPECIALIST

“Soybeans are good at sneaking nutrients out of the soil,” Heard said. “They are supported by a mycorrhizal network that scavenges phosphorus out of the soil.” Nonetheless, research by Gyles Randall at the University of Minnesota shows that soybean yields suffer if soil phosphorus levels are low. Based on field experiments from the late 1990s, Randall found that soybean fields with high residual phosphorus yielded 54 bu. per acre on average. Sites with low-test phosphorus averaged 42 bu. per acre. “ There is a consequence (to yields), but it’s not readily apparent because this crop can tap into the reserves,” Heard said. “(But) if you are going to continue farming in low (phosphorus) testing soils, be content with sub-optimal yields.” Soybean yields also depend on potassium levels. The crop will remove 1.4 lb. of potassium per bu., which means a

50 bu. per acre crop would pull out 70 lb. of potash per acre. “There is no other crop that you grow … that has as much potash in the seeds as soybeans do,” Heard said. Clay and clay-loam soils in Manitoba do have abundant stores of potassium, but sandier soils do not. Bending down to inspect a soybean plant at the WADO plot site, Heard pointed to a lower leaf with yellowing around its edge, which is an indicator of potash deficiency. “During seed fill, the seed removes between 1.2 and 1.4 lb. of potash per bushel,” he said. “It moves potash from the leaves to the pods. Malnourished plants, the leaves will start showing potash deficiency in later August. That’s a wake-up call to the grower that he needs to do some soil tests.” Dennis Lange, a Manitoba Agriculture crop production adviser in Altona, said a number of Manitoba producers are following a soybeansoybean rotation because prices are

strong and the crop is easy to grow. Heard said the beans will have a drastic effect on soil fertility if growers aren’t adding sufficient quantities of phosphorus or potash to the soil. “If you grow soybeans back to back, that’s a rented land or retirement policy,” he said. “If you supplied (the crop) with fertilizer, that’s called being a sustainable farmer…. Otherwise you are Fort McMurray, you are just depleting the soil reserves.” Ten to 15 parts per million of phosphorus is a reasonable target for soybeans if a grower decides to replenish depleted soil and restore yield potential. Heard said boosting residual phosphorus is a matter of mathematics. “What you remove, at some point to be sustainable, you’ll have to replenish.” Therefore, if a producer is growing wheat after a 40 bu. per acre soybean crop, he should add 35 lb. per acre of phosphorus to cover the amount that the beans pulled out and an additional 25 lb. per acre for the wheat. Heard said this is the wrong time to scrimp on soil fertility. With new crop soybeans at around $12 per bu., growers can afford to spend on potash and phosphorus. “You can buy more phosphorus with a bushel of soybeans now than when the price (of soybeans) comes down,” he said. “It is years like this when we should be investing in (fertility).”

Among the bruised and battered in the flooded town of High River, Alta., is the community’s museum with an extensive collection of western history and artifacts. “We lost about 80 percent of our collection,” said curator Irene Kerr. The Museum of the Highwood is in a 100-year-old building located in the downtown area. It had an extensive collection of more than 30,000 photographs, historical research materials and archives. These sustained minimal damage, but other artifacts are in ruins. “Our photos are probably the least of our worries, but we lost most of our negatives,” she said. For example, negatives from the High River Times were lost, but the newspaper also had microfilm of its material so some history was preserved. Museum staff had about 20 minutes to vacate the site when the flood waters swept through the town June 20. There was no time to save anything, said Kerr. They were preparing a new exhibit that included wedding dresses. Much of the textile collection in storage has been lost. “A lot of them got mould and a lot of them just disintegrated in the muck,” she said. Like many museums, large parts of collections are kept in storage. Items in the basement were lost when that area was filled with three metres of water. Residents and business owners were not allowed to return for a couple weeks so the collections sat for 10 days in dirty water and grew mould.

We had 17 saddles that got a lot of mould on them. We washed them off and they are now in a freezer truck. IRENE KERR MUSEUM CURATOR

Staff returned to find ruined books, shelves fallen over and an antique piano tipped upside down. It would have cost $20,000 to restore the piano, which is more than the museum can afford. Other antique wooden furniture was also ruined. Staff salvaged as much as possible, then cleaned and disinfected items and put them in a refrigerator truck. “We had 17 saddles that got a lot of mould on them. We washed them off and they are now in a freezer truck,” Kerr said. The building is drying out slowly to prevent warping and other damage. The museum is also considering new storage facilities to protect the surviving collection for the next time such a disaster strikes.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

5

WEEDS | GIANT RAGWEED

Debut of giant ragweed on Prairies possible Growers beware | The weed has been found in southeastern North Dakota and could move north BY ROBERT ARNASON

GIANT RAGWEED FACTS

BRANDON BUREAU

• Giant ragweed, also known as horseweed, is native to North America. • It is the most common cause of hay fever in eastern North America. A single plant can produce up to one billion grains of pollen. According to a U.S. study, ragweed pollen in some parts of the northern United States and Canada lingers almost a month longer than it did in 1995. These increases are linked to warming shifts caused by climate change. • It typically grows to a height of 1.5 metres, but it can grow more than five metres tall. • Just one ragweed plant per sq. metre has been shown to reduce crop yields 45 to 77 percent. • Giant ragweed is one of the dominant weed species in the U.S. Midwest and is the most important weed in the eastern corn belt. • Glyphosate resistant giant ragweed has been found in Ontario, Ohio, Indiana, Arkansas, Kansas, Minnesota, Tennessee, Iowa, Mississippi, Nebraska, Wisconsin and Missouri. Source: staff research

Scott Chalmers shows a rarely seen giant ragweed plant to people attending the Westman Agricultural Diversification Organization field day held near Melita, Man., July 30. | ROBERT ARNASON PHOTO

MELITA, Man. — Bending over carefully so he wouldn’t drop the microphone, Scott Chalmers reached down to pick up a metre long plant lying on the ground. Chalmers, a diversification specialist with Manitoba Agriculture, held the plant high above his head to show it to the 60 people attending the Westman Agricultural Diversification Organization field day held near Melita July 30. The leafy plant was something that western Canadian farmers rarely see: giant ragweed. “It probably came up from the U.S. through the Souris River somehow,” Chalmers said during an interview following the field tour. “Last year we found three plants and this year we found about a dozen plants.” Chalmers found the giant ragweed on a field south of Melita in the Souris River Valley. Severe flooding in 2011 likely carried seeds or plants into the flat-bottomed valley, but Chalmers doesn’t know exactly how the weed made its way to southwestern Manitoba. “It’s bizarre that it’s this far to the northwest of where it usually is. It’s almost one state out of its place.” Giant ragweed, also known as horseweed, is commonly found in the U.S. Midwest and the American south, but its northerly range is typically southeastern North Dakota. Hugh Beckie, an Agriculture Canada weed scientist from Saskatoon, said he’s never heard of giant ragweed on the Canadian Prairies. “Looking at the general weed surveys that my colleague Julia Leeson has done, I don’t believe that they detected that species.” Chalmers has found giant ragweed on only one field near Melita, but he suspects it’s also on fields further south in the Souris River Valley. “I’ll bet if you go up the river, upstream, you will find it for sure.”

HUGH BECKIE AGRICULTURE CANADA

Chalmers said high water levels flooded many fields in the valley this year. Weeds took over those fields, which may have allowed giant ragweed to get established. The weed’s arrival remains a curiosity because only a few weeds have been found, but Chalmers said prairie growers should be concerned. “Potentially, this could be a climate change signal or marker,” he said. “Some of these things that are problems further south might be coming further north and potentially affecting us.” Beckie agreed, noting that giant ragweed, which loves heat, could flourish in Western Canada. “With our warmer winters, we might see weeds that aren’t typically well adapted to the Prairies encroach into the Prairies,” he said. “We’ve documented this with other species (including kochia).” He said the weed’s arrival is a threat to the prairies because glyphosate resistant giant ragweed has been found in a number of American states and in southwestern Ontario. Last year, Chalmers conducted an informal test on a giant ragweed plant he found near Melita. He sprayed glyphosate on the weed with a bottle, and it died two and a half weeks later. “I was fairly satisfied that is wasn’t (glyphosate resistant), but you never know.” Beckie said it would be wise to eradicate the giant ragweed plants near Melita. “That would be very cost effective,” he said. “If it gets established and does become adapted, it could pose a lot of challenges for us.”

WEEDS | RESISTANCE

Glyphosate resistant kochia suspected in Manitoba BY ROBERT ARNASON BRANDON BUREAU

Growers and provincial agriculture specialists suspect that glyphosate resistant kochia has arrived in Manitoba. After applying glyphosate this year, several soybean growers found that the herbicide did not kill kochia plants in their fields. They alerted provincial employees, including Dennis Lange, a Manitoba Agriculture crop production adviser in Altona. Lange, who spoke at a field tour in Melita, Man., July 30, said it hasn’t been scientifically proven that the weeds are glyphosate resistant, but it is highly likely that tests will confirm the suspicions. Nasir Shaikh, a Manitoba Agriculture weed specialist, said he spoke to Lange about one case of potential

glyphosate resistance. “A couple of other growers (also) called me and they also suspect they might have glyphosate resistant kochia,” Shaikh said. “I do have plans to collect the plant material from them over the fall and send it to the lab.” If the tests come back positive, all three prairie provinces would now have confirmed cases of glyphosate resistant kochia. Scientists detected resistant kochia in southern Alberta in 2011, and last year resistant populations were found around Swift Current, Sask. Agriculture Canada estimates that herbicide resistant kochia is present on 8,000 acres of cropland in Western Canada. However, Stratus Agri-Marketing surveyed Canadian farmers earlier this year about herbicide resistance and found that there might be

651,000 acres of glyphosate resistant kochia on the Prairies. Shaikh didn’t disclose the locations of the suspected cases, but he said it’s not surprising that glyphosate resistant kochia exists in the province. “It’s just a matter of time that we’ll (officially) document it in Manitoba.” Shaikh and Hugh Beckie, a herbicide resistance specialist with Agriculture Canada, will conduct a weed survey in late August and September to assess the presence of glyphosate resistant kochia in Manitoba and Saskatchewan. Beckie agreed the appearance of glyphosate resistant kochia in the province isn’t shocking because the weed is abundant in southwestern Manitoba. During his presentation at the Westman Agricultural Diversification Organization field day, Lange said glyphosate resistant kochia in

DENNIS LANGE MANITOBA AGRICULTURE

soybean fields might be connected to agronomic practices. More producers are now growing soybeans back to back because they are profitable and easy to grow. Lange said the practice may be tempting, but it isn’t sustainable over the long run. “That’s a question I get from a lot of new growers: ‘I had soybeans last year, can I plant soybeans again this year?’ ” said Lange, the province’s unofficial soybean specialist. “Yeah, you can plant it (again), but it does start you off on the wrong foot.”

Shaikh said crop rotations are an effective way to mitigate the spread of glyphosate resistant weeds, but certain rotations exacerbate the selection pressure and likelihood of genetic mutations. “If a grower is planting Roundup Ready corn, then going Roundup Ready soybeans and Roundup Ready canola, he is rotating the crops but the base herbicide is still the same.” Instead, growers need to develop a long-term, integrated weed management strategy. Shaikh said the strategy should include crop rotation, tank mixing of herbicides and using proven but older chemistries. “These (older) herbicides are very effective and can be applied even in the fall and incorporated into the soil,” Shaikh said. “And in the spring, (producers) can have a clean field to start with.”


6

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

www.secan.com

MARKETS

NEW

Moats

HARD RED WINTER WHEAT MA RKE T S E DI T O R: D ’ARC E M CMILLAN | Ph: 306-665-3519 F: 306-934-2401 | E-MAIL: DARC E.M C M ILLAN@ P R OD U CE R . COM | TWITTE R : @ D AR CE MCMILLAN

BARLEY | PRICES

Barley outlook will have you crying in your beer Price forecast | Last year’s prices won’t be paid for this year’s crop BY ED WHITE WINNIPEG BUREAU

Farmers don’t want to bite the bullet and contract new crop malting barley at prices lower than what was offered recently for old crop. That’s what marketers are saying about farmers’ lack of interest in pricing beer barley, but some think the reluctance is a mistake. “They’ve been getting $6.50 (per bushel) for old crop, and now they’re seeing (new crop) bids of $5.50, which I think are pretty darned good, actually, and they don’t want to sell, but I think they should sell at least some at that price,” said CWB barley marketer Bob Cuthbert. “In a couple of months, $5.50 might look really good.” Barley had benefited greatly from last summer’s drought-induced rally, rising high as corn soared. Feed corn drove the rally and feed barley followed. To guarantee supply, maltsters had to boost prices and keep a hefty premium of $1 to $1.50 through the winter. However, both the base feedgrain price and the malting premium are under threat because of the perception that farmers are likely to harvest big barley and corn crops this fall. A massive inversion has existed between old crop and new crop prices, with new crop much lower

Everybody wants last year’s prices, but they have to realize that what they’re being offered now is probably better than what they’ll get offered in a month or two. DOUG HILDERMAN NORAG RESOURCES

than old crop values. As that inversion disappears, farmers are largely unwilling to lock in new crop values. “Everybody wants last year’s prices, but they have to realize that what they’re being offered now (for new crop) is probably better than what they’ll get offered in a month or two,” said Doug Hilderman of NorAg Resources. “Farmers are still thinking about last year’s prices, and those just aren’t obtainable any more.” Crop conditions are good across Western Canada and the parts of the United States that grow barley, and the market is expecting a big crop to be harvested. There are no major quality concerns. The only threat to barley is the potential for an early frost. Wo r ld pr i ces f o r ba r ley hav e dropped in recent weeks. Rain in Australia has improved prospects for the crop, which is in its early stages, while expectations are for good, big

crops in Europe and the Black Sea region. Cuthbert said world malting barley prices, backed off to Manitoba, equal $4.70 to $5 per bu. This means the offshore market won’t play a role in moving the crop if farmers don’t want to sell now to the domestic market for $5.50. However, Cuthbert and Hilderman think farmers will eventually blink, needing to move the new crop and accepting whatever market reality appears as the crop goes into the bin. It’s possible that something will damage barley or the underlying corn crop’s value, but the opposite is more likely: a big crop is harvested and knocks feedgrain values lower. “We could see feed corn prices approach $4 a bu. and lower,” said Cuthbert. “Farmers are seeing old crop feed (barley) bids of $5-plus, so it’s kind of hard to accept a new crop Manitoba (malting barley) bid for the same.”


MARKETS

7

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

CORN PRICE DROP | MARKET IMPACT

Biofuel sector stagnation contributes to lower corn prices Ethanol demand plateaued | Finding markets for surplus corn is ‘a really really big deal for the corn producer’: exporter

CORN PRICES ARE EXPECTED TO REMAIN FOR THE REST OF THE DECADE AT BETWEEN

$4 to $5 per bushel U.S. CORN EXPORTS TO RISE Reviving U.S. corn production will likely mean it will increase exports. Exports had fallen off in recent years as domestic demand rose due to the growing ethanol industry. Exports crashed in the last crop year because of the drought-reduced crop.

BY BARRY WILSON OTTAWA BUREAU

The impending sharp drop in U.S. corn prices will have repercussions throughout North American grain markets and produce a more aggressive U.S. trade focus, says an export specialist. It will also present U.S. corn and soybean producers who have enjoyed years of record prices with a reality jolt, now that Washington is unlikely to find the cash to fill the income gap, ProExporter Network president Marty Ruikka of Michigan told an Ottawa meeting of the U.S. Grains Council board in Ottawa July 29. He projects that corn prices will drop from the 2012-13 level of $6.90 US per bushel to $5 or less and remain between $5 and $4 through the decade, a 30 to 40 percent drop. “As a result, I think we are returning to an export market focus,” he said. “The only choice we see is with further exports.” At the core of the projected price tumble, already evident in markets, are a bigger crop and a flattening of U.S. biofuel industry demand for feedstock, said Ruikka. Strong biofuel demand in recent years has taken a large chunk of the U.S. grain surplus generated by yield increases. Along with production declines because of drought, it has contributed to recent years of strong prices. “What’s happening now is that while the ethanol industry demand will not decline, it has plateaued and so there will be a big drop in that strong demand and growing surpluses,” he said. “We have to find a home for that surplus.” He predicted that the looming sharp price decline could decrease corn sector gross income by more than $13 billion over the next three years. “This is a really, really big deal

U.S. corn used in ethanol production vs. corn exported (million bu.): 6,000 5,000 4,000 3,000 2,000 1,000 0 2004

corn used in ethanol

exports

2006

2008

2010

2012

Source: USDA | WP GRAPHIC

While the ethanol demand will not decline, it has plateaued, and an analyst expects as yields rise in coming years, farmers will have to find export markets for surplus corn stocks. | FILE PHOTO for the corn producer.” Meanwhile, the U.S. Department of Agriculture’s practice of doling out bil-

lions of dollars in farm supports when markets decline is “a thing of the past,” said Ruikka. “There is no more discre-

tionary spending in Washington.” A sharply divided Congress has been unable to even agree on a new

farm bill to set rules for the industry over the next five years. In an interview, Ruikka said the return to prices more in line with historic averages will be a challenge for a sector that has become accustomed to high cash flow. “The first thing is it is going to be very difficult for them to continue to pay the high prices for land and to support high rent prices,” he said. That means sharply reduced asset values and “a tightening of belts within operations.” He said recent entrants to the sector will face the biggest shock. “I think for the young farmer, in the past five to seven years he’s been able to make mistakes and get away with it,” he said. “In the future he’ll have to operate mistake-free or pay the consequences.” At the Canadian Federation of Agriculture summer board meeting in Montreal July 31, several provincial farm leaders said Canadian prices will inevitably follow the U.S. commodity price decline, and the projected increased export competition will have a depressing effect on prices for Canadian grain sales abroad.

WHEAT | OUTLOOK

Production problems support wheat but rally hopes dashed by sinking corn Bullish outlook | Charts show a potential turning point, but corn will have to stabilize BY ED WHITE WINNIPEG BUREAU

Even after a long, long slide, it’s still hard to find reasons to turn bullish on wheat. A good-sized, good-quality crop is growing in North America and elsewhere, and the underlying price leader for grain shows few signs of wanting to reverse its downward course. “Corn continues to set the overall framework for grain prices,” said Frontier Futures analyst Austin Damiani. “We can look at spring wheat or wheat in general, and even if we’re bullish (about those crops in isolation), prices can still go down if corn continues to go down.”

Chicago December corn futures were trading for around $5.40 per bushel near the end of June but have since slid to about $4.65. At the same time, spring wheat futures have slid less, from $7.90 to $7.50. Though pressured down by corn, wheat has received some support from Chinese demand, reduced forecast for the Russian wheat crop and potential quality problems in the U.S. soft red wheat crop, which was rained on at harvest, and the European wheat crop which is enduring a heat wave hastening its maturity. Damiani said cash spring wheat prices are now about equal to hard red winter wheat cash prices, which is helping stoke demand and buy sales.

“We’re already at the point where we’re low enough where end users, particularly domestic ones, are being incentivized to switch to spring wheat at the expense of hard red winter wheat,” said Damiani. He said hard red spring wheat might be able to recover some of the ground it has lost to hard red winter wheat, over which it normally carries a premium, if North American millers and export markets start snapping up cheap spring wheat. However, corn still rules the roost. “It’s going to be a lot easier to rally if corn can stabilize,” he said. Mike Krueger of the advisory service The Money Farm agreed. “The biggest problem wheat has is

corn,” said Krueger. “You take corn from seven bucks to below five dollars and you have people talking about $4 to $4.50 as a possibility, and if you get a big U.S. corn crop in, that limits where wheat can go.… You can’t take wheat too far from corn.” Damiani said demand for wheat is good now, w ith China making aggressive purchases, but the sheer weight of the corn slump is stopping the wheat rally. Winnipeg technical analyst Harold Davis thinks wheat has a good shot at rallying now because its chart pattern is showing a possible “W” forming, something that has previously preceded a nearby price bottom. “Recent price declines might seem

dramatic and discouraging, but they’re about normal for wheat,” wrote Davis in a July 30 analysis. Wheat prices in Saskatchewan tend to make $1.25 per bushel retreats, which is about what has occurred in recent weeks. Chicago wheat futures also seem to be hitting a possible terminal stage of a retreat. “A good crop has already been priced into the market and is old news,” wrote Davis, the main author of Prairie Crop Charts. “Looking forward, wheat is likely to make a stand close to current levels. If it succeeds, the tide should turn up and a new bull emerge. If it fails, the optimism of recent years will be dealt a serious blow.”


8

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

MARKETS

OPEN MARKETING | FEES

Major grain companies like shift to open market Richardson and Viterra | Biggest concern is about the rising cost of the Canadian Grain Commission BY BRIAN CROSS SASKATOON NEWSROOM

Top executives with Canada’s largest grain handling companies say the industry has adjusted well to operating in a deregulated market. However, there are still important issues to watch, including regulatory costs related to the Canadian Grain Commission and the impact of federal rail legislation. “From our perspective, things went about as well as we could have expected or hoped,” said Jean-Marc Ruest, vice-president of corporate affairs with Richardson International. “I think there are probably two areas that we have to keep our eye on going forward,” he added. “The first is on the regulatory side of things.” He said operational changes at the grain commission have resulted in significantly higher handling costs for the industry. Beginning Aug. 1, the commission will derive more revenue through user fees and less from the federal treasury. It is estimated that the Canadian grain industry, including farmers, will pay an additional $17 million for CGC services in the 2013-14 crop year. User fee revenues are projected to rise to more than $54 million, up from $37 million. The new fees are expected to cover 91 percent of the commission’s annual budget once the changes are fully implemented, while government will contribute nine percent, or $5.5 million. In previous years, Ottawa’s contri-

Big grain companies say the switch to an open wheat market allowed them to make more efficient use of their facilities. | FILE PHOTO bution has been closer to 50 percent. Ruest said regulatory costs must be kept in check to ensure the Canadian grain industry remains competitive. “The cost of the CGC to the system is very high,” he said. “If we really want to be competitive as an industry on a worldwide basis and our costs on the regulatory side are out of line with what’s being charged in other jurisdictions, that’s a problem for us.” On rail costs and level of service agreements, Ruest said the impact of recent legislative changes remains to be seen. “I think the (grain) industry has made its thoughts known on whether they think those changes are sufficient or not,” he said.

“I think that’s an area that we will still have to be mindful of.” Kyle Jeworski, Viterra’s vice-president and chief executive officer for North America, agreed that the transition to an open market has been smooth. Viterra is owned by Glencore Xtrata. “I would say things have gone as expected,” Jeworksi said. The changes have resulted in more efficient use of Viterra’s grain handling assets and improved price signals to farmers. “We’ve had positive feedback from farmer customers and end-use customers,” Jeworski said, adding that Viterra will continue to invest in its network to ensure modern, efficient facilities across the West.

Jeworski said deregulation allowed the Canadian industry to respond quickly to strong U.S. market demand in the post harvest period. “Right after deregulation, we did see a significant amount of red winter and red spring wheat moving into the U.S. early on to fill some of the deficit (there),” he said. “With deregulation, that really allowed the whole industry to be responsive to a specific need.” Viterra is selling wheat to overseas customers that were not traditional buyers of Canadian wheat under the single desk system, he added. It suggests that the deregulated industry is expanding markets for Canadian grain. Jeworski refuted suggestions that

promotion and market development efforts have suffered in the new environment. “CWB has been promoting Canadian grain for a long period of time, but now you’ve got a number of internationally recognized institutions, such as CIGI (Canadian International Grains Institute) that are doing a lot of good work … and you’ve got a lot of companies (as well),” he said “I don’t think anything has been lost. In fact, I think the industry is doing a good job of working with end-use customers in identifying their needs.” Market acceptance of minor classes of Canadian wheat, such as Canada Prairie Spring, is increasing, he added.

OPEN MARKETING | CASH MARKET

Small grain trader says open market has less competition than expected NorAg Resources | Big elevator companies dominate trade leaving little room for middlemen BY ED WHITE WINNIPEG BUREAU

As the era of the open market dawned, Doug Hilderman saw a golden sunrise for a bright new cash market for prairie grains. He thought board grains, freed of their control by CWB, would become aggressively bought and sold by a plethora of small, medium and large marketers and grain companies. This new trade would embrace any new opportunities and make the business more quick and active. Instead, Hilderman said less grain is being traded than when the CWB monopoly was intact. And rather than providing an opportunity for more grain marketers to enter, the basis of existing players is being challenged. “It’s a very poorly defined cash mar-

ket. There is almost no cash market,” said Hilderman, who sources and sells crops for marketer NorAg Resources. “It’s not unfolding the way a lot of people thought, not the way a lot of farmers expected. It’s not the way a lot of the industry thought.” Hilderman said the prairie grain industry is so dominated by three large grain elevator companies and a handful of smaller operators that little room appears to be left for marketers who buy from one company and sell to another. “It’s like there are three wheat boards out there now,” said a disappointed Hilderman. “There’s no incentive for a marketer to organize farmers’ grain and sell to a grain company, or buy from a small grain marketer and sell to a big grain company.”

He said the big grain companies appear to want to keep all grain procurement, movement and sales inhouse, so it’s often not possible to find bids or offers for anything. Grain marketers without handling facilities or with only a few facilities have often played an important role in the prairie grain business, either as exporters who find overseas buyers and then arrange delivery or as crop procurers who find on-farm supplies of crops and then find grain companies looking for those supplies. Accredited exporters often filled a significant share of the sales that the CWB oversaw during the wheat board monopoly era. With the board monopoly gone, Hilderman hoped last winter to see e v e n m o re b u y i n g a n d s e l l i n g between grain marketers and grain companies as everyone embraced

the opportunities of the free market and tried to match supplies and demand more aggressively. It is what he has seen in the United States, where companies buy and sell crops to each other to match the opportunities that each finds. However, he said some of the players on the Prairies, such as Richardson International, Cargill and Viterra, seem so dominant and vertically integrated that they appear to not need to trade with anyone. “They buy grain from the farmer, put it through their elevator, send it through their terminal to an export end user,” said Hilderman. “They don’t buy from other companies and they don’t sell from other companies.” Hilderman said it is sometimes possible to get bids or offers from the big companies, but they are at levels that

make profitable sales impossible. “There’s no way to make it work,” said Hilderman, whose company operates in western and eastern Canada. “The big line companies are putting the squeeze on the exporter that doesn’t have any procurement … and they’re squeezing out the guy at the bottom.” Hilderman said buying and trading crops between companies generally creates value. Companies don’t need to compete as aggressively with price to attract supply when only a handful of them are bidding for farmers’ grain. “A farmer doesn’t have a lot of choice,” Hilderman said. “There’s not a lot of market definition out there. There certainly isn’t a lot of competition out there for a farmer’s grain.”


MARKETS CANFAX REPORT

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

9

POTASH | MARKETING

FED CATTLE STEADY Fed cattle prices have been stuck in a $4 trading range for the past 12 weeks. The supply side of the market has had a greater influence on the price than the futures aspect. Fed supplies remain unseasonably tight, which has been reflected in the strong cash-to-U.S. cash and cashto-futures basis. Producers continue to negotiate lift times because front-end supplies are current. The Canfax average steer price was $120.17 per hundredweight, up 31 cents, and heifers were $117.93, down $1.13. Steers remain $10 higher than the same week last year and slightly more than $25 higher than the fiveyear average. Most of the trade was on a dressed basis at $201-$202 per cwt. delivered. Packers have been looking for cattle for near-term delivery, and there has been rumbling of packers accepting and calling upon August contract cattle early. Weekly sales rose 55 percent to 16,351. The Alberta fed cash-tofutures basis strengthened to close the week at $4.74. Weekly fed exports to July 20 fell nine percent to 3,234 head. Retailers should be looking to cover beef needs for the Labour Day holiday, which would support beef and cattle prices. Supply is expected to grow seasonally, but the weaker Canadian dollar should help keep prices steady.

Weekly western Canadian non-fed slaughter fell 21 percent July 27 to 5,730. Non-fed exports to July 20 fell 24 percent to 4,631.

FEEDERS STRONGER Strong demand pushed feeder prices higher. Auction volumes have bottomed and more animals will hit the auction ring as yearlings come off grass. A modest offering of 400-600 pound feeders traded mixed with prices $1 lower to $1.75 per cwt. higher. Feeders heavier than 600 lb. rose $1-$3. All feeders heavier than 700 lb. are trading significantly higher than the same week last year. Canfax weighted average steer prices for the week were 89 cents per cwt. higher and heifers were $1.42 higher. Weekly auction volume rose 43 percent to 11,136 head. Attractive prices are drawing summer yearlings to market early. Improved feeding margins have rallied feedlot interest in cattle, which will be ready for the 2014 first quarter fed market.

BEEF LOWER

COWS RISE

U.S. beef prices fell again last week. Choice closed at $186.66 and was 12 percent or $24.70 below the May peak. Select was $181.53, down six percent or $11.80 from May. Beef prices might have fallen to the lowest level of the season and normally trend higher into August. Weekly Canadian AAA cut-out values to July 26 fell $1.97 to $196.86 and AA fell $2.67 to $186.78.

Hamburger demand firmed slaughter cow prices with D1,2 cows rising 65 cents per cwt. and D3s rising 26 cents. Rail cow prices rose $1 to around $151-$156 per cwt. delivered. Butcher bull prices fell 64 cents to average $88.57.

This cattle market information is selected from the weekly report from Canfax, a division of the Canadian Cattlemen’s Association. More market information, analysis and statistics are available by becoming a Canfax subscriber by calling 403275-5110 or at www.canfax.ca.

WP LIVESTOCK REPORT HOGS SLIGHTLY LOWER

Last year’s total was 2.040 million.

The U.S. volume of market-ready hogs increased, and packers picked up slaughter to handle the extra numbers. Plants were willing to pay up to secure supply and process meat last week in advance of reduced production this week, when many plants close Aug. 5. Iowa-southern Minnesota hogs were slightly lower at $74.50 US per hundredweight delivered to packing plants Aug. 2, down from $75-$75.50 July 26. The estimated pork cut-out value was $104.02 Aug. 2, up from $99.50 July 26. Estimated weekly U.S. slaughter to Aug. 3 was 2.022 million, up from 1.988 million the previous week.

BISON STEADY The Canadian Bison Association said Grade A bulls in the desirable weight range averaged $3.50 Cdn per pound hot hanging weight with sales to $3.70. Grade A heifers sold at $3.45 with sales to $3.55. Animals older than 30 months and those outside the desirable buyer specifications may be discounted.

SHEEP, LAMBS STRONG Ontario Stockyards Inc. reported 1,527 sheep and lambs and 146 goats traded July 29. All lambs and goats sold actively at strong prices. Sheep traded $10 cwt. higher.

Potash cartel breakup sheds light on power of concentrated marketing MARKET WATCH

D’ARCE McMILLAN

T

he food vs. fuel controversy of the past few years has generated passionate debate. Critics of biofuel support programs in the developed world say these policies artificially increase the cost of food for poor people in developing countries. This year’s prospect of a bumper world corn crop and much lower grain prices might push that debate onto the back burner. But there is another situation that arguably profits rich people and raises the cost of food for poor people that I am surprised does not generate more debate. I’m talking about potash marketing groups, which are often described as cartels. The power of these marketing arrangements was illuminated last week when one of them broke down. Uralkali in Russia and Belaruskali in Belarus had marketed their potash together through a company called Belarusian Potash Co. (BPC), just as Canpotex markets the production of Potash Corp. of Saskatchewan, Agrium and Mosaic. Canpotex and BPC account for almost 70 percent of global potash sales and I’m sure they argue there is stiff competition between them. However, I’m also sure buyers believe the concentrated power of the sellers gave them an advantage. The companies involved in the two marketing groups believed profitability was better if sales focused on price rather than volume. If buyers would not agree to the price and demand fell, the members of the sellers’ group hung together and reduced production to prevent the buildup of surpluses. The falling out at BPC is over the two members accusing each other of selling outside the marketing partnership and underselling its product. The three owners of Canpotex, two owners of BPC and two other potash producers in the former Soviet Union had faced an antitrust court case in the United States dating back to 2008 that alleged they acted like a cartel to drive up prices. The Canpotex owners all denied any wrongdoing but decided to settle out of court this year, paying $100

Lower potash prices would be good news for poor countries. | million to the plaintiffs. The Russian and Belarusian producers settled claims in September 2012. Potash Corp. head Bill Doyle said the lawsuits were without merit. He said the company settled to avoid the distraction and enormous cost of a lengthy court battle. It is important to note that governments have not pinned antitrust allegations on the potash producers. However, it is also illuminating that Uralkali thinks the breakup of BPC will force down the international price of potash by 25 percent. North American potash producers’ presentations to investors often highlight that demand for the nutrient should rise sharply as food demand grows. Yields of crops in India and China fall short of their potential because farmers do not apply the three key nutrients, nitrogen, phosphorus and potash, in the proper balance. Potash is under-applied relative to amount of nitrogen that they use. Eventually, these countries must buy more potash to get the yields they need to feed their citizens, holding out the prospect of strong potash prices and the need to build more mines in Saskatchewan and elsewhere. However, India and China already must subsidize fertilizer to their poor farmers to the tune of billions of dollars a year, money that they could

FILE PHOTO

easily spend on other needs such as improved grain storage and transportation infrastructure. This situation is detailed by Frederic Jenny, a professor of economics at École Supérieure des Sciences Économiques et Commerciales in Paris, in a chapter of the book Trade, Competition and the Pricing of Commodities published by the Center for Economic Policy. He said most of the government subsidies simply cover the difference between what the cartels charge and what would be a lower price if there were more competition. Presumably, if the price of potash was lower, Indian and Chinese farmers could optimize their fertilizer balances and generate higher yields, benefiting themselves and consumers. I’m not arguing that the owners are Canpotex are evil. There are probably many nuances and details to the situation that make the ethics of potash marketing groups not a black or white matter. But as we worry about what these recent developments in the potash industry mean for construction projects at home and Saskatchewan government revenue, we might also consider what it means for farmers and consumers in poor countries. Follow D’Arce McMillan on Twitter @darcemcmillan.

THE WESTERN PRODUCER is proud to support

Please join us for a customer appreciation breakfast and help us celebrate 90 years in business. We wouldn’t be here without you.

WHAT: A pancake and sausage breakfast WHEN: Wednesday, Sept. 4 from 7 to 10 a.m. PLACE: The front lawn of The Western Producer, 2310 Millar Avenue, Saskatoon.

COST: Free with any cash donation to 4-H

We’ll also celebrate throughout the year at farm shows near you.


10

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

WPEDITORIAL

OPINION

Editor: Joanne Paulson Phone: 306-665-3537 | Fax: 306-934-2401 E-Mail: joanne.paulson@producer.com

BIOFUEL | SUBSIDIES

CRAIG’S VIEW

Winding down gov’t biofuel support right thing to do

F

ederal financial support of ethanol and biodiesel is coming to an end, as it should after helping create an appropriate-sized biofuel industry in Canada. Government assistance was needed to get the industry on its feet, creating a new domestic demand for grain, lowering greenhouse gas production and creating rural employment. However, industries should eventually survive on their own business acumen rather than government support. So it was welcome news when agriculture minister Gerry Ritz said at the recent federal-provincial agriculture ministers meeting in Nova Scotia that he has no interest in the government pushing the biofuel industry to get larger. He thinks agriculture in Canada does not support expansion of the federal biofuel mandates. The ethanol mandate is five percent of fuel and the renewable diesel mandate is two percent. The federal ecoEnergy for Biofuels program will wind down in 2017 after committing funds to two dozen projects. It provided eligible producers of alternative renewable fuels with an operating incentive of up to 10 cents per litre of eligible production for the first three years of the program. A flaw in the current situation is that Canadian biofuel production capacity falls short of filling the demand created by the mandate. The result is imports of biofuel, mostly from the United States. Canadian biofuel plants still planned or under construction should narrow the gap, but monitoring will be necessary and the policy environment might have to be tweaked to ensure that the mandates are eventually filled mostly by Canadian production. However, some American imports might always be possible. The industry there, helped initially by lucrative government supports, has more capacity than needed to meet its domestic mandate. There is a surplus of ethanol produced from corn, which is a cheaper feedstock than wheat.

Ritz seemed disappointed that more farmers did not invest in Canada’s biofuel industry. There are notable farmer projects, such as North West Bio-energy and Pound-Maker Ag Ventures, but the biggest players are companies such as Husky. There are several possible explanations for the lack of farmer enthusiasm for investing. One reason might be recent failures of farmer investments in hog barns and cattle processing. Also, you don’t need to be an investor to benefit from the grain prices support that biofuel provides. Farmers are also aware of how difficult it is for small agricultural enterprises to compete with multinational operators. Perhaps they simply felt that the biggest bang for their investment buck would come from putting money into their own farming operation. Regardless, Canada’s grain farming community appears satisfied with the state of the biofuel industry, at least judging by the interests of farm lobby groups, which choose to focus mainly on farm safety nets and trade issues. Other governments are also retreating from biofuel support. Policy makers in the European Union are moving toward capping biofuel production at about five percent of total transport energy consumption by 2020. The original target was 10 percent. In the U.S., new biofuel developments have almost stopped since the government scrapped a blenders’ tax credit and the industry now has the capacity to easily meet the biofuel use mandate, which is 13.8 billion gallons this year and is capped at 15 billion in 2015 and beyond. There is some bipartisan support for tweaking the mandate but not to end it, despite oil industry lobbying against it. A gradual pull back is the best course in the U.S. to avoid the grain market chaos that would accompany a sudden reduction in corn ethanol demand.

NATURE | UNNATURAL

Bruce Dyck, Terry Fries, Barb Glen, D’Arce McMillan and Joanne Paulson collaborate in the writing of Western Producer editorials.

POLICY | SAFETY NET

U.S. farm bill debate illustrates the declining influence of the ag lobby NATIONAL VIEW

BARRY WILSON

N

ot so long ago, Canadian farmers who thought governments have an obligation to support the industry in hard times cast their lonely, envious eyes south. Their gaze often rested on the U.S. farm bill. Now there was a safety net from a farmer-friendly government. Grain farmers were guaranteed a price that reflected cost-of-produc-

tion, government doled out enormous amounts of money for setaside and weather calamities and the support was largely predictable. With an over-represented farm and rural presence in Congress and a legislative system that functions on trade-offs between regions and sectors, the farm community had clout on Capitol Hill. It generally was regarded as one of the most effective lobbies in Washington. Of course, that generous government support gave American producers an advantage, kept their debt levels far lower than in Canada and drove U.S. competitor country governments crazy, including Canada’s. And of course, Canadian producer organizations generally agreed with the condemnation of rich U.S. subsidies, but their members also

saw them as leverage to pressure Ottawa for more. The mantra was that Canadian farmers are competitive, but Canadian farm policies and supports are not. Pony up, Ottawa. What a difference a decade can make to rural entitlement programs: a political shift, a growing urbanization trend and an essentially bankrupt U.S. government with a debt of more than $16 trillion US. Last week, there was some irony and envy from Americans in the room when agriculture minister Gerry Ritz told a meeting of the U.S. Grains Council in Ottawa that the five-year Growing Forward 2 program was essentially Canada’s farm bill. Many Canadian farm leaders are critical of support cuts in the GF2 program, but at least there is a five-year program.

The U.S. Congress has been unable to come up with a new farm bill, so the old one has been extended for a year as political wrangling continues. And the fight isn’t about how rich farm supports should be because the days of guaranteed prices and billion dollar payouts are over. The pot is empty. The battle is over what share of the limited (but still large) farm bill budget should be devoted to what the Americans call “nutrition” — really government school lunch and food programs for the poor. Washington lobbyist Scott Shearer, who attended the U.S. Grains Council meeting to dissect the farm bill impasse, said in an interview the farm lobby carries less weight these days than it once did. Congress increasingly is populated

by urban and suburban representatives with little knowledge of or innate sympathy for farmers, which their often poor constituents consider an asset-rich and taxpayersubsidized privileged class. He said the farm lobby has been slow to pick up on the significance of the change. “They often see their role as lobbying politicians from rural and agriculture areas, but really, what they have to be doing is talking to urban and suburban representatives and convincing them there are benefits to their constituents to have a strong rural economy and a farm bill,” he said. As well, House and Senate agriculture committees should no longer be the primary lobby focus. Health, energy, trade and many other committees now touch on their file.


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

11

& OPEN FORUM AG PROGRAMS | MITIGATING RISKS

POTASH | INDUSTRY OUTLOOK

Farm policy should provide safety net

Russian action sends potash sector reeling

BY ROGER JOHNSON

F

arming is a capital intensive and inherently risky profession, in ways that are different from most other occupations. Farmers are primarily prone to two types of risk: the relatively short-term risk posed by natural disasters and the long-term risk of prolonged periods of low prices. Farmers with less capital and liquidity often do not have the resources that they need to mitigate these risks. The U.S. National Farmers Union sees the federal government’s role in farm policy as providing a safety net to help in these two circumstances when disasters strike and markets collapse. It is also important that these farm programs be structured to provide assistance only when needed and not make payments when times are good. Crop insurance is a good mechanism to mitigate the short-term risk from natural disasters. However, the federal government has struggled, largely for political reasons, to implement consistent programs that help manage the long-term risk of extended low prices. Commodity farmers are operating in a system in which they have little control. Farmers are price-takers rather than price-makers, and they sometimes overproduce because it makes sense for them as individuals. In other words, as commodity prices drop and farmers receive less money per bushel or acre, they try and make up the difference by increasing their production, which only drives prices down further. U.S. federal farm programs were

Safety net programs are vital for farmers facing difficult times due to natural disasters or market crashes, says the author. | FILE PHOTO developed as a way to deal with overproduction problems and mitigate price volatility. Before 1996, commodity programs dealt with overproduction in a systemic way by managing commodity supplies available on the market and establishing a price floor that ensured farmers recouped something close to their cost of production. These programs were, for the most part, fairly successful in removing incentives for over-production and ensuring a relatively stable price for farmers and consumers. However, the 1996 farm bill dismantled them to give farmers the “freedom to farm.” Without the market stability provided by the farm safety net programs, commodities flooded the market, prices collapsed and Con-

gress authorized billions of dollars in emergency payments to farmers to prevent large numbers of farmers from going out of business. More recently, major disasters have resulted in the opposite occurrence: crop shortages and dramatically higher prices. Some now argue that we are in a new period of high commodity prices and that the risk of long-term price collapse has been eliminated. Therefore, our farm programs no longer need to address this risk. This sort of wishful thinking is what led to Freedom to Farm. History tells us that what goes up must come down, and high periods will be inevitably followed by decline. This is why we proposed a voluntary market-driven inventory system

(MDIS) to help smooth market highs and lows and provide more stable commodity prices to the benefit of farmers and consumers, both in the United States and around the world. MDIS would also operate at little cost to taxpayers because it would kick in and provide assistance only when prices are extremely low. In lieu of such a system, NFU supports implementing a counter-cyclical program to help farmers cover most of their cost of production when prices drop below a set reference price. Federal farm policy must also help previously under-served farmers mitigate their risk and strive to achieve broader policy objectives. For example, the farm bill encourages disadvantaged people to buy food from local specialty crop growers to help bridge their nutritional gap while simultaneously providing a market for these farmers and supporting the local economy. Just as farm safety net programs are important for farmers facing hardship, nutrition programs provide critical assistance to consumers in difficult times. Farm bill programs remain vitally important, and the legislation currently under consideration will make significant reforms. Congress has a responsibility to our nation’s farmers, ranchers, consumers and rural communities to pass a new five-year farm bill this year. Roger Johnson is president of the National Farmers Union in the United States. This article was published on the farmfoundation.org website and has been edited for length.

INPUT COSTS | VOLUME DISCOUNTS

Farmers can increase collective buying power HURSH ON AG

KEVIN HURSH

T

here are compelling reasons why producers should band together to increase their collective purchasing power. When the grain economy is buoyant, many of us pay less attention to the price of inputs. As long as the price is in the ballpark and the service is good, we have a supplier we’d prefer to deal with. Sometimes loyalty comes from the agronomic advice at a particular outlet. In those cases, you may be less inclined to buy somewhere else for a small price difference. Increasingly, however, agronomic advice isn’t coming from suppliers. Many producers invest the time and

energy to do the research and come up with their own answers. They have their own sweep nets for insects and they can follow what other producers and agronomists are advising through Twitter. Information is also available over the internet. Alternatively, many producers pay separately for field scouting and agronomic advice. They don’t have to patronize a particular retailer to get agronomic expertise. So, as the grain economy tightens, as it appears that it is, money saved on input purchases is money earned. And the producers paying the lowest prices are typically the ones with the largest volumes who are willing to shop around. At some suppliers, the price is the price and everyone apparently pays the same no matter the volume. At other suppliers, the price depends to a great extent on how much you’re buying and how much they want your business. Win a large producer’s business on Headline fungicide, for example, and you’ll have a better chance of supplying his glyphosate needs.

Suppliers don’t typically list their volume discounts on a bulletin board. You go in the office, close the door and negotiate a price. And every producer might have a different deal. All the cross promotions from manufacturers work into the mix as well. Use herbicide X on so many acres and get our fungicide Y at a lower price. Or get a cash rebate at the end of the year based on some complicated usage formula. Or get a free jacket or a free trip to Las Vegas. Special customers are first in line for special deals. Crop desiccants Reglone and Desica have the same active ingredient and are manufactured by the same company (Syngenta), but they have different price tags. A limited supply of the significantly cheaper Desica was provided to retail outlets this summer, but of course the demand far exceeded the supply. This was another tool suppliers could use to curry favour with preferred customers. Business is business and it isn’t surprising that larger customers get price discounts and other perks.

However, it is surprising that producers don’t do more to work together to increase their buying clout. In these times of product shortages and logistical issues, it’s best to have the products you need on the farmstead well in advance of application. As soon as you have a rough seeding plan in the early spring, you have a pretty good idea of your product needs from inoculants to herbicides and fungicides. Three or five or seven producers could buy under one name and have a lot of bargaining power. There would always be some products a producer would have to buy separately, but there should be significant price advantages for most of their input needs. Alternatively, a buying group could come together for one specific product. Perhaps dropping grain prices will convince more producers to work together on input purchases. Kevin Hursh is an agricultural journalist, consultant and farmer. He can be reached by e-mail at kevin@hursh.ca.

EDITORIAL NOTEBOOK

JOANNE PAULSON, EDITOR

W

hat does Russian potash producer Uralkali know that other producers do not? Or, do the company’s executives simply have a larger number of highrisk genes? All hell broke loose in the markets last week when Uralkali announced it would leave the Belarusian Potash Company cartel with the intention of selling big volumes instead of seeking high prices. Every fertilizer company’s share price took a dive, including Uralkali’s. Dire predictions followed. It’s the end of the potash market as we know it, said at least one analyst. Causing that kind of havoc means you’re pretty sure about your longterm plan and have the genes to make it happen. The question is, is Uralkali right, or are the North American fertilizer companies right? In The Globe and Mail, Scott Barlow said investors should have seen some sort of adjustment coming. Potash inventories are high, corn prices are low and Chinese fertilizer demand is down, he noted. Score one for Uralkali. It might be time for a bit of a correction. Saskatchewan and other potash-bearing regions have been riding high on pink gold for a long time, while fertilizer companies have been expanding at a great rate. However, all that expansion brings a lot of production to the market, and perhaps is even contradictory to the companies’ stated business plan of matching supply to demand. There is certainly enough fertilizer out there right now. Prices are down, and the Uralkali defection will almost certainly drive them down further — at least in the short to medium term. On the bright side, all this is good for farmers, assuming they’re not invested in fertilizer companies. It’s not so good for Saskatchewan if prices fall. Royalties will drop and government coffers will shrink. It’s potentially bad for anyone connected to, or living near, greenfield mines. Uralkali has put its greenfield mine on hold; could BHP Billiton or K+S do any differently in Saskatchewan? That would be tough on the communities near the potential mines. Land has been sold, plans made for housing and roads and hopes built around new jobs and long-term investment. Potash is an important piece of the food landscape and always will be, but it’s likely in for a correction, bringing the good and bad along with it. Uralkali’s decision to bolt its cartel will speed up the consequences.


12

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

OPEN FORUM LETTERS POLICY: Letters should be less than 300 words. Name, address and phone number must be included for verification purposes and only letters accepted for publication will be confirmed with the author. Open letters should be avoided; priority will be given to letters written exclusively for the Producer. Editors reserve the right to reject or edit any letter for clarity, brevity, legality and good taste. Cuts will be indicated by ellipsis (…) Publication of a letter does not imply endorsement by the Producer.

Act allowed our government to declare these lines as critical, without “proof of need,” cost-benefit analysis or any other checks and balances, and thereby basically ignored Alberta ratepayers’ concerns, as well as the public interest. Alberta Electric System Operator’s supply-demand report of July 5 shows Alberta’s maximum electricity generation capacity to be 14,409 MW. Peak consumption, on our most recent hot day, was 10,062 MW. Yet AESO ordered a rolling blackout, and made a public appeal to Albertans to reduce their use of power. This recent rolling blackout was attributed to AltaLink’s Ellerslie substation transformer tripping out, and

“a number of generators (being) out of service for planned and unplanned maintenance, and wind generation (being) very low.” AESO’s supply-demand report still shows five coal generators down: B a t t l e R i v e r, H . R . Mi l n e r a n d Keephills No. 1, plus Sundance No. 1 and No. 2. The latter two were deemed unrepairable and mothballed years ago, so it is a mystery as to why they are still listed as being capable of generating 576 MW. The AESO Report also reports 27 gas facilities generating zero MW … as well as eight wind generators…. According to Dave Cooper of the Edmonton Journal, Alberta has the highest amount of co-generation in North America, but AESO does not

track Syncrude’s, Suncor’s or Dow Hydrocarbon’s 1,736 MW co-generation capacity, nor the forest products plants, which each generate at least 20 MW. If Alberta is so short of power, why is Alberta exporting electricity? Despite … the National Energy Board reporting that Alberta exported 4,477 MW in December 2012 alone … this government still claims these two 4,000 MW DC lines are just for Albertans…. Albertans, question our current government’s approval of these two 4,000 MW DC lines, for many of the same reasons Lane lists, plus the fact that SNC Lavalin, a mega contractor now in court for worldwide fraud, owns AltaLink, did all the engineer-

ing on their WATL and will do all the construction. World Bank will no longer do business with SNC, but in Alberta, it is business as usual with SNC Lavalin, while Albertans pay all their costs, and increasingly obscene electricity bills…. Meanwhile, Albertans are repeatedly subjected to rhetoric about how the cost of these two 4,000 MW DC lines will only be the monthly equivalent of “a cup of coffee.” Proceeding with Manitoba’s BiPole III and Alberta’s two 4,000 MW direct current transmission lines is truly, as Lane says, “unnecessary and foolhardy.” Bill and Marion Leithead, Bawlf, Alta.

DIETARY FALSE HOPE To the Editor: The article, Scientists developing wheat for celiac suffers (sic), provides false hope to celiac sufferers that high quality bread can be made with no side effects. Contrary to Dr. van Wettstein’s assertion that gliadins “are not required for baking,” there are no peer-reviewed publications showing that high quality loaves can be prepared without this essential group of proteins.  The transgenic wheats that have been produced in the Washington state studies may be useful scientifically for understanding celiac toxicity, but it is hyperbole to suggest that they are or will be pragmatic dietary solutions for celiacs.

GREAT YIELD RUNS IN GET THE GENUITY ROUNDUP READY CANOLA ADVANTAGE ®

®

Martin Scanlon, C&G, PhD University of Manitoba, Winnipeg, Man.

GREAT YIELD, ON THE DOUBLE.

ROUNDUP READY

CO-OPERATION BEST

Get the advantage:

To the Editor: What a different outcome there would have been to the disaster of the mall collapse in Elliott Lake had the tenants believed in co-operation instead of private enterprise. All they would have had to do five years ago would have been to stand shoulder to shoulder and demand that the owner repair the building to their satisfaction before one cent of rent would be paid. As long as he could collect the rent without fear of their boycott, he was home free. There is nothing private enterprise can do except react to problems in individual ways because they firmly believe that co-operation is bad for business — because that is what they are always told. Nothing could be further from the truth, and any society that co-operates is far superior to any that do not.

æYield æSuperior weed control æEase and convenience

For greater convenience, insect protection, and yield potential.

Jean H. Sloan, Lloydminster, Sask.

LINES NOT NECESSARY To the Editor: Graham Lane’s Dam-nation list of the negative implications of Manitoba’s BiPole III are very similar to what Albertans face with the two 4,000 M W D C l i n e s ( AT C O ’s E AT L ; AltaLink’s WATL) being foisted on us. The Electric Statutes Amendment

ALWAYS FOLLOW IRM, GRAIN MARKETING AND ALL OTHER STEWARDSHIP AND PESTICIDE LABEL DIRECTIONS. Details of these requirements can be found in the Trait Stewardship Responsibilities Notice to Farmers printed in this publication. ©2013 Monsanto Company


OPINION/NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

13

GRAIN | CANADIAN WHEAT BOARD

Plans to privatize CWB moving forward, says Ritz Open marketing | Canadian Wheat Board executives expect to turn a profit over the 2012-13 season BY BRIAN CROSS SASKATOON NEWSROOM

A plan aimed at privatizing the former Canadian Wheat Board is expected to be in the hands of federal agriculture minister Gerry Ritz within the next year to 18 months. Speaking last week in Saskatoon, Ritz said privatization plans being drafted by CWB executives will be completed by 2014, if not earlier. “The five-year plan that we had started (with CWB) last August said that by (the end of) 2014 they would come to

me with a plan for privatization,” Ritz said. “They’re well on track to do that.” CWB executives have informed Ritz that they expect to turn a profit in 2012-13. “ ( C W B p re s i d e nt ) Ia n W h i t e assures me that they will have some positive ink on the bottom line in their first year,” Ritz said. “(They have) shown that even without the single desk that they’re still a profitable organization.” CWB’s pooling programs were “reasonably successful” in 2012-13 Ritz added, and the organization’s

customer base is still the envy of many in the industry. Japan committed to do 50 percent of its business with CWB in the 201213 crop year while it explored opportunities on the open market, he said. Ritz did not offer his views on what the CWB’s privatization plan might entail. “At some point, they’re going to have to decide … (if they want to) get bigger,” Ritz said. “You have to be part of the pipeline, not just a buyer in that pipeline.” Ward Weisensel, CWB’s chief oper-

ating officer, said executives are continuing to work on a privatization strategy and would like to formulate a plan quickly. Legislation requires that a privatization plan be in place by August 2017. “We think it’s very important to move much quicker than the time frame laid out in legislation, and that’s our objective,” Weisensel said. Ritz said the first year of open marketing went “extremely well,” adding that farmers moved more grain off the combine than ever before. “We had far more product go off the

combine last fall than we ever saw in previous years,” he said. “That’s cash flow, and that’s what keeps businesses expanding and running.” Ritz said logistics was a top concern heading into the 2012-13 crop year, but grain movement was better than many expected, in spite of heavier volumes last fall and weather-related issues during the winter. “With farmers able to pick their price and the time of sale, (some people wondered), ‘could the system handle it,’ and it did. The system worked exceptionally well.”

CHILDREN | LITERATURE

THE FAMILY

®

SPIRITUAL VIGNETTES

MORE BEANS PER POD, MORE BUSHELS PER ACRE.

æ5% Refuge right in the bag. Just pour and plant. æTwo modes of action against corn earworm and European corn borer, above ground. Be sure to scout for them. æHigher yield potential thanks to effective insect control and reduced refuge. Genuity®. Because every kernel matters.

‘”‡’”‘Ƥ–ˆ‘”›‘—ǡ–Šƒ• to game-changing soybean technology: æNext-generation Roundup Ready® trait technology for improved yield potential. æ Increased yield potential over original Roundup Ready soybeans. æSafe, simple, dependable weed control Genuity®. Because every bean matters.

GENUITY . EVERYTHING YOU WANT, AND MORE. GENUITYTRAITS.CA ®

Aboriginal stories of hope

JOYCE SASSE

C

aring for grandchildren often gives us an opportunity to reenact our youth. I think of one youngster with a pretend cookbook who made notes about great-granny’s recipes as they baked a cake together, and the fiveyear old who carefully lifted his pretend bales (hardened marshmallows) to the loft of his little barn. These are the kids (and adults) who would love to share aboriginal storyteller Victor Lethbridge’s new books about Little Chief. Kids understand how easy it is to befriend a gopher, so they quickly enter into the story of Little Chief and Mighty Gopher. The want-to-be hero finds friends and acceptance on the open prairie. It is a story of twists and turns, but it is also about hope, empowerment and determination. In his workshops, Lethbridge uses the story to help those who struggle with bullying and rejection. His second book is about a little girl and the loss of her horse. Little Chief and the Gifts of Morning Star speaks to those who may be grieving the loss of someone or something precious. Each book is beautifully illustrated by Ben Crane, and contains a CD in which the story is told in English, Blackfoot, Cree and Sioux. Lethbridge is a member of Wood Mountain Lakota First Nation in southern Saskatchewan. He visits communities across Western and Northern Canada, where he meets with youth and children. In his presentations, cloaked in song, storytelling and laughter, he addresses selfesteem, peer pressure, career choices and suicide prevention. Both his books have helpful notes on native traditions, culture, history, hope, resilience and compassion. For more information, visit TatankeWorkshops.com.

Joyce Sasse writes for the Canadian Rural Church Network at www.canadian ruralchurch.net.


14

NEWS

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

UPHILL BATTLE

CROPS | SOYBEANS

Man. soybean acres hit million 28 percent more acres than 2012 despite late seeding BY ROBERT ARNASON BRANDON BUREAU

A woman and her dog get some exercise running down — and up — a road on the outskirts of Sexsmith, Alta. | RANDY VANDERVEEN PHOTO

It appears that Manitoba farmers seeded more than one million acres of soybeans this year. Manitoba Agricultural Services Corp., the provincial crop insurer, is projecting 1.08 million acres of soybeans for the province in 2013. With 97 percent of the data reported as of late July, there were 1.048 million acres of insured soybeans in the province, said Doug Wilcox, MASC manager of program development for insurance. “If you add three percent to that, it becomes 1.08 million,� he said. The MASC figures are almost identical to Statistics Canada projections from June, which estimated Manitoba soybeans at 1.085 million acres. It means more soybeans are now grown in Manitoba than oats, barley and flax combined. The bean acreage is another record for Manitoba and a 28 percent increase from last year, when growers insured 844,660 acres. Most industr y watchers were expecting 900,000 to 950,000 soybean acres in Manitoba a month ago, so the 1.08 million figure is surprising. “In certain areas, seeding intentions were reduced because the crop insurance deadline came and it was

(still) wet‌ such as the southwest corner,â€? said Roxanne Lewko, executive director of Manitoba Pulse Growers. “We must of made up for those acres in other areas, where maybe the seeding intentions were increased in the last minute.â€? Producers and industry representatives have talked for more than a year about the possibility of one million bean acres. Lewko said exceeding the threshold is symbolic but also leads to a few questions. “Is that where we’re going to be, at a minimum, from now on? Are we going to see a million acres each year? Is that our new baseline?â€? Grain corn will also set a new Manitoba record this year. Growers seeded 342,593 acres this spring, based on MASC projections. It represents a 25 percent increase from last year, when producers seeded 270,000 acres of grain corn. Lorne Loeppky, who farms near Niverville, Man, said there is definitely more corn on the landscape in eastern Manitoba. “In our part of the world, we have quite a few new producers, and (also) people who tried it for the first time last year are growing considerably more acres (this year),â€? said Loeppky, who seeds 1,000 to 1,200 acres of corn. “I would attribute most of that to

MANITOBA SEEDED ACREAGE 2013 1,080,463 Soybeans Grain corn 342,593 Flax 74,409 Canola 3,326,133 Spring wheat 2,438,221 Winter wheat 622,613

2012 844,660 273,257 120,925 3,625,349 2,201,235 593,906

Source: Manitoba Agricultural Services Corp.

the kicking that guys took last year in canola, and the fusarium problems we face with cereal crops.� While corn and soybeans continue to expand, flax acres dropped to a new low. MASC will insure 74,000 acres this year. It is lower than the Statistics Canada projection of 85,000 acres and industry expectations of 150,000 acres. Only a decade ago, Manitoba producers regularly seeded more than 350,000 acres of flax. Manitoba Flax Growers Association chair Erid Fridfinnson said there’s no doubt that corn and soybeans are eating into flax acres, but this year it was primarily wet conditions in southwestern Manitoba that cut into flax acreage. “There was quite a bit of unseeded acreage in that part of the province,� he said. “That’s really where the bigger part of the flax crop has been grown.�

IMPORTED BEEF | LEVY

                          !



"

Beef levy benefits sector BY BARRY WILSON

                                          ! 

    



" #$ 



$   & &

# % &$



      

+! , -$./$) -      

 !"# $%&

' ( ) *      !

,

#)$ )$3)3  5+     

$!!  0 1 2)3/  4     !

# $# '%"

 ( ')

%& ")'

&##&'

!1$/. $ 1$/. -+    -  

,

 $,6, !7  ,6   

+,$)$/$

3$)80(!+  0(  !

! 5 53..30(!  0(  !

OTTAWA BUREAU

Beginning as early as autumn, the Canadian beef industry could be in a position to collect $1 per head on imported beef with the money earmarked for research and promotion. The levy, similar to import levies applied to Canadian beef imports in other countries, was announced July 30 at an eastern Ontario farm with agriculture minister Gerry Ritz and the cattle industry singing its praises. Canada Beef, which will administer the fund, estimates it will raise up to $800,000 annually for investment in the industry. Importers will collect the levy and pass it on. “This will provide a stable income for the industry for research, market development and promotion,� said Ritz. Canada Beef chair Chuck MacLean said the announcement is the result of years of work and planning. “It will strengthen the ability of Canada Beef to benefit from a more equitable relationship with our trading partners,� he said. Several months will be required to work out the bureaucracy of collecting the levy and getting it to Canada Beef, whose board will decide how it is invested. The announcement came after amendments to a levy order were issued under the authority of the Farm Products Council of Canada. It was based on 1993 legislative amendments that allowed the creation of a levy if a national sector had established an agency and charged the same levy on domestic sales.

It was a sweet day for FPCC chair Laurent Pellerin, a former Canadian Federation of Agriculture president who Ritz appointed to the council several years ago. Since his appointment, the former Quebec hog producer has been urging Canadian farm sectors to make use of the two-decade-old law. “The money is there to be collected,� he said. “I never understood why people weren’t using it.� He said the cattle industry’s move will allow other sectors to see how the levy works and the benefits it brings. Raspberry and strawberry farmers are looking at the option, while pork and potato sectors have shown some interest, he said. “I think there will be more, and cattle led the way,� said Pellerin. “As long as someone is doing it, others see that it can be done. And I use the argument that as long as you meet the rules, it is only fair because others put a levy on our exports.� Ritz told reporters that the levy will cause no trade problems with the United States because it simply is following the rules. It is not trade retaliation. However, he then raised the spectre of country-of-origin labelling. Asked why it had taken farmers 20 years to take advantage of collecting money through import levies, he suggested part of the problem was getting the industry to organize itself. “Too many cooks spoil the soup sometimes,� he said. “In some way, COOL refocused everyone’s efforts since if the Americans can do this, let’s put this money in place.�


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

15

GRAIN HANDLING | MISSION TERMINAL INC.

Producer car volumes decline Thunder Bay terminal | Ocean freight rates forced more grain west SASKATOON NEWSROOM

Canada’s top handler of producer cars says the amount of producer car grain it receives at its export terminal in Thunder Bay was down 20 to 25 percent in 2012-13. Nonetheless, Mission Terminal Inc. still sees a bright future in the producer car business, said Derek Drayson, the company’s grain merchant and business development expert. “I’m a bit more confident than most people are that producer cars can continue to function and continue to provide value in the new environment,” he said. “I think there’s definitely a role for them to play.” The reduction in producer car volumes in the 2012-13 crop year wasn’t necessarily caused by changes to the western Canadian grain marketing system that took effect last August, Drayson added. A bigger factor was ocean freight rates, which caused significantly larger volumes of prairie grain to move west, particularly durum. “I’d say our producer car volumes were down about 20 to 25 percent, but I wouldn’t say that’s totally a product of us switching into the new (grain marketing) environment,” he said.

“I’d say it’s largely a product of a lot of short covering at harvest time this year … and of the West Coast basis on durum as well. As ocean freight rates (adjust), I think things will stabilize again.” Drayson said competitive ocean freight rates have caused a significant shift in grain movement patterns during the past 12 months. Durum shipments through West Coast terminals were particularly high in 2012-13 with total durum volumes through Vancouver expected to be up more than 100 percent from the previous crop year. “Things were more economical to move all the way around South America to market rather than going (through Thunder Bay),” Drayson said. “Durum volumes are almost double through the West Coast this year. I think they’ll probably end up at 1.2 or 1.3 million tonnes through the West Coast, and that’s typically not the case.” According to statistics from the Canadian Grain Commission, the five-year average for West Coast durum, including shipments through Vancouver and Prince Rupert, is around 500,000 tonnes. Mission Terminal normally handles more producer car grain than other terminal operators.

Producer cars normally account for 25 percent of the MTI’s overall grain volumes at Thunder Bay. In an average year, the company expects to handle 40 to 50 percent of all grain shipped on producer cars. To maintain those volumes, the company recently hired a Saskatchewan representative to act as a liaison between it and producer car loading sites. This month, Mission will also launch a marketing app for iPhone users, allowing producers to select a crop type, choose a delivery location and acquire instant information on pricing and contract opportunities. The company has also retained shipping incentives of $3.50 per tonne on all CWB grain, minus a $1 per tonne administration charge. A few years ago, Mission officials announced plans to expand the company’s grain handling assets in Western Canada by acquiring existing primary elevators or building new ones. In addition to its 136,000 tonne terminal at Thunder Bay, MTI also owns a 6,000 tonne elevator at Alexander, Man., and has equity in three producer car loading facilities in Saskatchewan and Manitoba. It also has a minor equity in the Great Sandhills Terminal at Leader, Sask., and is a shareholder in several

Mission Terminal Inc. in Thunder Bay received 20 to 25 percent less grain from producer cars at its export terminal over the 2012-13 season. | FILE PHOTO short-line railway companies in Saskatchewan and Manitoba. Drayson declined to say whether the company still intends to expand its prairie assets. “Really, you’re looking at things in a different light than you were before,” he said. “The way you analyze these types of investments needs to change a bit.” As of early July, producer car shipments in 2012-13 were down almost 40 percent from the previous year, according to the CGC figures.

As of July 10, the number of hopper cars filled by grain growers stood at 8,487, down from 13,038 a year earlier. Despite the reduction, federal agriculture minister Gerry Ritz said there is no reason to believe the system is broken. Instead, the lower numbers suggest farmers have found more appealing ways to ship their grain. “The cars are still there should producers choose to use them,” Ritz said. “But if they choose not to use them, I’m not going to force them on it.”

westeel.com

BY BRIAN CROSS

MF22526-0513

Part of the land, like you.

Ask your Westeel dealer about our complete range of storage solutions for your farm, including our high performance smoothwall bins for fertilizer, seed and grain.

Get these free* Westeel Work Gloves when you visit your participating dealer. *While supplies last, no purchase required.


16

NEWS

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

TRADE | EXPORTS

Supply management concessions possible at Pacific Rim trade talks Officials at Trans-Pacific Partnership negotiations will defend system, but could bend under the right deal BY BARRY WILSON OTTAWA BUREAU

READY, AIM ... |

Charl Duvenage takes aim at a balloon during the cowboy mounted shooting event at the Vermilion Fair in Vermilion, Alta., in July. | ROBYN WHEAT PHOTO

A senior Canadian trade official says concessions on Canadian defensive issues such as supply management would not be a deal-breaker if Canada wins key demands in Pacific Rim trade talks. He was responding last week to a specific question about Canada’s willingness to make supply management concessions in the interests of a deal. Denis Landerville, director of Agri-

Advertisement

Break the cycle of sclerotinia this fall Unique fungicide offers new way to tackle yieldrobbing disease More and more producers are taking a new strategy in their fight against an old enemy. Contans® WG is a soil-applied biological fungicide that breaks the cycle of sclerotinia disease, protecting crop yield and quality for future seasons.

“Applying Contans made all the difference. I will definitely be using Contans again to protect my sclerotinia-susceptible crops, just more of it!” — Gerry Germsheid, Landis, SK Wet conditions in parts of Saskatchewan and Alberta contributed to very high levels of disease pressure during 2012. “Some canola and pulse producers lost 30 to 40 percent of their yield to sclerotinia last year,” says Chris Di Ubaldo, product manager for UAP Canada. “But producers who incorporated Contans into their disease management strategy were rewarded with extremely low levels of disease. Neighbours asked what they did differently as their fields were clean and yielded very well.”

Stop disease before it starts Their secret weapon is Contans – a one-of-a-kind fungicide that controls sclerotinia by attacking the diseasecausing fungus in the soil before it can infect a susceptible plant. Breaking this life cycle is essential in controlling the pest, which overwinters as sclerotia and can remain in the soil for five plus years.

Because Contans fights disease before it starts, applications are made during the fall after harvest or in the spring before seeding. Working in the soil or on infected crop residues, Contans gets to the root of the problem – the sclerotia bodies – and breaks them down. This action lowers the inoculum levels in the field, significantly reducing sclerotinia populations and disease pressure.

We are not taking our foot off the accelerator. Fields with a history of white mould/sclerotinia should receive a pre-seed or post-harvest treatment of Contans WG to break the disease cycle.

Thumbs up from producers Fred Stilborn of Balcarres, SK says his area was hit hard by sclerotinia in 2012. “You can visually see a line where Contans was applied and where it wasn’t. The fields with Contans had very low levels of sclerotinia disease, between one to five percent, and the fields without Contans ranged from 10 to 80 percent disease incidence,” says Stilborn who has used the bio-fungicide for the past three years. Contans applications have also become an annual disease management practice for Jeff Park, an agronomist and oilseed producer from Carman, MB. “It makes sense to use a biological like Contans as a long-term disease management tool to lower the inoculum levels in my fields,” he says.

compared to non-susceptible ones. To ensure inoculum levels are minimized for subsequent growing seasons, a maintenance rate is required. “It’s necessary to incorporate the product after application,” adds Di Ubaldo. “Once applied to the soil surface and crop residue, Contans should be worked into the upper soil layer by heavy harrow, rainfall or irrigation.” Contans is only one tool of many that producers should be using in an overall integrated disease management strategy that includes proper rotations and the use of foliar fungicides.

Proper application critical Contans can be applied to a number of field and greenhouse crops. It is effective in fields with a history of sclerotinia as well as those under a tight rotation of sclerotinia-susceptible crops (e.g. canola, pulses and beans). To maximize effectiveness, the product must be applied at the proper rate depending on time of application and susceptibility of the crop. A higher rate is required in the first year for sclerotinia-susceptible crops as

BREAK the CYCLE ® Contans WG is a registered trademark of PROPHYTA Biologischer Pflanzenschutz GmbH. UAP Canada is a member of CropLife Canada.

www.uap.ca

culture Canada’s trade negotiations division, said it was clear when Canada joined the Trans-Pacific Partnership talks last year that countries could not join without bringing all their issues to the table and being prepared for an “ambitious” outcome. “We came in prepared to live up to that,” he said during a July 30 panel discussion in front of a crowd of mainly American grain industry leaders at an Ottawa meeting of the U.S. Grains Council. “The test will be whether it is balanced.” He said Canada wants to obtain concessions from other TPP countries on market access for goods, government procurement and rules governing the mobility of people.

Always follow label directions.

DENIS LANDERVILLE AGRICULTURE CANADA

“What we receive on that will figure into whether we consider it balanced,” said Landerville. In a later interview, he said TPP talks are moving quickly. The 12 countries involved are taking pursuit of a deal seriously, he added, and a deal is possible this year or next. “We are not taking our foot off the accelerator.” He said Canadian negotiators’ instructions from the federal government continue to be to defend supply management import tariffs and quotas. “Defending supply management continues to be our ma rching orders.” However, he said Canada also wants a deal. “We’re not going to stand in the way of completing a deal,” said Landerville. “We’re pushing to meet the objectives for the TPP. We will not be the one that breaks a deal.” Negotiators meet again in September, and ministers will meet in October. He said the target is to complete a deal this year. “We are very much working to that objective.” The TPP panel at the grains council meeting also included representatives from the United States and New Zealand, and all speakers used their initial remarks to talk about what they want rather than what they would give. It took Grain Growers of Canada executive director Richard Phillips to set the Australian Shepherd herder among the sacred cows. He said the toughest livestock line in any trade agreement involves sacred cows, so would New Zealand be willing to offer more access to genetically modified crops, the United States to reduce protection for sugar and Canada to give the U.S. and New Zealand “real access” to Canadian dairy markets? In their responses, the U.S. and New Zealand representatives did more skating than Landerville.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

17

PRODUCTION | SUSTAINABILITY

Local food leaves a sizable footprint too Transportation efficiency | Energy consumption in local production may surprise consumers, says report BY BARRY WILSON OTTAWA BUREAU

Canadian consumers who opt for locally produced food because they think it is more environmentally friendly should think again, says a new study from the Conference Board of Canada. Improved transportation and food supply chain logistics have made long distance transport of fresh and frozen food viable, economical and environmentally sustainable, says the report published in late July. Local food production can actually consume more energy and leave a larger “environmental footprint” than food produced more efficiently and transported, says the report, Fast and Fresh: A Recipe for Canada’s Food Supply Chains. “While Canadian consumers often feel that they are environmentally conscious when it comes to their food choices, they will need a more sophisticated understanding of what determines the environmental footprint of their foods so they can effectively act on this concern,” it said. “Due to the relative energy consumption and associated emissions of the production and transportation

components of food supply chains, simply relying on local origins of food products is an inadequate indicator of environmental performance.” The report suggested that companies involved in the food system supply chain have an obligation to educate consumers. “Consumers who choose to narrowly focus on the distance their food has travelled in order to reduce greenhouse gas emissions may in fact be choosing a product with a larger emission footprint on a life cycle basis,” it said. “This is a result of the fact that significantly more energy is consumed during the production process relative to the transportation process.” The report calls for improvements in the food industry supply chain from better infrastructure to local regulations. The report, written by Vijay Gill from the conference board, is part of a series of food strategy background reports that will culminate in the unveiling of a proposed national food strategy next spring. The conference board, funded by fees charged for services provided to the private and public sector, has close ties to many of Canada’s large

The Conference Board of Canada says consumers who believe they are saving the environment by shopping locally are misguided. | FILE PHOTO food industry corporate players and support from Agriculture Canada. It bills itself as “the foremost independent, not-for-profit, applied research organization in Canada.” The report argues that technology allowing long distance movement of fresh and frozen food from efficient producing areas to markets, increasingly by rail, has been a boon for consumers by giving them an increased variety of eating choices at lower costs. However, the local food movement emphasis on the environmental costs and reduced “freshness” of transported produce has obscured the benefits of the modern ability to transport food “vast distances” in

temperature-controlled containers. “Unfortunately, the narrowly defined objective of food miles has typically generated more attention than the seemingly mundane, albeit highly rigorous, methodology of ‘life cycle emissions,’ ” said the report. “As a result, what could be heralded as a major contributor to higher quality of life has often been demonized for the very aspect that allows for those benefits: the safe and efficient transportation of food over vast distances.” It said the implication for improved food supply chain infrastructure extends far beyond Canada. Infrastructure improvements in foreign countries could help Cana-

dian exporters access new markets. It could also increase competition for Canadian product from other countries or domestic supply. It cites Canada’s booming pulse export industry as an example. “The development of foreign hinterland infrastructure can provide opportunities for domestic exporters,” it said. “But it can also pose a threat because countries such as India that lack inland infrastructure have difficulty delivering their own products to domestic consumers. Developing this infrastructure and competence could to some extent obviate the need to import similar products.”

BY CONSUMER REPORTS

T The 2013 SUBARU FORESTER is ranked as THE TOP-SCORING SMALL SUV BY CONSUMER REPORTS.

The Newly Designed Forester earned a remarkable 88 points out of a possible 100, this score is 11 points higher than Honda CRV, 13 points higher than Toyota Rav4 and 14 points higher than Mazda CX5. The Subaru Forester the logical choice!

JUST ARRIVED! • 46 MPG • 2014 IIHS+ PLUS TOP SAFETY AWARD.

MSRP FROM MS MSR

ALL NEW TOTALLY REDESIGNED D

2014 FORESTER INTRODUCING THE ALL-NEW • Full Off-Roading Capabilities with Symmetrical AWD • 1,500 LB Towing Capacity • Generous Ground Clearance • Sporty Handling • Class Leading Fuel Efficiency 6.0l/100KM MSRPFROM FROM MSRP

THE GAME CHANGING COMPACT CROSSOVER!

THE ALL-NEW STUNNING S T LOOKS

ARE JUST THE START MSRP FROM MS HEAD TURNING HEART PUMPING CONFIDENCE

INSPIRING

MANY MORE UNITS IN STOCK... OPEN 24 HOURS AT WWW.SUBARUOFSASKATOON.CA

ELITE AUTOMOTIVE GROUP INC. O/A

Open 24 Hours @

www.subaruofsaskatoon.com

SUBARU OF SASKATOON 471 CIRCLE PLACE • 306-665-6898 OR 1-877-373-2662

Open 24 Hours @

www.bramerauto.com

BRAMER AUTOMOTIVE GROUP

CORNER OF SARGENT & KING EDWARD • CALL 204-474-1011 • TOLL FREE 1-877-474-1011


18

NEWS

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FARM CREDIT CANADA | MANAGEMENT

New executive to assess FCC risk levels Chief risk officer | Michael Hoffort will look for financial exposure and vulnerability to fraud BY BARRY WILSON OTTAWA BUREAU

FCC’s new chief risk officer will assess the organization’s risk to factors like commodity prices and interest rates. | FILE PHOTO

Fa r m C re d i t Ca na d a’s n e w l y appointed chief risk officer says his major role is to make sure Canada’s largest farm lender is living within its “appetite for risk.” It is also Michael Hoffort’s job to assess the policy directions coming from the federal government and the government-appointed board of directors to ensure they do not jeopardize the viability of the crown corporation or its 100,000 agricultural customers. “A big issue is ensuring the board and

The most challenging thing that could happen in agriculture is the unexpected, significant change in conditions. MICHAEL HOFFORT FARM CREDIT CANADA

all levels of the organization that we are living within the risk appetite that we have set for the organization,” he said. If a policy directive threatened to undermine FCC’s conservative attitude to risk, “we would be consulted and we would do our best to make sure that the powers that be under-

stand the implications of that policy shift and the implications it could have for our customers and producers across Canada.” Hoffort, a 25-year veteran of FCC, started his new role July 1. Planning for the position has been in the works for more than a year, and the seeds

ADVERTISEMENT

Canadian farm families are trying to improve their cost competitiveness and increase their profitability, but it is exceedingly difficult in the current regulatory environment. (iStock photo)

PMRA contradicts its own policy Federal Pest Management Regulatory Agency badly in need of major performance audit say farmers, industry SASKATOON — The FNA farmers’ business alliance, pushing for improved generic registration regulation with support from a large group of generic companies, has concluded that the Pest Management Regulatory Agency (PMRA), in addition to ignoring the federal government’s cost competitive agenda, is clearly not adhering to its own policy objective. In its own overview of Protection of Proprietary Interests in Pesticide Data in Canada (PPIP) policy, the PMRA states, “the PPIP policy aims to provide favourable conditions for generic pesticide producers to enter the pesticide market and to increase the selection of products available to the user.” It is unacceptable that the implementation of PPIP, and the PMRA’s management of that regulation, has veered so sharply in the opposite direction, and the fact that no improvements have been made after months of deliberation demonstrates a lack of willingness on their part to change course. Farmers find it puzzling that the PMRA continues to hand basic registrants the tools to delay generic registrations, add questionable studies to the compensable data list, and force payment of compensable data, even though the generic applicant may not proceed with

registration after arbitration. This gives basic registrants more protection than was intended by the minister when the regulations were implemented and discourages generic companies from operating in Canada, resulting in Canadian farmers having access to fewer, lower cost generic products. Furthermore, the responses by PMRA and CropLife that there have been numerous products registered since the implementation of PPIP is disingenuous. In response to farmer letters, the PMRA is touting 74 registrations from 2010 to present. The agency knows very well that only a fraction of those are actually true end use generic products that are available to farmers. Why would they deliberately try to deceive farmers into thinking anything else?

Canadian growers at a disadvantage All that’s being asked for is several simple solutions, while maintaining basic registrants’ exclusive period and their right to fair compensation for relevant data that is relied on when a registration proceeds. It is imperative that the PMRA gives generic companies their rightful place in the industry, creates favourable conditions for generic products to enter the market, and facilitates a process that gives

Canadian farmers an opportunity to be more cost competitive. PPIP was meant to do exactly that, but either the actual regulation, the management of that regulation, or both, have failed. Farmers have called on the Harper government to reaffirm their industry cost competitive goals with the PMRA and instruct them to conform with the government’s agenda. Otherwise the current situation will continue to discourage generic companies from introducing new generic products. Canada will maintain its distinction as the most difficult country in which to register generic crop protection products, denying Canadian farmers a whole new array of lower cost generic crop protection products. The following price comparisons of product prices in Canada versus the U.S. illustrate what is already happening. • Banvel II: about triple the price • Refine Extra: double the price • Folicur: almost six times the price • Tilt: triple the price • Select: more than triple the price And it’s getting worse. Several applications have, in fact, been aborted during the registration process, and many have not been started as a result of unclear rules, contradictions in the process and how the rules have been

interpreted and applied. One generic company recently decided not to proceed in Canada. Others have contemplated pulling out of the business of registering generic crop protection products in Canada entirely.

Toward a better system Generic companies have made some specific suggestions to create a system that reflects the PMRA’s own guiding principles, which call for an inclusive, transparent, predictable process, one that encourages the addition of generic options for farmers. The generic industry is not asking to reduce the initial registrant’s rights to the exclusive use period and their right to fair compensation for legitimate data relied upon by the generic applicant. With these still in place, the incentive for innovation will continue in Canada. What generic companies are asking for is regulation that facilitates and expedites the registration of generic products after the protection for basic registrants has expired. For Canadian farmers it’s about achieving a level playing field with their competitors. It’s about improving cost competitiveness through millions of dollars of cost savings. And, of course, it’s about profitability.

were planted when the recession of 2 0 0 8 c re at e d e c o n o m i c c ha o s around the world and undermined the financial system. He said his role as a risk officer extends beyond financial exposure to areas such as fraud and risk to FCC’s reputation. However, with loans outstanding of more than $25 billion in a traditionally volatile and unpredictable industry, assessing repayment risk is a major part of the mandate. Commodity price declines or interest rate increases would affect the ability of some customers to service their loans. “We really encourage our customers to protect themselves as best they can,” said Hoffort. “The most challenging thing that could happen in agriculture is the unexpected, significant change in conditions. A slow increase in interest rates that plays out over a number of years is one thing, but a rapid and significant increase is another.” Part of his job is to consider the possibilities of a change in interest rates, prices or market access and then calculate the potential impact on the FCC portfolio. The government has been relatively hands-off in recent years as the corporation grows and makes money, but a change in political direction is also a risk. He has been around long enough to remember the fallout from the 1980s government directive that FCC would be the lender of last resort during a period of high interest rates and a struggling grain industry facing low prices because of an international export subsidy war. The result was large annual losses for FCC until the government intervened with more than half a billion dollars in equity investment and a new political order to become more business-like and make money. “For the first three or four years I worked here, all I did was work with families in financial distress, so I have a lot of memories of those days,” he said. A quarter century later with a risk officer in place, such a government policy would face resistance. “My role would be to bring to the table the implications for FCC, our customers and taxpayers and we would be much more able to do that today than we would have been 25 years ago.” These days, FCC declares profits of more than half a billion dollars annually, which leads to some farmer complaints that the corporation should use its strong bottom line to offer clients better loan terms. “It’s an interesting discussion,” said Hoffort. “Really, that $514 million (last year’s profit) goes right back into agriculture. Those profits are necessary to go into our equity to make sure we are properly capitalized so that we can do what we need to do to grow and to stay strong to support the sector.”

OUTSTANDING LOANS ISSUED BY FARM CREDIT CANADA TOTAL

$25 billion


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

19

RESEARCH | ROTATIONS

Single year rotation allows diseases to take root: experts Disease residue | Ergot is on the rise because the fungus lives in the soil and takes time to decompose BY KAREN BRIERE REGINA BUREAU

INDIAN HEAD, Sask. — A single year between cereal rotations is not enough to combat disease, says plant pathologist Kelly Turkington. Farmers are losing that first line of defence as rotations become tighter, the Agriculture Canada scientist told a recent field day at the Indian Head Agricultural Research Foundation. “In the last five to 10 years, there’s been a dramatic shift in rotation to cereal-canola-cereal,” he said. “That’s not great.” That single year doesn’t allow enough time for disease residue to decompose, he added. “You need at least two full years of a non-host crop.” For example, ergot has been on the rise, and one possible reason might be that the short rotations are allowing the ergot fungus to live in soil either in fields or adjacent to fields. Ergot likes to live in grassy areas. The second line of defence is disease resistance, which works only if farmers grow varieties that are resistant to the disease that is occurring.

Researchers say many producers aren’t leaving a long enough rotation between cereal crops, leading to an increase in disease. | “We don’t have varieties that have a complete set of resistance, especially of leaf diseases,” Turkington said. Fungicide application is the third line of defence, particularly against leaf spot diseases in cereals. The top three leaves of barley and the top two leaves of wheat are the most important in terms of yield. Fungicide should be applied at flag leaf emergence to protect those

leaves and preserve yield, he said. Turkington said farmers like tank mixing fungicide and herbicide at an early stage because it reduces field, but research has shown this won’t protect those critical leaves. “Spraying at the two to three leaf stage is just protecting the green leaf you can see,” he said. Movement of the fungicide within a plant is limited, which is why the

leaves most important for grain filling should be sprayed. Turkington said there is more research interest in fungicide combinations that target two aspects of a disease life cycle for better control. This could also limit fungicide resistance. Randy Kutcher, a plant pathologist from the University of Saskatchewan, said crop rotation and disease-resis-

STC Parcel Express

PARCEL TO SHIP? SEND IT BY BUS. STC ships on weekends too!

CALL

1.800.663.7181 OR VISIT STCBUS.COM

FILE PHOTO

tant varieties are the two best tools against disease. He is researching fungicide use in wheat and canaryseed. Kutcher said stripe rust, which was a major concern a couple of years ago and then dropped off, is showing up again, particularly in Alberta. Thirty-one winter wheat fields surveyed found six infected fields and two severe cases.


20

NEWS

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

AG NOTES HOLSTEIN CANADA HIRES COMMUNICATIONS CO-ORDINATOR

GREENER GRASS |

Craig Kaartinen of Eriksdale, Man., builds a fence around a quarter section of hayland to pasture his cattle. He uses his hammer for spacing so that wires run perfectly parallel. | CHARLENE KAARTINEN PHOTO

ELECTRIC COMBINE HOPPER COVERS QALL COMPONENTS ARE EASILY REMOVED IN MINUTES. QBREAKDOWN OF TARP COMPONENTS FIT INSIDE OF GRAIN TANK. Q A 12DC MOTOR IS A STANDARD FEATURE ON ALL TARPAULINS. QLIGHTWEIGHT.



John Deere

New Holland

FORAGE INDUSTRY PRESENTS INNOVATION AWARD

î BUSHEL Case IH

NOT ON INYOURS TGHREOUND! D

HAN

ISTANT S E R H CRATC SHEETLE U.V. &ASN MARGARD DAB LEX RS OF DEPEN FOR YEA SERVICE.

SAVE UP TO

PER ACRE ON CANOLA ALONE

OR MORE

NEVER CLEAN YOUR FEEDER HOUSE AGAIN!

39” Extender Kits Available

Industries, Ltd. CALL FOR DETAILS ON MODELS AND YOUR LOCAL DEALER

306-366-2184

Jennifer Kyle is Holstein Canada’s new communications co-ordinator. She had previously been magazine and youth co-ordinator with Ontario Holstein and also spent three years in the marketing department at the Semex Alliance. Kyle, a graduate of Durham College’s public relations program, grew up as an active participant on her family’s purebred Holstein farm, Shylane Holsteins, near Stratford, Ont., before moving to her husband’s family’s Jersey, Holstein and Brown Swiss farm, Ash Lawn Farms Ltd., near Ayr, Ont. As communications co-ordinator, Kyle will be responsible for the association’s publication, Info Holstein, and will work on external and internal communications projects while maintaining Holstein Canada’s social media channels on Facebook and Twitter. Holstein Canada has also hired Maureen Balsillie as events co-ordinator. She will be responsible for organizing the association’s annual convention as well as its booth at the Royal Agricultural Winter Fair and the events and shows that Holstein Canada attends throughout the year to promote its services and programs.

P.O. BOX 119 ST. GREGOR, SASKATCHEWAN S0K 3X0

www.michels.ca sales@michels.ca

Michel Tremblay has received the Saskatchewan Forage Council’s 2013 Forage Industry Innovation Award. It recognizes exemplary innovation, leadership, service and stewardship in Saskatchewan’s forage industry. Tremblay began his career in 1990 working with the forage council as its variety testing program co-ordinator. Saskatchewan Agriculture hired him as its provincial forage specialist in 1992, where he remained until last year. While with the government, he headed up extension events, spearheaded industry projects and worked to create a link between government and industry-producers. He played a lead role in forming the Saskatchewan Forage Seed Development Commission and helped create the Canadian Forage and Grassland Association.

COMING EVENTS Aug. 8: Loiselle Family Organic Farm field day, Vonda, Sask. (Register, 855-521-2400, david.hobson@ organicalberta.org) Aug. 9-11: Pioneer Acres Museum show and reunion, Irricana, Alta. (403-9354357, www.pioneeracres.ab.ca) Aug. 24: Olde Tyme Harvest for Hunger, Langenburg, Sask. (Joelene Kotzer-Mitschke, 306-743-5408, oldetymeharvestforhunger@gmail. com, www.oldetymeharvest.com) Aug. 24-25: Strathcona Vintage Tractor Pull, Bremner Historical Site, Ardrossan, Alta. (Ellis, 780-9226120 or Mike, 780-467-6973, www. strathconavintageractor.com) Sept. 10-12: Canada’s Outdoor Farm Show, Canada’s Outdoor Park, Woodstock, Ont. (800563-5441, 519-822-2890, info@ outdoorfarmshow.com) For more coming events, see the Community Calendar, section 0300, in the Western Producer Classifieds.


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

FARMLIVING

21

RESCUING OLD FILM A company in Indian Head, Sask., opens a window into the past by processing dated movie and print film sent from around the world. | Page 25

FARM LIVING EDITOR: KAREN MORRISON | Ph: 306-665-3585 F: 306-934-2401 | E-MAIL: KAREN.MORRISON@PRODUCER.COM

HUMANITARIAN PROJECTS | AFRICA

Project gives rural Africa a voice Sauti Moja | Canadian charity helps rural African women improve health, living conditions BY WILLIAM DEKAY SASKATOON NEWSROOM

TOP TO BOTTOM: A Rendille widow is all smiles — she just gave birth to a baby and the same day, received a heifer camel from another single mother. Duane McCartney, retired livestock scientist from Agriculture Canada’s Lacombe Research Centre, tries his hand at milking camels while visiting the livestock work of Sauti Moja in northern Kenya. Sadia had to discontinue schooling due to pregnancy. A Canadian donor sponsored her return to school, and Sauti Moja staff provided child support and counselling. She recently graduated from secondary school near the top of the class. Young Rendille girls are trained in prevention of HIV/AIDS and STIs.

Retired agronomist Tim Wright speaks for the vulnerable in Africa. As executive director of the charity organization Sauti Moja, or One Voice, Wright focuses on program management, food and nutrition security and sustainable livelihoods in rural Africa. “There’s people who refer to Africa as a rusty bucket. I take great offence at that. One of my great frustrations is helping people understand that with just a small contribution, they can make such tremendous differences in people’s lives,” he said. “We’re dealing with people who are invisible to even people in their own community, almost. We’re working with them and seeing incredible transformation in their lives.” Sauti Moja links donors to community initiatives that include education of vulnerable girls and children, HIV/AIDS prevention and providing livestock to widows and single mothers. Sauti Moja is about empowering the most vulnerable and is focused on improving economic and social goals and self-sufficiency. While in Canada this summer, Wright and wife Lyn Bishop call Winnipeg home and rent out their farmland at Nut Mountain, Sask. Much of their time is spent with fundraising and crisscrossing the country to visit donors such as the Canadian Foodgrains Bank. “We have agencies that provide small amounts of money, but the majority of money comes from individual donors. It’s kind of word of mouth marketing,” he said. The former agrologist worked as a research scientist with Agriculture Canada as director of the research station in Melfort, Sask., as well as work for the PFRA. He said Africa’s droughts are worsening, particularly in the marginalized areas. Hardest hit by a spiralling environment and increasingly intolerant larger society are the livestock keepers or nomads of East Africa. Droughts frequently devastate these

Agronomist Tim Wright is executive director of Sauti Moja, a charity helping at-risk people in Africa. | TIM WRIGHT PHOTOS communities, killing large numbers of the livestock that they depend on for milk, blood, hides and meat. “They are often very ostracized or oppressed. Within these communities the most vulnerable are people who do not have livestock and women, widows because it’s fairly patriarchal. These are the people we focus on,” he said. Wright said women can often spend five hours each day carrying a 20 litre jerry can of water on their back.

“It’s exhausting,” he said. “A girl child has to stay home from school to care for the baby. It’s really quite a complex and difficult situation that the women are in,” he said. Sauti Moja has helped provide widows and abandoned women with donkeys. “They are able then to help other people rather than being beggars or relying on others,” he said. “Historically most food agencies think of food security as crop pro-

Enter to WIN your spot on the 2013

YOU COULD

BE HERE! BROUGHT TO YOU BY

ENTER ONLINE www.producer.com/contest/

duction … but more and more they’re seeing that hardy livestock in these very arid environments is the only thing that’s really viable.” Sauti Moja also works with young girls that have been shunned because they became pregnant, often through sexual exploitation. The charity also responds to HIV/ AIDS challenges. Hardest hit is Tanzania, where up to 80 percent of the population is infected. More than a million children have been orphaned.

Two lucky farmers and each of their guests will receive: • Free admission to Canada’s Outdoor Farm Show on September 10, 11 and 12, 2013 • Roundtrip airfare to London, Kitchener or Hamilton, Ontario from their nearest major airport in Western Canada • Shuttle service to and from the Ontario airport • 4 nights accommodations at one of COFS’s selected partner hotels in Woodstock • Meal allowance of $50 per day per guest • VIP golf carts for the duration of the 3-day show • Shuttle service to and from the show each day


22

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FARM LIVING

HEAVY HORSES | BRABANTS

SKIN PROBLEMS | CAUSES

Small but sturdy wins day

Allergies can irritate skin HEALTH CLINIC

CLARE ROWSON, MD

Q:

Original Belgians | Couple uses Brabants for farm chores and to compete in pulling competitions

ABOVE, LEFT: Cattle are used to seeing Brabant draft team King and Queen in the pasture. Wayne Nagy and his wife, Lorna, often take them out for a drive on their ranch north of Melville, Sask. |

STORIES BY KAREN BRIERE REGINA BUREAU

MELVILLE, Sask. — King and Queen might bear royal names, but they don’t get to rest on their laurels. The pair of red roan Brabant draft horses work regularly on Wayne and Lorna Nagy’s Diamond Horseshoe Ranch north of Melville, as do the other heavy horses in the stable. However, this pair holds a special place in the household. They are the 2012 Canadian Western Agribition heavyweight division winners in the horse pull competition. As well, they placed second at the 2010 Calgary Stampede as middleweights. They are also special because few teamsters use Brabants. The breed is considered the original Belgian and is smaller and sturdier than the typical North American-bred Belgian. It has thick legs and is usually red or blue roan. The Nagys also raise chickens, milk a cow and work with horses on the farm. However, the operation is also firmly into modern times with 350 Black Angus cross cows and 1,800 acres of cropland. Wayne built it from scratch. He grew up not far from his farm, which he bought in 1984. Much of his family is still in the area. “There was one old run down barn and a small house,” he said. “No paint on anything.” The yard is not recognizable from those days, with a larger house, two barns, corrals and other buildings. The first draft horses arrived about nine years ago after a sale at a pregnant mare’s urine barn netted six colts. “Dad always had a team,” Wayne said, and he had always driven his saddle horses. Both he and Lorna grew up riding horses and they both have draft horse teams now. There are five teams on the farm, including some Belgians. “I just chore with mine,” said Lorna. “I feed round bales, clean the barn.” The couple makes sure their teams are fed good quality feed and vitamins and that the horses work every day or every second day to stay in shape. Horses can pull for decades as long as they are in good condition. However, the Nagys are looking ahead to when they might have to replace their Brabants and are seeking a stud to breed Queen.

KAREN BRIERE PHOTOS

BELOW: King and Queen won the heavyweight division in the horse pull competition at Regina’s Canadian Western Agribition last year. | FILE PHOTO

HORSE PULLS | COMPETITION

Teamwork leads to winner’s circle MELVILLE, Sask. — Wayne Nagy was bitten by the horse pull bug after winning first place at a Qu’Appelle Valley Horse Pull Club harvest day near Vibank, Sask., six years ago. He is now a member of the club and participates in pulls throughout the summer. The Calgary Stampede is definitely a highlight, Wayne said. His wife Lorna’s son, David, who farms with them, also attended the Stampede a couple of years ago with a team. Horses have distinct personalities and that can affect how they pull. Lorna said some horses don’t like a

crowd and won’t perform well. Sometimes one of the pair will figure out exactly how far to pull the weight and quit at a certain point. The standard required distance is 4.26 metres. They’ve found that teams usually try hardest in the first round. “King and Queen will pull hard every time,” Wayne said. He said teaching a team to start exactly together, each time, is tricky yet critical, particularly at higher weights. A mistake might not be as costly at the lower weights, he added. “If you watch, the winning ones are exactly in sync or in stride,” he said.

Different ground conditions will also affect how much the horses can pull. That’s why at certain places, the teams will pull more or less than they have elsewhere. “It gets to be a curling game.” He said it might look easy watching from the sidelines, but there are teamsters who have had their horses at pulls for decades who are still learning. It’s also a highly competitive arena. “As soon as you win one, they’re gunning for you,” he said. Big money is involved in the United States, Wayne said, with horses selling for $80,000 to $100,000.

For the past few months, I have experienced one inflammatory skin infection after another on my foot and arm. The skin area swells, blisters and breaks open. The doctor prescribes antibiotics and is unsure if it’s an infection or an allergic reaction. The antibiotics work for a while but a topical ointment did not help. I worry it could be something more sinister as I do have a history of testicular and skin cancer.

A:

It is understandable that you worry about cancer when you have a history of previous cancers. Fortunately, both testicular and most types of skin cancer, with the exception of melanoma, have a good prognosis. It is difficult to guess at a cause without actually seeing your skin rash, but the type of blisters you describe can be found in a condition known as dermatitis herpetiformis. This is sometimes referred to as gluten rash or celiac disease rash because it occurs in conjunction with gluten intolerance. Most sufferers complain of terrible itching. The rash can occur anywhere on your body, but the most frequent locations are where pressure occurs, like the elbows, knees, buttocks, lower back and the back of the neck. A simple way to determine if gluten sensitivity is the problem is to eliminate all wheat and barley products, including yeasts, beers and malt flavouring, for about six weeks and see if there is any improvement. It should clear up without the need for creams, ointments and antibiotics. Urticaria is another possibility. This is like a typical nettle rash commonly called hives and is mainly due to allergic reaction when the body releases histamine. Hives are red welts that may vary in size. They are usually caused by an allergic reaction when the body reacts by releasing histamine and other chemicals into the skin. It may be a response to certain foods, medications, sudden changes in temperature or insect bites. Most cases last for less than six weeks. However, if the rash lasts longer, it is known as chronic hives, which account for one-third of all cases. At this point, the doctor may wish to test for an underlying condition such as thyroid disease, hepatitis, viral, fungal or bacterial infections or even some types of cancer. The cancers most likely to be associated with hives are the lymphomas rather than the testicular and skin cancers. Each type of cancer is a separate condition with its own set of problems and patterns of spread. There are also rare skin diseases such as bullous pemphigoid that involve severe blistering. You may wish to be referred to a dermatologist.

Clare Rowson is a retired medical doctor in Belleville, Ont. Contact: health@producer.com.


FARM LIVING

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

23

EMPLOYMENT | PREPARATION

Advice on getting job SPEAKING OF LIFE

JACKLIN ANDREWS, BA, MSW

Spend the day job hunting but make time for yourself and family in the evening

Q:

I have to get a job. All my life I have been on the farm, fi rst as a child growing up and later as the wife of a farmer. Our divorce marked the first time I had left the farm to live in town. My children and I have settled into a house and we are quite happy, but the financial settlement my former husband and I negotiated is not going to last much longer. I am 34 and have never had a fulltime job. I need to figure out how I am going to approach this thing. What do you think? Do you have some tips?

A:

You need to understand that looking for work can be psychologically and emotionally damaging. Going to interviews or even applying for jobs carry the probability of being rejected. The paradox is that at a time when you need more self-confidence than you have ever had, you are at risk of failing and falling into some selfdeprecating, negative self-concepts. Be careful not to get discouraged. Employers are more inclined to hire someone with a bright outlook than someone who is discouraged and depressed. Before you get into the business of finding work, make sure that you have a support network. Make seeking employment your job until you are working. Set times in your day when you do nothing except write resumes, search newspapers and websites for employment opportunities, send in job applications to potential employers, make a list of character references, put together an outfit for interviews and do what you can to get your finances in order. Getting a job takes time and effort and is most likely to happen when you take your job search seriously. Most jobs ask you to follow some kind of a routine. You have to be at work on time, take breaks as allowed and meet various deadlines for job performance records. You can prepare yourself by putting routines into your day at home. Make sure that you and the children are at the breakfast table at the same time every day and that you have something scheduled for a defined time each morning. Remember that you are your best advertising tool. Any number of people get jobs just by being in the right place at the right time, by having a chance meeting with a potential employer or by tripping over someone in the grocery store.

Jacklin Andrews is a family counsellor from Saskatchewan. Contact: jandrews@ producer.com.

B.C. GARDEN | FRIENDSHIP

Bond with friend grows with stroll through her garden Garden plants, art | Yard serves as peaceful oasis Tending to a friend’s garden gives you the opportunity to appreciate her favourite things, understand her enjoyment and bring you closer together.

STORY AND PHOTOS BY SHELLEY A. LEEDAHL FREELANCE WRITER

D

o you need to be a gardener to appreciate a garden? I think so. I can understand and trust someone who spends hours on a little stool, tweezing miniscule weeds from around the pea plants, happy with the task. Who else could rationalize the loonie-sized blisters from weeding, and the lunacy of promising — only 500 more dandelions, then I’ll stop? There are back pains, garter snakes and slugs as big as your thumb. There is dirt, mud, bad weather and sometimes blood. There’s the knowing that you’ll never catch up in your lifetime, the understanding that no one would even notice your grand efforts and the calm realization that it does not matter. I’m on the Sunshine Coast caring for a friend’s acreage: 3.5 acres of pristine park, with numerous gardens, old growth Douglas Fir and two ponds, one with a bridge, waterfall and a Herculean frog. There are fruit trees, great shoots of bamboo and several plants my prairie tongue cannot name. I liberally water the new grass as if its proliferation will prove my good caretaking. I have planted leeks and picked and frozen rhubarb. I’ve stirred the compost with a pitchfork and covered it with wire to keep pets and wilder predators out. I water the delicate new sweet peas with sun-warmed water and spray the kale with one of the many

hoses that twist away from a central tap in multiple directions. I’ve long been enamoured with gardens, including my own. I also love to be walked around friends’ gardens and discover what they’ve planted and why. I’m learning that if you want to know someone, you should work in her garden. I have spent more than two weeks here, and although the friend that I’m acreage-sitting for is in far-away Maui, I’ve never felt closer to her. Now I see what she sees at dusk when the frogs start singing and she’s compelled to return to the vegetable garden to be sure she closed the gate or watered the garlic. I think of her as I stop to watch the cacophonous ravens play tag and spy on the parental robins, guarding their nest in the gazebo. Now I know what it is to hear the wind rush through bamboo and think there’s a ghost standing by. When I open the patio doors in the morning to give Jake the dog a warm pat, I smell the moist, florid air, as my friend must. To tend a friend’s garden is to form a bond. The earliest gardens were planted for food and medicine, and many of us still take great pride in how the

work of our hands facilitates settlerlike self-sufficiency. For me, a garden’s sensorial pleasures are paramount. I read and write while inhaling the soporific scent of lilacs in a mason jar. I stare at the sky through a crosshatch of branches. Being among these wondrous gardens and animals — Jake and Percy, the cat who swipes with hummingbird quickness — I am slowing to the poet’s pace. I am also pondering garden decoration. Yard art connotes gnomes and flamingos, plastic whirlygigs and department store specials, but I’m contemplating tasteful additions, made art, found art and meaningful gifts from friends. I believe there is a place for wellconsidered and well-situated yard art. Moderation is key. Sometimes garden art expresses personal beliefs. It can commemorate people, places or events. I know folks who place stones or shells from their travels around their gardens. There are memorials.

Yard decoration can certainly be store bought, but can also be an old iron bed frame or a wheelbarrow spilling with flowers. I imagine prairie pioneers found innovative ways to brighten their lives after they’d cleared the land, got the potatoes in the ground, built the sod hut and fed the babies, even if this was accomplished merely by stuffing a handful of black-eyed susans into a rusted tobacco can. This afternoon, I strolled about my friend’s gently hilled and generously treed acreage with a camera, snapping art that caught my eye from painted stones inspired by aliens to the simplicity of a single green rock set on a log bench. Items are underplayed, so each discovery brings surprise and delight. In this postcard perfect landscape, I find art camouflaged beneath hostas and balanced on stones. There are elegant bronze birds, smiling buddhas and turtles I half expect to blink. Each time I step into the garden, I see something new and feel richer.


24

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FARM LIVING

LEFT: Calvin Russell reduces costs on the farm near Drumheller, Alta., by using older equipment and making repairs himself. ABOVE: Calvin and Cassandra Russell took over the farm’s management from Calvin’s parents three years ago. Along with their children, Emilia, 4, Elyse, 3, and Everly, 1, they reside in the house where Calvin grew up. ON THE FARM | YOUNG FARMERS

New generation at the helm of family farm Returning home | Young family believes crop diversity will help ensure the future of 103-year-old family farm BY KAREN MORRISON SASKATOON NEWSROOM

DRUMHELLER, Alta. — For Cassandra and Calvin Russell, choosing a vacation is easier than swatting a mosquito on their farm near

Alberta’s badlands. That’s because Calvin’s parents, Craig and Janice, have properties in Manitoba and British Columbia and at a central Alberta lake. After farming for 46 years, the elder Russells let go of the management

Please join us

reins to Cassandra, 23, and Calvin, 30, three years ago. Craig and Janice moved to a new house in the district and continue to help seed and harvest the 3,500 acres of wheat, canola, peas, flax and barley. “Dad is a great resource person,”

You are cordially invited to attend a CUSTOMER APPRECIATION BREAKFAST to help us celebrate 90 years in business. After all, we wouldn’t be here without you. We’ll also celebrate throughout the year at farm shows near you.

WHAT: A pancake and sausage breakfast. WHEN: Wednesday, Sept. 4 from 7 to 10 a.m. PLACE: The front lawn

of The Western Producer, 2310 Millar Avenue, Saskatoon.

COST: Free with any cash donation to 4-H.

The Western Producer is a proud supporter of 4-H in Canada

said Calvin, whose business plan involves gradually paying back his parents for the farm he now rents from them, keeping costs in check with slightly used equipment and fixing machines himself. “It doesn’t matter whether it’s new or old, all will break down,” he said. Calvin grew up in the farm home he is currently renovating for his wife and their three preschoolers. He spent a decade off the farm working on natural gas engines in Drumheller, where he met Cassandra. “Dad wanted me to get experience,” he said. His sisters, Laura and Jill, pursued careers in Westlock, Alta., and Pilot Mount, Man. Cassandra was an only child who grew up in town but has adapted to rural life. She considers herself fortunate to live and work on the farm, founded by Craig’s mother’s family after migrating here from Ontario. She looks forward to welcoming another child by Christmas and homeschooling in the future. “I just want to be more in control of what they learn,” she said. It will also allow the family more opportunities to get away, she added. Farming allows Calvin to be his own boss and experience a wide variety of tasks. “Every day is different. There’s a brand new challenge every day,” he said. Planting and watching a crop grow is particularly satisfying, the couple agrees. Crops are in good shape this year, despite a storm that dumped 125 millimetres of rain in 24 hours. Oil and gas leases, so common in the area, are another challenge for crops. Calvin said yields are poorer above where pipelines are buried because heat from the pipes dries out plants. He is concerned about the amount of agricultural land owned by energy firms. “I hope I don’t have to be a serf farmer down the road, renting from them,” he said. The Russells believe that continuous cropping benefits their farm and environment by minimizing soil disturbance. They also believe in crop diversity and growing shelterbelts to

capture snow and slow erosion. “I’m not farming for me but trying to farm for future generations,” Calvin said, noting both he and his parents also enjoyed preserving habitat for wildlife. “We want to take care of the earth that you farm, not take all the nutrients out of it,” added Cassandra, who manages the books and helps when needed. That includes planting canola and peas together to control weeds and generate organic matter. “It’s more work, but it will pay off down the road. Overall, it’s more beneficial,” said Calvin, who swaths these crops and uses a seed cleaner to separate them. The Russell family was recognized this year for its contribution to agriculture in Alberta with the Bank of Montreal Farm Family award, presented at the Calgary Stampede. Cassandra called it a positive boost for the 103-year-old family farm. “That made me feel good about what I was doing,” added Calvin. For the future, the Russells can see enlarging the acreage slightly and involving their children. It’s the baby who enjoys riding in the tractor the most, while the oldest prefers the cows raised for the family’s use. Farm safety is paramount for the Russells, who set clear boundaries in the yard to keep their girls out of harm’s way. “We stay away from where Calvin’s working,” said Cassandra.

Emilia prefers the farm’s animals over its equipment. | KAREN MORRISON PHOTOS


FARM LIVING

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

25

HISTORY | FILM PROCESSING

Film company enjoys bringing history to life LEFT: Greg Miller, owner of Film Rescue International in Indian Head, Sask., houses movie processing equipment in the vault of an historic bank building. | KAREN MORRISON PHOTO FAR LEFT: The company specializes in exposed still and movie film that dates back many decades. | FILM RESCUE

Lost and forgotten | Movie and print film yields surprises BY KAREN MORRISON SASKATOON NEWSROOM

INDIAN HEAD, Sask. — Greg Miller never tires of looking at old photos. It’s his business at Film Rescue International, but it’s also a passion that started in childhood with the purchase of a Rollei SL 35 camera. “You never get bored with it,” he said. “I never get up in the morning and say, ‘oh, I have to work.’ ” From his home and office in a onetime bank building in Indian Head, Miller specializes in the cold cases: exposed still and movie film that dates back decades and requires a special process to bring to light. But there are limitations, said Miller’s wife, Tracey Gostick, who handles the company’s administration, customer service, shipping and receiving and accounting duties. “A stumbling block is dealing with people who don’t realize 40-year-old film won’t come out as two-year-old film,” she said. Miller honed his skills through jobs in which he processed and developed motion picture and still film. “He’s our mad chemist,” said Gostick. The couple came to Saskatchewan in 1999 to be closer to Miller’s parents, who live in Wolseley, Sask., and to take advantage of real estate that was considerably cheaper than their former home in Toronto. “Opportunities for creative things in a small town are way better,” said Miller, who performs with a local band and is active in the local theatre. “It doesn’t matter where you are: the nice thing about the business is you don’t have to be in a large urban centre,” said Miller, citing the company’s satellite offices for receiving materials in Holland and the United States. Processing and printing take place where tellers once stood and spills into a basement that includes a darkroom and plethora of processing equipment, computers and projectors. Technician Cory Rennebohm, one of eight workers drawn from the region, adjusts the contrast and lightens tones of a film depicting a family’s summer vacation in the 1960s. “You see how much you have in common with people around the world. It drives home the commonalities with people rather than the differences,” he said of the work. “It gives people a little bit of their family history.” Rennebohm said the images have inspired him to travel to these spots and see how they have changed. He trained in film studies but worked in health care until landing this position five years ago. Many of the images he has viewed have been pleasant, such as family gatherings, the Apollo 11 launch, nudes and tours of Russia. However, there is also a darker side, including footage shot in Vietnam

INTERNATIONAL PHOTO

from a helicopter as a village is fired upon. “It makes the hair stand up on the back of neck,” he said. “It has coloured how I look at the world. Gostick echoed similar sentiments. “It gives you an unhappy feeling.” She and Miller say their work

comes from people around the world and ranges from celebrity families of Sammy Davis Jr., George Harrison and Lyndon B. Johnson seeking long lost images to police departments looking for evidence of child pornography and other crimes. Miller marvelled at footage from

It’s Simple, Sign 100 Tonnes OR GREATER to 2013-14 CWB pool or cash contracts for a chance to win one of two John Deere Gators.

To learn more, go to cwb.ca/gator FOR MORE FARM LIVING, SEE PAGE 30

1950s Yukon, where “every frame was incredible,” a child’s open casket funeral, a mother and child looking out a window and a 1910 formal portrait of an aboriginal family. The company works in six week cycles on film that might be decades past its best before date. Approxi-

mate costs are $36 to develop 36 print exposures, although they are waived if nothing can be saved, and $48 for movies. The latest enterprise is creating digital archives of families’ images so that they can be preserved, easily shared and reprinted.


26

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

S S A L G O T N I GRA

BE A PART OF THE ADVENTURE! Invest in the Olds College Teaching Brewery In September 2013, Olds College will launch the first brewing training program in western Canada. The program is an intensive twoyear diploma that teaches brewing, technical, sensory, analytical, business, sales, and marketing skills. The program curriculum is designed to integrate theory with hands-on practice, and includes on-campus and on-site practical applications as core components of the program. Students gain experience and knowledge of brewing and brewery business strategies using an extensive array

of state of the art resources, equipment, These partnerships may include: and facilities. Q Cash Sponsorship Q Naming Opportunities Olds College has made a significant Q Gift in Kind donations for Brewery needs investment in the construction of this Q Use of our facilities at the College facility. Specialized brewing equipment, including Analytic Lab Services and classrooms and laboratories are being Pilot Brewery purchased and built. Q Industry Advisory panel participation Olds College is interested in exploring Q Other creative ideas will be explored collaborative, mutually beneficial and considered partnerships. Q Ongoing industry related professional Development Opportunities

To discuss opportunities with Olds College, please contact: Aaron Everingham Senior Development Officer aeveringham@oldscollege.ca 403-507-7714 or 1-800-661-6537

Karla Petersen Senior Development Officer kpetersen@oldscollege.ca 403-507-7721 or 1-800-661-6537

www.oldscollege.ca


ADVERTISING FEATURE

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

27

GRAND OPENING MOOSE JAW, SK.

With Saskatchewan’s booming economy, a common saying here is that in Saskatchewan there are two seasons: Winter and Construction. At Agrocorp Processing, we are adding the finishing touches as our facility nears completion. Agrocorp is preparing for the new crop season with anticipation and excitement. Our grand opening is on Friday, August 16, and we would like to extend an invitation to come and join us at the plant.  Contact our Moose Jaw office if you will be in the area and we will throw a hamburger on the grill for you! AGROCORP PROCESSING:

Agrocorp International Pte Ltd. is pleased to announce the expansion of its Canadian operations, with the creation of Agrocorp Processing Ltd., a high-speed loading and cleaning facility in Moose Jaw, Saskatchewan (SK). Built along a Canadian National Railway (CN) site capable of loading 100 cars, the facility will ultimately have the capacity to handle 250,000 metric tonnes (MT) of diverse products ranging from specialty crops to canola and wheat, as well as a processing capacity in excess of 100MT/hour and loading capacity of 400MT/hour. “With a realization that grain logistics are the key to success in this business, we have worked closely with CN Rail to identify a site suited to our aggressive program scope,� said Colin Topham, head of Agrocorp’s Canadian operations. “This venture intends to bridge

the producer-to-consumer equation in grain handling and vastly improve the marketing of Canadian crops. Our aim is to meet the diverse needs of the modern farmer by bringing crops to market as quickly as possible while maintaining a strong Canadian quality brand.� Agrocorp has recruited management and personnel with strong industry experience and connections, and are pleased to welcome Colin Young on board as Plant Manager. Young brings with him 12 years of experience in grain export management as an owner at R Young Seeds. Agrocorp has also teamed up with McDougall Acres, a Moose Jaw-based seed supply company, to add depth to their knowledge of local processes and industry. “We are excited to combine McDougall Acres’ 95 years of farming history and 10 years of seed marketing experience in the Moose Jaw community and abroad, with Agrocorp’s more than 30

years of experience in international marketing and finance expertise,� said Vijay Iyengar, Founder and Managing Director of Agrocorp International Pte Ltd. In addition, Agrocorp is pleased to announce Kevin Price who will be joining us as Senior Trader effective August 26th 2013. Kevin comes with many years of experience in the grain industry, most recently as Senior Manager at Mitsui Canada. He has previously worked with many of the Agrocorp International Canada staff, and we look

forward to adding his knowledge and experience to our growing team. ABOUT US:

Agrocorp International is a wholly owned subsidiary of Agrocorp International Pte Ltd. out of Singapore, one of the largest pulse trading houses in the world. Bringing forth a team of diverse culture and experience, Agrocorp International is poised to become an industry leader and innovator in the trade of Canadian agricultural com-

modities. With extensive experience in international trade, our team will be looking to grow an already well established network of producers, processors, buyers and brokers. Our trade professionals are geared to pro-actively deal with policy and trade issues and use them to our competitive advantage. Our market intelligence is a function of our membership and involvement in various trade body networks. Large trade volumes are swiftly handled on a consistent basis by our team of effective CONTINUED ON PAGE 28

Our Products

:HZRXOGOLNHWRWKDQNRXUSDUWQHUVDQGDOORIRXUSURGXFHUVZKRKDYHPRYHGSURGXFW WKURXJKRXUVLWHGXULQJWKLVFRQVWUXFWLRQSKDVH:HZLOOFRQWLQXHWRZRUNKDUGWREULQJ\RX FRPSHWLWLYHSULFHVJRRGGHOLYHU\WHUPVVWUDLJKWIRUZDUGDQGWUDQVSDUHQWFRQWUDFWV:HORRN IRUZDUGWRHDUQLQJ\RXUEXVLQHVVGXULQJWKHQHZFURS*R5LGHUV AGROCORP PROCESSING PLANT LAUNCH

Beans

Canary Seed

Canola

Chickpeas

Flax

Lentils

Wheat

Mustard Seed

Oats

Peas

2XUJUDQGRSHQLQJGDWHLV$XJXVWWK:HDUHH[FLWHGWRVKDUHQHZVRI VRPHVSHFLDOJXHVWVZKRZLOOEHDWWHQGLQJ *XHVWRIKRQRXU+RQRXUDEOH/\OH6WHZDUW0LQLVWHURI6DVNDWFKHZDQ$JULFXOWXUH $ODQQD.RFK'HSXW\0LQLVWHURI6DVNDWFKHZDQ$JULFXOWXUH 1LWKL*RYLQGDVDP\$VVRFLDWH'HSXW\0LQLVWHURI6DVNDWFKHZDQ$JULFXOWXUH :DUUHQ0LFKHOVRQ0/$IRU0RRVH-DZ1RUWK

Event Location: 1402 Caribou East Street, Moose Jaw 11:30AM 11:45AM 12:00PM 12:15PM 2:00PM

– – – – –

Ribbon Cutting / Introductory speeches Speech by Honorable Minister Stewart Warren Michelson mass grace BBQ Agrocorp Giveaways

If you have not already done so, please RSVP to sunny@agrocorp.ca Thank you for your continued interest in our project and we hope to see you there! Moose Jaw, SK Office: 1402 Caribou Street East Moose Jaw, SK Canada S6H 4P8 Tel: 306 693 8887 Email: teammj@agrocorp.ca

Vancouver, BC Office: 201-209 Carrall Street Vancouver, BC Canada V6B 2J2 Tel: 604 681 8675 Email: team@agrocorp.ca

www.facebook.com/Agrocorp www.agrocorp.ca

We work closely with our co-workers, suppliers, customers, and business partners around the world to realize our shared goals. We encourage open communication as well as sharing of expertise, knowledge, and ideas. Our strategically placed processing plant in Moose Jaw will have direct access to main production areas throughout Canada, through facilities and growers, whom we have formed strong alliances with. We ship both in containers, and in break bulk. Globally, Agrocorp handles volumes of more than 3 million metric tonnes. Long term partnerships are at the core of Agrocorp International’s mission.

Soybeans

We Trade with Trust


28

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

ADVERTISING FEATURE

GRAND OPENING MOOSE JAW, SK. trade specialists and stands as a testimony to the  logistical prowess and credibility of Agrocorp. Agrocorp is focused on building our sourcing and distribution infrastructure by rapidly expanding our logistical networks and cementing customer relationships; consolidating growth in established and emerging market regions. With a global turnover of more than US$1 billion dollars, Agrocorp’s extensive procurement network is geared to bulk purchases and shipments while ensuring quality and competitive pricing. We are globally well recognized experts in counter-trade and barter mechanisms, ensuring innovative solutions to financing problems. Now including Moose Jaw, Agrocorp also has offices situated in Abidjan, Chennai, Cotonou, Dar es Salaam, Istanbul, Jakarta, Kolkata, Mandalay, Melbourne, Moscow, Mumbai, Singapore, Vancouver, Yangon. PRODUCTS:

Pulses, legumes and cereals are becoming a regular a staple to the modern household and growing in demand; especially coupled with population growth and globalization. Agrocorp strives to meet the growing need for these products, all the while, maintaining an excellence in quality. We believe strongly in the products we trade, their nutritional benefits, and their role in making the world a healthier place. Agrocorp International specializes in the export of Canadian crops such as cereals, oil seeds and specialty crops.

Quality You Can Measure. Design and installation of scales and weighing systems. •Data Collection Systems •Truck Scales •Bulk Weighers •Service •Legal for Trade Inspections •Fertilizer Batching Systems

Although these products are the bulk of our business, we are not limited on growth potential in other areas. Agrocorp believes that willingness to grow and diversify our product knowledge will create opportunities for present and new partnerships. As global promoters and advocates of Canadian commodities, we are active members of the Canadian Special Crops Association, Alberta Pulse Growers, Saskatchewan Pulse Growers, Saskatchewan Trade and Export Partnership and are licensed and bonded by the Canadian Grain Commission. VISION

Long term partnerships are at the core of Agrocorp International’s mission. We pride ourselves in conducting business with honesty and integrity. In order to institute an effective supply chain with the highest quality of end product, it is our duty to bridge and link the gap between producers and consumer. We see ourselves as a competitive and reliable partner for companies in the agricultural sector. This perspective is fueled by our belief in sharing knowledge and expertise that empowers everyone in the global trade community; ultimately benefiting and providing total solutions to customers. STRATEGY

■ Agrocorp’s relationships with growers and focus on unique niche markets allow us to have greater control CONTINUED ON PAGE 29 on purchase,

Benson Trithardt Noren

PAICE CONSTRUCTION GENERAL CONTRACTORS BOB NELSON 306.631.1871

CHARTERED ACCOUNTANTS

TERRY PAICE 306.631.1736 Box 1992 Moose Jaw SK S6H 7N7 600 Fairford Street West

paiceconstruction@sasktel.net

306.693.9344

1673 Dugald Rd, Winnipeg, MB 204-661-6482 superiortech.com

514 Fairford Street West Moose Jaw, Sk S6H 1W3 protec.electric@sasktel.net

Congratulations to Agrocorp International on opening your new processing facility in Moose Jaw. We are proud to do business with you. To start a conversation with an agriculture specialist today, visit rbcroyalbank.com/agriculture or call 1-800 ROYAL® 2-0.

® / ™ Trademark(s) of Royal Bank of Canada. RBC and Royal Bank are registered trademarks of Royal Bank of Canada.

Congratulations Agrocorp

Congratulations Agrocorp on a project well done!

84224 (08/2013)

144 Ominica St. W, Moose Jaw, Sk S6H 1X2 Tel: (306) 693-0656 • Fax: (306) 692-3930

www.btnca.ca

on your upcoming Grand Opening. LMC is a Proud Supplier for all Seed Cleaning and Packaging Needs. Call us at

1-800-667-6924


ADVERTISING FEATURE

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

handling, and sale of food products; delivering consistent quality to customers. ■ Through combining market knowledge with financial resources, we are uniquely exposed to opportunities for all agricultural products in countries of operation ■ Agro cor p is able to advis e on seasonal price changes and fluctuations in supply and demand. We are proficient in establishing costs against future sales or purchase commitments; providing attractive value to clients ■ Our partnerships in procurement, logistics, banking, finance and trade enables us to follow a risk adverse approach through quick deliveries and has inspired all-round confidence; both within and beyond the company.

We would like to take a moment and thank our partners and all of our producers who have moved product through our site during this construction phase. We will continue to work hard to bring you competitive prices, good delivery terms, straightforward, and transparent contracts. We look forward to earning your business during the new crop year!  Go Riders!

Congratulations to Agrocorp on the grand opening of your new facility. Flaman is proud to be a part of the project.

We offer bucket elevators and drag conveyors to fit the needs of every producer and processing plant, from 100 to 30,000 BPH.

We’ll help you get your business cooking.

29

PLANT LAUNCH

Our grand opening date is August 16th. We are excited to share news of some special guests who will be attending: ■ Guest of honour Honourable Lyle Stewart, Minister of Saskatchewan Agriculture. ■ Alanna Koch, Deputy Minister of Saskatchewan Agriculture. ■ Nithi Govindasamy, Associate Deputy Minister of Saskatchewan Agriculture. ■ Warren Michelson, MLA for Moose Jaw North. 11:30AM Ribbon Cutting / Introductory speeches 11:45AM Speech by Honorable Minister Stewart 12:00PM Warren Michelson mass grace  12:15PM BBQ 2:00PM Agrocorp Giveaways If you have not already done so, please RSVP to sunny@agrocorp.ca Moose Jaw, SK Office: 1402 Caribou Street East Moose Jaw, SK Canada S6H 4P8 Tel: 306 693 8887 Email: teammj@agrocorp.ca www.facebook.com/Agrocorp www.agrocorp.ca Event Location: 1402 Caribou East Street, Moose Jaw Thank you for your continued interest in our project and we hope to see you there!

SMALL ADS,

BIG

Risk Management Deep Industry Knowledge Loan Syndication Trade Finance

RESULTS The Western Producer Congratulates

Rabobank. The financial link in the global food chain.™ Leasing

Asset Securitization

Financial Expertise

on their Grand Opening August 16, 2013!

Call our team to place your ad

1-800-667-7770

1-888-435-2626

From Start to Finish, We’ve Got it Handled

www.flamangraincleaning.com

United States – 212.916.7800 cbd@rabobankamerica.com Canada – 647.258.2020 fm.ca.toronto.contactus@rabobank.com

Congratulates

PACIFIC NORTHWEST

On the Opening of their New Plant

SHIP & CARGO SERVICES sĂŶĐŽƵǀĞƌ͕ĂŶĂĚĂ

Congratulations

ƚŽŐƌŽĐŽƌƉ ŽŶƚŚĞŽƉĞŶŝŶŐŽĨƚŚĞŶĞǁƉƌŽĐĞƐƐŝŶŐƉůĂŶƚ͘ tĞĂƌĞůŽŽŬŝŶŐĨŽƌǁĂƌĚƚŽǁŽƌŬŝŶŐǁŝƚŚLJŽƵ ŝŶƚŚĞĨƵƚƵƌĞ͘ ŵĂŝů͗ƉŶǁΛƉŶǁƐŚŝƉ͘ĐŽŵdĞů͗ϭͲϲϬϰͲϵϮϰͲϭϴϯϬ tĞďƐŝƚĞ͗ǁǁǁ͘ƉŶǁƐŚŝƉ͘ĐŽŵ

2020 Winston Park Drive, Suite 300 Oakville, Ontario, Canada L6H 6X7 Telephone: (905) 829-5829 Fax: (905)829-5219 Email: cft@cftcorp.com www.cftcorp.com EXPERTS IN SHIPPING SPECIALTY GRAINS WORLDWIDE


30

FARM LIVING

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

TOMATOES | RECIPES

Red, green or yellow, tomatoes are versatile and nutritious TEAM RESOURCES

SARAH GALVIN, BSHEc

M

y summer ritual is making tomato sauce with friends. We make a simple sauce and process it in a hot water bath to preserve it for the winter. After a long day of food preparation, I make pasta and we dip into our vat of freshly made sauce. Pick tomatoes when they are firm but not hard because they continue to ripen after they are picked. When buying, avoid ones that have bruises or cuts on the skin and keep tomatoes separate from raw meat, poultry and seafood in the grocery cart. Store whole tomatoes unwashed, uncovered and out of direct sunlight. When tomatoes are ripe, store in the refrigerator or cold room and use within days. Throw away cut or peeled tomatoes that have been left out at room temperature for more than two hours.

2 tbsp. finely minced garlic 30 mL 1/2 c. coarsely 125 mL chopped fresh basil 1/4 c. finely chopped 60 mL fresh parsley 1 tbsp. fresh lemon juice 15 mL 1/2 tbsp. extra virgin olive oil 8 mL 1 tsp. finely minced 5 mL fresh tarragon 1/4 tsp. crushed red pepper 2 mL flakes 2 baguettes, cut in 1/2-inch (3 cm) slices 6 cloves garlic, cut in half In a bowl, mix all ingredients except bread and garlic cloves. Add salt and pepper to taste. Set aside, unrefrigerated, for three hours. Carefully toast both sides of bread on a baking sheet under the broiler. Rub cut side of garlic on each slice and generously top with tomato mixture.

TOMATO JAM 5 lb. tomatoes, finely chopped 3 1/2 c. sugar 1/2 c. lime juice 2 tsp. freshly grated ginger 1 tsp. cinnamon 1/2 tsp. ground cloves 1 tbsp. salt 1 tbsp. red chili flakes

FRESH TOMATO BRUSCHETTA 8 ripe plum tomatoes, seeded and diced

2.2 kg 750 mL 125 mL 10 mL

Charring tomatoes over charcoal adds another dimension of flavour. reduce temperature to a simmer. Stirring regularly, simmer until it reduces to a sticky, jam-like state. This will take about 1 1/2 hours. When the jam has cooked down, remove from heat and fill jars, leaving 1/4 inch (2 mm) headspace. Process in hot water bath for 20 minutes in eight ounce (250 mL) jars.

Green tomato relish ingredients are simmered with spices and then canned for winter enjoyment. | SARAH GALVIN PHOTOS

SLOW ROASTED TOMATOES 5 mL 3 mL 15 mL 15 mL

Combine all ingredients in a large, non-reactive pot. Bring to a boil and

Roasting caramelizes the sugars and heightens the flavour of tomatoes. Add to dishes as a substitute for sundried tomatoes. Slice fully ripened tomatoes of any variety in half crosswise. Lay cut side

up on a lightly greased baking sheet. Drizzle lightly with olive oil and slow bake in a 225 F (100 C) oven for about six hours, depending upon the juiciness of tomatoes. Use immediately, refrigerate for up to a week or freeze by placing on a dry baking sheet lined with parchment paper. Transfer to a freezer bag.

GREEN TOMATO RELISH Proudly presented and managed by

of e d a r a P

s e m HoLottery

www.childrenshospitallottery.ca 1-855-635-4545

featured in the Saskatoon & Region Home Builders’ Association Parade of Homes

Early Bird Prize Early Bird Deadline : August 30th, 2013

$80,000 Cash 2013 Range Rover Sport 2013 Ford F-150 & Godfrey Pontoon Boat

Vacations for Life Canary Islands or $35,000 Cash Saint Lucia or $35,000 Cash

Additional Prizes $10,000 Cash Hot Tub ($10,000 value) 10 MacBooks 20 iPad Minis & many more Single ticket

........

$100

3-Pack

..................

$250

5-Pack

..................

$375

50/50 Draw Lottery License # LR13-0020 , LR13-0021

1 lb. green tomatoes, 0.5 kg thinly sliced 1/2 small onion, thinly sliced Combine in a bowl with two tablespoons (15 mL) coarse salt. Refrigerate for 12 hours. Drain and rinse. Combine in a non-reactive saucepan and bring to a boil until sugar dissolves: 1 c. apple cider vinegar 250 mL 3/4 c. light brown sugar 185 mL Stir in: 1 green bell pepper, sliced 1/2 red bell pepper, diced 1 clove garlic, minced 1/2 tsp. dry mustard 3 mL 1/2 tsp. salt 3 mL Add the tomatoes and onions and stir together well. Tie together in a cheesecloth bag: 1/2 tsp. whole cloves 3 mL 1/2 tsp. ground ginger 3 mL 1/2 tsp. celery seeds 3 mL 1 cinnamon stick, broken Simmer, stirring often, until the tomatoes no longer hold their shape, about one hour. For a thicker relish, remove lid for second half of cooking period. Remove spice bag and process relish in a hot water bath 16 ounce (500 mL) jars for 15 minutes or keep in the refrigerator up to one month.

FIRE ROASTED TOMATO SAUCE plum or roma tomatoes yellow onions, finely diced fresh basil, optional garlic, minced salt Grill tomatoes on charcoal or gas barbecue until skin blackens. Immediately drop into cold water and slip off skins. The meaty part goes into a large pot and is cooked slowly with finely chopped onions, garlic and

TOMATO TRIVIA • A tomato is a fruit, not a vegetable. • Tomatoes grew wild like berries in the South American Andes. They were about the size of cherries. • The modern tomato was developed in Mexico, where it is called tomatillo. • Tomatoes are a good source of vitamins E, C, A and K and dietary fibre.

salt to taste. Add chopped fresh basil in the last five minutes of cooking, if desired. Use immediately, keep in refrigerator for up to a week or water bath process 16 ounce (500 mL) jars for 35 minutes.

HOT WATER BATH PROCESSING This method of food preservation is suitable for food with a pH of 4.6 or lower. Tomatoes are borderline so add a teaspoon (5 mL) of lemon juice or citric acid to each two cup (500 mL) jar. If the recipe contains vinegar, there will be enough acid to safely process. Wash jars and lids and sanitize in a water bath just below the boiling point. Rubber rings and snap lids are kept in hot but not boiling water until used. Ladle hot food into jars leaving a headspace of 1/2 inch (1.5 cm) for tomatoes and chutneys. Slide nonmetallic utensil down the inside of jars to remove any air bubbles, then readjust headspace. Wipe rim of each jar, place lid on jar and apply screw band only until resistance is met. Do not over tighten. Place in canner of boiling water. Adjust water level so jars are covered by at least one inch (2.5 cm). When process time has elapsed, turn off heat and remove jars without tilting. Do not retighten. Cool upright, undisturbed for 24 hours. Check a reliable canning resource book for more information. Label and store in cool dark place. Sarah Galvin is a home economist, teacher and farmers’ market vendor at Swift Current, Sask., and a member of Team Resources. She writes a blog at allourfingersinthepie. blogspot.ca. Contact: team@producer.com.


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

31

MARKETS LIVE! Updated every 5 minutes.

producer.com

WPCLASSIFIEDS

This is where you’ll findit! Find live markets news at producer.com.

C L A S S I F I E D S A L E S | P : 8 0 0 . 6 6 7.7 7 7 0 F : 3 0 6 . 6 5 3 . 8 75 0 | E M A I L : A D V E R T I S I N G @ P R O D U C E R . C O M

4 EASY WAYS TO BOOK YOUR AD 1 Online at www.producer.com 2 By phone: In Saskatoon 665-3515 Toll Free 1-800-667-7770

LINER AD RATES

$5.85/Printed Line (3 line minimum) ADDITIONAL FEATURES Bolding = .75/word/wk Full Color Photo = $39.00/wk Black & White Photo = $25.00/wk Attention Getter = $15.00/wk Ask about our Priority Placement LINER FREQUENCY DISCOUNTS Start after 3 weeks Example: 4 weeks for the price of 3, (8 for 6) (12 for 9) (52 for 39) etc. (Does not apply to bolding)

LINER COMMUNITY CALENDAR RATES 2 For 1 Book an ad to run and the identical ad will appear in a second edition free of charge. (Maximum 4 ads)

CLASSIFIED DISPLAY AD RATES $116/column inch/week Talk with your sales rep about our Volume Discounts

CONDITIONS

producer.com

DEADLINES • Liner ads – Thursday previous to publication, 8:00pm CST • Display ads – Thursday previous to publication, Noon CST

findit

(anywhere in North America)

8:30am – 4:30 pm CST, Mon & Fri 8:30am – 8:00 pm CST Tues, Wed, Thurs. 3 Fax 306-653-8750 4 Email us at: advertising@producer.com

Tributes/Memoriams ..................... 0100 Announcements .............................0200 COMMUNITY CALENDAR British Columbia ..........................0310 Alberta ........................................ 0320 Saskatchewan ............................ 0330 Manitoba ..................................... 0340 Airplanes ........................................0400 Alarms & Security Systems ...........0500 ANTIQUES Antique Auctions .........................0701 Antique Equipment..................... 0703 Antique Vehicles ......................... 0705 Antique Miscellaneous ................0710 Arenas ............................................0800 Auction Sales .................................0900 Auction Schools .............................0950 AUTO & TRANSPORT Auto Service & Repairs............... 1050 Auto & Truck Parts .......................1100 Buses........................................... 1300 Cars ............................................. 1400 Trailers Grain Trailers .............................1505 Livestock Trailers....................... 1510 Misc. Trailers...............................1515 Trucks 2007 & Newer ........................... 1597 2000 - 2006 ............................. 1600 1999 & Older .............................1665 Four Wheel Drive .......................1670 Grain Trucks ............................... 1675 Gravel Trucks ............................. 1676 Semi Trucks.................................. 1677 Specialized Trucks .................... 1680 Sport Utilities ............................ 1682 Various .......................................1685 Vans..............................................1700 Vehicles Wanted .......................... 1705 BEEKEEPING Honey Bees ..................................2010 Cutter Bees ................................. 2020 Bee Equipment & Supplies .....................................2025 Belting ............................................ 2200 Bio Diesel & Equipment................. 2300 Books & Magazines ........................ 2400 BUILDING & RENOVATIONS Concrete Repair & Coatings .......................................2504 Doors & Windows ........................2505 Electrical & Plumbing .................. 2510 Lumber .........................................2520 Roofing.........................................2550 Supplies .......................................2570 Buildings .........................................2601 Building Movers ..............................2602 Business Opportunities ................. 2800 BUSINESS SERVICES Commodity/Future Brokers ........ 2900 Consulting ....................................2901 Financial & Legal .........................2902 Insurance & Investments ....................2903 Butcher’s Supplies .........................3000 Chemicals........................................3150 Clothing: Drygoods & Workwear ................. 3170 Collectibles .................................... 3200 Compressors .................................. 3300 Computers...................................... 3400 CONTRACTING Custom Baling..............................3510 Custom Combining ......................3520 Custom Feeding ........................... 3525 Custom Seeding ........................... 3527 Custom Silage ..............................3530 Custom Spraying ........................ 3540 Custom Trucking ..........................3550 Custom Tub Grinding ................... 3555 Custom Work............................... 3560 Construction Equipment................3600 Dairy Equipment .............................3685 Diesel Engines................................ 3700 Educational .................................... 3800 Electrical Motors.............................3825 Electrical Equipment ......................3828 Engines........................................... 3850 Farm Buildings ...............................4000 Bins ............................................. 4003 Storage/Containers .................... 4005 FARM MACHINERY Aeration .......................................4103

• The Western Producer reserves the right to revise, edit, classify or reject any advertisement submitted to it for publication. • The Western Producer, while assuming no responsibility for advertisements appearing in its columns, endeavors to restrict advertising to wholly reliable firms or individuals. • Buyers are advised to request shipment C.O.D. when purchasing from an unknown advertiser, thus minimizing the chances of fraud and eliminating the necessity of refund if the goods have already been sold. • Ads may be cancelled or changed at any time in accordance with the deadlines. Ads ordered on the term rates, which are cancelled or changed lose their special term rates. • The Western Producer accepts no responsibility for errors in advertisements after one insertion. • While every effort is made to forward replies to the box numbers to the advertiser as soon as possible, we accept no liability in respect of loss or damage alleged to arise through either failure or delay in forwarding such replies, however caused. • Advertisers using only a post office box number or street address must submit their name to this office before such an advertisement is accepted for this publication. Their name will be kept confidential and will not appear in any advertisement unless requested. • Box holders names are not given out.

Conveyors ................................... 4106 Equipment Monitors ................... 4109 Fertilizer Equipment.................... 4112 Grain Augers ................................ 4115 Grain Bags/Equipment ................ 4116 Grain Carts ................................... 4118 Grain Cleaners ............................. 4121 Grain Dryers ................................. 4124 Grain Elevators ............................ 4127 Grain Testers ................................4130 Grain Vacuums............................. 4133 Harvesting & Haying Baling Equipment ......................4139 Mower Conditioners .................. 4142 Swathers ....................................4145 Swather Accessories .................4148 H&H Various .............................. 4151 Combines Belarus ....................................... 4157 Case/IH ..................................... 4160 CI ................................................4163 Caterpillar Lexion ......................4166 Deutz ..........................................4169 Ford/NH ..................................... 4172 Gleaner ...................................... 4175 John Deere ................................. 4178 Massey Ferguson ....................... 4181 Python........................................4184 Versatile ..................................... 4187 White..........................................4190 Various ....................................... 4193 Combine Accessories Combine Headers ......................4199 Combine Pickups .......................4202 Misc. Accessories ......................4205 Hydraulics ................................... 4208 Parts & Accessories ..................... 4211 Salvage....................................... 4214 Potato & Row Crop Equipment ................................. 4217 Repairs .........................................4220 Rockpickers ................................. 4223 Shop Equipment .......................... 4225 Snowblowers & Snowplows.................................4226 Silage Equipment ........................4229 Special Equipment ...................... 4232 Spraying Equipment PT Sprayers ................................4238 SP Sprayers................................ 4241 Spraying Various .......................4244 Tillage & Seeding Air Drills .....................................4250 Air Seeders ................................4253 Harrows & Packers ....................4256 Seeding Various.........................4259 Tillage Equipment .....................4262 Tillage & Seeding Various.....................................4265 Tractors Agco Agco ......................................... 4274 Allis/Deutz ............................... 4277 White ...................................... 4280 Belarus .......................................4283 Case/IH ..................................... 4286 Steiger......................................4289 Caterpillar ..................................4292 John Deere .................................4295 Kubota....................................... 4298 Massey Ferguson .......................4301 New Holland ............................. 4304 Ford ..........................................4307 Versatile...................................4310 Universal.................................... 4313 Zetor...........................................4316 Various Tractors ........................4319 Loaders & Dozers ......................... 4322 Miscellaneous ..............................4325 Wanted .........................................4328 Fencing ...........................................4400 Financing/Leasing ......................... 4450 Firewood .........................................4475 Fish & Fish Farming...... ................. 4500 Food Products .................................4525 Forestry / Logging Equipment ....... 4550 Fork Lifts & Pallet Trucks ...............4600 Fruit / Fruit Processing .................. 4605 Fur Farming .....................................4675 Generators ...................................... 4725 GPS .................................................4730 Green Energy................................... 4775 Health Care .................................... 4810 Health Foods ...................................4825 Heating & Air Conditioning ........... 4850 Hides, Furs, & Leathers ................. 4880

Hobbies & Handicrafts .................. 4885 Household Items............................ 4890 Iron & Steel .................................... 4960 Irrigation Equipment ..................... 4980 LANDSCAPING Greenhouses ............................... 4985 Lawn & Garden ........................... 4988 Nursery & Gardening Supplies .................. 4990 LIVESTOCK Bison/Buffalo Auction Sales ............................5000 Bison/Buffalo............................ 5001 Cattle Auction Sales ............................ 5005 Black Angus .............................. 5010 Red Angus ..................................5015 Belgian Blue.............................. 5030 Blonde d’Aquitaine ....................5035 Brahman ................................... 5040 Brangus ......................................5042 Braunvieh ..................................5047 Brown Swiss ............................. 5049 BueLingo ....................................5052 Charolais ....................................5055 Dexter........................................ 5065 Excellerator................................5067 Galloway ................................... 5070 Gelbvieh.....................................5075 Guernsey ................................... 5080 Hereford ....................................5090 Highland ................................... 5095 Holstein......................................5100 Jersey .........................................5105 Limousin .....................................5115 Lowline ...................................... 5118 Luing .......................................... 5120 Maine-Anjou .............................. 5125 Miniature ...................................5130 Murray Grey ............................... 5135 Piedmontese ..............................5160 Pinzgauer ................................... 5165 Red Poll .......................................5175 Salers ......................................... 5185 Santa Gertrudis .........................5188 Shaver Beefblend ...................... 5195 Shorthorn.................................. 5200 Simmental..................................5205 South Devon .............................. 5210 Speckle Park .............................. 5215 Tarentaise ..................................5220 Texas Longhorn .......................... 5225 Wagyu ........................................5230 Welsh Black................................ 5235 Cattle Various ............................5240 Cattle Wanted ............................5245 Cattle Events & Seminars .................................. 5247 Horses Auction Sales .............................5305 American Saddlebred ................5310 Appaloosa .................................. 5315 Arabian ......................................5320 Belgian ....................................... 5325 Canadian .................................... 5327 Clydesdale .................................5330 Donkeys ..................................... 5335 Haflinger ....................................5345 Holsteiner .................................. 5355 Miniature ...................................5365 Morgan ....................................... 5375 Mules......................................... 5380 Norwegian Fjord ........................5385 Paint.......................................... 5390 Palomino ....................................5395 Percheron ................................. 5400 Peruvian.................................... 5405 Ponies ....................................... 5408 Quarter Horse ............................ 5415 Shetland.....................................5420 Sport Horses ..............................5424 Standardbred............................ 5430 Tennessee Walker ......................5445 Thoroughbred ........................... 5450 Welsh .........................................5455 Horses Various.......................... 5460 Horses Wanted ..........................5465 Horse Events, Seminars.................. 5467 Horse Hauling ........................... 5469 Harness & Vehicles ....................5470 Saddles ...................................... 5475 Sheep Auction Sales .............................5505 Arcott .........................................5510 Columbia....................................5520

BE STRONG! BE BOLD! Make your classified ad the best it can be. Make words in your classified ad stand out and get noticed, by using bold text. Ask our friendly classified ad team for more information. We’ll be happy to assist you with expert advice on how to get your item sold!

Place your ad on producer.com or call us at 1-800-667-7770

Dorper ........................................ 5527 Dorset ........................................5530 Katahdin.....................................5550 Lincoln ....................................... 5553 Suffolk....................................... 5580 Texel Sheep ................................5582 Sheep Various........................... 5590 Sheep Wanted............................5595 Sheep Events, Seminars................... 5597 Sheep Service, Supplies ...................................5598 Swine Auction Sales ............................ 5605 Wild Boars .................................5662 Swine Various ............................5670 Swine Wanted ............................ 5675 Swine Events, Seminars ..................5677 Poultry Baby Chicks ...............................5710 Ducks & Geese ...........................5720 Turkeys.......................................5730 Birds Various ............................. 5732 Poultry Various ..........................5740 Poultry Equipment..................... 5741 Specialty Alpacas ...................................... 5753 Deer............................................ 5757 Elk ..............................................5760 Goats .......................................... 5765 Llama .........................................5770 Rabbits....................................... 5773 Ratite: Emu, Ostrich, Rhea .................... 5775 Yaks ............................................5780 Events & Seminars..................... 5781 Specialty Livestock Equipment. ................................ 5783 Livestock Various ........................5785 Livestock Equipment .................. 5790 Livestock Services & Vet Supplies ..................................... 5792 Lost and Found .............................. 5800 Miscellaneous Articles................... 5850 Misc Articles Wanted ......................5855 Musical ............................................5910 Notices ............................................5925 Oilfield Equipment..........................5935 ORGANIC Certification Services ..................5943 Food .............................................5945 Grains...........................................5947 Livestock ..................................... 5948 Personal (prepaid) ......................... 5950 Personal Various (prepaid)................ 5952 Pest Control ................................... 5960 PETS Registered ....................................5970 Non Registered ............................ 5971 Working Dogs ...............................5973 Pets & Dog Events ........................ 5975 Photography .................................. 5980 Propane ..........................................6000 Pumps ............................................ 6010 Radio, TV & Satellites ....................6040 REAL ESTATE B.C. Properties .............................6110 Commercial Buildings/Land .......................... 6115 Condos/Townhouses ...................6120 Cottages & Lots ............................ 6125 Houses & Lots ..............................6126 Mobile Homes .............................. 6127 Ready To Move ............................. 6128 Resorts .........................................6129 Recreational Property .................6130 Farms & Ranches British Columbia........................ 6131 Alberta ....................................... 6132 Saskatchewan ............................ 6133 Manitoba ....................................6134 Pastures .....................................6136 Wanted .......................................6138 Acreages ....................................6139 Miscellaneous ........................... 6140 RECREATIONAL VEHICLES All Terrain Vehicles ...................... 6161 Boats & Watercraft ...................... 6162 Campers & Trailers ......................6164 Golf Cars ......................................6165 Motor Homes ...............................6166 Motorcycles ................................. 6167 Snowmobiles ...............................6168 Refrigeration .................................. 6180

RENTALS & ACCOMMODATIONS Apartments & Houses ..................6210 Vacation Accommodations .......................6245 Restaurant Supplies .......................6320 Sausage Equipment ....................... 6340 Sawmills......................................... 6360 Scales ............................................. 6380 PEDIGREED SEED Cereal Seeds Barley ........................................ 6404 Corn...........................................6406 Durum ....................................... 6407 Oats ........................................... 6410 Rye .............................................6413 Triticale ......................................6416 Wheat .........................................6419 Forage Seeds Alfalfa.........................................6425 Annual Forage ........................... 6428 Clover .........................................6431 Grass Seeds .............................. 6434 Oilseeds Canola ...................................... 6440 Flax ........................................... 6443 Pulse Crops Beans ........................................ 6449 Chickpeas ..................................6452 Lentil ..........................................6455 Peas........................................... 6458 Specialty Crops Canary Seeds ............................ 6464 Mustard ......................................6467 Potatoes .................................... 6470 Sunflower...................................6473 Other Specialty Crops................. 6476 COMMON SEED Cereal Seeds ............................... 6482 Forage Seeds............................... 6485 Grass Seeds ................................ 6488 Oilseeds .......................................6491 Pulse Crops ................................. 6494 Various .........................................6497 Organic Seed ................. See Class 5947 FEED MISCELLANEOUS Feed Grain................................... 6505 Hay & Straw .................................6510 Pellets & Concentrates ................ 6515 Fertilizer...................................... 6530 Feed Wanted ............................... 6540 Seed Wanted ................................6542 Sewing Machines ............................6710 Sharpening Services ....................... 6725 Sporting Goods ...............................6825 Outfitters .....................................6827 Stamps & Coins .............................. 6850 Swap................................................6875 Tanks ...............................................6925 Tarpaulins .......................................6975 Tenders............................................7025 Tickets .............................................7027 Tires ............................................... 7050 Tools ............................................... 7070 Travel...............................................7095 Water Pumps...................................7150 Water Treatment ............................ 7200 Welding ...........................................7250 Well Drilling ................................... 7300 Winches.......................................... 7400 CAREERS Career Training .............................. 8001 Child Care....................................... 8002 Construction ..................................8004 Domestic Services .........................8008 Farm / Ranch .................................. 8016 Forestry / Logging .......................... 8018 Help Wanted .................................. 8024 Management ...................................8025 Mining .............................................8027 Oilfield ........................................... 8030 Professional ....................................8032 Sales / Marketing ...........................8040 Trades / Technical .......................... 8044 Truck Drivers .................................. 8046 Employment Wanted (prepaid) ..................................... 8050


32 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

1966 PA24 CHEROKEE 140, white and blue, factory design, 6400 TT, 2100 ET, Garmin radios, SL30, 296 GPS, transponder Mode C, overhauled flight instruments, new tires, much more. Exc. flying aircraft. 204-769-2210, 204-741-0054, Souris, MB. AIRPLANE HANGAR, located at CYXE Saskatoon. 1470 sq. ft. (42x35’), concrete floor, Diamond aviation bi-fold door, $90,000 plus GST. For details and pics call/text: 306-717-0709.

LYCOMING 0-320, 150/160 HP, excellent condition, 2200 hours. 403-327-4582, 403-308-0062, Lethbridge, AB. H I G H P E R F O R M A N C E - 1971 Piper Cherokee 140D. Located at Saskatoon, SK. Airport. $27,500 OBO. Must be flown! Call 306-382-9024. 1962 and 1959 Champion 7ECA and 7EC w/C90 82 SMOH, total restoration, radio, mode C, intercom, new tires, Cleveland brakes, Scott tailwheel, strobe, wheelpants, Can email photos. Bonnyville, AB., ph 780-826-3684, dmchamp@mcsnet.ca CESSNA 150F OM, flies well, new cylinders and panel. Covers, spare parts, asking $16,000. Ph: 306-420-8707, La Ronge, SK.

1962 COMANCHE 250, good aircraft, don’t fly enough, $59,900 OBO. Trades? David Clark H20-10 and bag, $250 OBO. MX11 Com 760 LED flipflop, spare, w/tray, $800 OBO. 250-426-5118, 250-421-1484.

CESSNA 182, 1968, 5000 hrs. AF, engine 1/2 time, Horton stall w/cuffs, long range tanks, $75,000 OBO. Call 403-350-5264, Red Deer, AB.

WIRELESS DRIVEWAY ALARMS, calving/foaling barn cameras, video surveillance, rear view cameras for RVs, trucks, combines, seeders, sprayers and augers. Mounted on magnet. Free shipping. Call 403-616-6610, Calgary, AB.

1953 CESSNA 180, 4033TT, 0-470-K engine, 932 SMO, 190 on prop, tight EDO, 2870 floats, Mode C transponder, extended baggage, Horton Stol kit, Fly-lite 3000 hyd. wheel skis, Cleveland brakes, Tanis engine pre-heat kit. 306-468-2771, Debden, SK. 1973 THRUSH 600, 5400 TT, engine 0 TT, prop 15 TT, ext. wings, GPS, flow control, 29” wheels, lots more extras, $145,000. 306-268-7400 306-268-7550 Bengough SK FLUIDYNE 3200 WHEEL skis, w/reservoir, pump, brackets, stub axles for 180. $10,900. Photos available, 867-875-7678, Hay River, NT. LYCOMING 0-290-D, 135 HP, 1100 SMOH, FWF c/w mount and exhaust, exc. cond. Lethbridge, AB., 403-327-4582, 403-308-0062.

1991 RANS S-10 Sakota, midwing two place aerobatic taildragger, 304 TTAF, 583 Rotax, 90 HP, 110 MPH, inverted capability, affordable aerobatics, $24,000 OBO. Call 306-625-3922, Ponteix, SK.

WANTED: DIESEL MF 65, complete tractor or engine only. Call Cam-Don Motors Ltd. 306-237-4212, Perdue, SK.

FORD 8N TRACTOR w/3 PTH and PTO; IH McCormick Farmall A tractor; Minneapolis Moline 705 tractor, not running. Alvin Miller Farm Equipment Auction, Saturday, August 17, 2013, Stoughton, Sask. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962 1946 JD D tractor, styled, complete, restored, starter, lights. Reasonable offer accepted. 306-773-8256, Swift Current, SK. 2 THRASHING MACHINES complete; 1 electric sanding mill. Call 306-931-8686, Saskatoon, SK. 1952 JD AR styled, running, $2000; John Deere D, good tin, not seized, $1500; John Deere D, on steel, painted 12 yrs. ago, running, $3500; Minneapolis Z, metal good, running, PTO, $1000. Vegreville, AB. 780-632-6372, 780-603-5307. JOHN DEERE 730, 1960, good condition, $5500. 780-889-2106, Heisler, AB. MCCORMICK SUPER W4 in great original condition, power steering, lights, hyds, PTO, $2400. 250-862-7782, Kelowna, BC.

WORKING STEAM TRACTORS double acting brass cylinder and piston, forward, reverse and neutral control, plus working whistle. Runs 15 minutes per fueling. Regular $449.95, summer sale $299.96. w w w. y e s t e r y e a r t o y s c a n a d a . c o m SUPREME AUCTION SERVICES will be 1-800-481-1353. offering a huge number of antiques for sale by Auction in Sintaluta, SK. at 10:00 ANTIQUE BODIE AIRWAY grain and grass AM, Sunday, August 18. For details go to seed cleaner; VIKING DUPLEX fanning www.supremeauctions.ca PL #314604. mill. Offers. 306-642-5740, Assiniboia, SK. Contact Brad Stenberg 306-551-9411 or 1949 FARMALL CUB tractor, c/w belly Ken McDonald 306-695-0121. mount sickle bar mower, rebuilt engine, new paint, good tires, $4500 OBO. Call 403-772-2209, 403-820-1432, Morrin, AB.

RARE 1953 MMU diesel, complete restoration w/paint and decals. Good rubber, hydraic cylinder and manual. Photo avail. upon request. 306-874-5603, Naicam, SK. TRACTORS FOR SALE: JD’s 420 Hi-crop (rare), M, MTW, MTN, BW, H, Cockshutt 20. Call 403-660-8588, Calgary, AB. STRATHCONA VINTAGE TRACTOR PULL August 24 and 25th, Bremner Historical S i t e , A r d r o s s a n , A B . F o r m o r e i n fo www.strathconavintagetractor.com or call Ellis 780-922-6120 or Mike 780-467-6973. COCKSHUTT 30, Minneapolis Moline, Massey 102, and Cockshutt 80, $500/ea. Call 306-233-7305, Cudworth, SK.

CITY O F REG IN A EQ UIP . O N LIN E AUCTIO N

BIDDING CLOSES M ON. AUG. 19 – 1:00PM

V ie w a tCity Ya rd S t. John S t. & 6 th Ave . W e d . Au g . 14 -1p m – 3p m T erm s : C a s h, Intera c or W ire T ra ns fer TO IN CL UDE: HL A Ho rs t Pa llet F o rks , 5500 lb Ca p a city; S kid s teer Diggin g Bu cket w ith T eeth; S kid s teer Ro ck Bu cket w ith Gra p p le F o rk; 1993 F reightlin er F L 70 Du m p T ru ck; 1998 Chevro let 2500 Cheyen e T ru ck; 2000 F o rd F 150 T ru ck; 2 - 2004 F o rd F 150 XL T ru cks ; 2002 Do d ge Ra m 3500 T ru ck w /Du m p Bo x; 1994 F o rd F 350 XL T ru ck; 2002 GM C 3500 HD S L S ervice T ru ck; 1997 Chevro let 1500 T ru ck; 2000 Vo lvo W X64 Ga rb a ge Refu s e T ru ck.

ANTIQUE/HOUSEHOLD AUCTION - Sunday, Aug. 18, 2013. Gerry Goebel and Bep Hamer, curling rink in Shaunavon, SK, 1:00 PM. Antiques include: 2 dining room sets w/table, 6 chairs, china cabinet and sideboard; 1800’s large china cabinet; Hoosier cupboard; Settee; Chaise lounger; Rockers; Couch and chair; 2 rare doll sets (Native and Eskimo) handcrafted by Laura Parsonage of Maple Creek; Lamps and light fixtures; Old telephone; Pictures; Small misc. Household includes: TV’s; Allfridge; All-freezer; Beds; 2 pianos; Small misc. Google ‘Ralph Oberle Auction’ for full list and pictures. For more info contact Ralph Oberle 306-297-7979, Shaunavon, SK. PL #914868.

RARE 1966 AC D12 gas tractor, runs great, 2 spd./8 spd. trans., never lost a slow moving race, just over 9,000 made, $5,000. 306-621-1980, Yorkton, SK.

Bo o k M a rk M cDo u ga llAu ctio n .co m 306 -757-1755

ESTATE AUCTION Aug. 17/18, Sat./Sun. Athabasca, AB. Viewing Friday 4-6 PM, Saturday 9-10 AM, Auction at 10:00 AM both days. Lifetime collection of rare Chinese, Noritake and Blue Danube china sets and Oriental vases/plates; Original artworks, carvings, guns, collectables and Honda trikes; Victorian furniture, silverwares, art supplies. Over 700 lots. 80 plus detailed pictures and information at www.all-riteauctions.com 780-374-3864, Daysland, AB. PL #194638.

CLASSIFIED AD SUBMISSION FORM Complete name, address and phone number need not appear in your ad, although we must have this information for our files. NAME ________________________________________________________________________ DAYTIME PHONE# ___________________________ CELL# _________________________ EVENING PHONE# __________________________________ ADDRESS ________________________________________________ TOWN _________________________________________ PROVINCE _____________

SMALL ADS, BIG RESULTS This is where farmers buy and sell Canada’s largest agricultural classifieds.

Call our team to place your ad

1-800-667-7770

POSTAL CODE ____________________________________________ EMAIL ADDRESS _________________________________________

Entertainment Crossword by Walter D. Feener

PLEASE PRINT YOUR AD BELOW exactly as you want it to appear in the paper, including your phone number or The Western Producer box number. When using a phone or fax number within your ad copy, town and province are required (toll free numbers and WP Box numbers excepted). When using an email and/or website address within your ad copy, an alternative way for readers to contact you is required (ie: phone, fax or mailing address). Ads in the Personal column must be placed under a Western Producer box number or email address. There is a $45.00 charge for a box number ($95.00 International). A signature is required here for all Personal ads._________________________________________________

AD STARTS HERE:

a) Please circle the words you would like in bold print or b) ❑ entire ad.

________________________________________________________________ _______________________________________________________________________ _______________________________________________________________________ Last Weeks Answers

_______________________________________________________________________ _______________________________________________________________________ Town (required) ________________________________________________________ Province (required) _____________________________________________________ CLASSIFICATION NAME & NUMBER: ______________________________________ # OF WEEKS ________

Please start my ad in the ________________ issue

RATES: $5.85/printed line (3 line minimum). PLEASE SEE FRONT PAGE OF CLASSIFIED SECTION FOR FREQUENCY DISCOUNTS, FEATURE PRICING AND OTHER CLASSIFIED INFORMATION

When we receive your order a classified representative will contact you to confirm order and price. Are you a:

❑ ❑ ❑ ❑ ❑ ❑

❑ Subscriber ❑ Non-subscriber but a farmer ❑ Non-subscriber and not a farmer

Yes, I want a Western Producer box number. (Add $45.00 for handling replies) Yes, I want a photo. Full Colour photo $39.00/wk + line count. Black & White Photo $25.00/week + line count Yes, I want words in my ad bolded. (Add an additional .75¢ per word per week) Yes, I want to bold the entire ad. (Add .75¢ per word per week) Email/Weblink, Yes, I want to link my classified ad to my website or my email address (your website or email address must be in ad) VISA

MC Card No. __________________________________________ Expiry Date _________

SIGNATURE __________________________________________________________

Mail to: The Western Producer Advertising Department, Box 2500, Saskatoon, Sask. S7K 2C4 Ph. 1-800-667-7770

Fax 306-653-8750

ACROSS 1. Melanie of Thirtysomething 4. Black Snake ___ 9. ___ 57 11. Jeff, Who Lives at Home writer and director 12. D’Lyn of Dharma & Greg 13. Beau and Jeff’s dad 16. Life ___ 20. Nothing to ___ 21. ___ Hari 22. TV detective Mars 27. Sister ___ 29. Conn of Benson 31. Gregory Peck’s grandson 33. Sandra of Grey’s Anatomy 34. Judy of Scrubs 36. Scorsone of Private Practice 37. Best Canadian film at the 2003 Genie Awards 39. ___ Another Teen Movie 40. Eight ___ 43. The Journey of ___ Gann 46. ___ and Old Lace 48. Donovan of Clueless 49. Role for Hedy in 1949 51. ___ de la Garza 52. Director Verbinski 53. Actress Menzel 54. Atkinson of Mr. Bean 55. Jack of Barney Miller DOWN 1. Former TV series starring Patricia Arquette 2. Kotto of Homicide: Life on the Street 3. Actress Massen

4. One of the Kettles 5. Cotton Comes to Harlem director Davis 6. ___ Wednesday 7. Hud Academy Award winner 8. Canadian director Arcand 9. Film with a famous shower scene 10. Film starring Jodie Foster 14. Charlie Chaplin’s granddaughter 15. ___ Race 2000 17. He played Alfred the butler in the 1960s Batman television series 18. Actor Samuel 19. Lachman of Last Resort 23. Armstrong who has appeared in dozens of westerns during his 40-year career 24. Kevin of Weeds 25. Addams Family cousin 26. Douglas of The Bridge 28. Barbary ___ 29. The Girl with the ___ Tattoo 30. Cary Grant’s fourth wife 32. Talbot of Hogan’s Heroes 35. One of Charlie’s “angels” 38. Actress Thompson 41. Michele of Glee 42. Red ___ 44. Money ___ 45. Actor Serious 46. Thicke of Growing Pains 47. Michael of Arrested Development 48. ___ Stone 50. Cariou from Manitoba 51. Babylon ___ 52. Easy Come, Easy ___


CLASSIFIED ADS 33

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

CASE D TRACTOR, 1940, mostly restored PARTING OUT: 1927 Model A Ford parts, and runs good, needs rubber, asking r u n n i n g b o a r d s , f r a m e , c a b , e t c . $1500. 306-821-7441, Lloydminster, SK. 780-698-2650, Westlock, AB. ADRIAN’S MAGNETO SERVICE Guaran- REBUILT 1946 WILLY’S Jeep, Serial # teed repairs on mags and ignitors. Repairs. CJ2A-55358, $9500. Phone 306-867-3434, Parts. Sales. 204-326-6497. Box 21232, Strongfield, SK. Steinbach, MB. R5G 1S5. 1932 CHEVY 5 window Coupe, excellent COCKSHUTT 70; 1947 A/C model B, re- restoration project. New tires, engine stored, $2500; 1962 MF model 97, re- turns over, always shedded, $10,000 OBO. 780-632-1941, Vegreville, AB. or email stored, $2500. 780-877-2429, Edberg, AB. wcherniawsky1@hotmail.com COCKSHUTT 70 TRACTOR, motor runs real 1966 CADILLAC FLEETWOOD Brougham, good, needs a clutch, metal has no rust, 133� WB, rebuilt 429 V8, 340 HP, all Cadillooks good, has extra set rear tires $2500. lac options. $2500 OBO. 306-586-1305, 780-307-1530, Rochester, AB. Regina, SK. 1950 JOHN DEERE row crop, restored, 1958 INTERNATIONAL GRAIN TRUCK, new tires. Asking $4500 OBO; 1954 Ford A-160 Series, shedded, restorable, running NAA, restored, good tires, $3500 OBO. condition. 403-533-2143, Rockyford, AB. henryjohnson@shaw.ca Kelowna, BC. 1969 PLYMOUTH GTX, 95% restored, re2 CYL. JD TRACTORS, restored within built 440 CID with Hooker headers, Edelbpast 7 yrs: 1957 820; 1956 420; 1953 AR; rock intake, overhauled auto trans., new 1948 AR; 1945 BR and 1940 BR. Call vinyl roof, rear quarters and interior, fresh 780-222-6034, Sturgeon County, AB. paint, factory air, looks great. Asking $42,000 OBO. 204-937-7079, Roblin, MB. 1938 JOHN DEERE D project tractor, new hood, fenders, platform metal, tires. All 1926 CHEV 1/2 ton truck, 4 cyl., 4 spd., pieces to put together, $3000 OBO; 1952 running, wooden cab and wheels, $7500; Ferguson TO-30, w/Davis FEL loader, runs 1952 Chev 1300 1/2 ton shortbox, stepa n d w o r k s w e l l , $ 2 0 0 0 O B O . side, 6 cyl., 3 spd. std., running, $3500. 780-632-6372 780-603-5307 Vegreville AB 306-586-1305, Regina, SK. WANTED: OLD DEUTZ tractor, 65, 805, WANTED: FORD’S 1928 to 1934 in any 13006 or other European built. Also want- condition. Contact Mark or Rod toll free: ed stationary engine and antique cars. Call 1-888-807-7878. 403-559-7381, Olds, AB.

Sa t.Au g.10/ 13 1 0:00a .m . Da vid s o n , Sk. Co m m u n ip lex. Ho u s eho ld & An tiq u e s a le f o r L a u rie Fo u lkes o f Din s m o re.

Fu r n itu r e, a p p lia n ces , ya r d item s a s w ell a s la r g e co llectio n o f D ep r es s io n & Ca r n iva l g la s s , chin a , s ilver w a r e, co a l o il la m p s , s cu lp tu r es , S&P ’s , T ea cu p s , Co in co llectio n , o r n a m en ts , etc.

M o n .Au g.12/ 13 1 0:00a .m . Fa rm s a le f o r M a rcia W heeler, 6 m . W . o f Eyeb ro w , Sk., 3 m . S. o n Da rm o d y Grid , 1 / 2 m . E.

1 9 83 Ca s e 2 0 9 0 , 1 9 7 7 M F1 1 5 5 , Ca s e 489 0 4W D , M F1 1 0 0 , & W hite 2135 tr a cto r s , tr u cks , fa r m eq u ip m en t, ca ttle item s .

M A NZ’ S A UC TIONEER ING S ER VIC E D A VID S ON, S K. TIM M AN Z P L#9 1 40 3 6 w w w .m a n za u ctio n .co m 306 - 56 7- 29 9 0

N EXT SALE S ATUR DAY, 9:00 AM S EP TEM BER 7, 2 013 G R EAT PLAIN S AUCTIO N EER S

CROWN HILL AUCTION: Paul Bosckay Household and Shop Auction, Saturday August 24th, 10:00 AM, Legion Hall, Leask, SK. House and Lot, 177 Railways Ave; 1999 GMC Jimmy 4x4, 160,000 kms.; Basa WD400 quad; Household, wood and working tools; 12’ aluminum boat; Much more! Auctioneer, John Priestly, PL #917023.

5 M i. E. o f R egin a o n Hw y. #1 in G rea tPla in s In d u stria lPa rk TELEPHO N E (306) 52 5- 9516 w w w .grea tpla in sa u ctio n eers.ca w w w .glo b a la u ctio n gu id e.co m S ALES 1stS ATUR DAY O F EV ER Y M O N TH P.L. #91452 9

FARM AUCTION SALE: Lawrence and Elsa Jonasson,Thursday August 15th, 10:00 AM From Debden, SK. North on Park Valley Rd., 21 kms (Grid rd.), watch for signs. Please check our websites for more details. Sale Conducted by Schmalz Auctions, Highway #2 South, Prince Albert, SK. Phone 306-763-2172 or 306-922-2300, www.schmalzauctions.com www.globalauctionguide.com

FARM AUCTION FOR Roy Lucas of Leross, SK., Thursday August 8th. Full line of tractors, swather, combines, tillage equipment and much more. For directions and full listing go to: www.globalauctionguide.com and look for Double R Auctioneering or call Robert, 306-795-7387, PL # 309790.

BE AN AUCTIONEER. Call 507-995-7803, Mankato, MN. www.auctioneerschool.com

A U CTIO

N

AUCTION STARTS @ 8 AM SHARP N O TE M ACHINERY STARTS @ 9 AM SHARP w w w .s ch a pa n s ky.co m

IN TER N ET BID D IN G S TAR TS @ 9 AM ON M AC H IN ER Y

&/26,1* 0RQ$XJ

35(9,(: 0RQ)ULDPSP 6DWDPSP

/2$'2877XHV$XJ)UL$XJ

HW Y #3 EAS T, TIS DALE, S K

CHECK W EBS ITE FO R CO M PLETE LIS TIN G

ESTATE AUCTION FOR Joe Kajati of Punnichy, SK. Saturday August 10th. House and property; 2003 Ford 1/2 ton; Household and large line of yard equipment. For directions and full listing go to: www.globalauctionguide.com and look for Double R Auctioneering or call Robert, 306-795-7387, PL # 309790.

69LFWRU\'ULYH0DQNDWR01

P RE-HARV ES T AUCTIO N TUES . AUG . 13TH @ 8 AM

Â

SATURDAY, AUGUST 10, 9:00 AM, EISNER’S AUCTION CENTRE, Swan River. Manitoba’s Largest 43rd Annual Harvest Equipment Sale. includes 3 NH TX66 combines w/farmer upgrading. 100’s of items, 1000’s in attendance. Come early. 2 rings selling! Pancake breakfast 8-9. Check www.eisnerauctions.com for daily updates. Lawrence Eisner Auctions, 204-525-2225, Minitonas, MB.

23(1,1* 0RQ$XJ

REM IN D ER

MH 555D, c/w cab and PS, runs; 555D, not running; MH 446, ceased; MH 101, WANTED: OLD Anvils and pocket watches. Call 306-946-3304, Watrous, SK. ceased. Offers. 306-452-3795, Redvers, SK JD 920 diesel tractor with 3 PTH and PTO, WANTED: WOOD BURNING stove to realso JD 730 2WD diesel and JD R tractor. place Riverside Aer-Duct #628, approxiArt Beck Farm Equip. Auction, Saturday, mately 40� high x 16� square w/7� flue. August 24, 2013, Yellow Grass, Sask. area. 306-788-4502, Marquis, SK. Visit www.mackauctioncompany.com for WANTED: TRACTOR MANUALS, sales brosale bill and photos. 306-421-2928 or chures, tractor catalogs. 306-373-8012, 306-487-7815 Mack Auction Co. PL311962 Saskatoon, SK.

1966 EL CAMINO, 396 auto., fast car, fresh build, $20,900. pics at dclventures PBR FARM AND INDUSTRIAL SALE, last Also old Chev truck, take trades. Call Saturday of each month. Ideal for farmers, 306-529-7199, Craven, SK. contractors, suppliers and dealers. Consign now. Next sale August 31, 9:00 AM. PBR, 1975 GMC CABOVER, 350 DD, 13 spd., 105- 71st St. West, Saskatoon, SK., 40,000 rears; 1957 Dodge D700 tandem, www.pbrauctions.com 306-931-7666. 354 Hemi, 5&3 trans., 34,000 rears; 1971 GMC longnose tandem, 318 DD, 4x4 trans. FARM AUCTION FOR Fred Feszczyn of LeSterling 306-539-4642, Regina, SK. ross, SK., Friday August 16th: NH bale wagon, 6600 JD combine and much more. www.sterlingoldcarsandtrucks.com For directions and full listing go to: 1965 GALAXY 500 Ford convertible, good www.globalauctionguide.com or call condition. 306-934-7573, Saskatoon, SK. Robert 309-795-7387, Double R Auctioneering, PL # 309790. 1951 MERCURY PICKUP truck, frame off r e s t o r a t i o n , m a n y n e w p a r t s . LARGE ANTIQUES AND COLLECTIBLES Auction, Saturday, August 10, at 10:00 306-795-3349, 306-795-7349, Ituna, SK. AM, 312 Columbus Street, Rockglen, SK. JIM’S CLASSIC CORNER, a selling service Cook stove, RCA Victor gramophone, ice for classic and antique automobiles, box, etc. Sale conducted by Fister’s Auctrucks, boats. 204-997-4636, Winnipeg MB tion Service 306-642-8091.

UNRESERVED AUCTION SATURDAY, August 17, Randy Ballas, Elk Point, AB. 780-724-4294. Deutz 7120, DX110, 7110 tractors; Gehl 1875TDC and 8460 baler; Two JD 9350 press drills; Bourgault 28’ cult. vg; JD 7720; MF 750 and 760 combines; Hesston 6450 swather; JD 450C track loader; JD R, AR, MF 95 FWA tractors; Plus hopper bottoms and full line-up. www.prodaniukauctions.com - View online.

$IWHU$XJ30DQ\LWHPVQRWUHPRYHGZLOOEHFKDUJHGSHUGD\ORWUHQW $8&7,21((5·6127($OOHTXLSPHQWLVORFDWHGDW6RXWK9LFWRU\'ULYH0DQNDWR01 SDUWVGLVFRXQWRQDXFWLRQLWHPVWKURXJKWKHHQGRI$XJXVW6KRSUDWHVDSSO\IRUDQ\ DVVLVWDQFHUHTXLUHGRXWVLGHRIQRUPDOORDGLQJ)RUWUXFNLQJLQIRFRQWDFW-ROHHQRU.HOF\DW :DUPND7UDQVSRUW,QF

&203/(7(7(506/27/,67,1*6 3+2726$7,4%,'&20 75$&.75$&7256‡:'75$&7256‡0):' 75$&7256‡:'75$&7256‡&20%,1(6‡*5$,1 &$57‡&251+($'6‡)/(;+($'6‡3/$17(5 12 7,//'5,//‡),(/'&8/7,9$7256‡',6&5,33(56  &+,6(/3/2:‡27+(5(48,3‡/$:1 *$5'(1

.,%%/((TXLSPHQW,QF 7UDYLV

)RUDGGLWLRQDOLQIRFRQWDFW%UDG2OVWDG DW6WHIIHV$XFWLRQHHUV

,4%,'FRPLVDGLYLVLRQRI6WHIIHV$XFWLRQHHUV,QF 0DLQ$YHQXH(DVW:HVW)DUJR1' %UDG2OVWDG1' ,4%,'FRP‡6WHIIHV$XFWLRQHHUVFRP

WK$QQXDO3UH+DUYHVW

+RGJLQV$XFWLRQ&HQWUH 0HOIRUW6. 7KXUV$XJXVW $06+$53 

&RPELQHV

YOU COULD

BE HERE! Enter to WIN your spot on the 2013

1HZ+ROODQG&; &DW&KDOOHQJHU  0DVVH\)HUJXVRQ &DVH,+ -RKQ'HHUH

&RPELQH+HDGHUV 1HZ+ROODQG& 0DVVH\)HUJXVRQ &DVH,+ *OHDQHU

+\GUDXOLF([FDYDWRU 6NLG6WHHU/RDGHU &DW&7

7UXFN7UDFWRU 3HWHUELOW/

7DQGHP'LVN -RKQ'HHUH

+HDY\+DUURZ

*UDLQ7UDLOHU

'HJHOPDQ

'RHSNHU6XSHU%

*UDLQ&DUW 8QYHUIHUWK

+LJK&OHDUDQFH6SUD\HU

Two lucky farmers and each of their guests will receive: • Free admission to Canada’s Outdoor Farm Show on September 10, 11 and 12, 2013 • Roundtrip airfare to London, Kitchener or Hamilton, Ontario from their nearest major airport in Western Canada • Shuttle service to and from the Ontario airport • 4 nights accommodations at one of COFS’s selected partner hotels in Woodstock • Meal allowance of $50 per day per guest • VIP golf carts for the duration of the 3-day show • Shuttle service to and from the show each day

ENTER www.producer.com/contest/ ONLINE

7UDFWRUV -RKQ'HHUH7 -RKQ'HHUH7 1HZ+ROODQG7* -RKQ'HHUH

0RWRJUDGHU -RKQ'HHUH(

6ZDWKHUV

&DVH,+63;

:KHHO/RDGHUV &DW,7 -RKQ'HHUH &DW+

0DVVH\)HUJXVRQ :HVWZDUG  0DVVH\)HUJXVRQ ,QWHUQDWLRQDO

BROUGHT TO YOU BY

-RKQ'HHUH &DVH,+

*UDLQ6HUYLFH /LJKW7UXFNV 6HHGLQJ 7LOODJH(TXLSPHQW +D\LQJ(TXLSPHQW 1XPHURXV*UDLQ$XJHUV 3W+LWFK(TXLSPHQW /LYHVWRFN(TXLSPHQW *UDLQ%LQV $WWDFKPHQWV /DZQ *DUGHQ(TXLSPHQW

)RUXSGDWHVDQGPRUHLQIRYLVLWRXUZHEVLWHKRGJLQVDXFWLRQHHUVFRP

 4,1-t"#1-


34 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

McSHERRY AUCTION SERVICE LTD, VINTAGE SERVICE STATION /COCA COLA AUCTION, Sunday, August 11 at 10 am. Stonewall, MB., #12 Patterson Dr. OVER 125 Signs; Buffalo Bowser Globe; 3) Red Indian; 2) White Rose; Norwest Oil; B; Texaco; Good Year; JD; Ford; Coca Cola; Pepsi; Wynola; Rexall; MB. Telephone; Flour; Cig; Advertising clocks; Thermometers; Door Bars; Calendars; Gas Bowser pumps; Eco Air meter; Racks and cabinets; Oil cans; Vintage pedal bikes; Toy pedal car; pop coolers; Gum ball machine. Pics and website for growing list, Stuart M c S h e r r y, C a l l : 2 0 4 - 4 6 7 - 1 8 5 8 o r 204-886-7027 www.mcsherryauction.com HUGE UNRESERVED ANTIQUE Auction, Saturday, August 10th, 10:00 AM. Selling JD 50 tractor, pedal tractor and Farm Toy Collection, many other antiques. Coin Auction and preview Friday night. Scribner Auction, 780-842-5666, Wainwright, AB. www.scribnernet.com

TA N N E RY A N D TA X I D E R M Y S H O P Closeout Auction, Sat. Aug 31, 2013, Ryley AB., East of Edmonton on Hwy 14. Viewing 9 AM. Auction 10 AM. Large quantity of taxidermy supplies incl. head/body forms and molds, mammal, bird and fish eye set, stands, tables, fleshing equipment, salts and tanning oils, tanned caps, mounted birds, fish, mammals and rugs, tanning tumbler, vats, pressure tanner and tools. Ad is subject to changes. Detailed pictures and info at www.all-riteauctions.com 780-374-3864, Daysland, AB. PL #194638.

MIERAU AUCTIONS: Jacob and Tina Neufeld, North of Aberdeen, SK. to Smutts corner (at corner), Saturday August 10th, 10AM. EQUIPMENT: 1977 Case 970 w/cab and FEL, 4149 hrs.; JD 60 collector tractor, running, near new tires; TRUCKS: 1974 Chev 1.1/2 ton w/steel B&H, 26,000 miles; 1982 Ford F-150 XLT, V8 auto.; LAWN AND GARDEN: Yardman 13HP snowblower, 33” cut; 1300 gal. plastic tank, hose, garden hose, etc.; SHOP TOOLS: Power hacksaw, SR compressor, bench grinder, drills, Impact wrench (elec.), 10” table saw, band saw, mitre saw, various power tools. HOUSEHOLD: Gas stove, furniture, dishes. ANTIQUES AND COLLECTIBLES: Peter Wright anvil, 0-2-25; Tubs (round and square), vanity, china cabinet; Copper boiler, butter churn (3 gal. Red Wing); Plus many other items. Mierau Auction Service, Richard Mierau, PL#914867, Langham, SK. Phone 306-283-4662, www.mierauauctions.com

COMPLETE BUSINESS LIQUIDATION for WHEAT CITY ROOFING LTD at FRASER AUCTION BARN - BRANDON, MB. - SATURDAY AUGUST 17th at 10:00 AM DIRECTIONS: Sale will be held at Fraser Auction Service Ltd. sales yard 1/2 mile north of the junction of highways #1 & #10 on #25 Wheatbelt Road. Brandon, MB. THIS SALE WILL FEATURE: Trucks, Trailers, Roofing Equipment, Roofing Supplies, Tools, Roofing Sheet Metal, Office Equipment and much more. This will be a huge sale. Complete asset dispersal of both the Brandon, MB. and Winnipeg, MB. locations. Everything from Winnipeg will be hauled to Brandon and everything will be sold in our HUGE sale.

SEMI TRUCK*2000 Volvo Hwy Tractor, 500 HP, 12.7l Detroit Eng Series 60, 13 Spd Trans, S/N 4V4ND1RJ8YN239942, 151,832 kms showingVEHICLE*2007 Chevrolet Silverado 4 x 4 1500 Ext Cab, 8 Cyl, Orange,4.8l, V8 Gas Eng, Auto Trans, Ait Cruise, Tilt, box Liner, Receiver Hitch, S/N 1GCEK19C17Z536870, 180,203 kms showing*2007 Chevrolet Silverado 1500 LT, Reg Cab, Light PU, 6 Cyl, White, 4.3l, V6 eng, Auto Trans, Air, Tilt, Ladder Rack, Box Liner, Receiver Hitch, S/N 3GCEC14X87G229039, 115,045 Kms Showing*2007 Chevrolet Silverado 1500 LT, Reg Cab, Light PU, 6 Cyl, Orange, 4.3l, V6 Gas Eng, Auto Trans, Air, Tilt, Box Liner, Ladder Rack, Receiver Hitch, S/N 3GCEC14X77G228819, 122,719 Kms Showing*2006 GMC C7500, 4 door, 6 Cyl Duramax DSL, Auto Trans, 16’ Cancade B&H w/ Roll Back Load Cover, 2 Section Swinging End Gate, 22.5” Rubber, S/N 1GDL7E1346F429240, 180,346 kms showingTRAILERS*2010 Other Precision Utility Trailer, S/N 2P9BF6298AP078749*2007 Other Knudson Utility Trailer with Portable Roll Forming Machine KR-24 , S/N 1K9BU20267B282001*1994 Great Dane SemiTrailer, White, S/N 1GRAA062XRB064001INDUSTRIAL*CAT 910 Wheel Loader, S/N 80U1642, 5095 Hrs Showing*HD Extendable Boom for pallet ForksROOFING EQUIPMENT*Genesis Kettles from Garlock, Model 412, Temp Range 0-500*Gravely Professional 8 Power chisel w/ Kohler Eng, 979 hrs showing, s/n 40061*Garlock Roof Warrior Power Chisel w/ Honda GXV 340 eng, S/N 80228, N/A hrs showing*Hydraulic Power Back w/ Hyd Swing Hoist, Jonda Eng, s/n PP0320030036*Power Planer, Honda 8.5 Eng*Single Cutter, Honda EngLift CartROOFING SUPPLIES*(2) Pallets – Tar & Adhesive*(2) Pallets – Granules*(19) Pallets – Roofing Vents*(2) Pallets – Brackets*(2) Pallets – Rolls Roofing Material & Polly*(24) Rolls Roofing Material (Various Lengths)*(4) Rolls UnderlayINSULATION*(4) bundles of Bat Insulation R20 – 15”*(32) Bundles – Roxul 5” x32” x48”*(2) Bundles 2” x 24” x 48”*Assortment – foam Insulation 4 x 4 sheets, 1” – 4” Thickness*(2+) Bundles Foam 4’ x 8’ x 2.5”*Assortment Styrofoam InsulationSHOP EQUIPMENT*Roto Die Hydraulic Bender< Model 10, s/n 98266, Mac Capacity ¾” Opening 20guage x 10’, Mac Capacity 7/8” Opening 16 guage x 10’, Max Capacity ½” Hemming die Opening 20guage x 10’, 7.5HP Lincoln Electric Motor, 3PH, 230 Volts*Western 2 Post Shop Hoist, Capacity 15000 lbs*Brown Boggs Manual Bender, 10’*Manual Bender 36” Opening*4’ x 10’ HD Steel Table*(2) 4 ‘ x 10’ HD Steel Table w/ Wheels*3’ x 9’ HD Steel Table w/WheelsSHOP TOOLS*(21) Job Site BoxesSAFETY EQUIPMENT*(30) Fire Ext. Safety Cases*Pallet – Assorted Pylons*Assorted Fire Ext.*Road side Hazard Flare Kits*Pallet – Safety Netting & Safety FenceOTHER EQUIPMENT*X Stream 6500 Watt Generator*Craftsman 29” Snow Blower w/ 10HP Decumsen Eng*(4) Weather Guard Tool Boxes 18” x 90”METAL MATERIAL & SHEETS*(9) Rolls – Sheet Metal 15 5/8”W*(9) Rolls – Sheet Metal 7 ¾”W*(1) Roll – sheet Metal 3 5/8”W*(1) Roll – Sheet Metal 24”W*(3) Pallets - FlashingMISC*Pair – HD Ramps*Large Quantity of Hand Tools, Rakes, Shovels, Brooms Etc.*Large Assortment of Poly Tarps*(2) Shindawa Weed Trimmers*(2) Shelving – HD 7 shelves – 8’11”H x 50”W x 26”D

PRE-HARVEST CONSIGNMENT SALE at FRASER AUCTION BARN - BRANDON, MB. - SATURDAY AUGUST 17th at 9:00 am

FARM EQUIP. AUCTION for Jeff Simpso, 306-749-3229 or 306-749-7572. Consignors: Stan and Lorraine Phillips, Birch Hills, SK. Location: 11 kms East of Birch Hills on Hwy #3 to Brancepeth Corner and 11 kms North, 1.6 kms East and 1.6 kms North. Date: Saturday, August 17, 2013 at 10:00 AM. Automobiles: 1998 Ford F150 Supercab 4x4, 236,000 kms, 8’ box. 2003 Buick Lesabre Ltd, 190,000 kms, loaded; 2001 Chev Venture minivan, 290,000 kms; 1977 Ford F150 Supercab, 460 V8, auto, 8’ box, 2 WD. Recreation: 1985 Deltacraft 150 XLT fiberglass 15’ w/70 HP Johnson 2 stroke/3 cyl. outboard; 1998 Suzuki 300 King Quad, 6500 kms, w/winch; 1997 Honda XR100R Dirtbike; 2000 Arctic Cat Z120 snowmobile. 1992 Arctic Cat Jag 440 Longtrack w/reverse, oil injected, fan cooled, 6600 kms; 2 large toboggans; 12’ aluminum boat; 9.9 HP Johnson outboard; 12 volt trolling, new. Farm/Acreage Equipment: 1947 JD model M, parts, needs block, tires vg; JD 24T baler, shedded; 15 bale stooker; Malco 24’ bale elevator; small fert. spreader; 5’ 3 point cultivator; JD 100, 20’ DT; Cockshutt 247 16’ DT; Hammermill w/5 HP electric; 10 HP electric. Misc. livestock equipment. Custom welding deck and cabinets on 4 wheel trailer w/air compressor; JD 166 24’ drill; 2- NH 352 tanks. Bins: 2- Westeel Rosco 3300 bu., 19’. Shop Tools: Sanborn HD air compressor, 5 HP 220 v.; Sears air compressor; 50 ton homebuilt hyd. press; Industrial metal bandsaw 6”x12”; Craftsman 10” tablesaw and radial arm; HD drill press; 2 bench drill presses; floor stand grinder; 2 oxy/acet sets; Homelite 4800 generator w/Honda 8 HP motor; Hevac WC-100C automatic wood heater; Labtronics 919 moisture tester; large assortment misc hand tools. Lawn and Garden: 2009 JD Z225 zero turn mower, 100 hrs, 18.5 HP B&S, 42”; 1986 JD 318 lawn tractor, 18 HP tiller, 52” mower; JD 726 snowblower w/new 8.5 HP motor, E.S.; Husqvarna 322L weed eater; Husqvarna 132 HBV leafblower; Homebuilt Buzzsaw, 26’ blade, 16 HP B&S on trailer; tow behind grass sweeper, new. Misc. and household. Antiques and Collectables: Side board w/hutch; Spencer coal stove; CocaCola enamel sign; Ice saw and tongs. Consignors: Stan and Lorraine Phillips. Tractors and FEL and 3 PTH: IHC B414 diesel w/3 PTH; Volvo 650, cab, 1971, diesel, 18.4x34, vg, w/707 Leon FEL; JD BR, 1942; Turf Trac 16 HP lawn tractor/mower; 3 PTH fertilizer spreader; Buhler 7’, 3 PTH blade; yard rake for 3 PTH; yard machine 5 HP rototiller; Swisher lawn vacuum w/8.75 HP; Craftsman 11.5 HP snowblower, 30”, vg; lawn sweep, 42”. Shop and Carpentry Tools: Beaver 16” band saw; Trift weld 180 welder; Superior 14” chop saw; Craftsman 1-1/2 HP 14” band saw; Skil mitre saw; Trade Master scroll saw; Mastercraft oscillating sander; Bisquit joiner; Craftsman router; belt sander; Rockwell elec. plane; wood lathe 48”; Craftsman belt/disc sander; Roto zip; Dremel. Antique, Collectable and Household: antique chest of drawers; rocking chair; wood trunk; ice saw; ice box; 2 pair muklucks; 28 gal. cream cans; crocks, several; box of antique tools; 2 brass bells; sad iron; China cabinet; 3 wicker tables; Gibson 18 cu. ft. deep freeze. Conducted by: Balicki Auctions, Prince Albert, SK., 306-922-6171 or 306-961-7553, www.balickiauctions.com PL #915694.

DIRECTIONS: Sale will be held at Fraser Auction Service Ltd. sales yard 1/2 mile north of the junction of highways #1 & #10 on #25 Wheatbelt Road. Brandon, MB. THIS SALE WILL FEATURE: *Farm Equipment *Industrial Equipment *Trucks & Trailers *Livestock Handling Equipment *Vehicles *Lawn & Leisure *Shop Equipment & Tools *3pt hitch & Acreage Equipment *Government Surplus *Plus misc. Pallet Lots & more

MORE EQUIPMENT IS BEING ADDED TO THIS SALE DAILY! FOR A WEEKLEY UPDATED LIST WITH FULL DETAILS AND PICTURES GO TO: www.fraserauction.com

TRACTORS*Versatile 500 Tractor, 1979, Complete Rebuilt @4691 hrs, New Clutch @5270 hrs, New Hyd Pump @5286 hrs, New Front Tires 23.1 Single, 3 Remotes, PTP, Hours showing on unit 5471 (Receipts included)*1953 International McCormick W6, Loader & forks Blade, Good running order*4010 JD Tractor W/ Loader*3910 Ford Harvester Tractor, S/N BB46004HARVEST EQUIPMENT*2002 TR99 Combine, s/n 566298*1999 CAT Lexion 480, Cat Cert, Wide Body machine Mud-Hog RWA, 14’ Precision Header PU, 2200 Sep Hrs, shedded*1985 HD 8820 Combine, 2 Spd Cylinder, Chopper, Air Foil Sieve, Long auger, Sunny Brook Concave & Rub Bars, Grain Loss Monitor, always shedded*JD 6620 Combine*Case IH 2188 Combine*1990 8100 Hesston SP Swather, 25’ U2 Pick up Reel, Canola Auger - Front, Mounted Swath Roller on Back*1986 6455 Hesston SP Swather, 6 Cyl Chrysler Mtr - Gas, Cab, Air, 20’ Grain Header w/ Universal PU, 16’ Hay Header w/ conditioner, always shedded, One Owner, Very good Condition, 3100 hrs showing*(2) Kear Shears (Canola)SEED & TILLAGE EQUIPMENT*54’ Morris Harrows*53’ Morris Concept 200 Field Cultivator*21’ Disc (New Discs)HAYING EQUIPMENT*2001 Buhler/Inland Round Baler, Model 6072*486 New Idea Round Baler*Hay Moisture Tester – 9V*Bale ElevatorGRAIN HANDLING EQUIPMENT*13 x 91 Flex Wheatheart Auger S/N 4636*8 x 49 HD Sakundiak PTO Auger, s/n 1977645’ Sakundiak Grain Auger*7 x 37 HD Sakundiak Auger w/16 HP Kohler Motor w/ Wheatheart bin Sweep, s/n 25847OTHER EQUIPMENT*TD 65 Progressive 15.5’ Tri Deck Rotory Finishing Mower, S/N 9365203*S/A Converter Dolly*NH3 Wagon - NO TANK3PT EQUIPMENT*6’ Kodiak PT Mower, S/N 123158*6’ Blade Town & Sunny, S/N 12886*(2) 6’ Howse Mowers*(2) 5’ Howse Mowers*Post Hole AugerATTACHMENTS*NEW Lowe Hyd Auger 1650ch w/ 9in & 12in & 18in w/ skid steer quick attach, designed for 14-25 GPM/2,000-3,300 PSI and uses augers up to 36” in diameter, solid unit structure, heat-treated alloy shaft, HD reduction drive, 9”, 12” & 18” hex bit, Universal Quick attach plate*NEW Lowe Hyd Auger 750ch w/ 9in & 12in w/ skid steer quick attach, designed for 7-20 GPM/2,000-3,300 PSI and uses augers up to 18” in diameter, solid unit structure, heat-treated alloy shaft, HD reduction drive, 9” & 12” hex bit, Universal Quick attach plate*NEW Lowe Hyd Auger 750ch w/ 9in, 12in & 15” w/ skid steer quick attach, designed for 7-20 GPM/2,000-3,300 PSI and uses augers up to 18” in diameter, solid unit structure, heat-treated alloy shaft, HD reduction drive, 9”, 12” & 15” hex bit, Universal Quick attach plate*NEW Stout Brush Grapple XHD84 w/ skid steer quick attach, High strength ½” steel, Universal Quick attach plate, 84” x 38” x 30”, 6 7/8 Tine Spacing, Grapple opening 32”, 3034 PSI hydraulic lines, NPT ½” hydraulic flat-faced couplers, cylinder guards*NEW Stout Skid Steer Rock/Brush Grapple Bucket 72”, High Strength 3/8” Steel, Universal Quick Attach Plate, 72” x 41” x 30”, 3” Tine Spacing, Grapple Opening 39”, 3045 PSI Hydraulic Line, NPT ½” Hydraulic flat-faced couplers, cylinder guards*NEW Stout Material Bucket 84 w/ double cut-edge w/ skid steer quick attach, high strength 3/16” steel, Universal quick attach plate, 84” x 38” x 30”, dbl cut edgeSEMI TRUCKS & TRUCKS*1998 Mack Truck tractor, 6 Cyl, White w/Green, 427 HP Mack Eng, 13 Spd Trans, S/N 1M1AA18Y7WW084745, 315,037 kms showing*1996 Freightliner FL112, 330HP Cummins, 10 Spd, 3500 Gal Tank, 3” Pump, 560,000 kms showing, SAFETIED*15’ Gravel Box, Chassie w/ 25’ LongVEHICLE*1940 Chev Deluxe Suicide Doors, Partial Restoration, Newer 6 Cyl Eng, Frame, Rim - Blasted & Powder Coated, Bumper-replated, transmission Susp Rebuilt, New white wall Tires, Inside Parts included.*2004 Dodge Grand Caravan, 6 Cyl, Red, VIN:1D4GP24R34B544276, 198, 266 Kms Showing*2004 Ford F350 Truck*2002 Chevrolet Silverado 4 x 4, 1500 HD, White, Leather Heated Seats*1998 Chevy S10 LX, Rebuilt Transmission from Lyon (warrenty included) S/N 1GCDT19X7WK188169, 234865 kms showing, SAFETIED, Good Working OrderTRAILERS*10’ 2012 NEW ATV Mission Trailer, 2200 lbs, s/n 5WFBA1204CW017693*8.5’ 2012 NEW ATV Mission Trailer, 2200 lbs, s/n 5WFBA1025CW017691*HD Machinery Trailer w/ Converter, 30’ Working Deck w/ 5’ Beaver Tails, Ramps for over the Wheels, NO TOD - FARM USE ONLYINDUSTRIAL*1952 D4 CAT Bull Dozer, Rebuilt*6 Yard Eversmen Scraper, New Cutting Edge*Case 585E Fork Lift S/N JJG0213557TREEES, ROSES, EVERGREENS, SHRUBs and PATIO BLOCKS*Assortment of Fruit Trees, Shade Trees, Roses, Evergreens & Shrubs*(48) Pallets of Patio BlocksLAWN & GARDEN, & LEISURE*JD 68 Lawn Mower, s/n A684D032715M, N/A hrs showing, NOT RUNNING*Toro Lawn Tractor*MF Mower Deck*Turf Power Push Lawn MowerLIVESTOCK EQUIPMENT*(186) Light Duty Panel 9’ 6”*(2) Light Duty Panel w/ Gate 9’ 6”*(90 Pcs) 4’ General Purpose Gate*(50 Pcs) 6’ General Purpose GateSHOP EQUIPMENT*Measuring System Frame*Prairie Air Compressor, Model CK631222-60H5, s/n 225290853*Dayco, Model A PE30-Dayco Hydraulic Hose Press, s/n 3101X02322*Aeroquip, Model A Hydraulic Hose Press, s/n 87-573*Impact Gun*Bearing Driver Set*1/2” Torque WrenchTIRES & AXLES*(27) NEW Tires (Radial etc) P235/75R15, P195/75R14, P185/70R13,*(2) Tires - 1 Tire 10:00 x 20 w/ Rim & 1 tire 825 x 20 w/Rim*NH Baler Rim*18” Tire w/ Tube*(2) Truck WheelsBUILDING MATERIAL*Pallet - Cupboard Doors, Door, etc*Pallet – Insulation*(2) Pallets - Roofing PaperPUMPS & MOTORS*B & S Water Pump, 9HP*B & S Water Pump, 3HP*Irrigation Pump & Motor, Pipes, wheelsEQUIPMENT – MISC PARTS*Cylinder Bars for a 750 Massey Combine*Cylinder Bars for a 540 Massey Combine*Cylinder Bars for a 6600 JD Combine*Feeder Chain for 410 Massey Combine*Chaffer Sieve for a 7720 JD Combine*Box - Swather Cab AshtraysMISCELLANIOUS ITEMS*(2) Fuel Tanks & Stands*(6) Slip Tanks*(8) Used Outside Doors*(1) Large Freezer Door

Call our office now to consign to this very well attended consignment auction. 1-800-483-5856 or E-Mail office@fraserauction.com

DEALINE FOR ALL CONSIGNMENTS & RECEIVING ITEMS FOR PRE HARVEST SALE IS AUGUST 10TH

O N -LIN E AUCTIO N G RAIN ELEV ATO R LEG S & BIN S HOPPER S TEEL BIN S : 4 X W en in ger 4 L eg Bin s ; W en in ger M a gn u m Bin w /Ho p p er; 3 X W en in ger M a gn u m Bin w /Ho p p er; W en in ger Ho p p er Bin , 1300 b u s ; W en in ger Ho p p er Bin , S teep Co n e Bo tto m , 1850 b u s ; W en in ger Ho p p er Bin , 2400 b u s ; F ries in M a n u f. Bin ; Overhea d L o a d F a cility; W hea t L a n d Bin , 4 L egs . 12’ T rip le S kip fo r Ho p p er Bin . EL EV ATOR L EGS : 100’ L eg Cha rge fo r 9 Ho le Dis trib u to r; 60’ L eg Cha rge F o r 9 Ho le Dis trib u to r. TRUCK & BOAT: F o rd F -800 25’ Va n Bo d y w /Po w er T a ilga te; 12’ Alu m in iu m Bo a tW /T ra iler. TUBIN G, EQUIP., TOOL S & M IS C: Va rio u s S ized T u b in g Ra cks , Co n crete Cu lverts ; L a te Co m p u – Blen d M o d # T CC 2200 1 T o n M ix T a n k; M icro F eed 10 Co m p a rtm en t S ys tem ; Ja co b s o n Ha m m er M ill; M o to rs ; Pres s u re W a s her Ho s es p lu s T o o ls & M is c.

V iew By Appo in tm en t: PH: 306 -573-2034

FRASER AUCTION SERVICE LTD.

BOOK M ARK : w w w .M cDo u ga llAu ctio n .co m S AS K ATOON DIV IS ION

Not responsible for errors in description. Subject to additions and or deletions. Property owners and Fraser Auction Service not responsible for any accidents. GST & PST where applicable. TERMS: Cash or cheque. NOTE: cheques of $50,000 or more must be accompanied by bank letter of credit. Sale conducted by FRASER AUCTION SERVICE 1-800-483-5856 www.fraserauction.com

21st ANNUAL PRE-HARVEST Auction, Saturday, Aug. 17, 2013, 9 AM at Nelson’s Auction Center, Meacham, SK. Farm Equip: Combines: 1990 NH TR96 w/chopper, 1982 MF 750, 1980 MF 760, 24’ MF straight cut header. Swathers: 1982 Versatile 4400 SP, Case/IH PT. Augers: Westfield TR-1051 swing auger, Westfield 7”x41’, Sakundiak HD-745, Sakundiak HD-737, swather transport. Other: Kirby chaff/straw spreader, Koenders swath roller; Farm King Hopper Wagon, Cattle Squeeze; Farm Truck: 1983 International 1724 - 3T w/steel B&H. Vehicles: 2007 Pontiac Montana EXT; 2001 Pontiac Montana EXT; 2001 VW Jetta; 2000 Chev Suburban LT; 1999 Dodge Ram SLT. Recreation: 1990 Kawasaki quad; 1981 230 Sazuki quad. Buildings: storage buildings, pagoda party tents, 4-sided party tent, Marquee event tent; Steel storage containers, HD steel work bench, tools and misc. Shop and yard equip; Nursery surplus, rough lumber, patio blocks, household, farmer’s market table and much, much more. Consign early or book your own 2013 or 2014 auction. Call 306-944-4320 or visit: www.nelsonsauction.com PL #911669. Nelson’s Auction Centre, Meacham, SK

Loc a te d in BIRS AY, S AS K.

PLEASE DO NOT HESITATE TO ADD YOUR CONSIGNMENT TO THIS SALE TODAY Check out full listings & pictures at www.fraserauction.com

BRANDON, MANITOBA Licensed and bonded. P.L. License #918093. Member of M.A.A., S.A.A., A.A.A., A.A.C. PHONE: (204) 727-2001 FAX: (204) 729-9912 www.fraserauction.com EMAIL: office@fraserauction.com Auctioneer: Scott Campbell

FARM AUCTION, Terry and Elaine King, Smeaton, SK. Ph. 306-426-2142. Location: 1.6 kms West of Smeaton corner on Hwy #55 and .2 kms South. Date: Thursday, August 15, 2013 at 10:00 AM. Tractor: Versatile 835, 1978, 9000 hrs, quad hyds, 18.4x38 duals, new batteries and hyd. pump, purchased new. Trucks: 1989 Ford F600, 429 4V engine, 5&2 trans, 35,033 kms, WI 16’ B&H w/roll tarp, 11R22.5 radial duals; 1966 Ford 800, 391 V8, 5&2 trans, shows 111,619 miles, 15’ B&H, 1000x20 duals, vg. rubber. Combine: NH TR96, 1992, cab, air, chopper, Rake-Up PU, chopper, 1495 threshing hrs, hopper cover, shedded, S/N 533302; NH TR96 Redekop chopper. Swathers: MF 885 SP, Perkins diesel, cab, air, shows 1574 hrs, 25’ w/UII PU reel, knife, guards and canvases recently replaced, 18.4x16.1, all new rubber, S/N C000435; MF #35, 25’ PTO. Swather Transport: Flexi-Coil 2 wheel. Swath Roller: 8’ metal. Cultivators: Bourgault 36-40, 40’ Commander; CCIL 807 cult. 27-1/2’ deep tillage; JD 1000 24’. Disc: White 272 33’ double offset tandem w/cushion gangs, S/N 32188. Augers: Sakundiak 2- HD 7x41 w/16 HP Kohler and PTO; Sakundiak HD 8 - 1600, PTO; Sakundiak HD 37, 7x37 w/B&S 16 HP motor; Kendon 8x41, PTO. Bins: 3- Westeel Rosco 2000 bu. on good wood; Westeel Rosco 3300 bu; 2- plywood hopper 900 bu; 2Plywood double walled 1400 bu, hoppered, fertilizer bins w/lid openers and metal roofs; Westeel 2600 bu on Townside hopper w/double skid; Chief Westland 2200 bu on wood; Butler 1600 bu on wood; plywood 12x16 on wood floor; 12x24 dual compartment w/metal roof. Crawler Tractor: AC HD6 w/dozer (inoperative, s/n 17441. Front End Loader: Schultz FEL for 4010 JD and 8’ dozer. Brush Cutter: Brush cutter for D7 Cat, 14’ cut. Truck Boxes: 1967-1972 Ford and 1969-1972 Chev truck box. Dryer: Tox-OWik 360 w/ small seed screens, S/N 3384. Collectors Tractors and Trucks: McCormick Farmall Super SMD, diesel, seized, good rubber, S/N F29063J; 2- Farmall M gas parts; 1986 Ford F150, ext. cab; 1982 Dodge Power Ram 150, 4x4 (parts). Sprayer: Versatile 580, 500 gal., 60’, poly tank. Packerbar: Flexi-Coil 40’ P30 packers. Plow: Case 5x16 on rubber. Discer: JD 12’. Shop: Specialty OTC tools for JD 3010 and 4010, bushing drivers and tools; 36” Rigid p i p e w r e n c h ; q u a n t i t y c o m b i n at i o n wrenches; quantity of tools. Antiques and Collectables: Huron wood stove; kitchen cupboard; 8 and 2- 5 gal. cream cans; Westeel 5 gal. gas can. Service Manuals: PT/PTA Steiger series tractors; D7 Cat S/N 7M1 to 7M4324 catalogue and 17A1 to 17A11878; JD 20 series; McQuay/Norris vehicle; Versatile 256, 276, 276II; JD Skidder 640D and 648D, D8 CAT, S/N 35A, 36A and 46A; JD 740 and 640 Skidder parts; D8 Cat 14A1 and up and 15A1 Service; Delta disc trencher; Volvo 1240 Service; LM 845/846 parts; IT manuals AC/Case/JD; Chev 70, 80 and 90 series trucks. MISC: 32’ parachute; coil of metal banding; 1200 gal. poly water tank; several new bearings; JD 600 snowmobile, 1100 miles (not running). Consignor: Harvey Weir. 2- JD Model M’s, one w/ FEL; JD rototiller #550, 50”; JD 2 bottom plow. Conducted by: Balicki Auctions, Prince Albert, SK. 306-922-6171 or 306-961-7553, website www.balickiauctions.com PL 915694.

306-65 2 -4334 IN S AS KATOON OR TOLL FR EE 1-8 00-2 63-4193

L is ts u b jectto a d d itio n s & d eletio n s n o t res p o n s ib le fo r p rin tin g erro rs . lic# 314480

401 Witney Ave. - N. Saskatoon, SK. www.klassa.ca Manager: Tracey Verishine Auctioneer: Anne Klassen | Auctioneer: Bob Balion Telephone: 306.244.5527 Text: 306.280.1329 Email: info@klassa.ca License #329922

GUERNSEY AUCTION Guernsey School Yards St. Sampson Street Saturday, August 10, 2013 at 10AM FEATURING: • 1986 2294 Case 2WD Tractor • Swath Roller Plastic Drum • 1991 John Deere 30’ Pull Swather • 1991 416 Cat Backhoe • ESAB Meg Welder • 1981 510 John Deere Round Baler • 1998 Oldsmobile Intrigue • Westfield Auger 8”x60” • Versatile Auger 8”x45’ • Farm King Auger 8”x46’ • Allis Chalmers Tractor • 1982 Versatile 4400 Self Propelled Swather • 1989 Ford Econoline E350 22 Passenger Bus • 1982 Versatile Swather 4400 series • 1983 Ford F150 ½ ton Truck Propane Fueled • 2002 Windstar Sport Mini Van • 2000 Trailtech Tilt Deck 5th Wheel Trailer • John Deere L100 Series Riding Mower • 1969 Fruehauf 45 ft Flat Deck Trailer • 14 Ft Barracuda Boat • Shop Tools • Air Tools • Farm King Auger 10” x 50 • 1855 Cockshutt Tractor with Leon Loader • 2009 New Holland 8060 Swather • 1987 Massey Ferguson 8590 Combine Plus Many More Items Consigned Check out the latest pictures at: www.klassa.ca

Regina

24/ 7 O N LIN E BID D IN G

BIDS CLOSE: AUG 12TH @ 12PM Em e ra ld Pa rk, SASK.

NEW M cDouga ll Auction e e rs W a re h ous e ! Fea tu rin g: 2002 Bo m b a rd ier GT X DI S ea .Do o ; 1989 Ho n d a F o u rtra x 350 Qu a d ; 2000 BRP S ea .Do o ; 1991 Vo lks w a gen Jetta T DI Dies el; 1988 S ea Ra y 18 F T Co b ra ; 2011 Y a m a ha RS Ven tu re; Co ra l Pa n el - 5 Ba r L ight Du ty - 9’ L o n g; 2007 JD 635F Hea d er; JD Hea d er w /S u n Picku p ; JD 914 Co m b in e Picku p ; 1992 9600 JD Co m b in e; Bo b ca t Cem en t Brea ker Atta chm en t; Bo b ca t Po s t Au ger Atta chm en t; 16 S ca ffo ld in g E n d s ; M F 435 T ra cto r w /F E L ; Co m m ercia l F ro n t M o u n t S w eep er; Co m m ercia l Po s tho le Au ger; 20’ In s u la ted Office/L ivin g Qu a rters (New , Un u s ed ); 2005 In t.; 1997 IH 6500 Digger T ru ck; & M u ch M o re!

UPCOM ING EVENTS

REGIN A: C o fR E q u ip m en tS u rp lu s ; Cho ice F a m ily M ea ts Bu tcher S ho p ; M o to rcycle S ho p ; Ca s a L a tin a Res ta u ra n t; Ho rs e & T a ck. S AS K ATOON : Gra in E leva to r L egs & Bin s ; Res ta u ra n tE q u ip m en t; 4 Rea l E s ta te L o ts . M OOS OM IN : 1987 17’ T hu n d er Cra ft Bo a t; 1696 F o rd 3 T o n T ru ck; JD 450 Ca t w /Bu cket; Res ta u ra n tE q u ip .

Ge t Your Bids In Toda y!!

Ca ll N o w To Bo o k Yo u rL ive o rOn lin e Au ctio n !

P H: (306) 75 7-175 5 orTOLL FR EE (8 00) 2 63-4193 W W W .M CD O UG ALLBAY.CO M L IC.#31448 0

A U CTIO

G UN & HUN TIN G S UP P LY

N

S UN D AY AUG US T 25 TH @ 8 AM HW Y #3 EAS T, TIS DALE

 

TAKING CONSIGNM ENTS OF GUNS, ARCHERY, HUNTING SUPPLIES N O R ES TR IC TED W EAP ON S OR H AN D G UN S

M US T HAV E A V AL ID P.A.L . TO PURCHAS E FIREARM S N O TE YOU W E W IL L S TART TAK IN G CON S IGN M EN TS FOR THIS AUCTION N O TE S TARTIN G M ON DAY AUGUS T 19 TH.   N O TE VIEW ING DAY SAT. AUGUST 24 ONLY


CLASSIFIED ADS 35

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

MACK AUCTION CO. presents a Farm Equipment Auction for Alvin and Marilyn Miller 306-457-2978. Saturday, August 17, 2013 at 10 AM. Directions from Stoughton, SK. 6 miles South on Hwy. 47, 3 miles East and 1/2 mile South. Watch for signs! Also a farm dispersal consignment from Tom and Lori Flath 306-457-7598. Live internet bidding at www.Bidspotter.com. Miller Equipment consists of Case/IH 9130 4 WD tractor, Versatile 256 bi-directional tractor with FEL and grapple fork, Ford 8N tractor with 3 PTH and PTO, IH McCormick Farmall A tractor, Minneapolis Moline 705 tractor not running, IH 1480 SP combine with reverser and long auger, Versatile 2800 bi-directional 28â&#x20AC;&#x2122; swather header, 36â&#x20AC;&#x2122; MacDon 960 straight cut draper header with IH adapter, Koenders poly swath roller, 41â&#x20AC;&#x2122; Case/IH 5600 air seeder and Bourgault 2115 air cart plus granular kit, 60â&#x20AC;&#x2122; Flexi-Coil System 92 harrow packers, 70â&#x20AC;&#x2122; Flexi-Coil tine harrows, 19â&#x20AC;&#x2122; IH deep tillage cultivator, shop built 75â&#x20AC;&#x2122; SP sprayer converted from CCIL 5542 combine, 8â&#x20AC;&#x2122; Farm King 3 PTH snowblower, Rite-Way 2 batt rockpicker, shop built rock digger, square water tank and trailer, saw Mandrel, hyd. log splitter, 1000 gal. fuel tank w/electric pump, slip tanks, fuel tank and stands, 100 gal. water tank, Ritchie water bowl, 12x12 storage shed, quantity of fence posts, Farm King 10-50 swing auger, Sakundiak 7-33 auger with Honda engine, Midwest 552 grain vac, Behlin 5643 HL propane grain dryer, 1000 gal. propane tank, bin crane, 5 HP aeration fans and tubes, 1974 Ford F-500 grain truck with 28,054 miles, 1976 Chev 3/4 ton truck with flat deck, 24â&#x20AC;&#x2122; shop built tandem axle gooseneck flat deck trailer, Sanborn upright air compressor, Beach tool cabinet plus many shop tools and equipment! The following equipment is Tom and Lori Flathâ&#x20AC;&#x2122;s 306-457-7598. MF 4840 4WD tractor needs hyd. pump, JD 4440 2WD tractor with Outback GPS, NH TR98 SP combine w/1571 rotor hours and recent work orders, 36â&#x20AC;&#x2122; MacDon 960 draper header with NH adapter, 30â&#x20AC;&#x2122; MacDon 960 draper header, 30â&#x20AC;&#x2122; Case/IH 8230 PT swather, 41â&#x20AC;&#x2122; Harmon 4480 air drill with Harmon 1830 air cart, 31â&#x20AC;&#x2122; Case/IH 5600 cultivator, 41â&#x20AC;&#x2122; Morris Magnum CP 731 cultivator, 32â&#x20AC;&#x2122; of IH 310 discers, Harmon PT field sprayer, Degelman 3 batt PTO rockpicker, 1964 Mercury flat deck truck with water tank and pump, 4 Westeel Rosco 3300 bushel grain bins on wood floors. Visit www.mackauctioncompany.com for sale bill and photos. Join us on Facebook and Twitter. 306-421-2928 or 306-487-7815 Mack Auction Co. PL 311962.

MACK AUCTION CO. presents a premium Farm Equipment Auction for Art Beck, 306-465-2763, and guest consignment from the Estate of Ron Wilke, Saturday, August 24, 2013 at 10:00 AM. Directions from Yellow Grass, Sask. 3 miles South East on Hwy. 39. Watch for signs! Live internet bidding at www.bidspotter.com JD 8330 FWA tractor w/1220 hrs and Green Star ready, JD 7810 2WD tractor with JD 725 FEL and Outback GPS, antique JD R tractor, JD 9760 STS SP combine with 579 sep. hours and Green Star ready, JD 936D 36â&#x20AC;&#x2122; draper header, Westward 9300 SP swather 30â&#x20AC;&#x2122; with 960 MacDon header, Bergen 6000 ST swather transport, Parker 675 grain cart, Farm King 10â&#x20AC;&#x2122; steel roller, JD Green Star GPS, JD Star Fire GPS, 35â&#x20AC;&#x2122; Bourgault 8810 air seeder with JD 787 air tank, 35â&#x20AC;&#x2122; Bourgault quick attach tine harrows, Bourgault new cultivator shanks, 70â&#x20AC;&#x2122; Highline stubble buster heavy harrows, 70â&#x20AC;&#x2122; Flexi-Coil 95 packer bar, Doepker 70â&#x20AC;&#x2122; diamond harrow bar, Doepker 42â&#x20AC;&#x2122; rodweeder, 2009 Brandt 5000 EX grain vac, Spray Air 4261 swing auger, Super Deluxe 990 grain vac for parts, auger w/18 HP Kohler eng. and Beck seed treater, Bruns 4 wheeled grain wagon, PTO aeration fan, 14â&#x20AC;&#x2122; drill fill, 1977 Ford F-600 grain truck, 1971 Fargo 500 grain truck, Rowse earth scraper, JD 707 gyromower, JD air seeder granular kit, 12â&#x20AC;&#x2122; dozer blade, 30â&#x20AC;&#x2122; metered feed granular spreader, Chem Handler I, 3 PTH 2 Bottom Plow, 1000 gallon fuel tank and stand, Ford flathead engine, Perfect trip hammer. The Estate of Ron Wilke items: 2012 MF Hesston WR9735 SP swather and 36â&#x20AC;&#x2122; Agco 5200 draper header with only 11 hours, 2008 Chev Avalanche LT 1500 4WD truck with 88,000 kms, 1976 Chev C-65 3 ton grain truck, 1970 Mercury 3 ton grain truck not running, Case 1470 4WD tractor with Leon 12â&#x20AC;&#x2122; Dozer, JD 920 diesel tractor with 3 PTH and PTO, JD 730 2WD diesel tractor, Westeel Magnum L 65 ton fert. hopper bottom bin, 2 metal Industries 1500 bu. hopper bottom bins, JD 1610 41â&#x20AC;&#x2122; cult., White tandem disc, Schulte 20â&#x20AC;&#x2122; 3020 rotary mower, Farm King 3 PTH 8â&#x20AC;&#x2122; cult., Kirchner ditcher, Buhler Farm King 3 PTH finishing mower, MF Super 92 SP combine, MH SP combine, Simplicity Javelin Zero turn mower, 20â&#x20AC;&#x2122; sea container, Brandt 8-51 swing auger, Brandt 8-35 grain auger with 20 HP Onan eng., Brandt 8-35 grain auger with mover and Kohler engine, Sakundiak HD7-1400 auger, Sakundiak HD7-1400 with 18 HP Onan eng., shopbuilt header trailer, shopbuilt swather mover, GMC 1/2 truck box, 6 new 10.00x22.5 tires, quantity of 6x6 treated posts, quantity 2x6 lumber, Chem Handler I, Toro Push mower, Honda portable air compressor, complete line of shop tools, plus much much more!! Visit www.mackauctioncompany.com for sale bill and photos. Join us on Facebook and Twitter. 306-421-2928, 306-487-7815 Mack Auction Co. PL 311962.

MERLIN AND IDA PERRY, Saturday, August 17, 2013, 11:00 AM, 20 miles South on #640 GRID, 1 mile East or 13 miles North Punnichy on #640 Grid, 1 mile East, Wynyard, SK. Call 306-835-2677. Online bidding at 1:00 PM. Tractors: IHC 1586, cab, air, diesel, factory duals, 8100 hrs, front weights, nice; 1976 Case 970, cab, air, excellent tires, std, 18.4x38 tires, 5700 hrs, w/wo 8â&#x20AC;&#x2122; blade, real nice; 1957 Case 400, diesel, 18.4x30 tires, FEL, like new rubber, (exc. tin). Combines: 1979 NH 1400, diesel, cab, air, chopper, Victory PU, with 19â&#x20AC;&#x2122; straight cut header, large tires, heater, radio; NH 1400, diesel, cab, air, chopper, PU and 17â&#x20AC;&#x2122; straight cut header, large tires, heater, radio; NH 1400, cab, diesel, PU. Grain Truck: 1974 Dodge 600, 318, 4x2, steel B&H, wood floor, Sherlock tarp, 28,000 miles, real nice. Augers: Heenan 8x65 PTO swing-away auger, new flighting in swing-away, real nice; Westfield 7x41, 16 HP ES; Westfield 7x46 electric motor. Vehicles: 1997 Chev Silverado Z71 4x4, 350 V8, full loaded, Command Start, 3rd door, excellent rubber, 287,000 kms, real nice; 1995 SLE Chev 2WD, 6.5 diesel, toolbox, 348,000 kms, excellent; 1995 Buick Park Avenue, 4 door, fully loaded, 226,000 kms, new struts, new tires, new windshield, real nice. Bins: Twister 1100 bu. seed bin, hopper, skids, bin indicator; Westfield 1650 bu. hopper bin, skids, bin indicator; Westfield 1650 bu. hopper, skids, aeration fan, bin indicator; Westfield 2600 bu. with rocket, aeration fan, hopper and skids. Recreation: JD X320, 23 HP riding lawnmower, hydro, 48â&#x20AC;? deck, Kawasaki eng., 190 hrs, excellent; 2 wheel tilt ATV trailer. Plus drills, tillage, shop, misc. equipment. Note: Merlin sold the farm. Machinery used on small acreage and is above average condition. Really nice for the year, not many small items. Visit www.ukrainetzauction.com for updated listing and pictures. PL #915851.

P UBL IC AUTOM OTIVE & RV AUC TION A PPROX IM ATEL Y 1200 U N ITS

S ATURDAY AUG 1 7TH ,201 3 ED M O N TO N ,A L BERTA

EUGENE HUSAREWICH AUCTION on Sunday, August 18, 2013, 10:00 AM, 1-1/2 miles East, 1 mile North, 1 mile East, 3/4 mile North of Invermay, SK. Contact 306-593-4430. Online bidding 1:00 PM. Tractors: Case 1175, cab, standard, dual hyd., 23.1x34 tires, nice; IHC 806 diesel, cab, fan, 23.1x30 tires, 8500 hrs, had motor job, S/N 7818, nice; Super W6 TA, like new Leons 606 FEL; MMU. Combine: IHC 715, cab, PU, chopper, gas, shedded; IH 815, parts; JD 96 PTO combine. Truck: 1967 GMC 5500, V8, 4x2, 15â&#x20AC;&#x2122; wood B&H, real nice; IHC 1010 half ton, parts; 1953 Chev 1 ton, B&H. Stonepicker: Degelman stonepicker, real nice. Harrows: Flexi-Coil System 82, 50â&#x20AC;&#x2122;, 5-bar harrows, excellent; Allied 13 section diamond hangup bar. Antique: Trip Hammer (AB Jardine & Company, Hespeler Ont). Plus tillage, augers, swathers, yard, misc. equipment, shop lathe and shop items. Eugene sold the farm. Major equipment is shedded, nice shape, and well looked after. For updated listing and pics K-B TRUCK PARTS. Older, heavy truck salvage parts for all makes and models. visit www.ukrainetzauction.com Call 306-259-4843, Young, SK. C H E C K OUT OUR parts specials at: www.Maximinc.Com/parts or call Maxim Truck & Trailer, 1-888-986-2946. WRECKING LATE MODEL TRUCKS: 1/2 tons, 3/4 tons, 1 tons, 4x4â&#x20AC;&#x2122;s, vans, SUVâ&#x20AC;&#x2122;s. Also large selection of Cummins diesel motors, Chevs and Fords as well. Phone Edmonton- 1-800-294-4784, or CalgaryBUTCH E R S H OP ONL INE AUCTION 1-800-294-0687. We ship anywhere. We have everything, almost. VIE W ING AUG 10 SOUTHSIDE AUTO WRECKERS located 10a m â&#x20AC;&#x201C; 5p m Weyburn, SK., 306-842-2641. Used car parts, light truck to semi-truck parts. We B id s Clos e Aug. 12th buy scrap iron and non-ferrous metals. L OCATION : 320 Grea t Pla ins Roa d in TRUCK PARTS AND ENGINES: 1/2 ton Em era ld Pa rk S a s ka tc hew a n. to 3 ton; Gas engines: 304, 345 IH, 370 S h o uld yo u w is h to d is cus s a n y Ford; Diesel engines: 5.9 Cummins, 6.5 GM, 3116 Cat, 6.6 Ford (inline 6), DT 360 a n d a ll, ple a s e ca ll Alle n a t IH; 4 and 5 spd. trans., single and 2 spd. 306-5 41-7 838 d urin g b us in e s s h o urs . axles and many other parts. Phoenix Auto, Y o u a re b id d in g o n eq u ip m en t tha t is Lucky Lake, SK., 1-877-585-2300. cu rren tly b ein g u s ed , a n d is in w o rkin g WRECKING 1989 FORD L9000, good front co n d itio n , b id w ith co n fid en ce. end and cab; 1983 3 ton IHC, V8 diesel, 5 G e t you r b id s in TO D AY!! spd., single axle; Volvo trucks: Misc. axles and trans. parts; Also tandem trailer susw w w.M c D ou g a llAu c tion .c om pension axles. 306-539-4642, Regina, SK.

SCHOOL BUSES: 1986 to 2001, 18 to 66 pass., $1600 and up. Phoenix Auto, Lucky Lake, SK., 1-877-585-2300. DL #320074.

1964 CHEVROLET BEL AIR, 4 door, $1200 OBO; 1963 Chevrolet Biscayne, 4 door, partially restored, $1000 OBO. Call 306-548-4214, Stenen, SK. 1990 LINCOLN TOWNECAR Signatuare Series, fully loaded, grey, like new cond. 306-795-3349, 306-795-7349, Ituna, SK. 2003 BUICK PARK Avenue Ultra, loaded, 148,000 kms, new brakes, new tires, good cond., $4200. 403-948-7674, Airdrie, AB. 2008 BUICK ALLURE CXL, loaded, 228,000 kms, excellent condition, $4500. 306-257-3693, Elstow, SK. 2009 JEEP PATRIOT, 4 dr. SUV, 4 WD, copper brown, 160,000 kms, $8800; 2009 Dodge PT Cruiser, blue, 114,000 kms, $8800. Larry at 306-563-8765, Canora, SK.

R egina

1-800-26 3-4193

2010 LODE-KING PRESTIGE grain trailers Super B, new AB safety, auto greaser installed since new. Super clean units. Call Dave 780-216-1155, Falun, AB. NEW WILSON SUPER Bas, tridem and tandem; 2011 Doepker Super B, alum rims; 2009 Castleton 40â&#x20AC;&#x2122; tandem, air ride; 2008 Lode-King alum. open end Super B, alum. rims, air ride, also 2009 w/lift axles; 1998 Castleton Super B, air ride; 1994 Castleton tridem, air ride; 1989 Lode-King tridem, VS TRUCK WORKS Inc. parting out GM springride, new paint; Tandem and S/A 1/2- 1 ton trucks. Call Gordon or Joanne, converter, drop hitch, certified; 17â&#x20AC;&#x2122; A-train pup, very clean. 306-356-4550, Dodsland, 403-972-3879, Alsask, SK. SK. DL #905231. www.rbisk.ca

AGRICULTURAL LAND & EQUIPMENT

Download the free app today Up-to-date news, weather, classiďŹ eds and more.

H E AV Y D U T Y PA R T S o n s p e c i a l at www.Maximinc.Com/parts or call Maxim Truck & Trailer, 1-888-986-2946. SASKATOON TRUCK PARTS CENTRE Ltd. North Corman Industrial Park. New and used parts available for 3 ton highway tractors including custom built tandem converters and wet kits. All truck makes/models bought and sold. Shop service available. Specializing in repair and custom rebuilding for transmissions and differentials. Now offering driveshaft repair and assembly from passenger vehicles to heavy trucks. For more info call 306-668-5675 or 1-877-362-9465. www.saskatoontruckparts.ca DL #914394 TRUCK BONEYARD INC. Specializing in obsolete parts, all makes. Trucks bought for wrecking. 306-771-2295, Balgonie, SK. WRECKING TRUCKS: All makes all models. Need parts? Call 306-821-0260 or email: junkman.2010@hotmail.com Wrecking Dodge, Chev, GMC, Ford and others. Lots of 4x4 stuff, 1/2 ton - 3 ton, buses etc. and some cars. We ship by bus, mail, Loomis, Purolator. Lloydminster, SK. WRECKING SEMI-TRUCKS, lots of parts. Call Yellowhead Traders. 306-896-2882, Churchbridge, SK. 1996 DUALLY TRUCK BOX, exc. condition, dark blue, spray-in boxliner, JackRabbit tonneau cover. Ph: 306-755-2071 or 306-228-9096, Tramping Lake, SK.

SLEEPERS AND DAYCABS. New and used. Huge inventory across Western Canada at www.Maximinc.Com or call Maxim Truck & Trailer, 1-888-986-2946. ONE OF SASKâ&#x20AC;&#x2122;s largest inventory of used heavy truck parts. 3 ton tandem diesel motors and transmissions and differentials for all makes! Can Am Truck Export Ltd., 1-800-938-3323.

SIJTZE & LOUISE KEULEN OF BASHAW, AB

REMOTE CONTROL TRAILER CHUTE openers can save you time, energy and keep you safe this seeding season. FM remote controls provide maximum range and instant response while high torque drives operate the toughest of chutes. Easy installation. Brehon Agrisystems call 306-933-2655 or visit us online at: www.brehonag.com Saskatoon, SK. 2010 DOEPKER SUPER Bs, heavy stainless fenders, dual cranks, alum. rims, fresh safety. 306-220-9635, Prudâ&#x20AC;&#x2122;homme, SK.

MONDAY AUGUST 12, 2013 @ 10:00am DIRECTIONS: From Bashaw Go Approx. 6 Miles South to Milton Gatsby Rd, Then go 300 Yards East to Range Road 220 & Go 4 Miles South to Yardsite W> ^Z/Wd/KE dKd> h>d/sd dy^ '^t>> Z^ Z^ ZsEh Ď­

^tͲϯϏͲϰϏͲώϭͲϰ

Ď­ĎŽĎŹÍ&#x2DC;Ͼϴ

ϾϹZ^

ΨώÍ&#x2022;ĎŹĎŹĎľÍ&#x2DC;Ď´Ď´

ΨϰÍ&#x2022;Ď°ĎŹĎŹÍ&#x2DC;ĎŹĎŹ

ĎŽ

EtͲϯϏͲϰϏͲώϭͲϰ

Ď­Ď°Ď­Í&#x2DC;ώϹϭ

Ď­ĎąZ^

ΨĎ­Ď°ĎŹÍ&#x2DC;ĎŹĎ´

ΨϰÍ&#x2022;ĎŽĎŹĎŹÍ&#x2DC;ĎŹĎŹ

ĎŻ

^ͲώϹͲϰϏͲώώͲϰ

Ď´Ď°Í&#x2DC;Ď´Ď´

ϳϹZ^

ΨĎ­Ď­ĎąÍ&#x2DC;ĎŽĎŽ

ΨώÍ&#x2022;ϾϏϏÍ&#x2DC;ĎŹĎŹ

Ď°

EͲώϰͲϰϏͲώώͲϰ

Ď­ĎŹÍ&#x2DC;ϲϹ

ĎąZ^

ΨĎ­ĎŹÍ&#x2DC;ϳϏ

Ďą EtͲϭϾͲϰϏͲώϭͲϰ ϭϏϲÍ&#x2DC;ϲϯ ϳϲZ^ ΨĎ­ĎŻĎłÍ&#x2DC;ĎŽĎľ  PARCEL 1 Improvements: Approx. 2,150 Sq. Ft. TERMS ON REAL ESTATE Bungalow , Five Bedrooms, Four Baths, Attached 1. 15% Non-refundable Deposit Saleday. Two Car Garage, Developed Basement. Built in 2. Balance On Or Before September 30th, 1988 With Manicured Yard And Mature Trees. 2013. Yardsite Only, Lands Subject To With Wood Lot Along The Lake. Approx. 32x25 Existing Land Rental Agreement Until House With Attached 10x16 Porch Entrance, 3. December 31, 2013. 50x80 Cold Storage. 60x40 Shop With 8x10 4. Possession By September 30, 2013. Overhead Door, 12x12 Overhead Door 40x14 5. High Bid Subject To Sellers Approval Sliding Door. Has In Floor Heat . Also comes with 6. Parcels to be sold individualy, as numerous outbuildings! &217$&76LMW]H /RXLVH.HXOHQ# 23(1+286(6XQ$XJXVW30 FEATURED EQUIPMENT:53"$5034'&/%5t.08&3$0/%*5*0/&3/)85%JTD

2010 LODE-KING SUPER B, lift axle, current CVIP, 80% tread, approx. 300,000 kms, asking $68,000 OBO. 780-842-6773, Wainwright, AB. 2009 DOEPKER SUPER B, lift axles, dual cranks, aluminum rims, $59,500. Call 306-338-8022 days, 306-338-2288 evenings, Kuroki, SK. 2001 DOEPKER SUPER B grain trailers, brakes recent, tires 80% or better, new tarps 2 yrs. ago, $24,900. 780-994-3225, Wetaskiwin, AB. 2005 LODE-KING OPEN end Super Bs, new Michelin rubber, auto greaser, fresh safety, $50,000. 306-398-4079, Cut Knife, SK.

2006 PETERBILT and 2006 DOEPKER Super B grain trailer, $119,000; Peterbilt 379 w/550 CAT engine, new motor at 850,000 km, new trans., new clutch, new power divider in the last 200,000 km. Recent brakes on truck and trailer. Tires in good condition. Would like to sell as unit. Contact Carl: 403-362-1717, Brooks, AB.

#JOFt5"/%&.%*4,46/'-08&3t)":3",&$-"44-*.&33PUBSZ3BLFt -"3(&426"3&#"-&3)&4450/t."/63&8"(0/580/6)/4t&*4&-.0%&-t.*9 8"(0/53*0-&5.0%&-t30$,1*$,&3)*()-*/&9-t#*/4 #V"TTPSUFE4UFFM#JOT 2009 C eda r C reek Da y Drea m er 40Q S D Fifth W heel Tra iler

2010 Ford S u per Du ty F-250 S RW 4W D S u perC a b XL T

W W W .M AAUCTIO NS .CO M 1 - 8 00- 6 6 5- 58 8 8

hodginsauctioneers.com

   3+0,s!"0,

2013 WILSON BELT trailer, air ride, alum. wheels, 42â&#x20AC;&#x2122;Lx102â&#x20AC;?Wx78â&#x20AC;?H, $46,000. 204-736-4854, www.vermilliontrucks.com Sanford, MB.


36 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

DOEPKER GRAIN PUP trailer, aluminum 2008 CANCADE TRI-AXLE pup grain trailrims, tires in good shape, $8000 OBO. er, 20’ box, roll tarp, stone guard on front, 306-743-7622, Langenburg, SK. less than 30,000 kms, dark grey, exc. cond. Call 306-698-7778, Wolseley, SK. 2014 DOEPKER TRIDEM grain trailer with lift axles, many colors and features to 2007 TIMPTE three hopper tri-axle grain choose from; 2009 Doepker tridem lead trailer, fresh safety, $35,000. Phone: grain bulker, steel wheels, flat fenders, 306-734-7759 cell, Craik, SK. 22.5 rubber; 2014 Doepker Super B’s in stock with Minimizer fenders. Many more 2004 ADVANCED Tri-axle, 2 hopper, w/duused and new trailers arriving daily. In al cranks, 12 new tires, brakes 90%, Michstock, 2014 Doepker end dumps; 2014 els Tarp, good cond., $36,000 OBO. Call Globe lowboys, 55 ton now avail. for your 306-678-4506, 403-928-2607, Hazlet, SK. specialty heavy hauling needs. New oilfield 1-888-CAN-TARP (226-8277) tridem scissor necks, 40 and 50 tons, 10 (306) 933-2343 | Fax: (306) 931-1003 wides in stock; 2007 to 2011 used trucks in stock, various makes. Visit our website at: www.customtruck.ca 1-800-665-6317. 2005 LODE-KING PRESTIGE Super Bs, new safety, rubber 75%, great UC, good shape, SIDE-ROLL TARPS AND SYSTEMS $42,000. 306-594-4225, Benito, MB.

“Canadian Made”CALL FOR PRICING REPAIR SERVICE TO ALL INDUSTRIAL FABRIC PRODUCTS

2000 ARNE’S TRIDEM end dump, air ride, certified. 306-356-4550, Dodsland, SK. DL #905231. www.rbisk.ca

MANUFACTURERS LTD.

Southern Industrial is the proud supplier and service shop for Neville Built trailers.

DECKS, DRY VANS, reefers, storage trailers at: www.Maximinc.Com or call Maxim Truck & Trailer, 1-888-986-2946. HAUSER GOOSENECK TRAILERS. Featuring 2 trailers in 1: Use as HD gooseneck trailer and/or bale transporter. Mechanical side self-unloading. LED lighting. Ramps optional. $18,560. Call Hauser’s Machinery, Melville, SK., 1-888-939-4444. www.hausers.ca 1997 WABASH TRIDEM spring ride pup trailer frame, excellent for 20’-21’ box, new sandblast and paint, all new brake pots, 80% brakes and drums, 4 new 11Rx24.5 recaps, 4 at 80%, 4 at 60%, on alum. wheels, $16,000. E-mail pics available, 403-638-3934, ask for Jeff. Sundre, AB.

CANADIAN TARPAULIN

2001 36’ LOADHANDLER grain trailer, air ride suspension, farm use only. 306-436-7681, Milestone, SK. 1996 CASTELTON 44’ grain trailer, 2 hopper tridem, farm use only, $20,000. 306-268-7400, Bengough, SK.

53’ AND 48’ tridem and tandem stepdecks; Two 48’ tandem 10’ wide, beavertail, flip ramps, air ride, low kms; 1991 Trail King machinery trailer, hyd. tail; 53’, 48’, 28’ tridem and tandem highboys, all steel and combos. SUPER B HIGHBOYS; Tandem and S/A converter with drop hitch; 53’-28’ van trailers; B-train salvage trailers; Tandem lowboy, 9’ wide, air ride; High Clearance sprayer trailer w/tanks and chem handlers. 306-356-4550, Dodsland, SK. DL #905231. www.rbisk.ca

Michel’s Industries and Shur-Lok (Replacement Tarps and Parts).

10

%

BEFORE AUGUST 30TH 2013

LOWBEDS, LOWBEDS: 2 and 3 axle, detachables, beavertail, single/double drops, $10,000 new skidsteer trailers, 2 axwww.cantarp.com le, $4500.plus; 306-563-8765, Canora, SK. Email: sales@cantarp.com 2012 CROSS COUNTRY Tridem end dump, used very little, full heavy liner, full fenders, crank tarp, factory grain shoot in tailgate, $45,000. Call 306-423-5339 leave 2005 BARRETT 53’ alum. flat side ground message, Domremy, SK. load livestock trailer, extra height, 5 compartment, full board kit and toolbox, good 20’ GRAVEL WAGONS, $7500 to $9500; cond., safetied, $40,000. 204-724-3171, Pup, $6500; 1982 Decap belly dump, $9800; 2008 Tri-axle clam dump, $28,700. Neepawa, MB. 306-222-2413, Saskatoon/Aberdeen, SK. 2010 WILSON TRI-AXLE cattleliner, new Pictures www.trailerguy.ca brakes, good tires, excellent condition. 2009 FELLING FT-40-2, tandem axle, pin306-768-2790, 306-768-7726, Carrot River tle hitch, beavertail w/ramps, 17 1/2” rubWWW.DESERTSALES.CA Trailers/Bins b e r, v g c o n d . C a l l 3 0 6 - 4 8 4 - 4 4 4 4 , Westeel hopper bottom bins. Serving AB, 306-725-7797, Govan, SK. BC and SK. Wilson, Norbert, gooseneck, 1996 LANGFAB quad axle flatdeck trailer, stock and ground loads. Horse / stock, 10’ wide x 30’ long deck, 12’ ramping tail, cargo / flatdeck, dump, oilfield, all in air over hyd. tail, tandem rear axles w/tanstock. 1-888-641-4508, Bassano, AB. dem axle converter and pintle hitch 2006 WILSON TRI-AXLE Cattleliner, fold tongue, exc. rubber, 54” deck height. up doghouse, feeder nose, alum. wheels, Would be excellent for moving machinery e x c e l l e n t c o n d i t i o n , $ 3 4 , 0 0 0 O B O. behind 4 WD tractor, $10,500. Email pics available. 403-638-3934, Sundre, AB. 1-888-404-4972, Calgary, AB.

UP TO

OFF

SEE WEBSITE FOR MORE DETAILS

Trailers In Stock: • 38.5’ tandem on air, 78” high side, side chutes, loaded.............$35,500 • 45’ Tri-Axle, 78” high sides, 2 hopper, air ride................$43,500 New Trailers Arriving Daily! Call for quotes.

53’ Sprayer Trailer 5’ Beaver Tail and 5’ Ramps.

46,600

$

Call Today for your Equipment Trailer Needs.

306-842-2422

www.southernindustrial.ca Hwy. Jct. 13 & 39 Weyburn, SK NEW 2014 NEVILLE, 2 and 3 axle, both spring and air ride, cheapest in Western Canada. Call 306-563-8765, Canora, SK.

2003 DOEPKER TRIDEM, three hoppers, Michel’s tarp, 24.5 tires, a must see. Accepting offers. 306-584-5050, Regina, SK. 2013 TIMPTE ALUMINUM 40’ tandem grain trailer, brand new, $43,500; Other trailers avail. 306-435-3700 Moosomin, SK 1994 LODE KING triaxle grain trailer, w/Michels remote augers, $28,000 OBO. Phone 403-362-9211, Bassano, AB. 1996 CASTELTON 40’, good condition, MB. safetied, shedded. 204-548-2592 or 204-638-2592, Gilbert Plains, MB. BRAND NEW 2013 Emerald 3 hopper tridem Call Neil for details, 306-231-8300, Humboldt, SK. DL#906884 2007 AND 2008 DOEPKER Super B’s, open end, air ride, 11x24.5. 306-728-5366 or 306-728-6766, Waldron, SK. 2008 DOEPKER SUPER B, open ends, aluminum slopes, checker plate fenders, 24.5 duals, low mileage, 1 owner, nice shape, $60,000 OBO. 403-935-4567, Irricana, AB. 2008 DOEPKER SUPER B grain trailer. Call Hodgins Auctioneers, 1-800-667-2075. PL #915407.

SALES & RENTALS WE SELL AND RENT

2005 SOUTHLAND 28’ aluminum stock trailer w/8000 lb. tri-axles, lots of extras, exc. shape. 306-342-4456, Glaslyn, SK.

Hi Boys, Low Boys, Drop Decks, Storage Vans, Reefer Vans and Freight Vans & More. 7 KM West of RED DEER from Junction of HWY. 2 & 32nd St.

403-347-7721

SANDBLAST AND PAINT your grain trailers, boxes, flatdecks and more. We use industrial undercoat and paint. Can zinc coat for added rust protection. Quality workmanship guaranteed. Prairie Sandblasting and Painting, 306-744-7930, Saltcoats, SK. NEW 2014 NEVILLE 38’ tandem, air ride, 78” high sides, $33,500; 45’ tri-axle, $43,500. 780-913-0097, Edmonton, AB. 1996 DOEPKER TRIDEM, spring ride, good rubber and tarp, recent paint, vg cond., $35,000. 306-598-2195, Annaheim, SK.

LACOMBE TRAILER

NEW BLUEHILLS GOOSENECK stock, 20’, $13,900; 18’, $11,900. Call 306-445-5562, Delmas, SK.

COMPONENTS FOR TRAILERS. Shipping daily across the prairies. Free freight. See “The Book 2013” page 195. DL Parts For Trailers, 1-877-529-2239, www.dlparts.ca STAINLESS STEEL CLEAN Potable Water Super B tankers, $44,000. Will split $23,700/ea. Pictures at www.trailerguy.ca 306-222-2413, Saskatoon/Aberdeen, SK. 40 FLATDECK SEMI TRAILERS, hi-boys and stepdecks, $2100 to $25,000. Pics and prices at www.trailerguy.ca 306-222-2413, 2004 WILSON TRIDEM cattlepot, full nose Aberdeen/Saskatoon, SK. decking, fold down doghouse, fresh AB. safety, $35,000 OBO. Call 403-575-7677, ALL ALUMINUM TANDEMS, tridems and Consort, AB. Super B Timpte Grain Trailers. Call Maxim Truck & Trailer, 1-888-986-2946 or see: 1998 2500 DODGE RAM, V10 Magnum, www.Maximinc.Com 242,000 kms.; 2002 Blue Hills 26’ T/A stock trailer. Current safety on both. Prefer GOOD TRAILERS, REASONABLY priced. to sell as one unit. Keen 16’ stock trailer, Tandem axle, gooseneck, 8-1/2x24’, Beavertail and ramps, 14,000 GVW, $6900; or as is. 204-874-2287, Minnedosa, MB. triple axle, $7900. All trailers custom built from 2000 to 20,000 lbs., DOT approved. Call Dumonceau Trailers, 306-796-2006, 2006 ADVANCE and HUTCHINSON alum. Central Butte, SK. TC406 crude tankers, 34,000 liters, air 2005/2008 ARNE’S End dump tri-axle ride, certified. 306-752-4909, Melfort, SK. trailer, roll or flip tarp, new paint, alumiwheels, 11R22.5, spray tank, new 1991 STAINLESS TANKER, Tremcar Super num B insulated tankers, 4500 Imp. gal. per safety. 204-937-7417, Roblin, MB. tank, Spring Ride Reyco susp., recent safe- 2006 SATURN MOBILE home dolly, tri-axty, 22.5 Dayton wheels. Set up to transport le, 9’ wide, exc. cond., new safety, 1999 liquid fertilizer, water, etc. Comes with Freightliner, 11’ deck c/w gin poles, headHonda motor w/John Blue pump, $35,000. ache rack, winch, will separate, $50,000. 306-861-5911, Weyburn, SK. Call 780-305-3594, Mayerthorpe, AB.

2002 DOEPKER 42’ tri-axle grain trailer, open front end, 3rd hopper in rear, 24.5 alum. budds, electric tarp, Michel’s augers for middle 2, custom built auger for rear. All new brakes, drums, cams and pots. Minimal rock chips, excellent shape, $35,000 OBO. Call or text Robin at 306-463-8128, Kindersley, SK. 2013 PRESTIGE LODE-KING SUPER B grain trailers, 11R22.5 tires, air ride, exc. cond., 8 sets to choose from $85,000 each OBO. Call 403-236-4028, Calgary, AB.

Tr

Leasing Available “#1 Seller in Western Canada”

Wilson Ranch Hand Goose Neck

2004 DODGE 2500, 5.9 dsl., auto, A/T/C, PW, PL, P seats, quadcab, 2 WD, longbox, NEW ENCLOSED SERVICE trailer. Wells trailer pkg., 222,000 kms, white, $11,000. Cargo 16’ long, electrical hookups, int. 306-270-5951, Saskatoon, SK. lights, panels gen hook up, ext. light, 12” 2005 DODGE 1500 Crew, short box, 4x4, centers, mounting brackets, two 5200 lb. gas, $4900; 2006 Dodge 5.9 diesel, Crew, axles, $8990. Call Corner Equipment, long box, $18,000. Call Neil 306-231-8300, Dwight, 204-483-2774, Carroll, MB. Humboldt, SK. DL#906884

Load Trail Goose Neck, Car Haulers and Bobcats

2005 DODGE RAM 2500 quad, 4x4, $12,888. www.thoens.com, Wynyard, SK. 1-800-667-4414, DL# 909250.

Snow Hauler and Cargo Trailers MIDLAND CLAM GRAVEL trailer, 3 axle, S/P ride, near new brakes, drums, tires, alum. rims, vg cond., can deliver $29,000. 2005 ESCALADE EXT, immaculate diamond white, full load, NAV, 6 disc CD, sunCypress River, MB. 204-743-2324. roof, new tires, shocks, regular mainteU N I V I S I O N E Q U I P M E N T T R A I L E R nance, 198,000 kms. mostly highway, no rust, exc . paint, $18,000 OBO. Call w/hyd. beaver tail, winch, all new: tires, Ph: Don - 780-672-4596 Camrose, AB breaks and break drums, farm plated, does 306-562-7651, Canora, SK. Ph: Pat 780-878-1126 Wetaskiwin, AB n e e d s o m e r e p a i r, $ 1 5 , 5 0 0 O B O , 2006 FORD F350 AWD, white, 224,555 780-334-0400 Ft. McMurray, AB 306-747-2514, Shellbrook, SK. kms, STK# SK-U01140A, $18,995. Call www.raystrailersandtractors.com PRECISION TRAILERS: Gooseneck and 1-866-980-0260. DL #914077. Website bumper hitch. You’ve seen the rest, now www.subaruofsaskatoon.ca own the best. Hoffart Services, 2006 GMC 3/4 Crew, 4x4, 176,000 kms. 306-957-2033, www.precisiontrailer.com Reduced $9999. PST paid. Wynyard, SK. 2011 KAUFMAN heavy equipment pintle Phone: 1-800-667-4414, www.thoens.com trailer w/dual wheels and tandem axle, DL#909250. 25’, air lift ramps, fresh safety, $16,000. 306-594-7981 or 306-594-2628 after 8 MUST SELL 2005 DODGE dually, 4x4, long box, only 150,000 kms, diesel, 4 door, PM, Norquay, SK. loaded, 306-654-7772, Saskatoon, SK. TOPGUN TRAILER SALES “For those who demand the best.” PRECISION AND AGASSIZ TRAILERS (flatdecks, end NEW END DUMPS available for fall harvest dumps, enclosed cargo). 1-855-255-0199, 1951 GMC 1 ton truck, $1700 OBO. tandem, Shurlok tarp, steel wheels, 34’ Moose Jaw, SK. www.topguntrailersales.ca 306-548-4314, Stenen, SK. grey, $36,900. For details. Corner Equipment, Dwight, 204-483-2774, Carroll, MB. C H E C K OUT OUR parts specials at: www.Maximinc.Com/parts or call Maxim Truck & Trailer, 1-888-986-2946. 2005 CHEV 2500 ext. cab, 4x4, shortbox, LOWBEDS: 5 Tri-axles, $37,500-$47,000; PW, PD, well maintained clean truck, 5 -16 wheelers, $14,500-$48,000; 8 and 319,000 kms, $7500 OBO. Call Brent 16 wheel Jeeps, tandem axle detach, 306-232-7810, Rosthern, SK. $10,700; Scissor neck, $13,500; BeaverTrailer Sales And Rentals tail, $9700; 3 Hydraulic machinery trailers, 2005 GMC SIERRA NEVADA 4x4, $9995, $19,800-$28,000; Pintle hitch, $5800. Call PST paid. 1-800-667-4414, Wynyard, SK. 306-222-2413, Saskatoon/Aberdeen, SK. www.thoens.com DL# 909250. www.trailerguy.ca 2006 FORD F250, 4 WD, ext. cab, black, Fina nc ing Is Ava ila ble! Ca ll Us Toda y! DROP DECK semi style and pintle fresh rubber, spark plugs and tune-up, WILSON GOOSENECKS hitch sprayer trailers. Air ride, tandem $7800. Larry at 306-563-8765, Canora, SK. & CATTLE LINERS and tridems. Contact SK: 306-398-8000; 2007 CHEV CREWCAB, 1 ton long box, sinAB: 403-350-0336. gle rear wheels, 67,000 kms, loaded, above average condition, $19,900; 2007 Chev 3/4 ton, ext. cab, w/8’ service body, 220,000 miles, fresh safety, $12,900. Call K&L Equipment, 306-795-7779, Regina/ Ituna, SK. DL #910885. WILSON ALUMINUM TANDEM, 2007 CHEV SILVERADO Max, 6L, leather, TRI-AXLE & SUPER B GRAIN TRAILERS DVD, sunroof, 210,000 kms, exc. shape, $15,500. 306-648-7971, Gravelbourg, SK.

Andres

Andres specializes in the sales, service and rental of agricultural and commercial trailers. Call for a quote

W e will m a tc h c om petitor pric ing spec for spec Lethbridge, AB Nisku, AB 1-888-834-8592 1-888-955-3636 Visit our website at:

www.andrestrailer.com

6- 1997 48’ Hi-boys, priced from $2,500. to $8,500. Cheap ones as is, good ones Sask. Certified; 1995 LodeKing 48’ tri-axle combo flatdeck, Sask. Certified, $9500; 2000 Doepker Super B grain trailers, $34,500; 1998 Talbert 48’ stepdeck, Sask. Certified, $15,000; 2002 TrailTec tandem Pintle combine/sprayer trailer, $16,500; 1998 Eager Beaver 20 ton float trailer, $16,500. Call 306-567-7262, Davidson, SK. www.hodginshtc.com DL #312974

2007 DODGE 5.9 Cummins, Crew, 4x4, long box; 2008 Ford F250, 5.4 gas, ext. cab, 4x4, long box, would make good farm trucks. Call Neil 306-231-8300, Humboldt, SK. DL#906884 2008 CHEV AVALANCHE LT 1500 4WD truck with 88,000 kms. Art Beck Farm Equipment Auction, Saturday, August 24, 2013, Yellow Grass, Sask. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962

2007 DODGE 3500 diesel, mega cab, auto, 188,000 kms. $28,500 OBO. More to choose from. 306-463-8888, Dodsland, SK. www.diamonddholdings.ca DL#909463

2011 RAM DIESEL dually, 4x4, Crew, 2008 DODGE 3500, long box, 6.7L diesel, $36,975. 1-800-667-4414, Wynyard, SK. 6 speed standard 4X4, 92,000 kms. www.thoens.com DL #909250. 306-741-5289, Simmie, SK. 2012 DODGE DURANGO SXT, 7 passenger, 2008 FORD RANGER Sport, ext. cab, 4L, 5 loaded, $28,999. 1-800-667-4414, Wynspd., new tires, only 34,000 kms, vg cond., yard, SK. www.thoens.com DL #909250. $9750. 306-752-4909, Melfort, SK. NEW INTERNATIONAL TERRASTAR 3 ton 2010 CHEVY SILVERADO 1500, 4x4 white, 4x4 at: www.Maximinc.Com or call Maxim l o a d e d , 8 5 , 0 0 0 k m s , $ 2 2 , 0 0 0 O B O. Truck & Trailer, 1-888-986-2946. 306-823-4319, 306-823-7556, Neilburg SK WANTED: 2003 OR NEWER Dodge 3500 2010 FORD F150 XLT, auto, 25,996 kms, one ton, w/dual rear wheels, Cummins black, Stk# SK-U0827, $31,995. Call Diesel, auto or manual, w/wo box or flat1-866-980-0260. DL #914077. Website deck, have bale deck to mount. Watrous, www.subaruofsaskatoon.ca SK. 306-946-2264 or 306-946-7738.

TRI HAUL SELF-UNLOADING ROUND BALE MOVERS

D ecks

Live s toc k

2013 E BY All Al um i nu m 20’ Deck Un d er 2013 E BY All Al um i nu m 20’ Deck Over 2013 F ellin g 53’ T ria xle Dro p Decks 2013 F ellin g 48’ T a n d em Decks 2013 F ellin g 30’ Pin tle Hitch Deck, 30 T o n 2013 F ellin g T iltDeck W /a ir Ra m p s , 25 T o n 2013 F ellin g T iltDeck, 25 T o n 2014 F ellin g 9’ W id e T a n d em w /b ea verta il F ellin g Dro p Deck, 53’x10’, T ria xle w /b ea verta il

2014 E BY 53’ Gro u n d L o a d T a n d em 2014 53’ T ri Axle Bu ll Rid e 2009 E BY Bu ll Rid e T ria xle

G oos e n e c k Tra ile rs 2013 E BY M a verick 20’ 2013 E BY W ra n gle r 24’ 2013 E BY M a verick 30’ All S al tS id e Go o s en ecks w ti h T a n d em 7K a xles

Regina - 1-800-667-0466 | Keefe HallCell- 306-535-2420

w w w .sa sk v olv o.com

2008 IHC PRO-STAR tandem grain truck, automatic 13spd. Eaton UltraShift. ISX 475HP Cummins, this truck is in show room condition, no rattles, no rips or tears, very clean. Ice cold A/C. New 20’x8.5’x64” monobody box w/Nordic scissor hoist, Breon remote control chute and 1-800-505-9208 hoist controls. White w/viper red box, MB. www.LiftOffTriHaul.com 2011 DODGE 1500, black, 4x4, grey leath- safetied, $79,900. Farmer Vern’s Premium er, heated and cooled seats, sunroof, DVD, Trucks, 204-724-7000, Winnipeg, MB. Navigation, chrome bug inserts at door 07 FREIGHTLINERs and 06 IHC 9200s handles and rocker panels, Tonneau cover, w/new CIM boxes and hoists, AutoShifts boards and ram boxes, truck has a full load and UltraShifts, new SK. safties. Online at: of options. 99,300 kms, rubber was new 78truxsales.com 306-270-6399, Saskatoon 15,000 kms ago. Asking $29,900. Call 1966 CHEV 3 ton truck, B&H, 350 engine, Dwight 204-573-7787, Carroll, MB. r u n s g o o d , $ 3 5 0 0 O B O. C a l l C h r i s 2011 FORD F150 crewcab, 111,000 kms., 306-628-7840, Eatonia, SK. 6.2L engine, leather seats, box cover, new tires, many other extras, mint cond., SK. tax paid, $27,500. 306-821-6659, Lloyd2010 MIDLAND CLAM gravel trailer, 3 ax- minster, SK. le, A/R, new MB safety, flip back tarp, vg 2012 DODGE 1500 Ram Laramie, 4x4, cond., 11.4x24.5 tires on alum. rims, can white, 31,000 kms., spray in box liner, tondeliver. Call anytime, $45,000. Cypress neau box cover, running boards, all weathRiver, MB. 204-743-2324. er floor mats, Nav., fully loaded, leather, Ta n d e m G ra in Tru c k s 24’ GOOSENECK Tridem 21000 lbs, $7890; $39,995 OBO. 780-385-0334 Lougheed, AB Bumper pull tandem lowboy: 18’, 14,000 2012 FORD F150 AWD, auto, white, 8,547 S ta n d a rd & Au tom a tic lbs., $4250; 16’, 10,000 lbs., $3090; 16’, kms, Stk# SK-U01191, $37,995. Call 7 0 0 0 l b s , $ 2 6 5 0 . F a c t o r y d i r e c t . 1-866-980-0260. DL #914077. Website Ye llow he a d S a le s 888-792-6283 www.monarchtrailers.com www.subaruofsaskatoon.ca 306 -783-2899 2006 HUTCHINSON ALUM. TC406 crude NEW 2013 RAM DIESEL 2500, 4x4, crew, tankers, 34,000 litres, air ride, Certified. $49,999. 1-800-667-4414, Wynyard, SK. Yorkton, S K www.thoens.com DL #909250. Call 306-752-4909, Melfort, SK.

8’ to 29’ lengths - 6 to 18 bales also excellent for feeding cattle in the field - 4 bales at a time with a pickup.

TRUCK & TRAILER SALES

ALL ALUMINUM TANDEMS, tridems and Super B Timpte Grain Trailers. Call Maxim Truck & Trailer, 1-888-986-2946 or see: www.Maximinc.Com

NORMS SANDBLASTING & PAINT, 40 years body and paint experience. We do metal and fiberglass repairs and integral to daycab conversions. Sandblasting and paint to trailers, trucks and heavy equip. Endura primers and topcoats. A one stop shop. Norm 306-272-4407, Foam Lake SK. 1996 DOEPKER 42’ tridem, 3 hopper, 76” sides, good rubber, good cond., $25,000. 306-967-2423, Eatonia, SK.

Raailyer’Ssales

2012 RAM 2500 Laramie Longhorn, diesel, crewcab, 4x4, molten red, added options include power chrome heated mirrors, power sunroof, chrome side steps, dual tran. oil heater, rear seat video, extended warranty to 2017, Extang tri-fold box cover, 14,037 kms., $58,000. Sask. Tax paid. Moving must sell. Call 306-398-7706, Cut Knife, SK.

D.L#909069

C a ll fo rAva ila b ility a n d P ricin g Fin a n ce R e po ’s Acce ptin g Offe rs

ATTENTION FARMERS Ins toc k 32


CLASSIFIED ADS 37

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

NEU STA R

MANUFACTURING

2003 LOAD LINE 22’ pup trailer and 1995 Freightliner tandem w/21’ Midland grain box, M-11 Cummins and 9 spd. Sell as a complete unit, or will sell individually, asking $59,000 OBO. Call 204-355-4856 or 204-326-7937, Ste. Anne, MB.

2 0 ’ GR A IN B OX

N euStar M anufacturing 1470 W illson Place W innipeg,M anitoba 1-204-478-7827

2005 GMC TOPKICK 8500, loaded, Allison auto, Cat diesel, 8.5x20’ box, remote tarp, hoist and endgate, shedded, $44,000 kms. Retired. 306-752-3820, 306-921-9920 cell, Melfort, SK.

2007 FREIGHTLINER, 20’ box, rear cont., alum. wheels, Mercedes, 450 HP, power AutoShift w/clutch, green, safetied, real good, $67,500; 2007 Freightliner, new 20’ box, rear cont. and alum. wheels, Mercedes, 450 HP, AutoShift w/clutch, exc. cond., $67,500; 2005 IH 9400 w/Cat eng., 425 HP, AutoShift w/clutch, 20’ box, rear cont., alum. wheels, safetied, real nice, $57,500; 2005 IH 9400 w/Cummins eng. 425 HP, AutoShift, no clutch, 20’ box, rear cont., alum. wheels, safetied, $57,500; 1996 IH 9200 w/Cummins eng., 350 HP, 10 spd. std., 20’ box, rear cont., alum. wheels, safetied, real good, $41,500. Coming soon: 2006 Mack with 460 HP Mack engine, AutoShift, no clutch, 20’ box, alum. wheels, real nice, safetied, $63,500. Trades accepted, all trucks have Jake brakes, A/T/C and diff. locks. 306-276-7518 cell, or 306-767-2616 res., Arborfield SK. DL #906768.

2005 IH 9200 and 2004 IH 8600, Eaton AutoShift, Cat or Cummins, new 20’ BH&T; 1966 FORD 3 ton, 14’ Western Industries 1976 GMC 6500, 366, 5&2, 16’ wood box. 2008 PETERBUILT 387 factory daycab, B&H, recent tarp, 330 eng., 5 spd. trans., 306-356-4550, Dodsland, SK. DL 905231. ISX 475HP 18 spd. Eaton, 14,600 lbs front and 46 lbs. rear axles w/4-way n ew b r a ke s a n d t i r e s , $ 6 5 0 0 O B O. www.rbisk.ca lock ups, wet kit. A serious work horse 306-231-7054, 306-231-8173 Englefeld SK w/high level interior, low kms. This unit is 1968 DODGE 2 ton w/14’ steel B&H, good in immaculate condition. White with lots rear 900x20 tires, $2000. 306-395-2668, of chrome and alloys, 90% rubber, fresh 306-681-7610, Chaplin, SK. safety, $54,900, delivered anywhere in Western Canada. Farmer Vern’s Premium 1974 FORD F-500 grain truck with 28,054 Trucks, 204-724-7000, Winnipeg, MB. miles consigned by Greg Cameron to the Alvin Miller Farm Equip. Auction, Saturday, 8- 2007 INTERNATIONAL 9200, Cat 430 August 17, 2013. Stoughton, Sask. area. HP, 13 spd. Eaton UltraShift, 750,000 kms, Visit www.mackauctioncompany.com for $68 to $70,000; 2007 International 9200, sale bill and photos. 306-421-2928 or Cummins 370 HP, 10 spd. Eaton Ultra306-487-7815 Mack Auction Co. PL311962 422,000 kms, $69,500; 2- 2007 2005 INT. 9200I tandem, Cummins ISX, Shift, Freightliner Columbia, Detroit 455 HP, 13 1975 DODGE 600, 361 motor, good 13 spd., 1.1M kms., new 19’x66” Bergs spd. UltraShift, 4-way lockers, $64,000. tires, 15’ box, shedded, asking $7000 OBO. grain body, $57,500. Call 204-966-3254, and $68,000; 2007 Mack Vision, Mack 385 204-212-0953, Birnie, MB. or email: HP, 10 spd. Eaton UltraShift, $64,500; 780-385-0334, Lougheed, AB. n8brkmn@gmail.com 2003 International 8600, Cat 410 HP, 10 1976 GMC TANDEM grain truck, 20’ box, spd, $47,500; 2000 International 9200, w/tarp, good cond. Harry Vissers Farm Detroit 430 HP, 13 spd, $44,500. All trucks Equipment, Enchant/Lethbridge, AB. Call listed have 20’ Cancade grain box packag403-327-0349 or cell: 403-330-9345. es installed. Call 306-567-7262, Davidson, 1976 IHC LOADSTAR, 345 V8, rollaway SK. www.hodginshtc.com DL #312974 tarp, very low miles, no rust, $5750 OBO. ATTENTION CAT MACHINERY owners: 306-747-2514, 306-961-8061, Shellbrook. 13 spd., UltraShift automatic tandem 1978 IHC 1700, roll tarp. 1975 IHC 1600, grain truck. Paint matches Cat equiproll tarp. 306-283-4747, 306-220-0429, ment, 2008 IHC Pro-Star, ISX 475HP 306-291-9395, Langham, SK. Cummins, loaded w/Jake’s power windows, door locks, high level interior, al1980 CHEV 3 ton, 427, 185,000 kms, loys, etc. New 20’ New Star grain box, 8-1/2x16’ Univision box, carb needs work, loaded w/Nordic scissor hoist, LED lights, $4000. Phone: 306-753-2697, Macklin, SK. 2005 PETERBILT 378, Cat C15, 475 HP, 13 work lights inside box, Micheals roll tarp, 1981 CHEV 70 full tandem grain truck, spd, 166” cab to axle w/o sleeper, for 21’ pintle plate, decal kit, plumbed dump 20’ box, roll tarp, 366, 5x4 trans, 61,000 box, alum wheels, original owner, prairies valve, etc. $74,900 or lease OAC. Farmer Vern’s Premium Trucks, 204-724-7000, kms, good condition, $14,900 OBO. Phone truck, $37,000. 403-875-5557 Calgary, AB. Winnipeg, MB. 306-771-2210, Edenwold, SK. 1982 GMC 7000, 17’ box, roll tarp, 96,000 kms., $14,000 OBO; 1973 GMC 6500, 15’ box, roll tarp, 86,000 miles, $6000 OBO. Both always shedded. Call 780-603-7833, 780-688-2348, Vegreville, AB. 1988 VOLVO TANDEM, 3406 Cat eng., 15 spd., bent frame, 21’x70’Hx8.6’W silage box, 35 ton Harsh hoist and control, $14,000 OBO. 403-631-2373, Olds, AB. 1997 FREIGHTLINER FL112, MII Cummins, 10 spd. A/R, $41,900; New CIM 20’ BH&T, fresh Sask. safety. Call Cam-Don Motors Ltd. 306-237-4212, Perdue, SK.

2000 INTERNATIONAL 9200I premium grain truck w/Cummins, 10 speed, 20’ x 66” new grain body, Michels tarp, ChuteMax end gate and hoist control, $52,500. 306-539-3418, Holdfast, SK. 2001 FREIGHTLINER FL112, 460 Detroit, 10 spd, new 20’ ultracel box, hoist, tarp, no rust, $57,500; 2007 IH 4300, Allison automatic, new 16’ ultracel B&H, premium cond., low miles, only $48,500. Call for details, 306-946-8522, Saskatoon, SK.

AUTOMATIC 2005 Freightliner Columbia, new 20’ B&H, roll tarp, $55,000; 2010 Int., B&H, $70,000. 306-563-8765, Canora, SK.

SEVEN PERSONS ALBERTA

(Medicine Hat, Alberta)

2006 Freightliner Century Detroit Power, 10 speed Autoshift Transmission, 3.73 axle ratio, Southern truck

Please call about Grain Trucks arriving soon!

403-977-1624

www.automatictruck.com rawlyn@automatictruck.com

1997 VOLVO, REBUILT Detroit 470 and 18 spd., 40 rears, lockers, 11x24.5 on alum. at 80%, vg truck, $16,500. 306-752-4909, Melfort, SK. 1997 WESTERN STAR daycab tractor, 244” WB, 156 C.A., 430HP series 60, 15 spd., 40 rears, 3 way locks, 80% rubber, new AB safety, $19,800. 403-638-3934 Sundre, AB 2000 9900; 2005 9900; 2003 Freightliner; 2005 Freightliner; 2006 Volvo; 2006 Mack, AutoShift. Can supply boxes. Call Neil 306-231-8300, Humboldt, SK. DL#906884 2000 IHC 9200, C12 Cat, 430HP, 10 spd. AutoShift w/clutch petal, 3-way locks, 51” flat top sleeper, 60% rubber, new rear brakes, cold A/C, new AB safety, $16,000. Email pics. avail. 403-638-3934 Sundre AB 2000 IHC 9400 highway tractor, 72” prosleep double bunk, tandem 24.5 rubber, 18 spd., N14 Cummins, select 460 plus, KENWORTH T600 with brand new 17’ box, 234 wheel base, 390 rear ends, good cond, tarp and hoist in vg cond., new paint, IX $15,500. Call 306-316-0299, Yorkton, SK. Cummins eng., 475 HP, 11R24.5 tires 2 0 0 0 M A C K TA DAY C A B , 4 5 0 H P, w/rubber at 85%, 13 spd. tran. over fuller, w/2003 TA Ranco/Anvil, 36’ end dump main transmission RT60 16913A, 12,000 trailer, w/power tarp, good cond., $42,000 front and 40,000 rear, axle ratio 3.90, OBO. 2000 FORD F-800, low mileage, 384932 kms., pup trailer ready, $77,000. w/drill piling rig, ready to go, $28,000. Call 204-739-3818, Hodgson, MB. 2003 STERLING TA dump truck, safetied, NEW TRUCK 2013 PETERBILT 367 heavy excellent shape, $36,000. 1995 DECAP spec, c/w Capital alum. box and quad tri-axle belly dump gravel trailer, recently trailer, will sell separate. 780-940-7497, safetied, $20,000. Financing available. 306-291-4043, Saskatoon, SK. Edmonton, AB. area. SINGLE AXLE AUTOMATIC dump, 14’ 2002 IH 8200, daycab, tandem, 370 HP box, 2007 IH 4300, 466 dsl, hyd. brakes. Cummins, 10 spd., air ride, premium, no rust truck, only $26,500. Call for details, $36,000. 306-563-8765, Canora, SK. 306-946-8522, Saskatoon, SK. TANDEM AXLE Gravel trucks in inventory. New and used, large inventory across 2003 MACK w/small bunk, 475 HP, 18 spd. Western Canada at www.Maximinc.Com or trans., 46 rears, 1.2M kms, exc. cond., $16,900 OBO. K&L Equipment, Ituna, call Maxim Truck & Trailer 1-888-986-2946 SK., Ladimer, 306-795-7779. DL #910885. 2005 EAGLE 9400i, AutoShift, 22.5 tires, 440 Cummins, $16,000. 306-782-2738, 2008 PETERBUILT 387 factory daycab, Yorkton, SK. ISX 475HP 18 spd. Eaton, 14,600 lbs front and 46 lbs. rear axles w/4-way 2005 FREIGHTLINER COLUMBIA, daylock ups, wet kit. A serious work horse cab, 460 Detroit, 10 spd, premium cond., w/high level interior, low kms. This unit is low miles, only $38,500. Call for details, in immaculate condition. White with lots 306-946-8522, Saskatoon, SK. of chrome and alloys, 90% rubber, fresh safety, $54,900, delivered anywhere in Western Canada. Farmer Vern’s Premium Trucks, 204-724-7000, Winnipeg, MB. 1978 KENWORTH W900, daycab, 350 Cummins, 13 spd., nice running good dep e n d a b l e f a r m t r u c k , g o o d r u b b e r, $14,000 OBO. 1975 Kenworth K100, cabover, 350 Cummins, 10 spd., runs good, $7000 OBO. 1984 Esler B-train grain trailer, $9500 OBO. Chris 306-628-7840, Eatonia, SK.

1988 MACK R688 tandem w/15’ gravel AUTOMATIC 2010 IH Prostar, premium, box, 350 CID, 13 spd. Fuller trans., new Cummins power, new 20’ B&H, roll tarp, rubber, exc. cond., fresh safety, $35,000 $72,000. 306-563-8765, Canora, SK. OBO. 306-594-7981 or 306-594-2628 after AUTOSHIFT TRUCKS AVAILABLE: Boxed 8 PM, Norquay, SK. tandems and tractor units. Contact David 1995 WESTERN STAR, 46,000 rears, 15 306-887-2094, 306-864-7055, Kinistino, spd. Cummins, nice old truck, $16,000 2005 STERLING, 427,000 kms, 46 rear, 18 SK. DL #327784. www.davidstrucks.com OBO. Larry at 306-563-8765, Canora, SK. spd., 460 Detroit, dbl. locks, 20’ box, silage 1997 FREIGHTLINER FLD 120, 3406 Cat, gate, air ride convertor, 30’ Doepker trail15 spd., 40 rears, vg condition, $18,500. er, $89,000. 403-823-9977, Rosedale, AB. 306-752-4909, Melfort, SK.

2006 FREIGHTLINER COLUMBIA grain truck with 450 HP Mercedes and 10 spd. automated trans., 20’x65” CIM Ultra II grain box w/Michel’s roll tarp, 22.5 alum. wheels and tires with a 3.70 rear ratio. Equipped w/front air ride axle, $64,500. 306-887-2094, Kinistino, SK. DL #327784. www.davidstrucks.com

BERG’S GRAIN BODIES: When durability and price matter, call Berg’s Prep and Paint for details at 204-325-5677, Winkler, MB. COMMERCIAL INDUSTRIAL MFG. for grain box pkgs., decks, gravel boxes, HD combination grain and silage boxes, pup trailers, frame alterations, custom paint, complete service. Visit our plant at Humboldt, SK or call 306-682-2505 for prices. FARM CHEMICAL/ SEED COMPLAINTS We also specialize in: Crop insurance appeals; Chemical drift; Residual herbicide; Custom operator issues; Equipment malfunction. Qualified Agrologist on staff. Call Back-Track Investigations for assistance regarding compensation, 1-866-882-4779.

2001 FREIGHTLINER FL80, 300 HP, 9 speed trans., new 16’ ultracell BH&T package, exc. cond., no rust, only $37,500. Call for details, 306-946-8522, Saskatoon, SK. 2001 FREIGHTLINER FL80, Allison automatic, Cat diesel, new 20’ ultracell BH&T package, premium, no rust truck, $59,500. Call 306-946-8522, Saskatoon, SK. 2002 IHC 4400 new body style, 466 Allison auto., cab and chassis, will take 20’ box, low low miles, $36,900; 2001 IHC 4900, 466 Allison auto., 18’ BH&T, 130,000 miles, $44,900. K&L Equipment, Regina/Ituna, SK. DL#910885. 306-795-7779, 306-537-2027 email: ladimer@sasktel.net

2001 CHEV C8500 tandem gravel truck, Cat diesel, Allison auto, 129,000 miles, $24,900. K&L Equipment, Regina/Ituna, SK, 306-795-7779, 306-537-2027 or email: ladimer@sasktel.net DL #910885. GRAVEL TRUCKS AND end dumps for sale or rent, weekly/ monthly/ seasonally, w/wo driver. K&L Equipment, Regina/Ituna, SK, DL 910885. 306-795-7779, 306-537-2027 email: ladimer@sasktel.net

IF YOU SPRAYED LIBERTY and received crop damage call Back-Track Investigations for assistance 1-866-882-4779. 2006 INTERNATIONAL 9200i grain truck w/400 HP Cummins and 12 spd. auto. trans., 20x64”, Cancade Monobody grain box and Michel’s roll tarp. 24.5 alum. whls and tires w/3.90 rear ratio. $64,500. 306-887-2094, Kinistino, SK. DL #327784. www.davidstrucks.com

PETERBILT TANDEM AXLE grain/silage truck, S/N 1XP5DB9X0JN267941, Cat 3406B, 425 HP, eng. brake, 18 spd., 46,000 rears, double diff. locks, alum. wheels, new safety, 712,796 total kms, 2006 KENWORTH T800, AUTOSHIFT, 10 c/w 19’ ABC box w/silage extensions, spd., new B&H, ISM Cummins, very clean $45,900. Bob 780-679-7680, Ferintosh, AB truck. Also trucks avail. with ISX Cummins REMOTE CONTROL ENDGATE AND and no box. 204-673-2382, Melita, MB. DL hoist systems can save you time, energy #4525 and keep you safe this seeding season. 2007 FREIGHLINER COLUMBIA grain Give Brehon Agrisystems a call at truck, 15L Detroit 465-500HP, 13 spd. 3 0 6 - 9 3 3 - 2 6 5 5 o r v i s i t u s o n l i n e at Eaton UltraShift automatic, 4 way lock www.brehonag.com Saskatoon, SK. up diffs., loaded, safetied, w/20’ New Star box and Nordic scissor hoist, $73,900. Farmer Vern’s Premium Trucks, Winnipeg, MB. 204-724-7000. 2007 FREIGHTLINER CLASSIC 515 Detroit pre-emission, 13 spd., lockers, Jakes, $58,900; 2007 Freightliner Century 515 Detroit pre-emission, 13 spd. Eaton Ultra- STEEL GRAIN BOX and hoist, 18’ long, reshift, 4-way lockers, Jakes, $63,900. Both mote end gate, rear hydraulic centering have new 20’x65” Ultrashift BH&T, safe- auger, vg cond. 403-664-2028, Oyen, AB. tied, Western trucks. 306-256-3569 or 306-230-4393, DL #917908, Cudworth, SK 2010 FREIGHTLINER COLUMBIA tri-drive, 450 HP, DD15, 18 spd. AutoShift, 24’ CIM B&H, electric roll tarp, remote endgate, 29,250 kms. 306-231-8060, Englefeld, SK.

1996 FORD 900, N14 Cummins, 13 speed, c/w new gravel box, $31,000; 2013 Neustar tri-axle end dump gravel trailer, $53,500. 306-435-3700, Moosomin, SK.

2010 IH Lon e s ta r, 485 HP IS X Cu m m in s , 18 s p , 12/ 40, 22.5” a lloy w heels , 244” W B, m id -ris e bu n k , 819,866 k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $6 5,000 2010 Ke n w orth T370, 300 HP Pa ca r PX-6, 6 s p , 10,000 fron t20,000 rea r, 3:55 g ea rs , 200” W B, d iff. lock , 202,336 k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $45,000 2007 P e te rb ilt 379, 565 HP Cu m m in s IS X, 13 s p , 12/ 40, 3-w a y d iff. lock s , 3:55 g ea rs , 244” W B, 70” bu n k , 1,070,660 k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $59,000 2-2007 P e te rb ilt 387, 430 HP Ca tC13, 13 s p , 12/ 40, 3:55 g ea rs , 22.5” a lloy w heels , 238” W B, hig h-ris e bu n k , 968,391 k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $29,000 2007 P e te rb ilt 379, 430 HP Ca tC13, 10 s p , 12/ 40, 36” fla t-top bu n k . . . $35,000 2007 Fre ig htlin e r Colu m b ia , 515 HP Detroit, 18 s p , 4-w a y d iff. lock s , 4:11 g ea rs , s u p er40 rea r, 22.4” a lloy w heels , 209 W B, en g in e ha s been rebu ilt, 800,487 k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $42,000 2007 Fre ig htlin e r S D , 515 HP Detroit, 18 s p , 4-w a y d iff. lock s , 3:90 g ea rs , 12 fron ts u p er40 rea r, 22.5” a lloy w heels , 209” W B, 48” fla t-top bu n k , 1,037,000 k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $35,000 8-2007 IH 9400I, 435 HP IS X Cu m m in s , 13 s p , 12/ 40, 22.5” a lloy w heels , m id -ris e bu n k , 1M k m . . . . . . . . . . . . . . . . . $24,000 3-2007 IH 9900I, 475 HP IS X Cu m m in s , 18 s p , 12/ 40, 3-w a y d iff. lock s , 22.5” a lloy w heels , 3:90 g ea rs , 244” W B, 72” m id -ris e bu n k , 900,000- 1,200,000k m . . . . . . $37,000 2-2007 IH 9400I, 435 HP Cu m m in s IS X, 18 s p A u tos hift, 12 fron t46 rea r, m id -ris e bu n k , 240” W B, 1.2M k m . . . . . . . . . . . . $27,000 2006 IH 9900I, 565 HP Cu m m in s IS X, 18 s p , 3:90 g ea rs , 12/ 40, 4-w a y d iff. lock s , m id -ris e bu n k 22.5” a lloy w heels , 1,414,256,k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $32,000 2006 W e s te rn S ta r 4900 d a y c a b , 450 HP M erced es , 10 s p A u tos hift3 p ed a l, 12/ 40, 22.5” a lloy w heels , m id -ris e bu n k , 1.1M k m . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $33,000 2-2006 IH 9400I, 435 HP IS X Cu m m in s , 13 s p , 12/ 40, 4:11 g ea rs , 22.5” a lloy w heels , 200” W B, 51” m id -ris e bu n k , 1.3 KM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $24,000 2005 IH 9900I, 450 HP IS X Cu m m in s , 13 s p , 12/ 40, 22.5” a lloy w heels , 3:73 g ea rs , 244” W B, 1,441,746 k m . . . $24,000 d lr# 0122. P h. 204-6 85-2222, M a c G re g or M B. To vie w p ic tu re s of ou r in ve n tory vis it w w w .tita n tru c k s a le s .c om

2007 KENWORTH T600 daycab tractor, 430HP, C13 Cat, 18 spd., Super 40 rears w/4-way locks, 90% 11Rx24.5 rubber on aluminum wheels, 554,000 kms., cold A/C, 195” WB, new AB/BC safeties, $46,000. Delivery available. E-mail pics. available, 403-638-3934, Sundre, AB. 2008 CALGARY BASED TIM HORTON’S fleet truck, Freightliner C15 Cat, 15 spd., 4-way lock up diffs., 85% 24.5’s on alloys, small 34” bunk. Ideal for oilfield, gravel, construction or farm use. Only 618,000 kms., mint condition, $46,900, delivered anywhere in Western Canada. Farmer Vern’s Premium Trucks, 204-724-7000, Winnipeg, MB. 2008 IHC PRO-STAR tandem grain truck, automatic 13spd. Eaton UltraShift. ISX 475HP Cummins, this truck is in show room condition, no rattles, no rips or tears, very clean. Ice cold A/C. New 20’x8.5’x64” monobody box w/Nordic scissor hoist, Breon remote control chute and hoist controls. White w/viper red box, MB. safetied, $79,900. Farmer Vern’s Premium Trucks, 204-724-7000, Winnipeg, MB. 2008 PETERBILT 335, PX8 engine, 8 spd. trans., 180,000 miles, air brakes, air ride, deck. Also wired for elec. brakes, very good cond., $54,000 OBO. 306-421-1444, Estevan, SK. dcwanner@sasktel.net 2008 PETERBILT 388, 525 ISX Cummins, Super 40 rears, 18 spd, 3.70, 22.5 rubber, 870,000 kms, 70” bunk, white, $70,000. 306-677-7617, Hodgeville, SK. 2008 PETERBILT 389L, 550 Cummins ISX, 18 spd, Super 40s, 410 rears, dual Webastos, Alvena fenders, 724,000 kms. fresh safety; Also, 2010 Doepker Super Bs, heavy stainless fenders, dual cranks, alum. rims, fresh safety. Will separate. Call 306-220-9635, Prud’homme, SK. 2009 T800 KENWORTH, 485 ISX, 18 spd., 46 rears, 787,000 kms, loaded, $69,500. Call 306-752-4909, Melfort, SK. 2009 PETERBILT 367 setback axle daycab tractor, 475 HP Cat, 668,000 kms, 12,000 hrs, 1850 torque, RTLO18918B trans, Super 40 rears, 4-way locks, 373 ratio, auto greaser, new 5th wheel, new AB. safety, clean Western truck, $61,000. Delivery available. Email pics available. Call Jeff 403-638-3934, Sundre, AB.

2010 PETERBILT 388, 63” bunk, factory Cummins ISX 550 HP, 18 spd., 2050 torque, 244 wheel base, 46 rear air trac suspension, 4-way lockup, 24.5 tires, new steering tires, rear tires at 70%, steering air ride suspension, Wabasto heaters, power inverter, new turbo, new clutch, 2005 KENWORTH T800, ISX Cummins, 13 platinum interior, engine DPF deleted, spd., 40,000 rears, safetied, 60” bunk, 1.4 920,000 kms, asking $78,500. Prince Almillion kms., $22,000. 306-931-2678, Sas- bert, SK. 306-961-0366. katoon, SK. 2005 PETERBILT 379, C15 Cat, 18 spd. 12/40’s. Open to Offers. 204-870-2050, Portage la Prairie, MB.

2012 W900 L Kenworth truck, ISX Cummins 600 HP, only 146,000 kms, 18 spd., 46000 rears, 3.91 ratio, new 11R24.5 Bridgestone tires. Full 4-way lockers. Loaded heavy spec truck, oilfield ready. Come with a T&E oil pump, Berkley water pump, 4” pump, $125,000. Call anytime for more 2005 T800 KW Cat, 470 HP, 13 spd, 3-Way info. 204-743-2324, Cypress River, MB. locks, 797,000 miles, 24”, alum. polished rims, studio sleeper, new fan and transmission clutch, loaded, Michelin tires 85%, n e w M B S a f e t y. C a n d e l i v e r. C a l l 204-743-2324, Cypress River, MB.

ATTN FARMERS/ GRAVEL HAULERS: 2006 Freightliner FLD120 Classic, 550 Cat Twin Turbo, dual exhaust, twin air breathers, 18 spd, 12/40, 3.58 gears, 36” bunk, 144” cab to mid axle, double full lockers, 10 brand new 22.5 tires not recaps, new SK. safety, odometer reads 067,290 kms, $44,900. Call 306-242-2508 or for financing call Gord at Horizon 306-934-4445, Saskatoon, SK. 2005 VOLVO w/ISX Cummins, 10 spd., VN670 model, 40,000 rears, safetied, $20,000. 306-931-2678, Saskatoon, SK. 2006 KENWORTH W900L, 475 Cat, 12 spd. automatic, 80% 11Rx24.5’s, sunroof, new AB safety, $32,000. Email pics avail, 403-638-3934 ask for Jeff, Sundre, AB,. 2007 FREIGHTLINER CORNADO daycab tractor, 515HP Detroit, 18 spd. AutoShift, w/clutch petal, Super 40 rears w/3-way locks, 300,000 kms. on long block, recent front diff. injectors and clutch, roo bar, new steer tires, 70% rears on alum., new AB. safety, $43,000. Delivery available, 403-638-3934, ask for Jeff. Sundre, AB. 2007 FREIGHTLINER FLD120SD, 515 Detroit, 18 spd., S40 rears, 4-way locks, 36” flat top sleeper, $33,000. 2007 Freightliner Columbia, 48” sleeper, 515 Detroit, 18 spd., S40 rears, 4-way locks, $32,500. 2008 Freightliner FLD120SD, 515 Detroit, 18 spd., S40 rears, 4-way locks, 42” flat top sleeper, $42,500. 306-547-7680, 306-325-2021, Lintlaw, SK. DL #304675. 2007 IHC 9900 tractor, 500 Cummins, 18 spd., 46 rears, 4-way locks, 51” sleeper, new AB. safety, clean Western truck, $47,000. Delivery available. Email pics available. Jeff 403-638-3934, Sundre, AB. 2007 PETERBILT 378, 500 HP, C15 Cat, 63” bunk, 12,000 fronts, 46,000 rears. three to choose from. $60,000/ea. 403-852-4452, Calgary, AB.

HODGINS HEAVY TRUCK CENTRE: 2007 International 9900, Cat 430 HP, 13 spd, $34,500; 2006 International 9900, Cummins 525 HP, 13 spd, $36,500; 2005 Kenworth T800, Cat 430 HP, 13 spd, $28,500; Daycabs: 2007 International 9900, Cummins 500 HP, 18 spd, 46 rears, $44,500; 2000 Kenworth T800, Cat 380 HP, 10 spd, $18,500. Specialty trucks: 1994 International 9200, Cat 350 HP, 10 spd, 24’ hyd. tilt and load deck w/winch, $26,500; 1995 Volvo, Cummins 370 HP, 10 spd, 24’ hyd. tilt and load deck, $22,500. 306-567-7262, www.hodginshtc.com Davidson, SK. DL #312974 SLEEPERS AND DAYCABS. New and used. Huge inventory across Western Canada at www.Maximinc.Com or call Maxim Truck & Trailer, 1-888-986-2946. TWO 2006 T800 KW, ISX Cummins and Cat, bunk and daycab, 46 diff., 18 spd., lockers; 2005 W900 KW, daycab, Cat, 18 spd., 46 diff, Rubar bumper; 2004 and 2003 Pete 379, Cat, 18 spd., 46 diff., lockers, 2 year warranty, rebuilt trans. and diff; 2007 and 2005 IHC 9900Is, 18 spd., 46 diff, lockers; 2003 Freightliner Classic, Cat, 18 spd., new rubber; 2- 2001 Western Stars 4964, N14 Cummins and Cat, 13 spd; 1999 9300 IH, dual stacks dual breathers 60 Det., 13 spd.; 1998 IH 9200, Cat, 15 spd., $10,500; 1996 Volvo 425, 18 spd., 3-way locks, new diff., $12,000; 1989 T600 KW, 425 Cat, 18 spd. 306-356-4550, Dodsland, SK. DL #905231 www.rbisk.ca


38 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

2006 MACK DUMP TRUCK, low kms., 18 1998 WESTERN STAR manure spreader, spd., pup equipped. Call 780-983-0936, 60 Series Detroit 470 HP, 15 spd., 336 cu. ft. box, tailboard with pintle hitch, air to Westlock, AB. the back, runs good, $40,000+ GST. Pics via email 403-638-3958, Sundre, AB.

PINE, POPLAR AND BIRCH: 1” and 2” Vjoint, shiplap, log siding, 1”x8” and 1”x10” boards. Phone 306-862-5088, Nipawin, SK. ROUGH LUMBER: 2x6, 2x8, 2x10, 1” boards, windbreak slabs, 4x4, 6x6, 8x8, 10x10, all in stock. Custom sizes on order. Log siding, cove siding, lap siding, shiplap, 1” and 2” tongue and groove. V&R Sawing, 2005 JEEP GRAND CHEROKEE Ltd. $9998. 306-232-5488, Rosthern, SK. PST paid. 1-800-667-4414, Wynyard, SK. www.thoens.com DL# 909250. 2007 CADILLAC ESCALADE EXT, Raven black, cashmere interior, 18” chrome CONTINUOUS METAL ROOFING, no exwheels, fully loaded leather, 85,000 kms. posed screws to leak or metal overlaps. FORD F350 AMBULANCE, very low miles, $30,999. PST paid. 306-873-2633, Tisdale, Ideal for lower slope roofs, rinks, churches, pig barns, commercial, arch rib buildfully equipped. Cash and charity receipt. SK. www.bowmargm.ca DL# 910416 ing and residential roofing; also available 306-283-4747, 306-220-0429 Langham SK 2007 SUBARU Outback 2.5i Touring pkg., in Snap Lock. 306-435-8008, Wapella, SK. AWD, silver, auto, 117,254 kms, Stk# SKS2584A, $19,995. Call 1-866-980-0260 or www.subaruofsaskatoon.ca DL #914077. 2009 GMC YUKON XL, fully loaded leather, STEEL BUILDINGS, BIG or small. Save up all new rubber, 18” chrome wheels, 85,000 to 50%, for best deal with contract conkms, like new, GM Cert. pre-owned, struction to complete. Source #18X. Call $30,999. Phone: 306-873-2633, Tisdale, 1-800-964-8335. SK. www.bowmargm.ca DL# 910416 2013 SUBARU XV Crosstek Touring, AWD, CVT, white, 6,084 kms, Stk# SK-2851A. C a l l 1 - 8 6 6 - 9 8 0 - 0 2 6 0 . D L # 9 1 4 0 7 7 . FREESPAN WOODEN BUILDING on concrete, 110’x158’, full building width doors www.subaruofsaskatoon.ca 20’ high. 306-773-6322, Swift Current, SK. 1997 WESTERN STAR bale picker truck, e-mail: scairport@live.com w/trailer and grain box combo, 14 bale Goldenview self-loading bale deck and 14 PRE-ENGINEERED METAL BUILDING bale pup trailer. Also c/w two 21’ grain, siPKG, 40x60x14’, includes doors, windows, lage boxes, w/roll tarps and hyd. silage eaves, downs. 306-948-2140, Biggar, SK. end gates. Quick detach bale decks and STEEL BUILDING, 40X40X16’, 4 SEA congrain silage boxes, w/hyd. lift and stand. tainer structure. Easy to move, $7500. Call Asking $170,000 OBO. Ph: 780-678-6800 306-781-2600, Regina, SK. or 780-374-2404, Daysland, AB.

Wadena, Sask.

306-338-2993/cell: 338-7291

S UM M ER S PECIALS O N ALL US ED IN V EN TO R Y

2010 PALFINGER 15500 Knuckleboom Picker on 1995 GMC Topkick w/17’ deck, live roll, flip over 5th wheel and hitch. Picker has 300 hrs, inspected yearly. Truck has 653,000 kms, CVIP’d yearly, c/w all chains, boomers, slings and man basket, $55,000. E-mail: truddt1@xplornet.com or 780-712-9376, Edson, AB.

2007 W e s te rn Sta r Ba le Truck Detro itPo w er, T ri- d riv e, a ll rights p ecs , New Ca n ca d e, 17 Ba le, S elf L o a d i ng d eck.

Ca ll: 403-9 77-16 24 o r 306 -740-7771 L o ca ted a t M ed icin e Ha t, AB Other tru cks w ti h n ew a n d u s ed d ecks a va ila b le. 2005 FORD F550, 4x4, powerstroke, 5 spd. auto, 177,000 kms, hyd. hoist and dump box/flatdeck, $15,500. Stockholm, SK. 306-793-2190, 306-745-7274. SPECIALTY TRUCKS AVAILABLE. Fire/ emergency trucks, garbage trucks, bucket trucks, deck and dump trucks. See us at our new location on Cory Rd., Saskatoon, SK., Summer of 2013. 306-668-2020. DL #90871.

2000 FORD F450 service body, 271,000 kms with VMac air compressor, new rubber 7.3L powerstroke with 6 spd manual, m u s t b e s e e n , $ 1 3 , 9 0 0 . C a l l Ke n t 306-684-9693, Moose Jaw, SK.

1989 FORD L9000, Golden View 17 bale deck, 344,000 kms, 7300 hrs., 3406 Cat engine, 9 spd trans., 10 new tires, new front wheel seats, new air compressor, safety certified July 2013. Ready to go to work, $65,000. Phone: 403-637-2047 or 403-637-2003, Cremona, AB. SPECIALIZED TRUCKS and Equipment. Government Surplus units, sweeper, water truck, cement mixer, fire trucks, service trucks, flusher truck, picker truck, brush chippers and digger trucks. 306-668-2020, Saskatoon, SK www.northtownmotors.com DL #908171. 1993 GMC TOPKICK 3 ton high-rail truck, factory 3116 Cat diesel, UNIC 12,000 lb. crane and power-lift tailgate, vg cond., c/w hyd. impact tool, 6 extra tires on rims, $15,000. Call 306-673-2323, Prelate, SK. 1996 INTERNATIONAL 4700, 4x2, 22’ deck, $18,000 OBO. Call Jim at Woodland 306-332-6221, Fort Qu’Appelle, SK. 1990 KENWORTH W900 tandem axle water truck, Series 60 eng., vg cond. Call 780-983-0936, Westlock, AB. 1995 INT. 8100 Cummins M11, 10 spd. with 17 bale Cancade self load and unload, $45,000. 780-618-7299, Grimshaw, AB.

1998 to 2008 Ken w orths , Peterbilts , In tern a tion a l a n d Freig htlin ers - Da y ca bs , s leep eru n its , va n tru ck s , va c u n its , g ra in boxes a n d g ra in tra ilers . A v ailable and in s tock

Ca ll Kels ey @ 306- 338 - 2 993 or 306- 338 - 72 91 Dea lers fo rW ilso n , Ca stleto n , S to u ghto n a n d M u v- Alltra ilers.

Fin a n cin g a va ila b le

Website: www.prairie-west.com Dealer Lic. #910736 89 PETE 378 semi tractor, 460 Detroit, 10 spd., daycab, no rust, only $19,500; 2004 Freightliner M2, tandem, Allison auto, excellent cab and chassis or box pkg., only $39,500. Call for details, 306-946-8522, Saskatoon, SK. CAN-AM TRUCK EXPORT LTD., Delisle, SK, 1-800-938-3323. 1994 Kenworth 900, daycab, 3406 Cat, 15 spd., 40 rears, $21,000; Cat V110 forklift, propane, good cond., 11,000 lbs., $10,000; 1996 Load King 53’ highboy, $12,000; 1993 FLD120 daycab, 60 Detroit, 13 fronts, 40 rears, clean, older truck, $13,000; 17 ton Grove crane, carry deck, $23,000; 1984 Autocar tri-drive Allison auto, 290 Cummins, new tires, $13,000; 1985 IHC single axle, hydro vac truck, only 58,000 kms, nice older truck, $24,000; 2000 T800 Kenworth, C15 Cat, 18 fronts, 40 rears, $24,000; 2001 Dodge Ram 3500 HD, 5.9, auto, 12’ deck, $8,500; 2005 GMC W4500 diesel, auto, cube van w/power lift gate, hyd. brakes, $18,000; 1988 Fruehauf, spring susp., highboy curtain with current safety, $7,500; 1979 Chev C60 grain truck, 350, 5&2 spd., 15’ grain box, $7,500; 1976 Chev C60 grain truck, 350, 4&2 spd., 14’ grain box, $7,500; 1991 IHC 4700, DT 466, Allison auto, 12’ gravel unit w/sand spreader, front mount snowplow, hyd. disc brakes, $25,000; 1998 Manac highboy trailer 53’, air ride, tandem, $8,500; Gen sets available. Financing available, OAC. www.can-amtruck.com DL #910420.

PRIVE BUILDING MOVERS Ltd.! Bonded, licensed for SK. and AB. Fully insured. Moving all types and sizes of buildings. Call Andy 306-625-3827, Ponteix, SK. www.privebuildingmovers.com

SMALL MANUFACTURING SHOP and residence. 40 yrs of operation with established product line. Owner retiring. Turnkey operation. 306-445-5562, Delmas, SK. DOG BOARDING KENNEL business and acreage w/4 bdrm home and horse barn in Prince George, BC. Excellent income, owners retiring. Call 250-964-1456. BUSINESS OPPORTUNITIES: HANLEY, near #11 Hwy, former bake shop, gas bar, confectionary, has 2 work bays and living quarters; 5000 sq. ft. commercial building in Southey SK, with or without car wash; Excellent starter investment property, commercial building in large town on major hwy, Sask Gov’t lease; East of Regina on #46 near Pilot Butte, 68 acres with a home, secondary serviced site and some sub-division. Country residential and/or Commercial; SW, near larger city, motel, food and beverage business on #1 hwy; Hotel near Regina on major hwy, showing excellent volume growth. Restaurant, cafe, 2 suites (living or rent) rooms to rent, bar w/banquet area; Lintlaw, 4 acres, school w/ gym, good shape, many applications; On #11 Hwy in Craik, Bar and Grill, turnkey, housing available; On #39 Hwy in small town, 7300 sq. ft. building on 2 acres land, great for truckers; Regina, large volume liquor outlet with bar, food and some room income are available; Seed cleaning and processing plant on CN rail line 40 miles north of Regina. Contact: Brian Tiefenbach, 306-536-3269, 306-525-3344, NAI Commercial Real Estate (Sask) Ltd. VAC. TRUCK/SEPTIC WASTE hauling business, Wakaw, SK. Large client list. 2 yr. old 1800 gallon tank and Fruitland pump on a 2005 IHC. Price negotiable. 306-233-4418 A METAL FABRICATING/Manufacturing business in Potash Country, Sask. Customers are mines, construction companies, the agricultural industry. Have on site experience and capabilities. Over a million gross this year, capacity to triple that. Labour force will stay on to provide a fully operating unit. Price $1.1M. Will finance up to 30% and assist in additional financing. Serious inquiries only. Will provide more details upon your disclosure of financial capability. Box 5580, c/o The Western Producer, Saskatoon, SK, S7K 2C4.

1/2” THICK BELTING for sale in 36” to 54” widths. Phone 306-768-8555, Carrot River, TURNKEY BUSINESS OPPORTUNITY! New state of the art, 8-bay carwash for SK. sale in thriving Saskatchewan community. Located on 1.5 acres with great location on highway. Great customer base! Selling due to health concerns. Serious inquiries only please! Call 306-232-4767. 5 ACRE HOBBY, Nursery and Landscape business. 2 miles North of Courtenay, Vancouver Island, BC. Buy inventory and equipment with lease, $249,000 or buy CONCRETE FOUNDATIONS: We pour new everything $749,000. Beautiful view propand repair existing fdns. Also rent concrete erty, near by 4 golf courses, skiing, hunting and big salmon. Mild winters. Build forms. 306-249-1100, Saskatoon, SK. your retirement home. 250-218-0142. BURTON CONCRETE: PROVINCE-WIDE www.ospreystoneandbamboo/forsale2012 mobile concrete trucks. We set up on site, THRIVING EAST CENTRAL SK livestock pour all sizes of shops or bin pads w/one market for sale in the heart of cattle councontinuous pour. Eliminates delivery try. 306-675-2077, Leross, SK. charges and wait times. Phone Waylyn 306-441-4006, Blaine Lake, SK. GROWING RETAIL NURSERY in North Okanagan, BC. 25 acres with newer Cape C o d h o m e , g o o d w a t e r, f l a t l a n d . bmndeb@gmail.com TANKLESS WATER HEATERS, instant, on WELL EQUIPPED WELDING/MACHINE demand. Showers, cabins, RV’s. Gas (natu- shop for sale in Moose Jaw, SK. Includes: al or propane) or electric. Edmonton, AB., mobile welding machines, 10,000 lb. telewww.firepitfundamentals.ca 780-952-4884 handler, 15 ton carry deck crane, plus TANKLESS WATER HEATERS, instant, on much more equipment. Retiring from the demand. Showers, cabins, RV’s. Gas (natu- business, 306-693-8556 or 306-631-6052. ral or propane) or electric. Edmonton, AB., VERY BUSY EMBROIDERING shop. Last 780-952-4884 www.firepitfundamentals.ca year sales over $500,000. All equipment, customers and suppliers included. For more info. call 780-862-8575, Tofield, AB. DIMENSIONAL HARDWOOD lumber, 1/4 FENCING BUSINESS FOR SALE: chain link, cut Oak, Elm, Black Walnut, Hickory, 1/4 barbwire and wood for oilfield and comcut Cherry. Inventory at 511-3rd Street, mercial, Lloydminster area, AB/SK. Call 306-344-4891, www.hardesfencing.com Davidson, SK. Call 403-318-7589 (AB cell).

EQUIPMENT FOR SALE/ RENT: portable feeder, 2007 Power Screen 1400 Commander screen plant, 30 yard Surge bin and 36”x75’ radial stacking conveyor. Call Hikon Industries Ltd. at 306-244-4533 or O3 EQUIPMENT HAULING Ltd. Profession- email hikon@sasktel.net Saskatoon, SK. al transportation of equipment in Western Canada and NW USA. Call 403-963-2476, 1959 D6-9U, with dozer and winch, was running. Offers. Phone 306-452-3795, Lacombe, AB. www.o3hauling.com Redvers, SK. MANLIFT TOW BEHIND, JLG 350, Honda HISTORIC FALKLAND PUB for sale in engine, 500 lb. capacity, self-contained, Falkland, BC. Home of the Falkland Stam$23,000. 306-563-8765, Canora, SK. pede! Well established social hub of the community! Charming, spacious, patios. Fully equipped kitchen with great menu! Rental Suite Revenues! 2 lots on Hwy 97! http://www.garyirelandrealty.ca/Property/5747-Highway-97-Falkland-53 GREAT INVESTMENT OPPORTUNITY in a new auto dealership in the very prosperous Parkland region of north central Sask. JETCO ENT. INC. Experienced equipment hauling. Alberta, Saskatchewan and ManiFor complete info call 306-621-4698. toba. Call 780-888-1122, Lougheed, AB. GREAT OPPORTUNITY IN Melville, SK., 13,250 sq. ft., historical building, 2-storey CUSTOM BALE HAULING have 2 trucks and plus 1 storey building, upper level approx. t r a i l e r s , 3 4 b a l e s p e r t r a i l e r. C a l l 4000 sq. ft. w/5 occupied suites, main lev- 306-567-7100, Imperial, SK. RAMMAX REMOTE CONTROLLED and walk el approx. 9,250 sq. ft. w/4 tenants and behind vibratory packers, work ready and owner occupies 4000 sq. ft. Brenda excellent condition. Cambrian Equipment McLash, Realty Executives MJ, Moose Jaw, ph 204-667-2867 fax 204-667-2932, TANKLESS WATER HEATERS, instant, on Sales, SK, 306-630-5700. blmclash@sasktel.net demand. Showers, cabins, RV’s. Gas (natu- Winnipeg, MB. ral or propane) or electric. Edmonton, AB., CAT IT28B WHEEL loader, QA, GP bucket, 780-952-4884 www.firepitfundamentals.ca pallet forks, auxilary hyd., cab, heater, 17.5x25 tires, good cond. Call 306-621-0425, 306-782-4425, Yorkton, SK PALLISER CUSTOM SWATHING, 30’ NH MARK 2 POWERSCREEN, 4x6, 3 deck, 4.5L, 80 HP dsl. power plant, new hyd. FARM/CORPORATE PROJECTS. Call A.L. SP c/w PU reels, rotor shears, and GPS. JD new feed belt, multiple screens, Management Group for all your borrowing Reasonable rates, friendly service. Will motors, runs excellent, $32,000. 250-265-3758, and lease requirements. 306-790-2020, travel. Stan 306-309-0080, Pangman, SK. Nakusp, BC area. Regina, SK. BRUSH MULCHING. The fast, effective 1993 JOHN DEERE 790E hydraulic excavaDEBTS, BILLS AND charge accounts too way to clear land. Four season service, tor. Hodgins Auctioneers, 1-800-667-2075 high? Need to resolve prior to spring? Call competitive rates, multiple units. Borysiuk PL #915407. us to develop a professional mediation Contracting, 306-960-3804, Prince Alplan, resolution plan or restructuring plan. bert, SK. www.borysiukcontracting.ca 1995 KOMATSU EXCAVATOR PC 200, Call toll free 1-888-577-2020. TALBOT HOT BIN SEALING, we seal bins c/w clean up bucket, two digging buckets, shank ripper tooth, hydraulic thumb. NEED A LOAN? Own farmland? Bank says on wood and concrete floors. Serving SK, long n o ? I f y e s t o a b o v e t h r e e , c a l l AB and MB. 306-631-0203, Moose Jaw, SK. Call James 403-869-4417, Cochrane, AB. talbotbinsealing@gmail.com 1-866-405-1228, Calgary, AB. SKIDSTEER ATTACHMENTS: rock buckets, buckets, grapples and more top WILL CLEAN UP scrap iron from farm, in- dirt Also have truck decks in stock. dustrial, oilfield, and commercial sites. quality. Quality Welding and Sales 306-731-3009 306-463-1713 leave msg, Kindersley, SK. or 306-731-8195, Craven, SK. REGULATION DUGOUTS: 120x60x14’ 160x60x14’ $2700; 180x60x14’ USED UNDERCARRIAGE, rails to fit NEED PROTECTION. Land, equipment or $1900; 200x60x14’ $3500. Saskatoon, SK, D6C/D, D6H/R, D7G/H/R, $1500 per set. individual asset protection from Canada’s $3100; Good selection of rollers, track pads and #1 insurance and investment company, Phone: 306-222-8054. rails for excavators and crawlers. Western SunLife Financial/Brighter Horizon Finan- FROESE CUSTOM SWATHING, M155 Heavy Equip. 306-981-3475, Prince Albert. cial Services Inc. With my Ag background MacDon swathers w/30’ header attach. I can relate, Financial Advisor Darren and GPS. Will swath grain and canola in AB 2011 JD 318D SKIDSTEER, 1550 hrs., power QA, AC, stereo, new tires, 74” buckWeinkauf, Lloydminster, SK/AB. Phone and SK. 403-952-4422, Rolling Hills, AB. et, just serviced, very clean, Hi Flow, 780-205-2334. MULCHING - TREES, BRUSH, stumps, $24,500+gst. Phone 780-479-8135 or WANTED: FARMER OWNED grain terminal caraganas, etc. 12 years of enviro friendly 780-991-0999, Edmonton, AB. shares. Call 647-300-4063, Toronto, ON. mulching. Call today! 306-933-2950. Visit: PUSH DOZER, FITS D9G or D9H c/w belly email: jimmy192@rogers.com www.maverickconstruction.ca pan, good shape, $3500; Long shank ripCUSTOM SWATHING, AB and SK. Brand per, 2 barrel, fits D8H or D8K, $3500; new 30’ MacDon. Call: 403-866-2775, Roll- D8H angle dozer w/C frame, $1000; D8H U blade w/C frame, $1000. 780-942-3763 ing Hills, AB. or 780-914-2941, Redwater, AB. FARM CHEMICAL/ SEED COMPLAINTS We also specialize in: Crop insurance ap- NEUFELD ENT. CORRAL CLEANING, payloader, Bobcat with rubber tracks and peals; Chemical drift; Residual herbicide; Custom operator issues; Equipment mal- v e r t i c a l b e a t e r s p r e a d e r s . P h o n e function. Qualified Agrologist on staff. Call 306-220-5013, 306-467-5013, Hague, SK. Back-Track Investigations for assistance FENCE LINE, BRUSH mulching and clearregarding compensation, 1-866-882-4779. ing shelter belts and scrub land. Call Jonah at 306-232-4244, Rosthern, SK. CUSTOM SWATHING. MAGILL FARM & FIELD SERVICES is now booking swathing acres for the 2013 cropping season. Late model MacDon swathers. For all your swathing needs: magillhay@yahoo.ca or NEUMILLER HARVESTING has seven call Ivor at 403-894-5400, Lethbridge, AB. 8120/7230 Case combines and is looking CUSTOM SEEDING/ BALING/ SWATHING. for a yearly stop in Canada. Contact Roger Also parting 567 baler; Some hay for sale. 701-653-5433, Bowdon, ND. Call Alan: 306-463-8423, Marengo, SK. FIELD HARVESTING IS looking for acres in AB/Peace region, SK and MB. 3 JD STS BLASTING OF DAMS, culverts, water combines, grain cart and trucking sup- ways, rocks and crushing of concrete. Call 306-961-1170, Domremy, SK. plied. 780-603-7640, Bruce, AB.

‘06 GENIE Z45/25 ARTICULATING BOOMLIFT - 45’, 4x4, Deutz 3 cyl diesel, 48hp, 1,347 hrs., max. load 500 lbs, $32,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

CAT HYD. PULL SCRAPERS: 463, 435, 80, 70, and 60, all very good cond., new conversion. Also new and used scraper tires. Can deliver. 204-793-0098, Stony Mountain, MB. 2006 CAT 450CT skid steer loader. Call Hodgins Auctioneers, 1-800-667-2075, PL#915407.

4T CONTRACTORS INC. Custom fencing, mulching, corral cleaning and bobcat services. Metal siding and roofs. Will do any kind of work. 306-329-4485 306-222-8197 Asquith HYDRAULIC SCRAPERS: LEVER 60, 70, SK. 4tcontractorsinc@sasktel.net 80, and 435, 4 - 20 yd. available, rebuilt for years of trouble-free service. Lever Holdings Inc., 306-682-3332, Muenster SK PARKER SCREENER, 24x48’ with 48x120’ screen deck. 306-482-5121, Carnduff, SK. EQUIPMENT RENTALS: Loaders, dozers, HYDRAULIC PULL SCRAPERS, 6 to 40 excavators, compactors, etc. Conquest yards: Caterpillar, AC/LaPlante, LeTourEquipment, 306-483-2500, Oxbow, SK. neau, Kokudo, etc. PT and direct mount BOOKING ALFALFA, BARLEY and corn tires also avail.; PT motor grader, acres for 2013. Call for rates and details. ROME PLOW AND KELLO DISC blades avail., 2010 53’ Stepdeck, $24,995; New 306-381-7689, Hague, SK. and bearings; 24” to 36” notched disc $14,900; Agricart grain cart, 1050 bu., c/w tarp, blades. 1-888-500-2646, Red Deer, AB. $27,500. 204-822-3797, Morden, MB. ERW CUSTOM SILAGING is ready to take www.kelloughs.com care of all your alfalfa and cereal silage. SP JD chopper and trucks, swathing, bagging ATTACHMENTS: Skidsteer, pallet forks, and packing also available. Reasonable hay spears, augers, buckets. Conquest rates. To book call Eldon 306-370-0776 or Equipment, 306-483-2500, Oxbow, SK. 306-225-5720, Hague, SK. RECLAMATION CONTRACTORS: Bigham KSW CUSTOM CHOPPING, JD SP chop- 3 and 4 leg mechanical trip 3 pt. hitch per, live bottom trucks, 21 yrs. experience, Paratills in stock; parts for Bigham and Tye reasonable rates. For all your alfalfa cereal Paratills. Call Kellough’s: 1-888-500-2646. and corn silage needs call Kevin CATERPILLAR 627 twin engine motor 306-947-2812, 306-221-9807, Hepburn SK scraper, well maintained, low hr. components, guarded for excavator, top loading, $28,650; Caterpillar 300B excavator, SELF-LOADING/UNLOADING round bale c/w bush guarding and thumb work ready, 1983 D6D CAT, total recondition, new UC, truck. Max. capacity 34 bales. Custom $29,880; Caterpillar 330BL excavator, torque rebuilt motor, final drive, steering, hauling anywhere in AB. or SK. Phone c/w bush guarding and thumb, component twin tilt angle blade, 24” pads, warranty, Bernd, Bales on Wheels, Tofield, AB., repair history available, work ready- Call. exc. cond., can deliver, $56,000. Call 250-489-9502, Cranbrook, BC. 403-795-7997 or 780-922-4743. 204-743-2324, Cypress River, MB. LOWDERMILK TRANSPORT IS providing 2004 CAT 312CL excavator, good cond., one call service for all Equipment/Hay $67,000. 2005 CAT 305C excavator, prehauling. Very experienced, multiple trucks mium, $38,000. 2000 CAT M318 wheel 2006 CASE 621D wheel loader, 165 HP , serving AB., SK., and MAN. 780-872-0107, 4,474 hrs, 4 spd. PS trans, hyd. Q/A, 2.75 excavator, $59,000. 2006 CAT 287B 306-252-1001, Kenaston, SK. Q/A bucket and pallet forks, 3rd valve, track loader, very good, $32,000. 2000 CUSTOM BALE HAULING, self-loading new 20.5-25 tires, C/A/H, exc. cond, C AT C S 5 3 6 C packer, 84” pad foot, and unloading 17 bale truck. Radisson, SK. $99,000. Jordan anytime 403-627-9300, $40,000. Offers. Financing available. 306-291-4043, Saskatoon, SK. Pincher Creek, AB. 306-827-2269 or 306-827-7835. PS ripper; Cat 235 Trackhoe; D760 C U S T O M B A L E H A U L I N G . P h o n e CAT D8N CRAWLER c/w cab, ripper, D7G grader; Skidder, tree farmer, sweeps and guarded, very good cond. Call Champion 306-567-7199, Kenaston, SK. new 18.4x34 tires; Case 580 Super M ex780-983-0936, Westlock, AB. tendahoe; Grousen dozer blade, fits JD TTS BALE HAULING LTD. custom round picking and hauling. Two self-loading/un- MCCLOSKEY SCREENER, sitting on a tri- 8970, 16’; New steel quonset, 35x52x18H, loading units, 17- 34 bales. Ph. Tyson axle carrier, very low hrs., work ready. Call in crate, super price; 2004 Dodge Rumblebee, $12,500. 306-236-8023, Goodsoil, SK. 306-867-4515, 306-855-2010, Glenside SK 780-983-0936, Westlock, AB. WANTED SOMEONE TO custom combine 900 acres canola. Crop is located in the Carlyle, SK. area. Approx. time of harvest is mid Sept. Call Steven at 306-448-4923 or 306-577-8605, Manor, SK. CUSTOM HARVESTER looking for acres to harvest. 4- new JD S670 combines, 1100 bu. grain cart, and Peterbilt semis. Headers for all crops. Will travel anywhere. 306-421-9270 leave msg., Bromhead, SK.


CLASSIFIED ADS 39

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

1999 CAT 902 Wheel loader, QA bucket, LOADERS, GRAVEL TRUCKS & EQUIP: cab, auxilary hyd., good condition. Call 99IT24F LOADER; 2004 Case, 521D load306-621-0425, 306-782-4425, Yorkton, SK er; 2 Case 580SM, 4x4, extend-a-hoe, remote rear bucket, 4 in one 1 loader; 1998 2007 580 Case Super M Plus backhoe, FL112 Freightliner, pal finger crane, 4x4, pilot controls, 4 in 1 front bucket, 24,000 lb; 1998 Freightliner 112, flatdeck new rubber, exc. cond., 5000 hrs., $50,000 crane and wench; 3 -T300 Kenworth, sinOBO. 306-594-7981 or 306-594-2628 after gle axle, C&C end-decks; 2 Case, 2011 and 8 PM, Norquay, SK. 2010, 450 Series III skid-steers; 2 -2007 14’ cube vans; 2 -T800 Kenworth, long 1985 CASE 450C Crawler, 6-way dozer, wheel base C&C; 1996 Freightliner FL80, 65% U/C, $18,500. 204-525-4521, Minito- 20’ silage box, auto; 1999 Freightliner nas, MB. www.waltersequipment.com FLD120, 20’ silage box; 1996 Freightliner FLD120, new 16’ gravel box; 1998 FreighROAD GRADERS CONVERTED to pull tliner FL80, auto., 15’ gravel box; 1999 behind large 4 WD tractors, 14’ and 16’ T300 Kenworth, single axle, 14’ gravel box; blade widths available. CWK Enterprises, 2007 48’ combo drop-deck; 1996 Peterbilt 306-682-3367, 306-231-8358, Humboldt, 377 tractor, equipped. Other service trucks SK., www.cwenterprises.ca and half ton trucks, gas and diesel. Con1997 CAT 140H Motograder. Call Hodgins tact Bud at 306-256-3301, 306-221-2166, Cudworth, SK. Auctioneers, 1-800-667-2075. PL#915407 2007 LEON 1700 scraper, good cond., 17 yds. Call 306-231-8060, Englefeld, SK. REDUCED TO CLEAR (2) 15 T o n Ha n gin g S ca les (2) Po s tPo u n d ers (2) 7’ Pu ll Bro o m s Ha n gin g As p ha tl Ro llers An d M a n y Others . (2) 12’’ S o il S p rea d ers (4) Pu ll T yp e S heep s fo o tPa ckers , s in gle 48x40 a n d d o u b l ed ru m 60x60 a n d o thers . 5 a n d 6 fo o tPa t. L a w n Aera to rs 3’ W a lk Behi nd Aera to rs Ca s e & Ditch w ti ch T ren chers - w a lk b ehi nd a n d rid e o n S P a n d Pu ll T yp e W a b lee Pa ckers S kid s teer Ba ckho e Atta chm en ts 300 Bu ckets fro m s m a ll to b ig 48” Pa lletF o rks fro m $275 p a ir a n d u p L eerT ru ck ca p s fo r ½ a n d ¾ to n tru cks Gra s s a n d Bru s h M o w ers New E lectric F u el Pu m p s o n ly $49 ea ch Y a rd a n d Bu ild in g S w eep ers S evera l S ci ss o r L fi ts Over 50 Gen s ets 1 a n d 3 p ha s e 3.5 to 193 kw . (3) S tu m p Grin d ers 7’ Ditch Ba n k M o w er 500 Hyd . Cylin d ers (3) 8N F o rd T ra cto rs , fro m $1800 a n d u p (12) Ra il cu ttni g s a w s (3) 3 PH Ro to tillers F a rm T ra cto rs w /l oa d ers fro m $4000 and up M a n y typ es o ffo rklfi ts , electric, p ro p a n e, ga s , d ies el. (5) Air Co m p res s o rs a n d S a n d b l as ti ng Po ts (2) New Cu b Ca d ets 25 & 28 HP u p to 50% S a vin gs 1700 New a n d Us ed M o s tyl In d u s tria l T ires S to ra ge Va n s u p to 53 F o o t.

Hund red s of Other Item s On 2 Ya rd s. Low Low Pric es.

C a m b ria n Equipm e n tS a le s

Ph: 204-6 6 7-28 6 7 Fa x: 204-6 6 7-29 32

2 0 0 4 D E E R E 9 5 0 - C L G P, 4 3 9 7 h r s , straight twin tilt blade, new UC, 26” pads, exc. working condition, 3 shank HD ripper, job ready, CAH, full warranty 60 hours 60 day whichever comes first, $176,000. Can deliver. 204-743-2324, Cypress River, MB. EXCAVATOR HITACHI 120 LC, $38,000; Loader JD 544E, $38,000; Backhoe JCB 215E, $38,000; JD 310SG, $38,000; Skidsteer Cat 247B tracks, $24,000; Bobcat 853, $13,500. 306-563-8765, Canora, SK. HYDRAULIC PULL SCRAPERS 10 to 25 yds., exc. cond.; Loader and scraper tires, custom conversions available. Looking for Cat cable scrapers. Quick Drain Sales Ltd., 306-231-7318, 306-682-4520 Muenster SK OVER 100 SKIDSTEER attachments, 15 Skidsteers: 2005 Cat 287B on tracks, CAH; Bobcat 7753, on steel tracks; Bobcat 753; 2- Bobcat 743; 1999 JCB 185 Series 3; NH L-555; NH LS-170; Bobcat 2000 articulating loader; Toro Dingo X420 walk behind skidsteer. The following units in need of repair: Bobcat 610, only $1800; 2- Thomas skidsteers, $3300 for the pair; 1996 Gehl 6625, $5700. Other units being parted out. Cambrian Equipment Sales, 204-667-2867, fax 204-667-2932, Winnipeg, MB.

EA R L Y

R OR D E

PORTABLE TOILET SALES: New 5 Peaks portable toilets, assembled or unassembled. 5 Peaks Distributors, Western Canad a I n c . , w w w. 5 p e a k s d i s t r i b u t o r s . c a 1-877-664-5005. CLIFF’S USED CRAWLER PARTS. Some o l d e r C at s , I H a n d A l l i s C h a l m e r s . 780-755-2295, Edgerton, AB.

ZI P P ERLO CK Buildin g Com p a n y (2005) In c. O rde r N O W f or 2013 Cons tru c tion

ATTACHMENTS AND PARTS. Large inventory of construction equipment attachments for excavators, wheel loaders and crawlers. Hyd. thumbs, compactors, hammers, digging and clean-up buckets, quick/attaches, brush rakes, grapples, rippers, jib booms, brush cutter, mulchers and winches. Wrecking assorted constr. equip. for salvage parts. Western Heavy Equipment 306-981-3475 Prince Albert SK 15 LOWBED/EQUIPMENT trailers. Call 306-222-2413, Saskatoon/Aberdeen, SK. Pictures and prices at www.trailerguy.ca

3h/>d3/E3,KhZ^3dK3>4^d343>/&d/D

• H igh P ro file • B ig O verh ea d Do o rs • Eq uip m en t • Gra in • F ertilizer • P o ta to es • S h o p s

Au tho rized In d ep en d en tBu ild er Pre Engineered Structural SteelBuildings

1-888-6 92-5515 D errick - Cell

306 -6 31-8550 w w w .z ip p e rloc k .c om

CONTERRA GRADER for skidsteers and tractors. Excellent for road maintenance, floating and levelling. 518S-SS, $2499. Conterra manufactures over 150 attachments. Call 1-877-947-2882, view online at www.conterraindustries.com UNRESERVED AUCTION, Thursday, Sept. 19, NJN Excavating, Edmonton, 780-910-4567. 2- 2008 Volvo SD116TF, 84” packers; 2- Gehl 7810 and 7800 skidsteers; Finlay Screener; 2008 Cross Country tridem end dump, as new; 1998 Mack gravel truck; D5H-LGP Cat; JD 850B Cat; Kobelco 850 loader; Champion 780A and 750A graders; 2 Fiat Allis 95A graders and much more. www.prodaniukauctions.com REPOSSESSED CONSTRUCTION EQUIP., 2011 Bomag 55/65 Plate Tamper diesel; 2012 Frostfighter 500,000 BTU; Magnum Pro T5080 towable light tower; 2012 Forest River 20’ enclosed cargo trailer. Website photos www.saskwestfinancial.com E-mail saskwestfinancial@sasktel.net for bidding instructions. 2 0 0 3 J D 6 4 4 H w h e e l l o a d e r, n ew 23.5x25 tires, new injectors, 8600 hours, good tins, third valve, good overall cond., $69,000 OBO. Call Wes 306-682-3367, Humboldt, SK. LETOURNEAU OPEN TOP 14 yd. scraper, like a Cat scraper, good tires, $19,000. 16 yd. Woolridge scraper, new front tires, $23,000. Call 306-338-7114, Clair, SK.

1997 D7R LGP Cat, 2500 hrs, on major overhaul, bush ready, full guarded canopy, 3 shank ripper, straight tilt blade, UC 90%, exc. working condition, CAH, full warranty 60 hours 60 day whichever comes first, $176,000 OBO. Can deliver. 204-743-2324, Cypress River, MB.

FARM AND INDUSTRIAL ELECTRICAL motor sales, service and parts. Also sale of, and repairs to, all makes and sizes of pumps and phase converters, etc. Tisdale Motor Rewinding 1984 Ltd., 306873-2881, fax 306-873-4788, 1005A- 111 Ave., Tisdale, SK. www.tismtrrewind.com

CRAWLER DOZER D6C bush rake, winch, new chains, canopy, $39,000; WHEEL LOADER- WA50 Komatsu, 4x4, bucket, forks, boom, $28,000. Canora, SK., 306-563-8765. 2012 JD 320D skid steer, 116 hrs., AC, 74” bucket, like new cond., $34,500. Crystal City, MB. 204-873-2369, 204-825-7104.

• Complete engine rebuilding • Head and Block rebuilding and resurfacing • Crankshaft grinding and polishing • Reboring

DONE MILKING! Mueler 2700 gal. milk tank with coolers $15,000, Bou Matic 7.5 HP Air Star vac pump $3000, 140 gal. heat reclaimer, Bou Matic 2x8 herringbone with jars and 2000V detachers. Will sell in pieces, buy some spare parts and jars! Fred 250-263-3214, Fort St. John, BC. MUELLER STAINLESS STEEL milk tank, 800 gal., vg shape, $3500; Mueller Energy Star cooling unit, 5 HP, only used 6 mos., $3200; Mueller plate cooler, standard, used 6 mos., $2500; 200’ stainless steel 2” milk line, $500; Wic 45 feed car, vg shape, $2000; New barn cleaner parts for Berg 600. Call 403-559-6214, Didsbury, AB.

Ask for Brent in the Engine Shop

USED, REBUILT or NEW engines. Specializing in Cummins, have all makes, large inventory of parts, repowering is our specialty. 1-877-557-3797, Ponoka, AB. 290 CUMMINS; 350 Detroit; 671 Detroit; Series 60 cores. 306-539-4642, Regina, SK 3406B, N14, SERIES 60, running engines and parts. Call Yellowhead Traders, 306-896-2882, Churchbridge, SK.

1-800-665-0470 S to ny Pla in O ffice 780-975-3748 A irdrie O ffice 403-470-4570 M B S a les 204-534-2468 S a sk. S a les 306-737-8788 V erm ilio n O ffice 780-581-5822

Westrum Lumber

www.westrumlumber.com

1-888-663-9663 R o ulea u,S K

1 S TEEL BUILD IN G S

1- 8 77- 5 2 5 - 2 002

w w w .pio n eero n es teel.co m

S I LV E R S T R E A M S H E LT E R S Super Spring Fabric Building Sale. 30x72 single black steel, $4700; 30x70 dbl. truss P/R, $6995; 38x100 dbl. truss P/R, $11,900; 42x100 dbl. truss P/R, $14,250; 12-1/2 oz. tarp, 15 yr. warranty. Trucks running w e s t w e e k l y, d e l i v e r y a v a i l a b l e . 1-877-547-4738, silverstreamshelters.com

W E H AVE A B UILDING T O S UIT A LM O S T A NY NEED! CA LL US W IT H YO URS !

DIAMOND CANVAS SHELTERS, sizes ranging from 15’ wide to 120’ wide, any length. Call Bill 780-986-5548, Leduc, AB. www.starlinesales.biz

Rig id fra m e bu ild in g a va ila ble for s m a ll reta il ou tlets to la rg e in d u s tria l fa cilities . This s ize for on ly $29,418.

POLE BARNS, WOODSTEEL packages, hog, chicken, and dairy barns, grain bins and hoppers. Construction and concrete crews available. Mel or Scott, MR Steel Construction, 306-978-0315, Hague, SK.

BUILDING SUPPLIES & CONTRACTING

FARM BUILDINGS “Today’s Quality Built For Tomorrow”

LULL 10K39P TELEHANDLER. Call Hodgins Auctioneers, 1-800-667-2075. PL#915407

LAND PRIDE BACKHOE, BH1560, indeHYDRAULIC EXCAVATORS: 2008 Hitachi pendent PTO, hyd. pump, used only 1 ZX350 LC-3; 1998 Cat 325BL. Edmonton, time, $5500. Call Gerald 306-489-2018, 306-485-7399 cell, Alameda, SK. AB. 587-991-6605.

Fo r A llY o ur Fa rm , C o m m ercia l& Industria lN eeds

204-725-0500

Ca ll

2002 JD 444H, 2.5 yd., grapple, new rubber, 7800 hrs. very tight, excellent shape. 306-744-8113, Saltcoats, SK.

P RICED TO CLEAR!!!

FARM BUILDINGS

204 - 87 1 - 1 1 7 5 or 1 - 86 6 - 86 2- 83 04 w w w .triplesta rm fg.c a

BARGAIN OF THE YEAR! 4 for less than the price of 1! Package includes 4- TS14B Motor scrapers with cabs and air, spare motors, transmissions and various other parts. Low hours on components. Package price only $300,000. Pictures available. 780-847-2592, Marwayne, AB.

$$$$$$$$$$$$$$$$$$$$$ $ $ $ $ $ $ 7 5 TR UC KLOAD S $ $ 29 G AUG E FULL H AR D 100,000 P S I $ $ H I G H TEN S I LE R OOFI N G & S I D I N G $ $ 16 C OLOUR S TO C H OOS E FR OM $ $ $ B-G r. Colou red . . . . . . . . . . . . . . . 70¢ ft2 $ $ M u lti Colou rM illen d s . . . . . 49¢ ft2 $ $ $ BEAT THE P RICE $ $ IN C R E A S E S $ $ AS K ABO UT O $UR BLO W O UT $ $ CO LO RS AT 0.6 5 S Q . FT. $ $ CALL N O W $ $ $ $ F o u illa rd S teel $ $ S u p p lies L td . $ $ S t. La za re, M a n . $ $ 1- 8 00- 5 10- 3303 $ $ $$$$$$$$$$$$$$$$$$$$

w w w .go o do n.co m

JD 772D 2005 and JD 872D 2007, AWD, 8,000 hrs., X-County, $120,000 and REMANUFACTURED DIESEL ENGINES: GM $145,000. 403-291-1010, Calgary, AB. 6.5L, $4750 installed; Ford/IH 7.3L, $4950 D4 CAT, good working cond., canopy and installed; New 6.5L engines, $6500; 24v guards; D2 Cat, S/N #5U, 1200 orig. hrs., 5.9L Cummins, $7500 installed; GM Duravery good condition. 204-734-3804, Swan max Ford 6.0L, $8500 installed. Other new, used, and Reman. diesel engines avail. Can River, MB. Email: keziah@mymts.net ship or install. Call 204-532-2187, 8:00 AM AFAB INDUSTRIES POST frame buildings. to 5:30 PM, Mon. to Fri., Thickett Engine For the customer that prefers quality. 1-888-816-AFAB (2322), Rocanville, SK. Rebuilding, Binscarth, MB.

10’ Big Dog , in stock.. . . . . .. $ 3,900 12’ Big Dog ...................... $ 4,2 00 12’ BIL Cen terPivot, in stock ...................... $ 8,900 14’ BIL Cen terPivot, in stock .................... $ 13,550 14’ BIL 48’’ hig h Big Ha m m er, Dem o Un it............... $ 2 1,500 20’ BIL 32’’ hig h b ox scra per..................... $ 12 ,850

BEHLEN STEEL BUILDINGS, quonsets, convex and rigid frame straight walls, grain tanks, metal cladding, farm - commercial. Construction and concrete crews. Guaranteed workmanship. Call your Saskatoon and northwest Behlen Distributor, Janzen Steel Buildings, 306-242-7767, Osler, SK.

Hague, SK | (306) 225-2288

www.zaksbuilding.com

3UH(QJLQHHUHG/DPLQDWHG3RVWV

S TR AIGHT W ALL 40’ X 60’ X 16’

ALP INE 32 ’ X 5 0’ X 18 ’ In clu d es fra m ed op en in g for 14x14 overhea d & 4’x7’, s ervice d oor, excellen t s hop or s tora g e bu ild in g , com es w ith fou n d a tion d ra w in g s & m a n u a ls , d elivered to m os ta rea s . O n ly $15,500.

CALL TO D AY AN D AVO ID STEEL PRICE IN CREASES!


40 CLASSIFIED ADS

G RAI N H AND LI NG & STO RAG E w w w .skyw aygrainsystem s.com HU TCHIN SO N G rain Pum ps LA M BTO N Bucket Elevators LA M BTO N Drag Conveyors (Seed Com patible Conveyors) Rail Load-O ut System s Pulse Crop Equipm ent W ESTEEL G rain Bins SU KU P A eration & Bins G rain G uard Bins and A eration

G RAIN SYSTEM S IN C.

1-800-561-5625 WHEN

Quality COUNTS

• The HEAVIEST metal • The STRONGEST posts • SUPERIOR craftsmenship Choose Prairie Post Frame

1-855 (773-3648)

www.prairiepostframe.ca

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

FOR ALL YOUR grain storage, hopper cone and steel floor requirements contact: Kevin’s Custom Ag in Nipawin toll free: 1-888-304-2837. WESTEEL, GOEBEL, grain and fertilizer bins. Grain Bin Direct, 306-373-4919.

BBB BIN CONSTRUCTION- Erections, extensions and repairs in SK. Fully insured. The 2013 season is filling up fast. Call 306-716-3122, Eston, SK. QUANTITY OF HOPPER bins located approximately 15 miles SE of Regina, SK. 6x3500 bu. Behlen; 6x3900 bu. Westeel; 3x4500 bu. Twister; Combinations of air, fans, OPI cords, 2.50 - 2.75/bu.; 6x7200 bu. Chief Westland with unload and air on cement. Variety of other bins. Call Trent 306-540-5275, Tyler 306-533-8834.

SDL HO PPER C O NES

14’Hopper 8 leg H/Duty .................2,250 14’Hopper 7 leg S/Duty ..................$2,1 50 15’Hopper 8 leg S/Duty ..................$2,6 00 15’-10” Hopper 10 leg H/Duty .........$2,9 50 18’Hopper 12 leg M/Duty ...............$3,9 50 19’Hopper 12 leg M/Duty ...............$4 ,250 $

SDL STEEL BIN FLO O RS

Canadian Built Insurance Certified Bin Anchors

5- 5742 bu. Behlen bins on cement, 75 cents/bu. 780-847-3792, Marwayne, AB.

SD L H OP P E R CONE

WILLWOOD INDUSTRIES STEEL temporary grain bins, 2 yrs. old, used once, 35’ diameter, 5250 bu. Asking $2500 OBO. 306-726-4424, Southey, SK. LIFETIME LID OPENERS. We are a stocking dealer for Boundary Trail Lifetime Lid Openers, 18” to 39”. Rosler Construction 2000 Inc., 306-933-0033, Saskatoon, SK. GRAIN BIN REPAIR. Concrete and setup for large diameter bins. Quadra Development Corp 1-800-249-2708, Rocanville, SK

306-324-4441 M ARG O ,SASK.

BIN MOVING, all sizes up to 19’ diameter, with or without floors. 306-629-3324, 306-741-9059, Morse, SK. 3- 3300 BUSHEL Westeel Rosco bins with wood floors, $1/bu. 306-738-4534, Gray, SK.

BINS & CONES

4- 18’ STEEL BIN FLOORS, 3 years old, $1500 each. Can email pictures. 780-205-6028 cell, Neilburg, SK.

Pho n e : 3 06 -6 45-2152

1-866-974-7678 FREE QUOTE IntegrityPostStructures.com

Grain Bin Direct Factory To Farm Grain Storage Galvanized • Flat Floor • Hopper Bins Smooth Walls • Fertilizer • Grain • Feed Aeration • Rockets • Fans • Heaters Temp Cables Authorized Dealer

Saskatoon, SK

Phone: 306-373-4919 grainbindirect.com

TWO 1650 BU. wooden bins, good cond., take both $400; Six 1500 bu. hopper bins, $1.75/bu. Call Stephen at 306-279-2033, Yellow Creek, SK.

M A

$10,575.00

$4,900.00

We make hopper cones for all makes & sizes of bins.

Prices do not include setup or freight. Prices subject to change. Quantities are Limited.

M & K WELDING 1-877-752-3004

Em a il: s a les @ m kw eld ing.ca | Melfort, Sask | w w w.m kw eld ing.ca

Ro ca n ville, S K

FLAT BO TTO M AN D HO P P ER BO TTO M

D

1-866-665 -667 7

F la t F lo o r Bin s up to 1,000,000 Bus he ls !

A

• 4” co rru ga tio n a n d 50 k s i yield s tren gth ( 6 5 k s i ten s ile) s teel a re s till u tilized . • 10 yea r w a rra n ty o n co rru ga ted b in s

R

4,000 - 40,000 b u s he l p k g s

M A

.59 /BUS HEL

I B

N EED BIN S FAST -SET U P YO U RSELF

I

AS K ABO UT O UR PICK UP W ITH PR E- AS S EM BLED PAR T PR O G R AM

N S

M AN UFACTURE --- FIN AN CE --- D ELIV ERY --- S ET UP

THE “FORCE” LINE AGR I- TR AD E IN N OVATION AW AR D W IN N ER 20 12

• Re pla c e yo u ro ld • Le g-s tyle b in s a n d flo o rs a n d a d d u p to re pla c e m e n t ho ppe rs w ith a n 1500 b u s he ls a e ra tio n s ys te m tha t c a pa c ity to u s e s the b a s e a n d yo u r e xis tin g b in s . le gs a s the ple n u m • No m o re fightin g to fo rc e the a irin to w ith yo u ro ld d o o rs . the ho ppe r. Ou rpa te n te d JTL • Ae ra tio n s ys te m d o o ris gu a ra n te e d c o m e s a s s ta n d a rd to m a ke yo u s m ile e qu ipm e n t fo ra ll e ve rytim e yo u “ Fo rc e ” b in s & u s e it! con es.

1-888-CAN-TARP (226-8277)

Bushel pkg:

CANADIAN TARPAULIN MANUFACTURERS LTD.

“Canadian Made”CALL FOR PRICING

– Store grain for pennies a bushel. – All covers feature silver/black material to reflect heat and sunlight, vent opening allows moisture to escape, reinforced brass eyelet tie-downs every 3’ to eliminate wind whipping. IN STOCK AND READY FOR SAME DAY SHIPPING REPAIR SERVICE TO ALL INDUSTRIAL FABRIC PRODUCTS

SEE WEBSITE FOR MORE DETAILS

DEALERS

WANTED!

%

BEFORE AUGUST OFF 30TH 2013

www.cantarp.com

Email: sales@cantarp.com

60,000 BU. WESTEEL and Behlen bins for sale. Size range 2000 to 7000 bu. some with air, to be moved, .50¢/bushel. Located south of Climax, SK. 306-539-1972. 2- 5300 BUSHEL Westeel 19’- 8 ring, c/w ladders, temp. cable, on cement, $5500 each. 306-287-8062, Watson, SK. 34,000 BU. WESTEEL WIDE core grain bin, Model 3015 c/w aeration and sweep. 306-867-4411, Conquest, SK.

The o n ly c lo s e d in ho ppe r/a e ra tio n b in o n the m a rke t.

2406-10386

GRAIN BIN COVERS

10

THE LEGACY LINE

DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s

(306) 933-2343 | Fax: (306) 931-1003

UP TO

1-306 -8 23-48 8 8 1-78 0-8 72-49 43 1-8 77-6 9 7-7444 1-306 -224-208 8 1-204-371-5400

L EA S IN GL E A V A IL A B

w w w .d a rm a n i.c a

FACTORY D IRECT P R IC IN G

N eilb u rg S K S tettler AB “ The Pea ce Co u n try” W in d tho rs tS K M a n ito b a

s a les @ jtlin d u s tries .ca

W a yn e M a tth e w s

I

S

• Manhole • 10 legs • 37 degree slope • Single 10x4x188w skid base

REMOTE LID OPENERS For Most Sizes of Bin Starting at $129.00

LO O K IN G FO R LA R G E B U S H EL S TO R A G E? Ca ll for pricing.

N

I

HopperC one for 19 ft Westeel Rosco up to 3300 bu.

JTL is n o w o ffe rin g c o rrug a te d b in s s e tup o n o ur a w a rd w in n in g “F o rc e ” ho p p e r, o ur “L e g a c y” 6 ’ hig h fla tflo o r o r o n c o n c re te p a d .

Bin $ FROM

N

$2,750.00

w w w.jtlin d u s tries .ca N E IL BU RG, S AS K ATCH E W AN

N

B

• Manhole • 7 legs • 37 degree slope • Single 8x4x188w skid base

Other sizes of new bins also available.

DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s

R

HopperC one for 14 ft Westeel Rosco up to 2000 bu.

• Ladders • Remote lid opener • Safety-fil Indicator • 12 leg hopper • 37 degree slope • Manhole • Double 6x4x.188w skid base

SO LD

1 On ly 4000 M erid ia n S m o o th W a ll Gra in Bin w /Ro cket. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$14,8 3 3 00 1 On ly 4000 M erid ia n S m o o th W a ll Gra in Bin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $14,51200 1 On ly 5000 M erid ia n S m o o th W a ll Gra in Bin w /Ro cket. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .$18 ,9 4000

A

www.canadianhayandsilage.com

New1 8-05 Meridian Hopper Bin (Approx. 5000 bu.)

USED BINS FOR sale, on wooden floors: 3Westeel Roscoe 19-6 w/air, $1/bu; 2Westeel Roscoe 19-4, 5- Westeel 18-5, $0.65/bu; 1- 1400 and 1- 1800 bu. smooth wall hopper, no skids, $1.50/bu. Located near Speers, SK. Ed 403-507-1945

2- 3290 BU. GOEBEL GRAIN BINS (new in 2010 and never used) on 8 post, double skid Goebel hoppers, includes aeration, full length ladder, and remote bin openers, $9000 ea. + GST. 306-230-0102, located 2.5 miles NE of Allan, SK. 2200 BU. GSI, full aeration floor with wood floor underneath, $1800; 2200 bu. Chief Westland with wood floor, $1300; 1650 bu. Chief Westland with wood floor, $1000. 306-654-7657, Prud’homme, SK.

AUG US T S P ECIALS

Call 403-994-7207 or 780-206-4666

M & K WELDING

FOUR 50’ DIAMETER 10,000 bu. grain bin rings, $1500/each OBO. 306-436-4302, Milestone, SK.

Borde rla n d Co-op e ra tive Lim ite d

D

9’, 10’ and 12’. Have dealers in Saskatchewan.

36’ BROCK 30,000 bu. BIN, bottom ring damaged, needs unloader and may need a new floor and new bolts. Disassembled. Call Tim 204-764-0532, Decker, MB.

BEHLEN 50’ GRAIN RING, new, $1100 USED LARGE GRAIN bin hydraulic jack set. 306-759-2572, Eyebrow, SK. TOP QUALITY BEHLEN/ SAKUNDIAK OBO. Phone Earl 306-581-1013 Pense, SK. BINS. Book now for best prices. Example: all prices include skid, ladders to ground, manhole, set-up and delivery within set radius. Behlen Hopper combos: 3500 bu. Ro ca n ville, S a s k a tchew a n $10,450. SPECIAL 5000 bu. $13,990. We manufacture superior quality hoppers and steel floors for all makes and sizes. Know what you are investing in. Call and find out why our product quality and price well exceeds the competition. We also stock replacement lids for all makes and models of bins. Leasing available. Hoffart Services Inc., 306-957-2033, Odessa, SK.

CHIEF WESTLAND AND CARADON BIN extensions, sheets, stiffeners, etc. Now available. Call Bill, 780-986-5548, Leduc, AB. www.starlinesales.biz

Quality GRAINBAGS

POLY HOPPER BINS, 100 bu., $900; 150 CUSTOM GRAIN BIN MOVING, all types bu. $1250. Call for nearest dealer. Buffer up to 19’ diameter. Reasonable rates. Call USED WESTEEL GRAIN bin parts, includ- Valley Ind., 306-258-4422, Vonda, SK. 204-648-7129, Grandview, MB. ing: wall sheets, roof sheets, perforated aerations floors and hopper cones. Wal- 73 TON WESTEEL MAGNUM fertilizer bin, BROCK (BUTLER) GRAIN BIN PARTS w/skid base, $6900 OBO. 306-535-2820, and accessories available at Rosler Condron, SK. 306-728-5366 or 306-728-6766. south of Krono, SK. struction. 306-933-0033, Saskatoon, SK. 2106 WESTSTEEL, WC w/hopper skid base, inverted V-air, 7.5 HP fan (unassembled); Also 4- 1406 WestSteel on hoppers. 306-752-3820, 306-921-9920, Melfort, SK.

10 gauge bottom ,8” or 12” Side Wall (1)O r (2)piece construction 12’- 28’sizes Tru ck ing Av a ila b le

PH:306-445-5562 www.evertightanchors.ca

2- WESTEEL HOPPER 5-tier, $4500 each; 2- Twister hopper 5-tier, $4500 each; 1Westeel fert. 3-tier hopper, $8500; 1- TriR i t e 3 - t i e r f e r t . h o p p e r, $ 6 0 0 0 . 306-332-6221, Fort Qu’Appelle, SK.

Call for Pricing on Notch Landleveller

DWAYNE ENTERPRISES

• •

• Box 46 • Beatty, SK S0J 0C0 • Ph: 306-752-4445 Fax: 306-752-5574

Call for all other DE hopper bin packages from 4000-19000 bushels! DE retrofit hopper bottoms from 9-27’ any brand bin Grain Guard Products (rockets, fans, heaters...) Bin Anchors Aeration socks

www.dwayneenterprises.ca

• • • • • •

Rocket aeration Triple 8x4” skid Ladder/Inspection hole LevAlert fill indicator 14 legs Manhole

$

25,500

+ setup and delivery (can be arranged)

1805-4750 Bushel pkg:

• • • • • •

$

Rocket aeration Double 8x4” skid Ladder/Inspection hole LevAlert fill indicator 12 leg Hopper Manhole

12,250

+ setup and delivery (can be arranged)


CLASSIFIED ADS 41

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

4 WESTEEL ROCSO, 1650 bu. bins on boot hopper with air, $4000. per bin. Call 306-536-8820, Francis, SK.

Download the free app today.

TEN 6 SENSOR OPI-ONE temperature cables for 7800 bu. bin; Six 8 sensors for 10,000 bu. bin; Two cable monitors; Four 16’ skids, 5x7” beam, off 100T Meridian bin, 306-260-4343, Dinsmore, SK. CUSTOM GRAIN BIN MOVING, all types 3- HOPPER BINS on Goebel bottoms, no up to 22’ diameter. 10% spring discount. s k i d s , 6 5 0 0 t o t a l b u s h e l s , $ 8 5 0 0 . Accurate estimates. Sheldon’s Hauling, 306-961-9699, Prince Albert, SK. 306-491-9605, near Colonsay, SK.

ATLAS BUILD IN G S YS TEM S & S ALES LTD . Yo rk to n , S K .

(3) 5 000 Bu. M e rid ia n ( S a kun d ia k) h o ppe r b in co m b o c/w ro o f a n d w a ll la d d e rs , to p s a fe ty ca ge s , a uto lid o pe n e rs ,12 le g h o ppe rs , m a n w a ys , s lid e ch ute s , triple s kid s & e re cte d .

P rice: 40,000.00 o r $2.66 pe r b u. $

2) 6200 b u. M e rid ia n ( Be h le n ) h o ppe r b in co m b o c/w ro o f a n d w a ll la d d e rs , to p s a fe ty ca ge s , a uto lid o pe n e rs , 12 le g h o ppe rs , m a n w a ys , s lid e ch ute s , triple s kid s &e re cte d .

P rice: $33,000.00 o r $2.66 pe r b u.

FOR ALL YOUR AG & C OM M ER C IAL S H OP S

(m a teria l pa c ka ge only) c/w co lo r w a lls , ga lva lum e ro o f, gutte rs a n d d o w n s po uts , 8’ lin e r, 1–w a lk d o o r, 1-24’x18’ OH d o o r, R 20 in s ula tio n in ro o f a n d w a lls . Exa m ple:

40’x 60’x20’ P rice: $49,000.00 o r $20.41 pe rs qft. 5 0’x60’x20’ P rice: $5 4,000.00 o r $18.00 pe rs qft. 60’x60’x20’ P rice: $5 7 ,600.00 o r $16.00 pe rs qft.

M a n y o th e r s ize s to ch o o s e fro m . C re w s a va ila b le fo r s e tup. Le a s in g a va ila b le o n a ll pro d ucts . C ON TAC T US TOD AY!

O ffice: (3 06 ) 78 2-3 3 00 | cell: (3 06 ) 6 21-53 04 |(3 06 ) 6 21-3 025

w w w .a tla s b uildin gs .n e t

AUG US T S P ECIALS S TEEL BIN FLOOR S AER ATION FAN S TEM P M ON ITOR IN G

AUGUS T W E S TE E L H OP P E R S AL E

Hig h Profile Hop p erbottom ; S teep 36 d eg ree s lop e; d ou ble ba n d for s ecu re bin m ou n tin g ; a ll boltholes p u n ched ; leg s a re d ou ble w eld ed to both ba n d s ; w ith g u s s etp la tes ; d rip free s ea led chu te; d ia m on d d es ig n m a n hole; con tin u ou s M IG w eld ed ; S a s k a tchew a n m a d e.

20’ TO 53’ CONTAINERS. New, used and modified. Available Winnipeg, MB; Regina BEAVER CONTAINER SYSTEMS, new and Saskatoon, SK. www.g-airservices.ca a n d u s e d s e a c o n t a i n e r s , a l l s i z e s . 306-220-1278, Saskatoon and Regina, SK. 306-933-0436. SEA CAN CONTAINERS FOR SALE/ RENT. 20’-53’ containers available. Delivery, shelving, rollup and man doors, windows and custom builds available. For inventory and pricing call 780-910-3542, St. Albert, AB, Containers and Chains. SHIPPING CONTAINERS FOR SALE: 10’, 20’, 40’ and 53’ containers available, great quality, great prices. Call: 1-800-419-2109 Visit: www.lhandccs.com Regina, SK.

SHIPPING CONTAINERS FOR SALE. 20’53’, delivery/ rental/ storage available. For inventory and prices call: 306-262-2899, Saskatoon, SK. thecontainerguy.ca

Sa ve w h e n you Buy 3 or M ore 14’ W es teel Hop p erc/ w d ou ble s k id . Reg . $3,150. . . . . . . . . $3,000.00 19’ W es teel Hop p erc/ w d ou ble s k id . Reg . $5,975. . . . . . . . . $5,800.00 19’ W es teel Hop p erc/ w trip le s k id . Reg . $6,675. . . . . . . . . $6,500.00 W hile s upplies la s t. Rosler Construction 2000 Inc. 120 - 71st St. W. Saskatoon, Sask. S7R 1A1 PH: (306) 933-0033 Fax (306) 242-3181

w w w .ros le rc on s tru c tion .c a FLOOR SKIRTING 12’ to 30’ dia. up to 7” wide, a sloping tin over outer edge of floor. G. B. Mfg 306-273-4235, Yorkton, SK SUMMER BOOKING: 5000 bu. Superior bin combos, $11,200; 8000 bushel Superior combos, $17,500. Limited quantity avail. We make hopper bottoms and steel floors for all makes of bins. Try our U-Weld kits. Call 306-367-2408 or 3 0 6 - 3 6 7 - 4 3 0 6 , M i d d l e L a ke , S K . www.middlelakesteel.com

S TEEL FLO O R S W O R K Sa ve

UP T O 50% fro m cem en t

20 Y EAR W ARRANTY

D ARM AN IG RAIN S TO RAG E 1-86 6 -6 6 5-6 6 77

AKRON

3 -3300 BU. WESTEEL Rosco, wood floors, USED SEA/STEEL Storage Containers f a i r c o n d i t i o n , $ 1 . 2 5 / b u O B O. C a l l for sale. 20’, 40’, 40’ HC, 48’ HC, etc. Guar306-445-5485, 306-480-8116, Delmas, SK. anteed wind, water and rodent proof. Ask about modifications and accessories for GRAIN BINS: 3500 bu. Meridian/Behlen your container (ramps, electrical kits, new bin/hopper combo, 10 leg hopper and paint, etc.) Call Bond Industrial Direct, skid, roof and side ladder, safety fill, con- 306-373-2236, 306-221-9630, Saskatoon, structed, limited supply for $9995 FOB at SK. joe@bondind.com www.bondind.com Regina, SK. Leasing available. Peterson Construction, 306-789-2444. 20’ AND 40’ SHIPPING CONTAINERS, large SK. inventory. Ph. 1-800-843-3984, 306-781-2600.

®

*UDLQ%DJ6WRUDJH6\VWHP

Flex

NEW

53’ STEEL CONTAINERS. Also available in 20’ 40’ and 48’. 40’ standard open top containers. 306-861-1102, Radville, SK.

Custom Container Fabrication Custom manufacturing sea containers to your specifications offices, tool cribs, storage units, walkways, first-aid room and more. Servicing every industries requirements for customized containers.

Call Us Today! 306.543.6900

www.qualityassuredmfg.com info@qualityassuredmfg.com

OSLER, SASK.

PH: (306) 242-7767 FAX: (306) 242-7895 CHECK US OUT AT www.janzensteelbuildings.com

HORNOI LEASING NEW and used 20’ and 4 0 ’ s e a c a n s fo r s a l e o r r e n t . C a l l 306-757-2828, Regina, SK. 20’ AND 40’ SEA CONTAINERS, for sale in Calgary, AB. Phone 403-226-1722, 1-866-517-8335. www.magnatesteel.com

FOR ALL YOUR 2013 GRAIN & FERTILIZER STORAGE NEEDS

“BOOK EARLY TO GUARANTEE BEST SELECTION” “Up TO 5 YEAR Lease Terms” STANDARD FEATURES INCLUDE:

KEHOE AERATION SYSTEM, 3 HP fan, double cross tubes for 19’ bin, $2000. 306-553-2239, 306-741-6040 Neidpath SK

UNSTIFFENED SIDEWALL PANELS WALL & ROOF LADDERS SAFETY RING & SAFETY FILL 18” RACK & PINION GATE MANWAY IN CONE

CALL FLAMAN SALES for your aeration fan and duct work needs. We carry round duct or Grain Guard rockets to fit existing bins. Aeration fans from 3-10HP. Call Flaman Sales Saskatoon at 1-888-435-2626.

“ALL JSB CONES ARE SANDBLASTED PRIOR TO PAINTING” 3513 Bu. & 4135 Bu. 4920 Bu. & 5999 Bu. Hopper Bin Hopper Bin 16’ DIAMETER BIN

18’ DIAMETER BIN

H. Duty 8 leg cone c/w 18” port Painted cone inside & out DBL 4”x6” skid - Setup included Air Screen & 3hp/5hp Fan (Extra)

H. Duty 10 leg cone c/w 24” port Painted cone inside & out DBL 4”x6” skid - Setup included Air Screen & 5hp Fan (Extra)

KEHO, STILL THE FINEST. Clews Storage Management/ K. Ltd., 1-800-665-5346.

A ER ATION ! PO W ER LESS UP TO

10 %

VENTILATION IS OFF A M UST FOR ALL GRANARIES BEFORE AUGUST Re le a s e s tra ppe d TH he a ta n d m o is tu re 3 0 2013 G ra in s to re d w ith tu b e c o o ls w ithin 3 0 d a ys Fo r u s e w ith a ll s e e d va rie tie s Elim in a te ho tpe a ks in c e n te rs Ea s y s e tu p a n d in s ta lla tio n Fo r u s e in fla to r ho ppe r b o tto m b in s , b a rn s , qu o n s e ts a n d gra in pile s Ec o n o m ic a l No M ore B ugs !

3513 Bu. $10,430. + delivery 4920 Bu. $13,345. + delivery 4135 Bu. $11,325. + delivery 5999 Bu. $14,910. + delivery “SUPPLY ONLY PACKAGES”

“SUPPLY ONLY PACKAGES”

3513 Bu. $9,420. + delivery 4920 Bu. $12,030. + delivery 4135 Bu. $10,180. + delivery 5999 Bu. $13,360. + delivery

UNLOAD A SUPER B IN AS LITTLE AS 11 MINUTES! KEEPS UP TO THE LARGEST GRAIN CARTS ON THE MARKET! CHABOT IMPLEMENTS Elie, MB 204-353-2392 Neepawa, MB 204-476-3333 Steinbach, MB 204-326-6417 F.V. PIERLOT & SONS Nipawin, SK 306-862-4732 GREENFIELD AGRO SERVICE Rosetown, SK 306-882-2600 KROEKER MACHINERY Winkler, MB 204-325-4311 MARKUSSON NEW HOLLAND Emerald Park, SK 1-800-819-2583 MARTODAM MOTORS Spiritwood, SK 306-883-2045 MOODY’S EQUIPMENT LTD. Saskatoon, SK 306-934-4686 Perdue, SK 306-237-4272 Unity SK 306-228-2686 Lloydminster, SK 306-825-6141 Kindersley, SK 306-463-2335 Olds, AB 403-556-3939 High River, AB 403-652-1410 Balzac, AB 403-295-7824 NYKOLAISHEN FARM EQUIPMENT Kamsack, SK 306-542-2814 Swan River, MB 204-734-3466

NEERLANDIA CO-OP Neerlandia, AB 780-674-3020 PARKLAND FARM EQUIPMENT North Battleford, SK 306-445-2427 REDVERS AGR. & SUPPLY LTD. 306-452-3444 ROBERTSON IMPLEMENTS (1988) LTD. Shaunavon, SK, 306-297-4131 Swift Current, SK 306-773-4948 SCHROEDER BROS. Chamberlain, SK 306-638-6305 WHITE AG SALES & SERVICE Whitewood, SK 306-735-2300 AR-MAN EQUIPMENT Vulcan, AB 403-485-6968, 1-866-485-6968 BILL’S FARM SUPPLIES INC. Stettler, AB 403-742-8327 CAOUETTE & SONS IMPLEMENTS St. Paul, AB 780-645-4422 FOSTER’S AGRI-WORLD Beaverlodge, AB 780-354-3622, 1-888-354-3620 HI LINE FARM EQUIPMENT LTD. Wetaskiwin, AB 780-352-9244, 1-888-644-5463

Email: craigyeager@grainbagscanada.com or aaronyeager@grainbagscanada.com

ROCKY MOUNTAIN EQUIPMENT Falher, AB, 780-837-4691, 1-866-837-4691 Grimshaw, AB 780-332-4691, 1-800-746-4691 KASH FARM SUPPLIES LTD. Eckville, AB 403-746-2211, 1-800-567-4394 E. BOURASSA & SONS: Assiniboia 1-877-474-2456 Estevan 1-877-474-2495 Pangman 1-877-474-2471 Radville 1-877-474-2450 Weyburn 1-877-474-2491 RAYMORE NEW HOLLAND Raymore, SK 306-746-2911 WATROUS NEW HOLLAND Watrous, SK 306-946-3301 YORKTON NEW HOLLAND Yorkton, SK 306-782-8511

Call Your Local Dealer

or Grain Bags Canada at 306-682-5888

www.grainbagscanada.com

CANADIAN TARPAULIN

7082 Bu. Hopper Bin

9702 bu. Hopper Bin

19.5’ DIAMETER BIN

22’ DIAMETER BIN

H. Duty 12 leg cone c/w 24” port Painted cone inside & out Double 4”x8” skid Setup included (Saskatoon Area) Air Screen & 7hp Fan (Extra)

H. Duty 14 leg cone c/w 24” port Painted cone inside & out Setup included (Saskatoon Area) Triple 4”x6” skid (Extra) Air Screen & 10hp Fan (Extra)

$19,455. + gst/delivery

$21,855. + gst/delivery

“SUPPLY ONLY PACKAGES”

“SUPPLY ONLY PACKAGES”

M AN UFACTURERS L TD.

306-933-2343

1- 888- CAN - TAR P (2 2 6- 82 77)

w w w .ca n ta rp.co m KEHO/ GRAIN GUARD/ OPI STORMAX. For sales and service east central SK. and MB., call Gerald Shymko, Calder, SK., 306-742-4445 or toll free 1-888-674-5346.

HOPPER AERATION

7082 Bu. $17,220. + gst/delivery 9702 Bu. $18,935. + gst/delivery

AA-GG.COM

Authorized Dealer

5- 5 HP and 1- 3 HP aeration fans, 4- transition tubes, related aeration ducting, offers. Located Viscount, SK. 403-312-5113.

READY TO SHIP!! CREWS AVAILABLE!!

AUG US T S P ECIALS S TEEL BIN FLOOR S AER ATION FAN S TEM P M ON ITOR IN G TEM P M ON ITOR IN G

KEHO/ GRAIN GUARD Aeration Sales and Service. R.J. Electric, Avonlea, SK. Call 306-868-2199 or cell: 306-868-7738.

AERATION FAN S Sa ve

Up 3 HP = 5 HP = 7 HP =

T o 3 5% 995 $ 13 25 $ 16 45 $

D ARM AN IG RAIN S TO RAG E 1-86 6 -6 6 5-6 6 77 w w w.d a rm a n i.c a


42 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

2007 BATCO 1335 TD w/electric motor, BRANDT GRAIN AUGER, 8â&#x20AC;?x46â&#x20AC;&#x2122;, track mov$8500. 306-858-2400, Lucky Lake, SK. er, bin sweep, $8000. 306-472-3113, Briarcrest, SK. NEW 2400 BATCO belt conveyor- Get more capacity, up to 14,000 bu./hr., 23.5â&#x20AC;? FARM KING 13â&#x20AC;?x70â&#x20AC;&#x2122;, hyd. mover, brand belt with a 14â&#x20AC;? tube. Call your nearest Fla- new, never used except for undercarriage, $15,500; Farm King 13â&#x20AC;?x85â&#x20AC;&#x2122;, hyd. mover, man Sales store or call 1-888-435-2626. used slightly, immaculate condition, BUILD YOUR OWN conveyors, 6â&#x20AC;?, 7â&#x20AC;?, 8â&#x20AC;? $17,500. 306-260-4343, Dinsmore, SK. and 10â&#x20AC;? end units available; Transfer conveyors and bag conveyors or will custom FARM KING 10â&#x20AC;?x50â&#x20AC;&#x2122; mechanical swing build. Call for prices. Master Industries grain auger, never used for fertilizer, vg Inc. www.masterindustries.ca Phone cond., $4300. 306-276-2442, Nipawin, SK. 1-866-567-3101, Loreburn, SK. 2008 WHEATHEART 13X71 auger, power TUBE CONVEYORS, 1 HP motor, 17â&#x20AC;&#x2122; long, swing and lift, full bin alarm, $11,000; 8â&#x20AC;? diameter, $250. and 5â&#x20AC;&#x2122; long, 6â&#x20AC;? diame- Farm King 10X60, $2000. 204-673-2402, ter, $200; Hytrol flat portable conveyor, or 204-264-0398, Waskada, MB. 20â&#x20AC;&#x2122; l, 18â&#x20AC;?w, $300. Call 218-291-0966, SAKUNDIAK 10â&#x20AC;?x52â&#x20AC;&#x2122; swing auger, good Moorhead, MN. condition, $4500. 306-459-2676, Ogema, BATCO CONVEYORS, new/used, grain SK. augers, grain vacs, SP kits. Delivery and NEW 10x51 WHEATHEART auger - c/w 38 leasing available. 1-866-746-2666. HP motor and mover kit. Get more capacity! Call your nearest Flaman Sales store or call 1-888-435-2626. DICKEY JOHN NH3 sectional control sys- MX WESTFIELD 10X61 swingaway auger, tem, 6 section capability, $1500 firm. $4500. 306-592-4405, Buchanan, SK. 780-842-8917, Edgerton, AB. 2012 FARM KING 16â&#x20AC;?x104â&#x20AC;&#x2122; auger, hyd. lift, FERTILIZER STORAGE TANKS- 8300 Imp. hyd. swing, very little used. Phone gal. tanks available. Contact your nearest 204-744-2279, Altamont, MB. Flaman store or call 1-888-435-2626 or NEW 13â&#x20AC;? WHEATHEART SWING AUGER visit www.flaman.com X13-74, w/remote and hydraulic lift LOOKING FOR a floater or tender? Call me w/reverser, reg. $26,210, sale $22,500. first. 33 years experience. Loral parts, new 306-648-3622, Gravelbourg, SK. and used. Call 403-650-7967, Calgary, AB. SAKUNDIAK GRAIN AUGERS available with self-propelled mover kits and bin FOR ALL YOUR sweeps. Contact Kevinâ&#x20AC;&#x2122;s Custom Ag in Nipawin toll free 1-888-304-2837. WHEATHEART 10â&#x20AC;?x61â&#x20AC;&#x2122; auger, has meEQUIPMENT NEEDS chanical swing, in new condition, $9000. ADAMS SPREADER & TENDER 306-553-2239, 306-741-6040 Neidpath SK CALL US FOR PARTS ON ALL

BOOK TODAY and SAVE on your bottom line. Quality GRAIN BAGS at wholesale pricing. All sizes available! We also sell net wrap, twine, pit covers, and more! Donâ&#x20AC;&#x2122;t pay till we deliver it! Inventory also available in Manitoba and Sask. Call Mike at 403-634-1615, Lethbridge, AB. www.committedagsupply.com FLAMAN GRAIN BAGS. Offering Up North grain bags as well and Prostor. 10â&#x20AC;&#x2122; diameter bags, x200, x250, x300, x400. For details call Flaman Nisku, 1-800-352-6264.

2008 MAINERO 2230 GRAIN BAGGER, 9â&#x20AC;&#x2122;, h o p p e r e x t e n s i o n . C a l l fo r d e t a i l s , 306-287-8062, Watson, SK. 2008 BRENT 1282 grain cart. Mostly shedded since new. $49,000. Phone 306-867-3832, 306-222-405 Kenaston SK. PARKER 2 COMPARTMENT grain cart, 450 bushel, $2200. 780-915-3417, Tofield, AB. USED BALZAR 1500 bu. grain cart, 4 tire, walking axles, 5 PT weigh scale, roll tarp, 24â&#x20AC;? auger, $59,000. Call Flaman Sales Saskatoon at 1-800-435-2626.

  

)(,+!,$

FERTILIZER

          

SPREADER/TENDER MAKES AND MODELS

*''+(*+(%+ (% %*!#+*!#+,,$ ,*)&,')+#$)%!,$

1 800 667 8800

www.nuvisionindustries.ca

GRAINMAX HIGH CAPACITY AUGERS 8 MODELS TO CHOOSE FROM 6395 EXTEND

NEW

SWING AUGER

SEE VIDEO ON WEBSITE

2011 KILLBROS 1950, 1100 bu. grain cart, scale, 900 tires, used one season, like new. Will trade for tridem or semi truck. 306-921-6697, 306-752-3777, Melfort, SK. 2007 PARKER 739 Cart, PTO, good condition, $26,000. 306-644-4742, Loreburn, SK BRENT 674, JM 875 and JM 750. Call 306-563-8482, 306-782-2586, Rama, SK.

AVALANCHE 1084, 2008 scale tarp, walking axles, very clean, $39,000. Corner Equip., Dwight, 204-483-2774, Carroll, MB.

2006 BRENT 880 grain cart, hyd. drive or *'*+  WESTFIELD MK-100-61 swing away grain PTO, $30,000 OBO. Call 403-823-8264, auger, good condition, asking $4800. (#, +& ""&&"" Drumheller, AB. 306-233-5722, Wakaw, SK.  ,*)& ,')( FARM KING 10x70 swing auger, hyd. mover, full bin indicator, one season, first 2009 AKRON E9250 grain bagger, 9â&#x20AC;&#x2122;, vg $10,000. 780-208-4808, Two Hills, AB. shape, $12,000. Tyler 306-533-8834, Trent S A K U N D I A K A U G E R S I N S TO C K : 306-540-5275, Regina, SK. swings, truck loading, Hawes Agro SP movers. Contact Hoffart Services Inc. GRAIN BAGS on sale NOW! Imported 10x250, $499. ProStor (by Grainflex) Odessa, SK, 306-957-2033. 9x250, $599; 10x250, $679; 10x300, $799. 2006 BUHLER FARM KING, 13x70, hyd. Limited time offer, Call your local Flaman swing, reverser, lights, never used for fer- store today or call 1-888-435-2626. tilizer, good cond., can deliver, $12,000 2010 RICHIGER EA240, 9â&#x20AC;&#x2122; or 10â&#x20AC;&#x2122; bag exOBO. 204-734-8071, Swan River, MB. tractor w/2008 R9 Richiger grain bagger, $32,000. 306-858-2400, Lucky Lake, SK.

FULL-BIN SUPER SENSOR Never Clim b A B in A ga in

1 800 667 8800

www.nuvisionindustries.ca SAKUNDIAK AUGER SALE: With engine, mover and electric clutch. HD 8x39, cash $13,800; HD 8x53, cash $15,750; HD 10x53, cash $17,900; TL 10x39, cash $15,250. 306-648-3622, Gravelbourg, SK.

REPLACEMENT FLIGHTING FOR augers, seed cleaning plants, grain cleaners, combine bubble-up augers.

Rosetown Flighting Supply 1-866-882-2243, Rosetown, SK www.flightingsupply.com

SAKUNDIAK SWING AUGER SALE: SLMD 10-72, cash price $12,750; SLMD 12-72, cash price $17,500; SLMD 12-79, cash price $18,900. Used SLMD 12-72, cash $12,500. 306-648-3622, Gravelbourg. AUGERS: NEW and USED: Wheatheart, Westfield, Westeel, Sakundiak augers; Auger SP kits; Batco conveyors; Wheatheart post pounders. Good prices, leasing available. Call 1-866-746-2666. MERIDIAN 12x72â&#x20AC;&#x2122; SWING auger, $17,250; Meridian 12x79â&#x20AC;&#x2122; swing auger, $18,450; Sakundiak 10x1200, 29 HP, Kawasaki, new tube and flight SP kit, $13,750. Brian â&#x20AC;&#x2DC;The Auger Guyâ&#x20AC;&#x2122;, 204-724-6197, Souris, MB. 10â&#x20AC;?X41â&#x20AC;&#x2122; FARM KING AUGER, 30 HP Kohler eng., Hawes mover, electric clutch, used 2 yrs. Retired. 306-752-3820, 306-921-9920 cell, Melfort, SK. 2009 FARM KING 10â&#x20AC;?x60â&#x20AC;&#x2122; mechanical swing auger, exc. shape, replaced with 12â&#x20AC;?, $6500. 306-554-2850, Wynyard, SK.

BRANDT 2610 grain bag loader, $21,500; Brandt 8510 grain bag unloader, $31,500. DEMO 1150 ELMERS cart, 2012 green, 900 Both exc. 403-578-3308, Coronation, AB. rubber, tarp and 460 scale, fast unload and best clean out in the industry, $54,900. Call Corner Equipment, Dwight, 204-483-2774, Carroll, MB. 2006 UNVERFERTH 9250 grain cart, 925 2006 STX280, 16 SPD. POWERSHIFT, bu. Contact Hodgins Auctioneers at 306-228-297 1 o r PTO, diff. locks, 900R50 big single tires, 1-800-667-2075. PL #915407. 1632 hrs, asking $130,000. Call 1-87 7 -228-5 5 98 GRAIN CARTS: 450-1050 bu. large inven- 403-755-6374, 780-385-0260, Alliance, AB w w w .fullb in s upe rs e n s o r.co m tory. JM500- $9000; Brent 620- $10,000; 2010 UNVERFERTH 1115 Xtreme, 24â&#x20AC;? auNEW â&#x20AC;&#x153;Râ&#x20AC;? SERIES Wheatheart Augers: JM750- $12,500; JM875- $20,000. Call ger, 20.8 duals, tarp, hyd./PTO drive, used With engine, mover, and electric clutch. 204-857-8403, Portage la Prairie, MB. one season 306-743-5178, Langenburg, SK R-8x41, cash price $12,250; R-8x51, cash $12,750; R-10x41, cash $13,240. 306-648-3622, Gravelbourg, SK. NEW SAKUNDIAK TL 10x1200, regular $7493, cash $5998; Sakundiak SLM 12x2400, list $19,488, demo unit $14,897. 780-888-7659, Lougheed, AB.

Equip yo ur a uge r to s e n s e w h e n th e b in is full. 2 ye a r w a rra n ty. Ca ll Brow n le e s Truckin g In c. Un ity, SK

M AGNETIC CAM ERA PACKAGE

â&#x20AC;˘ Po s itio n gra in a u ger o r co n veyo r in to b in rem o tely; N EW b y yo u rs elf. PRODUCT â&#x20AC;˘ Po w erfu l m a gn ets to a d here to gra in & co m b in e a u gers , co n veyo rs , etc. â&#x20AC;˘ Ca m era is w a terpro o f & co lo r w ith a u d io . S ee w eb s ite fo r m o re d eta ils o r Ca ll

Brow n le e s Truckin g I nc. Un ity, S K

306-228-297 1 o r 1-87 7 -228-5 5 98

w w w .fullb in s upe rs e n s o r.co m

â&#x20AC;&#x2DC;04 BRENT AVALANCHE GRAIN CART 1,100 bu., tandem walking axle, 20â&#x20AC;&#x2122; hyd. auger, hydraulic drive avail. $30,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

GET ON THE right track with a J&M Storm Tracker grain cart. Excellent flotation on soft fields and reduced soil compaction, 1326 to 1501 bu. capacities available, call Flaman Sales at 1-888-435-2626.

PTO DRIVEN VERTEC grain dryer, model VT 6500, propane burner, in good shape, $28,000 OBO. 204-841-0779, Carberry, MB SUKUP GRAIN DRYERS: 1 or 3 phase, liquid propane or nat. gas, canola screens. In stock and ready for immediate delivery. 204-998-9915, Altamont, MB. NEW AND USED grain dryers. Contact Franklin Voth, Manitou, MB. 204-242-3300 or cell: 204-242-4123, www.fvoth.com SUPERBEE GRAIN DRYERS and Moridge NEW HARROWS, used harrows. Call Cor- dryer parts in stock. 306-272-4195, Foam ner Equipment for all your harrow needs. Lake, SK. Fall Specials include new 60â&#x20AC;&#x2122; gates, heavy harrow, $29,900; New 84â&#x20AC;&#x2122; Gates heavy harrow, $39,000; Degelman 2008 82â&#x20AC;&#x2122;, new tines, $34,500; Bourgault 70 mid 6000, SELLING GRAIN LEGS, distributors, connice shape, $24,500. Corner Equipment, veyors and truck scales. Also other elevators parts. 403-634-8540, Grassy Lake, AB. Dwight, 204-483-2774, Carroll, MB. PARKER 675 GRAIN CART, also Bruns 3 USED 120â&#x20AC;&#x2122; high capacity commercial 4-wheeled grain wagon. Art Beck Farm grain legs. Asking $38,000/ea; Also used Equipment Auction, Saturday, August 24, dust collection system, asking $10,000. 2013, Yellow Grass, Sask. area. Visit Open to offers on the whole works, want it www.mackauctioncompany.com for sale gone ASAP!! 780-247-0101, High Level, AB bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962 2010 DEGELMAN, 1150 bu, unfolding pivot OPI TEMPERATURE and moisture cablesauger, can be lowered, 35.5x32 rubber, accurately monitor your grain in the bin. roll tarp, 1000 PTO, shedded, exc. cond. The Integris system monitors grain from 306-944-4252, 306-231-8523, Viscount SK your computer. Pricing starts at $265/bin. N E W 4 0 0 B U. G R AV I T Y WAG O N S , Call Flaman in Saskatoon 1-888-435-2626 $7,100; 600 bu., $12,000. Large selection or www.flaman.com used gravity wagons, 250-750 bu. Used LABTRONICS MOISTURE TESTER Model grain carts, 450-1050 bu. 1-866-938-8537. 919, used by producers and elevators, www.zettlerfarmequipment.com available as a complete kit plus complete set of charts, power adapter and operational manual, used very little. Saskatoon, SK, 306-244-1246, ikelsey@sasktel.net INDENT LENGTH SEPARATOR, Model Ideal S32QC, Serial #1277, 3â&#x20AC;? over 3â&#x20AC;?, 6 drum machine, disassembled, $400/ea; Spiral separator, 4 double core units, no housing, $350. per 2 core unit. Call 218-291-0966 Moorhead, MN. #3 UNIFLOW w/3 piece shells, 245 w/asM a n u fa c tu re r o fthe pirator, precision graders, Carter disc, variM o d e l 919ÂŽ M o is ture Te s te r ous shells. 204-534-2566, Boissevain, MB. DUAL STAGE ROTARY SCREENERS and Kwik Kleen 5-7 tube. Portage la Prairie, www.zettlerfarmequipment.com or call 204-857-8403. SUPERIOR SCALPER ASPIRATOR; 3 Carter Day no.3 indents, will shells, stands and motors; Carter 412 grader w/shells and stand; Forever 54â&#x20AC;? w/full set of screens; Oliver 160 Gravity. Phone 204-871-4666, MacGregor, MB. 2 PIECE EXCHANGE scalping sieves FG 5.5x23 mm and 2 piece exchange main sieves FG 2.20x23 mm. Two complete sets of four pieces each, 1 used, $1200, 1 new, $1500. Cdn. funds, buyer covers shipping. Purchased from Buhler Inc for cleaning machine LAAA TAS 152A-2. Call Ken at 250-546-8911, Armstrong, BC. or email Ken.Smith@gambrinusmalting.com CUSTOM COLOR SORTING chickpeas to mustard. Cert organic and conventional. 306-741-3177, Swift Current, SK. TWO VINTAGE CLIPPER seed cleaners, table top model, completely restored c/w new seed hopper and removable screening bin. Includes trays and 25+ screens. $1800/each. 780-674-3672, Barrhead, AB. USED LMC CLIPPER Titan screens for sale. $50/each OBO. 13/64 slot, 14/64 slot, 17x3/4 slot, 15/64 slot, 18/64 slot. 16 of each size. 306-352-5200, Regina, SK. FAN, 14â&#x20AC;? inlet, 16â&#x20AC;? exhaust, 10 HP, explosion proof motor, $500; Gravity table, make: Forsber, model: 50V, serial #5654, $2,400; Hullers, quantity 3, make: Forsberg, model: 2, serials #14946, #14947, #14948, $500. Contact 218-291-0966, Moorhead, MN. CUSTOM COLOR SORTING. All types of commodities. Call Ackerman Ag Services 306-638-2282, Chamberlain, SK. WANTED: LOOKING FOR grain cleaning e q u i p m e n t , 2 0 0 t o 4 0 0 b u . / h o u r. 306-640-8600, Assiniboia, SK.

N ew M o d el 9 19 Ž Co n vers io n Cha rt App. No w Ava ila b le fo r iPho n e, iT o u ch $ 00 o r iPa d .................

149

Digita l Gra in S ca les , Do cka ge S ieves , T es t W eightE q u ip m en t- 0.5L m ea s u re, S m a rt s co o p fo r tes tw eighto r fert. b u lk d en s ity. Gra in S a m p ler Pro b es - 4,6,8, & 10' len gths . T herm o m eters , Ca n o la E q u ip . & S ieve S ets . L a b tro n ics Ž /M o to m co M o d el 919Ž S ervice & Reca lib ra tio n . 

P hone 204-7 7 2-6998 12 Ba n go rAve., W in n ip eg, M B R3E 3G4 or vis itw w w .la b tro n ics .ca for m ore info. In Alb erta ca ll N ick C h o m ik a t 7 80-35 2-4023

2009 BRANDT 5000 EX grain vac. Art Beck Farm Equip. Auction, Saturday, August 24, 2013, Yellow Grass, Sask. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962 REM 2700 GRAIN VAC, 182 hrs., $16,500 OBO. 780-888-1258, Lougheed, AB. GRAIN VACS: REM 552 - $3500, REM 2500 HD - $9500, Brandt 4000 - $7000, Brandt 4500 - $7500, Weigh wagon w/digital scale - $3500. 1-866-938-8537. VAC-U-VATOR GRAIN VAC, very good c o n d . , a l w ay s s h e d d e d , $ 3 0 0 0 . P h . 306-429-2785, Glenavon, SK. CONEYAIR GRAIN VACS, parts, accessories. Call Bill 780-986-5548, Leduc, AB. www.starlinesales.biz

2005 J&M 1075 grain cart, 22â&#x20AC;? unloading auger, 2cameras, $35,000 OBO. Call Jake 2009 BRENT 1194, tarp, 20.8x38 tandem 403-740-6500, Stettler, AB. tires, private machine, only used 3 yrs, ex- 2006 BOURGAULT 750 cart, bought new in cellent, $51,000. Lloyd Sproule, Pincher 2008, scale, tarp, 1000 PTO, 800/32 tires, FLAMAN AERATION FANS: 3 HP, 5 HP, 7 Creek, AB. 403-627-2764, 403-627-7363. $32,500 OBO. 306-228-7997, Unity, SK. HP. Available in turbo, inline and full centrifugal. For details and pricing call 1-800-352-6264, Flaman Sales, Nisku, AB.

SAKUNDIAK 12X72â&#x20AC;&#x2122; SWING AUGER, used for 3 seasons, very good condition, asking $13,000. Phone 306-537-0942 or 306-771-4319, Edenwold, SK.

FARM KING 13X70 swing auger, hyd. winch, hyd. mover kit, excellent condition. REMOTE CONTROL SWING AUGER Call 306-563-7505, Canora, SK. movers, trailer chute openers, endgate and hoist systems, wireless full bin alarms, FULL BIN ALARM digital wireless tractorCam, the Simpler Sampler portable combine. All shipped diSTOP climbing bins! rectly to you. Doing it right, keeping you Alarm sounds when bin is full! safe, by remote control. Phone Brehon Agrisystems at 306-933-2655 or visit us THREE IN ONE: at www.brehonag.com Saskatoon, SK. 1. COMPLETE AUGER SPOUT 2012 WHEATHEART 8x51 R Series auger with â&#x20AC;&#x153;NO SNAG SPOUTâ&#x20AC;? with mover and clutch, $10,500. 306-452-3868, Redvers, SK. 2. FULL BIN ALARM 10X61 WESTFIELD auger, w/hydraulic 3. NIGHT LIGHT swing, shedded. Contact 780-366-2383, â&#x20AC;˘ Available for 10, 13 Myrnam, AB. and 16 inch augers MERIDIAN GRAIN AUGERS: SP kits and â&#x20AC;˘ No batteries needed clutches, Kohler, B&S engines, gas and â&#x20AC;˘ Enclosed Sensor diesel. Call Brian â&#x20AC;&#x2DC;T h e A u g e r G u y â&#x20AC;&#x2122; 204-724-6197, Souris, MB. â&#x20AC;˘ Proven Design since 2003 SAKUNDIAK AUGERS: New 2013 stock arriving daily! Used 12â&#x20AC;?x72â&#x20AC;&#x2122; SLM/D 14,900; â&#x20AC;˘ Valued priced from 12â&#x20AC;?x78â&#x20AC;&#x2122; SLM/D 15,900. In stock: Convey$515 to $560 All TCSNH-1045 hyd. drive, c/w mover kit, + shipping and 38 HP Kohler diesel, list $38,900. â&#x20AC;˘ 3 days delivery to Leasing available. Call Dale, Mainway Farm Equipment, 306-567-3285, 306-567-7299 your farm www.mainwayfarmequipment.ca DavidIf you donâ&#x20AC;&#x2122;t like it, send back after son, SK. harvest for a refund. NEW 2013 HARVEST Int. heavy duty grain John & Angelika Gehrer auger dealer. Commercially built, hi speed volume. All sizes 8â&#x20AC;?/10â&#x20AC;?/13â&#x20AC;? in stock, 36â&#x20AC;&#x2122; NEVER SPILL SPOUT Inc. to 112â&#x20AC;&#x2122; available. Special intro pricing in 1-866-860-6086 effect now! Gary Reimer, 204-326-7000 www.neverspillspout.com reimerfarmequipment.com Steinbach, MB.

5(11*UDLQ%DJJHU   DĹ˝Ä&#x161;Ä&#x17E;ĹŻ

dƾŜŜÄ&#x17E;ĹŻ tĹ?Ä&#x161;Ć&#x161;Ĺ&#x161;

ĆľĹ?Ä&#x17E;Ć&#x152; Ĺ?Ä&#x201A;ĹľÄ&#x17E;Ć&#x161;Ä&#x17E;Ć&#x152;

Ä&#x201A;Ć&#x2030;Ä&#x201A;Ä?Ĺ?Ć&#x161;Ç&#x2021; Ä?ƾ͏Ĺ&#x161;Ć&#x152;

ŽŜÇ&#x20AC;Ä&#x17E;Ç&#x2021;Ĺ˝Ć&#x152;  KĆ&#x2030;Ć&#x;ŽŜ

 Z'Ď­ĎŹ

Ď­ĎŹÍ&#x203A;

ϭϲÍ&#x;

Ď­Ď´Í&#x2022;ĎŹĎŹĎŹ

ĎŽĎ°Í&#x;ÍžtÍżÇ&#x2020;ĎŽĎŽÍ&#x203A;Íž>Íż

 Z'Ď­ĎŽ

Ď­ĎŽÍ&#x203A;

ĎŽĎŹÍ&#x;

ĎŻĎŻÍ&#x2022;ĎŹĎŹĎŹ

ĎŻĎŹÍ&#x;ÍžtÍżÇ&#x2020;ĎŽĎ°Í&#x203A;Íž>Íż

Íť/ĹśĆ&#x161;Ä&#x17E;Ĺ?Ć&#x152;Ä&#x201A;Ć&#x161;Ä&#x17E;Ä&#x161;ĨŽůÄ&#x161;Ĺ?ĹśĹ?Ć&#x161;Ć&#x152;Ä&#x201A;ĹśĆ?Ć&#x2030;Ĺ˝Ć&#x152;Ć&#x161; ÍťhŜůŽÄ&#x201A;Ä&#x161;Ć&#x161;Ć&#x152;ĆľÄ?ĹŹĆ?Ä&#x201A;ĹśÄ&#x161;Ĺ?Ć&#x152;Ä&#x201A;Ĺ?ĹśÄ?Ä&#x201A;Ć&#x152;Ć&#x161;Ć?Ä&#x201A;Ć&#x161;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ć?Ä&#x201A;ĹľÄ&#x17E;Ć&#x;ĹľÄ&#x17E;

5(110LOO&HQWHU,QF55/DFRPEH$%7/1 &DOOWKHIDFWRU\WRILQG\RXUORFDOGHDOHU 7(/_ZZZUHQQPLOOFRP

GSI GRAIN DRYERS. Ph. Glenmor, Prince Albert, SK., 1-888-708-3739. For all your grain drying needs! www.glenmor.cc We are the GT grain dryer parts distributor. RETIRED: SUPER B automatic 115 bu. batch grain dryer, auto. load/unload, one owner, 2505 hrs., good cond., c/w loading auger; Also available 2000 gal. propane tank, 8x1400 (46â&#x20AC;&#x2122;) unloading Sakundiak auger w/new 10 HP elec. motor. Can email pics. 306-873-8444. Listed with Schapansky Auctions, Tisdale, SK. August 13th, 2013. www.schapansky.com 2003 GSI 112 grain dryer, good cond., 1200 hrs., $26,500 OBO. Can email pictures. 204-324-1561, cell: 204-324-4264, Halbstadt, MB. QED HIGH EFFICIENCY grain dryer, 6 million BTU. Installed 2008 in commercial operation, dried less than 5000 bu., like new, 50â&#x20AC;&#x2122; tall modular design, asking $115,000 OBO. 306-694-7760, Moose Jaw, SK.

2009 WALLINGA 6614 grain vac, used very little. Call 306-862-5993, 306-862-7138, Codette, SK. REM 1026 GRAIN vacuum, good condition, 10â&#x20AC;? auger, $7000 OBO. 306-747-3771, Shellbrook, SK.

MASSEY FERGUSON NO.3 baler, running condition, $750 OBO. 780-872-0700, Lloydminster, SK. USED IBEC GRAIN DRYER, model 1216, propane operated, located in Davidson, SK. 1989 JD #468 square baler, with 1/4 turn, greaser, hyd. tension, very good condition. Call 403-593-8293. Call 306-342-4456, Glaslyn, SK. VERTEC 6700 with roof, nat. gas burner, elec. fan, Ibec auto moisture and meter 2005 NH BR780, $12,267, Raymore New control, wet/dry auto fill, $36,000. Call Holland, 306-746-2911, Raymore, SK. or 306-961-1170, Domremy, SK. www.raymorenewholland.com


CLASSIFIED ADS 43

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

NH BR780 BALER, 1000 PTO, extra sweep NEW HOLLAND 855 round baler, $1600; PU, Bale Command, net and twine, shed- NH 848 round baler, $1100. 306-395-2668 d e d , e x c e l l e n t c o n d i t i o n , $ 1 5 , 0 0 0 . or 306-681-7610, Chaplin, SK. 780-352-4947, Millet, AB. NEW HOLLAND 315 square baler, $1500; JD 335 ROUND baler, very good condi- NH model 114, 12’ haybine, $2500. Call t i o n , $ 6 7 0 0 . N e a r B a l g o n i e , S K . 306-395-2668, 306-681-7610, Chaplin, SK. 306-771-2923, 306-535-0922, cell. MONITOR AND CABLE for JD 567 round 2002 JD 567 round baler, silage w/mega baler. For model with baler serial number wide PU, bale push bar, hyd. PU, net wrap, w i t h l a s t 6 d i g i t s b e fo r e 3 0 0 , 0 0 0 . excellent cond, field ready. 403-574-2222, 306-455-2615 or 306-577-9068 Arcola, SK Stettler, AB. BALE SPEAR ATTACHMENTS for all 2007 NEW HOLLAND BR780A, wide PU, loaders and skidsteers, excellent pricing. bale command, floatation tires, 9000 Call now 1-866-443-7444. bales, rebuilt PU 2 yrs. ago, new belts this yr., $19,000 OBO. Derreck, 306-229-6161, NEW IDEA BALER, parting out: drive shaft, gear box, hydraulic cylinder, etc. Cudworth, SK. 306-376-4500, Meacham, SK. CASE/IH 8465 1998, 5x6, auto. Call for NET WRAP, TWINE, silage covers, grain details 306-864-2200, Kinistino, SK. bags! Excellent pricing, fully guaranteed NEW IDEA 4865 round baler, 5x6 bales, products. In stock now. 306-227-4503 hyd PU, 2300 bales, shedded, good shape. Saskatoon, SK. www.norheimranching.com 306-944-4325, 306-231-8355, Bruno, SK JD 2001 and 2004, 567 balers, 1000 PTO, 664 NH BALER, hard core w/bale com- Mega PU, shedded, top shape, $12,000 mand, bale kicker, no welds, nice cond., and $14,000. 403-308-4200, Arrowwood. $6500 OBO. 306-946-7151, Watrous, SK. 2003 567 BALER, MegaWide PU, twine 338 JD SQUARE BALER, shedded; 1037 NH tie, heavy drive chains, shedded, well bale wagon, 105 bales. Call 306-672-3746, maintained, no dents or dings, premium cond., 18,000 bales. Wawota, SK. Gordon 306-672-7822, Gull Lake, SK. 306-739-2763, Trevor 306-739-2924. 2007 CIH RBX563, $21,000. Raymore New Holland. 306-746-2911, Raymore, SK. RBX 562 CASE/IH round hard core baler, e x c e l l e n t c o n d i t i o n , $ 1 2 , 0 0 0 O B O. or www.raymorenewholland.com 403-470-1210, Irricana, AB. 2008 NH BR7090, netwrap, 8240 bales, regular PU with gathering wheels, exc. 2003 NH BR780, $8000, Raymore New condition, $26,000 OBO. 306-236-8968, Holland, 306-746-2911, Raymore, SK. or www.raymorenewholland.com 306-236-3637, Makwa, SK. MF 228 SQ. BALER, premium condition; 2003 NH BR780, $16,500, Raymore New MF 124 baler, excellent. 306-283-4747, Holland, 306-746-2911, Raymore, SK. or www.raymorenewholland.com Langham, SK. 605L round baler, flotation tires, MF 128 SQUARE , 1/4 turn chute, wide PU, VERMEER athering wheels, $6000 OBO. l o w b a l e s , s h e d d e d , g o o d s h a p e . g306-524-4901, Semans, SK. 306-944-4325, 306-231-8355, Bruno, SK. 1999 NH 664 round baler with Bale Com2007 NH BR780A, extra sweep PU, floa- mand, $8000. Phone 306-558-4444 or tation tires, hyd. PU lift, vg condition, 306-558-7133 cell, Maple Creek, SK. shedded. 306-921-8594, 306-752-4810, Melfort, SK. BALE SPEARS, high quality imported from Italy, 27” and 49”, free shipping, excellent pricing. Call now toll free 1-866-443-7444, Stonewall, MB. 2007 NH BR780A, auto wrap, hyd. PU, $8500. 2008 NH BR7090, net wrap, endless belts, hyd. PU, $14,000. Contact 204-636-2448, Erickson, MB.

1995 MALDON 9000 Westward windrower, dual speed turbo, shedded unit, 960 Maldon 30’ platform, PU reel, consignment piece, has not been used in 5 yrs, 1552 hrs, $34,900. Steinbach, MB. Gary Reimer, 204-326-7000 reimerfarmequipment.com

HESSTON 1160 14’ haybine hydroswing, good condition, and shedded, $8000. Tho2011 NH BR7090, $23,900. Raymore New rhild, AB. 780-398-3858, 780-307-8337. Holland, 306-746-2911, Raymore, SK. or www.raymorenewholland.com 2002 RBX 561 hard core round baler, field r e a d y, g o o d b e l t s , $ 7 0 0 0 O B O . 306-681-7610, Chaplin, SK. 2007 BR780A NH baler, made 3000 bales, shedded, Trelleborg floatation tires, autotie, kicker, extra wide hyd. PU, $19,000 OBO. Call 306-861-5222, Weyburn, SK. 2005 CIH RBX562, $13,204, Raymore New Holland, 306-746-2911, Raymore, SK. or www.raymorenewholland.com WILK BALE WAGON, hauls 17 - 22 bales; New Holland 357 mixmill, vg shape. Call 306-488-2103, Holdfast, SK.

C anu ck Prem iu m N etw rap N etwrap - H igh quality,im ported from G erm any 67’’startin g at$205 64’’startin g at$200 Silage B alew rap -startin g at$84

Pho ne:403-994-7207 or 780-206-4666 www.canadianh ayandsilage.com

‘05 DEGELMAN 1220 SIDEARM, mower attachment, 1000 PTO front & rear, fits 10`-20`mowers, $6,980. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com 18’ NH HAYBINE, not used since 2010, good shape, $18,000. Call for pics, 306-697-7463, Grenfell, SK. 2011 JOHN DEERE A400 windrower, 350 hours, $139,000. Wynyard, SK. Call 306-554-2536, www.maplefarm.com or call one of our 7 stores near you. 2004 HESSTON 1275 16’ mower conditioner, new knife, vg cond. $11,000 OBO. Phone 306-421-0679, Estevan, SK. JOHN DEERE 1600A 16’ haybine, in good condition, $6900. Near Balgonie SK. 306-771-2923, 306-535-0922, cell.

Euro B elting & Ind ustria l Sup p l yLtd .

W here S olutions a re Endles s Beltin g fo r a ll a gric u ltu re a p p lica tio n s . 4603 - 91 Ave . Ed m o n to n , Alb e rta , C a n a d a T6B 2M 7 Te l (780) 451-6023 100% C a n a d ia n Ow n e d Fa x: (780) 451-4495 To ll Fre e : (866) 3 67-23 58 Em a il: e u ro b e lt@ te lu s pla n e t.n e t Ca ll 1-86 6 -FO R-BELT Rou n d Ba le r Be ltin g

NEW MACDON 16’ R85 disc mower conditions in stock, ready to go. Finance or lease or huge cash discounts. Cam-Don Motors Ltd., 306-237-4212, Perdue, SK. 2009 JD 4895 windrower w/895 power reverser header, bar tires, HID lights, variable spd. reel, 488 hrs., premium 2011 ANDERSEN NWX60 plastic bale cond., $85,000 OBO. Ph. 204-838-2352, wrapper, never been used. Taking offers. Virden, MB. Email: sdryden@rfnow.com Call 306-342-4456, Glaslyn, SK. MACDON R80 discbines, 2009 and 2010, as new, $22,000 each. Call 306-441-0452, 306-398-7449, Cut Knife, SK. MF 220 SERIES II, c/w 16’ hay header, 1465 hrs., nice shape, $38,000 OBO. 780-763-2179, Myrnam, AB. 2011 CASE/IH RD 182, 18’ disc mower conditioner header, $15,000. Muenster, SK. 306-682-4520, 306-231-7318 cell. NEED BALERS? ‘01 HESSTON 856A, $9,800; ’83 MF 124 Square Baler in exc. cond’n, $4,850; NH 166 Inverter in good cond’n, $3,980. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com 2005 CASE/IH RBX 562 round baler, wide PU, belts new or vg, chains excellent, wet kit, will bale rotary straw, 10,000 bales, always shedded, $13,900. 204-834-2401 or NEW 2012 MF (Hesston) 1375, 15’ 3” disc 204-476-0100, Carberry, MB. mower conditioner. Pre-season sale, 3.99% for 72 mos, no chg, OAC plus cash discounts. One available. Cam-Don Motors Ltd., 306-237-4212, Perdue, SK. BOOK TODAY and SAVE on your bottom JUST OFF LEASE: 2010 MF 1475 (Hesston) line. Quality NET WRAP at wholesale pric- 16’ mower conditioner, low acres, sheding. All sizes available! We also sell grain ded, vg, $25,900. Cam-Don Motors Ltd., bags, twine, pit covers, inoculants and 306-237-4212, Perdue, SK. more! Don’t pay till we deliver it! Inventory also available in Manitoba and Sask. Call 2007 FRONTIER MOWER conditioner 16’, Mike at 403-634-1615, Lethbridge, AB. $17,500 OBO; Also, Case/IH baler, $4000 www.committedagsupply.com OBO. 306-682-3095, Humboldt, SK.

RECON 200 HAY Conditioner, PTO drive, $5500 OBO. 306-524-4901, Semans, SK. 12’ NH 499 hydro-swing haybine, always s h e d d e d , ve r y g o o d c o n d i t i o n . C a l l 306-342-4329, Medstead, SK. 21’ 885 MF MacDon gas swather w/HD wobble box, $3900. No Sun. calls please. 204-427-2074, 204-324-7410, Tolstoi, MB. 2001 NH 499 HAYBINE, 12’, unused since 2008, shedded, $9900. 306-764-7865, Prince Albert, SK. 2009 HESSTON 9635 SP 16’ disc windrower, 190 HP, dual conditioner, hyd. tilt, cab susp, shedded, Greenlighted, 1400 hrs, $85,000 OBO. 403-308-4200, Arrowwood. MF 205 MOWER conditioner header for sale, 14’, fits MF 200 or 220 swather, $5000 OBO. Ph: 403-934-3394, Strathmore, AB. dthurston@efirehose.net JD 956, 15.5’ discbine, stored inside, well maintained, $18,000 OBO. 403-308-4200, Arrowwood, AB. 2006 JOHN DEERE 4895 windrower, 822 h r s , $ 8 5 , 6 0 0 . Yo r k t o n , S K . C a l l 306-783-9459, www.maplefarm.com or call one of our 7 stores near you. 14’ HESSTON 1014 hydroswing haybine; MF 124 square baler; NH 1033 bale wagon, all in good shape. 306-283-4747, 306-220-0429, Langham, SK.

’08 Case IH WDX1203 36’ SWATHER Includes 36’ header, hydraulic center limbs, clean cab & body, in overall great cond’n! $76,800. Trades welcome. 1-800-667-4515. Financing available. www.combineworld.com

2000 MACDON, 922, 18’, moco header, $ 1 9 , 9 0 0 . w w w. f u l l l i n e a g . c o m C a l l 306-934-1546, Saskatoon, SK. or 306-773-7281, Swift Current, SK. 885 MASSEY, diesel, 3015 hrs, 1994 MacDon 30’ header, shedded. Phone: 306-567-8081, Davidson, SK. 2009 MF 9435, big cab, 120 HP, 407 hrs, 30’ DSA, UII PU reel, $69,000. Saskatoon 306-934-1546 www.fulllineag.com or Swift Current - 306-773-7281. 1995 MF 200, 26’ DSA, UII reel, needs a bit of love but price is right, $17,900. Cam Don Motors, 306-237-4212, Perdue, SK. WESTWARD 36’ PULL TYPE swather, good condition, reasonably priced. Phone 306-472-5912, Lafleche, SK. 2012 CIH WD1203 SC, c/w DH362, cab and rear suspension, std. cab, cold start pkg, $135,000. 1-800-219-8867, Swift Current, SK. or www.redheadequipment.ca 2012 MF HESSTON WR9735 SP swather and 36’ Agco 5200 draper header with only 11 hours consigned by the Estate of Ron Wilke at the Art Beck Farm Equipment Auction, Sat., August 24, 2013, Yellow Grass, Sask. area. For sale bill and photos visit www.mackauctioncompany.com Mack Auction Co. 306-421-2928, 306-487-7815, PL 311962. 590 JD MACDON PT swather, new style reel and 36’ knife drive- 1 yr. old, $2000. 306-424-2723, Montmartre, SK.

1998 PREMIER 2920, MacDon 960, 30’ triple delivery header, 1596 hrs., new tires, knife, valley gage wheels, $56,000. Call 306-577-7416, Wawota, SK. 2000 WESTWARD 9250, 2176/1638 hrs., 30’, 972 header w/triple delivery, double knife, split reel, gauge wheels, attached swathroller, vg, $57,500. 306-921-5402, HONEYBEE 50’ SWATHER, TM50, good St. Brieux, SK. FARM CHEMICAL/ SEED COMPLAINTS condition, choice of 2 units, $11,500. Call 2003 MF 220XL, 1480 hrs., 30’ DSA, UII We also specialize in: Crop insurance apBrent 403-578-8444, Coronation, AB. PU reel, $68,000. Call 306-934-1546, Sas- peals; Chemical drift; Residual herbicide; operator issues; Equipment malJD 2320 SWATHER w/21’ header, UII PU katoon, SK. or 306-773-7281, Swift Cur- Custom function. Qualified Agrologist on staff. Call r e e l , C A H , 2 0 8 1 h r s . , $ 7 5 0 0 . rent, SK. www.fulllineag.com Back-Track Investigations for assistance 306-469-2027, Big River, SK. 9260 HESSTON SWATHER, w/36’ 2010 regarding compensation, 1-866-882-4779. 1996 PREMIER 2920 c/w 21’ Model 960 header w/PU reel, like new, big cab and 2009 MACDON M200 SC, 1000 hours, header, 2937 hours, field ready, $29,000. big power unit, Hesston same as Challeng- windrower, no header, $98,000. Contact er and Massey. Power unit is a 2005 HessTyler 403-872-2940, Ponoka, AB. ton, very nice, $70,000. 204-871-0925, 1 - 8 0 0 - 6 6 7 - 9 7 6 1 , S a s k at o o n , S K . o r www.redheadequipment.ca, or 1997 CASE 8820, 2338 hrs, 30’ UII PU MacGregor, MB. reel, good shape. Phone 306-270-8594, 2 0 1 0 W D 1 2 0 3 , 3 6 ’ , $ 9 9 , 9 0 0 ; 2 0 1 1 2008 MF 9430 36’ swather, loaded, mtd Simpson, SK. W D 1 2 0 3 , 3 6 ’ , $ 1 1 5 , 0 0 0 ; 2 0 0 4 C I H roller, shedded, 452 hrs., 1 owner, asking PRAIRIE STAR 4600 and JD 590. Both 30’, WDX1101, 30’, $64,500; 1994 CIH 8820, $79,000. 306-369-4180, Bruno, SK. w/autofold and new tires, $2500 each. 25’, $15,900; 2006 MF 9420, 30’, $69,900; BLOW OUT JD 590 30’ MacDon PU reel, 1995 CIH 8820, 30’, $25,500; 2010 306-389-4827, 306-441-2097 Maymont SK WD1203, 36’, $104,500; 2009 Premier $2000; JD 590 30’ Batt reel, $1500. $2500 2- 36’ CASE/IH 736 swathers, one 540, (MacDon) M150, 35’, $115,000; 1984 MF takes both. 306-793-2897, Stockholm, SK. one 1000 PTO, $800 and $1000. Phone: 885, $9900; 2002 JD 4895, 36’, $69,900; email: justinbanga@sasktel.net 306-424-7761, Montmartre, SK. 1999 Premier 4920, 30’, $39,000; 2005 MF 1996 WESTWARD 9300, 21’, 2 spd. turbo 2003 WESTWARD 3020 30’, PU reel, Roto- 9220, 25’, 1200 hrs., $53,500; 2006 CIH diesel, triple delivery, 1460 hrs., shedded, Shear, new condition, $8500 OBO; Case WDX1202, 36’, 1400 hrs., $79,900. Call $36,000; MacDon 922 16’ hay header, 8230 30’, new knife drive. 306-734-2967, Hergott Farm Equipment 306-682-2592, $9500. 780-672-6062, Camrose, AB. Humboldt, SK. Aylesbury, SK. 1995 PREMIER 1900 25’ PTO swather, low 2001 HESSTON 8110S 25’, UII PU reel, CASE/IH 730, 30’ PT swather, excellent acres, stored inside, $5000 OBO. Call: triple delivery, double swath, 1880 hrs, guards and knife, belts replaced, $1000. 306-893-7665, Maidstone, SK. shedded, $35,000 OBO. 780-679-5980, 306-287-7889, Englefeld, SK. 1903 CASE/IH SWATHER, 510 hours, 780-679-5723, Daysland, AB. 2010 MF 9435, 30’ DS, rear mounted 30’ HoneyBee header, Roto-Shears, hyd. 1998 PRAIRIE STAR swather w/30’ 960 swath roller, Outback AutoSteer, deluxe header tilt, rear axle susp., suspended cab, header, 1800 hrs, large rear axle, smooth- cab, exc. cond., 628 hrs, $85,000; 2009 MF 2 spd. hydro, double knife drive and head9435, 30’ DS, deluxe cab, 720 hrs, Raven er transport kit, large 18.4x26 fronts and er ride $34,000. 519-818-9522 Burdett, AB AutoSteer, $80,000. Financing available. 14Lx16.1 8 PR rear tires, 5000 acres, new SWATHER TIRES for wet conditions, 306-843-7260, Wilkie, SK. canvases start of 2012 due to update, field 600/65R28, like new. Call: 306-862-8233, 1989 CCIL 722, 30’ with PU reel, extra 18’ ready, $105,000. Can arrange delivery. Nipawin, SK. 403-901-5390, Strathmore, AB. header. Call 306-641-9851, Melville, SK. 1997 MF 220-30’, $36,500. Yorkton New CASE/IH WDX 1202, 1310 hrs., 30’ douHolland, 306-783-8511, Yorkton, SK. or WHITE 6200, 21’ SP, one owner swather, ble swath, roto shears, all options, shedalways shedded, exc. shape, $2500 OBO; www.yorktonnewholland.com Apollo 8’ swath roller, good shape, $400 ded. Barry Kit, 780-210-3799, Myrnam, AB. WESTWARD 7000 SWATHER, 25’, gas, UII OBO. Call 306-675-4883, Lipton, SK. 2005 PRAIRIE STAR 25’ header, 718 hrs., PU, CAH, HoneyBee knife, 2044 hrs., 64” asking $77,000 OBO. Call 204-724-6666, opening; 3- 400 Versatile swathers, 20’, 1996 MACDON 9300 w/14’ hay header, PU Minnedosa, MB. one w/MacDon PU reel, one w/hay crimp- reel, conditioner, 3100 hrs., good tires, good condition, $22,500. 306-861-4592, 2008 MF 9435, 800 hrs., 25’ header, mint er, good knifes and canvases, field ready, condition, $67,000. Call 403-501-4891, all have good cabs; CIH 736 swather, 36’, Fillmore, SK. batt reel, good canvases and knives, field 2000 CIH 8825 HP swather, 30’ header, PU Duchess, AB. ready; Two Blanchard swath rollers, 6’ and reel, $30,000. Phone: 306-473-2749 or MF 200 SWATHER, 1994, 1774 hrs., UII 8’; Versatile 400 motor overhauled, zero 306-640-8181, Willow Bunch, SK. PU, 26’, vg condition. 306-764-7920, hrs. Good all around cond. Wainwright, AB. 306-961-4682, Prince Albert, SK. 2006 JD 4995-16.5’ DB $73,000. Yorkton 780-755-2115, or cell 780-842-7836. New Holland, 306-783-8511, Yorkton, SK. 1987 CASE/IH 4000, 24.5’, shedded, 2010 MF 9430 SP swather, 295 hrs, 30’ or www.yorktonnewholland.com CAHR, low acres, little use last 5 yrs. double swath, new condition, $85,000 25’ CASE/IH 8820 w/PU reels, new condi- 306-877-2014, 306-877-4402, Dubuc, SK. OBO. 306-628-7055, Leader, SK. tion, $5000. 306-452-3868, Redvers, SK. 2009 JD 4895, 36’ HoneyBee, UII PU reel, JD 590 25’ PT, shedded, $2500; also MF 8 8 5 2 5 ’ S P, K e e r s h e a r s , $ 7 5 0 0 . CASE/IH 721 PTO swather, 21’, MacDon 1680 eng. hrs., 1288 cutting hrs., $71,000. PU reel, good condition, $2400 OBO. Call 204-648-7129, Grandview, MB. 306-239-4949, Osler, SK. 306-563-6330, Kamsack, SK. 2004 CASE/IH WDX 1101, 25’ header, JD 590 PT swather, 30’ platform, good condition, $3000 OBO. Call 306-723-4317, VERSATILE 4750 25’ header with UII PU, new hydro pump last year, $47,500. Call 1040 hrs. field ready, $21,000 OBO. 403-823-8264, Rosedale, AB. Cupar, SK. 403-819-7593, Calgary, AB. 2002 PREMIER 2940, 962 header, 1032 NEW NOBILE 702 PT, 26’ like new condi- eng. hrs., 880 header hrs., large rear tires, tion, fully hydraulic, offers. 204-525-4927, good cond. 306-277-4609, Ridgedale, SK. Minitonas, MB. 2005 WESTWARD 93521 SP swather, 2001 CASE 8825, 30’ double swath, field w/36’ MacDon header, 505 hrs, exc. cond. ready, $30,000. Harvey at 780-753-0353, 306-834-7643, Kerrobert, SK. Kirriemuir, AB. M 150 & M 155 2008 MF 9435, 5200 header, 36’ PU reel, 2002 PREMIER 2952, 2210/1698 hrs., large cab, Performance monitor, $70,000; M ACDON SW ATHERS 36-972 header w/gauge wheels, split reel, 2009 NH H8040, 1015 hrs., 36’ Honeybee AVAILABLE transport, shedded, vg cond., $67,500. Call header, PU reel, Roto-Shear, AutoSteer, swath roller, $95,000. Call 306-745-7018, 306-921-5402, St. Brieux, SK. ALL W ITH D6 0 3 0’ OR 3 5’ SK Tantallon, SK. OR DK HEADS 2003 MF 220XL, 1200 hrs., c/w 30’ DSA head (black), UII. 0% 12 months OAC, 1995 CASE/IH 8820 SP, 25’ swather, die$49,900. Call Cam-Don Motors Ltd. sel, double knife drive, double swath, exSTARTING AT cellent condition, 1100 hrs. Phone Tarry at 306-237-4212, Perdue, SK. $ 306-661-7251, Golden Prairie, SK. MF 9420 2006, 25’, UII reel, 480 front t i r e s , s w i v e l g a u g e w h e e l s . C a l l 2010 MF 9435, big cab, 120 HP, 265 hrs, 30’ DSA, UII PU reel, $99,000. Saskatoon 306-864-2200, Kinistino, SK. 306-934-1546 www.fulllineag.com or 2000 NEW HOLLAND HW300, 25’, field Swift Current - 306-773-7281. ready, $30,000. Phone 204-842-3713, or 204-782-9438, Birtle, MB. 1 9 9 1 C I 7 2 2 s w a t h e r, 2 6 ’ , S e r i a l same as MF 200, 2062 2006 PREMIER 1920 MacDon swather, #38018-90145, PU reel, hydro w/joystick control, used very little, not used in last 2 yrs., hrs., Izuzu diesel. New: drive tires, roto shears, $9000 OBO. Call 780-753-6578, Hayter, AB knife and guards, battery starter and can1999 9200 WESTWARD, c/w 30’ 962 vasses, Schumacher knife drive, CAHR, 53 42-50 Ave . | V e gre ville , AB. | T9C 1M 3 header, new style wobble box, valley pack- $27,500, exc. condition. 1-877-862-2387 M ike Gotts e lig | Sa le s M a n a ge r er gauge wheels, new canvas, large rear Cell 306-862-7524 or 1-877-862-2413 Cell tires, $39,000 OBO. Churchbridge, SK. 306 862 7761, Nipawin, SK. V e gre ville : 1-8 77-6 3 2-6 772 306-745-9269. 1996 MACDON 9300 c/w 972 30’ header, Bu s in e s s : (78 0) 6 3 2-6 772 1987 COOP 722, 30’ batt reel, AC, diesel, $39,000. Call 306-934-1546, Saskatoon, C e ll: (78 0) 6 03 -3 28 9 SK. or 306-773-7281, Swift Current, SK. 1500 hrs., hydro. just done, always shedFa x: (78 0) 6 3 2-3 223 ded, $17,000 OBO. Edmonton area. Call www.fulllineag.com 780-233-3380, Waskatenau, AB. 1989 CASE/IH 6500, 25’ SP, diesel, PU m ike .g otts e lig@ w e b b s .c a 1988 CI 722 UII PU reel, double swath, reel, 1700 hrs., very good condition, 8’ JD 2420 21’ swather, diesel, CAH, asking $ 1 2 , 0 0 0 O B O . 2 0 4 - 8 6 8 - 5 5 0 4 o r poly swath roller. Call 204-325-0537, $5000; Brandt QF 1000 70’ sprayer, good 204-874-2206 eves., Minnedosa, MB. or 204-829-3924, Plum Coulee, MB. email: neilgalb@gmail.com shape, $3500. 306-783-8783, Yorkton, SK 2011 NH H8040-36’, $120,000, Raymore VERSATILE 4400 22’, CAHR, DS, PU and 2 IHC MODEL 75 21’ PT, $800/ea; MF New Holland, 306-746-2911, Raymore, SK. batt reel, side cutters, shedded, low acres. model 35 18’ PT, $500. Call 403-575-0194, or www.raymorenewholland.com 306-877-2014 or 306-877-4402 Dubuc, SK 403-577-2271, Consort, AB. 1984 MASSEY 885, 21’, DS table, gas eng., 2003 CASE 1101 windrower c/w 2010 36’ 2002 HESSTON 8250 highpower SP swath- PU reel, crop lifters, gauge wheels, field Honeybee header, 960 hrs., $70,000. Call er, new knife/guards, good shape, priced ready. 306-962-7650, Eston, SK. 306-530-8433, Lumsden, SK. for quick sale. 306-228-2092, Unity, SK. 742 CO-OP IMPLEMENTS swather, 30’ 36’ JOHN DEERE PT swather, excellent MF 220 1998, 1713 hours. Call for details header, batt. reel, good condition. Call 403-552-2216, Esther, AB. condition. Call 306-536-8820, Francis, SK. 306-864-2200, Kinistino, SK.

W E HAVE 10

115,000 CASH

INTERNATIONAL 5000 DIESEL motor, 24-1/2’, red cab, new knife, canvassess and roller bearings with pickup reel, big tires, w/wo Bergen mover, exc. cond. North Battleford, SK. 306-386-1268. 1995 MF 200, 26’ swather, keer shears, UII PU reel, Claas pickup guards, vg cond., field ready, $25,000. 306-769-4122 or 306-768-7753, Arborfield, SK. JD 2360 SWATHER, 21’ PU reel, diesel, 2400 hours, exc. cond., $15,000. Call 204-886-2179, Petersfield, MB. 590 JD 36’ PTO swather, wide swath opening, field ready, $2400 OBO. Call Bob 403-934-4081, Mossleigh, AB. 1995 CASE 8820, 21’, shiftable table, 2146 hrs, gauge wheels, new knife, exc. cond. $22,500 OBO; 1977 Co-op 550, 15’, canopy, gas motor, vg cond, working order, $2000 OBO. Both swathers kept inside. 780-877-3923, Ferintosh, AB. 2003 4260 PRAIRIE STAR, 2 units, 30’ PT, PU reels, very good condition, 100% field ready and serviced. Not many acres, used as spares, MacDon plastic finger reels, $11,000. Lloyd Sproule, Pincher Creek, AB. 403-627-2764, 403-627-7363. MF 220, 30’, UII PU, newer tires, Schumacker drive, mounted roller, 2900 hrs, good cond., $26,000 OBO. 306-682-3183, 306-231-4683, Muenster, SK. PREMIER 2952, 30’, 972 header, triple delivery, large tires, hyd. fore/aft, tilt, valley gauge wheels, slow spd. mover kit, 1500 eng. hrs, 1100 header hrs. 204-242-2940, 204-242-4036, Manitou, MB. JD 580 PT 18’ swather, UII PU reel and crop lifters, $2750. 780-915-3417, Tofield, AB. 2011 WESTWARD 150, 30’, D60 header w/293 hrs., 390 eng. hrs, JD ATU guidance avail., always shedded, exc. cond., photos available. 780-961-4169, Legal, AB. 400 VERSATILE, good knife, new guards, straight table, engine recently rebuilt, unit s h e d d e d , g o o d s h ap e , $ 2 5 0 0 . C a l l : 306-693-9837, Moose Jaw, SK. IHC 4000 WINDROWER, 24.5’, gauge wheels, U11 PU reel, original owner, cab, no AC, $6800. Hesston 1200 PTO swather, 30’, factory U11 PU reel, low acres, $8400. 306-463-3631, 306-460-8006, Kindersley. PARTS FOR: 4700/ 4750 Vers. swather. New wheel motor, ring gear/hub assembly and bearings for wheel drive, complete planetary assembly, main hydro. drive pump, radiator, lots of misc. parts. Rossburn, MB. 204-859-3277 or 204-859-0015. 8820 18’ PICKUP reel, 1400 hrs., c/w 8480 soft core baler, almost new. Only $35,000. Harry, Vissers Farm Equipment, Enchant/ Lethbridge, AB. 403-327-0349 or cell: 403-330-9345. NEWER MF 885, 30’ slide table, batt reels, shedded, great paint, 1300 hrs., newer canvas, excellent condition. 306-843-2219 eves or cell: 306-843-8344, Wilkie, SK. JOHN DEERE 590 30’ PT swather w/MacDon PU reel. 306-771-2527, Edenwold, SK. 1980 VERSATILE 4400, 22’, UII hydraulic PU reel, CAH, $4200. 306-748-2847, 306-748-2849, Neudorf, SK. 1995 30’, 8820 Case/IH, SP, w/PU reel, $18,500; 1997 30’ 8825 Case/IH, w/PU reel, $26,500; 2009 30’ H8040 New Holland, SP, PU reel, transport, sliding cable, $98,000. A.E. Chicoine Farm Equipment, 306-449-2255, Storthoaks, SK. 2010 HESSTON 9435, c/w 36’ header, 640 hrs., $89,000. Call Cam-Don Motors Ltd., 306-237-4212, Perdue, SK. 2010 MASSEY FERGUSON 9430, 35’ SP, 636 hours. Call Hodgins Auctioneers, 1-800-667-2075. PL #915407. 2008 CASE WD1203 swather w/DHX 302 header, 860 hrs., roto shears, AutoSteer, loaded, very good condition. Melfort, SK. 306-921-8594 or 306-752-4810. 1984 VERSATILE 4400, CAHR, new: knife, canvases and MacDon PU reel, good shape. 306-734-2970, Chamberlain, SK. 2008 MASSEY FERGUSON 9635, dual headers, 600 hrs., 25’ draper header, 16’ disc. header. 403-501-4891, Duchess, AB. JD 590-30’ PT, straight, no welds, $3900 OBO. Call Dave at 306-424-7511, Montmartre, SK. 742 CO-OP SWATHER, newer canvas, HoneyBee knife, gauge wheels, good cond., $9500 OBO. 306-682-3183, 306-231-4683, Muenster, SK. VERSATILE 400, 18’ header w/PU reels and cab, always shedded, $2500 OBO. 780-940-7497, Edmonton, AB. JOHN DEERE 4890 c/w HoneyBee ST36, PU reel and double knife drive, $40,000 OBO. 780-847-3792, Marwayne, AB. 1978 VERSATILE 400 swather with cab, 20’ DS; Also Flexi-Coil swath carrier. 306-549-2449, Hafford, SK. 1996 PRAIRIE STAR 4900, turbo Cummins 2 spd. hydro, 2398 hrs, w/960 MacDon 25’ single delivery grain header w/PU reels. Good service record, always shedded, clean unit, $35,000. 306-893-2879. Maidstone, SK. buddy_biggully@hotmail.ca 2001 WESTWARD 9350, 972 hyd. tilt, 30’, triple delivery, large tires, $55,000. 306-536-9528, Francis, SK. WESTWARD 3000 25’ PT swather, autofold, not used last 5 yrs., always shedded, exc. cond, $5500. 306-595-4706, Pelly, SK 2006 CHALLENGER SP115B, 727 hrs, 36’ header and transport, Trimble 500 EZSteer, exc. cond., $72,500. Standard, AB. 403-644-3983, cell 403-934-7961. WESTWARD 9300 SP swather 30’ with 960 MacDon header. Art Beck Farm Equipment Auction, Sat., August 24, 2013, Yellow Grass, SK. area. For sale bill and photos visit www.mackauctioncompany.com Mack Auction Co. 306-421-2928, 306-487-7815, PL 311962.


44 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

C anu ck Prem iu m N etw rap

WANTED: 4700/4750 25â&#x20AC;&#x2122; Versatile swather, good cond. Call Walter 306-238-2178, 306-238-2176, Goodsoil, SK. 2011 MF 9430, 36â&#x20AC;&#x2122; SP, 275 hrs., $97,000. 0% OAC for 24 months. Cam-Don Motors Ltd., 306-237-4212, Perdue, SK. 2010 CIH WDX 2303 SA, upgrade cab, cold start, UII one piece PU reel, double knife, $135,000. 1-800-535-0520, Lloydminster, SK. www.redheadequipment.ca 2002 PREMIER (MACDON) 2952, large tires, turbo, 1595 hrs, w/30â&#x20AC;&#x2122; 972 triple delivery header, double PU reel, $59,500 ATTN CANOLA PRODUCERS: Achieve maximum yield w/the new Hauser Revo Roller, OBO. 403-485-8116, Vulcan, AB. all steel 10â&#x20AC;&#x2122; drum swath roller. Mimics eve1996 PRAIRIE STAR 4920, 30â&#x20AC;&#x2122; 960 Mac- ry movement of the swather, accurate and Don header, Roto-Shears, 1730 hrs. consistent ground gauging, legal width $39,900 OBO. 306-747-7097, Leask, SK. transport. Fits most SP swathers. Hauserâ&#x20AC;&#x2122;s 1-888-939-4444, Melville, SK. 1998 JD 4890, w/2000 SP30 HoneyBee Machinery, 30â&#x20AC;&#x2122; header, pea auger, wired for JD Auto- www.hausers.ca Steer, 4970, engine hrs., good condition, shedded, $50,000 OBO. 306-272-7418, Foam Lake, SK. 4000 IH SWATHER, 24.5â&#x20AC;&#x2122;, no cab, needs wobble box, $1500 OBO. Call 306-946-7151, Watrous, SK. 2420 JD SWATHER, 25â&#x20AC;&#x2122;; Also JD 8450 tractor. 306-278-2616 or 306-278-7741, Porcupine Plain, SK. 2007 WESTWARD 9250 SP, Harvest 972 h e a d e r, 8 8 4 h r s . , fi e l d r e a dy. C a l l 306-453-2906, 306-453-6290, Carlyle, SK. CASE/IH 4000 SP swather, 24.5â&#x20AC;&#x2122;, w/PU reel, ACHR, hydrostatic 6 cyl. Ford, left and right rotor sheers, w/aux. hyd. system, new canvass and guards, new bearings in rollers, throats modified for heavy canola crops w/roller and belly pan, vg cond $9500. 204-734-3043 Swan River MB PRAIRIE STAR 4600 1997, 25â&#x20AC;&#x2122;. Call for details 306-864-2200, Kinistino, SK. 25â&#x20AC;&#x2122; CASE/IH PTO 725 swather, w/Keer Shear, new canvasses and knife, harvest ready, $3700; All steel 1 year old 10â&#x20AC;&#x2122; swath roller, $1800. 306-628-8092, Eatonia, SK. 1996 30â&#x20AC;&#x2122; PREMIER PT, MacDon PU reel, work and field lights, rear hitch for swathroller, good shape, $5600 OBO. Can deliver. 306-948-7843, Biggar, SK. 1985 MASSEY 885, 25â&#x20AC;&#x2122;, gas, hitch, shedded, batt. reels. Contact 780-366-2383, Myrnam, AB.

N etwrap - H igh quality,im ported from G erm any 67â&#x20AC;&#x2122;â&#x20AC;&#x2122;startin g at$205 64â&#x20AC;&#x2122;â&#x20AC;&#x2122;startin g at$200 Silage B alew rap -startin g at$84

Pho ne:403-994-7207 or 780-206-4666 www.canadianh ayandsilage.com

1550 Hw y. 39 Ea s t, W eyb urn, S K

www.mrmachines.ca

30â&#x20AC;&#x2122; MF 9030 rigid header, $1500 OBO; NH 114 haybine, $3250 OBO; NH 116 haybine, $3250 OBO; NH 1033 bale wagon, $2500. 306-395-2668, 306-681-7610, Chaplin, SK.

2004 CASE/IH 2388, 2015 PU header, yield monitor, 1617 eng. hrs, 1257 sep. hrs, aftermarket hopper topper, long auger, chopper, $110,000. Torquay, SK. 306-421-1361, sabeholzer@hotmail.com

1996 NH 18â&#x20AC;&#x2122; 9030 haybine header, $6500, must sell! 306-896-2918, Churchbridge, 2007 CASE/IH 2588, 2015 PU header, long auger, 300 bu. hopper, 1319 eng. hrs, SK. 1028 sep. hrs, yield monitor, $130,000. 7â&#x20AC;&#x2122; SICKLE MOWER; self unloading flat bale Torquay, SK. sabeholzer@hotmail.com wagon; 5â&#x20AC;&#x2122; rotary mower; hay crimper; bale 306-421-1361. 1996 MACDON 9300 w/14â&#x20AC;&#x2122; hay header, PU spear. 306-283-4747, 306-220-0429, reel, conditioner, 3100 hrs., good tires, Langham, SK. good condition, $22,500. 306-861-4592, 2008 NH 1431 discbine; 2007 Claas liner Fillmore, SK. 470T rake; 2003 NH BR 780 baler; Laurier Fa rm Eq u ip m e n t Ltd . 655 MF SWATHER, 15â&#x20AC;&#x2122;, high lift cylinders 7 bale picker. 204-483-3617, Souris, MB. hay crimper avail., shedded, good cond., PR E M IUM USE D $4000 OBO. 780-398-3858, 780-307-8337, 1986 TRAILMASTER HAY trailer 42â&#x20AC;&#x2122;, licensed; NH 660 baler with bale command; CO M BIN E S Thorhild, AB. NH 2300 18â&#x20AC;&#x2122; haybine header; Conveyair 2011 CIH 8120, d ua ls, $289,000; 1996 HESSTON 1200 35â&#x20AC;&#x2122; swather. Always # 1 a i r va c . S t o ny B e a c h , S K , c a l l shedded. Excellent condition. Phone 306-345-2806, cell 306-527-6088. 2012 CIH 8120, d ua ls, $309,000; 306-731-7197, Holdfast, SK. 2008 JD 9870, d ua ls, $218,000; NH 1033 and 1044 bale wagons, good 2003 JD 96 50STS, $127,000; 1996 shape. 306-283-4747, 306-291-9395, JD CTS, $39,500; 2006 CIH 8010, Langham, SK. 116 5 hrs, $179,000; 2004 CIH 8010, BERGEN 6000 swather transport, full carry, BUHLER INLAND 2500 hayliner, S/N 1700 hrs, $155,000; 2007 CIH 7010, good cond.; Bergen small carrier, 2 whl for #01BM2500016, 14-16 round bale mover 1190 hrs, d ua ls, $16 2,000; 2009 older swathers. 306-567-7571 Davidson right and left lifting arms w/one deflector, CIH 9120, 76 5 hrs, $249,000; 2010 FOR RENT: BRAND new Bergen swather TA control handle/remote valve operation, NH CR9080, d ua ls, $249,000; 1999 transport, entire swather fits on mover, $22,000 OBO. 306-345-2444, Stony Beach CIH 2388, $72,500; 1994 CIH 16 88, $300/day. 780-876-0588 Grand Prairie, AB $25,000; 2010 CIH 9120, 6 20 hrs, 24.5â&#x20AC;&#x2122; UII PU reel, good shape, wire spring   $26 9,000; 2002 CIH 2388, $79,000; PU teeth, $3200 OBO. Call 306-946-7151,     2006 CIH 8010, $179,000; 1995 CIH Watrous, SK. 2188, $49,000; 2010 CIH 8120, WANTED: BERGEN or similar full carry $253,000; 2010 CIH 8120, $26 9,000; swather mover to rent for one day. 1999 JD CTS II, 2200 hrs., $6 3,500. 306-946-7738, Watrous, SK. LO W -RATE FINANCING A U G E R H E A D E R S : 1 4 â&#x20AC;&#x2122; C h a l l e n g e r, AVAILABLE! $24,500; 16â&#x20AC;&#x2122; CCIL 715/722, $5500; 16â&#x20AC;&#x2122; HUM BO LDT, SK Hesston 8020, $15,950; 16â&#x20AC;&#x2122; Hesston 8020, )&,' (,,'( (,"+*& CA L L (30 6)682-25 92 $16,760; 14â&#x20AC;&#x2122; CCIL 714/722, $5995; 16â&#x20AC;&#x2122; Hesston fits 220, $14,990; 16â&#x20AC;&#x2122; Versatile, w w w .her g o ttca seih.co m       $5450. Lougheed, AB. 780-888-7659.      18â&#x20AC;&#x2122; CASE/IH HEADER, c/w PU reel, gauge       wheels, off 8820, used very little, $6995 OBO. 780-205-2334, Lloydminster, SK.      CASE/IH COMBINES and other makes      BERGEN 6000 PC swather transport, new and models. 5 years interest free on most condition, $10,000 OBO. 306-628-7337, units. Call the combine superstore. Trades          Leader, SK. welcome, delivery can be arranged. Call     Gord 403-308-1135, Lethbridge, AB.

+$$,)+,)& 2007 CASE/IH 8010 AFX, shedded, 2016 )&*,#)&+%)# PU head, c/w reverser, VSR, auto HHC, fore/aft, lateral tilt, rock trap, long auger, hopper exts, chopper, chaff spreader, *+%'"*$%,#%&* 900/60R32, 480/70R30, 1180 sep. hrs, "+$+, " 1500 eng. hrs, $175,000. 306-457-7857, )#* ,'((''( ( Stoughton, SK. 2005 CASE 2388, 1400 eng. hrs, 1100 ro!!!!*+%'*$%) tor hrs, asking $138,000. Call Steve 780-674-8080, Cherhill, AB. 1991 1680, JJC0116655, rebuilt 8.3 Cummins, hopper extensions, specialty rotor, S W ATH RO LLERS Order Today! long sieves, long auger, field ready, $20,000 OBO. Call Sean 306-435-2622 or â&#x20AC;˘ La rge Dia m eterS teelDru m Call 306-435-9843, Moosomin, SK. â&#x20AC;˘ Hea vy Du ty Tu b in g Fra m e 204.325.5677 | 1.866.234.4602 LATE MODEL 1682 Case/IH PT combine, â&#x20AC;˘ S t eel Dr u m ha s W ei ght & www.bergsprepandpaint.com good paint, excellent shape, $6700. o u tla sts Pla stic R o llers 306-741-0247, Swift Current, SK. ROTO-SHEAR CROP dividers from 30â&#x20AC;&#x2122; 972 MacDon header, left and right w/hoses, G RAIN BAG S 1997 CASE/IH 2188, shedded, Victory $1600. 306-424-7761, Montmartre, SK. Super 8 PU, ready to go, asking $55,000 Up N o rth & Ag Ba g OBO. Call 403-633-1302, Rainier, AB. BERGEN SWATHER TRANSPORT, full â&#x20AC;˘ To p Q u a lity G ra in , S ila ge carry, very good condition, $7500 OBO; 1460 C/IH w/PU, Red lited, many new Trailtech swather transport, good condiBa gs a n d Co vers parts, approx. 2900 hrs, gd cond, field tion, $4250 OBO. Shellbrook, SK. ready, offers 204-525-4927 Minitonas, MB. â&#x20AC;˘ AllS izes 306-747-2514, 306-961-8061. â&#x20AC;˘ Am erica n M a d e 2004 CASE/IH 2388, 1595 rotor hrs., 2011 HAUSER REVO ROLLER, used for rotor, PU header, 30â&#x20AC;&#x2122; flex header, hop3500 acres, excellent condition, shedded, Apo llo M a chin e & Pro d u cts AFX per ext., chopper, loaded, great shape. $2900. Ph. 306-435-7526, Moosomin, SK. S a ska to o n , S K $110,000 OBO. Kyle, SK. Armin Loftsgard 306-375-2923 or cell: 306-375-7257 WANTED: 25â&#x20AC;&#x2122; OR 30â&#x20AC;&#x2122; swather table for Ph: 306- 2 42 - 9884 o r 8110 Hesston. Call Robert 780-745-2574, 1997 C/IH c/w AFX rotor, internal chop1- 8 77- 2 5 5 - 018 7 780-871-4816, Lloydminster, AB. per, 1015 PU header and IH PU, harvest w w w .a po llo m a chin ea n d pro d u cts .co m services wide bar concave and filler plates, 2 5 â&#x20AC;&#x2122; U I I P U r e e l , $ 2 5 0 0 O B O. C a l l hopper topper and new chaffer sieve, 3120 306-668-4975, Vanscoy, SK. JD 510, $1250; JD 530, $3500; eng. hrs., 2185 sep. hrs., stored indoors, TRAILTECH SWATHER TRANSPORT with BALERS: 535, $6000. Haybines: Gehl 2270, e x c e l l e n t c o n d i t i o n , $ 4 2 , 5 0 0 O B O. cradles to haul combine header, $4500; JD NH 116, $3000. Rakes: 14 wheel, 306-227-5217, 306-644-2166 Loreburn,SK Leon 808 loader, $3500. 306-960-3000, $3900; $6500; Vermeer R23 hyd., $8500; NH 2009 CIH 8120 SA, 910 hrs., hopper exSt. Louis, SK. swath inverter, $3000; NH 9â&#x20AC;&#x2122; mower, tension, lateral tilt, 900 tires, $272,000. 2011 35â&#x20AC;&#x2122; MACDON D50 header with trans- $2200; JD 1518 15â&#x20AC;&#x2122; rotary mower, $8500. 1-800-535-0520, Lloydminster, SK. or port. For pictures or more information call 1-866-938-8537, Portage La Prairie, MB. www.redheadequipment.ca 360-398-4714, Cut Knife, SK. 2003 MORRIS 881 hay hiker, good condi- 1996 CIH 2188, 2685/2182 hrs., extensive 21.5â&#x20AC;&#x2122; UII PU reels, like new, $2000 OBO. tion, $10,000 OBO; Also 2002 TM150 trac- upgrades, very good, $58,000 OBO. Phone 306-795-7692, Ituna, SK. 306-563-8482, 306-782-2586, Rama, SK. tor w/loader. 306-831-9600, Dâ&#x20AC;&#x2122;Arcy, SK.

THE HIGH ROLLER

11â&#x20AC;&#x2122;

Steel Drum Swath Roller

1989 CIH 1680, 1015 PU, motor changed 350 hrs. ago, extra fine-cut chopper, Urvold hyd. spreader, field ready, 3777 hrs., well maintained; 1989 30â&#x20AC;&#x2122; 1010 straight cut header, shedded. I have retired. Call 306-873-8444. To be sold at Schapansky Auctions, Tisdale, SK, August 13th. View on: www.schapansky.com 2004 CIH 2388, AFX rotor, chopper, hopper topper, big tires, auger ext., AutoSteer ready, 2096/1700 hrs, shedded, excellent, $87,000. 306-776-2496, Wilcox, SK.

2 0 0 5 C I H 8 0 1 0 , 4 WD, front tires 1250-45-32 means 45â&#x20AC;? wide, rear tires 28Lx26 means 28â&#x20AC;? wide, apparently will go as far as a track machine, 4 spd. hyd. trans., straw chopper and spreaders, Pro 600 monitor, approx. 1950 sep. hrs. c/w 2052 30â&#x20AC;&#x2122; draper header, $125,000; 2008 IHC 8010, AWD, 45x32 front tires, 28x26 rear tires, spreader and chopper, approx. 800 sep. hrs., 30â&#x20AC;&#x2122; flex draper header, $240,000. Can email pics. 204-871-0925, MacGregor, MB. 1987 CASE/IH 1482 PT combine, has reverser, shedded, works good, $5000. 306-239-4949, Osler, SK. 1986 1680, 3070 hrs., duals, Kirby chaff spreader, Victory PU, also 24â&#x20AC;&#x2122; straight cut header, UII reels, $22,000. 306-256-3510, 306-233-7348, Cudworth, SK. 2000 CIH 2388, 2262 sep. hrs., $77,000. Cash is King! 0% financing for 60 months. 306-682-9920, Humboldt, SK. or for full online listings www.farmworld.ca 403 INTERNATIONAL COMBINE; JD mower; JD 273 baler; JD hammer mill. Call 306-364-4720, Jensen, SK.

Toll Fre e : 1-8 6 6 -8 42-48 03 CONTINUOUS FEED HEADER AUGERS

* Cro ps tha t a re hea vy, light, ta n gled o r lo d ged w ill n o lo n ger b e a pro b lem fin gers a re in serted a lo n g the en tire len gth o f the a u gerfo ra very co n sisten t, fa ster feed in g, sm o o ther flo w o f cro p. These a u gers w illea sily pick u p m a n y va rieties o f cro ps. * Alla u gers a re b u ilt to O EM specs a n d a re m a d e w ith a hea vier ga u ge co n stru ctio n .

2012 CASE/IH AF7230, 220 hrs., leather, Pro-700 color monitor, SLS, HC unload auger (40â&#x20AC;&#x2122; heads), CVT drive, 20.8x42s with duals, lateral tilt, rock trap, chopper, $249,500 US. www.ms-diversified.com Phone: 320-848-2496 or 320-894-6560, Fairfax, MN.

2009 CIH 6088 LL, AFX rotor, straw chopp e r, y i e l d l o g g i n g , $ 1 9 9 , 0 0 0 . C a l l 1-800-535-0520, Lloydminster, SK. or â&#x20AC;&#x2122;98 CIH 2388 Field-ready, recent work www.redheadequipment.ca order, AFX rotor w/ new concaves & rub- 2004 2388 CASE/IH SP combine, 1300 bars, AFS, Crary topper, hopper extâ&#x20AC;&#x2122;n, 3,157 eng. hrs, 945 threshing hrs, field ready. hrs., w/ pick-up & warranty. 4 more 2388s 1997 36â&#x20AC;&#x2122; Honeybee header w/PU reel, in avail. $49,800. Trades welcome, financing g o o d c o n d i t i o n , C a s e / I H a d a p t e r. available. 1-800-667-4515. 306-834-7643, Kerrobert, SK. www.combineworld.com. CASE 1480, 3600 engine hrs., 1015 PU 1999 CIH 2388, 2325 sep. hrs., $81,900. header, reverser, bushings just done, Kirby Cash is King! 0% financing for 60 months. spreader, no chopper, good shape, $8000 306-682-9920, Humboldt, SK. or for full OBO. 306-528-4777, Nokomis, SK. online listings www.farmworld.ca 1988 1680, w/PU and chaff spreader, 1987 1680, low hrs., PU header, many up- 2070 hrs, shedded, good condition, grades; 1020 flex header, with transport, $15,000. 306-696-2297, Broadview, SK. $30,000, may separate. Stuart Valley, SK. 1996 CIH 2188, 2563 sep., 3063 eng., 306-773-9057. hopper topper, duals, new sieve rails and 1993 CIH 1688, new AFX rotor, new tires, bushings, recent feeder chain, Redekop. rock trap, long auger, hopper ext., internal Rake-Up, always shedded, $43,000 OBO. chopper and Redekop chopper, 1015 PU 306-287-7476, LeRoy, SK. header, exc. cond., $27,500 or $24,500 without Redekop; CIH 1688, chopper, long 2007 CIH 7010, 1080 sep./1365 eng. hrs., a u g e r, n e e d s s o m e p a r t s , $ 1 6 , 5 0 0 . well maintained, shedded. Call for specs. 306-621-7777, 306-783-2245, Yorkton, SK 306-861-4592, Fillmore, SK. 2004 CASE/IH 8010, w/2007 MacDon PU 1682 PT COMBINE, reverser, rock trap, header, GPS, 1900 sep. hrs., loaded, variable PU speed adjust to ground speed, $109,000. 306-951-7508, Biggar, SK. shedded, not used in 8 yrs., $5500 OBO. Call 306-363-4645, Drake, SK. 2008 CIH 2588 LL, AFX rotor, chopper, with 2015 Swathmaster, $179,000. IH 1482 with header reverser, chaff comes 1-866-659-5866, Estevan, SK. or spreader, good condition. 306-429-2877, Call www.redheadequipment.ca Glenavon, SK. SLIM TUBE ROTOR for 8120 CIH combine, 1993 CIH 1688 combine, hydro, 2 WD, low hrs., exc. cond., $4000. 204-773-3044, auto header height, auto reel spd., 2 sets 204-773-6689 cell, Russell, MB. concaves, grain/corn/soybean, 21â&#x20AC;&#x2122; unload auger, chopper, consigned, 3700 hrs, 2004 CIH 2388, 1788 rotor hrs., AFX ro$29,000. Call Gary Reimer, 204-326-7000 tor, Strawmaster PU, hopper extension, field tracker, large work order. Retired. reimerfarmequipment.com Steinbach, MB. 306-847-4413, 306-963-7755, Liberty, SK. CASE 8120 2010, 900/75R32 front, 6 0 0 / 6 5 R 2 8 r e a r, 1 1 1 1 h o u r s . C a l l 1996 2188, AFX rotor, Swathmaster PU, Greenlighted every yr. since new, 2715 306-864-2200, Kinistino, SK. eng. hrs., 1943 sep. hrs., one owner, 1999 CASE 2388, 2395 sep. hrs, 3258 $42,000 OBO. Call Grant at 306-746-7336, eng. hrs, Y&M monitors, AFS system, spe- 306-524-4339, 306-524-2155, Semans, SK cialty rotor, Sunnybrook concave, updated chopper knives, auger ext., big top hopper 1993 CASE/IH 1688, Rake-Up PU, spreadtopper. 1015 Super 8 PU and 1010 25â&#x20AC;&#x2122; ers, auger extension, 4360 hrs., $25,000 straight PU reel w/transport, $90,000. Call OBO. Call 306-831-6196 or 306-831-6186, 306-379-4418, Dâ&#x20AC;&#x2122;Arcy, SK. Dan 780-876-1750, Sexsmith, AB. 1995 CIH 2166, 2436 eng. hrs., 1832 rotor hrs., excellent condition, always shedded. Contact Andrew 306-365-7404 or Fred 306-365-4750, 306-365-7674, Lanigan, SK 2010 CIH 7120 SC, duals, auto guidance, HID, fine cut chopper, $220,000. Call 1 - 8 0 0 - 6 6 7 - 9 7 6 1 , S a s k at o o n , S K . o r www.redheadequipment.ca 1985 CIH 1480, 2 heads: PU header, and 25â&#x20AC;&#x2122; 1020 flex head w/skid plates. AHC, rock trap, chopper, new rub bars, 2 sets of concaves, recent new tires, always shedded, good cond., $10,000 OBO; 1020 flex head $8000 OBO. 306-483-5034 Oxbow SK 2004 CIH 2388, Swathmaster PU, AFX rotor, chopper, 1900 threshing hrs., hopper ext., $77,000. 306-782-2738, Yorkton, SK. 1986 CASE/IH 1640, 3066 hrs., new 23.1x26 tires, Kirby spreader, 1015 PU header, shedded, vg and 24â&#x20AC;&#x2122; 810 straight header, large auger, 1000 acres on new guards, knife and batts, exc., $20,000 OBO. Call 403-379-3960, Bindloss, AB. 1680 W/SPECIALTY Rotor, chopper, long auger, 3850 hours, no header, $9500. Riverhurst, SK. 306-353-4560, 306-280-6101. 1998 CIH 2188 combine w/PU, 3092 eng. hrs. and 2407 sep. hrs., no chopper, always shedded, good shape, $50,000 OBO; Also 1010 30â&#x20AC;&#x2122; header sold separately. Email rvarend@sasktel.net 306-567-0218, Davidson SK. IH 1480 SP combine with reverser and long auger. Alvin Miller Farm Equipment Auction, Saturday, August 17, 2013, Stoughton, SK. area. For sale bill and photos visit www.mackauctioncompany.com 306-421-2928 or 306-487-7815, Mack Auction Co. PL 311962. 1994 CASE/IH 1688 2412 engine hrs., one owner, mint. $49,000. 306-563-8482 or 306-781-2586, Rama, SK. 1989 CASE/IH 1680, w/1015 pickup head, lots of new parts, good condition, $15,000. Rosetown, SK. 306-882-2423. 1995 CASE/IH 2188, 2545 rotor hrs., internal chopper, Kirby chaff spreader, hopper extension, nearly new tires, wired for JD GPS, always shedded, $33,000; 1995 36â&#x20AC;&#x2122; HoneyBee header with UII PU reel, gauge wheels, to fit above combine, $ 1 2 , 0 0 0 . W i l l s e l l s e p a r at e ly. C e l l : 306-858-7575, Lacadena, SK. 2006 8010, 579 ROTOR HOURS, 900 rubber, Swathmaster PU, Pro600 monitor, field ready. Retired. $187,500 OBO. 306-598-2195 306-231-6242 Annaheim SK 1994 CASE 1688, specialty rotor, rebuilt and balanced, w/accelerator, 1015 pickup, many new parts, exc. shape, $27,000 OBO; 9 7 4 M a c d o n h e a d e r a l s o ava i l a b l e , $34,000. 306-648-7123, Gravelbourg, SK.

1480 IH COMBINE, ready to go, $6900 OBO. Call 780-853-2024, Vermilion, AB. 1989 CIH 1680, long auger, big rubber, Kirby chaff spreader, chopper, reverser, 3620 eng. hrs., always shedded, very good condition, $18,500. 306-325-0044 or 306-814-0007, Lintlaw, SK. 2010 9120, c/w 2016 header, HID lighting, duals, 819 engine hrs., 603 sep. hrs, $235,000. Call cell: 306-527-8843 or 306-584-8286, Regina, SK. 2000 2388 CASE and pickup header, 2550 rotor hrs., hopper extension, long auger, always shedded, very good. Phone: 306-698-2102, Wolseley, SK.

2006 CIH 8010 SA, hopper topper, 900 tires, shedded, $195,000. Call 1-800-219-8867, Swift Current, SK. or www.redheadequipment.ca 2- 1688 COMBINES, both shedded, one has 2657 hrs. w/header, $50,000; one has 4 1 6 0 h r s . w / h e a d e r, $ 3 5 , 0 0 0 . b o t h w/1015 PU and 30â&#x20AC;&#x2122; HoneyBee drapers. 403-534-2241, Milo, AB. 2009 CIH 7088 SA, lateral tilt, AFX rotor, 800 tires, straw chopper, $180,000. Call 1 - 8 0 0 - 6 6 7 - 9 7 6 1 , S a s k at o o n , S K . o r www.redheadequipment.ca

2002 480R CAT Lexion, w/PU header, 20.8x42 duals. $90,000. A.E.Chicoine Farm Equip. Ltd, 306-449-2255, Storthoaks, SK. WILL SELL EITHER: 2005-570R, 1470 hrs. or 2008-580R, 500 hrs. Both completely field ready in excellent condition. Also have a P14 PU head and 2012 35â&#x20AC;&#x2122; FD70 MacDon. 306-267-4815, Big Beaver, SK. 2003 CHALLENGER 660, 1660 sep. hrs., $22,000 spent in repairs, shedded, field ready. Pickup head and 30â&#x20AC;&#x2122; flex header available. Fraser Farms Ltd., Pambrun, SK, call 306-741-0475. 2012 LEXION 670, 150 sep. hrs., deluxe cab, long auger, auto grease, mint cond. 780-768-3766,780-603-0331,Hairy Hill, AB NEW LEXION STRAW CHOPPER c/w belts and shields, 57â&#x20AC;?W; 3 -6.5mmx40mm Cat concaves. 306-373-2568, Saskatoon, SK. 2000 CAT 450, 2800 eng. hrs., 14â&#x20AC;&#x2122; Rake-Up PU, chopper, spreader, gd cond. $45,300. Call Greg 306-883-2568, Spiritwood, SK.

DEUTZ 7120, 7110 FWA, and DX110. To be sold by Unreserved Auction Sat., August 17, Elk Point, AB. Ph. 780-724-4294, View online: www.prodaniukauctions.com

1996 NH TR98 $28,500. Yorkton New Holland, 306-783-8511, Yorkton, SK. or www.yorktonnewholland.com 1981 NH SP TR85, S-cubed rotors, 3208 Cat eng., straw spreaders, Rake-Up PU, 1890 hrs., always shedded. 306-648-2737, 306-648-7214 cell, Gravelbourg, SK. 2009 NH CR9080, 492 sep. hrs, $256,000. Cash is King! 0% financing for 60 months. 1-888-442-6084 or for full online listings www.farmworld.ca 1985 NH TR85, 3208 Cat, 3075 hrs., #970 NH PU, 23.1x26 tires like new, chopper, $4950 OBO. 306-278-3394, 306-539-1290, Porcupine Plain, SK. 1996 TR98 NH, S/N 559698, 1889 sep. hrs, 2520 eng. hrs, c/w elec. stone trap, Dutch chaff spreader, Swathmaster PU, $42,500. 780-352-3118, Wetaskiwin, AB. 2006 CR960, NH 76C 14â&#x20AC;&#x2122; header w/RakeUp PU, Firestone 800/65R32, well maintained, field ready, 1136 sep., 1600 eng., 105,000 OBO. 306-749-7771, Hagen, SK. NH TR98 SP combine with 1571 rotor hours and recent work orders consigned by Tom Flath to the Alvin Miller Farm Equipment Auction, Saturday, August 17, 2013, Stoughton, SK. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962 1995 NH TR97, 1800 threshing hrs, rebuilt rotors, feeder chain in 2011 chopper, c/w PU and NH 971 25â&#x20AC;&#x2122; strait cut header, doub l e k n i fe d r i ve , P U r e e l , $ 3 0 , 0 0 0 . 306-961-8094, Prince Albert, SK.

1982 NH TR95, Kirby spreader and straw chopper, 4500 hrs., new bearings on drive pully, all tires two years old, $5500 OBO. 306-536-2840, Balgonie, SK. 1994 TX66 Swathmaster PU, $20,000; 1995 TR97 Rake-Up PU, $25,000. Both 2007 CIH 8010 LL, deluxe cab, lateral tilt, field ready. 306-253-4454, Aberdeen, SK. 2 4 â&#x20AC;&#x2122; u n l o a d a u g e r , $ 2 2 9 , 0 0 0 . 2006 CX 860, $125,000; 2005 CX 860, 1-800-219-8867, Swift Current, SK. $117,000; new rub bars, 1500 sep. hours, www.redheadequipment.ca gd cond, 780-672-7340, Camrose, AB. 2003 CASE 2388, AFX, AFS, 2015 header, 1992 TR96, FORD motor, 2231 threshing 2140 sep. hrs., $69,900. 306-274-7604, hrs., new tires, many new parts, vg cond., Lestock, SK. $ 1 5 , 0 0 0 c a s h o r t r a d e fo r c a t t l e . 1680 COMBINE, w/Redekop chopper for 306-863-4177, Star City, SK. sale, field ready, always shedded, $25,000. 1993 NH TR96, 1900 sep. hrs., 2250 eng. 780-267-8700, Leduc, AB. hrs., SwathMaster PU, feeder reverser, lat2008 7010, c/w 2016 header, long auger, eral tilt. 204-857-2791, Portage, MB. grain tank extensions, duals, 955 engine 2003 NH CR970, 1449 sep. hrs, $110,000. hours, 727 sep. hours, $160,000. Cell: Cash is King! 0% financing for 60 months. 306-527-8843, 306-584-8286, Regina, SK. 306-682-9920, Humboldt, SK. or for full 1680 IH, ENGINE, 3272 engine hrs., online listings www.farmworld.ca 30.5x32 tires, crossflow fan, auto. header 1985 NH TR96, 2942 sep. hrs., $11,500. height, fore & aft, long auger, rear wheel Cash is King! 0% financing for 60 months. assist, chopper, chaff/straw spreader, rock 1-888-442-6084 or for full online listings trap, Pederson chaffer, 1015 header, 1986, www.farmworld.ca $23,000. 306-778-2310, Swift Current, SK. 2008 NH CR9070, 1230 sep. hrs, 1981 IHC 1460, 4250 hrs, lots of recent $199,000. Cash is King! 0% financing for repairs, always shedded, good running 60 months. 306-682-9920, Humboldt, SK. combine, ready to go to work, $6000 OBO. for full online listings www.farmworld.ca 306-246-2109, 306-441-7016, Richard, SK. NH TR99, 1600 sep. hrs., auger 1680 CASE/IH, w/1015 PU header, incl. 2000 big top hopper, grain loss monitor, 1010 straight cut header and transport. ext., factory duals, PU header, always shedded, 780-928-2691, Buffalo Head Prairie, AB. $65,000 OBO. 36â&#x20AC;&#x2122; HoneyBee straight cut also available. 403-552-2106, Altario, AB. 2006 CASE 8010, 1084 threshing hrs, Y&M, Pro 600, 28L26 rears, lateral tilt, vari 1997 NH TR98, 3591 sep. hrs., $32,500. speed feeder, diff. lock, fine cut chopper, Cash is King! 0% financing for 60 months. 2016 PU, large hopper topper, downspout OAC. 1-888-462-3816 or for full online ext., all updates including air intake. Only listings www.farmworld.ca thrashed barley and canola. Great shape. $176,000. Keith 403-638-0660, Olds, AB. 2009 NH CR9070, 617 sep. hrs, $227,500. is King! 0% financing for 60 months. 2002 CIH 2388, 1960 sep. hrs., 2015 Cash or for full online listings Swathmaster PU, hopper ext., one year on 1-888-442-6084 www.farmworld.ca rub bars, chains and filters, shedded, 1994 NH TX66, 2400 sep. hrs, chaff $85,000. 306-644-4742, Loreburn, SK. spreader, lots of recent work, shedded, 1997 CASE/IH 2188 combine, $49,000; w/971 PU head, exc. cond., w/wo 24â&#x20AC;&#x2122; 2000 Case/IH 2388 combine, $79,000; straight cut header. Call 204-476-6137, 2004 HoneyBee 30â&#x20AC;&#x2122; Draper header, w/pea Neepawa, MB. auger, $23,000. Call: 306-693-5079, CX840 w/1593 sep. hrs, 2124 eng. hrs. Moose Jaw, SK. w/16â&#x20AC;&#x2122; Rake-Up PU, very well maintained, CIH 2188, 1015 header Rake-Up PU, SP vg cond. 403-391-6021, Red Deer, AB. rotor w/exceller, 2 SP auto header 2388 u p d at e s , 2 5 6 5 h r s . , $ 4 2 , 0 0 0 O B O. NH CX8090 2009, 698.2 hours. Call for de306-728-3142, 306-728-1604 Fenwood SK tails 306-864-2200, Kinistino SK.


CLASSIFIED ADS 45

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

2009 CR9070 with Swathmaster PU, dual 620-70Rx42 tires, yield and moisture and y i e l d m ap p i n g , 7 2 3 t h r e s h i n g h r s . , $175,000. 306-793-2190, 306-745-7274, Stockholm, SK.

2005 NH CR970, 1365 sep. hrs, $158,000. Cash is King! 0% financing for 60 months. 1-888-462-3816 or for full online listings www.farmworld.ca

1990 NH TR96, 3821 sep. hrs., $10,900. Cash is King! 0% financing for 60 months. 1-888-462-3816 or for full online listings www.farmworld.ca 1990 TR96, 2999 engine hours, spent $26,000 on insurance claim, many new parts, 8 belt Victory PU, chopper, $18,000 OBO. 306-233-7529, Cudworth, SK. 2008 NH CR9070, 538 sep. hrs, $205,000. Cash is King! 0% financing for 60 months. 1997 TR98 NH, 270 HP engine, rock trap, 1-888-442-6084 or for full online listings variable feeder house, spreader, grain loss monitor, 2800 threshing hrs, new rear www.farmworld.ca tires, 971 header and Swathmaster PU, 3- NH TR98’s SP, 971 pickups, shedded, $23,000 OBO. 780-632-1774 Vegreville AB well maintained, 1400-2300 sep. hrs., $ 3 5 , 0 0 0 e a c h O B O. 3 0 6 - 6 2 1 - 0 6 1 4 , 2001 NH TR99 $75,000. Raymore New Holland, 306-746-2911, Raymore, SK or 306-269-0215, Foam Lake, SK. www.raymorenewholland.com 2010 NH CX8080 $242,000. Watrous New Holland, 306-946-3301, Raymore, SK. or 2009 NH 9070, 570 separator hours. Dealer serviced fall 2012, ready to go, in great www.watrousnewholland.com condition. Not used fall of 2012. Fully inte2006 CR970, Y&M, 26’ auger, new sieves, grated factory GPS with AutoSteer/yield Mav chopper, air compressor, 1453 sep. mapping, two sets of concaves, $170,000. hrs, var. spd. feeder house, no header, CAD. Call 306-722-7644 or 406-268-1028. $92,000. 306-662-3388, Maple Creek, SK. Email: hjohnson@jmgrain.com 2003 NH CX840, 1827 sep. hrs., $96,000. 2004 NH CR960 $125,000. Yorkton New Cash is King! 0% financing for 60 months. Holland, 306-783-8511, Yorkton, SK or 1-888-462-3816 or for full online listings www.yorktonnewholland.com www.farmworld.ca 1992 TR96, 240 HP, Swathmaster PU, Re2004 NH CR960, Rake-Up PU, elec. hopper dekop straw chopper, reverser, electronic topper, long auger, deluxe chopper, pea stone trap, lateral tilt and terrain tracer, concaves - never used, 1304 sep. hrs. Ask- always shedded, $21,000 OBO. Call i n g $ 1 2 5 , 0 0 0 O B O. 7 8 0 - 6 3 2 - 7 3 9 7 , 306-834-8508, Kerrobert, SK. 780-632-9862, Vegreville, AB. 2003 CR940, 2 spd. rotor, 1820 sep. hrs., 2007 NH CR9070, 988 sep. hrs, $183,500. good condition, field ready, shedded, Cash is King! 0% financing for 60 months. $90,000 OBO. 306-843-7046, Wilkie, SK. 306-682-9920, Humboldt, SK. or for full online listings www.farmworld.ca 2008 CX 8080, 1125 sep. hrs., swathmaster PU, yield & moisture, GPS, all the options, loaded, $180,000 OBO; 36’ NH Draper header, dual knife, loaded, $35,000. Priced to sell; 2007 CR 9070, 1295 sep. hrs., Swathmaster PU, yield & moisture, all the options, loaded, $180,000 OBO; 36’ NH Draper header, loaded, $35,000. Priced to sell. 780-814-3998, Rycroft, AB. 1997 TR98, 3840 eng/ 2945 sep hrs, c/w Victory Super 8 PU, 4150 Redekop chopper, extra set of Harvest Ind. concaves, hopper topper, $37,500. 306-648-8005, 306-648-7595, Gravelbourg, SK. TR70 NH COMBINE, 3208 Cat engine, many new parts, 3000 hrs., $2000. Call 780-662-3002, Tofield, AB. 2010 NH CR9070 $265,000. Yorkton New Holland, 306-783-8511, Yorkton, SK. or www.yorktonnewholland.com 2009 NH CR9070, 733 sep. hrs, $212,500. Cash is King! 0% financing for 60 months. 1-888-442-6084 or for full online listings www.farmworld.ca CX860 SUPER Conventional, 1857 hrs., recent 65,000 overhaul by dealer, all options, hopper roll-up cover, $128,000 OBO. 306-268-7400 306-268-7550 Bengough SK 2008 NH CX8070 $173,000, $198,000 Raymore New Holland 306-746-2911, Raymore, SK www.raymorenewholland.com 2008 NH CR9070, 632 sep. hrs, $199,000. Cash is King! 0% financing for 60 months. 1-888-442-6084 or for full online listings www.farmworld.ca 2010 NEW HOLLAND CR9060, ContourMaster, 2WD, 20.8x42 duals, 607/504 hrs, $189,900. 605-480-1750, 605-270-4841. 1994 TR97 TERRAIN Tracer, electronic stone trap, long auger, Redekop chopper, R a ke - U p P U, h o p p e r t o p p e r. A s k i n g $24,000. 306-742-5912, Churchbridge, SK. 2004 NH CR970, 1410 sep. hrs, $145,000. Cash is King! 0% financing for 60 months. 306-682-9920, Humboldt, SK. or for full online listings www.farmworld.ca 2010 NH CX8090 $258,000. Watrous New Holland, 306-946-3301, Watrous, SK. or www.watrousnewholland.com 1996 NH TX66 w/Rake-UP PU, 2213 eng. hrs, 1721 cyl. hrs, $50,000 OBO. Phone: 204-467-5638, Rosser, MB. TR86, 4100 hrs., fair condition, w/near new tires, Rake-Up PU, $7500. Call 306-561-7780, Davidson, SK. 1998 TX68, 2100 hrs, Rake-Up, Sunnybrook concave, new chopper knives, hopper cover, field ready, $45,000 OBO. 780-210-0280, Andrew, AB. 2 -TR85, both used last fall, must sell, make an offer. Also straight cut headers avail. Call 306-747-2363, Shellbrook, SK. 1994 NH TR97, 3333 eng. and 2529 thrashing hrs, 12’ PU, 30’ 971 straight cut w/UII PU reels, lifters and carrier, new bubble auger 2012, terrain tracer, Redekop chopper, shedded, serviced and field ready. $30,000. 306-843-3135, Wilkie, SK. 2010 NEW HOLLAND CX8080 SP, 563 sep. hrs. Hodgins Auctioneers, 1-800-667-2075 PL#915407. 2012 FORD/NEW HOLLAND CR 7090 combine. 377 eng. hrs, 255 sep. hrs, 790C-12 header, reverser, auto header height control, hyd. fore and aft, Terrain Tracer, long auger, grain tank ext, chaff spreader, chopper, Intelliview IV monitor, yield and moisture, Terrain Tracer feeder house, HID lighting, 900/60R-32 tires, 402 HP. One owner. Zero hrs. on NH triple inspection. All updates done. Factory warranty to Sept 1, 2013, ext. engine warranty to Sept 1, 2014, $275,000. Will take almost anything on trade. 1-877-862-2387, cell 306-862-7524 or 1-877-862-2413, cell 306-862-7761, Nipawin, SK. TR70 FORD ENGINE for sale, 378 Melroe PU, 2909 hrs., $2000. Call 204-242-2943, Lariviere, MB. 1991 TR96, approx. 2365 hrs., Ford eng., Rake-up PU, shedded. Call 306-682-4923, 306-231-9414, Humboldt, SK.

G L E A N E R R 7 6 2 0 0 9 , 4 2 0 0 h e a d e r, 18.4R42 duals, 503.4 hours. Call 306-864-2200, Kinistino, SK. GLEANER R65 2005, 1755 sep. hours. Call for details 306-864-2200, Kinistino, SK. GLEANER 1989 R70, 2594 eng. hrs, 1992 sep. hrs, always shedded, asking $20,000. Call 780-674-4287, Barrhead, AB. 1998 36’ AGCO draper header, transport, pea auger, Schumaker knife drive, PU reel, fits 62’s / 72’s. 306-642-7748, Assiniboia. 2003 GLEANER R75, 2681 sep. hrs., $94,500. Cash is King! 0% financing for 60 months. 1-888-462-3816 or for full online listings www.farmworld.ca C-62 GLEANER c/w Rake-Up PU header, 1430 hours, with Sunnybrook upgrade, $55,000. Call: Doug 403-485-8375, Lamond, AB. doug.s5farms@gmail.com 1982 N7, IMMACULATE condition, professionally serviced every 2nd year, Kirby chaff spreader, shedded, good rubber, $14,000 OBO. 306-628-7840, Eatonia, SK. 1981 L2, 1845 hrs, always shedded, new rubber, field ready, $10,000 OBO. Call 403-935-4331, 587-888-2112, Airdrie, AB. 1995 GLEANER 30’ Honeybee, w/PU reel and 1998 adaptor for R62, $14,900. 306-948-9870, Biggar, SK.

1987 8820 TITAN II, 214 PU, long auger, 2200 hrs., dual range, hydro, reverser, always shedded, vg cond., $32,500; 925 rigid header available, $9500. 780-905-2979, Westlock, AB. 2004 JD 9760, 16’ PU, 2400 sep. hrs., always shedded, $95,000; 1990 JD 9600, 3000 sep. hrs., Sunnybrook bars and concave, $39,000. 306-524-4960, Semans, SK. 1989 JOHN DEERE 9600, 5231 eng. hours, 3784 sep. hours, $41,100. Wynyard, SK. 306-554-2536, www.maplefarm.com or call one of our 7 stores near you. 1995 JD 9600, new: front tires, rub bars, and concave, chaff spreader, $9,000 spent on Greenlight, $50,000. Call Dale 204-649-2288, 204-522-5708, Pierson, MB 1997 JD 9600 w/9610 updates, 914 header, 2500 sep. hrs., 3500 eng. hrs., long auger, fine tooth chopper, chaff spreader, regular Greenlight, always shedded, premium condition, $70,000. 204-859-2752, 204-859-6655, Rossburn, MB. 1998 JD 9610 combine, 2360 hrs.; 1998 JD 925 25’ flex header. 204-764-2544 (days), 204-764-2035(eves.) Hamiota, MB. 1996 JD 9600 c/w 914 PU header, 2984 sep. hrs., fine cut chopper, chaff spreader, reverser, long auger, hopper extension, always shedded, good condition, $49,500; Also 30’ straight cut header c/w Bergen trans., $6500. 306-283-4657, Langham, SK 2005 JD 9760, 1425/1790 hrs., Y&M, 914 PU, plumbed for Outback, shedded; Also 2000 930 draper header. $142,000. for both. Call 403-823-5308, Drumheller, AB. 7720 HYDRO w/fine cut chopper, chaff spreader, c/w header and trailer, exc. shape, $15,000 OBO. Call 306-842-4596, Weyburn, SK. 2011 JD 9870 STS, 520/85-42 dual front tires, 28L-26 rear tires, 155 sep. hrs., Contour-Master, 26’ auger, 615P PU header. Asking $320,000. 306-921-7295, Star City, SK., email mike.mcavoy@sasktel.net 1996 JD 9600, 914 PU, dual range, 4340 eng. hrs., 3300 threshing hrs., excellent condition, $42,000 OBO. 306-549-7635 or 306-549-2389, Hafford, SK. 9650 STS, 1389 sep. hrs, deluxe header control, level land feeder house, 914 PU, Y&M, $105,000. 306-459-7850 Ogema, SK 9600 JD, 914 PU, chopper, topper, reverser, field ready, always shedded, looks like new. 306-654-7772, Saskatoon, SK.

1997 JD CTS, 3100 sep hrs., 914 PU header, annual Greenlights, field ready, $45,000. 306-782-8303, Yorkton, SK. 1990 JD 9501 combine c/w JD 912 PU, like new, $24,000. Phone 306-543-4641, 306-536-3542, Regina, SK. 1986 JD 8820 Titan II, new concave 2011 used very little, Sunnybrook cyl. fine cut chopper, field ready. Rake-Up PU optional, 306-325-4340, evenings, Lintlaw, SK. 1987 JD 7721 PT combine, Titan II, 2 spd. cyl., hyd. transport, belt PU and chopper, always shedded, vg cond., $5000 OBO; Leon 35’ cultivator, tandem wheels, $500. 306-544-7717, Hanley, SK. 1997 JD 9600, 914 header, fine tooth chopper, shedded, work done on it, very clean machine, $49,000. 780-674-5516, 780-305-7152, Barrhead, AB. 2009 JD 9770 STS, 463 hrs, Premier cab, Contour Master with hi-torque reverser, 20.8x42s with duals, 600/65R38 rears, chopper, JD factory bin extension. Very nice low hour combine! $199,500 US. Phone: 320-848-2496 or 320-894-6560, Fairfax, MN, www.ms-diversified.com 7720 YELLOW CAB, 2 speed cylinder, good rubber, PU table, $11,000. 306-472-3113, Briarcrest, SK. 2010 JD 9770STS, 625 sep. hrs., c/w 2012 JD 615P PU header w/only 100 hours on header, Contour-Master high torque variable spd. feeder house, high cap lift cyl., 22’ high cap unload auger, wide spread fine cut chopper, 800/70R38, small and large grain concave’s, always shedded, exc. cond. $235,000. Call Jordan anytime at 403-627-9300, Pincher Creek, AB.

2010 9870 STS, low hrs., 343 sep. hrs, 520 duals, 4 WD, Contour-Master, c/w 615P header, optional to include 635 HydraFlex header, $284,000. Call 204-227-5679, Warren, MB. Email: riddellseed@mts.net 1986 JD 7720 Titan II, 3794 eng. hrs., 212 1986 JD 6620 TITAN II, 2734 hrs, posi- PU header, chaff spreader, straw chopper, torque, 212 PU and reverse variable speed std. trans., asking $11,000. 306-554-2616, feeder house, many new parts, new tires, 306-554-7022, Wynyard, SK. always shedded, vg condition, asking 2009 JOHN DEERE 9770, Contour-Mas$10,000 OBO. 306-846-7521, Dinsmore SK ter, 2WD, 520x85R42 duals, 1282/849 2008 JD 9870, 613 sep. hrs, 969 eng. hrs, hours, extended warranty, $172,500. 615 PU header, 520x38 duals, 28Lx26 rear, 605-480-1750 or, 605-270-4841. electric Michaels roll tarp, 24’ high cap unload auger, wide spread chopper, green 1978 SIDEHILL 6600 combine, 3370 hrs., lighted 150 hrs. ago, shedded, well main- Sund PU, chopper and spreaders, new contained, serviced and field ready, exc. cond cave and rub bars, good cond., $3300. Call 306-475-2779, Crane Valley, SK. $218,500. 306-273-4311, Stornoway, SK.

2009 T670, 704 sep. hrs., 1013 eng. hrs., MAV chopper, power spread adjust, Y&M, power hopper/mirrors, c/w 615P PU, $200,000. 403-994-4041, Three Hills, AB. 1994 JD 9600, Greenlighted regularly w/912 PU, clean, field ready, 2940 sep. GLEANER R62 1997, stone trap, 1950 hrs, $44,000. 306-861-1314, Weyburn, SK. sep. hours. 306-864-2200, Kinistino, SK. 2011 9870 STS, 240 rotor hrs., big duals, 2009 GLEANER A86 c/w chopper, spread- Contour-Master, powercast chopper, 26’ er, factory warranty, $299,000. Phone: unload auger, pro-drive, harvest smart, no Saskatoon 306-934-1546 or Swift Current, pulses, Greenlighted, $297,000. Call 306-834-7610, Major, SK. 306-773-7281. www.fulllineag.com GLEANER S67 2011, 18.4x26, 900/62R32 JOHN DEERE 9610, 3050 sep hrs., c/w front, 393.9 hours. Phone 306-864-2200, 914 PU, Greenlight annually. Phone 306-775-2845, Regina, SK. Kinistino, SK. LONGER LASTING GLEANER accelerator rollers, 3 to 5 times longer than OEM. Phone 306-759-2572, Eyebrow, SK. 1999 C62 GLEANER, 2018 sep. hrs, Sunnybrook concave and cylinder, Redekop chopper, Victory 8 belt PU, grain tank tarp, 25’ straight cut header, $75,000. Call Cliff 780-402-9196, Laglace, AB. ‘07 JD 936D HEADER - Single pt., 1979 L2 GLEANER combine with pickup. factory transport, hyd. F/A, new canvas, knife, & PUR fingers. $29,800. Call: 306-256-3607, Cudworth, SK. Trades welcome. Financing available. 2002 GLEANER R72, 1224 rotor hours, 1-800-667-4515. www.combineworld.com $85,000. Phone 403-581-9270 cell, or 1988 JD 7720 Titan II, 4000 hrs., exc. 403-526-2113, Frontier, SK. 24.5x32 and 14.9x24 tires, variable spd. GLEANER R76 2009, 900 front, 16.9x16 feeder with reverser, near new rad., water rear, elec . sieves, 731.6 hours. Call pump, governor weights in injection 306-864-2200, Kinistino, SK. pump, reman. injectors, cold AC, $18,000 GLEANER R66 2009, 4200 header, 751.7 OBO. 306-654-4905, Prud’Homme, SK. sep. hours. 306-864-2200, Kinistino, SK. 2006 9760 STS, bullet rotor, 615 pickup, GLEANER R72 2002, 1878 sep. hours. Call Michel’s elec. tarp, crop catcher, excellent condition, 1300 sep. hrs., fresh Greenlight, for details 306-864-2200, Kinistino, SK. $157,500. 306-230-9853, Watrous, SK. 2005 R65, 4200 pickup, SP30 HoneyBee, 1228 eng. hrs, 957 sep. hrs, shedded, no 1993 JD 7721, shedded, field ready, $4500; also, MacDon 25’ PU reel, good peas, $115,000. 780-205-2590 Waseca, SK shape, $3000. 306-932-4902, Kelfield, SK. FOR SALE: 2002 R62 gleaner, 300 HP Cummins, Rake-Up PU, $15,000. preven- 1982 JD 7720, 3817 eng. hrs, 212 PU tive maintance inspection done in 2011, header, chopper, front axle ext., rice tires, good cond., always shedded, $12,000 $55,000. 306-460-4060, Kindersley, SK. OBO. 204-746-2818, Morris, MB. 2009 JD T670, 749 sep. hrs., shedded since new, JD Auto Guide ready, new cyl1991 JD 9600 combine, w/new complete inder bars, concave and feeder chain in rebuilt engine, head and injectors, good winter 2013, c/w 615 JD PU header, cond. 306-741-7012, Swift Current, SK. $210,000; 2012 JD 635F 35’ flex header, NICE 1997 JD CTS, Y&M, fine cut chop- PU reel, fore/aft., only used 1 season, c/w per, Swathmaster PU, shedded, field Beregen header transport, $38,000. Will ready, 2515 hrs, $40,000 OBO. May deliv- sell separately. Phone 403-577-2277 or er. Contact 204-546-2131, 204-572-5032, 403-575-1114, Consort, AB. 204-572-5186, Grandview, MB. T670 JD COMBINE w/615P PU, fine cut AutoHeight, lateral tilt, Y&M, 960 ESTATE SALE: 2003 9650, 2171 sep. hrs, chopper, hrs., 724 sep. hrs., regular servicing, w/Redekop chaff blower and wagon, eng. shape, asking $189,000 OBO. Call $85,000. 1993 9600, 2680 sep. hrs, vg 306-921-6900, St. Brieux, SK. $40,000. 403-601-1360, Nanton, AB. 1985 JD 6620 Titan II, 3302 hrs, 212 PU, 1998 9610, 14’ PU, 1809 threshing hrs, harvest track monitor, header reverser, new drive tires, 2 spd. cyl., fine cut chop- shaft monitors, 2 spd. cyl., shedded, one per, chaff spreader, hopper topper, long owner, $8000. 306-728-3263, Melville, SK. auger, $86,000 OBO. Call 403-823-8264, Drumheller, AB. 2006 JD 9760, 1710 hrs., duals, field $145,000 OBO.; 615 PU, $16,000 1994 JD 9600, 3338 eng. hrs., 2609 ready, 630 flex header, $26,000 OBO. thrashing hrs., PU header and 930 flex OBO; 403-527-9661, Medicine Hat, AB. header w/PU reels and lifters, new sieves 2012, shedded, serviced and field ready, 9650 STS, 2002, 2000 sep. hrs, w/914 PU. $50,000 OBO. 306-843-3135, Wilkie, SK. Call 306-531-7600, Regina, SK.

1986 JD 7721 Titan II, PTO, rub bars, tires and belts good, shedded, well maint. Greenlighted 2008, low acres, $5000. Birch Hills, SK, 306-922-2124, 306-961-6124 1995 JOHN DEERE CTS, 4408 eng. hours, 3202 sep. hours, $41,700. Moosomin, SK Call 306-435-3301, www.maplefarm.com or call one of our 7 stores near you. 1981 JD 7720 COMBINE, with pickup header and 222 straight cut header and transport, 3661 hrs., new feeder and elevator chains, new tin on bottom feeder house. air foil chaffer, strawchopper, Harvestrack, and some spare parts, stored inside, $17,500. 403-575-1132, Consort, AB. 1987 JD 7721 pull type combine, field ready, good condition, asking $9000. Phone 306-228-3251, Unity, SK. 1988 JD 8820, JD pickup and chopper, $24,500; 1983 8820, JD PU, chopper and chaff spreader, $16,500. 306-423-5983, 306-960-3000, St. Louis, SK. 1989 JD 9600, Greenlighted regularly, can show work orders, 4910 eng. hrs., 3418 sep. hrs., very nice cond., $38,000 OBO. Call 306-769-8599, Arborfield, SK. 1996 JOHN DEERE 9600 w/914 PU, 2600 sep. hrs, Sunnybrook cyl, fine cut, chaff spreader, well maintained, ready to go. 780-512-4256, Grande Prairie, AB. 1991 JD 9400, 3352 sep. hrs., 3852 eng. hrs., 912 PU, fine cut chopper, $30,000; Also, 224 straight header available. 306-946-9981, Watrous, SK. 2010 JD 9770, 411 sep. hrs., premium cab, 20.8x42 duals, 615 PU, no pulses, Greenlighted, warranty, interest free, always shedded, excellent cond., $250,000. 306-728-3498, Melville, SK.

1998 JD 9610, 3495 eng. hrs., 2650 sep. hrs., Dial-A-Matic, long unload auger, 2 spd. cyl., new sieves top and bottom, new front, new rear tire. Always shedded, good cond; JD 925 flex header, good cond. 306-644-4703, Loreburn, SK. 2003 JD 9750, Contour Master, c/w JD 914 Victory PU, 2068 sep. hrs., $110,000 OBO. 780-679-7795, Camrose, AB. 2002 JD 9650 walker combine, 2300 sep. hrs., w/chaff spreader, excellent shape, $79,000 OBO. 403-654-0430, Vauxhall, AB. 2006 JD 9860 STS, w/MacDon PU, 1300 sep. hrs., $149,000; 2005 JD 9760 STS w/PU head, 1700 sep. hrs., $119,000. 306-948-3949, 306-948-7223, Biggar, SK. 1982 7720 TURBO hydro, 2 spd cylinder, fine cut chopper, new PU belts, hyd. pump, primary countershaft and bearings, $14,000 in recent Greenlights, 4600 hrs., $12,000 OBO. Phone: 204-868-5504 or 204-874-2206 eves, Minnedosa, MB. or email: neilgalb@gmail.com 1995 JD 9600 combine, 914 PU, Rice tires, new rear tires, hopper topper, long auger, 3113 eng., 2418 sep. hrs., only 346 hrs. since major Greenlight, shedded, very good cond., field ready, $57,000. Glenlea, MB., call 204-883-2336, 204-981-6959. 1985 JD 7720 Titan II, good shape. 7721 for parts. 306-867-8477, 306-867-8457, Outlook, SK. 1994 JD 9600, one owner, fine cut chopper, chaff spreader, auger ext., yield & moisture, dual spd. cyl., 100 hrs. on bars and concave, shedded, 2500 sep. hrs. $47,000 OBO; Also 930 JD header. Grandview, MB. 204-638-2513 or 204-572-6576. VERY MINT, JD 9610, 1999, 1800 sep. hrs, 2300 eng. hrs., fully loaded, Greenlighted, field ready, $75,000. A must see! Phone 306-843-8024, Wilkie, SK. 2001 JD 9750 STS, 2000 sep. hours, Y & R , $ 7 0 , 0 0 0 . Wi n d t h o r s t , S K . , 306-224-4272. 1996 JD 9600, Greenlighted, 2716 sep. hrs., 914 pickup, AutoSteer, yield and moisture. 306-625-3674, Ponteix, SK. 1992 9600 w/914 PU, always shedded, big eng. Dial-A-Spd, Dial-A-Matic, 2 spd. cyl, AutoHeight, dual chaff, chopper, long auger, recent tires. CMIs up to 2012, exc. cond. in and out, $37,000. Also 930 flex. Lyle at 306-567-7618, Davidson, SK. REDUCED YOUR CHOICE: 2006 9760 STS 615 PU, 1444 sep. hrs., $150,000; 2003 9650 STS w/914 PU, 2184 sep. hrs., $85,000. Field ready. Watrous, SK. For info ph or text 306-946-7173, 306-946-8120. 2005 9860 STS, 1008 sep. hrs., bullet rotor, production monitor, 914 PU, $158,000 OBO. Call 780-951-0783, Calmar, AB. 1989 JOHN DEERE 9600, 4861 eng. hours, 3362 sep. hrs, $27,800. Balcarres, SK. 306-334-2492, www.maplefarm.com or call one of our 7 stores near you. 1996 JD 9600, 3254 sep. hrs., yield monitor, long auger, $47,500; 2000 JD 9650, 2776 sep. hrs., hopper topper, $78,000. Both machines have fine cut choppers, chaff spreaders and grain loss monitors. 780-512-3120, 780-831-9159, Hythe, AB. 1988 JD 7720 Titan II, 3824 hrs., 12’ PU and 20’ straight cut headers, always shedded, $20,000. 306-492-4662, Dundurn, SK.

2000 JD 9650W, 2538 sep. hrs., auto. sensing, Sunnybrook cyl., Redekop MAV chopper, hopper topper, chaff spreader, HID lights, 914 PU header w/new belts, $89,000. Two 24.5x32 Firestone rice tires on JD rims, $3200. 204-347-5244, St. Malo, MB. 1979 JD 8820, 2935 hours, diesel, AC, wide-belt PU, $8200. Ph: 204-564-2527, Shellmouth, MB. JD 9760 STS SP combine with 579 sep. hours and Green Star ready. Art Beck Farm Equipment Auction, Saturday, August 24, 2013, Yellow Grass, Sask. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962 2007 9860 PREMIUM, loaded, shedded, Greenlighted, zero hrs. on new engine w/warranty, 1143 sep. hours. $195,000. 306-369-4180, Bruno, SK. 1982 JD 7720 combine, w/212 PU header, good condition, excellent rubber, priced to move at $15,500. 403-575-7222, Brownfield, AB. 7721 JD pull type for parts, new tires, $4000 OBO. 403-734-2148, Gleichen, AB. 1989 JD 9500, shedded, 1 owner, Redekop chopper, Rem chaff spreader, $30,000; JD 930 header avail. 306-736-8190 Kipling SK FARM CHEMICAL/ SEED COMPLAINTS We also specialize in: Crop insurance ap- 1981 JD 7720, 3800 hrs., very good condipeals; Chemical drift; Residual herbicide; tion, $8000. 306-452-3868, Redvers, SK. Custom operator issues; Equipment mal- YOUR CHOICE OF 3 JD 7721’s. All are function. Qualified Agrologist on staff. Call shedded, Greenlighted annually, c/w Back-Track Investigations for assistance choppers, field ready condition, $6,000 per regarding compensation, 1-866-882-4779. combine. Call Blaine 306-621-9751 or 1984 JD 8820, 212 PU, dual range, Kirby, Justin 306-621-0487, Yorkton, SK. reverser, good rubber, through shop, field 1998 JD 9610, 3511 engine hrs., 2530 ready. $14,900. 306-259-4901, Young, SK. sep. hrs., 914 header, long auger, shed2010 JOHN DEERE 9870, Contour-Mas- ded, $55,000; 1996 930 flex header, ter, 2WD, 650x85R38 duals, 849 sep. hrs, $5500. 204-636-2283, Sandy Lake, MB. $199,900. 605-480-1750, 605-270-4841. 1998 9510, w/914 PU, 2012 threshing 1994 JD 9600, 212 PU, 4950 eng./3583 hrs., hopper topper w/cover, chopper and sep. hrs., dual spd. cyl. fore/aft, chopper, chaff spreader, shedded, $59,000. Call chaff spreader, unload auger extension, 306-338-2710, Hendon, SK. shedded, 400 hrs. on $18,000 Greenlight, maintenance records available, field ready, 2010 JD 9870, 4979 sep. hrs., $279,000. Cash is King! 0% financing for 60 months. $42,500 OBO. 306-642-8611, Limerick, SK. 306-682-9920, Humboldt, SK. or for full 1997 JD 9600, 914 PU, long auger, MAV, online listings www.farmworld.ca data center, JD chaff spreader, Maurer 1998 9610 w/914 PU, shedded, chopper, hopper extension, shedded, 2961 sep. hrs, chaff spreader, new back tires, 2100 $55,000. 780-608-9297, Rosalind, AB. thrashing, 3100 engine, lots of work done. 1993 JOHN DEERE 9600, 4652 eng. $77,000 OBO; Also 930 rigid and 930 flex hours, 3326 sep. hours, $55,000. Yorkton, header. 306-843-2219 eves or cell: SK. 306-783-9459, www.maplefarm.com 306-843-8344, Wilkie, SK. or call one of our 7 stores near you. 1995 JD 9600, 3586 sep. hrs., 5259 eng. JD 9500, VERY low hrs., new front tires, hrs., 914 PU, fine cut chopper, $38,000; Greenlight done in 2011, always shedded, Also JD 230 straight header available. Call 306-946-9981, Watrous, SK. very good. 306-621-5417, Yorkton, SK.

1981 7720, 212 PU, auto header control, 2 spd. cyl., Kirby, long auger, chopper, hoppper cover, 3900 eng. hrs., good cond., $13,000. 306-882-5101, D’Arcy, SK. 1999 JD 9610 w/914 PU, chopper, chaff spreader, Sunnybrook cylinder, concave, back beater. 2672 sep. hrs., 3521 eng. hrs., shedded, well maintained, $70,000. 780-842-4088 or 780-806-3439 (cell), Wainwright, AB. 2 0 0 6 JD 9860 STS, 1051 sep. hrs., $193,000. Cash is King! 0% financing for 60 months. 1-888-442-6084 or for full online listings www.farmworld.ca 2010 JD 9870 combine, 275 hrs., fully loaded, GPS, OptiSpread chopper. Call Doug 306-248-7855, Paradise Hill, SK. 1979 JD 6620, approx. 2500 hrs., shedded, good condition, $5000. 780-336-4061 or 780-390-0075, Viking, AB. 1996 JOHN DEERE 9600 Conventional combine, Hrs: 3245 sep., 4780 eng. Long auger, straw chopper, chaff spreader, DialA-Matic, new rear tires 14.9x24, front tires (70%) 30.5x32, dual range cylinder, big engine, harvest track and yield monitor, feeder house reverser, Greenlighted in 2012, always shedded, field ready, well maintained, owner/operator manual and parts CD; Also available 212 PU header. Asking $39,000. Call 306-540-4818, Claybank, SK. Email: gregfunke@sasktel.net VERY MINT 1994 9600 w/914 PU, 2000 sep. hrs., $54,900; 1994 9400 w/PU, 2300 sep. hrs., c/w 1995 930 flex, all for $29,000; 1994 930 flex, $6900; 2004 635 flex, $22,000; 2010 635 flex, $29,000. 306-948-3949, 306-948-7223, Biggar, SK. 1982 8820, 3860 hrs, 214 PU, long auger, chaff spreader, hydro reverser, field ready $18,500. 780-905-2979, Westlock, AB 2009 JD 9870, 650 sep. hrs., 615P PU header, always stored inside, 2013 Greenlight inspected, $230,000. Call Ron 204-941-0045, 204-322-5638, Rosser, MB. 2007 JD COMBINE 9860 STS SPECIAL, single owner/operator, approx. 1300 hrs., large dual front tires, large rear tires, 615 PU head, ext. auger, late model production has most of 70 Series extras and recently Greenlighted. Call Ted 204-673-2527, 204-522-6008 or Rodney 204-673-2382, Waskada, MB. tnmcgregor@yahoo.com 1995 JD CTS, like new, 2839 thrashing hrs., completely looked over (2011), replaced rub bars, elevator chains, many bearings and all filters. Selling because needed larger combine, $45,000. Call Tom 306-753-7575, Cactus Lake, SK. 1997 CTS, 2388 sep. hrs; 1997 CTS, 3085 sep. hrs. 914 PU’s, both just Greenlighted, $45,000/ea. OBO. Also have 30’ flex and rigid headers. 306-378-7865, Elrose, SK. JD 9500 w/914 header, chopper, chaff spreader, all new tires, c/w 224 straight cut header and mover; JD 7721 Titan II. Both units always shedded and vg cond. Call 306-342-4329, Medstead, SK. 1998 JD 9510, 914 PU, long auger, chaff spreader, fine cut chopper, 2580 sep. hrs, duals, recent Greenlight, shedded $65,000. 306-728-3383, 306-728-8628, Melville, SK 1993 JD 9500, 4191 eng. hrs., 3161 sep. hrs., 2 spd. cyl., fine cut chopper (w/new flails), new concaves, new chrome bars, new feeder chain, chaff spreader, auger extension, for&aft., height adjustment, harvest trac, always shedded. Gull Lake, SK. 306-672-3746 or 306-672-7822. 1986 JD 8820 TITAN II, 2482 hrs., 914 PU, dual range cyl., fine cut chopper, long auger, new concave and beater, Sunnybrook threshing cylinder, nice shape, field ready, $32,000. Call Bob 780-755-2115, 780-842-7836, Edgerton, AB. 9760 STS, 1300 SEP. HRS, Y&M, duals, long auger, 914 PU, elec. tarp, Greenlight yearly, AHH, incl. plumbed Outback GPS, $159,900. Jason 306-436-7566 Regina, SK 2000 JD 9650 STS combine, premium cond., low hrs., shedded, Greenlighted yearly, $115,000. 780-831-8776, Valhalla Centre, AB. JD 7721, 1 season on concave, rub bars and feederhouse chain, good condition. Phone 306-472-5912, Lafleche, SK. TWO SHEDDED, FIELD ready JD 9600 combines: 1996 w/3000 sep. hrs.; 1997 w/3520 sep. hours. $85,000 spent on Greenlight in last 2 yrs. Also pickup heads, 36’ HoneyBee headers, 30’ flex headers and chaff collectors available. Fraser Farms Ltd., 306-741-0240, Pambrun, SK.

’04 JD 9660 STS Field-ready, 2013 $20,000 work order, Greenstar, NEW duals, FC chopper, hopper ext’n, 2,523 hrs. $109,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com RETIRED: JD 6620, 3780 hrs. PU, 18’ straight header, always shedded, vg condition, $11,000. 306-862-4909, Nipawin, SK. 1986 JD 7721 combine, mint cond., new rub bars, like new tires, chopper, hyd. swing on hitch, always shedded. Call 306-272-7873, Foam Lake, SK. 1996 JD CTS, 914 PU, 2209 threshing/ 3099 eng. hrs, lots of extras, immac. shape, $53,000 OBO. 306-228-1571, Unity. 2- 1997 9600, c/w 914, long auger, fine cut chopper, JD chaff spreader, recent $30,000+ work orders on both, new 800x65R32 Michelins, shedded, excellent condition, delivery available, $60,000 OBO. 780-847-3792, Marwayne, AB. 1984 JD 7721 PT, low acres, shedded, asking $5000. 306-344-4568, St. Walberg, SK.


46 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

1993 JD 9400, 1367 sep. hrs, 914 PU 1980 750 COMBINE with PU and 24’ TWO VERSATILE AXIAL flow 2000, PT, de- HONEYBEE 25’ DRAPER header, PU reel, header, 925R platform c/w transport trail- straight cut header, always shedded. Ph. cent shape, $3500 for both. 306-962-2266 c/w JD adapter, exc. cond., $22,000 OBO. er, $62,900. 306-378-2902, Elrose, SK. 306-486-4514, Oxbow, SK. Eston, SK. area. Call 403-823-1894, Morrin, AB. 1998 HONEYBEE SP30 JD adapter, PU reel, 1994 JD 9600, w/914 header, long au- 1984 MF 850, 2nd owner, Melroe PU, shedded, $16,000. 204-328-7877, Rivers, ger, chaff spreader, 2137 sep. hrs, 2876 c h o p p e r, s h e d d e d , a s k i n g $ 8 5 0 0 . e n g . h r s , s h e d d e d , $ 6 0 , 0 0 0 . C a l l 306-783-8783, Yorkton, SK. 5 5 4 2 C O M B I N E PA R T S , n e w c o n - MB. 403-304-4883, 403-773-2477, Elnora, AB. MF 9795 2009, 28Lx26 rear, 18.4R42 du- cave/thrasher belt/air filter, also good CORN HEADER 2009, 16x30, Cat Lexion 1993 9600, recent Greenlight, approx. als, heavy duty axle, 782.8 hours. Call used parts. 306-475-2664, Kayville, SK. C516, 16-row, low profile, w/little change 2700 threshing hrs, Redekop chopper, exc. 306-864-2200, Kinistino, SK. 1982 8650 PT, not used for several years, to adapt to Case/IH or JD, w/counter cond. 306-228-3062, Unity, SK. head, hyd. deck plates, knife and rollers, M F 9 5 6 0 2 0 1 2 , 7 5 0 / 6 5 R 2 6 R 1 W, $500 OBO. Call 306-747-2363, Shellbrook, nice condition, $55,000. 204-871-0925, SK. 1994 JD 9600, 4900 eng. hrs., 3300 sep. D20.8R42 R1. 306-864-2200, Kinistino SK. MacGregor, MB. hrs., dual range, DAS, DAM, fine cut chop430 COCKSHUTT COMBINE w/Melroe PU. JD FLEX HEADER 925, very good, field per, long auger, chaff spreader, Green- 1979 MF 750, 1780 hours, shedded, field 306-695-2047, Indian Head, SK. ready, with mover. 306-386-1268, North lighted last year, $35,000. 306-297-6425, ready, many new parts, header setup, $6700. 306-220-6754, Davidson, SK. Battleford, SK. 306-297-8837, Shaunavon, SK. RETIRING: JD 7721 Titan II PT, Rake-Up 2007 MF 9895, 1122 hours., chopper/ NH 971 30’ header w/transport, good PU, new tires, chopper, good condition. spreader, pickup header, $225,000. Call: 2007 CR 9070 NH, 379 sep. hrs, 14’ PU shape, $5500. Phone 306-629-3772, 306-587-2730, Cabri, SK. Saskatoon: 306-934-1546; Swift Current: header, 20.8x42 duals, abrasion kits, hop- Morse, SK. 306-773-7281 www.fulllineag.com per topper, chopper, $195,000; 2000 Hon2001 9650 WALKER w/PU head, Y&M and 36’ grain header, split reel, steel 1986 JD 224 rigid header, HD skid plates, Counter-Master, 2800 sep. hrs, $79,000; 1985 MF 850, 2777 eng. hrs., hydro., eyBee TR adapter, $24,000; 1992 Case very low acres on JD wobble box, recent 1998 36’ HoneyBee w/PU reel, $16,900; chopper, 354 Perkins, chrome bars, 2 con- teeth, 8820, 25’ dual knife, double swath, UII PU, Duralite knife and sections, Gleaner batt 1995 930 flex, $5900; 2010 JD 35’ flex cave’s, $5000 or $6500 w/Rake-Up PU. gauge wheels, plastic teeth, large work or- r e e l , $ 3 8 0 0 O B O . 3 0 6 - 6 5 4 - 4 9 0 5 , header, $29,000. Phone 306-948-3949, 306-650-7800, Bateman, SK. der, $22,000. Arch Equipment, Outlook, Prud’Homme, SK. 306-948-7223, Biggar, SK. 1982 550 WESTERN SPECIAL, Perkins en- SK. 306-867-8254, 306-867-7252. GERINGHOFF/JD 8 row, 30” chopping IF YOU SPRAYED LIBERTY and received gine, low hrs., shedded, $6000 OBO. Call C.I. 9600 COMBINE, low acres, shedded corn head, head site and stompers, A1, crop damage call Back-Track Investiga- 306-747-2363, Shellbrook, SK. shedded, $48,900. 204-324-4277, Altona. since new. 306-946-7497, Watrous, SK. tions for assistance 1-866-882-4779. 1987 MASSEY 860, always shedded, like JD 8820, 914 PU header, and 930 grain 930 JD BATT reel, like new, shedded, 2007 JD 9660WTS, 528 sep. hrs., Green- new rub bars and concave, 6 new rub bars header w/wheels, $22,000; MF 860 w/PU $1000. 306-424-2723, Montmartre, SK. Star ready, chopper, chaff spreader, hyd. also, 2280 hrs., 388 Melroe PU, chopper, header, 20’ grain header; MF 410 combine, fore/aft, grain loss monitor, rock trap, extra hopper ext. holds 200 bu., variable PU header; Honeybee 36’ draper header, 2008 JD 936D, one owner, shedded, vg 21’x6” unloading auger, hopper topper, speed, standard trans., $13,000. Combine PU reel, pea auger, fits Case 2388 and cond. $32,000. Phone: 204-822-3797, Greenlighted, c/w 2011 JD 615 PU header, hasn’t been used in 4 years; Also Massey 2 5 8 8 c o m b i n e , $ 1 4 , 0 0 0 O B O. C a l l Morden, MB. always shedded, $169,000. Call Jordan 24’ 9024 straight cut header, $3000; Head- 306-236-8023, Goodsoil, SK. 36’ MACDON PEA AUGER, fits 974 or FD anytime 403-627-9300, Pincher Creek, AB. er transport, $1500. 306-776-2363 eves. 70, $2500 OBO. Located Viscount, SK. 403-312-5113. JD 9610, FINE cut chopper, chaff spread- or cell: 306-529-7788, Rouleau, SK. er. Phone 306-383-2915, Rose Valley, SK. 2008 MF 9790 w/4200 header, Howard 7720 TITAN II, rice tires, well maintained, concaves, lateral tilt, variable spd. header $12,000; 4700 VERSATILE SP swather, drive, 1608 hrs., shedded, $100,000 OBO. good in mud, $10,000. 1-866-507-3369, Call 403-654-0198, Vauxhall, AB. 2008 HONEYBEE SP36, red, AFX/CR/CX 204-735-2313, Starbuck, MB. 2009 MF 9795, 609 eng. hrs., 421 thresh adapter, fore/aft, UII PU reel, very good, 2 0 0 4 JD 9860 STS, 1549 sep. hrs., hrs., Massey concave, airfoil top, electric $39,000. 306-845-7719, Mervin, SK. $165,000. Cash is King! 0% financing for bottom sieve, lat. tilt, hyd. fore/aft, PU 1996 JD 930 straight cut header, with 60 months. 1-888-462-3816 or for full on- header, MAV chopper, hopper ext., front mover, $12,000 OBO. Call 403-823-8264, duals 520/85R42, rears 480/80R26, adj. line listings www.farmworld.ca axle, thru MF shop- winter 2012, field Drumheller, AB. 2008 JD 9870 STS, 828 threshing hrs., ready. Call for price. Gregoire Seed Farms MACDON FD70 40’ dbl. knife drive, pea Highwear pkg., 800 metric front tires Ltd. 306-441-7851, 306-445-5516, North auger, poly, JD adapter, transport, field ’05 JD 630R 30’ header w/ full finw/large rears, 615 JD PU, very nice shape, Battleford, SK. ger auger, PU reels, hyd. F/A. $22,800. ready, shedded. 306-843-7757, Wilkie, SK. $200,000 OBO. Call 306-873-8526 or Trades welcome. Financing available. 9690 MF 2006, 1220 sep./1650 eng. hrs, 2004 NH 94C, 30’ CR/CX adapter, fore and 1-800-667-4515. www.combineworld.com 306-873-7356, Bjorkdale, SK. updated Roto at 500 hrs, hopper cover, aft, transport, Hart Carter reels, gd shape, 2012 JD S670, 303 hrs, ATR, GS3 color TS shedded, Melroe PU, exc., $105,000. Car- $35,000 OBO. 306-537-0950, Pelly, SK. 30’ 1010 IHC straight cut, batt reel, clean, monitor, Premium cab, HIDs, Contour rot River SK 306-768-7812, 306-768-7392 Also, 17 1/2’ 810 IHC straight cut, JD 230 STRAIGHT cut auger header, batt $5750. Master w/hi-torque reverser, Pro Drive, $2000 OBO. 780-927-3638, La Crete, AB. 20.8x42s w/duals, chopper, $259,500 US; 1995 MF 8460, shedded, one owner, reel, good shape, header, $4000. Trans2012 JD S660, 282 hrs, GS3 color TS field ready. 306-874-7795, 306-874-2354, p o r t ava i l a b l e . 3 0 6 - 4 2 9 - 2 7 8 5 , c e l l 2008 JD 635 Hydra flex platform, 35’ hydra 306-424-7575, Glenavon, SK. Monitor, Premium cab, Contour Master Naicam, SK. flex, poly skids, fore & aft, PU reel, real w/hi-torque reverser, 3 speed trans, sharp, $21,900. Call Gary 204-326-7000, 1995 960 MACDON 36’ header, PU reels, Steinbach, MB. reimerfarmequipment.com 1980 MF 751 PT combine, Renn drum 18.4x42s w/duals, chopper, $239,500 US. JD adapter, Trailtech transport, always Phone 320-848-2496 or 320-894-6560, PU. Offers. 306-642-5740, Assiniboia, SK. shedded, good condition, $12,500 OBO. Fairfax, MN. www.ms-diversified.com 1983 MF 860 w/Melroe PU, header rever- 306-476-2588, Rockglen, SK. ser, chaff spreader, new chopper knives, 2001 9750, 2171 sep. hrs, Y&M, shedded, 1995 JD 925 flex platform, 25’, PU reel, HEADERS AT WHOLESALE PRICES: ext. auger, many updates done, $85,000. $5200 OBO. 306-364-4210, Jansen, SK. poly skids, fore & aft., $7900; 1998 JD 925 306-221-8155, 306-257-3897, Allan, SK. 8680 1998 MF, c/w Rake-Up PU header. flex platform, 25’, PU reel, poly skids, fore 1998 930 flex, Crary air reel, $16,500; Has Sunnybrook cylinder upgrade. 1500 & aft, reconditioned, $11,900; 1998 JD 2004 635 flex w/Crary air reel, full finhrs, $55,000; 36’ 5100 Draper c/w adap- 925 flex platform, 25’, PU reel, poly skids, gered, $21,900; 2005 635 flex, $13,750; tor, $11,000; 25’ 400 auger header, fore & aft, Crary air reel, reconditioned, 2006 635 flex, $19,650. 204-746-6605, $7500. Doug 403-485-8375, Lomond, AB. $14,900; 2001 JD 925 flex platform, 25’, 204-325-2496, Morris, MB. doug.s5farms@gmail.com PU reel, poly skids, fore & aft, full fingered 2005 JD 635 hydra flex header, 50 series 2011 MF 9895, 245 hours, MAV chopper, auger, reconditioned, $14,900. Steinbach, hookup, poly dividers, high stone dam, d u a l s , 1 6 ’ R a ke - U p P U, w a r r a n t y, MB. Call: Gary Reimer 204-326-7000 $23,000. 780-933-0610, Edberg, AB. reimerfarmequipment.com $290,000. 403-412-4456, Three Hills, AB. 2009 CASE/IH 2015 PU table Swathmas2006 9760 JD STS, dual wheels, power 1984 860, 1843 ORIGINAL HOURS, 6 2009 MACDON D60D, 40’, cross auger, JD ter, shedded, used only 3 yrs. $18,000. spreader, Michel’s roll top cover, 615 PU, c y l i n d e r h y d r o , a l w a y s s h e d d e d . adapter, always shedded, only used on 306-644-4742, Loreburn, SK. 3000 acres of wheat, $57,500. Call 945 thrashing hrs., field ready, $165,000. 403-882-2401, 403-323-0409, Castor, AB. 1998 1020 FLEX header, PU reel, fore and 306-843-7192, 306-658-4734, Wilkie, SK. 306-753-7615, 306-753-7618, Macklin, SK aft, $9500. Call Frank at 306-394-2131, MF 9895 2001, 606 hours. Call for details IF YOU SPRAYED LIBERTY and received Coderre, SK. 2- JD 7721’s w/choppers, good cond., 306-864-2200, Kinistino, SK. crop damage call Back-Track Investigashedded, $5000 ea. OBO. 403-345-5149, 2003 HONEYBEE SP30 draper header, 2 0 0 6 MF 9790, 1016 hrs, chopper/ tions for assistance 1-866-882-4779. Coaldale, AB. No Sunday calls please. now $26,700. Russell, MB. Call spreader, $186,000. Ph. 306-934-1546, MACDON 25’ 972 w/Pea auger, lift- 204-773-2149, www.maplefarm.com or 1987 JD 7721 PTO Titan II, always shed- Saskatoon or 306-773-7281, Swift Current. 2001 ers, PU reel w/872 Case/IH adapter, call one of our 7 stores near you. ded, good condition, tires very good, www.fulllineag.com $25,000. 306-236-6018, Meadow Lake, SK. $5500. 306-567-3166, Davidson, SK. 1998 NH 973 30’ flex, AWS air reel 1981 MF 860 hydro., 3700 hrs., all upMACDON 960 36’ draper header, batt w/header drive fan, reels can be sold sep2004 JD 9760, 969 eng. hrs, 647 thresher dates, clean and in good shape, $5000. 1996 reel, Case adaptor, built-in transport, new arately; Sep. drive for JD combine for air hrs, high spd unload, 800x32 tires, Green- Call 204-744-2389, Notre Dame, MB. knifes, spare knife, shedded, $10,000 OBO. reels, $11,000. 306-969-4511, Minton, SK. light done, $160,000; 2003 36’ HoneyBee 306-963-7769, Stalwart, SK. header w/quick attach. Both in vg cond., REDUCED: 8460 MF, 1500 eng. hrs, 2007 HONEYBEE 30’, PU reels, cross auger, 204-328-7441, 204-724-7949, Rivers, MB. Westward 388 PU, exc. shape, $25,000. AGCO 400, 25’, PU reel. Call for details Case adapter, always shedded, vg shape, 306-823-4319, 306-823-7556, Neilburg SK 306-864-2200, Kinistino SK. $36,000 OBO. 306-628-8020, Prelate, SK. 1997 MASSEY FERGUSON 8780 SP combine. Contact Hodgins Auctioneers, 1-800-667-2075. PL #915407. 1 9 9 4 MF 8460, c/w pickup header, $37,000. Phone 306-934-1546, Saskatoon or 306-773-7281, Swift Current, SK. www.fulllineag.com 1980 MF 750 combine, 2323 hrs., always shedded, $3000. Contact 306-225-5720, Hague, SK. 1987 MASSEY FERGUSON 860, 3070 hrs., Rake-Up PU, shedded, good condition. 403-883-2284, Donalda, SK. 1982 MF 550 Western, 1640 hrs., Rake-Up PU, chopper, $5800 OBO; 1978 MF 550, 1917 hrs., 378 Melroe PU, chopper, $5000 OBO. Both shedded, excellent cond. 306-771-2670, 306-551-8794, Balgonie SK 1993 MF 8570, 4007 engine hrs., $18,000; 1994 MF 8570, 3670 engine hrs., $20,000; 24’ MF header, UII pickup reels, fits 8570, 8780 MF; 30’ MACDON draper header, pickup reels, fits 8570, 8780 MF; 1984 MF 860, 3000 eng. hours, chopper, $5500. 306-753-7465, Denzil, SK. 1984 MF 860, $4000 work order done in 2012, always shedded, $7900 OBO. Call Lorne 306-383-2961, Quill Lake, SK. 1986 MF 860, 4800 eng. hrs., original owner, always shedded, no pulses, V8, hydro, 9001 Melroe PU, good condition, well maintained. Assorted new parts and filters, $9000. 306-237-4420, Kinley, SK. 2009 MF 9795 c/w pickup header, chopper, spreader, 1 of 2, $275,000. Phone: Saskatoon: 306-934-1546; Swift Current: 306-773-7281 www.fulllineag.com 2010 MF 9795, lateral tilt, power hopper, power ladder, leather seat, MAV chopper, Outback GPS ready, 900/60R32 fronts, 28L-26 rear tires, 1072 eng., 772 thresher hrs, $245,000. 306-463-8600, Coleville, SK MF 9690, 1070 eng. hrs, 760 sep. hrs, exc. shape, 30’ draper, Agco 5100. 306-243-4960 306-867-4167 Dinsmore SK 1984 MF 860 combine, V8 hydro, 3100 hours. 403-443-7217, Three Hills, AB.

1995 MACDON 36’ draper, built in trans., batt reels, TX/TR NH adapter, spare adapter and canvas, $11,000. 306-969-4511, Minton, SK. 2009 CASE/IH 2142 draper header, 35’, AFX-CR-CX adapter, $44,000 OBO. Call 306-563-8482, 306-782-2586, Rama, SK. 2005 30’ HONEYBEE 94C w/Pea auger, UII PU reel, TR adapter, always shedded, $32,500. 306-648-2763 or 306-648-7595, 306-648-8005, Gravelbourg, SK. 960 MACDON 25’ header, w/bi-directional adapter, field ready, $11,900 OBO. Call 780-853-2024, Vermilion, AB. 2008 HONEYBEE 94C 36’, UII PU reel, fore/aft, pea auger, AutoHeight, double knife, hyd. tilt, gauge wheels, poly skids, CR adapter, transport package, excellent condition, low acres, field ready, $48,500 OBO. 306-843-7540, Wilkie, SK. 1993 JD 930 flex platform, 30’, PU reel, poly skids, fore & aft, needs reel repair, $3900; 1998 JD 930 flex platform, 30’, PU reel, poly skids, fore & aft, reconditioned, $11,900; 2001 JD 930 flex platform, 30’, PU reel, poly skids, fore & aft, full fingered auger, reconditioned, $15,900; 2002 JD 930 flex platform, 30’, PU reel, poly skids, fore & aft, reconditioned, Crary air reel, $21,900. Gary Reimer, 204-326-7000, reimerfarmequipment.com Steinbach, MB. 2005 JD 635F, full finger auger, all new PU reel fingers, shedded, c/w JD vine lifters, $22,500. $25,000. with Bergen transport. 306-843-7192, 306-658-4734, Wilkie, SK. 2003 NEW HOLLAND 30’ HoneyBee, good shape, $30,000 OBO. 780-632-7397, 780-632-9862, Vegreville, AB. FLEXHEADS: C/IH 1020, 30’, $8000; C/IH 1020, 25’, $5000; C/IH 1010 rigid, 30’, $4500; IH 820, $2000; JD 925, $6500; JD 930, $7000. 204-857-8403, Portage, MB. www.zettlerfarmequipment.com 25’ JD 925 RIGID header with PU reel and F&A, set up for Contour-Master, Spline driveshafts, stubble lights, $12,000. 780-512-4256, Grande Prairie, AB. 1997 CASE/IH 1020 flex header, 30’, shedded, good shape, $12,000. 306-644-4742, Loreburn, SK.

2012 MACDON CASE/IH 2162 35’ flex draper header, w/adapter to fit Case/IH and NH, hyd. fore/aft., done approx. 500 acres, skid plate kit, spare knife, as new condition, $70,500 OBO. 204-825-8108, 204-272-2180, Pilot Mound, MB.

EASY HARVEST SYSTEM S LTD * used combine headers - all makes - all sizes * new EHR PU reels * used Draper Headers * PU reel updates: to rebuild Hart Carter reels

P hone 78 0- 8 75 - 8 5 05

Llo yd m in ster, Alta . Em a il: ra b en o it@ m csn et.ca Fa x: 780- 875- 8567

2011 635F with Crary air reel and header mounted fan, spare knife, fully loaded, $57,500; 2012 MAURER HEADER TRANSPORT with lights, brakes, telescoping hitch, front fender, and spare tire, $8,500. 306-472-3000, Lafleche, SK. IHC 820 FLEX header, 22.5’ w/electronic 1994 CIH 1010 LL, 30’, PU reel, transport, height control, big auger, $1800; IHC 820 $11,900. 1-800-219-8867, Swift Current, flex header, 20’ w/mechanical height conSK. or www.redheadequipment.ca trol, $800. 306-353-4560, 306-280-6101, Riverhurst, SK. JD 924 STRAIGHT cut header, w/Hart Carter PU reel, Dutch Industries lifters, $6000. Call 306-749-7607, Birch Hills, SK. RECONDITIONED rigid and flex, most makes and sizes; also header transports. Ed Lorenz, 306-344-4811, Paradise Hill, SK. www.straightcutheaders.com 2004 JD 635 Hydra flex platform, 35’, PU reel, poly skids, F/A, reconditioned, ’12 CIH 3016 Case head & pick-up. Excel- $23,900; 2009 JD 635 hydra flex platform, lent cond’n w/ factory updates. $24,800. 35’, PU reel, poly skids, mint cond, Trades welcome. Financing available. $15,900; 2012 JD 635 hydra flex platform 1-800-667-4515. www.combineworld.com 35’, PU reel, poly skids, like new, $29,900. Call Gary Reimer, 204-326-7000, SteinCIH 1010, 30’, 5 batt reel, hyd. fore/aft, bach, MB. reimerfarmequipment.com rigid header w/new trailer, very straight, excellent cond., $9,500. 403-823-1928, 30’ NH 971 w/UII PU reels and gauge wheels w/transport. Used very little, armor@xplornet.ca Drumheller, AB $7800. Dennis, 306-795-2963, Ituna, SK. 1998 NH 994, 30’ draper header, TR adapter, PU reel, fore/aft, gauge wheels, good 2004 JOHN DEERE 936D draper header, condition, $20,000. 306-799-2146, Brier- n o w $ 4 3 , 9 0 0 . F o a m L a ke , S K . C a l l 306-272-3345, www.maplefarm.com or crest, SK. e-mail: rflegel@sasktel.net call one of our 7 stores near you. NH 971 header 30’, pickup reel, fore and HONEYBEE SP30 2011, S77 adapter, UII aft. Call 780-847-2619, Marwayne, AB. reel, plastic teeth. Phone 306-864-2200, 2004 MACDON 873 adapter for CRCX or Kinistino, SK. Case/IH, excellent condition, $5000. 2002 30’ HONEYBEE HEADER, UII PU 306-424-2645, Montmartre, SK. reel, fore/aft, pea auger, gauge wheels, 2004 JD 936 draper header, excellent fits NH or Case/IH combine, $22,500 OBO. condition, $35,000. Phone 403-664-2414, 403-588-9497, Bashaw, AB. Oyen, AB. JD 930 FLEX header, fits models 9610 and JD 214 HEADER, w/14’ Sund PU, very older; also, JD 922 flex header, both w/PU g o o d c o n d i t i o n , $ 5 0 0 0 O B O . C a l l reels. 780-679-7795, Camrose, AB. 780-398-3987, Thorhild, AB. MF 9650 FLEX header, fits 8460 and 8450 2000 HONEYBEE HEADER, SP30, w/pea combines, $4,000. 306-629-3976, Morse, auger, NH TR adapter, exc. cond., $27,000. SK. 780-352-3118, Wetaskiwin, AB. 2012 MACDON D60S, 40’, JD adapter, all 2001 JD 930F flex header, 30’, includes available options, 1300 acres, absolutely transport. $12,000 OBO. 306-563-8482, mint, $56,900. Will take Super B’s on 306-782-2586, Rama, SK. trade. 306-641-9123, Rhein, SK. 2009 HONEYBEE 30’, red/black AFX/ TWO 30’ HONEYBEE DRAPER headers, CR/CX adaptor, low acres, $38,000 OBO. 2001 and 2005, both in exc. cond., w/JD 306-563-8482, 306-782-2586, Rama, SK. adapters. Call 306-298-4445, Bracken, SK. 1010 IH HEADER, 25’, field ready, $5600 2120 FLEX HEADER, PU reel, good condition. 403-883-2284, Donalda, SK. OBO. Call 780-853-2024, Vermilion, AB.

1998 CIH 1010, 30’ header, batt reel, hyd. fore/aft, 4 wheel trans, vg cond., $8500. 306-648-2859, Gravelbourg, SK. 2008 HONEYBEE 30’ Grain belt Plus with CR/CX or 810 adaptor, every option on header, very nice shape, always shedded, $42,000 OBO; 2002 HoneyBee 30’ CR/CX or 810 adapter, auto. header height, fore&aft, full length Pea auger, $32,000 OBO. 780-650-1052, Smokey Lake, AB. 2009 NH 94C-30’ CR/CX $49,900. Raymore New Holland, 306-746-2911, Raymore, SK. www.raymorenewholland.com 1995 CIH 1020 flex platform, 30’, PU reel, poly skids, fore & aft, reconditioned, $11,900; 2001 CIH 1020 flex platform, 30’, PU reel, poly skids, fore & aft, reconditioned, $14,900. Call Gary Reimer 204-326-7000 reimerfarmequipment.com Steinbach, MB. 2004 JD 936D w/PU reel, for&aft, factory trans., single point, field ready, can deliver, $34,000 OBO. 204-734-8071, Swan River, MB. 2002 30’ HONEYBEE draper header, pea auger, UII PU reels, IHC adapter, 800 acres on new knife and guards, fore/aft gauge wheels, shedded, one owner. 306-353-2280 leave msg, Riverhurst, SK. 25’ MACDON 960 header w/PU reel, vg cond., $11,500 OBO; IHC 30’ 1010 header, batt reel, very good condition, $5000 OBO.; MacDon 960 30’ draper header, w/PU reel, TR adapter and transport, shedded, exc. cond., $13,500 OBO. Shellbrook, SK. 306-747-2514, 306-961-8061. 2004 CIH 1010 SC, 30’, PU reel, full finger auger, $19,000. Call 1-800-667-9761, Saskatoon, SK. or www.redheadequipment.ca 1997 HONEYBEE SP30 with TR/TX adaptor, PU reel, good shape, $18,000 OBO. Ph 204-479-6665, St. Francois Xavier, MB. GLEANER C/W 30’ Hart Carter PU reel, $8500; 14’ Gleaner PU head, $2500 Pro Ag Sales, 306-441-2030, North Battleford, SK. 1997 JD 930F flex header, new knife, new poly skids, good cond., ready for work. Call 306-551-7477, Regina, SK. Email for pics jd930flex@yahoo.ca 2005 HONEYBEE 30’ straight cut w/JD hookups, factory transport, cross auger, UII PU reel, hyd. fore/aft, shedded, one owner, $25,000. 403-363-9973, Ituna, SK. 35’ D50 MACDON header, with 21-23-25 Series adaptor, transport, pea auger, fore/aft, only done 500 acres. Antler, SK. 306-452-7870. 2002 CIH 1042 ES, 30’, PU reel, 2388 adapter, $28,500. 1-800-535-0520, Lloydminster, SK. or www.redheadequipment.ca TWO 2010 MACDON FD70 40’ headers, all options, Case/IH adapter, shedded, like new, $65,000 each. 306-473-2749 or 306-640-8181 cell, Willow Bunch, SK. 2009 JD 635D header, factory transport, all updates done, very good condition, $46,000. 780-352-3106, Wetaskiwin, AB. 2011 MACDON D60 draper header, now $81,700. Moosomin, SK. Call 306-435-3301, www.maplefarm.com or call one of our 7 stores near you. 2000 JD 930R header, PU reel, fore/aft, full finger auger, good condition, $10,000. 306-861-1314, Weyburn, SK. 2011 JD 640D, PU reel, fore/aft, poly skid, transport, very low acres, as new, $65,000. 780-847-3792, Marwayne, AB. 2000 HONEYBEE SP30 SC, 30’, pickup reel, transport, fore/aft, $24,000. Call 1-800-219-8867, Swift Current, SK. or www.redheadequipment.ca 1997 ADAPTER TO fit 960 MacDon header, for IHC combines, $2500. 306-246-4251, Mayfair, SK. 1997 MACDON 960, 30’ straight header c/w PU reel and JD adapter, $12,000. Phone 306-648-8005 or 306-648-7595, Gravelbourg, SK. 2006 NH HONEYBEE, 30’ draper header, JD adapter, fore/aft, double knife drive, pea auger, UII pickup reels, poly skid, lifters, factory transport, HoneyBee end strut gauge wheels, either JD 100, 60, or 70 Series hookup, shedded, exc cond., $38,000. 306-224-4606 leave msg., Glenavon, SK. HONEYBEE 25’ DRAPER HEADER, pea auger, 2006, asking $32,000. Call Steve 780-674-8080, Cherhill, AB. JD 230 RIGID STRAIGHT cut header, Batt reels, crop lifters, $4500. 306-799-4410, Briercrest, SK. NEW HEADER TRAILERS: 38’ double beam, w/lights and brakes, 3 axles, $7175; 30’ 4-wheel w/flex bar and lights, $4445; 30’ 2-wheel, flex kit, lights, $3300; 36’ 4-wheel, flex kit, lights, $5250. 204-746-6605, 204-325-2496, Morris, MB.

NEED COMBINE HEADERS? ’94 30’ CIH 1010, $6,980; ‘94 36’ Macdon 960, $4,900; ’95 30’ AGCO 400, $4,980; ’91 JD 30’ 930, $5,950. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com 2- 36’ MACDON 960 straight cut draper headers with IH and NH adaptors. Alvin Miller Farm Equipment Auction, Saturday, August 17, 2013, Stoughton, Sask. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962 JOHN DEERE 224 straight cut header, rigid, $5200. 403-578-3609, Brownfield, AB. 1 9 9 8 H O N E Y B E E D R A P E R h e a d e r, $13,000; 2000 Flex JD header, $12,000. 306-268-2600, 306-268-7436, Viceroy, SK.


CLASSIFIED ADS 47

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

2007 SHELBOURNE STRIPPER header, 32’, w/CIH 2388 adapter, $35,000. Phone 306-672-6605, 306-741-1634, Hazlet, SK. 2010 NH 74C-30’ $33,000. Raymore New Holland, 306-746-2911, Raymore, SK. or www.raymorenewholland.com JD 930 STRAIGHT cut header, UII PU reel, w/transport trailer, good cond., $11,500 OBO. 306-743-7622, Langenburg, SK. JD 925 FLEX header, recently reconditioned by Ed Lorenz, exc. shape, ready to work, asking $17,500. Call 306-782-7749 or 306-621-5136, Yorkton, SK. 1995 HONEYBEE 30’ header, batts, transport, Gleaner R adapter, excellent condition, always shedded. 306-842-6173 or 306-861-5224, Weyburn, SK.

2002 MACDON 962 30’ harvest header and MacDon 871 adapter, to fit following combines: JD 9500, 9600, CTS and 50 series; Case/IH 1404, 1600, 2100 and 2300 series; NH TR and TX series; Agco Gleaner R62 and R72 series; Cat Lexion 450, 460, 465, 470, 480 and 485 series combines; Elmer’s Transport. Low acres, exc. cond., always shedded. Variety of new replacement parts inclcluded. $23,000 OBO. NH 971: 2 headers, 30’ w/Intersteel sunflower pans and drums. Adapted to CX se204-845-2113, Elkhorn, MB. ries NH combines, $10,500/$9,500 OBO. 204-724-0287, Souris, MB.

’10 MacDon 45’ D60 Double knife drive, pea auger, transport, hyd. head tilt, adapters avail. Excellent cond’n. $ 59,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com 2006 CIH 2020 flex platform, 30’, PU reel, poly skids, F/A, Crary air reel, $23,900; 2009 CIH 2020 flex platform, 35’, PU reel, poly skids, F/A, $23,900. Call Gary Reimer, 204-326-7000, Steinbach, MB. reimerfarmequipment.com 2004 MACDON 963, 30’ header, PU reel, new knife and guards, JD adapter, single point hookup, E-Z Trail transport, $20,000. 25’ HoneyBee w/adapter, $5000. Contact 204-636-2448, Erickson, MB.

2011 625D, PU reels, double knife drive, exc. cond., $48,500. 306-939-4554 or, 306-731-7235, Earl Grey, SK. NH 973 25’ FLEX HEADER, PU reel, poly skids, vine lifters, transport, good cond., $8400. 306-753-7576, Macklin, SK. JD 925 FLEX header, field ready, $8500 OBO. Also, 6620 Titan II, $10,000 OBO. 306-846-7521, Dinsmore, SK.

’10 MacDon 40’ D60 W/ transport, new knife, adapter for 8010/CR/CX, others avail. Guards, reel, & canvas are 9/10 cond’n. $53,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

MUST SELL: 1989 MACDON 960, 36’, priced for quick sale at $3500. Also have available CIH or JD combine adapter for above. Dave 306-424-7511 Montmartre SK 2005 CASE/IH 30’ rigid header, PU reel, shedded, low acres, mint cond., $15,000. Call 306-576-2242, Wishart, SK. WHITE HEADERS, 22’ and 24’ w/batt reels, $750 each; White 8650 combine, $500. Call Don at 204-748-1085, Virden, MB.

2007 30’ HONEYBEE 94C, pea auger, fore/aft, NH adaptor, UII reel, one owner, shedded. 306-236-7797 or 306-236-6811, Meadow Lake, SK. CUSTOM BALE HAULING, 17 bale selfloading and unloading truck. Contact 306-280-4840, Delisle, SK. JD 224, always shedded, very good, c/w Batt reel, upgraded drive and Trailtech transport. 306-827-7704, Radisson, SK. JD 930 30’ flex, AutoHeight, var. reel spd., poly, knife and guards in 2012, $7000. Contact Lyle, 306-567-7618, Davidson, SK.

1997 MACDON 960 LL, 36’, PU, pea auger, 2388 adapter, $17,900. 1-866-659-5866, Estevan, SK. or www.redheadequipment.ca GLEANER 30’ HEADER, ultra premium cond., fits up to 2002 combines, $11,900 OBO. 403-585-1910, Rockyford, AB. 1020 FLEX HEAD, 2005, $15,500; 2000 1020 flex head, $9500. Rosetown, SK. 306-882-2423. 1999 SP30 HONEYBEE 30’ header, UII PU reels, Pea cross auger, Case/IH 8010 and 2388 adapter, $17,000. 780-826-3946, Fort Kent, AB.

MAXIMIZE

M CD 9 6 0-9 72......................$550.00 S chu m a cher 30’ L H D .........$599.00 M F 200-220 30’..................$525.00

1½ Mi. W. of Biggar, SK on Hwy. #14

S W ATHER D RIVE ROLLERS NEED PICKUP HEADERS? ’98 CIH 1015, $3,480; ‘91 JD 914 $4,900; ’08 16’ MacDon PW7, $12,800; ’93 14’ Gleaner, $1,850. Trades welcome. 1-800-667-4515. www.combineworld.com

2000 JD 994, 30’ JD 9610, $25,500. Watrous New Holland, 306-946-3301, Wa2- SETS OF 20.8x38 clamp-on duals, used trous, SK. or www.watrousnewholland.com to clamp up to 30.5x32 combine tires, incl. 2007 MACDON 973 36’ w/ hydraulic fore all hardware, good shape, $4000/set. One & aft, auger, transport, 873 adaptor for JD, poorer older set, $1500. Set of Firestone $42,500. Call Dave at 306-424-7511, 800/70R38’s w/10 hole rims, came off JD Montmartre, SK. combine, less than one season use, like new, $7000/set OBO. Chris 306-628-7840, IHC 30’ FLEX header, fore/aft, PU reels, Eatonia, SK. $8000. 306-782-2738, Yorkton, SK. REDEKOP CHOPPER, fits NH9080, 1 year 2001 30’ HONEYBEE, for&aft. UII PU old. Call: 306-862-8233, Nipawin, SK. reel, JD adapter, new canvases, poly skids, flex finger lifters, always shedded; JD 925 NEW ROTO CAGE with doors and helicial 25’ flex header, w/Crary air reel, header bars for N6/N7 Gleaner combine, $6500. mounted fan, poly skids and transport. 780-290-0057, St. Vincent, AB. 306-672-3746, 306-672-7822 Gull Lake SK USED AIR FOIL chaffer for TR96 NH combine, $500; 20’ Hart Carter PU reel, offers. Phone 306-245-3756, Tyvan, SK.

8 8 20 CIH, 8 100 Hes ............$570.00 4000-5000 CIH ....................$210.00 9 72 M CD .............................$434.00 9 6 0 M CD .............................$425.00 7000 M CD, 8 8 5 M F.............$318.00 220-200 M F........................$193.00 5000 Agco ..........................$195.00 4400 V ers ............................$214.00 4700 V ers ............................$297.00 1200 Hes , 8 230 CIH ............$352.40 UIIPU Reel tin e.......................$1.88 Ra k e-u p PU tin es .....................90 ¢

YOUR COMBINES POTENTIAL!!! $ All makes and models $ Outlasts and outperforms all others $ Universal Concave that saves you time and money $ Increase capacity, improve thrashing, and Save Grain

S HIPPING A VA ILA B LE

Dealer Inquiries Welcome

A Division of Rockn L Enterprises Ltd.

Box 1496 | Biggar, SK | SOK OMO 306-948-5335 | 1-800-667-6700

www.howardconcave.com

Ph:306-244-2068

2835B Cleveland Ave. Saskatoon,SK.

w w w .affordableparts.ca

PARTING OUT: 8640 John Deer 4WD tractor. Call 306-696-2920, Broadview, SK. WRECKING COMBINES: IHC 1482, 1460, 915, 914, 715, 503, 403; JD 7701, 7700, 6601, 6600, 106, 105, 95, 630; MF 860, 850, 760, 751, 750, 510, 410, S92; NH TR70, 95, 1400, 995; White 8900, 8800, 8700, 8650, 8600, 7800, 7600; CFE 5542; Gleaner C, F, L, M; CCIL 9600, 960, 951; Versatile 2000. 306-876-4607 Goodeve SK

1995 36’ HONEYBEE header with 2 piece UII PU reel, gauge wheels, Case/IH Series JD 914 PU, 1 owner, shedded, low acres, NEW REM CHAFF SPREADER for JD 8 8 a d ap t e r, s h e d d e d , $ 1 2 , 0 0 0 . C e l l converted to single point hookup, HHS, 9 4 0 0 , 9 5 0 0 , 9 6 0 0 , $ 2 , 5 0 0 O B O . DAS, $14,500. 306-731-3449, Craven, SK. 306-858-7575, Lacadena, SK. 306-424-7511, Montmartre, SK.

’09 30’ MacDon D60-S W/ CNH adapter for 8120/CR9070, other adapters avail. New knife, guards, & reel fingers. Excellent welcome. cond’n. $49,800. Trades 1-800-667-4515. Financing available. www.combineworld.com 2000 36’ HONEYBEE, PU reel, pea auger, 9790 MF adapter, $20,000 OBO. Call 306-831-7734, Zealandia, SK. JOHN DEERE 930 rigid header, batt reel c/w transport, excellent, $8800 OBO. 306-549-7635, 306-549-2389, Hafford, SK. 2000 MACDON 972, pea auger, split reel, Case adapter, crop lifters, new canvas, $27,500. 306-485-8187, Alameda, SK. NH 973 FLEX header, 25’, PU reel, Crary knife and guards, fits TX and TR, vg cond., $7000. 780-753-6584, Hayter, AB. FD70 MACDON, 1 year old, NH adaptor. Call: 306-862-8233, Nipawin, SK. 1996 JD 930 flex header, PU reel, fore/aft. new wobble box, good shape, asking $10,500; 1986 JD 224 flex header, offers. 306-270-8594, Simpson, SK.

2006 MACDON 973, 36’, JD adapter, transport, very good cond., $35,900. Cam-Don Motors Ltd., 306-237-4212, Perdue, SK.

S ICK LE AS S EM B LIES

1998 CASE/IH 1020, flex header, fore/aft, good shape, $11,000 OBO. 306-843-2920, Wilkie, SK.

12’ JD PICKUP, heavy shaft, big wheels, MUST SELL: HONEYBEE 36’ upper cross shedded, $2600. 306-576-2242, Wishart, auger for 36’ header, new, priced to sell at SK. $2450. 306-424-7511, Montmartre, SK. CASE/IH 1015 w/7’ belt IHC PU, $5500; Case/IH 1015 w/12’ Rake-up PU, $6500. 306-353-4560, 306-280-6101, Riverhurst.

M e d icine Ha t Tra ctor Sa l va ge I nc. Specia lizing In N ew, Used & Reb uiltAgricultura l And C onstruction Pa rts Call Today

MF 9024 24’ straight cut header, UII PU reel, good cond., $4500. 306-782-8303 or 306-521-0329, Yorkton, SK. 2008 NH 94C (HoneyBee), 30’ CR/CX/AFX adapter, vg, one owner, $36,900 OBO. 306-563-8482, 306-782-2586, Yorkton, SK

ARGO 400, 25’ header, w/transport, good condition, $4000 OBO. Call 780-554-3572, Camrose, AB.

Pre Harvest Deals

2007 NH 76C pickup header, very little use, always shedded, $15,500. Call Larry 705-728-1610, Minesing, ON.

HOPPERCOVERS: ALL COMBINES, all extensions, for less money. 204-436-2335, Elm Creek, MB. www.hoppercovers.com

1-877-527-7278

KIRBY SPREADER, frame brackets, hydraulic hoses, $500. Call 306-868-2275, Rouleau, SK.

B uying Ag & Construction Equipm ent For D ism antling

COMBINE TIRES: 2- 800-65R32 Goodyear tires and rims to fit STS JD, 9 out of 10 cond., $7000. 306-276-2442, Nipawin, SK.

NEW PICKUPS GUARANTEED AVAILABILITY. Swathmaster 14’, $13,838; 16’, $15,838. Used pickups available. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

www.mhtractor.ca M edicine Ha t, AB .

USED PICKUP REELS - 21’ UII, $3,180; 25’ Macdon, $3,850; 21’ UII, $3,780; 24’ UII, $4,480; 36’ HCC, $5,980; 36’ UII, $5,980; 42’ UII, $7,800. Trades welcome. Call 1-800-667-4515. www.combineworld.com

1981 WHITE 8900 combine, 3 headers; Flax roller, blue, $700 OBO; MF 360, piggyback discers - 3x12. Call 306-882-3759, 306-831-8499, Sovereign, SK.

Harvest Salvage Co. Ltd. 1-866-729-9876 5150 Richmond Ave. East Brandon, MB

www.harvestsalvage.ca New Used & Re-man parts

NEW PICKUP REELS – GUARANTEED AVAILABILITY. Hart Carter 25’,$5,795; 30’, $6,795; 35’, $7,300; 36’, $7,900. UII 25’, $6,830; 30’, $7,900; 36’, $8,900. Plastic teeth, fit JD/NH/CIH/MacDon headers & Swathers. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

Tractors Combines Swathers TRIPLE B WRECKING, wrecking tractors, combines, cults., drills, swathers, mixmills. etc. We buy equipment. 306-246-4260, 306-441-0655, Richard, SK. 1982 CASE 4890 tractor, 8 good tires, n e e d s e n g i n e w o r k , $ 1 2 , 0 0 0 O B O. 306-436-4302, Milestone, SK.

TRADE IN YOUR JD 615, NH 76C OR CIH 2016 for a brand new Macdon PW7 header w/ 16’ Swathmaster pickup, pay as little as $2,000 with trade-in. 1-800-667-4515. www.combineworld.com

HARVEST SERVICE PLASTIC b o t t o m sieve, long shoe, for 1680 combine, $500; 2 West Lake combine tires, 30.5Lx32’s, 12 ply rating, 80% tread, $700/ea. or $1200 for both; Black plastic downspout, NEW RAKE-UP PICKUPS, regular $18,827. for unloading auger for CIH, $200; Harnow only $12,989; Orbit motor kits list at vest Service rotor for CIH, $1500. 548.00, now only $398. FOB Lougheed, 306-734-2728 or 306-734-2228, Craik, SK. AB. 780-888-7659.

2006 MACDON S30 header SC, 30’ swather PU reels, $17,000. Call 1-866-659-5866, Estevan, SK. or www.redheadequipment.ca 2012 HONEYBEE SP36, mint, 750 acres, fore/aft, fact. transport, UII, pea auger, CNH adapter, $53,000. Will take Super B’s 2005 14’ RAKE-UP pickup, $2500. Phone: NEW WOBBLE BOXES for JD, IH, MacDon 780-678-0808, Ferintosh, AB. on trade. 306-641-9123, Rhein, SK. headers. Made in Europe, factory quality. Get it direct from Western Canada’s sole 2008 JD 635 flex w/Crary CWS air reel, 2005 MACDON 973, 40’ w/2006 873 distributor starting at $1,095. 1-800-667adapter, PU reel, fore/aft, tilt, transport, excellent cond. $31,900. 204-324-4277, VARIOUS PICKUPS IN STOCK - ‘93 12’ 4515. www.combineworld.com Altona, MB. $29,500. 306-424-2645, Montmartre, SK. Rake-up, $3,900; ‘81 JD212, $1,980; WANTED: 30’ HONEYBEE adapter for a STEIGER TRACTOR PARTS for sale. Very ‘02 14’ Rake-up, $4,900; ‘96 14’ NH 971 30’ HEADER, PU reel, split sickle, 9610 JD combine. Have to trade or sell new and used parts available, transport, good condition, $8400. Call Int. adapter for a 2388 combine. Call Rake-up, $3,980; ’00 JD 914P Pickup, affordable made in Canada and USA. 1-800-982-1769 $4,800; ’04 16’ Rake-up, $5,800. 306-753-7576, Macklin, SK. 306-939-4509, Earl Grey, SK. Trades welcome. Financing available. PUMPS, PRESSURE WASHERS, Honda/Ko2003 NH 74C-30’ $20,800. Yorkton New TWO HONEYBEE DRAPERS 2009 and 2010 1-800-667-4515. www.combineworld.com shin pumps, 1-1/2” to 4”, Landa pressure Holland, 306-783-8511, Yorkton, SK. l o a d e d , N H a d ap t e r s , $ 4 4 , 0 0 0 a n d washers, steam washers, parts washers. 2006 RAKE-UP 13’ PU header, shedded, www.yorktonnewholland.com $49,000. 403-350-2510, Lacombe, AB. excellent condition. Call 204-851-0745, M&M Equip. Ltd. Parts and Service, Regi2010 MACDON D50 35’ header, MF9000 na, SK., 306-543-8377, fax 306-543-2111. Elkhorn, MB. Series combines, $50,000. 306-831-8696, 2010 JOHN DEERE 640D draper header, n o w $ 7 3 , 3 0 0 . Wy n y a r d , S K . C a l l Rosetown, SK. 306-554-2536, www.maplefarm.com or MACDON 960, 30’, PU reel, TR adapter, call one of our 7 stores near you. For Over 30 Years built in transport, $10,000. 306-762-2176, HONEYBEE 2004 94C 30’ draper, PU reel, 306-537-0651, Odessa, SK. fore & aft, AutoHeight, CX and CR adaptor 1993 CIH 1020 flex platform, 25’, PU $39,500. 306-424-7312, Candiac, SK. reel, poly skids, $5900; 1997 CIH 1020 2010 HONEYBEE SP36, CR/CX/AFX adaptflex platform, 25’, PU reel, poly skids, re- er, very good, one owner, $43,000 OBO. For a Noticeable Improvement in combine performance we conditioned, $11,900; 2000 CIH 1020 flex 306-563-8482, 306-782-2586, Brandon MB platform, 25’, PU reel, poly skids, nice manufacture Feeder Chains, Conventional Concaves, Rotary s h ap e , $ 1 0 , 9 0 0 . C a l l G a r y R e i m e r, 25’ MACDON 960 header with PU reel and Concaves, Air Foil Chaffers, and Plastic Louvered Sieves. 204-326-7000 reimerfarmequipment.com J D a d a p t o r. G o o d u n i t , $ 1 4 , 0 0 0 . 780-512-4256, Grande Prairie, AB. Steinbach, MB. For the Dealer nearest you CASE/IH 1020 FLEX head, 25’, PU reel, 2010 MACDON D60S, 40’ w/transport, skid plates, $8000 OBO. 306-483-5034, adapter for 70 series JD, exc. cond., used SERVICES LTD. Oxbow, SK. one season; 930 JD rigid header w/transport. 306-743-5178, Langenburg, SK. 2007 36’ NH and 40’ NH 94C draper headers. Loaded with AWS air reels. Will 1996 JD 930 flex, full finger auger, Macwww.harvestservicesltd.com separate, $40,000 and $45,000 OBO. Don PU reel, fore/aft, exc. 306-677-2582, 306-677-7337, Hodgeville, SK. 306-753-7913, Macklin, SK.

THE LEADER AND INNOVATOR IN

NEW SALVAGE TRACTORS: IH 5288, 885, 574; Ford 2600, 5000, 7710; MF 65, 35, 3165, S90; DB 1690, 1410, 885; Volvo 810T. County and Nuffield. Unity, SK., 306-228-3011. www.britishtractor.com

COMBINE PARTS

HARVEST 1-800-667-2601

GOODS USED TRACTOR parts (always buying tractors) David or Curtis, Roblin, MB., 204-564-2528, 1-877-564-8734. 750 MASSEY COMBINE and 550 Co-op swather for salvage. Phone 306-795-7692, Ituna, SK. SMITH’S TRACTOR WRECKING. Huge inventory new and used tractor parts. 1-888-676-4847. ALLISON TRANSMISSIONS Service, Sales and Parts. Exchange or custom rebuilds available. Competitive warranty. Spectrum Industrial Automatics Ltd., Blackfalds, AB. 1-877-321-7732.

TOP $$$ PAID for scrap batteries. Call 306-761-1688, Regina, SK. LOEFFELHOLZ TRACTOR AND COMBINE Salvage, Cudworth, SK., 306-256-7107. We sell new, used and remanufactured parts for most farm tractors and combines.

W H Y PAY M O RE?? CALL FYFE & SAVE

BALER BELTIN G

John Deere Model 530 -535 3 ply Diamond top laced with alligator lacing Complete Set - $2269.00 • New Holland Model 660-664-668 3 ply mini rough top laced with alligator lacing Complete Set - $1735.00 Case IH/Hesston model 8460/8560/560/565 3 Ply Chevron w/alligator lacing

Complete Set - $2,235.00 Com plete s ets form os tm akes ...Call forpricing • B u lk B eltin g M os t Sizes • En dles s B elts Too

NET WRAP

CO M BIN E PARTS

Rub Bars, Concaves, Cages, Rotor Cones, Vane Kits, Walkers, Feeder Chains, front drums and sprockets, augers, auger troughs, top chaffers and bottom sieves, (air foil and standard), shoe frames.

PICK UP BELTS & TEETH, DRIVE BELTS • G UARD S & CUTTIN G PARTS • SCH EASYCUT SYSTEM S • SW ATH ER CAN VAS UP TO 42” – $14.49/FT • H O N EY BEE H EAD ER 413⁄4” W /G UID E/EXTRA TH ICK,M ACD O N 411⁄2” W /G UID E • PICK UP REEL FIN G ERS:H ARTCARTER,M ACD O N ,U-2

S a ska to o n 1- 800- 667- 3095 R egin a 1- 800- 667- 9871

M a n ito b a 1- 800- 387- 2 768 Ed m o n to n 1- 800- 2 2 2 - 6594

FYFE P A R TS w w w .fyfepa rts .com


48 CLASSIFIED ADS

T HE REAL USED FARM PART S SUPERST ORE O ver2700 Un its forS a lva g e Tra ctors Com b in e s Sw a th e rs Dis ce rs Ba le rs

WATROUS SALVAGE W a trou s , S a s k . Ca llJo e, Len o rDa rw in 306- 946- 2 2 2 2 Fa x 306- 946- 2 444

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

RICHARDTON HIGH DUMPS: 1200, 700, 770; Miller #1093, $6000; JD 3970 harvester, $8900; NH 890, $2500; IH 781, $2500. Heads available. 1-866-938-8537. TYCROP HYDUMP 16â&#x20AC;&#x2122;, floatation tires, good condition, asking $8000. Call 306-329-4780, 306-371-7382, Asquith, SK. NEW HOLLAND FP240 silage cutter, good gallantsales.com Large inventory of New c o n d i t i o n . P h o n e 7 8 0 - 8 7 7 - 2 3 3 9 o r and Used potato equip. Dealer for Tristeel 780-877-2326. Edberg, AB. Mfg. wash line equip. Dealer for Logan JF 1350-55 HARVESTERS for sale. From Equipment. Call Dave 204-254-8126, MB. dealership dispersal. Phone Al Dunlop at: 780-349-0448, Westlock, AB. 4500 LOCKWOOD HARVESTER w/blower, spider dirt eliminator, all belted chain, excellent condition, $4800; Spudnik piler with remote control, $12,000 OBO; Have many other pieces of potatoe equipment. 306-813-3115, 306-813-7153, Wilkie, SK.

2010 JD 4830 SC, 100â&#x20AC;&#x2122;, 1000 gal. tank, full autoguidance, $245,000. Call 1-800-219-8867, Swift Current, SK. or www.redheadequipment.ca YOUNGâ&#x20AC;&#x2122;S EQUIPMENT INC. For all your silage equipment needs call Kevin or Ron 2012 JD 4730 sprayer, 300 hrs, 100â&#x20AC;&#x2122;, 800 gal. poly, 2 sets of tires, full GPS. Call toll free 1-800-803-8346, Regina, SK. 306-747-7911, Shellbrook, SK. BRAND NEW 2012 NH FR9050, 0 hrs., c/w NH 290 FP 17â&#x20AC;&#x2122; pick up header, full 2008 1074 ROGATOR, 120â&#x20AC;&#x2122; alum. boom, 1525 hrs, one owner, crop dividers, 2 sets warranty. 780-753-0353, Kirriemuir, AB. of tires, Raven flow control, AutoSteer, Au1985 NH 2115 SP silage cutter, 350 HP toFarm GPS, 1080 gal. tank, foam markers, DAF engine, Metal Alert II, AC, just turned v e r y c l e a n u n i t , $ 1 8 9 , 0 0 0 O B O . knives and shear bar 2500 tonnes ago, 204-870-2828, Portage la Prairie, MB. complete new blower 2500 tonnes ago, asking $30,000. Sold cows. 306-961-8094, 1984 4400 VERSATILE SP, CAH, 24â&#x20AC;&#x2122; table, new parts, good cond. Call 306-383-2615, Prince Albert, SK. 306-383-7319, Quill Lake, SK.

Ope n M o n .thru Fri., 8 a .m .-5 p.m . w w w .w a tro u s s a lva ge.co m Em a il: s a lv@ s a s kte l.n e t

PICKETT ONE STEP 8R30 cutter/windrower w/hyd. drive and table shift, $12,000; tractor crop dividers, JD mounting brackets, $1000; IHC 1460 combine converted for dry bean harvesting, no header, $10,000. 306-353-4560, 306-280-6101, Riverhurst, SK. 2012 SCHULTE FX530, 30â&#x20AC;&#x2122; mower, like new condition. Phone: Machinery Dave 403-545-2580, Bow Island, AB.

Combine World 1-800-667-4515, www. combineworld.com; 20 minutes E. of Saskatoon, SK on Highway #16. Used Ag & Industrial equipment, new, used & rebuilt parts, & premium quality tires at unbeatable prices! 1 yr. warranty on all parts. Canadaâ&#x20AC;&#x2122;s largest inventory of late model combines & swathers. Exceptional service.

FLEXI-COIL 100â&#x20AC;&#x2122; suspended boom 1600 gal., windscreens, 18.4 duals, 7 section, loaded, mint. 306-692-4047 Moose Jaw SK

W RECKIN G TRACTO RS , S W ATHERS , BALERS , CO M BIN ES

COMPUTER SPRAYER, 1987, 2200 litre tank, 60â&#x20AC;&#x2122; booms, $2500. 306-745-2737 or 306-745-9096, Esterhazy, SK. FLEXI-COIL #65 80â&#x20AC;&#x2122;, 800 gal., new tires, wind curtains, chem. tank, $4000 OBO. 306-389-4827, 306-441-2097 Maymont SK BOURGAULT 74â&#x20AC;&#x2122; ELIMINATOR 540, chem tank, disc markers, AutoFold, $5000. 306-239-4949, Osler, SK.

(306) 547-2125 PREECEVILLE SALVAGE PREECEVILLE, SASKATCHEWAN

G.S. TRACTOR SALVAGE, JD tractors only. 306-497-3535, Blaine Lake, SK.

GRATTON COULEE

AGRI PARTS LTD. IRMA, AB.

1-888-327-6767 www.gcparts.com

Huge Inventory Of Used, New & Rebuilt Combine & Tractor Parts. Tested And Ready To Ship. We Purchase Late Model Equipment For Parts.

1999 WILMAR 8100, 90â&#x20AC;&#x2122;, 800 gal. SS, crop FP230 SILAGE CHOPPER, premium dividers, AutoSteer, two sets tires, 3200 shape, always shedded, $18,000 OBO. Also hrs, $55,000. 306-256-3555 Cudworth, SK. hydump avail. 780-940-0549, Leduc, AB. 2012 JD HIGH CLEARANCE 4830, two sets NH 900 SILAGE cutter, c/w 600 Crawford of wheels, 140 spraying hours. Call: Jiffy Dump, very good cond., sell as a unit, 306-937-2857, Battleford, SK. $9800. 780-446-5348, Calmar, AB. 2006 WILLMAR 8500, 1000 gal. SS, 100â&#x20AC;&#x2122;, 1900 hrs., 2 sets of tires, $125,000. Silage Tim e is H ere 306-460-7748, Eatonia, SK. SPRA-COUPE 4640 1999, 60â&#x20AC;&#x2122;. Phone Sila ge B a lew ra p startin g at$84 306-864-2200, Kinistino, SK. Sila ge C overs -32 feetto 120 feetw ide,a ny length 1997 WILLMAR 785SE, 90â&#x20AC;&#x2122;, 3300 hrs., new tires, rear duals, AutoSteer, vg cond., Phone:403-994-7 207 $45,000. 780-352-2865, Wetaskiwin, AB. or 7 80-206-4666 2010 SPRA-COUPE 4660, manual trans., with cruise control, 80â&#x20AC;&#x2122; boom, foam markw w w.ca na dia nh a ya ndsila ge.com er, roof lights, 475 hrs., one owner and alNEW KEMPER CORN heads, 4, 6, 8 and 10 ways shedded, asking $82,000. EZ-Steer row. Harry Vissers Farm Equipment, En- and 540 metrics also available. Phone: chant/Lethbridge, AB. 403-327-0349 or 306-921-7516, Melfort, SK. cell: 403-330-9345. 2006 ROGATOR 1064 SC, 120â&#x20AC;&#x2122;, loaded and 10â&#x20AC;&#x2122; SILAGE BAGGER. Versa Custom Pac tow sets of tires, 1000 gal. tank, $105,500. will do 300â&#x20AC;&#x2122; bags, $25,000; Case/IH Call 1-800-667-9761, Saskatoon, SK. or FHX300 silage chopper, $8000; Jiffy 600 www.redheadequipment.ca h i - d u m p , g o o d r o o f , $ 3 0 0 0 . C a l l MILLER A75, 2008, full load, 103â&#x20AC;&#x2122; boom 250-263-3214, Fort St. John, BC. and hypro nozzles, 1000 gal. tank, crop diNH 2115 SP forage harvester, c/w hay viders, AutoSteer, AutoBoom, AccuBoom, pickup and 360 N6 corn header. Has new $150,000 OBO. 780-674-7944 Barrhead AB cylinder knives and tires. Good cond., 2006 APACHE 1010, 1100 hrs., 1000 gal. $25,000. 204-655-3550 or 204-655-3286, tank, 90â&#x20AC;&#x2122; boom, AutoBoom, AutoSteer, Sifton, MB. drop boxes. Contact 204-585-5252 leave message, Sandy Lake, MB. 2000 JOHN DEERE 4700, 2500 hrs., Norac AutoBoom, Reinex swath control, Outback AutoSteer w/STS mapping, 2 sets tires, crop dividers. 306-424-7693, Kendal, SK.

COMB-TRAC SALVAGE. We sell new and used parts for most makes of tractors, combines, balers, mixmills and swathers. Phone 306-997-2209, 1-877-318-2221, Borden, SK. www.comb-tracsalvage.com We buy machinery. AGRA PARTS PLUS, parting older tractors, tillage, seeding, haying, along w/other Ag equipment. 3 miles NW of Battleford, SK. off #16 Hwy. Ph: 306-445-6769. 2006 26â&#x20AC;&#x2122; CANCADE silage box, 60â&#x20AC;? sides plus 2â&#x20AC;&#x2122; extensions c/w silage gate, great condition, used very little. Contact Kevin at 306-435-7313, Moosomin, SK.

S EXS M ITH US ED FARM P ARTS LTD . S EX S M ITH , ALTA. w w w .u sed fa rm pa rts.co m Em ail: fa rm pa rt@ telu spla n et.n et

YOUR ONE STOP FOR NEW , USED & REBUILT AG PARTS. Dis m a n tlin g a ll m a jor m a ke s a n d m ode ls of tra ctors , com b in e s , s w a th e rs , b a le rs a n d fora ge h a rve s te rs .

2003 NH 240 CUTTER, good working condition, and 900 Jiffy high dump wagon. 403-304-4883, 403-773-2477, Elnora, AB. JIFFY 700 HIGH dump silage wagon $5500, OBO. 306-524-4901, Semans, SK. 2008 JF-STOLL 1355 forage harvester, used 4 seasons, less than 500 hrs., with backup parts. New rotor, knives, and shear bar, always shedded, 1 owner, exc. shape, $45,000. 306-668-4218, Vanscoy, SK.

2007 ROGATOR 874, one owner, loaded, 865 gal. SS tank, 90â&#x20AC;&#x2122; Raven Viper Pro, Smartrax, AccuBoom, AutoBoom, Tridekon crop dividers, 1575 eng. hrs, vg cond. $137,500. 780-878-1479, Camrose, AB. MILLER A75, 2008, full load, 103â&#x20AC;&#x2122; conventional and air boom, 1000 gal. tank, crop dividers, AutoSteer, AutoBoom, AccuBoom, 2 sets of tires, ready to go, 3000 hours, $98,000. Phone 306-344-4561, 306-344-7674, Paradise Hill, SK. 2008 CASE INTERNATIONAL SPX4420 high clearance sprayer, 100â&#x20AC;&#x2122;. Hodgins Auctioneers at 1-800-667-2075. PL #915407. TYLER PATRIOT XL, 75â&#x20AC;&#x2122;, 4283 hrs., good shape, $27,000 OBO. Call 306-843-2032, 306-843-2870, 306-843-7839, Wilkie, SK. 1999 ROGATOR 854, 800 gal. SS tank, 80â&#x20AC;&#x2122;, like new narrow tires, NH FM-750 GPS, AutoBoom, $91,500 OBO. Ph. 306-728-9033, Melville, SK.

1995 NH 900 silage cutter, new chains, new top feed roll, good cond., always JD 4830 2009, 100â&#x20AC;&#x2122;, JD AutoSteer, mapshedded. Call 403-742-4867, Stettler, AB. ping, sectional control, 648 hrs. Call Plu s M u ch M o re! 2006 JD 688Z silage corn header, 20â&#x20AC;&#x2122; 8 306-864-2200, Kinistino, SK. row, asking $28,000. Contact Ken at 2008 7660 SPRA-COUPE, 735 hrs, 90â&#x20AC;&#x2122; 306-435-7405, Moosomin, SK. booms, 725 gal. tank, fully loaded, AutoBu yin g Fa rm Equ ipm en t NH 892 SILAGE cutter, with 3 row corn Boom, AutoGlide, SmarTrax AutoSteer, Fo rD ism a n tlin g header #890A. For pictures or more infor- FWA, HID lighting, $128,500 OBO. Vegreville, AB, 780-603-7833, 780-688-2348. DEUTZ TRACTOR SALVAGE: Used parts mation call 306-398-4714, Cut Knife, SK. for Deutz and Agco. Uncle Abes Tractor, HAGIE STS12 2011, 100â&#x20AC;&#x2122;, 1200 gal., 1173 JD 5730 SP forage harvester, field ready. hrs. Call 306-864-2200, Kinistino, SK. 519-338-5769, fax 338-3963, Harriston ON For info call 306-587-2388 or PARTING OUT: 7010 Belarus; Also various 306-741-2006 cell, Cabri, SK. other older tractor models, parts; Also parting out NH haybines and balers. 2006 JF 1350-55 silage cutter, updated to 1355 model, new bigger U-joints, new 306-395-2668, 306-681-7610, Chaplin, SK. rotor, knife and shear bar. Always shedPARTS FOR 4700/ 4750 Vers. swather. ded, one owner, excellent shape, $22,500. New wheel motor, ring gear/hub assembly 403-588-0958, Alix, AB. and bearings for wheel drive, complete planetary assembly, main hydrostatic drive 18â&#x20AC;&#x2122; JIFFY HYDUMP wagon with 3 axles. pump, radiator, lots of misc. parts. Ross- For pictures and more information call 306-398-4714, Cut Knife, SK. burn, MB. 204-859-3277 or 204-859-0015.

1-8 00-340-119 2

MILLER 4365 2010 sprayer, 1200 hrs., 2 sets of tires, crop dividers, Raven viper GPS, autoheight and spray, reversing engine fan, 1600 gal. tank, 365 HP, 120â&#x20AC;&#x2122; 2010 JD 1830 61â&#x20AC;&#x2122;, 12.5â&#x20AC;? space, 5.5â&#x20AC;? packboom, also on board pressure washer, ers, single shoot, primary blockage, Dutch carbide 4â&#x20AC;? paired row boots, AgroMac $250,000. 780-678-0808, Ferintosh, AB. hitch. JD 1910 cart 430 TBT, var. drive on 2009 CIH 4420 SC, 120â&#x20AC;&#x2122;, aim command, 3 tanks, powered calibration system, Pro600, autoguidance, Omnistar, 380 tires, 20.8R42 duals, 12â&#x20AC;? conveyor. Virden, MB., $259,500. 1-800-535-0520, Lloydminster, 204-748-8332. john@galvinfarms.com SK. www.redheadequipment.ca

2010 BOURGAULT 5710, 74â&#x20AC;&#x2122;, 9.8â&#x20AC;? spacing, 3.5 steel packers, Dutch paired row knives, with 6700 air tank, $242,000. Millhouse Farms, 306-398-4079, Cut Knife, SK. DAVIDSON TRUCKING, PULLING air drills/ air seeders, packer bars, Alberta and Sask. 30 years experience. Bob Davidson, Drumheller, AB. 403-823-0746.

2010 NH 70â&#x20AC;&#x2122;, P2070 precision drill, 430 bu. P1060 VR cart, 10â&#x20AC;? spacing, double shoot dry w/liquid fertilizer kit, low acres on openers, dual hi-floatation tires on front, dual fans, tow hitch on cart, extra rollers included, field ready, $149,000. Financing available. Deposit will hold until spring. Call 306-535-7708, Regina, SK. 2008 6012 SEEDMASTER w/Smart Hitch, DS, 2007 4000 Ezee-On air cart w/variable 1999 ROGATOR 854, 100â&#x20AC;&#x2122; boom, 3-way rate, asking $145,000; Also w/wo 2000 nozzles, 5 section shut-off, 800 SS tank, 2250 Ezee-On air cart TBT, SS, 40 bu. aux. new Raven Envizio Pro GPS, 4035 hrs., 2 tank, $25,000. 306-843-7260, Wilkie, SK. sets of tires and rims, 4 crop dividers. Ask2005 SEED HAWK 60-12, 2100 gal. liquid ing $92,000. 780-398-2227, Abee, AB. tank, dual shoot Bourgault air kit, 28Lx26 dual rears, $60,000 OBO. 306-452-7930, 701-756-6433, Redvers, SK. SET OF 4 12.4R/46 High Clearance sprayer tires and rims, $5,000 for set. 306-233-5722, Wakaw, SK. SEEDMASTER 80â&#x20AC;&#x2122;x12â&#x20AC;?, 300 bu. onTRIDEKON CROP SAVER, crop dividers. 2012 tank, w/UltraPro canola meters and Reduce trampling losses by 80% to 90%. frame w/scales, fully loaded, sectional Call Great West Agro, 306-398-8000, Cut cameras, control, run block monitors, packing force Knife, SK. sensors, duals, c/w 2012 Nova cart, 3 HEAVY DUTY EXTENDABLE tow bar for comp. 780 bu. w/scales and duals, field 3640 Spra-Coupe $800. 780-939-3601 or ready, $325,000. Deposit will hold until spring, will seperate; 2013 SEEDMASTER 780-718-3778, Morinville, AB. 88â&#x20AC;&#x2122;x14â&#x20AC;?, 360 bu. on-frame tank, w/UltraSPRAYER TIRES: 4- 23.1-26 Goodyear Pro Canola meters and cameras, w/scales, tires and rims to fit JD 4700 sprayer. Good fully loaded, sectional control, run block cond., $4000. 306-276-2442, Nipawin, SK. monitors, packing force sensors, duals, c/w 2013 Nova XP-cart, 3 comp. 780 bu. w/scales and duals, field ready, $420,000. Deposit will hold until spring, will seperate. Call 306-535-7708, Regina, SK. 2005 CIH 3185 SA, 90â&#x20AC;&#x2122;, aim command, 270 tires, $105,000. Call 1-866-659-5866, Estevan, SK. or www.redheadequipment.ca 2009 MILLER NITRO 4275 120â&#x20AC;&#x2122; booms, new 20.8x38, 1600 gal. SS tank, AutoBoom, 3 way nozzles, boom tilt accumulators, Raven 460 controller, 2300 hrs. Very Clean. $185,000 USD. Call 605-226-0695

HIGHLINE 40â&#x20AC;&#x2122; ROTARY harrow w/coil packers, 1-3/4â&#x20AC;? coils, exc. cond., $10,000. Call Jordan anytime 403-627-9300, Pincher Creek, AB. MACFARLANE HEAVY HARROWS, 60â&#x20AC;&#x2122;, asking $33,500. Call Steve 780-674-8080, Cherhill, AB.

DEGELMAN STRAWMASTER 7000 heavy harrow drawbar, hyd. lift, 70â&#x20AC;&#x2122;, new 5/8x26â&#x20AC;? tines, vg cond, $38,000. Heavy harrow located in Kamsack, SK. 204-526-0321. 70â&#x20AC;&#x2122; HIGHLINE STUBBLE BUSTER heavy harrows, 70â&#x20AC;&#x2122; Flexi-Coil 95 packer bar, Doepker 70â&#x20AC;&#x2122; diamond harrow bar, Doepker 42â&#x20AC;&#x2122; rodweeder. Art Beck Farm Equipment Auction, Sat., August 24, 2013, Yellow Grass, SK. area. For sale bill and photos visit www.mackauctioncompany.com Mack Auction Co. 306-421-2928, 306-487-7815, PL 311962. 2012 DEGELMAN STRAWMASTER 70â&#x20AC;&#x2122; heavy harrow, hyd. tilt and angle, used 2 yrs, $40,000. 306-338-8078, Quill Lake, SK PACKER/HARROW COMBINATION: 40â&#x20AC;&#x2122;, 8â&#x20AC;? spacing, good condition, priced to sell. 306-595-2180, Pelly, SK. SUMMER HEAVY HARROW 60â&#x20AC;&#x2122;, w/3255 Valmar applicator, excellent condition, $22,000, Camrose, AB. 780-679-7839.

41â&#x20AC;&#x2122; CASE/IH 5600 air seeder and Bourgault 2115 air cart plus granular kit, also consigned 41â&#x20AC;&#x2122; Harmon 4480 air drill with Harmon 1830 air cart. Alvin Miller Farm Equipment Auction, Saturday, August 17, 2013, Stoughton, Sask. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962

2008 WISHEK 842NT disc 30â&#x20AC;&#x2122;, 11â&#x20AC;? spacing, 3-bar harrows, 385/65R 22.5 truck tires. 26â&#x20AC;? blades $58,000 USD. 605-226-0695. JD 2410 deep tillage cultivator, 12â&#x20AC;? spacing, 63â&#x20AC;&#x2122;, JD 3-bar harrows, Nichols knockon clips, AccuDepth control. 306-231-8060, Englefeld, SK.

WANTED: CASE 8500 air drill, any spac- 11â&#x20AC;&#x2122; TRCH ROME hinge offset disc, i n g . P r e f e r A B . / S K . , g o o d s h a p e . $13,000; 8â&#x20AC;&#x2122; ROME offset breaking disc, 403-333-0736, Rocky View, AB. $13,000. 204-256-2098, Treherne, MB. 2003 MORRIS MAXIM 11 40â&#x20AC;&#x2122; air drill, www.hirdequipment.com S/N 3902034916, 7180 tank S/N 7189500272, 10â&#x20AC;? spacing, single shoot, 4â&#x20AC;? B ETTER DIS K IN G S TARTS HERE steel press wheels w/mud scrapers, tandem gauge wheels, shank type anhydrous mid-row banders, NH3 kit, semi hopper, 12,000 acres, premium, straight, no welds, $ 4 9 , 9 0 0 . N i p a w i n , S K . To l l f r e e N EW SUM M ERS DISKS 1-877-862-2413, cell 306-862-7761 or H IGH Q U ALITY... N O RID GIN G DROP DECK semi style and pintle 1-877-862-2387, cell 306-862-7524. hitch sprayer trailers. Air ride, tandem CALL: M ACH IN ERYD AVE and tridems. Contact SK: 306-398-8000; 403-545-2580 - BO W IS LAN D , AB AB: 403-350-0336. NEW, NEVER USED aluminum boom tips, 2012 JD 1895, 36â&#x20AC;&#x2122;, 1910 TBH, 430 bu. cart, extends 100â&#x20AC;&#x2122;-120â&#x20AC;&#x2122; for Rogator sprayer, w/fert. kit, asking $187,000. Call Steve Vis it o u r we b s ite a t: $ 1 0 , 0 0 0 O B O. R e g . p r i c e $ 1 5 , 0 0 0 . 780-674-8080, Cherhill, AB. www.s u m m e rs m fg.co m 306-843-7260, Wilkie, SK. 35â&#x20AC;&#x2122; BOURGAULT 8810 air seeder with JD 787 air tank. Art Beck Farm Equip. Auction, Saturday, August 24, 2013, Yellow Grass, SK. area. www.mackauctioncompany.com for sale bill and photos. Mack Auction Co. 306-421-2928, 306-487-7815. PL 311962. QUICK ATTACH PACKERS for a 48â&#x20AC;&#x2122; Bourgault 8800 air seeder, asking $3800. Call 780-754-2180, 780-806-1157, Irma, AB. FLEXI-COIL 600, 48â&#x20AC;&#x2122; deep tillage w/floating hitch, mounted harrows, Flexi-Coil 1600 single shoot air tank, $15,000. 306-736-8336, Kipling, SK. GATES HARROW COULTER hybrid 4 demo, 4-bar harrow, rolling baskets, $56,500. 2009 SEEDHAWK 800, 84â&#x20AC;&#x2122;, sectional con- 8â&#x20AC;&#x2122;, trol, liquid kit w/var. rate control, 12â&#x20AC;? Corner Equip., 204-483-2774, Carroll, MB. spacing, DS, run monitors, new fertilizer 2007 WISHEK DISC, 14â&#x20AC;&#x2122;, 26â&#x20AC;? blades, good WINTER WHEAT, FLEXI-COIL 5000, 57â&#x20AC;&#x2122;, knives, $329,000 OBO. Will consider condition, $23,900. Phone 306-435-8008, Wapella, SK. 9â&#x20AC;? spacing, 4â&#x20AC;? rubber packers, 2320 tank, trades. 306-435-8008, Wapella, SK. $29,900. 204-324-4277, Altona, MB. DEMONSTRATOR 2013 MORRIS Contour II 71â&#x20AC;&#x2122; c/w 8650 TBT mechanical cart. Huge summer discounts. Cam-Don Motors Ltd. 306-237-4212, Perdue, SK. 2000 FLEXI-COIL 7500 â&#x20AC;&#x2DC;Slimâ&#x20AC;&#x2122; 60â&#x20AC;&#x2122; air drill, S/N 7000-096360-00, 10â&#x20AC;? spacing, double shoot, 4â&#x20AC;? steel packers, approx. 20,000 acres, good cond., no tank or openers, $14,900. Located near Saskatoon, SK. Toll free 1-877-862-2413, cell 306-862-7761, 1-877-862-2387, cell 306-862-7524. 2005 NH SD440, 33â&#x20AC;&#x2122; Dutch openers w/SC 230 DS, var. rate cart, exc. cond. $65,000. Call Greg 306-883-2568, Spiritwood, SK.

2012 SEEDMASTER 50-12, c/w smart hitch, lift kit, tire in tire, granular plus NH3 fert. shank. 2001 JD 1900, 340 TBH air cart, $165,000. 306-939-4800 Earl Grey SK 2005 52â&#x20AC;&#x2122; SEED-HAWK, 10â&#x20AC;? spacing, 1000 gallons on board, newer knives and packers, 2009 3315 Ezee-On TBT cart, variable rate, 315 bu., $85,000 OBO. Stockton, MB. 204-526-5017. 2007 NH 58â&#x20AC;&#x2122;, 9â&#x20AC;? spacing, 4.5â&#x20AC;? steel, c/w 430 tank, TBT, mech., exc., $85,000. Swift Current, SK. 306-773-6761, 306-774-5994. 2006 FLEXI-COIL 5000, 33â&#x20AC;&#x2122;, Stealth knives, less than 7000 acres, $45,000; 2011 3850 TBT var. rate cart, 3000 acres, $57,000; 2013 4350 TBT, less than 1000 acres, $67,000; 2013 5000, 51â&#x20AC;&#x2122;, less than 1000 acres, $115,000. 780-385-5704, Viking, AB

$OZD\V0RYLQJ )25:$5'70

<RXÂśOOQHYHUÂżQGDEHWWHUVROXWLRQIRUPDQDJLQJ\RXU VWUDZWKDQD5LWH:D\-XPER+DUURZ0LGUDQJH +DUURZRU0$;,5RWDU\+DUURZ 2XUKDUURZVDGMXVWWR\RXUÂżHOGFRQGLWLRQVDQG FRPHLQWKHULJKWVL]HIRU\RXUIDUPLQJRSHUDWLRQ 7KH\IROGXSQDUURZHUIRUHDVLHUWUDQVSRUWDQGWKH\ DUHHDV\WRIROGDQGXQIROG-XPER-XQLRUDQG0$;, IHDWXUHWKHSDWHQWHG)25:$5'70XQIROGLQJV\VWHP WKDWOHWV\RXXQIROGZKLOHPRYLQJIRUZDUG

WANTED: 5 1/2â&#x20AC;? RUBBER packers for Flexi-Coil 5000, 9â&#x20AC;? spacing. Will trade 4 1/2â&#x20AC;? steel. 403-793-1705, Brooks, AB. BOURGAULT 5710 59â&#x20AC;&#x2122; side band, w/6700 cart, shedded near ND border, $159,000. 306-563-8482, 306-782-2586, Yorkton, SK

ZZZULWHZD\PIJFRP LQIR#ULWHZD\PIJFRP 


CLASSIFIED ADS 49

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

KELLO-BILT DISC PARTS: Blades and bearings. Parts to fit most makes and models. 1-888-500-2646, Red Deer, AB. www.kelloughs.com WANTED: 50’ CULTIVATOR, must be in good shape. Call Jim at 306-862-8518, Choiceland, SK. IN STOCK, NEW Summers heavy harrows, 60’, new Summers harrow packers, 50 and 60’. Harry Vissers Farm Equipment, En- ’12 IH 95” Bucket/Grapple - FEL complete chant/Lethbridge, AB. 403-327-0349 or w/ brackets & quick-attach. Case model L765. cell: 403-330-9345. $9,800. Trades welcome. Financing available. CO-OP IMPLEMENTS 45’ deep tillage, 12” 1-800-667-4515. www.combineworld.com spacing, harrows, $4500. 306-424-2723, 2009 MAGNUM 215, 1600 hrs., 5 hyd. reMontmartre, SK. motes, PTO, shedded, exc. cond. Call KELLO-BILT 8’ to 20’ offset discs w/24” 204-851-0745, Elkhorn, MB. to 36” notched blades; Kello-Bilt 24’ to 38’ 1984 CASE 4994, vg cond., PTO, Autotandem wing discs w/26” and 28” notched Steer, 5000 orig. hrs, asking $33,000. Call blades and oil bath bearings. Red Deer, AB. 306-921-5402, St. Brieux, SK. www.kelloughs.com 1-888-500-2646. 2012 CASE/IH 600, quad-trac, 8 hyds., 36” EXPERIENCED EQUIPMENT: 14’ Kello tracks, PTO, fully loaded, 500 hrs., series 275 offset disc; 12’ Kello series 210 $401,000. 306-398-4079, Cut Knife, SK. offset disc; 12’ Kello series 176 offset disc; 12’ Kello series 155G offset disc. Call CASE/IH 5088, 140 HP, 3 PTH, FEL, cab, A C , v e r y g o o d r u b b e r, $ 1 5 , 0 0 0 . 403-347-2688, Red Deer, AB. 204-871-0925, MacGregor, MB. CIH 8920 MAGNUM, 3 PTH, 540/1000 PTO, 4 WD, 6.9x28 fronts, 18.4R42 rears, plus duals, showing just over 6500 hrs., $45,000. 204-871-0925, MacGregor, MB. CASE/IH STEIGER built, 4 WD/Quads; Plus other makes and models. Call the Tractor Man! Trades welcome. We deliver. SALFORD RTS 570 vertical tillage tool, Gord 403-308-1135, Lethbridge, AB. 2010, 30’, 2400 lbs. added weight, all 13 wave Coulters that measure 16.5/20”, 3 1979 CASE 1270, 6800 hrs. CAH, $7500. tine harrows, rolling baskets upgraded last Call 306-469-2027, Big River, SK. year, new tires. Used 3 seasons, excellent 830 CASE TRACTOR w/loader, starts, runs shape, $39,500. 780-205-3477, Lashburn, well, was used all winter, still using now, SK., nscfarms@yahoo.com perfect for acreage, asking $5000. Call or JD 610 CHISEL PLOW, 41’, good condition, text 306-314-2757, Meath Park, SK. a s k i n g $ 1 2 , 0 0 0 O B O . C a l l L u c a t 1982 CASE 4890 tractor, 8 good tires, 204-744-2208, St. Leon, MB. n e e d s e n g i n e w o r k , $ 1 2 , 0 0 0 O B O. CO-OP 40’ deep tillage, orange, all walk- 306-436-4302, Milestone, SK. ing axles, $3900. Phone 306-287-8062, 1976 IHC 766, 6252 hrs., 1 owner, $7500 Watson, SK. OBO. Call 306-563-8482 or 306-782-2586, Rama, SK. 2003 CASE/IH MX210, 210 HP, 5976 hrs, 18 spd. powershift w/shuttle, MFD, 3 PTH, dual PTO, CAH, 480/80R46 duals, always shedded, $69,500. Call Jordan anytime 403-627-9300, Pincher, Creek, AB. 1993 9280 CASE/IH 4 WD, $60,000. 306-449-2255, A.E. Chicoine Farm Equip. Ltd., Storthoaks, SK. CASE/IH 9130 4 WD tractor. Alvin Miller KELLO-BILT Series 5000 subsoiler, $6000 Farm Equip. Auction, Saturday, August 17, OBO. Call 306-533-2567, Tisdale, SK. 2013, Stoughton, Sask. area. Visit 1980 KELLO-BILT 28’ Series 210 tandem www.mackauctioncompany.com for sale disc, new front discs 4 yrs. ago, does not b i l l a n d p h o t o s . 3 0 6 - 4 2 1 - 2 9 2 8 o r have hydraulic fold, 2 -14’ sections. Asking 306-487-7815 Mack Auction Co. PL311962 $20,000. 306-961-8094, Prince Albert, SK. 2001 STX 375, 3400 hrs., 5 hyd., big hydraulic pump 55 GPM, excellent tractor, $130,000. 306-640-8003, Willowbunch, SK 2006 STX 530 Quadtrac, 30” tracks, Cummins QSX-15, 4 hyd., scraper and Ag hitchBOURGAULT MOUNTED HARROWS, es, deluxe cab, 16 spd, powershift, 4.5’, 4-bar HD, quantity 7, new never used, $192,500 USD.605-226-0695 Aberdeen SD $350 ea. 306-424-7511, Montmartre, SK. 1995 MAGNUM 7240, MFWD, 18 spd., 4 COMPLETE SHANK ASSEMBLIES: JD 1610, hy d . , 6 3 0 0 h r s . , 4 n ew t i r e s . C a l l $135; JD 610, black, $180; JD 1600, $90; 403-558-2038, Longview, AB. Morris 7-series, $135. 306-946-7923, CASE 1470 4WD tractor w/Leon 12’ dozer. 306-946-4923, Young, SK. Art Beck Farm Equip. Auction, Saturday, WANTED: 50’ plus Noble or Victory blade. August 24, 2013, Yellow Grass, Sask. area. Phone Ross at 306-741-2842, Glen Bain, Visit www.mackauctioncompany.com for SK. sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962

FENDT 820 2009, 877 hours. Call for details 306-864-2200, Kinistino, SK. 2004 AGCO RT100, CVT, MFWD, cab suspension, 4 spool hyds. w/joystick, c/w Alo 970 loader, 670 hrs., $69,995. Leduc County, AB. 780-955-2364, 780-554-4736. 2001 FENDT 712, FWA tractor w/Alo loader, 5220 hours, 4 remotes, new battery, $59,000. Call 306-864-7917, Kinistino, SK.

WRECKING FOR PARTS: CASE/IH 3394 FWA, vg running eng., exc. sheet metal; 2290 Case, vg engine, vg powershift; 1070 Case, vg engine, exc. sheet metal. Call 1-877-564-8734, Roblin, MB. CASE/IH 4240, 104 HP, 2200 hrs., 3PTH, LPTO, big hyd. pump, heavy duty 15’ steel flail mower, plus front hyd. PTO pump, $15,000. 204-871-0925, MacGregor, MB. CASE 4690, one owner, good shape, 1000 PTO, $15,000. 306-697-7463, Grenfell, SK. LIZARD CREEK REPAIR and Tractor. We buy 90 and 94 Series Case 2 WD, FWA tractors for parts and rebuilding. Also have r e b u i l t t r a c t o r s a n d p a r t s fo r s a l e . 306-784-7841, Herbert, SK.

1991 DEUTZ ALLIS 9130, 2WD, 5500 hrs., original owner, 20.8x38 singles, $19,900. Call Cam-Don Motors Ltd., 306-237-4212, 2005 CHALLENGER 670 SP combine. Call Perdue, SK. Hodgins Auctioneers, 1-800-667-2075. PL#915407. CHALLENGER 945C 2012, 800 duals, de2-105 WHITE, COMPLETE new engine in- luxe cab. Call for details 306-864-2200, Kiframe 10 hrs. ago, rear tires approx. 80%, nistino SK. LPTO, high-low shift, nice tractor, $9000. CAT 35, 3310 hrs, 16 spd. powershift, 4 204-871-0925, MacGregor, MB. hyds, PTO, 3 PTH, tracks replaced, exc. tractor, grain cart ready. 306-457-2935 eves., Stoughton, SK. 1982 IHC 5088, 8979 hrs., triple hyds., Leon 707 FEL, $17,500. 204-525-4521, www.waltersequipment.com Minitonas MB 1966 JD 4020, powershift w/158 loader and bucket, 3 spool hydraulic valve for loader, 12V system, near new Goodyear rear tires, 5010 front axle and tires. Loader a n d b u c ke t a r e b o t h ve r y s t r a i g h t , $10,500. 306-276-2442, Nipawin, SK. JD 7810 MFD, quad with LHR, loaded, 3 PTH, 740 loader, exc. cond. Financing available. 780-990-8412, Edmonton, AB. 1995 JOHN DEERE 8770, 300 HP, approx. 7000 hrs, full AutoSteer w/mapping, 24 spd, diff. locks, 4 SCVs, 650/65R38 duals, 2006 STX280, 16 SPD. POWERSHIFT, 14’ Degelman 6 way dozer blade. Excellent PTO, diff. locks, 900R50 big single tires, shape, $69,500. Call Jordan anytime 1 6 3 2 h r s , a s k i n g $ 1 3 0 , 0 0 0 . C a l l 403-627-9300, Pincher Creek, AB. 403-755-6374, 780-385-0260, Alliance, AB JD 4440 1982, with loader 11,758 hours. 1976 CASE 1070, 3600 hrs., refurbished Call 306-864-2200, Kinistino SK. and field ready, $9500 OBO. Located in Ab2010 JOHN DEERE 9630T, 1548 hrs, 36” bey, SK. Call Gary 306-751-4987. tracks, powershift, 5 SCVs, extended warSET OF 4 20.8x42 tires with Case/IH rims. r a n t y, $ 2 5 9 , 9 0 0 . 6 0 5 - 4 8 0 - 1 7 5 0 , o r Rims like new with older tires, $3000. 605-270-4841. 204-539-2066, Swan River, MB. 2002 JD 9220, 4 WD, 24 spd, deluxe cab, 4 4690 CASE/IH, runs well, updated trans, hyds., 20.8x42 duals, 2369 hrs., exc. cond., good grain cart tractor, good condition. $129,900. 306-272-7300, Foam Lake, SK. 780-744-2213, 780-808-6569, Islay, AB. JD 4250, 2 WD, 1984, 8000 hrs., power1993 STEIGER 9270, 3400 orig. hrs., new shift, duals available, 2 hyd. w/split to rubber, standard, Case Up-time, mint three, shedded, exc. cond. 306-742-4624 shape. Call 306-744-8113, Saltcoats, SK. home, or 306-742-7795 cell, MacNutt, SK.

LOOKING FOR: JD 30, 40, 50 series tractor in good cond. with mechanical issues. 306-621-7170, Yorkton, SK. 2007 JOHN DEERE 9520T track tractor. Call Hodgins Auctioneers, 1-800-667-2075 PL #915407. 1996 JD 7800, 2 WD, 3478 hrs., one owner, shedded, $53,000 OBO. Trades? Call 306-563-8482, 306-782-2586, Yorkton, SK 1966 JD 4020, powershift, 540/1000 PTO, tires good, cab, 7700 hrs. Call 306-736-3022, Glenavon, SK.

JD 4230 w/148 loader, 8000 hrs, new crankshaft, top shaft in trans, new clutch, quad trans; JD 4430 w/007 loader, lots of work done, field ready; Dunray 6500 AC 110 volt and AC 220, used once or twice. 204-274-2789 or 204-249-7193, Westbourne, MB. 1998 7810, 2 WD, PQ, 3 PTH, 3 remotes, factory duals, 150 HP, shedded, exc., $45,000 OBO. 204-740-0851 Cromer, MB. 1985 JOHN DEERE 4450 MFWD, $30,000: Also, JD 740 FEL available. 306-736-8190, Kipling, SK. 7810, VERY CLEAN CONDITION, 2002, 1980 4440 QUAD, 3 point hitch, 8000 4213 hrs, 3 PTH, TLS, 20 spd. powerquad, hours, good rubber, sharp, Greenlighted, 3 spools, 2 spd. PTO, 710x70R38 85%, 306-744-8113, Saltcoats, SK. 600x65R28 30%. 306-457-8044, Kisbey SK 2010 JOHN DEERE 9630T track tractor. 2012 JD 9410R 4 WD, powershift, 330 Call Hodgins Auctioneers, 1-800-667-2075 hrs., 7” color display, premium cab, prem. HID lites, 710/70R42’s, weight pkg, powPL #915407. ertrain warranty until April 2015, $230,000 JD 8400 1996, 225 HP, 4 hydraulics USD. 320-848-2496, 320-894-6560, Fair710-38 duals, 16 spd. powershift, 840 fax, MN. www.ms-diversified.com loader, grapple, joystick, 9300 hrs., 2012 JD 7330 MFWD, w/JD H360 loader $75,000. 306-264-3834, Kincaid, SK. /grapple, 970 hrs, 3 PTH. 306-322-7672, 1976 4430 QUAD, 3 PTH, 7100 orig. hrs., 306-322-2227, Rose Valley, SK. good rubber, sharp. 306-744-8113, YorkJD 8330 FWA tractor w/1220 hours and ton, SK. Green Star ready plus JD 7810 2WD trac1992 JD 4455 MFWD, 265 loader, joystick, tor with JD 725 FEL and Outback GPS. Art powershift, 3 hyds., shedded, excellent Beck Farm Equipment Auction, Saturday, r u b b e r. G o l d e n P r a i r i e , S K . c a l l August 24, 2013, Yellow Grass, Sask. area. 306-662-3404 or 403-504-1095. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or STEVE’S TRACTOR REBUILDER looking 306-487-7815 Mack Auction Co. PL311962 for JD tractors to rebuild, Series 20s, 30s, 40s or 50s, or for parts. Will pay top dollar. JD 4450, low hrs; JD 4050, 4030, 4640, Now selling JD parts. 204-466-2927, 4440, 4240 w/rebuilt engines; 740, 640, 280, 158 and 148 loaders. Taking JD trac204-871-5170, Austin, MB. tors on trade that need work. Phone MITCH’S TRACTOR SALES LTD. For 204-466-2927, 204-871-5170, Austin, MB. Sale: JD 2750, MFWD, 3 PTH, 245 FEL, painted; JD 2950, MFWD, 3 PTH, painted, 1996 JD 7800, FWA, 740 loader w/grapw/265 FEL; JD 3140, MFWD, 3 PTH, ple, exc. rubber, low hrs. 403-504-9607, w/260 FEL, painted; JD 3155, MFWD, 3 Medicine Hat, AB. PTH, painted, new int.; JD 4020, Synchro, w/168 FEL, grapple; JD 4240, Quad, 5800 JD 6030, new 18.4x38 duals, motor overhrs., 3 PTH, mint; JD 4250, 2 WD, 15 spd., hauled, w/Leon dozer to fit w/stone hook, 3 PTH, 2 hyd.; JD 4450, MFWD, 3 PTH, 15 will sell separately; 50’ DS Case/IH swathspd., powershift, 2 hyd.; JD 4640, 2 WD, 3 er and 50’ for parts; Also, hyd. drive for a PTH, 3 hyd., quad shift; JD 567 baler, 54 Rock-O-Matic, offers; 100’ Bourgault monitor, Mega wide PU, Mega tooth, 1000 sprayer w/1600 gal. tank. 306-460-9027, PTO, netwrap, bale kicker; Case 575 ma- 306-463-3480, Flaxcombe, SK. nure spreader, double beater, double 1965 JOHN DEERE 4020, cab, vg back chain. All tractors can be sold with new or tires, $4000 OBO. Phone 306-792-2152, used loaders. Phone 204-750-2459, St. Springside, SK. Claude, MB. Mitchstractorsales.com JD 70 DIESEL with loader, PS, all original, 1998 JD 8300 FWA, 3700 hrs., 16 spd. always covered, runs excellent, $4900. Ph. powershift, duals all around, diff. locks, 780-307-8571, Westlock, AB. large PTO, c/w 12’ Degelman 4-way blade with two 1’ ext., great cart tractor, very WANTING: LOADER BRACKETS to fit Alclean. Asking $100,000. Can email pics. l i e d 5 9 5 l o a d e r f o r J D 4 0 1 0 . 306-744-2595, Saltcoats, SK. 306-847-2048, 306-946-7668, Liberty, SK JOHN DEERE 7430 premium MFWD, IVT JD 4240, 16 spd. quad trans., 7000 hrs., 3 w/LH shift, 741 loader, 3 PTH, HID light- PTH. Also 789 Butler loader, good cond. ing, 420/85R28 front, 480/80R42 rear, $25,000. Call 403-505-7129, Olds, AB. fenders, sunroof, loaded, stored inside, 1979 JD 4640, 8965 hrs, 20.8x38 duals, like new condition. One owner/trades con- exc. cond. 306-283-4747, Langham, SK. sidered, $129,500. Calgary, AB. 7930 2009, 50 kms/hr, IVT, 3258 hrs, TLS, 3 PTH, 2 spd. PTO, 4 remotes, active seat, buddy seat, trailer air brakes, 600x70R30 20%, 650x85R38 50%. 306-457-8044, Kisbey, SK. 2004 JOHN DEERE 9520, 5547 hours, 800/70R38 duals, powershift, 4 SCVs, $99,900. 605-480-1750, or 605-270-4841. 2008 JD 9530 4WD, 1397 hrs, 800/ 70R38’s, weight package, 4 remotes, AutoTrac ready, active seat $189,500 USD. 320-848-2496, 320-894-6560, Fairfax, MN. www.ms-diversified.com

2012 JD 7280R, 50 km, IVT, axle susp., front hitch and PTO, 746 hrs, like new, 280 engine HP, air brakes, electronic joystick, mid-mounts, Active Command steering, cab susp., 710/70R42 Michelin rears, $169,000. Low cost freight available. Call 226-750-3310 or email agriquip@cyg.net Milverton, ON. 1982 JD 4640, 6000 HRS., always shedded, 8 speed powershift, 20.8x38 duals, 3 Pioneer spools, $30,000 firm. Phone 780-888-1236, Hardisty, AB. JD 7810 MFWD; JD 7710 MFWD. Low hours, can be equipped with loaders; JD 8110 MFWD, low hours. 204-522-6333, Melita, MB. JD 8440, 20.8x38 singles, PTO, 8400 hrs., $18,900 or with Degelman blade, $23,900. Call 306-222-2115, Allan, SK. 1976 4630 w/QUAD range, diff lock, 3 hyd. outlets, 1000 PTO, rear wheel wgts, 20.8x38 duals, 7990 hrs, shedded. Unity, SK. 306-228-2554 cell: 306-228-8104. JD 8770, 300 HP, 5700 hrs. 4 SCVs, 24 spd. shedded, $65,000; JD 4020 c/w 158 loader, 306-344-4568, St. Walberg, SK. 1988 JD 8870, 4WD, 12 spd., 20.8x42 duals, S2 Outback GPS and AutoSteer, $89,000 OBO. 306-753-7913, Macklin, SK. 1980 JD 4640, 2056 original hrs., shedded, $39,900 OBO. Call 306-563-8482, 306-782-2586, Rama, SK. WANTED: JD 5020 named LAZY NELLIE. Former owner would like to hear from present owner. 204-734-8071, Swan River 1990 JOHN DEERE 4555, 4700 hrs., 28.8x38 duals, 3 remotes, excellent condition. 306-424-7693, Kendal, SK. 1981 JOHN DEERE 4640, 160 HP, 16 spd. quad trans, 3 SCVs, 1000 PTO, 20.8R38 duals, completely rebuilt engine, excellent condition, $22,900. Call Jordan anytime 403-627-9300, Pincher Creek, AB. 1990 JD 4455, 3785 hrs, MFD, complete service of all fluids and filters. 2 hydraulics, quad shift, excellent condition, $59,500. 306-728-4340, Yorkton, SK.

WANTED: ARTICULATING WHEELED loader, Swinger/Kubota R520/R420, running units/parts. Call Brad at: 306-960-1532, Prince Albert, SK. GRATTON COULEE AGRI PARTS LTD. Your #1 place to purchase late model combine and tractor parts. Used, new and rebuilt. www.gcparts.com Toll free 888-327-6767. 2 0 0 6 M C C O R M I C K X T X 1 8 5 , F WA , w/Quickie loader, 185 HP, 6200 hrs. 306-462-4832, 306-577-7164, Kisbey, SK. SUPER 570 CCIL Co-op tractor, 1960’s, 3300 orig. hrs, Hercules diesel, vg, shedded; 1850 Cockshutt, 4400 orig. hrs., vg, shedded. 306-372-7715, Luseland, SK.

1998 CAT IT28G loader, quick attach tool changer, 20,620 hours, new Reman fuel pump, all new brakes, mint cond, $55,000. 204-981-3636, 204-864-2391, Cartier, MB. USED LEON 650 land scraper, 2011, 6.5 cu. yd. bowl capacity, 5500 lbs., 100-150 HP, asking $20,500. Call 1-800-352-6264, Flaman Sales, Nisku, AB.

Tractors From 24.5 HP up to 90 HP with loaders and backhoes

2007 CONSERVA PAK 5112 56’ air drill, 440 tank, $150,000; 1993 JD 9600 combine, 914 PU, $68,000; JD 930D straight cut header, $35,000; 2006 JD 4995 SP swather w/30’ HoneyBee header and JD 5 meter discbine, $110,000; 1997 JD 9400 4 Year 4 WD tractor, GS3 and 2630 screen, Warranty DK90 $128,000; 1997 JD 7810 FWA tractor, 740 loader and SI grapple, $60,000; 1999 JD 7410 FWA tractor, 740 loader, silage grapPh: Don - 780-672-4596 Camrose, AB ple, brand new rubber, $58,000; 2005 JD 567 round baler, netwrap, $22,000; Renn Ph: Pat 780-878-1126 Wetaskiwin, AB 36” rollermill, $3000; Crown hyd. 3 batt www.raystrailersandtractors.com rockpicker, $3750; 1997 Freightliner semi, $24,000; 2012 Wilson tridem trailer, $55,000; 2001 IHC 9200 semi, $24,000; Leon 16’ 4-way blade, $15,000. Lougheed, AB., call 780-386-2220, 780-888-1278. LIKE NEW 6-WAY 14’ Degelman dozer ESTATE SALE: 2010 CIH 2152 header, 35’, blade. 306-741-7012, Swift Current, SK. $49,000; 2003 Flexi-Coil air drill, 51’, 3450, $49,000; 2008 Haybuster tub grinder, $48,000; 2005 Wheatheart 8/46 auger/mover, $8900; 2002 Brandt 10/70 auger, $5500; MacDon 25’ PT swather, $4500; AC scraper, $18,000; Lucknow 375 mixer wagon, $9500; Trail King 42’ hyd. equip. trailer, $12,000; 5000 gal. tri-axle water trailer w/chem. handler, $5800. Contact 306-563-8482, 306-782-2586, Maple Creek, SK.

Ray’s Trailer Sales

FIAT ALLIS FD 12B wheel loader, 3 yd. bucket, rebuilt trans 2 yrs. ago, no leaks, quick attach, c/w a set of forks, vg working condition, can deliver. $39,000. 204-743-2324, Cypress River, MB.

ODESSA ROCKPICKER SALES: New Degelman equipment, land rollers, Strawmaster, rockpickers, rock rakes, dozer blades. Phone 306-957-4403, cell 306-536-5097, Odessa, SK. DON’T GET STUCK without a Tow Rope! Best selection of tow ropes and straps in C a n a d a . F o r t r a c t o r s u p t o 6 0 0 H P. 1-888-435-2626. www.flaman.com RETIRED: 1980 CASE 4490 tractor,18.4x34 duals; 1979 JD 7720 combine, hydro., 212 PU, reverser, chopper, chaff spreader; Case/IH 725 PTO swather. 306-332-4838 or 306-332-8802, Fort Qu’Appelle, SK. PALMIER SWATH FLUFFER/HAY inverter, $3000 OBO; double hitch for JD 750 no-till drills. 306-325-4340, Lintlaw, SK. 1982 JOHN DEERE 4640 w/Ezee-On FEL, 8’ bucket and grapple, clamp on duals, 9500 hrs., $23,000; JD 530 baler, good, $4,000; Massey 1560 baler, $1000 OBO; 1974 IHC Loadstar 1600 w/BH&T and bale deck, $3,000. 306-861-2152, Oungre, SK. 500 VERSATILE TRACTOR, 4500 approx. hrs., PTO, nice tractor; Three cultivators; JD swather; Swath roller. 306-478-2798, Mankota, SK. 1981 IHC 986 tractor, one owner, 7500 hrs., 10’ bulldozer blade, $11,000; 6’ swath roller, $300; 10’ IHC cultivator w/4’ extensions, $500; 357 mixmill w/bale feeder, $2000. Call 306-225-4546, Hague, SK.

LOADERS: TWO 2004 JD544J; JD 310G backhoe for rent or sale. Conquest Equipment, 306-483-2500, Oxbow, SK. 710 CASE/IH FEL, grapple, 7220 mounts, electric over hydraulic joystick. Call 306-662-3712, Maple Creek, SK. 1998 CAT IT38 wheel loader. Call Hodgins Auctioneers, 1-800-667-2075. PL#915407 DEGELMAN 14’ DOZER, hyd. angle, 2’ siRENTAL RETURN: 2012 MF 2680, 85HP lage extension, mounts for JD 4WD. Call PTO, FWA, loader, joystick, 3PTH, 100 hrs., 306-873-5483, 306-873-7738, Tisdale, SK. warranty, 3.99% for 72 months N/C OAC. DEGELMAN 9’ DOZER c/w 1’ extension, Cam-Don Motors 306-237-4212 Perdue SK new hydraulic cylinders, $1900; Leon 9’ WANTED: Massey 4840 tractor, with pow- blade, needs repair, $600; Leon 7’ blade, ershift and PTO, must be in good working $600. Call 306-287-8062, Watson, SK. cond. Chris 306-628-7840, Eatonia, SK. WANTED: DOZER to fit FWA tractor. Call 306-287-8062, Watson, SK. ALLIED 595 LOADER with mounts to fit 2006 TJ280, PTO, new 480/80Rx42’s, PS, White 2-85, w/6’ bucket, $4250 OBO. HID lights, front/rear weights, 4 hyd’s, 306-762-2176, 306-537-0651, Odessa, SK. shedded, exc. cond., 5000 hrs., great for 1980 JD 350C crawler loader c/w backgrain cart. 780-385-0091, Sedgewick, AB. hoe, recent chains and sprockets and 2007 NH T6070 w/3 PTH, 20.8x38 tires, m a ny o t h e r r e p a i r s , $ 1 2 , 5 0 0 O B O. 840TL loader and grapple, powershift, LH 403-896-7373, Huxley, AB. forward/reverse, 2350 hrs, one owner DOZERS: Reduced Price! 2005 and 2007 (grain farmer). $75,000. 306-939-4554, Cat D6N LGP’s for sale. Rentals too. Con- 4’ COMPACT SCRAPER. 204-955-6070, 306-731-7235, Earl Grey, SK. Rosenort, MB. www.gaenterprises.ca quest Equipment 306-483-2500 Oxbow SK NH T9050 2008, 800 duals, AutoSteer, diff lock, tow cable, touc h s cre en. Call 306-864-2200, Kinistino, SK. 2012 NH 9615, 800 metric duals, factory AutoSteer, HD axles, HID lites, 680 hrs., warranty- Nov./14, like new, $255,000 negotiable. Jim 403-575-0069 Coronation AB ® 2008 NH T6020, 715, hrs., with 830TL loader, sunroof, diff. lock, mint cond., $57,000. 204-648-7129, Grandview, MB. 2006 TJ380, 710/42 duals, powershift, Au t o S t e e r, r e a r we i g h t s , 1 9 0 0 h r s , $147,500. 306-297-2593, Shaunavon, SK. 2002 TM150, FWA loader and grapple, shuttle shift, 3590 hrs., full shop service, $57,000 OBO. 306-831-9600, D’Arcy, SK.

NEW MOWERS at USED PRICES batwing

2007 JD 5325 tractor, cab, MFWD, JD 542 loader, 2900 hrs, looks like new, $42,900. Steinbach, MB.

8N FORD TRACTOR, NEW back tires, FEL, 3 PTH, includes cultivator, blade, mower, plow, asking $6000. Good for acreages. 306-747-2775, Shellbrook, SK.

2012 VERSATILE 190, FWA, 16.9R28 fronts, 20.8R42 duals, rear weights, 3 PTH, with 3895 loader, bucket, large bale grapple, Hydrafast, cushion ride, bale tines, pallet forks F/R 6 manual ranges, 4 powershift/ range, 24F/24R, shuttle shift, 560 hrs. 306-834-7579, Major, SK. 1976 SERIES II Versatile 800 4 WD, 14.0L Cummins, 6047 hrs. Great tractor, never a problem, $17,000. 403-578-3609, Brownfield, AB. VERSATILE 256 BI-DIRECTIONAL tractor with FEL and grapple fork. Alvin Miller Farm Equip. Auction, Saturday, August 17, 2013, Stoughton, Sask. area. Visit www.mackauctioncompany.com for sale bill and photos. 306-421-2928 or 306-487-7815 Mack Auction Co. PL311962 1990 BLUE FORD Versatile 876, 5280 hrs., 20.8x38 duals, $42,000. 780-905-2979, Westlock, AB 1983 VERSATILE 835, 5770 hours, one owner, excellent condition, $28,900. Call 306-563-8482, 306-782-2586, Rama, SK.

WOODSBATWINGS WOODS BW180

15ft, 6 Foam filled Tires.

$14,500 WOODS BW1800 15ft, 8 Foam filled Tires, Tandem Walking Axles.

$19,900 woodsequipment.com

306-442-7646 or 306-897-8971


50 CLASSIFIED ADS

1980 CASE 4490 tractor, completely rebuilt, $16,000; 1980 Case 4690 tractor w/12â&#x20AC;&#x2122; blade, completely rebuilt, $20,000; 70â&#x20AC;&#x2122; Flexi-Coil harrows and packers, $7000; 2 IH press drills, 56â&#x20AC;&#x2122; each, new bearings, $2500/ea.; 3 IHC 1978 discers, $800; 4 CCIL 12â&#x20AC;&#x2122; discers w/hitches, $6000; FlexiCoil air seeder, 52â&#x20AC;&#x2122;, $15,000; 2004 Agco stripper header, 25â&#x20AC;&#x2122;, like new, $15,000;, 50â&#x20AC;&#x2122; Brandt PTO and electric mover, 8â&#x20AC;?, $2200; 36â&#x20AC;&#x2122; swather, new canvases, $1800; 2 fiber glass 2000 gal. water tanks, $800/ea.; 9 ton fertilizer bin, never used, hopper bottom, $4500; M&W rotary hoe, 40â&#x20AC;&#x2122;, $5000; Terragator fertilizer spreader, $15,000. 306-693-2660, Moose Jaw, SK.

 

  ) ) ('!)#'# *()'( * !&) '# *) )*

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

PIPE FOR SALE, 2-7/8â&#x20AC;? and 3-1/2â&#x20AC;?. Call Lloyd at 306-463-8044, Kindersley, SK.

SPEEDRITE/PATRIOT ELEC. FENCERS and accessories. Lamb Acres, Bulyea, SK. 306-725-4820, www.lambacres.ca

2-3/8â&#x20AC;? OILFIELD TUBING, has cement and plastic lining, $20/ea; 3/4â&#x20AC;? sucker rods, $6/ea. Truckload quantities only. Call 306-861-1280, Weyburn, SK.

FLEXI-COIL PTO POST pounder, high hitter extension, one owner, exc. cond., $4500. Call 306-747-2363, Shellbrook, SK.

SURPLUS STEEL ALWAYS stored inside, 8â&#x20AC;?x8â&#x20AC;?x1/4â&#x20AC;?x48â&#x20AC;&#x2122;, 1,152â&#x20AC;&#x2122;; 8â&#x20AC;?x8â&#x20AC;?x1/4â&#x20AC;?x40â&#x20AC;&#x2122;, 320â&#x20AC;&#x2122;; 8â&#x20AC;?x8â&#x20AC;?x1/2â&#x20AC;?x40â&#x20AC;&#x2122;, 200â&#x20AC;&#x2122;; 3â&#x20AC;?x6â&#x20AC;?x3/8â&#x20AC;?, 3,216â&#x20AC;&#x2122;; 8â&#x20AC;?x4â&#x20AC;?x1/2â&#x20AC;?, 2,880â&#x20AC;&#x2122;. All steel p r i c e d a t 0 . 6 8 / l b . C a l l M i ke a t GUARANTEED PRESSURE TREATED fence DIECI 621 2006 Telehandler, 21â&#x20AC;&#x2122; reach, 204-829-3092 day, or 204-362-5233 even6000 lb., 1100 hrs., $33,500. Corner ings, or email: mike@mandakoagri.com posts, lumber slabs and rails. Call Lehner Plum Coulee, MB. Wo o d P r e s e r ve r s L t d . , a s k fo r R o n Equip., Dwight, 204-483-2774, Carroll, MB. 306-763-4232, Prince Albert, SK. VIBRATING POST DRIVER, skidsteer mounted, ideal for driving drill stem. Up to 16â&#x20AC;&#x2122;. Asking $9500. 306-266-0011, Wood Mountain, SK.

MULCHING - TREES, BRUSH, Stumps. Call today 306-933-2950. Visit us at: www.maverickconstruction.ca

IRRIGATION TURBINE WATER pumps, 6â&#x20AC;?-8â&#x20AC;?, 4 cyl. dsl, 600-1000 gal/min, very efficient; HYD. PIPE SPINNER for oil/water pipe. 403-878-6302, Grassy Lake, AB.

CUSTOM FENCING AND corral building, no job too big or too small. Call 306-699-7450, Quâ&#x20AC;&#x2122;Appelle, SK. 5x10 PORTABLE CORRAL PANELS new design. 403-226-1722, 1-866-517-8335, Calgary, AB. magnatesteel.com CUSTOM FENCING. Will travel. Call for pricing and booking. 306-221-8806. WILL DO FENCE repairs, tear downs, barbwire and corrals. Reasonable rates. Will travel. 306-344-7067, Onion Lake, SK.

*($%*'$)# $*

NEW AND USED generators, all sizes from 5 kw to 3000 kw, gas, LPG or diesel. Phone for availability and prices. Many used in stock. 204-643-5441, Fraserwood, MB.

('(! )

#* )%""%%"" &&&&*($%*'$!

LETOURNEAU 11 YD. PT industrial hyd. scraper, $16,500; 6â&#x20AC;? floating water pump w/Honda motor, $750. 306-423-5983, 306-960-3000, St. Louis, SK. RETIRED. REASONABLE OFFERS ONLY: Case/IH, 7120 MFWD tractor, 2000 hrs. on new engine; Brandt QF 120â&#x20AC;&#x2122; sprayer, 5/10 nozzles, wind cones, new hyd. pump; Case/IH 6200 DD drills 42â&#x20AC;&#x2122;; Rite-Way harrow/packer 42â&#x20AC;&#x2122;; Walinga 510 grain vac, rebuilt; Market gravity grain wagon 400 bu.; Brandt folding truck drill fill; 1967 GMC 950 grain truck; Triple axle 20â&#x20AC;&#x2122; flatbed trailer; 2-1200 gal. water tanks; Case 1482 combine, new clean grain paddle, rebuilt feederhouse. Plus misc. parts: 3 cultivators 28â&#x20AC;&#x2122;, 24â&#x20AC;&#x2122; and 14â&#x20AC;&#x2122;; Fork rockpicker, rebuilt forks; 2 Case discers, 33â&#x20AC;&#x2122;, 24â&#x20AC;&#x2122;; Large air compressor. Bill Rayner, 306-543-4608, Regina, SK. e-mail: brayner@sasktel.net

â&#x20AC;&#x2122;00 LULL 644D34 TELEHANDLER, 6,000 lbs., 34â&#x20AC;&#x2122; reach, w/ cab, well maintained, good shape. $29,800. Trades welcome, financing available. 1-800-667-4515. www.combineworld.com.

GENERATORS: 20 KW to 2000 KW, low hour diesel and natural gas/ propane units Abraham Generator Sales Co. Phone: 701-797-4766 or 701-371-9526, Cooperstown, ND. www.abrahamindustrial.com

BOURASSA 3 PT HITCH was on JD 4020, but could fit other tractors, $1000. 306-276-2442, Nipawin, SK. SUNFLOWER HARVEST SYSTEMS. Call for literature. 1-800-735-5848. Lucke Mfg., www.luckemanufacturing.com RETIRED: DUTCH PU guards, $100; 50â&#x20AC;&#x2122;x8â&#x20AC;&#x2122; PTO Brandt grain auger, $950; 1983 Allis L3 combine, standard w/Sund PU, approx. 2600 hrs., $5500; Deutz/Allis 24â&#x20AC;&#x2122; header w/dutch PU guards, $1000; 7â&#x20AC;&#x2122; Farm King swath roller, $250. Phone 306-475-2549, Spring Valley, SK.

WANTED: MF #36 DISCERS, all sizes, prompt pick-up. Phone 306-259-4923, 306-946-9669, 306-946-7923, Young, SK. WANTED: 1970â&#x20AC;&#x2122;s JD 6030 tractor, any condition. Call 204-955-8970.

â&#x20AC;&#x2122;79 SELLICK 6000 Sellick 6000 Rough Terrain Forklift, 24â&#x20AC;&#x2122; reach, 6,000lb capacity, 3cyl diesel, w/ cab. $10,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

VERSATILE TRACTOR WANTED: Model 276, w/loader, prefer 3 PTH and PTO at both ends, low hrs. Phone 604-823-6673, Chilliwack, BC. WANTED: USED, BURNT, old or ugly tractors. Newer models too! Smithâ&#x20AC;&#x2122;s Tractor Wrecking, 1-888-676-4847. WANTED: DEUTZ 7110 with FWA. Must be in good shape. Call 204-467-5608 or cell 204-461-0706, Stonewall, MB. MASSEY FERGUSSON 65 diesel tractor, complete or just engine. Call Cam-Don Motors Ltd. 306-237-4212, Perdue, SK. WANTED: Older and newer tractors, in running condition or for parts. Goods Used Tractor Parts, 1-877-564-8734. WANTED: 30â&#x20AC;&#x2122; PT SWATHER in good condition. Phone 306-210-7573, Reward, SK.

â&#x20AC;&#x2122;00 LULL 644D34 6,000lb capacity, 34â&#x20AC;&#x2122; reach, w/ cab. $24,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

OVER 100 SETS of forklift forks in stock from 3-8â&#x20AC;&#x2122; long; 15 forklifts up to 10 ton; parting out over 20 units. 2 yards, over 50 acres, salvage of all types, new and used parts. Low, low prices. Cambrian EquipWANTED: MF 18â&#x20AC;&#x2122; 360 discers with single ment Sales. Phone: 204-667-2867, fax: or duplex hitch. Need blade size. Call 204-667-2932, Winnipeg, MB. 250-491-5633. WANTED: MORRIS 8900 deep tillage, 9â&#x20AC;? spacing, heavy shanks, 50â&#x20AC;&#x2122;. Kamsack, SK. 306-542-2872, 306-542-7684. WANTED: GOOD USED HAYBUSTER tub grinder, electric, Model H1130 or 1000. Ph. Jacques 819-357-6935, Plessisville, QC

Bred cow program ! Feeder Program !

Toll Free 1-8 66-8 48 -6669 No Res triction s ; Pu rcha s e a n d m a rk etin g - You rchoice

w w w.foothills lives tock.ca

SPRUCE FOR SALE! Beautiful locally grown trees. Plan ahead and renew your shelterbelt or landscape a new yardsite, get the year round protection you need. We sell on farm near Didsbury, AB. or deliver anywhere in western Canada. Details phone 403-586-8733 or check out our JD GPS SYSTEM 2600 monitor, ATU, website at www.didsburysprucefarms.com new 3000 receiver, $11,500 OBO as pkg. or will separate. 780-889-2223, Heisler, AB. email: wellermalcolm@gmail.com

BISON WANTED - Canadian Prairie Bison is looking to contract grain finished bison for growing markets. For more info. contact Roger Provencher at 306-468-2316. roger@cdnbison.com SOLAR TRACKERS - NET METERING 20% Government Grant avail. Kelln Solar, website: www.kellnsolar.com Lumsden, SK. 1-888-731-8882.

WAREHOUSE DIRECT. Best in class. Indoor/outdoor wood gasification boilers. Water/hot air eff., 93% to 97%. CSA approved. Starting $4950. 1-877-538-3818. www.orlancanada.com TANKLESS WATER HEATERS, instant, on demand. Showers, cabins, RVâ&#x20AC;&#x2122;s. Gas (natural or propane) or electric. Edmonton, AB., 780-952-4884 www.firepitfundamentals.ca WWW.NOUTILITYBILLS.COM - Indoor coal, grain, multi-fuel, gas, oil, pellet and propane fired boilers, fireplaces, furnaces and stoves. Outdoor EPA and conventional wood boilers, coal / multi-fuel boilers. Chimney, heat exchangers, parts, piping, pumps, etc. Athabasca, AB, 780-628-4835.

SASKOTA NATURAL is looking for finRODâ&#x20AC;&#x2122;S WELDING: 2-3/8â&#x20AC;? pipe, $1.05/ft; 2â&#x20AC;? ished bison. Cash on delivery. Paying marpipe, $0.85/ft. comes in 24â&#x20AC;&#x2122; and 30â&#x20AC;&#x2122; ket prices. â&#x20AC;&#x153;Producers working with Prolengths. 403-746-5455, Red Deer, AB. ducers.â&#x20AC;? Call 306-231-9110, Quill Lake, SK

HIGHLAND BULLS FOR Sale. Phone: 306-493-8233, Outlook, SK.

FRESH AND SPRINGING heifers for sale. Cows and quota needed. We buy all classes of slaughter cattle-beef and dairy. R&F Livestock Inc. Bryce Fisher, Warman, SK. Phone 306-239-2298, cell 306-221-2620.

BIG ISLAND LOWLINES Premier Breeder. Selling custom designed packages. Name your price and we will put a package together for you. Fullblood/percentage Lowline, embryos, semen. Black/Red carrier. Darrell 780-486-7553, Edmonton, AB.

CANADIAN MAINE-ANJOU ASSOCIATION. Power, performance and profit. For info on Maine-Anjou genetics. Call 403-291-7077, PUREBRED BLACK ANGUS long yearling Calgary, AB., or www.maine-anjou.ca bulls, replacement heifers, AI service. Meadow Ridge Enterprises, 306-373-9140 or 306-270-6628, Saskatoon, SK. 30 SALERS BULLS, weighed and perfor2 YEAR OLD BLACK ANGUS BULLS mance tested. Delivery available and can from easy calving herd, birthweight 70 to feed until needed. Call 780-924-2464 or 90 lbs, will deliver. Sharpley Angus, 780-982-2472, Alberta Beach, AB. 403-325-1245, Strathmore, AB. BENLOCK FARMS working two yr. olds, developed and bred to survive and thrive. Cover more cows with fewer wrecks. Why FOR SALE OR RENT: Red, black and fullbuy a yearling when you can buy a two yr. blood Simmental bulls. A.I. breeding, seold for the same price. Excellent service, men tested, reasonable prices. Phone Dale excellent selection of heifer or perfor- 780-853-2223, Vermilion, AB. mance bulls. Time tested, family bred genetics since 1910. Complete listing at: www.benlockfarms.com 306-668-2125 or ALBERTA TEXAS LONGHORN Association cell: 306-230-9809, Saskatoon, SK. 780-387-4874, Leduc, AB. For more info. RAVEN RIDGE ANGUS has a herd of www.albertatexaslonghorn.com Reg. Black Angus for sale. A great opportunity to start or expand a purebred REG. TEXAS LONGHORN bulls. Bred cows, herd of cattle. Approx. 70 cow/calf pairs, 9 open and bred heifers. Ph Dean at Panoheifers, 5 herd bulls. Cows are in great rama Ranch 403-391-6043, Stauffer, AB. shape, raising quality calves. Avg. age of cows is 6 years. Serious inquiries only. Call Derek 204-725-6004, Oak River, MB. 80 SIMMENTAL and Simmental Red Angus cross, start calving Mar. 1, bred Simmental or Red Angus, will keep until after harvest. REG. PUREBRED yearling Red Angus bulls Call 306-762-4723, Odessa, SK. for sale. Maple Ridge Acres. Call Les CATTLE FINANCING AVAILABLE for Saunders 306-997-4507, Borden, SK. feeder cattle and bred heifers/cows. LOOKING TO PURCHASE a complete herd Competitive interest rates. Call Marjoof commercial Red Angus cow/calf pairs. rie Blacklock, Stockmens Assistance 306-861-4592, Fillmore, SK. Corp., 306-931-0088, Saskatoon, SK. RED ANGUS BULLS, two year olds, semen tested, guaranteed breeders, delivery RK AN IM AL S UPPL IES - Be o n ta rget, Us e the p ro d u cts available. 306-287-3900, 306-287-8006, Englefeld, SK. skinnerfarmsangus.com en d o rs ed b y the p ro fes s io n a ls . RED OR BLACK BULLS, 1 and 2 years, reaRK & S UL L IV AN S UPPL IES sonable prices. Tom Ward 306-668-4333, Clark Ward 306-931-3824, Saskatoon, SK. C a ll fo r d e ta ils a n d a fre e c a ta lo gu e

MARTENS CHAROLAIS has yearling and 2yr old bulls. Dateline Sons for calving ease, Specialist Sons for consistent thickness. 204-534-8370, Boissevain. MB. 40 WHITE PB COW/CALF PAIRS. Bull out to calve March 1st. Also red purebred 100% WOOD BREEDING bulls, 2 and 3 year cow/calf pairs. 306-394-4406, Courval, SK olds, $3,000 each OBO. Can deliver. 403-289-0327, Sundre, AB.

ELK VALLEY RANCHES, buying all ages of feeder bison. Call Frank 780-846-2980, Kitscoty, AB or elkvalley@xplornet.com

YEARLING, 2 YR. old and one 3 yr. old Polled Hereford bulls. Excellent selection of calving ease and performance bloodlines. Semen tested, guaranteed, delivery available. BBJ Farms, Harris, SK. Brian: 306-656-4542, or 306-831-9856.

RED POLLED LIMOUSIN, two yearling PB bulls, registered, semen tested. Call Donna at 403-650-9848, Rocky View, AB.

BISON PRODUCERS OF ALBERTA is hosting Summer Field Day at HeadSmashed-In Buffalo Jump on August 10th near Fort MacLeod. Activities include guided tour, movie, lunch and BPA update. Fee is $20/person. Registration for tour is at 9:00 AM. Info. call Linda at 780-955-1995 or www.bisoncentre.com

HERD DISPERSAL: Approx. 60 animals, 8 calves, 10 yearlings, rest mature adults, and 2 bulls. 306-463-7127, Marengo, SK.

WANTED: DEXTER BULL, to either buy or trade. Does not need to be registered. Prefer Regina, SK. area. 306-726-4552. COW/CALF PAIRS and yearling heifers, 1 and 2 year old bulls. 403-845-5763, Rocky Mountain House, AB.

GENUINE GENETICS GALLOWAY Female Sale, Oct. 19th. View: LiveAuctions.TV SELLING: BLACK ANGUS bulls. Wayside Call Russell 403-749-2780, Delburne, AB. Angus, Henry and Bernie Jungwirth, 306-256-3607, Cudworth, SK.

NORTHFORK- INDUSTRY LEADER for over 15 years, is looking for finished Bison, grain or grass fed. â&#x20AC;&#x153;If you have them, we THREE YEAR OLD REGISTERED BULL for want them.â&#x20AC;? Make your final call with s a l e . P h o n e 3 0 6 - 6 8 2 - 1 4 7 7 d a y s , Northfork for pricing! Guaranteed prompt 306-682-4233 evenings, Muenster, SK. payment! 514-643-4447, Winnipeg, MB.

50 PURE WOOD/ Wood Cross bison, avg. price $2000/head. Contact Dr. Marshall Patterson, 306-475-2232, Moose Jaw, SK.

POLLED 2 YEAR old and yearling Charolais bulls, some Red Factor. Kings Polled Charolais, 306-435-7116, 306-645-4383 or 306-645-2955, Rocanville, SK.

Roc k y M ou n ta in Hou s e , AB

BLACK ANGUS BULLS, two year olds, seNEED TO MOVE water or irrigate? 6â&#x20AC;?-10â&#x20AC;? men tested, guaranteed breeders, delivery alum. pipe, pump units. Taber, AB. Dennis available. 306-287-3900, 306-287-8006, Englefeld, SK. skinnerfarmsangus.com at: 403-308-1400, dfpickerell@shaw.ca REG. BLACK ANGUS bulls, semen tested, WESTERN IRRIGATION - Large supply of and EPDâ&#x20AC;&#x2122;s available. Call High Tree Cattle, new and used irrigation equipment. New Wilkie, SK., 306-843-7354, 306-843-2054. and used Cadman travelling gun dealer, used PTO pump, used electric Zimatic cen- MIDNITE OIL CATTLE CO. has on offer tre pivot, used large volume pumping unit s e m e n t e s t e d y e a r l i n g b u l l s . 306-734-2850, 306-734-7675, Craik, SK. w/gated pipe. 306-867-9461, Outlook, SK. BULLS, 2 year olds and yearlings, AI ZIMMATIC 4 TOWER towable, self con- REG. herdsires, can be viewed, moderate tained pivot, $22,000. 306-843-3115 or sires, birthweight, quiet. Call JP Monvoisin, 306-843-7153, Wilkie, SK. 306-648-3634, Gravelbourg, SK.

DIESEL GENSET SALES AND SERVICE, 12 to 300 KW, lots of units in stock, used and new, Perkins, John Deere, Deutz. We also build custom gensets. We currently have special pricing on new John Deere units. Call for pricing 204-792-7471.

â&#x20AC;&#x2122;87 IH 586E Forklift w/ cab & 4WD, 6,000lb capacity, 20â&#x20AC;&#x2122; reach. $20,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

LIV ESTO C K C O - O P

JOHNSTON/FERTILE VALLEY is selling yearling and 2 yr. old Black Angus bulls. Most are sired by the best AI bulls in the industry including Final Answer, Mustang, Pioneer, Hoover Dam and King. Also a group sired by our low maintenance New CASE 444 with 46â&#x20AC;? lawn mower and snow- Zealand outcross Sire VVV Glanworth 57U. b l o w e r, g o o d c o n d i t i o n , $ 2 5 0 0 . These are thick, easy fleshing bulls pro306-693-2577, Moose Jaw, SK. duced by over 500 low maintenance, high production cows. Many of these bulls are suitable for heifers. All bulls are semen tested with complete performance and carcass info available. Dennis or David Johnston at 306-856-4726, Conquest, SK.

BLOCKED SEASONED JACK Pine firewood and wood chips for sale. Lehner Wood Preservers Ltd., 306-763-4232, Prince Albert, USED RAMROD 1150 Tankmaster, rubber SK. Will deliver. Self-unloading trailer. track, ride behind unit. Available with lots of attachments, $9900. For more details call Flaman Nisku, 1-800-352-6264. 1992 CIH 1680, 3700 hrs., well kept, $24,000; 1997 Doepker B-train, air guages, BEVâ&#x20AC;&#x2122;S FISH & SEAFOOD LTD., buy dinew paint, $21,000; Degelman land roller, rect, fresh fish: Pickerel, Northern Pike, 45â&#x20AC;&#x2122;, low acres, $24,000; Sakundiak 10x50 Whitefish and Lake Trout. Seafood also PTO auger, $1200; 8â&#x20AC;&#x2122; dozer off Case 2WD, available. Phone toll free 1-877-434-7477, $400. 306-224-4515, Windthorst, SK. 306-763-8277, Prince Albert, SK.

W a yn e Oa tw a y

FOOTHILLS

WANTED: PARTS for 1968 Allis Chalmers HB112 or Symplicity Sovereign 3112H lawn tractor. Contact 780-991-6292, 780-922-7133, Sherwood Park, AB.

F I R E W O O D : C u t a n d s p l i t , d e l i ve r y available. 306-862-7831, 306-862-3086, Nipawin, SK.

204-9 8 1-429 1

BC, ALBER TA, S AS K. â&#x20AC;&#x153; Fa rm e rs He lping Fa rm e rs â&#x20AC;?

USED BANDIT Tree Chippers: 65XL w/24 HP Honda v-twin, cuts 6â&#x20AC;? material; 95XL w/50 HP Kubota diesel, cuts 9â&#x20AC;? material. 1-800-352-6264, Flaman Sales, Nisku, AB.

CANADAâ&#x20AC;&#x2122;S EQUIPMENT LEASING EXPERTS

(5) JD 63 5 Fle x He a d e rs C a t53 5 Fle x C a tF3 0 Fle x (2) JD Ad a pto rs FD 70â&#x20AC;&#x2122;s M D 900 s e rie s JD a n d NH Ad a pte rs JD 2410 61â&#x20AC;&#x2122; C u ltiva to r Bre n t975 G ra in C a rt, S c a le / Ta rp C a t70 S c ra pe r

RAIN MAKER IRRIGATION Zimmatic by Lindsay pivots/Greenfield mini pivots, KLine towable irrigation, spare parts/accessories, new and used equipment. 32 years in business. www.rainmaker-irrigation.com Call 306-867-9606, Outlook, SK.

O N E S TO P

CATTLE FIN AN CIN G

TWO YR OLD and yearling bulls, polled, horned, white and red factor. Semen tested, delivered and guaranteed. Prairie Gold Charolais, 306-882-4081, Rosetown, SK. REG. WHITE CHAROLAIS bulls, polled and horned, growthy, calving ease and quiet. Semen test and deliver. Call Qualman Charolais, 306-492-4634, Dundurn, SK.

1-8 00-440-26 9 4. w w w .rka n im a lsu pplies.co m

125 COWS w/CALVES, you pick from 170 head, $1850. Will pasture till Oct. 15th. Phone 306-297-7986, Shaunavon, SK. 170 YOUNG CHAROLAIS/ANGUS cow/calf p a i r s o r b r e d c o w s fo r s a l e . C a l l 306-848-0076, Weyburn, SK. 40 BLACK SIMMENTAL/Black Angus cross cow/calf pairs, $2000/pair. 306-427-4682, Shell Lake, SK.

For Your Vermeer Parts, Sales & Service

Call For a Demo Today Airdrie Tractorland Greg Jensen 1-877-948-7400

Calgary Tractorland Derek Bell 1-877-240-1977


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

51

CAPACITY IS KING

500C SERIES More Capacity. Less Complications. - New processor gives greatest capacity yet. - The most direct and efficient transfer of power to all major components. - 20% better fuel savings. - Cooling system runs at max efficiency with self-cleaning V-Cool System. - ComforTech™ II cabs are roomier, quieter and give more visibility than ever before.

Farren Huxted Salesman, Ag World Equipment

PRE-OWNED EQUIPMENT HARVESTING

Case 8120 ‘10, 900/75R32 frt, 600/65R28 rear, 1111 hrs...............................................................................$229,000 R76 ‘10, 4200 hdr, 16 .9x26 R1, 900/60R32 R1W, 712.7 hrs..............................................................................$229,000 R72 ‘02, 1878 sep hrs..............................................................$79,500 2 - R66 ‘09, c all .................................................. Starting @ $169,900 4 - R65 ‘08 - ‘03, c all .......................................... Starting @ $100,000 2 - R62 ‘98, call, 2045 hrs & up ............................ Starting @ $59,900 R62 ‘97, stone trap, 1950 sep hrs ............................................$59,900 R62 ‘95, 2518 hrs ....................................................................$29,900 2 - MF 9895 ‘11, 606 & 710 hrs ............................................$269,000 MF 9795 ‘10, elec adj sieve, hyd reel fore/aft, beacon lt, bin sensor.............................................................................$269,900 MF 9795 ‘09, 28Lx26 rear, 18.4R42 duals, heavy duty axle, 782.8 hrs......................................................................$209,000 2 - MF 9560 ‘12, 750/65R26 R1W, D20 .8R42 R1..................$339,000 NH CX8090 ‘09, 698 .2 hrs ...................................................$225,000

SWATHERS

4 - MF 9740 ‘13 & ‘12, call................................. Starting @ $149,000 3 - MF 9430 ‘11 & ‘10, call................................... Starting @ $89,900 MF 9420 ‘05, w/5000 hdr .......................................................$64,900 2 - MF 220 ‘97 & ‘98, call..................................... Starting @ $20,000 MF 200 ‘95, 26’, UII reel, DSA, 2083 hrs..................................$39,500 Prairie Star 4600 ‘97, 25’ .........................................................$5,900

ST CUT HEADERS

Agco 327, 27’ ...........................................................................$4,900 Agco 400 25’, pu reel ...............................................................$9,900 2 - HB SP30 ‘11, S77 adaptr, UII reel, plastic teeth ...................$59,000 HB SP30 ‘09 ............................................................................$42,900 HB SP30 ‘02 ............................................................................$29,900

SPRAYERS

Bourgault Centurion III 850, ‘94, 100’ ....................................$6,900 Hagie STS12 ‘11, 100’, 1200 gal, 1173 hrs...........................$299,000 JD 4830 ‘09, 100’, JD auto steer, mapping, sectional ctrl, 648 hrs ..........................................................................$249,000 SC 4640 ‘99, 60’, 420/70R24 ..................................................$39,900

TRACTORS

Challenger 965C, ‘12, 500/85R46, R1W, 900 diff lock ..........$319,900

Challenger 945C, ‘12, 800 duals, deluxe cab ........................$259,000 Case 500 ‘12, 30” new tracks, X20, Prosteer, pto, 719 hrs.................................................................................$339,500 Case 2294, ‘84, approx . 8500 hrs...........................................$19,900 Case 932 ‘69, factory cab & 2 remotes ......................................$4,995 Fendt 820 ‘09, 877 hrs .........................................................$179,900 JD 4440, ‘82, w/ldr, 11,758 hrs ...............................................$29,900 NH T9050 ‘08, 800 duals, autosteer, diff lock, tow cable, Touch screen ........................................................................$219,000 MF 5480, ‘08 w/ldr, 1565 hrs ..................................................$79,000 NH 9882 ‘98, 5484 hrs ..........................................................$109,000 NH 9882 ‘97, 20 .8R42 triples, Radar & Perf mon, 5063 hrs ..$119,000 NH 9880 ‘94, 30 .5-32 duals, 12 speed, 4 remotes, 6771 hrs.................................................................................$89,900

Gleaner R62

MF 8780XP

‘‘00, 30.5Lx32/16.9x24s

‘01, w/4000 hdr, 1683.2 hrs.

49,900

79,000

$

$

HAY EQUIPMENT

Case IH 8465 ‘98, 5x6, auto....................................................$15,000 Case IH 625 Hay Header, 16’ .................................................$15,900 Highline 7000 ‘01 ....................................................................$7,900

TILLAGE

Bourgault 7950 ‘12 ..............................................................$229,000 Bourgault 6700 ‘09 ..............................................................$129,900 4 - Bourgault 6550 ‘09, ‘11, ‘12, ‘14, call............ Starting @ $59,900 Bourgault 6350 ‘08, 3 tank meter, RTH, bag lift .....................$69,900 Bourgault 5350 ‘00, 2 tank meter, NH3 line, RTH, brand new 3rd tank meter & rear rice tires........................................$45,900 3 - Bourgault 3320 ‘10, ‘13, ‘14, call................. Starting @ $219,000 2 - Bourgault 3310 ‘09...................................... Starting @ $129,900 Bourgault 3225, ‘97, Call for details .......................................$19,900 Bourgault 135 ‘86, load/unload, hydraulic fan ..........................$8,900 Bourgault 2115, load/unload....................................................$4,500 3 - Bourgault 5710 ‘97 - ‘05, call for details ........ Starting @ $44,900 Bourgault FH536-40, call .......................................................$19,900 Bourgault 7200 ‘10, 84’, 21 .5x16L tires ................................$44,900 Bourgault 7200, ‘08 ...............................................................$39,900 Bourgault 5400, 70’ .................................................................$6,900 Flexi-Coil 1610 Plus, load/unload, tow hitch...........................$11,900 Flexi-Coil 3450 ‘97, load/unload .............................................$34,900 IHC 496, ‘82 disc, 32’ ..............................................................$27,900 Riteway Junior Jumbo harrow ‘09, 72’ ................................$29,900

MF 9420

Gleaner S67

‘06, 5200 hdr, 25’, UII reel, 480 frt tires, swl gauge whls

‘11, 18.4x26, 900/62R32 frt, 393.9 hrs

250,000

$

64,900

$

Case 9120

Gleaner R75

‘12, 16’ Case pu, long unload, 620/70R42 duals, 28L26 rear, Trimble autosteer, 191 hrs.

‘04, w/Gleaner 400 hdr, Super 8 pickup, 975 hrs.

319,900

$

129,000

$

For a complete listing visit our website

Greg Shabaga

Lyle Mack

Paul Hickerson

www.agworld.cc

H (306) 864-3364 C (306) 864-7776

H (306) 752-2954 C (306) 921-6844

(306) 864-2200

Randy Porter

Farren Huxted

H (306) 864-2579 C (306) 864-7666

H (306) 752-3792 C (306) 864-7688

Product Specialist, Sprayers H (306) 864-2669 C (306) 864-7000

Kinistino, SK


52

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

1-800-667-4515

SASKATOON

www.combineworld.com

REGINA

20 min. E of Saskatoon on Hwy. 16

Text Us! 306-229-9507 Email: coleman@combineworld.com

Numerous pictures available on our website www.combineworld.com ‘04 CIH 2388

‘97 CIH 2388

1,500 sep hrs., heads in stock. ..................

$

59,800

‘04 JD 9660 STS

$

49,800

‘01 JD 9650 WALKER

Field-ready, 2013 $20,000 work order, Greenstar, FC chopper, 2,523 hrs.............

$

2,792 threshing hrs., w/ head & pickup, AFS, AFX, recent work order ...............

109,800

3,317 threshing hrs., yield & moisture, auto lube, chaff spreader, topper, heads avail. .............

$

49,800

‘02 CIH 2388 2,887 sep hrs., 3 spd rotor, hyd. reverser ...........

‘99 CIH 2388

$

49,800

‘93 JD 9600 2563 threshing, avail w/ JD 914 for $39,800. ............

3173 threshing hrs. ..........

‘95 CIH 2188

$

38,800

‘89 JD 9600

$

29,800

W/ 1015. 3,300 hrs. Some mechanical issues .......................

NEW 16’ MACDON PW7 FOR CIH/NH

IN STOCK Brand new, w /16’ Swathmaster ...........

$

25,800

‘10 45’ MACDON D60 HEADER

Double knife drive, pea auger, fits all combine makes, hyd. head tilt, excellent cond’n .....................

$

59,800

IN STOCK. Brand new, w /16’ Swathmaster, fits CIH 9120 & CR9070 ...................

$

26,800

‘10 40’ MACDON D60 HEADER

Factory transport, hyd. reel fore & aft. Good guards, reel, canvas, & skid shoe .............

$

53,800

‘95 WILLMAR 745 SPRAYER

1,900 hrs., 500 gal. tank, excellent tires, JD diesel. ................

2,555 sep. hrs. ...................

$

18,800

3,844 eng hrs., fore/aft, strawchopper, some mech. issues ...

32,800

‘09 30’ MACDON D60

NEW knife, guards & reel fingers, includes CNH adapter for 8120/CR9070 ..........

44,800

$

350 bushels, good condition, new auger. ..............

$

18,800

USED PICKUPS & HEADERS

‘97 JD AIR TANK

$

27,800

‘93 CIH 1688

WE WELCOME YOUR TRADES!!

NEW 16’ MACDON PW7 FOR JD

$

24,800

$

‘07 JD 936D

New guards, canvas, & reel bushings. Factory transport. Overall excellent cond’n ......

$

29,800

23,800 12,800 6,800

$ ‘12 NH 790CP-15................ ‘08 MacDon 16’ PW7 $ Hardly used STS PU head ..... ‘02 JD 14’ 1300 $ MacDon precision model ........

‘01 JD 39’ 930R

W/ full finger auger & pick-up reel. $12,800 ready-to-go or $9,800 as is .............

$

9,800

AVAILABLE FINANCING & LEASING W/NO PAYMENTS TILL NOV.!! (OAC) ‘04 BRENT 1084 AVALANCHE

Grain cart, 1,100 bu., tandem walking axle, new roll tarp, 20’ hydraulic auger, 1000 PTO ................

$

30,800

Hyd. Fore/Aft, full finger auger, single point hyd. hook-up, PU reels, excellent condition...................

$

19,800

$

32,800

New front tires, runs well ......................

RAKEUP PICKUPS OVERSTOCKED!

‘05 JD 35’ 635F

Hydraflex header, auger & floor excellent cond’n, overall 70% ..............

$

16,800

’79 Sellick 6000 24’ reach, 6,000 lb capacity, 3 cyl. Ford $ diesel, w/ cab ....................... ’87 IH 586E, 6,000 lb capacity, 20’ reach, 4 cyl. .9L $ Cummins, 4WD, 2,053 hrs ..

10,800

$

9,800

Starting at ......................

20,800

Like-new 35’ Horst Drawpin hitch, 36’ flex bar, built-in rachet strap w/ quick-adjust saddles. $ 2 available! ............................. NEW Elmers Mfg HT30 30’, full trailer, 6,000lb axle, & header supports, clevis hitch, std brackets. $ 5 available ...............................

4,980

$

1,950

TELEHANDLERS

FORKLIFTS

‘66 CAT MODEL 12 GRADER

‘06 GENIE Z45/25 LIFT

45’ reach, 4WD, Deutz diesel, like-new tires, 1,347 hrs.................

‘05 JD 30’ 630R

HEADER TRANSPORTS

’05 Terex TH644C 4,497 hrs., 44’ reach, 4.5L JD, $ 6000 lb capacity heated cab...... ’05 Terex TH644C 3,735 hrs., 44’ reach, 4.5L JD eng., $ 6000 lb capacity ........................ ’00 Lull 644D34 w/ 4,600 hrs., 6000 lb capacity, 34’ reach, $ well maintained .........................

42,800 39,800 29,800

2,780

“Great place, very helpful. John (CWI salesperson) is very nice and helpful. Lots of parts. Great for farmers, gives us choices.” — Ron Simpson CEO, R & N Farms, Rosetown, SK


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

53

Quality Undercarriage & Repair Parts for use on equipment manufactured by: Cat, Case, Deere, Hitachi, Hyundai, Kobelco, Komatsu, Volvo, and other fine manufacturers.

Sealed & Greased Excavator Chains

Forged Links

Excavator links are lubricated using â&#x20AC;&#x153;Extreme Pressure Synthetic Greaseâ&#x20AC;? and fitted with the latest style Polyurethane Seal Groups to maximize lubricant retention and insure long life.

ITR Links are forged from Boron Steel, quenched, tempered, and induction hardened using the latest automated link hardening equipment to ensure excellent wear resistance under even the most severe working conditions.

Sealed & Lubricated Dozer/Loader Chains

Lubricated Dozer Chains are sealed with Polyurethane Seals and Metal rings to extend operating life and to eliminate the possibility of dry joints between â&#x20AC;&#x153;west turnsâ&#x20AC;?.

Pins & Bushings

Pins and bushings are critical to track chain wear life and are manufactured and dimensionally matched to ensure a perfect fit and sealing and joint integrity. Outside Surface Hardness is > Rockwell C58 to a depth of > 4mm with a core hardness of > Rockwell C34.

Chain Assembly

Lubricated Chains are assembled on fully automated chain assembly lines. Seal installation, Plug introduction and Oil fill quantities are 100% computer controlled and every joint is individually pressure tested to eliminate the possibility of leakage during working conditions. Min / Max interference fit tolerances between the Pins, Bushings and Links are maintained automatically by min/max press force specifications. This process minimizes link breakage and pin/bushing drifting.

â&#x20AC;&#x153;ITâ&#x20AC;&#x2122;S WHAT WE DOâ&#x20AC;?

9004B YELLOWHEAD TRAIL, EDMONTON, AB T5B 1G2 TOLL FREE 1-877-413-1744 LOCAL 780-413-1740 FAX 780-413-1720 E-MAIL: info@terrateam.ca www.terrateam.ca

2010 CHEV SILVERADO 1500

2012 CHEV SILVERADO 1500 LT 2008 FORD F350 KING RANCH 5VM5-7

AC, CC, CD, PWR GRP, 18,602KM

32,995 5VM5-7

AC, CC, CD, LTHR, PWR GRP

$

2007 FORD F150 LARIAT 4X4 5VM5-7

2008 FORD F350 FX4 5VM5-7#

42,995

$

2008 GMC SIERRA 1500 SLT

26,995

5VM5-7

4X4, AC, CC, CD, DVD, LTHR, DIESEL

5VM5-5#

LS SERIES, 4.8L V8, AUTOMATIC, 35,300 KM

2012 GMC SIERRA 1500 SLE

5VM5-7

28,995

$

2008 FORD F350 SD LARIAT

5VM5-7

$

2009 NISSAN TITAN SE 5VM5-7

AC, CC, PWR SEAT, PWR GRP

24,995

$

5.3L V8, AUTOMATIC, 27,692KM

33,995

$

2008 FORD F150 LARIAT 4X4

5VM5-7

LTHR, MOONROOF, BACKUP SENSOR

28,995

$

2006 TOYOTA TACOMA

5VM5-5#

LTHR, REMOTE START, SUNROOF

26,495

$

2007 DODGE RAM 2500 SLT 5VM5-7

HEMI, 4X4, AC, CC, PWR GRP QUAD CAB

27,995

$

AC. CD, HTD SEATS,PWR GRP

34,500

$

07 FORD F150 LARIAT 4X4

5VM5-7

AC, CC, CD, LTHR, PWR GRP

25,995

$

AC, CC, TURBO DIESEL, 4X4

37,995

$

2008 FORD F150 4X4

5VM5- 7#

AC, CC, CD, PWR GRP, TONNEAU COVER

CALL

LIMITED TRD SR5, 4DR, 4.0L AUTOMATIC, 96,478KM

24,995

$

MANY MORE UNITS IN STOCK... OPEN 24 HOURS AT WWW.SUBARUOFSASKATOON.CA

ELITE AUTOMOTIVE GROUP INC. O/A

Open 24 Hours @

www.subaruofsaskatoon.com

SUBARU OF SASKATOON 471 CIRCLE PLACE â&#x20AC;˘ 306-665-6898 OR 1-877-373-2662

Open 24 Hours @

www.bramerauto.com

BRAMER AUTOMOTIVE GROUP

CORNER OF SARGENT & KING EDWARD â&#x20AC;˘ CALL 204-474-1011 â&#x20AC;˘ TOLL FREE 1-877-474-1011


54

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

MEAN PERFORMANCE MEETS GENTLE HANDLING Delicate crops need delicate treatment. The solution: match a New Holland H8000 Series windrower with the 14HS Specialty Header to get legendary Speedrower® performance as well as gentle crop collection for maximum seed retention. Reduced auger speed and a wide header floor opening make the 14HS perfect for fragile crops such as mint, grass and flower seed. SMOOTH CUTTING IN DAMP, HEAVY AND TANGLED CONDITIONS FULLY-ADJUSTABLE 6-BAT REEL WITH IN-CAB SPEED ADJUSTMENT 1828-SPM KNIFE SPEED AND STUB GUARDS FOR CLEANING CUTTING BACKED BY NEW HOLLAND’S ONE-YEAR FACTORY WARRANTY

©2012 CNH America LC. New Holland is a registered trademark of CNH America LLC.

SEE OUR FULL INVENTORY ONLINE AT WWW.FARMWORLD.CA 2011 NEW HOLLAND H8060

$

105,500

2005 NEW HOLLAND HW325

$

88,000

2009 MASSEY FERGUSON 9430

$

78,500

$

78,500

142,000

$

53,000

Follow Twitter Farm World on for parts NH ld or W rm @Fa ecials, sp t en and equipm ts, ld Farm Wor even n, fu , ts es nt co and winning!

55,500

$

133,000

1996 MACDON 4930

$

1998 PRAIRIE STAR 4920

$

2011 JOHN DEERE D450

SOLD!

2009 MASSEY FERGUSON 9430

2009 WESTWARD M200

$

2000 NEW HOLLAND HW320

39,500

1992 HESSTON 8100

$

1986 CASE 6500

$

19,500

21,000 1988 VERSATILE 4700

$

14,900

HWY. #3, KINISTINO, SK — Bill, David H, Jim, Kelly SPRAYER DEPARTMENT, KINISTINO — Jay, David J., 306-864-7603

306-864-3667

HWY. #5, HUMBOLDT, SK — Paul, Tyler

306-682-9920

235 38TH ST. E., PRINCE ALBERT, SK — Brent, Aaron SPRAYER DEPARTMENT, PRINCE ALBERT — Chris, 306-922-2525

306-922-2525

Check out our website at www.farmworld.ca


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

55



1.888.986.2946 1195 GREAT DANE DRY VAN

2005 TRAILMOBILE DRY VAN

Storage, Tandem axle, Aluminum Duct floor, Width: 102in, Length: 53ft. Calgary, AB. Stock #SW078803U

$ 2004 WILSON FLATDECK Deck, Flatdeck, Air Ride suspension, Tandem axle, Steel rims, Wood floor, Winches: 26 Fixed, Width: 102in, Length: 53ft. Winnipeg, MB. Stock #4N608129U

$

13,900

2012 INTERNATIONAL PROSTAR +122 Tandem Axle Day Cab Tractor, MaxxForce 13 engine, Eaton Fuller O/D transmission (18 speed), Air brakes, 414000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 4-Way rear lockup, A/C. Regina, SK. Stock #8281-12A

$

89,500

2007 INTERNATIONAL 9200I 6X4 Tandem Axle Day Cab Tractor, Cummins ISX engine (464 HP), Eaton Fuller D/O transmission (13 speed), Air brakes, 865000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 3-Way rear lockup, A/C. Calgary, AB. Stock #V472634

$

59,900

2005 INTERNATIONAL 9400I 6X4 Tandem Axle Sleeper Tractor, Cummins ISX engine (453 HP), Meritor ZF transmission (12 speed), ABS brakes, 1352330 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, Diff Lock rear lockup, A/C, 72” Hi-Rise sleeper, Single bunk. Winnipeg, MB. Stock #4017-05B

$

29,500

2006 CHAPARRAL FLATDECK

2011 INTERNATIONAL PROSTAR +122

95,000

2006 INTERNATIONAL 9400I 6X4 Tandem Axle Day Cab Tractor, Cummins ISX engine (464 HP), Eaton Fuller D/O transmission (18 speed), Air brakes, 660000 km, 14000 lbs front axle capacity, 46000 lbs rear axle capacity, 3-Way rear lockup, A/C. Winnipeg, MB Stock #7017-06A

$

1997 UTILITY REEFER VAN Reefer Van, Air Ride suspension, Tandem axle, Reefer: Thermo King , Steel rims, Flat Grocery Floor floor, Width: 102in, Length: 48ft. Winnipeg, MB. Stock #VU353604U

$

32,900

Tandem Axle Day Cab Tractor, MaxxForce 13 engine, Eaton Fuller D/O transmission (13 speed), Air brakes, 94990 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 4-Way rear lockup, A/C. Delta, BC. Stock #412956

$

$

5,500

Deck, Flatdeck, Air Ride suspension, Tandem axle, Aluminum rims, Alum w/ 4 Nailers floor, 36 king pin, Winches: 20 Fixed w/ Hooks Opposite, Width: 102in, Length: 48ft. Winnipeg, MB. Stock #6M949728U

$

Dry Van, Air Ride suspension, Tandem axle, Steel rims, Wood floor, 36 king pin, Aluminum roof, Logistic Posts side posts, Width: 102in, Length: 53ft. Winnipeg, MB. Stock #51005999U

52,500

9,900

2010 INTERNATIONAL PROSTAR Tandem Axle Day Cab Tractor, Cummins ISX engine, Eaton Fuller D/O transmission (13 speed), Air brakes, 278005 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 4-Way rear lockup, A/C. D’Anjou, QC. Stock #402944

$

85,900

2007 INTERNATIONAL 9400I 6X4 Tandem Axle Sleeper Tractor, Cummins ISX engine, Eaton Fuller D/O transmission (18 speed), ABS brakes, 737500 km, 12000 lbs front axle capacity, 46000 lbs rear axle capacity, 3-Way rear lockup, A/C, 72” Hi-Rise sleeper, Double bunk. Brandon, MB. Stock #V472595

$

59,900

2001 VOLVO VE D12

2006 PETERBILT 387 Tandem Axle Sleeper Tractor, Cat C13 engine, Eaton Fuller D/O transmission (13 speed), Air brakes, 1,400,000 km, 12,000 lbs front axle capacity, 40,000 lbs rear axle capacity, 2-Way rear lockup, A/C, 70” Sky-Rise sleeper. Regina, SK. Stock #5362-06A

$

39,500

11,900

1996 GREAT DANE STORAGE VAN Deck, Flatdeck, Air Ride suspension, Tandem axle, Steel rims, Wood floor, 36 king pin, Winches: 31 Fixed w/ Hooks Opposite, Width: 102in, Length: 53ft. Calgary, AB Stock #TW038904U

$

5,500

2009 INTERNATIONAL 9200I 6X4 Tandem Axle Day Cab Tractor, Cummins ISM engine, Eaton Fuller Auto Shift transmission (10 speed), Air brakes, 309000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 3-Way rear lockup, A/C. Regina, SK. Stock #V492784A

$

69,900

2007 KENWORTH T800 Tandem Axle Sleeper Tractor, Cummins ISX engine (450 HP), Eaton Fuller D/O transmission (13 speed), Air brakes, 1139000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, Diff Lock rear lockup, A/C, 63” Mid-Rise sleeper, Double bunk. Regina, SK. Stock #4913-07A

$

49,900

2005 PETERBILT 379

Tandem Axle Sleeper Tractor, Volvo 13L engine (465 HP), Eaton Fuller transmission (13 speed), Air brakes, 1 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 2-Way rear lockup, A/C. Regina, SK. Stock #2149-01A

$

22,500

Tandem Axle Sleeper Tractor, Cummins ISX engine (430 HP), Eaton Fuller transmission (13 speed), Air brakes, 1,186,500 km, 12,000 lbs front axle capacity, 40,000 lbs rear axle capacity, A/C, 63” Hi-Rise sleeper. Regina, SK. Stock #2788-05A

$

37,900


56

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

306•934•1546 - Saskatoon, SK 306•773•7281 - Swift Current, SK

PRE-OWNED EQUIPMENT SPRAYERS

‘12 Rogator 1300, factory 120 ft boom, 1300 gal, GPS loaded, 2 sets of tires ................................................................... $395,000 ‘12 Rogator 1300, 1300 gal, 100 ft boom, GPS loaded, 2 sets of tires, sharp shooter, 1 of 2, 446 hrs .......................................... $375,000 ‘11 Rogator 1396, 100 ft boom, 1300 gal viper pro, AutoBoom, AccuBoom, Smartrax, 2 sets of tires, 680 hrs ................... $305,000 ‘11 Rogator 1396, 1300 gal, 100 ft boom, GPS loaded, 2 sets of tires ................................................................... $305,000 ‘10 Rogator, 1386 gal, 100 ft, GPS Loaded, 2 sets of Tires .................................................................. $305,000 ‘09 Rogator 1286C, 120 ft, 1200 gal, viper pro,loaded, GPS, 1121 hrs, 2 sets of tires ................................................... $289,000 ‘09 Rogator 1084SS, 1000 gal, 100 ft, GPS loaded, 1200 hrs .......................................................................... $245,000 ‘09 Rogator 1084, 1000 gal, 100 ft boom, GPS, loaded, 2 sets of tires, 1532 hrs ................................................... $205,000 ‘09 Rogator 884 SS, 800 Tank, 100 ft boom, GPS Loaded, 2 sets of Tires, 990 hrs .................................................... $210,000 ‘09 Rogator 1286C, 1200 gal tank, 100 ft boom, GPS, loaded, 2 sets of tires ................................................................... $285,000 ‘07 Rogator 1074SS, 100 ft boom, 1000 gal truck viper pro, Smartrax, AutoBoom, AccuBoom, 2473 hrs, 2 sets of tires ................................................................... $198,000 ‘05 Rogator 1064, 1000 gal, 100 ft boom, S3 outback c/w E-drive, automatic, 1450 hrs, 2 sets of tires, foam marker .................................................................... $175,000 ‘04 Rogator 864, 800 gal, SS tank, 100 ft 1300 boom, 2800 hrs, S3 mapping, E-Drivex, automatic, sec. control, auto-boom, 3 sets of tires ................................................ $169,000 ‘03 Rogator 864, 800 gal SS tank, 100 ft boom, outback GPS, AutoBoom, section control, auto steer, S3, 2 sets of tires, 2700 hrs .......................................................................... $155,000 ‘96 Willmar, 765 Special Edition, 600 gal, 75 ft boom, 4300 hrs, Trimble 250 EZ Steer ......................................................... $45,000 ‘95 Willmarr 7400, 750 gal., 90 ft., Raven auto boom, Ez-guide, 260 w/EZ-Steer, 2080 hrs. ........................................................ $75,000

AIR DRILLS

Flexi-Coil 5000, 51 ft c/w 2320 tow behind tank, rubber packers, single shoot w/sideband ........................... $69,000 ‘03 Flexi-Coil 3450, tow between cart, DS, variable rate....................................................................... $45,000

‘04 Morris Max II, 60 ft, 70” spacing, single shoot, 3.5” sp, c/w 8370 tow between cart ................................ $105,000 ‘10 61 ft Morris Contour, DS, 12” sp, 5.5 packers, c/w 8370XL tow between, 3 tank air cart ......................... $260,000 ‘03 Morris Max II, 49’, 7.5” sp, single shoot, edge on shank, dutch openers, 3.5” packers c/w 7240 tow behind tank ................................................. $59,000

SWATHERS

‘10 MF 9435, big cab, 120hp, 265 hrs c/w 30 ft DSA UIII PU reel ......................................................................... $99,000 ‘09 MF 9435, big cab, 120hp, 407 hrs c/w 30 ft DSA UII PU reel .......................................................................... $96,000 ‘00 MacDon 922, 18 ft, moco hdr ......................................... $19,900 ‘03 MF 220XL, 1480 hrs, 30 ft DSA UII pu reel ...................... $68,000 ‘96 MacDon 9300 c/w 972 30 ft hdr ..................................... $39,000 ‘10 JD A400, 255 hrs, c/w 30 ft HoneyBee hdr double knife drive, hyd swath roller ............................................................... $130,000 ‘06 MF 9420, 1284 hrs, c/w 30 ft DSA UII PU reel ................. $75,000

TRACTORS

‘08 Agco LT95, c/w FL45 frt end loader, joystick grapple, FWA, 95hp ......................................................................... $69,000 ‘07 MF 1540, FWA, hydro, 40hp, 3pth c/w ldr ....................... $24,900 ‘07 MF 1533, 33hp, hydro, 3pth, frt end ldr, 375 hrs ............. $23,900 ‘92 MF 3690 FWA, 170hp ..................................................... $37,000

4WD TRACTORS

IN STOCK NOW!!!!!!

MT 875C Challenger, 585hp track 36” extreme, poly mid wheels, hyd. swing draw bar, 1 of 2 MT 865C Challenger, 525hp track 36” extreme, poly mid wheels, hyd. swing draw bar, PTO, 1 of 6 MT 855 Challenger, 475hp track 36” extreme, hyd. swing drawbar, PTO, 1 of 2 MT 955C, 475hp, 4WD, powershi ft, PTO, diff lock, 5 hyd, remotes, dual, 800/70R38, 1 of 2 MT 945C, 440hp, 4WD, powershi ft, PTO, diff lock, 5 hyd, remotes, dual, 800/70R38 ‘94 NH 9680, 5, 54 hrs, S76 Shi ft, 20.8R42 Duals ................ $67,000

HEADERS

‘09 NH 940 36 ft draper c/w pea auger + transport .............. $62,500 ‘09 MF 7200, st. cut hdr, 35’ ................................................. $29,000

‘07 MF 8200 fl ex hdr, 35’..................................................... $33,000 ‘03 Honey Bee GB 36 ft, pea auger, transp. fits R65/R75 ....... $35,000 ‘03 Honey Bee SP30 draper, 30 ft, fi ts MF8570 or MF8780 .. $35,500 ‘99 Agco 5000 36 ft draper w/trans, fits R62/72 ................... $29,500 ‘02 Agco 5000, 36 ft draper fits Gleaner R62 ........................ $24,500 ‘96 MacDon 960, 36 ft draper fits R-65 ................................ $24,500 Agco 600, 36 ft draper fits Gleaner R62 ................................ $17,500

USED COMBINES

‘11 MF 9895, 139 hrs, chopper/spreader pu header ........... $385,000 ‘10 MF 9895, chopper/spreader pu header ......................... $289,000 ‘09 MF 9895 c/w PU hdr, chopper, spreader, 555 hrs .......... $299,000 ‘08 MF 9895 c/w PU hdr, 1 of 3 .......................................... $285,000 ‘08 MF 9895, 1 of 3, PU hdr, chopper/spreader .......................... CALL ‘07 MF 9895, 1122 hrs, chopper/spreader, pu header ......... $225,000 ‘09 MF 9795 c/w PU hdr, chopper, spreader, 1 of 2 ............. $275,000 ‘06 MF 9790, 1016 hrs, chopper/spreader .......................... $186,000 ‘06 MF 9790, 726 hrs, chopper/spreader ............................ $195,000 ‘01 MF 8780 XP, chopper/spreader, 1280 hrs ........................ $99,000 ‘97 MF 8780, chopper/spreader pu header ........................... $65,000 ‘97 MF 8570, PU hdr............................................................. $48,000 ‘94 MF 8460 c/w p.u. hdr ..................................................... $37,000 ‘09 Gleaner A86 c/w chopper, spreader, factory warranty .... $299,000 ‘09 Gleaner A86, chopper/spreader ..................................... $297,000 ‘07 Gleaner A85, 1311 hrs, chopper/spreader ..................... $225,000 ‘08 Gleaner R75, 1077 hrs, pu header................................. $225,000 ‘05 Gleaner R65, 1058 hrs, pu header................................. $115,000 ‘05 Gleaner R65, 1748 hrs, pu header................................. $115,000 ‘06 Gleaner R65, pu header ................................................ $149,000 ‘06 Gleaner R65, pu header ................................................ $149,000 ‘03 Gleaner R75 c/w 1800 sp p.u. Hdr. chopper, spreader ... $145,000 ‘98 Gleaner R62.................................................................... $89,000 ‘08 CR 9070 c/w PU hdr, MAV chopper, spreader ................ $190,000

BALERS

‘09 NH BR7090..................................................................... $28,500

MISCELLANEOUS

Hay Rakes 712 Jiffy ................................................................... CALL Bale Processor 920 Jiffy ............................................................ CALL Snow Dozer Blade Horst ............................................................ CALL

More info on used with pictures at www.fulllineag.com OR email rick.r@fulllineag.com

306•934•1546 - Saskatoon, SK 306•773•7281 - Swift Current, SK Dealers for:

SASKATOON SALES: Chris Purcell Dave Ruzesky Doug Putland SWIFT CURRENT SALES: Ross Guenther Tim Berg Murray Weston


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

1089 eng hrs, 752 sep hrs, auger 24’ unloading, cast drum, mod conc ABR.

2008 NEW HOLLAND CX8090

$

239,000 100ft. booms, full GPS, 1000 gal. tank, chem injection.

Equipment Sale 1994 FLEXI-COIL 5000 AIR DRILL

2002 FLEXI-COIL 5000 AIR DRILL

1998 MORRIS MAXIM AIR DRILL

45 ft c/w 2320 TBH tank

51 ft

55 ft c/w 6180 TBH Tank

2003 McCORMICK CX105

$

$

160,000 703hrs, 506 Sep Hrs, RU/PU, Y&M Mon., Small Color Display, Chf Blwr

$

43,500

$

$

33,000

35,500

29,900 SP Windrower, 2480 hrs, 16.5 995 Rotary header

28,000

2000 MORRIS MAXIM AIR DRILL

2002 MORRIS MAX II AIR DRILL

2002 MORRIS MAX II AIR DRILL

49 ft c/w 6300 Air Tank

49 ft

34 ft c/w 8100 CIH Air Cart & 1300 Gal Liquid Cart

2008 NEW HOLLAND CX8080

$

2540 eng. hrs., 3 hyd. outlets, loader.

1997 FLEXI-COIL 3450 AIR TANK

2008 MILLAR A40 HIGH CLEARANCE SPRAYER

$

2006 JD 4995

$

198,000

73,000 796 hrs, 365hp, 1600 gal, fenders, real wheel nozzle, 120ft.

39ft 10in c/w 7240 TBH

$ 2000 MORRIS MAXIM

$

42,000

30,000

$

$

33,000

29,800

2004 NEW HOLLAND CR960 COMBINE

2004 NEW HOLLAND CR940 COMBINE

2008 NEW HOLLAND CX8070 COMBINE

1733 hrs

1681 hrs

1346 hrs

2011 NEW HOLLAND SP365F

$

319,000

1085E/826S hrs., TW20.8R42 duals, yield and moisture monitor

1877E/ 1424S Hrs, Swathmaster, Redekop

2009 NH CX8090

$

1998 NEW HOLLAND TR98

258,000 2200 hrs, 1900 S hrs, elect. stone trap, long unloading auger, single spd rotor

1997 NEW HOLLAND TR98

$

55,000

2011 NH T9.505

$

Luxury cab, Autoguidance 262, WAAS receiver, 4 remotes, F&R diff lock

289,000 286 hrs., Prairie Special kit, cab and rear axle susp., 18.4R26, fixed final drive shields

2011 NH H8040 36’ WINDROWER

$

120,000

$

125,000

ANDERSON BALE WRAPPER

28,900

$

118,900

$

$

173,000

62,000 2552 hrs., 70 ft. booms, 400 gal. tank

COMBINES

2010 NH CX8080 ......................... $242,000 2010 NH CX8080 ........................ $239,000 2009 NH CX8080 ........................ $220,000 2009 NH CX8090 ........................ $258,000 2009 NH CX8070 ........................ $199,000 2008 NH CX8080 ........................ $180,000 2008 NH CX8080 ........................ $185,000 2008 NH CX8080 ........................ $198,000 2008 NH CX8090 ........................ $239,000 2008 NH CX8070 ........................ $173,000 2008 NH CX8080 ........................ $180,000 2006 NH CX840 .......................... $129,000 2005 NH CX860 .......................... $149,000 2004 NH CR940 .......................... $118,900 2004 NH CR960 .......................... $125,000 2003 NH CR940 .......................... $112,000 2002 NH CX840 ............................ $95,000 2001 NH TR99 .............................. $75,000 1998 NH TR98 .............................. $62,000 1997 MF 8570 .............................. $55,000 1997 NH TR98 .............................. $38,000 1997 NH TR98 .............................. $55,000 1997 NH TR98 .............................. $54,900 1996 NH TR98 .............................. $28,500 1995 NH TX66 .............................. $27,000

COMBINE HEADS

$

57

2011 MB D60DK-35FT ................. $57,000 2010 NH 74C-30FT ....................... $33,000 2009 NH 94C-30FT CR/CX ............ $49,900 2003 NH 74C-30FT ....................... $20,800 2000 JD 994-30FT JD9610 .......... $25,000 1999 HY 994-30FT R65/R75/MF ... $25,000 1998 JD 930F ............................... $20,000 1998 NH 994-30FT TR/TX ............. $28,000 1998 NH 994-30FT TX .................. $24,000

1998 NH 994-36FT CR/CX ............ $21,900 1992 JD 925R ................................ $7,500 1988 NH 971 .................................. $5,900

SWATHERS

2011 NH H8040-36FT ................. $120,000 2007 CIH WDX1202-36FT ............. $96,333 2006 JD 4995-16.5FT DB ............. $73,000 2005 NH HW305-30FT .................. $74,000 1999 CIH 8825-25FT .................... $22,900 1997 MF 220 ................................ $29,714 1997 MF 220-30FT ....................... $36,500 1984 MF 885 .................................. $4,000

SEEDING

2011 JD JOHN DEERE 1910 VR AIR CART ......................................... $78,000 2010 CIH 3380 TBT ...................... $62,000 2007 SHAWK 60FT-10IN ............. $159,000 2002 FC 5000-51FT-9IN ............... $33,000 2002 MR MAXIM 2-49FT-10IN ...... $33,000 2000 MR MAXIM 49FT-10IN C/W 6300 ......................................... $30,000 1998 MR MAXIM 55FT-10IN C/W 6180TBH ................................... $28,000 1997 FC 3450 TBH AIR CART VR ... $29,900 1994 FC 5000-45FT-9IN C/W 2320 TBH ........................................... $43,500

ROUND BALERS

2011 NH BR7090 .......................... $23,900 2007 CIH RBX563 ......................... $21,000 2007 CIH RBX563 ......................... $16,900 2005 CIH RBX562 ......................... $13,204 2005 NH BR780 ............................ $12,267 2005 NH BR780 ............................ $17,000 2005 NH BR780 ............................ $14,900 2005 NH BR780 ............................ $16,500 2004 CIH RBX562 ........................... $9,000

2003 NH BR780 .............................. $8,000 2003 NH BR780 .............................. $8,900 2003 NH BR780 ............................ $16,500 2001 NH 688 .................................. $9,900 CIH 8465A .................................... $7,500

1993 SPRAY COUPE

$

25,900

HAYING

Tow between, single shoot, variable rate cart.

2011 NH H7460 ............................ $31,900 2002 NH 1475 .............................. $15,900 1998 NH 1475 C/W 2300 16FT ....... $9,714

SPRAYERS

2011 NH SP365 F - 1600GAL 120FT ...................................... $319,000 2011 NH SP.275R ....................... $299,571 2008 MILLAR A40-1000 GALLON 100FT ...................................... $169,000 2001 FC SYS 67 XL-90FT ............. $19,900 1999 FC S67 WB ............................ $6,000

2010 CIH 3380 AIR CART

$

62,000 1635 hrs, A/C, Deluxe Cab

TRACTORS

2013 BUVA 2375 ........................ $190,000 2013 BUVA 2375 ........................ $199,000 2013 BUVA 2375 ........................ $199,000 2011 NH T9.505HD ..................... $289,000 2008 NH T1520 ............................ $16,400 2003 MCORK CX105 ..................... $35,500

2009 NEW HOLLAND C190 TRACK LOADER

$

MISCELLANEOUS

TRAILER 2010 PJ PJ30 ................... $8,500 TRAILER/GRAIN 2007 DOEPK SUPER B .................................... $45,000 TRACK LOADER 2009 NH C190 ..... $33,900 MOWER/ZERO TURN 2007 CK RZT54 ...................................... $2,679 SILAGE WAGON 1976 RCHTN 1200 ........................................... $5,500 ATV 2009 CK 3100S ........................ $9,250 ADAPTER 2007 NH 2330BF ............ $5,500

33,900 30’ Header Draper, Fits John Deere 9610

2000 HONEY BEE 994

$

25,000

Highway #2 South

Highway #6 North

Highway #10 East

Ph: 306-946-3301

Ph: 306-746-2911

Ph: 306-783-8511

Fax: 306-946-2613 watrousnewholland.com

Fax: 306-746-2919 raymorenewholland.com

Fax: 306-782-5595 yorktonnewholland.com

www.agdealer.com/raymorenh


58

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

2012 Case IH 9230

2011 Case IH 9120

2011 Case IH 9120

2010 Case IH 7120

Lateral tilt, fine cut chopper, stnd spreader..$350,000

Adj steering axle, lat tilt, hopper cover..$315,000

Powerplus cvt feeder, c/w 3016 pick up header...$300,000

575hrs, 900 singles, std straw chopper.. $279,000

TRACTORS

SEEDERS

2WD Tractors

COMBINES

2011 Bourgault 3310 (SC) 75ft, 10” spacing, no MRB’s, 4.5 round

2010 CIH Magnum 215 (SA) w/LC780 loader, luxury cab, PTO, hitch ready, 262 WAAS receiver............................................................$185,000 2013 CIH Puma 130 CVT (SC) MFD, cap suspension, L765 loader, 95” bucket & grapple..................................................................$159,000 2009 CIH Magnum 180 (SA) 3 remotes, L780 loader, S2 outback autosteer, 3 point hitch.............................................................$155,000 2009 Massey Ferguson 7480 (SC) massey 960 FEL loader w/ grapple, 3 point hitch, CVT transmission.................................$94,500 2002 CIH MX240 (ES) 3 point hitch, rear duals, powershift, degelman 12ft 4 way blade............................................................................$90,000 2009 CIH Maxxum 125 (SC) MFD, LX750 loader grapper, rear weights...$85,500 2004 McCormick 135 (SA) PTO 540/1000, FEL with grapple....................$59,000 1988 CIH 7120 (ES) MFD, 20.8 duals....................................... $48,900 1994 JD 7700 (LL) 10,000hrs, ez-on loader, 3 remotes, MFD, dual PTO....$45,900 1997 NH 8260 (SC) loader & grapple, MFD, shedded................$44,900

4WD Tractors

2011 CIH STX550 (ES) PTO, 36” tracks, auto guidance, cab suspension, 6 remotes.............................................................................................$405,000 2010 CIH STX535 (SA) std quadtrac, luxury cab, 1000rpm IND PTO, hi cap hydr pump........................................................................................$357,000 2011 CIH STX450 (SC) 111hrs, full autoguidance, 800 duals, front weight frame................................................................................................$315,900 2009 JD 9430 (SC) full cast weights front & rear, standard transmission, diff

SOLD

lock, 710 duals.................................................................................. 2006 CIH STX480 (SC) luxury cab, guidance ready, 16 speed p/s trans, PTO, diff lock...................................................................................................$195,500 2005 New Holland TJ450 (LL) 710 duals, weights, deluxe cab, EZ guide

SOLD

autosteer, 4 remotes...........................................................................

1989 CIH 9130 (LL) 18.4/38 duals, PTO, powershift..............................$39,000

SOLD

semi-auto packers, duals, 591 monitor...................................

2010 CIH ATX700 (SC) 60ft, 10” spacing, ADX3430 tank, double shoot, sideband................................................................................................$188,000 2008 Seed Hawk 60-12 (SA) TBT JD1910, TBT 270BUH, 2000 gal TBH liquid, no quick pin..............................................................................$185,000 2003 Bourgault 5710 (SC) 54ft, 9.8” spacing, single shoot, 3 1/2” steel packers, 5350 tank, double shoot............................................................................$107,500 2005 Bourgault 5710 (SA) 64ft, 9.8” spacing, mrb, 3 1/2” steel packers, double shoot, 5440 tank, 591 mon..........................................................................$90,000 1998 Bourgault 5710 (SC) 54ft, 9.8” spacing, 2 1/4” steel packers, 2002-5440 tank, 3 tank metering...................................................................................$89,900 1999 Bourgault (ES) 54ft, 12” spacing, 4350 cart, MRB’s, 3.5 steel packers...$85,000 2004 Morris Maxium II (SA) 49ft, 10” spacing, single shoot, 7240 TBT tank.................................................................................................$55,000 2000 Flexicoil 7500 (SC) 60ft, 10” spacing, rubber packers, single shoot, TBH 3450 tank.....................................................................................................$45,900 1996 Flexicoil 5000 (SA) 45ft, dbl shoot, 2320 tank, 9” spacing, rubber packers..............................................................................................$42,500 1999 Flexicoil 5000 (SA) 39ft, 1720 tank, steel packers, NH3 kit, atom jet single openers......................................................................................................... $41,000 1994 FLexicoil 2320 (SA) air cart, tow behind, rear hitch, completely rebuilt in 2006................................................................................$12,500 1997 Bourgault 3225 (SC) new metering auger.......................$10,500

SPRAYERS 2012 CIH 4430 (SC) 600hrs, 120ft, aim command, autoboom, lux cab, PRO700..............................................................................................$310,000 2010 CIH 4420 (SC) 1000hrs, 80 duals, pro 600, autoboom..........$290,000 2009 CIH 4420 (SC) 120ft, full guidance, 650 floaters, aim, luxury cab..$260,000 2009 CIH 4420 (SC) 120ft, aim command, pro 600, autoguidance, omnistar, 380 tires, autoboom...........................................................................$259,500 2010 JD 4830 (SC) 100ft, 1000 gal tank, full auto guidance.........$245,000 2011 CIH 3330 (SA) 100ft, pro 600, aim command, deluxe HID lighting,

SWATHERS 2012 CIH WD1903 (SA) c/w DH362 header, cab suspension, chaff wiper

SOLD

kit...............................................................................................

2010 CIH WDX2303 (SA) upgrade cab, cold start, UII one piece p/u reel, double knife, DHX362 header............................................$135,000 2012 CIH WD1203 (SC) c/w DH362, cab&rear suspension, stnd cab, cold start pkg...........................................................................$135,000 2009 MacDon M200 (SC) 1000hrs, windrower, no header.......$98,000 2009 CIH WD1203 (SC) 500hrs, c/w DHX302 hdr, cab & rear axle sus.....SOLD

2000 Massey Ferguson 220 (SA) 30ft triple delivery..........SOLD 1996 MacDon 4930 (SC) 2000 25ft 972 header, pu reel, 1994 14FT conditioner...$35,000 2006 MacDon S30 (SC) 30ft, pick up reel...................................$17,000

SOLD

accuboom, 262 receiver................................................................. 2005 JD 4720 (SA) 90ft, 800 gal tank, 2 sets of tires, autosteer, fence row nozzles................................................................................................$175,000

2008 Terragator 8204 (SA) 3 way tips, 85ft, 10” spacing..............SOLD 2006 Rogator 1064 (SC) 120ft, loaded & tow sets of tires, 1000 gal tank...$105,500 2005 CIH 3185 (SA) 90ft, aim command, 270 tires..............................$105,000 2000 CIH 4260 (SC) 90ft, 380 tires, chem inductor, autoboom, accuboom...$89,000 2001 Apache AS790 (SA) 90ft, trimble 250, raven controller, 3 ways with 2 nozzles.........................................................................................................$80,000 2001 CIH 3200 (SC) 5200hrs, 90ft, aim command, 800 gal s/s tank, norac autoboom, 5 way nozzle...........................................................$78,500 1998 Wilmar 8400 (SC) 110ft, autoboom, raven controls, outback sterring....54,900 2003 Flexicoil S67 (SC) 90ft, 1500 gal tank, suspended boom, autoboom.....26,900 2007 NH SF216 (LL) 100ft, 1600 gal tank, chem eductor...............17,500

Saskatoon (306) 934-3555 800-667-9761

Swift Current (306) 773-2951 800-219-8867

2010 CIH 9120 (SA) 861hrs, lateral tilt, autoguide Nav II, c/w 2016 pick up header.......................................................................................$299,000 2012 CIH 8120 (SC) 671hrs, lat tilt, hyd fold topper..................$275,000 2009 CIH 8120 (SA) 910hrs, hopper extension, lat tilt, 900 tires.......$272,000 2007 CIH 8010 (LL) deluxe cab, lateral tilt, 24ft unload auger......$229,000 2010 CIH 7120 (SC) duals, auto guidance, HID, fine cut chopper...$220,000 2009 CIH 6088 (LL) AFX rotor, straw chopper, yield logging........$199,000 2006 CIH 8010 (SA) hopper topper, 900 tires, shedded..............$195,000 2009 CIH 7088 (SA) lat tilt, AFX rotor, 800 tires, straw chopper........$180,000 2008 CIH 2588 (LL) AFX rotor, chopper, c/w 2015 swathmaster.........$179,000 2006 JD 9760 (SC) 1328hrs, michel’s topper, single tires, 2006 pick up header............................................................................................$169,500 2008 CIH 2588 (SC) 1250hrs, AFX rotor, chopper, 50.5 singles, hopper topper...$169,000 2004 CIH 2388 (SC) 2110 rotor hrs, topper, long auger, chopper, c/w 2015 swathmaster.....................................................................................$115,900 2003 CIH 2388 (SA) new sieves, new hammers, new bubble up auger, c/e 2015 pick up header................................................................................$89,000 1998 CIH 2388 (SC) new tires, 1015 pu header..............................$59,000 1996 CIH 2188 (SC) AFX rotor, chopper, field tracher...........................$49,000 1989 CIH 1680 (SC) specialty rotor, no header.............................$30,000

HEADERS 2011 CIH 2162 (SC) 40ft, double knife, 5 bat, upper cross auger........$74,900 2010 CIH 2152 (LL) 45ft, dbl knife, 5 batt, AFX adapter, hyd tilt pkg..$67,000 2012 CIH 2152 (SC) 40ft, single knife, slow speed transport, AHHC, AFX adapter............................................................................................... $62,900 2004 CIH 2042 (LL) 36ft, AFX adapter, slow speed transport.......$60,400 2010 CIH 2152 (SC) 40ft, slow speed transport, pu reel, hyd f&a..$59,900 2007 HoneyBee SP40 (SC) 40ft, p/u, hyd f&a, cross auger, AFX adapter, transport........................................................................................... $49,900 2010 HoneyBee SP36 (SC) 36ft, pu reel, transport, hyd f&a..............$47,900 2008 JD 930 (SC) 30ft, with air reel......................................................$47,900 2009 CIH 2020 (SC) 35ft, p/u reel, fore & aft, auto header..........$39,000 2003 Macdon 972 (LL) 36ft, pu reel, pea auger..................................$39,000 2007 HoneyBee (SC) 36ft, UII pu reel, transport, 2588 adapter..........$35,900 2012 CIH 3016 (SC) AUX front wind guard, 15ft, PTO drive, castor gauge wheels...............................................................................................$29,900 2002 CIH 1042 (ES) 30ft, pick up reel, 2388 adapter..................$28,500 2000 HoneyBee SP30 (SC) 30ft, p/u reel, transport, fore & aft...$24,000 2004 CIH 1010 (SC) 30ft, pick up reel, full finger auger...............$19,000 1997 Macdon 960 (LL) 36FT, p/u, pea auger, 2388 adapter.........$17,900 2006 Macdon S30 Header (SC) 30ft swather pick up reels.......$17,000 1994 CIH 1010 (LL) 30ft, p/u reel, transport.................................$11,900 1998 CIH 1020 (SA) 30ft, p/u reel, poly skids................................$10,500 1986 CIH 1015 (SC) melroe pick up................................................$7,500

Lloydminster (306) 825-3434 800-535-0520

Estevan (306) 634-4788 866-659-5866

w w w . r e d h e a d e q u i p m e n t . c a


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

TTO H U A G IK & L C N U E TR E ! R T G

E G

U W HO L B

2010 FORD F150 HARLEY DAVIDSON

FULLY LOADED

LEATHER SUNROOF PST PAD 4X4 5.3L 94KM

SAVE $$$

U O G!

E V SA

2009 GMC SIERRA 1500 SLF GFX EDITION

FULLY LOADED PST PD 4X4 5.4L SUNROOF NAVIGATION BACK UP CAMERA PRICED TO SELL

4 TO CHOOSE FROM!

BLACK BEAUTY

BEST

SELECTION

2012 FORD F250 XLT

2011 DODGE RAM 1500 LARAMIE

FULLY LOADED

6.7L DIESEL LOADED 4X4 105KM

HEMI PST PD 4X4

WE NEED YOUR TRADES

BI

ONLY 40KM

JUST IN!

$39,995 2008 CADILLAC ESCALADE EXT

View ALL INVENTORY ON-LINE

2009 FORD F150 KING RANCH

FULLY LOADED

FULLY LOADED PST PD 4X4 5.4L

90KM PST PD

NOW

4 TO

PRICED TO SELL

$25,995

CHOOSE FROM

www.GreenlightAuto.ca 2008 FORD F250 KING RANCH

2008 DODGE RAM MEGA CAB DIESEL

6.4L DIESEL

FULLY LOADED

SLT PST PD 4X4 LOADED FULLY INSPECTED

$29,995

$23,995

PST PD 4X4

59

2006 DODGE RAM 2500 SLT

5.9L CUMMINS DIESEL

LOADED 4X4 AUTO 290KM

FRESH TRADE

LOWERED TO

Call FINANCE HOTLINE 306-934-1455 2715 FAITHFULL AVE., SASKATOON, SK.

DL#311430

MAPLE FARM EQUIPMENT 1989 JD 9600

1996 JD 9600

5231 hrs., 3784 sep, 914 hdr.

3789 hrs., 2824 sep., 914 hdr.

$

41,100

$

1997 JD CTS

1997 NH TR98

5027 hrs., 914 hdr.

4060 hrs., 971 hdr.

$

$

55,600

69,000

33,000

2004 Brent 620 Grain Cart

2004 JD 9760 STS

$

$

2361 hrs., 1686 sep., 914 hdr.

19,500

BALCARRES, SK 306-334-2492

172,200

1995 John Deere CTS Combine Engine Hours: 4408; Sep Hours: 3202 ............ $41,700 1993 John Deere 9600 Combine Engine Hours: 4652; Sep Hours: 3326 ............ $55,000 1989 John Deere 9600 Combine Engine Hours: 5231; Sep Hours: 3784 ............ $41,100 1989 John Deere 9600 Combine Engine Hours: 4861; Sep Hours: 3362 ............ $27,800 2007 John Deere 9760 STS Combine Engine Hours: 2187; Sep Hours: 1524 ......... $195,000 2005 John Deere 9760 STS Combine Engine Hours: 2283; Sep Hours: 1744 ......... $155,000 2009 John Deere 9770 STS Combine Engine Hours: 748; Sep Hours: 541 ............. $262,000 2008 John Deere 9770 STS Combine Engine Hours: 1086; Sep Hours: 764 ........... $242,000 2008 John Deere 9870 STS Combine Engine Hours: 1121; Sep Hours: 681 ........... $267,000 2011 John Deere 9870 STS Combine Engine Hours: 1036; Sep Hours: 728 ........... $339,000 2009 John Deere 9870 STS Combine Engine Hours: 942; Sep Hours: 661 ............. $275,600 2012 John Deere S680 Combine Engine Hours: 297; Sep Hours: 220 ............. $421,700 2010 John Deere A400 Windrower Hours: 477; Sep Hours: 360 ........................ $123,000 2006 Massey Ferguson 9220 Windrower Hours: 930 ..................................................... $59,900 2006 MacDon 4952I Windrower Hours: 1997; Sep Hours: 1607 ....................... $80,500

FOAM LAKE, SK 306-272-3345

62/'

2011 John Deere D450 Windrower Hours: 138 .................................................. $152,200 2012 John Deere A400 Windrower Hours: 120 .................................................. $132,400 2012 MacDon M155 Windrower Hours: 176 .................................................. $143,000 2011 John Deere A400 Windrower Hours: 350 .................................................. $139,000 2011 John Deere A400 Windrower Hours: 332 .................................................. $133,300 2006 John Deere 4895 Windrower Hours: 822; Sep Hours: 655 ........................... $85,600 2006 Honey Bee SP30 Header Draper Now............................................................... $32,200 2006 Honey Bee SP30 Header Draper Now............................................................... $32,200 2003 Honey Bee SP30 Header Draper Now............................................................... $26,700 2010 John Deere 640D Header Draper Now............................................................... $73,300 2004 John Deere 936D Header Draper Now............................................................... $43,900 2011 MacDon D60 Header Draper Now............................................................... $81,700 2010 John Deere 640D Header Draper Now............................................................... $72,200 2009 John Deere 635D Header Draper Now............................................................... $53,900 2009 John Deere 635D Header Draper Now.............................................................. $53,900

62/'

62/'

PREECEVILLE, SK WYNYARD, SK YORKTON, SK 306-547-2007 306-554-2536 306-783-9459 WWW.MAPLEFARM.COM

2009 Elmers 1600 Grain Cart

2010 JD 9870 STS

$

$

651 hrs., 463 sep., 615P hdr.

69,500

318,100

2011 Case IH STX500

2011 Case IH STX535

815 hrs.

798 hrs.

$

311,000

2011 JD 953OT

$

2012 JD A400

1889 hrs..

$

283,500

MOOSOMIN, SK 306-435-3301

280,000

409 hrs., HB hdr.

$

146,700

RUSSELL, MB 204-773-2149


AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

RO TI UGHR CK IDE ET R S WI T

RE CE IV E

60

HUGE ALL-MAKE TRUCK SALE!

2F

HOTEL & FUEL PAID FOR ALL OUT OF TOWN BUYERS

4x4

4x4

MONSTER LIFT

DIESEL FORD F350 HARLEY DAVIDSON LOADED! Power Stroke Diesel, Leather, black on black

$32,400

SUMMER $ SPECIAL

26,777

DIESEL 2012 RAM 3500 LONGHORN DUALLY

59,995

4x4

$229 B/W

E

DDIESEL IESSEL IE 2011 FORD F350 CREW LARIAT

LOADED! Cummins Diesel! Huge Mega Cab, Leather, 6000KMS ON SALE ONLY MSRP OR EASY LEASE $ $

$86,385

RE

PU H RC EA HA CH SE

LOADED! 22” wheels, tow pkg, fender flares

HUGE SALE ON NOW!

699/MO

4x4

$239 B/W

LOADED 2011 CHEV SILVERADO

2011 FORD F150 SHORT BOX

2008 GMC SIERRA 2500 HD

2011 F150 CREW FX4 4X4

LOADED! Chrome pkg, Rims, many extras!

4x4, all power options, alloys, access doors

4 doors, All power options, tow & payload pkg,

LOADED! Ecoboost, tow pkg, leather, extras

LOW

$32,500 PRICE $27,377

$26,250

WOW

$

19,995

$20,825

4x4

DIESEL

LOADED DUALLY 2007 RAM 3500 LARAMIE 4X4, Tow pkg, chrome pkg, leather seats

LOW $33,890 PRICE $27,444

4x4

$139 B/W

2009 F150 SUPERCREW Local trade. Excellent condition! Great Value!

$21,500

WOW $ ONLY 16,799

WOW

$

17,555

- GREAT SELECTION - 550+ UNITS - WARRANTY AVAILABLE ON ALL UNITS - OPEN EXTENDED HOURS - WE DELIVER ANYWHERE! - ALL UNITS GUARANTEED - ALL TYPES OF TRADES WELCOME - PLAY AREA FOR THE KIDS - STARBUCKS CUSTOMER LOUNGE - EASY ON-SITE FINANCE - INSTANT APPROVALS - FRIENDLY STAFF TO SERVE YOU

LOW

$34,750 PRICE $29,997

4x4 2008 CHEV AVALANCHE LTZ LEATHER, custom wheels, fresh trade!

LOW

$29,470 PRICE $24,377

4x4

$239 B/W

4x4

LUXURY TRUCKS

LINCOLN MARK LT 4X4

2007 GMC SIERRA E/CAB

2011 FORD F150 SVT RAPTOR

LOADED! Chrome, box cover, leather, prem sound

2012 RAM 2500 CREW CAB

Excellent Value! Loaded with features!

LOADED! 6.2L, 411 HP! Leather, sunroof

Loaded! Tow pkg, signal mirrors, box liner

LOW $18,950 PRICE $14,440

SUPER DUTY

4x4

LOADED! Tow Pkg, machined alloys, Box steps

SALE $27,550 PRICE $22,946

$40,575 VALUE $34,999

GREAT

SPECIAL

SUBARU

609 WINNIPEG STREET (306)525-6700 REGINA, SASKATCHEWAN 1-888-763-6700 www.autogallery.com Prices include any trade worth $2500 or cash equivalent. DL#917632

LOCATION

609 Winnipeg St. Regina, Sk. R Winnipeg St.

As New! All power options, V8, alloys

11 y#

2012 RAM 1500 QUAD CAB 4X4

Loaded! Low kms, One owner. All options

SALE

$33,745 PRICE $29,211 Hw

2009 HONDA RIDGELINE EX

2012 FORD F250 CREW CAB 4X4

Hwy #6

AS NEW

2012 TOYOTA TACOMA TRD Loaded! Off-road pkg, hood scoop, as new!

Broad St.

PST PAID

$28,770 PRICE $23,727

LOW $ $36,555 PRICE 29,988

Albert St.

$179 B/W

$48,450

WOW $ ONLY 39,888

Pasqua St.

RARE $ TRUCK ONLY 22,995

4th Ave. Dewdney Ave.

ing

Ro

ad

Ross Ave.

Victoria Ave. Hwy #1 East


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

61

SOUTH COUNTRY EQUIPMENT LTD.

#00658401

#0746230A

COMBINES

2000 JD 9650 CTS

2619 sep hrs, auto header height, deluxe hdr ctrl,800x32. WAS $79,000

$

CASH SALE

71,000

2012 JD S680

253 hrs., 520/85R42, JD link, premium. WAS $395,300

CASH SALE

$

#0731288B

2009 JD 9670 STS 480/70R30, 20.8X38 duals. WAS $212,000

CASH SALE

$

190,800

#00691834

2001 JD 9750 STS 420/80R46, var spd., chop, chaff. WAS $121,900

CASH SALE

$

0692259A

2001 JD 9650 STS 2176 sep., 800/65R32, premier. WAS $104,000

$

CASH SALE

93,600

2011 JD 9770 STS 405 sep 600/65 R28, premie.. WAS $299,900

CASH SALE

$

254,700 #0745777A

2009 9570 STS

2012 JD S670

374 hrs., 800/65R32, sprdr, chaff. WAS $220,700

$

188,100

457 hrs., 520/85R42M, JD link. WAS $342,400

CASH SALE

$

#0736815A

2010 JD 635F Auger composite fingers. WAS $52,800

CASH SALE

$

45,180

103,500 #0742219A

#0730543A

CASH SALE

336,600

307,800 #0715877A

2006 JD 9860 STS 1153 hrs., 520/85R42, chop/chaff. WAS $218,700

CASH SALE

$

186,300

#0500976B

2005 Honey Bee SP36 Draper F/A, gauge wheels, UII pickup reel

CASH SALE

$

225,505

(7) 12 JD S680 combines - 132 hrs up, GS3 2630, JD Link ................................................$362,000 up (MJ, RM, S) (2) 12 JD S670, demo’ed combines, 246 hrs up ..............................................................................$342,000 up (M) (4) 09 JD 9870sts, 681 hrs up, premier cab............................................................................$254,900 up (M, R, W) 10 JD 9870 STS, 702 hrs, premier cab ..........................................................................................$272,000 up (MJ) (5) 11 JD 9770 STS, 245 hrs up, premier cab ...................................................................... $276,500 up (M, MJ, W) 09 JD 9770 STS, 586 hrs, 520/85R38 duals, hopper top ......................................................................$241,100 (M) 09 JD 9670 STS, 1021 hrs up, 208x38 duals .........................................................................................$212,000 (A) 09 JD 9570S, 374 hrs,800/65R32, chop, sprdr .....................................................................................$209,000 (W) 06 JD 9860 STS, 1153 hrs, 520/85R42 ............................................................................................ $207,000 up (R) 05 NH CR9070, 1306 hrs, w/Rakeup 76C PU .....................................................................................$205,800 (MM) (2) NH CR9060, 609 hrs up,800x32..................................................................................................$176,800 up (M) 04 JD 9860 STS, 1854 hrs,800/65R32, deluxe hdr ctrls .....................................................................$155,100 (RM) (4) 04 JD 9760 STS, 1743 hrs up, sprdr, chop .............................................................. $122,500 up (M, MJ, MM, W) 02 JD 9650 STS, 1956 hrs,800/65R32, auto header, dial spd, Crary ext............................................. $111,500 (MJ) (2) 01 JD 9750 STS, 1964 hrs up, 305LX32 ............................................................................. $106,000 up (RM, W) 03 JD 9650W, 1901 hrs, dial spd, auto head height..............................................................................$104,000 (W) 01 JD 9650 STS, 2176 hrs up ,800/65R32, chaff, chop .......................................................................$104,000 (W) 00 JD 9650W, 2017 hrs, dial spd, auto Hdr height, 305L-32....................................................................$92,300 (A) 01 CIH 2388, 2365 hrs, dial spd, 305/32, w/2015 PU Swathmaster ................................................... $82,500 (MM) 00 JD 9650 CTS, 2619 hrs,800x32, fine cut chop, 20’ .............................................................................$79,000 (S) 94 JD 9600, 3424 hrs, 305x32, Crary Chaff Sprdr ...................................................................................$56,500 (S) (2) 97 JD CTS, 2589 hrs up , dial spd, chopper ........................................................................... $55,300 up (RM, S) (2) 97 JD 9600, 2589 hrs up, dial spd, dual range ........................................................................ $50,800 up (A, R) 96 JD CTS, 2566 hrs , 305x32, dial matic , Crary Top ..............................................................................$52,200 (A) (2) 97 JD 9500, 3100 hrs up, dial spd, ..............................................................................................$41,400 up (M) 95 JD 9600, 3030 hrs, dial spd, 20’ aug, chaff sprdr .............................................................................. $45,000 (M) 98 JD 9510,4008 hrs, dial spd, 305L-32, hop topper.............................................................................. $44,800 (M) 1990 - JD 9500 & 9600, 3617 hrs up..........................................................................................$26,000 up (M, MJ)

HEADERS 10 & 11 MacDon FD70-40' ..............................................................................................................$75,500 up (MJ) (3) 10 MacDon FD70 - 45' flex draper hdr, off JD 70 series comb ..................................................... $79,500 up (R) (2) JD 640FD, flex drapers .................................................................................................................... $77,600 (MJ) 10 JD 635D, draper, cutbar full width skid shoes ....................................................................................$75,000 (R) 10 MacDon D60, 35', dble knife, f/a, 60/70 series hookup .....................................................................$72,800 (S) 09 -11 MacDon FD70 -35' .......................................................................................... $65,500 up (A, M, MJ, MM, S) 08 MacDon D60 - 40' rigid, f/a, , auto header height, hyd tilt ................................................................. $63,600 (M) 10 MacDon D60, 35', f/a, gauge whls ......................................................................................................$58,600 (S) 10 & 11 MacDon D60-35' ...................................................................................................................$58,500 up (S) (5) 11 JD 635D headers starting at............................................................................................................... $53,000 07 MacDon 974, 36', f/a, upper cross aug, reel spd sensor ...................................................................$51,400 (W) 2009 & 2010 JD 635 flex headers starting a ........................................................................................$50,200 (R) (5) 12 JD 635F headers ...................................................................................................................$50,100 up (MJ) (2) 10 JD 635D, came off JD 9870s .........................................................................................................$50,000 (R) 06 MacDon 974 36', single knife, cross aug ......................................................................................... $48,800 (MJ) (9) 09 JD 635 Flex headers ............................................................................................... $38, 900 up (MM, R, S, W) 05 Honey Bee SP36 header .................................................................................................................. $38,300 (MJ) 06 & 08 Honey Bee WS30 headers .............................................................................................$34,600 up (M, RM) 02 Honey Bee SP36, new knife, newer guards, UII PU ............................................................................ $33,000 (M) We have a wide range of headers - variety of years and sizes - please call for details!

SPRAYERS (2) 12 JD 4940, 322 hrs up, 120’................................................................................................. $360,000 up (M, R) 10 JD 4930, 120', 380/105R50, swath Ctrl pro, 20" noz space .............................................................$302,000 (R) 09 JD 4930, 1021 eng hrs , 120’, 20” nozz ...........................................................................................$299,000 (W) 08 JD 4930, 120' 20" nozz space, 1443 hrs, 710/70R42 ....................................................................$298,000 (RM) 11 CIH 4420, 1050 hrs, 120', 1200 gal, 650/65R38 ...............................................................................$288,000 (A) 10 JD 4930, 1010 eng hrs , 120’, 20”nozz .............................................................................................. 280,000 (M) 11 JD 4830, 845 hrs, 100’, 20” nozz, 520/85R38...............................................................................$272,000 (MM) (3) 08 JD 4930, 1682 hrs up, 120’, 20” noz ............................................................................$253,000 up (M, S, W) 08 CIH Patriot 4420, 120', Trimble, Aim Command, 650/65R38 .............................................................$226,000 (R) 11 JD 4730, 750 hrs, 90',800 gal, 380/90R46 .......................................................................................$215,080 (S) (2) 06 JD 4920, 1975 hrs up, 120', .............................................................................................. $210,000 up (R, S) 05 JD 4920, 1858 hrs, 380/105R50, autotrac .......................................................................................$191,500 (M) 10 Apache 715 -90',800 gal, Raven autorate, Trimble 500 ....................................................................$145,000 (S) 94 Ag Chem 1844 Terra Gator 60' float truck...........................................................................................$46,000 (S) 09 Brandt SB4000 90', triple combo swivel jet ...................................................................................... $34,600 (M) 08 Brandt SB4000 100' field spray, Norac, Ace hyd pump....................................................................$33,200 (RM)

TRACTORS 12 JD 9560R, 20 hrs, 560 Hp, demo unit ............................................................................................ $435,000 (MJ) 12 JD 9510R, 466 hrs, 510hp,800/70R38, 6 hyds.................................................................................$374,200 (M) (2) 11 JD 9630T, 875 hrs up, 36” trk belt, deluxe comfort pkg ................................................. $374,000 up (R, RM) 09 JD 9630T, 1581 hrs, deluxe comfort pkg, HID lights ........................................................................$317,500 (M) 08 JD 9530T, 1905 hrs, deluxe cab, 1000 pto ........................................................................................$283,000 (S) (2)11 JD 9430, 1500 hrs, diff lock, 710/70R42 ......................................................................... $276,000 up (MJ, W) 08 JD 9630, 2258 hrs, 18F/6R,800/70R38, diff lock ........................................................................... $269,000 (MJ) 11 CIH Steiger 450-4WD, 710/70R42, w/Degel 7900 blade ................................................................ $258,000 (MJ) 07 JD 9420, 1891 hrs, 425 hp, 710/70R42 ...........................................................................................$229,000 (M) 06 JD 9620, 4WD,500 hp, diff lock,800/70R38, Greenstar autotrac.................................................... $225,000 (MJ) 02 NH TJ450, 5013 hrs, 16F/2Rps,800/70R38 ......................................................................................$124,000 (M) 04 JD 7920, 4350 hrs, 520/85R42, MFWD, 4hyds ..................................................................................$120,800 (A) 98 JD 9200, 5230 hrs, 184-42 triples, diff lock ....................................................................................$109,000 (S) 03 NH TM190, 1550 hrs, w/ Q980 Ldr ..................................................................................................... $80,500 (W) 05 JD 7520, 4800 hrs, MFWD, w/741 Load ..............................................................................................$93,000 (A) 95 JD 8870, 5044 hrs, 12spd, 4 hyd, 208R-42...................................................................................... $79,000 (MJ) 04 CIH MXM130, 3106 hrs, MFWD, w/LX162 Load...................................................................................$60,500 (A) (2) JD 7610, 11,500 hrs up, MFWD, 184x38 .................................................................................$51,600 up (A, MJ) 88 JD 4850, 5138 hrs, (3 new 208x42 tires), MFWD............................................................................... $33,200 (M) 97 JD 6400 cab, 6968 hrs, 16 spd, 184X34 ............................................................................................$26, 900 (R)

Assiniboia, SK (A) 306-642-3366 Montmartre, SK (MM) 306-424-2212 Moose Jaw, SK (MJ) 306-692-2371 Mossbank, SK (M) 306-354-2411 Raymore, SK (RM) 306-746-2110 Emerald Park/ Regina, SK (R) 306-721-5050 Southey, SK (S) 306-726-2155 Weyburn, SK (W) 306-842-4686 Don’t forget to visit

www.southcountry.ca

WINDROWERS & HAYING 11 JD D450, w/ 635D, Autotrac, rotosheers ...........................................................................................$167,500 (R) 12 JD D450, 73 hrs w/ JD 635D header ...............................................................................................$166,000 (M) (6) 11 JD D450 Wdr's, 363 hrs up, w/JD 635D headers ................................................................... $146,000 up (R) (2) 09 JD 4895, 804 hrs, w/ Honey Bee headers .................................................................... $107,000 up (MM, R) (2) 08 JD 4895, 695 hrs, w/ Honey Bee 36' hdr ........................................................................... $109,000 up (R, S) 10 CIH WD1203, 566 hrs, w/30' draper head, 18' auger hdr ................................................................$109,000 (W) 09 NH H8040 Wdr , 1744 hrs, w/Honey Bee 30' draper ........................................................................$102,000 (M) 07 NH HW325 Wdr,400 hrs, w/WS30 Hdr, dual knife ..............................................................................$98,500 (R) 09 MF 9430 Wdr, 1190 hrs, w/30' hdr, UII reel ...................................................................................... $81,700 (MJ) 98 MacDon 4820 Wdr, 3300 hrs, w/ 972-25" & 16' auger hdr.................................................................$56,600 (A) 09 JD 568, 7140 bales, mega wide plus pu, pushbar, surf wrap .............................................................$31,900 (R) (3) 03 JD 567 balers, hyd pu, mega,5000 bales up ................................................................$18,000 up (A, MM, S) 02 JD 567, 7500 bales, push bars, all new belts .................................................................................... $18, 700 (S) 08 NH BR7090, 850 bales , crop saver whls .........................................................................................$21,500 (RM)

Don’t forget to visit www.southcountry.ca


62

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

1-800-667-4515 www.combineworld.com

SASKATOON REGINA

20 min. E of Saskatoon on Hwy. 16

SAVE UP TO 50% NEW & USED PARTS • 1 YEAR WARRANTY JD 9600/10, 9750/60 STS $ tight knife rotor upgrade kit .....

4,100 $ TX66/68 ................................. 6,800

8,900 9,000 9,350

$ TR95-TR99 ............................................................................... $ CR960/9060 ............................................................................. $ CIH 88 series ............................................................................

JD 9600/10 fine cut.............................

866 795 990 $ 24.5-32 14 ply ................................... 1,749 $ 30.5-32 16 ply .................................. 2,195 20.8-38 12 ply .......................

3,950 1,795 295 555

9,850 13,702 13,900 14,702

$

23.1-26 12 ply .......................................

$ $

18.4-38 12 ply ....................... MORE SIZES IN STOCK. RIMS ALSO AVAILABLE

$ JD 615 table auger .............................. Hopper extensions $ JD/CIH/NH ............................................ CIH 1460-2388 front $ rotor bearing holder .................................. $ CIH header lift cylinder .............................

JD 9400-9600/10/CTS/ $ CTSII Kit w/o tires ......................................... JD 9400-9600/10/CTS/CTSII Kit $ c/w new 20.8-38 tires ................................ CIH 1680-2588 Dual Kit $ w/ new 20.8-38 tires ................................. JD STS Kit $ c/w new 20.8-38 tires ................................ TRADE YOUR SINGLES FOR DUALS

650 895 990 1,690

JD steering arm spindle............................

$

$ JD/CIH Unloading auger extension ............ 20’ Unloading auger tube $ JD 9500-9600/STS 50.............................. CIH heavy-duty rear steering $ axle centre tube...................................

“Awesome deals today. I’ll come back again! Lots of stuff available.” — Patrick Stocker Wolseley, SK

3,845

$

CIH 80/88 series ................................... $4,310 JD STS 70 Series.................................. $5,145

MacDon Old Style MD headers & swathers.................. $1,495 MD wobble box pulley .$259 MD wobble box arm .... $165

NOW ALSO OPEN ON SATURDAYS!

MON-FRI: 8:00 AM-5:00 PM SATURDAY: 8:00 AM-2:30 PM

USED CHAFF SPREADERS BLOWOUT SALE! $ Complete units,

695

while supplies last........................................

MOST MAKES AND MODELS AVAIL.

PICKUP REELS IN STOCK NEW HCC (Hart Carter) 30’ $ JD930/CIH 2010/20 ............................... 6,795 $ UII 25’ MD 960 ..................................... 6,830 $ HCC 35’ CIH 2010/20 ............................ 7,300 $ UII 30’ HB SP30/MD 960 ....................... 7,900 $ UII 36’ HB SP36, 1-pc........................... 8,900

ALL NEW WOBBLE BOXES OEM QUALITY – USED & REBUILT ALSO AVAILABLE

NEW STRAWCHOPPERS IN STOCK CIH 40/60 chopper w/drive$4,080

486 558 770 698 898 789

$ 14.9-24 12 ply ....................................... $ 16.9-28 12 ply ....................................... $ $ 18.4-34 12 ply ........................ $ $

NEW PARTS IN STOCK

NEW REDEKOP CHOPPERS

DUAL KITS

NEW TIRE DEALS

FACTORY DIRECT – NO MIDDLEMEN

MacDon New Style John Deere MD headers & swathers CIH CIH JD 200/900 ............. $1,095 1042/1052/1062 ..... $1,995 $ CIH 1010/1020/ JD wobble box pulley .. 259 MD wobble box pulley .$389 4000/5000 .............. $1,595 JD wobble box arm ..... $195 MD wobble box arm ....$223 NEW ARM AND BEARING ARE REQUIRED FOR WARRANTY

MacDon Update Kit Convert old style to new style. Pulley & arm included ........... $2,497

USED $ UII 21’ MF200 ........................................ 3,780 $ UII 24’ MF ............................................. 4,480 $ HCC 36’ HB/AGCO ................................ 5,980 $ HCC 30’ IH/JD/NH .................................. 6,975 $ UII 42’ HB/NH ........................................ 7,800

USED KITS

750 950 1,275 1,980 2,750 3,500

$ Auto header height CIH 2388 ............................... $ Reel Fore/Aft kit CIH/TR .................... Starting at $ Cross flow fan kit CIH 80/88 series.................. $ Bubble-up auger upgrade kit TR96-98 ........... $ Hydraulic reverser CIH 2388 ........................... PTO drive w/ clutch $ assembly for CIH 80/88 ............... Starting at

Clean your own air filter in seconds!

$

389

GUARDS 66603

Ralph Mohr Parts, Ag World Equipment

6$9(



Reg. $13

For MF 200-5200

GUARDS

SICKLE ASSY.

For MF 200-220 26’ Reg. $714

BLOWOUT!

9

$ 99

6$9(



BLOWOUT! Knife head not included.

$

1599

399

KONDEX KNIFE ASSY.

For MF 5200 30’ Reg. $611

BLOWOUT! Reg. $23

$

BLOWOUT! Knife head not included.

ENDS

$

499

AUG. 15, 2013 Kinistino, SK

*While quantities last. No rainchecks.

6$9(



GRAIN BAGS 9’

10’

12’

30’ Reg. $824

STARTING AT

BLOWOUT!

$

$

449

LIFTERS

6$9(83



72

36’ Reg. $770

BLOWOUT!

$

599

499

6$9(



BLOWOUT! AS100

Reg. $41

$

2599


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013



),1$1 &, 02 1*)25 17+ 2$& 6

1995 NEW HOLLAND TR97

1997 NEW HOLLAND TR98

62/' 2278 sep hrs.

$

22,000

$

32,500

94,500

$

2000 CASE IH 2388

183,500

62/' 1365 sep hrs.

2006 NEW HOLLAND CR970 1488 sep. hrs.

169,000

$

2002 GLEANER R62

145,000

279,000 1999 CASE IH 2388

$

205,000

2004 NEW HOLLAND CR970

2570 sep hrs.

2240 sep hrs.

72,500

2003 NEW HOLLAND CX860 1880 sep. hrs.

119,000

$

$

1998 NEW HOLLAND TR98 2566 sep. hrs.

32,000

$

$

199,000

1500 sep hrs.

$

2009 NEW HOLLAND CR9070

215,000

110,000 2009 NEW HOLLAND CR9070

543 sep hrs.

$

199,000 2003 NEW HOLLAND CR970

1230 sep hrs.

$

62/' 105,000

632 sep hrs.

2008 NEW HOLLAND CR9070

2003 NEW HOLLAND CR960

$

170,000

96,000 2008 NEW HOLLAND CR9070

1197 sep hrs.

1272 sep hrs.

127,000

1827 sep hrs.

$

62/'

62/' 62,500

227,500

11,500 2003 NEW HOLLAND CX840

2005 NEW HOLLAND CR970

2641 sep hrs.

81,900

$

617 sep hrs.

$

1998 JOHN DEERE 9610

$

62/'

$

$

165,000

2942 sep hrs.

2009 NEW HOLLAND CR9070

538 sep hrs.

62/' $

2008 NEW HOLLAND CR9070

2325 sep hrs.

110,000

1410 sep hrs.

$

$

1449 sep hrs.

2004 NEW HOLLAND CR970

212,000

497 sep hrs.

62/' $

77,900 2010 JOHN DEERE 9870

2003 NEW HOLLAND CR970

77,000

2005 NEW HOLLAND CR970

158,000

22,500

$

733 sep hrs.

$

1985 NEW HOLLAND TR96

1549 sep hrs.

2009 NEW HOLLAND CR9070

2420 sep hrs.

242,000

2262 sep hrs.

$

193,000

62/'

440 sep hrs.

$

$

2000 JOHN DEERE 9650

$

2004 JOHN DEERE 9860 STS

1051 sep hrs.

256,000

2009 NEW HOLLAND CR9070

283,000

988 sep hrs.

$

3904 sep hrs.

552 sep hrs.

2007 NEW HOLLAND CR9070

$

62/'

2011 NEW HOLLAND CR9070

897 sep hrs.

$

125,000

$

2006 JOHN DEERE 9860 STS

492 sep hrs.

1995 NEW HOLLAND TR97

10,900

62/'

124,500

$

3821 sep hrs.

$

2006 GLEANER R65

$

1250 sep hrs.

1990 NEW HOLLAND TR96

2681 sep hrs.

2009 NEW HOLLAND CR9080

62/'

3591 sep hrs.

2003 GLEANER R75

$

2003 NEW HOLLAND CR960

538 sep hrs.

$

215,000

$// 35,&(6$5(

&$+

CLICK ON FARMWORLD.CA FOR MORE PICTURES AND INFO Follow Twitter Farm World on for parts NH ld or W rm @Fa ecials, sp t en and equipm ts, ld Farm Wor even n, fu , ts es nt co and winning!

HWY. #3, KINISTINO, SK HWY. #5, HUMBOLDT, SK 235 38TH ST. E., PRINCE ALBERT, SK

306-864-3667 306-682-9920 306-922-2525

Check out our website at www.farmworld.ca

63


64 CLASSIFIED ADS

HWY

21

Feeders

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

2 7 t h A N N U A L R O C K I N G W FA L L HORSE SALE. Sat., August 31st, Keystone Centre, Brandon, MB. Late entries accepted. More info call: 204-325-7237 or email: rockingw@xplornet.com Held in conjunction with Northern Lights Barrel Racing Faturity. www.rockingw.com

W ANTS TO BUY YOUR CATTLE DIRECT

SINCLAIRâ&#x20AC;&#x2122;S FLYING S Ranch 6th Annual Production Sale, Aug. 10th, 2:00 PM. 35 One owner APHA and AQHA horses. Broke mares and geldings, 2013 foals and broodmares. Call 306-845-4440, Spruce Lake, SK. Catalogue online at buyagro.com â&#x20AC;˘N o co m m issio n s â&#x20AC;˘ N o tru ckin g co sts â&#x20AC;˘ N o so rtin g fo r gen d er n eed ed â&#x20AC;˘ Flexible w eigh co n d itio n s â&#x20AC;˘O ptio n o freta in ed o w n ersh ip â&#x20AC;˘Pu rch a sin g fro m 4 w estern pro vin ces

RANCH COUNTRY HORSE SALE (Perrin, Parsonage, Bertrams) on Sat., Sept. 14th, 1:00 PM. Sale Preview. 9:30 AM. Rodeo Grounds, Maple Creek, Sask. Approx. 45 AQHA/APHA foals from the members. Approx. 40 riding horses from members and  C ALL LY LE@ 403 546 -2278 EX T. 6 guest consignors. For catalogue/ info. call Ken Perrin, 306-662-3730, Lou Parsonage, 306-299-4474. Catalo gue online at: BRED HEIFERS: 29 Black Angus, 18 Charo- www.northernhorse.com/ranchcountry lais Red Angus cross; 2 yearling Black Angus bulls. 306-695-3585, Indian Head, SK. BAR HEART HORSE SALE, Aug 10, 2013. Offering 35 ranch broke geldings. View BLACK AND RED Angus cow/calf pairs catalogue online: www.barheartranch.com for sale. 306-773-1049, Swift Current, SK. For more info call 780-754-2296, Irma, AB

5TH ANNUAL PRAIRIE HARVEST Horse Sale, Sunday, August 25, 2013, 1:00 PM at Johnstone Auction Mart. Featuring quality ranch/pleasure/show geldings and mares, well started younger geldings and mares, brood mares, yearlings and 2 year olds, teams, Registered and Grade. For more info or to be mailed a catalogue, call Scott Johnstone, Auctioneer, 306-631-0767 or Glen Gabel, Consultant, 306-536-1927, Moose Jaw, SK. Catalogues on-line early Au g u s t at w w w. j o h n s t o n e a u c t i o n . c a PL#914447.

4- HAFLINGERS: 10 yr. old mare, Reg. 14.1 HH, started riding and driving, quiet, powerful, $2000; 14 yr. old mare, 13.1 HH, drives single or double, some riding, $1500; 2- 2 yr. old geldings, well matched, will mature around 14.1 HH, quiet, halter broke, $1200 each, sold together. Package of four $5000. 403-363-7384, Cessford, AB

REGISTERED SUFFOLK PUNCH draft horses: two 2010 mares; 2010 gelding; 2012 stud colt. 306-763-3522, Prince Albert, SK. COMMON PIGEONS $4.00 each; also wantTRIM BOSS: The Power Hoof Trimmer. ed Muscovy ducks, Bantams and Guinea Take the work out of hoof trimming. Trim hens. Call eves 306-563-2020, Canora, SK. wall, sole and flare on saddle horses, drafts and minis. Call 780-898-3752, Alder Flats, AB. www.trimboss.ca HIGH QUALITY WHITE or brown ready to WWW.ELLIOTTCUTTINGHORSES.COM lay pullets. Avail. end of October. Hutchâ&#x20AC;&#x2122;s 35 plus years of training, showing, sales, Poultry, 306-435-3530, Moosomin, SK. PUREBRED MARES AND geldings, all halter clinics, lessons. Clifford and Sandra Elliott, broke, some started for harness, $600 to Paynton, SK. Phone 306-895-2107. $800. Email: rblanchard@sasktel.net or 306-467-4516, Duck Lake, SK.

GOOD QUALITY REG. and grade Belgian mares for sale exposed May 28th. Also, a selection of well bred Belgian stallions. 12 YEAR OLD grey Percheron mare, well Some 2013 foals available. Call Robert broke to harness. Phone 204-732-2456, evenings, Rorketon, MB. 204-821-5011 or 204-842-3607, Birtle, MB



ZZZURFNLQJKHDUWUDQFKOWGFRP 0DUF*DUQHU  0HORG\*DUQHU  CANADIAN FARRIER SCHOOL: Gary Johnston, www.canadianfarrierschool.ca Email gary@canadianfarrierschool.ca 403-359-4424, 403-637-2189, Calgary, AB.

%$5775$,/(56

The Fluidity Advantage â&#x20AC;˘ Outperforms Adequan & Legend in joint care!! â&#x20AC;˘ Replaces the need for joint injections!! â&#x20AC;˘ Safe for both mares & bleeders! â&#x20AC;˘ Palatable to even the fussiest horse!

866-571-7537

Hot Heals CrossďŹ re

Also carrying a wide selection of Rodeo gear

Hot Heals Roping Dummy

$

3395.00

$

399.00

Hot Heals Saddle Stand $

375.00

&+(&.2872851(::(%6,7(²'(7$,/62129(575$,/(56

www.bart5trailers.com



Located on the Cowboy Trail 10 Miles S.W. of Calgary on Hwy #22 at 274th Ave

DORIS DALEY

Fine western entertainment for conventions, campďŹ res and everything in between.

SALES! LEASING! FINANCING!

PHONE: 250.379.2790 CELL: 250.212.7930

Doris is a favourite at festivals, private parties, corporate banquets, Ag Societies and fund raisers throughout Western Canada and the U.S. She will scrub her neck and show up with a smile for your event no matter how large or small

www.thehorsegate.com

Visit www.dorisdaley.com for details.

TRAILER SALES

FOR SALE - Pepto Little Man

Performance enhancement Activation of metabolic processes and overall Support of healing vitality processes

regeneration and relaxation

Asking $7,500 Jesse and Elyse Thomson â&#x20AC;˘ RR#1 High River, Alberta Canada Ranch (403) 558-0005 â&#x20AC;˘ Cell (403) 815-0128 â&#x20AC;˘ email: 7pranchhorses@xplornet.com

FIRST TIMBERâ&#x20AC;&#x2122;s First Foals Are 3 Years Old Of 2013.

6(//<285 2:1 +256(6

&RQWDFW/\QGD%D[WHU  IRU Â&#x2021;&XVWRP:HEVLWHVÂ&#x2021;6(20DUNHWLQJÂ&#x2021;+RUVH0DQDJHPHQW6\VWHP ZZZFKL[HTXLQHGHVLJQFRP

FERRIS FENCING HORSE â&#x20AC;˘ WILDLIFE & FARM â&#x20AC;˘ VINEYARD & ORCHARD â&#x20AC;˘ AQUACULTURE

Complete Electro Rope & Tape Systems, Bayco, Non-Climb & Diamond Mesh, HorseRail, Livestock & Predator Control Electric Nets

1-800-665-3307

Tel: (250) 757-9677 info@ferrisfencing.com

)HH &DQDGLDQ

Fax: 250-757-9670 www.ferrisfencing.com

Wanda Parks 780-905-9351

Belinda (BJ) Lafond 780-293-3193

First Timber VL

Eligibilities: Alberta Stallion Stakes, CBHI and Black Gold Inquiries To: :HV 6XH2XOWRQ (403) 556-7299 Olds, Alberta, Canada rollingoranches@gmail.com

3URPRWH\RXU6WDOOLRQVDQG6DOH+RUVHV +RUVH0DQDJHPHQW6\VWHP$GG\RXU +RUVHV9LGHRV3KRWRV 3HGLJUHHV :HWHDFK\RXKRZ

other treatment modalities in a wide range of conditions

www.mediconsult.ca

Full brother to )LUVW3UL]H7LPEHU si 102 (2010, $56,018)

9LVLWXVWR GLVFRYHU\RXU QH[WSURVSHFW

2DN7UHH6SHFLDOVL)LUVW3UL]H 'DVKVL'DVK)RU&DVKVL

COMMERCIAL BEEKEEPING Unique 45 week certiďŹ cate. Study bees & the business of beekeeping! Paid work practicum. beekeeping@gprc.ab.ca 1-888-999-7882 Fairview, AB

www.gprc.ab.ca

NORTHFORK- INDUSTRY LEADER for over 15 years, is looking for Elk. â&#x20AC;&#x153;If you have them, we want them.â&#x20AC;? Make your final call with Northfork for pricing! Guaranteed prompt payment! 514-643-4447, Winnipeg, MB.

THE LIVERY STABLE, for harness sales and repairs. 306-283-4580, 306-262-4580, PUREBRED LAMANCHA GOATS, show Langham, SK. quality, does 1 - 4 yrs. old, meat kids 50 60 lbs. 306-982-3785, 306-960-8570, HORSE COLLARS, all sizes, steel and alu- Prince Albert, SK. minum horseshoes. We ship anywhere. BREEDING BUCKS for sale, 10 PB Neubians Keddieâ&#x20AC;&#x2122;s, 1-800-390-6924 or keddies.com and 4 PB Alpines, also have a very friendly GEORGEâ&#x20AC;&#x2122;S HARNESS & SADDLERY, makers Saanen X doeling avail. Jesse, Hague, SK of leather and nylon harness. Custom sad- 306-225-2180 or cell: 306-270-6975. dles, tack, collars, neck yoke, double trees. www.georgesharnessandsaddlery.com Call 780-663-3611, Ryley, AB. LONG STRAW HORSE collars. New softer and smoother designs fits better on shoulders, stuffed with sheepâ&#x20AC;&#x2122;s wool. For free LIVESTOCK SCALE SINGLE or multiple anibrochure fax to 519-335-3941, Gorrie, ON. mal capability, 10,000 lb capacity; also a livestock chute suitable for cattle and METAL CARTS- 1â&#x20AC;? tubing, seats 2, motor- hyd. cycle wheels or skis, detachable pole and horses. 306-539-2792, White City, SK. shafts, $650. 306-561-7823, Davidson, SK.

FREESTANDING WINDBREAK PANELS, up to 30â&#x20AC;&#x2122;, made from 2-3/8â&#x20AC;? oilfield pipe. 2ND ANNUAL ALL-BREEDS Prairie Square bale feeders, any size. Can build Ram Sale, Saturday, September 7, 1:00 other things. Elkhorn, MB. 204-851-6423, PM at Johnstone Auction Mart. 100 Regis- 204-845-2188, 204-851-6714. tered and Commercial Rams of various breeds and ages plus small packages of ewe lambs. Catalogue will be on-line mid August at www.johnstoneauction.ca or call 306-693-4715, Moose Jaw, SK. OLDS AUCTION MART Special Breeding Ewe Sale, Thursday, August 15, 2013, Sale Time 10:00 AM, Olds, AB. Flock dispersals, replacement ewe lambs and more. For info Call Joel 403-512-6151, 1-877-556-3655.

Compliments and supports

Prevention Improvement of

ELK TROPHY BULL & BREEDING Stock Auction, 7 PM, Friday, Aug. 9th, 2013 Nisku Inn, Nisku, AB. Live video auction Online bidding available. For details and updates call: 1-866-304-4664 or go to: www.gwacountry.com

FROSTFREE NOSEPUMPS: Energy free KENWAY 100 ASSOCIATION saddle in solution to livestock watering. No power g r e a t c o n d i t i o n , $ 1 0 0 0 O B O . C a l l required to heat or pump. Prevents backwash. Grants available. 1-866-843-6744. 306-375-2425 after 6PM. Kyle, SK. www.frostfreenosepumps.com BAUMANS BLACK AND silver tooled form JIFFY 900 BALE SHREDDER, shedded, in fitter, like new. Eamor/ Kenway/ Hamley/, excellent condition, $6500. 306-239-4949, Bona Allan. All in like new condition. Cran- Olser, SK. brook, BC. 250-426-5118 or 250-421-1484 63 HORSE OR CORRAL panels, 6â&#x20AC;&#x2122;x12â&#x20AC;&#x2122;, $200. per panel OBO. Call 306-587-7755, Abbey, SK.

HELPING HORSES TO ACHIEVE OPTIMAL HEALTH & EXCELLENT ENDURANCE WITH MAGNETIC RESONANCE STIMULATION

2006 AQHA Sorrel Gelding Sire: Hide a Pepto, Dam: Zans Miss Jackpot Discipline(s): Ranch Horse, Team Roping Looking for a great head horse, ranch horse deluxe this is the one. This great gelding has been started heading out of the box we have heeled off him a bit and roped the heel-o-matic. He has been rode in the feedot, roped bulls, moved cows and yearling to pasture. He is a solid reliable gelding who is ready to go to work for you.



ATTENTION ELK PRODUCERS: If you have elk to supply to market give AWAPCO a call today. No marketing fees. Non-members welcome. info@wapitiriver.com or 780-980-7589.

&2/767$57,1* &+$//(1*($1'6$/(

7DEHU$OEHUWD &KDOOHQJHDW$0 6DOHDW30

Fluidityâ&#x201E;˘ is a palatable oral paste that will outperform AdequanÂŽ I.M. and LegendÂŽ for joint care in Equine athletes. Using Natural ingredients Fluidity helps rebuild joints & cartilage

www.oxygen-north.com

ELK WIRE 1-1/2 miles, posts, elk squeeze, and wooden corrals. Call 306-862-5088, Nipawin, SK.

7$%(5$*5,3/(;

SASKATOON ALL BREED Horse & Tack Sale, August 27. Tack 11:00 AM, Horses to follow. Open to broke horses (halter or riding). Sale conducted at OK Corral, Martensville, SK. To consign call Frederick, 306-227-9505 bodnarusauctioneering.com

Our customers have experienced that Fluidityâ&#x201E;˘ provides both short & long-term relief for their horses, & Fluidityâ&#x201E;˘ reduces inďŹ&#x201A;ammation from day one improving stride length, overall freedom of movement & performance Oxy-GenÂŽ.offers horses a dependable source of safe, legal, all-natural products that are the industryâ&#x20AC;&#x2122;s ďŹ nest & have helped make Oxy-GenÂŽ a barnyard name.

G E N E T I C S W I T H C L A R I T Y. P h o n e 403-227-2449 www.antlerhillelkranch.com

$XJXVW

WANTED: ANGUS OR Angus/Simmental or Angus/Hereford cows or heifers. Lease to own. References available. 306-542-2575, LIVING SKIES FIRST ANNUAL PROD. SALE, Sat., August 10, Tack 11:00 AM, Veregin, SK. Horses 3:00 PM, OK Corral, Martensville, SK. Approx. 60 head. Barbeque and social to follow. bodnarusauctioneering.com or call Robin 306-567-5596, Nanette 306-476-2476. PL #318200. HORSE SALE, Johnstone Auction Mart, Thursday, Sept. 5, 2013. Tack sells: 2 PM. Horses sell: 4 PM. All classes of horses accepted. 306-693-4715, Moose Jaw, SK. www.johnstoneauction.ca PL #914447.

5$1&+/7'

QUARTER HORSE MARES - 2 w/foals, ESTATE DISPERSAL, 30 plus head brood- young geldings and studs, well bred, low mares and geldings. Jean, 403-556-1633, priced. Call Don, Olsons Quarter Horses, Olds, AB. www.westerdaleclydes.com 306-492-2180, Dundurn, SK.

MAMMOTH JACK DONKEY, halter broke. 6 STANDARDBRED HORSES, all harness Also yearlings jacks. Call 306-685-2224, broke and quiet, 2 mares and 4 geldings. 306-742-4530, Wroxton, SK. Gainsborough, SK.

WANTED: CULL COWS for slaughter. For bookings call Kelly at Drake Meat Processors, 306-363-2117, ext. 111, Drake, SK.

52&.,1*+($57

ELK FOR SALE for meat price, 12 males and 9 females, various ages plus this yearâ&#x20AC;&#x2122;s calves. 306-825-4000, Lloydminster, SK.

KELLN SOLAR FLOAT Pumps: efficient, COMPLETE FLOCK DISPERSAL. Regis- economical and easy to use. Lumsden, SK. tered PB Suffolks, 17 Ewes, 3 Rams. Hodg- www.kellnsolar.com 1-888-731-8882. es Farm, 306-254-2678, Dalmeny, SK. RENN ROLLER MILL, 12â&#x20AC;? wide rollers, 16â&#x20AC;? diameter, fixed unloading auger, undercarriage w/wheels, 540 PTO, 12â&#x20AC;? magnet, hopper, $4000; HIGHLINE 16 SPRING EWE LAMBS, ready to go end concentrate PRO 8000, 1000 PTO, right-hand of Sept. Ewes: Chevy/Suffolk, Ram: PB BALE discharge, hyd. chute, 16.5Lx16.1SL tires, Dorset. 7 yearling ewes, also can be sold $9500. 306-654-7657, Prudâ&#x20AC;&#x2122;homme, SK. w/lambs at side or after weaning. Call 306-745-3523, Esterhazy, SK. CADILAC HYD. SQUEEZE w/neck extenders, really good shape, $6900; Stampede steel S-alley, $1500; Wheatheart heavy hitter p o s t p o u n d e r , just demoâ&#x20AC;&#x2122;d, $10,000. 780-349-3869, Westlock, AB. SHEEP DEVELOPMENT BOARD offers extension, marketing services and a full line of sheep and goat supplies. 306-933-5200, Saskatoon, SK.

PORTABLE PANELS 30â&#x20AC;&#x2122; freestanding 3bar windbreak frames, 5-bar, 4-bar panels w/wo double hinge gates and more. On farm welding. Oxbow, SK., 306-485-8559, 306-483-2199. GRAIN TROUGHS, 30â&#x20AC;&#x2122; c/w skids, made of conveyor belting and pipe, $700/each. 306-538-4685, 306-736-7146 Kennedy, SK

BUYING WILD BOAR pigs/swine for 20 YOUNGâ&#x20AC;&#x2122;S EQUIPMENT INC. For your years, all sizes. 1-877-226-1395. Highest livestock feeding, cutting, chopping and handling headquarters. 1-800-803-8346. $$$. www.canadianheritagemeats.com RED RHINO SELF unloading hay trailers! Fast and simple! 306-227-4503, Saskatoon, SK. www.norheimranching.com BERKSHIRE BOARS, bred sows and weanlings; Tamsworth bred and open gilt. De- SVEN ROLLER MILLS. Built for over 40 livery available at cost. 204-750-1493 or years. PTO/elec. drive, 40 to 1000 bu./hr. Example: 300 bu./hr. unit costs $1/hr. to 204-828-3317, St.Claude, MB. run. Rolls peas and all grains. We regroove LIMITED NUMBER OF large Black and and repair all makes of mills. Call Apollo Tamworth bred gilts and boars for sale. Machine 306-242-9884, 1-877-255-0187. Call 403-783-5159, Ponoka, AB. www.apollomachineandproducts.com


CLASSIFIED ADS 65

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

RETIRE IN KELOWNA AND STILL FARM YOUR LAND in SK. or AB. Will trade up or down my Kelowna, BC. clear titled downtown penthouse on the Okanagan Lake, and lease your land back to you. To view please Google dolphins Kelowna. Contact Marshall 780-499-0126 or 778-484-0023, or email northpeace@hotmail.com SHUSWAP COUNTRY ESTATES. Manuf. homes start at $69,900. Retire with us...on time...on budget. 250-835-2366, Salmon Arm BC. www.shuswapcountryestates.com

FREESTANDING PANELS: 30’ windbreak panels; 6-bar 24’ and 30’ panels; 10’, 20’ and 30’ feed troughs; Bale shredder bunks; Silage bunks; Feeder panels; HD bale feeders; All metal 16’ and 24’ calf shelters. Will ECOCERT CANADA organic certification custom build. 306-424-2094, Kendal, SK. for producers, processors and brokers. Call the western office 306-665-9072, Saskatoon, SK, www.ecocertcanada.com

1925 EATON HOUSE two storey for sale to be moved, always lived in, complete plumbing, some renos done, but still 90% original. 306-287-7928, Quill Lake, SK. SUPREME AUCTION SERVICES will offer for sale by Public Auction, a two storey house on a beautiful well treed 150’x300’ lot, 107 Main Street in Sintaluta, SK. at 10:00 AM, Sunday, August 18. For details go to www.supremeauctions.ca PL314604. Contact Brad Stenberg 306-551-9411 or Ken McDonald 306-695-0121.

MORAND INDUSTRIES Builders of Quality Livestock Equipment, Made with Your Safety in Mind!

1-800-582-4037 www.morandindustries.com COVERED WAGON W/SPRUNG seat, good CANADA ORGANIC CERTIFIED by OCIA canvas, in vg shape, stored inside, photos Canada. The ultimate in organic integrity for producers, processors and brokers. Call DOGS OF DISTINCTION. Mistyglen Irish avail. Susan 306-423-5252, Batoche, SK. Ruth Baumann, 306-682-3126, Humboldt, Wolfhounds Perm. Reg. Puppies/adults SK, rbaumann@ocia.org, www.ocia.org available from domestic and imported PRO-CERT ORGANIC CERTIFICATION. lines. References required. For more info Canadian family owned. No Royalties! Ph. p l e a s e c o n t a c t e v e s . a f t e r 5 : 3 0 . 780-576-2364 or check out our website at 306-382-1299 or visit www.pro-cert.org irishwolfhound-mg.com Newbrook, AB.

TOWN OF LUMSDEN, SK. 8.65 acres, zoned commercial, asking $750,000. Email: jkexit@gmail.com for information. STORE AND LAND, like new, currently not being used. On main street going towards the lake in a tourist town, two lots, asking $175,000. Big River, SK. Call 306-469-5675, 306-469-0074. ENDLESS POTENTIAL. 20,000 sq. ft. building on 7.79 acres, $150,000. Call 403-548-2299, Manyberries, AB.

GREEN LAKE, SK. Fishing Lodge subdivision. Immaculate mobile home on 2 lots, 3 bdrms, wood stove, 24x28’ double garage, one owner, elder gent, no kids, no pets. Will sell fully furnished, $248,500. Must be seen. Call 306-832-2191. SMALL CABIN/BUNKHOUSE to be moved, 16x20’, insulated and finished, $6,000 at Prince Albert, SK. Call 306-244-6402.

LOOKING FOR HARD Red Spring Wheat LASSIE COLLIE PUPPIES, 8 wks, ready old crop and new crop contracts. Prompt to go $300 ea. 306-563-6678, Canora, SK. delivery and payment. 306-354-2660, R.W. TO GIVE AWAY: 2 females house dogs, 3 SUPERIOR BALE FEEDERS the only cost Organic Ltd., Mossbank, SK. yrs. old, Yorkie Terrier silver back and effective feeder on the market. For info go to superiorbalefeeders.ca or call your local WANTED ORGANIC RED clover, Sweet black Terrier mix. Would like to go to one dealer 1-866-690-7431 or 250-567-8731, clover and alfalfa seed. Cleaned or un- home. 306-747-3998, Deer Ridge, SK. Fort Fraser, BC. Quality is priceless, if it cleaned. Birch Rose Acres, 306-863-2900, LAKEFRONT COTTAGES. Lake of the Star City, SK. doesn’t say Superior, it isn’t. Prairies, Bodnaruk Hill Development, 1560 sq. ft., 4 bdrms, 3 bthrms, walk-out baseJD 550 TA manure spreader, $5500; NH WANTED: BUYING ORGANIC screenings, GREAT PYRANESE PUPPIES, 2 months old, ment, in-floor heat, attached double car 795 manure spreader, $7250. Both field delivered. Loreburn, SK. Prompt payment. ready to go. Contact 306-735-2939, garage, $415,000; Kilman Resort, 1008 sq. ready. Call 204-525-4521, Minitonas, MB. 306-644-4888 or 1-888-531-4888 ext. 2 Whitewood, SK. ft., walk-out basement, deck, hard wood fireplace, 3 bdrms, cedar dock, boat SILVER STREAM SHELTERS. Super CERT. ORGANIC RED CLOVER seed, ap- TRUE BLUE HEELERS off great working floors, $339,000. Call Karen Goraluck, Sales Spring Fabric Building Sale. 30x72 single prox. 15,000 lbs. Custom blend of Cert. Al- parents, siblings on dairies, stockyards and lift, Person, 204-937-8357, black steel, $4700; 30x70 dbl. truss P/R, gonquin alfalfa, w/Carlton smooth brome farms, 4 males, 4 females. Available early NorthStar204-773-6797, Insurance & Real Estate, Roblin, $6995; 38x100 dbl. truss P/R, $11,900; grass and common Timothy, 70/20/10 August. Delivery can be arranged. Call MB. www.north-star.ca 42x100 dbl. truss P/R, $14,250; 12-1/2 split, 3500 lbs. Call Tim 306-542-4353, 306-492-2447, 306-290-3339, Clavet, SK. oz. tarp, 15 yr. warranty. Trucks running 306-542-8280, Veregin, SK. KUVASZ/PYRENEES PUPPIES: 3 males, 2 w e s t w e e k l y, d e l i v e r y a v a i l a b l e . BEST COOKING PULSES accepting samples females, farm raised. 403-502-9470, 1-877-547-4738, silverstreamshelters.com of org. green/yellow peas for 2012/2013 Medicine Hat, AB. NORHEIM RANCHING HAS a full line of crop year. Matt 306-586-7111, Rowatt, SK REG. BORDER COLLIE pups, 2nd shots, high quality livestock handling equipment dewormed, working parents, $250. Lee Suat discount prices. 20’ of continuous steel teau, 306-237-4754, Sonningdale, SK. fence only $120! Gates; free standing panels; loading chutes; bunks; self unloading hay trailers, etc. 306-227-4503 Saskatoon, WANTED: CERT. ORGANIC grass fed AKBASH PUPPIES: 1/8 Great Pyrenees, slaughter beef. Peter Lundgard at Nature’s raised w/sheep and goats. Excellent guarSK. www.norheimranching.com dian animals, will bond with any flock or Way Farm 780-338-2934, Grimshaw, AB. herd, $125/ea. 204-656-4430, no Sunday MANURE SPREADERS: JD 780, $7000; calls please. Winnipegosis, MB. NH 800, $7500; New Idea 3634, $4000; SUN HILLS RESORT at Lake of the PrairGehl 1410 (same as NH 195), $6500; H&S ies, only 40 minutes East of Yorkton, SK. 400 bu. $2500; Dual #340 loader, $2000; Lots selling now! Starting at $56,000, fully Allied 2795 (new), $4500. 1-866-938-8537 serviced! Phone 306-597-4660 or visit www.sunhillsresort.com PAYSEN LIVESTOCK EQUIPMENT INC. We manufacture an extensive line of cattle LAKE LOT LAC DES ISLES- NEW 2 handling and feeding equipment including acres, $85,000. $10,000 down, balance squeeze chutes, adj. width alleys, crowdwhen title raised. 5 acre lot, $215,000. ing tubs, calf tip tables, maternity pens, Call 306-373-4808, loiselh@msn.com gates and panels, bale feeders, Bison WAKAW LAKE, SK. Lakefront 1350 sq. ft. equipment, Texas gates, steel water home, high eff. natural gas furnace and troughs and rodeo equipment. Distributors fireplace, 24x36 garage. 306-233-4981. for Cancrete concrete waterers, El-Toro electric branders and twine cutters. Our CEDAR LOG HOMES AND CABINS, sidsqueeze chutes and headgates are now ings, paneling, decking. Fir and Hemlock available with a neck extender. Phone flooring, timbers, special orders. Rouck 306-796-4508, email: ple@sasktel.net Bros., Lumby, BC., www.rouckbros.com website: www.paysen.com 1-800-960-3388. 49 YEAR OLD male looking for female TWO YEAR OLD post and beam home, 10 GREG’S WELDING: Free standing corral companion 35-55. Enjoys outdoors, ani- minutes east of Creston, BC. Quiet loca- COZY 2.3 ACRES 2 story home, 2 shops, panels, windbreak panels, calf shelters, mals, quiet time, relaxing and watching tion, 12 acres, some wooded, borders close to great snowmobiling and Shuswap belting troughs, etc. Many different styles movies. Southwest MB. Box 5581, c/o The creek. 1-1/2 storey 2038 sq. ft. plus fully Lakes. 250-308-2110, Mara, BC. to choose from. Call for pricing, delivery Western Producer, Saskatoon, SK S7K 2C4 finished walkout basement, large kitchen, PRIME FULLY SERVICED lake lot located available. 306-768-8555, Carrot River, SK. 3 bdrms, 3-1/2 baths, wood and timber at Lauman’s Landing on beautiful Lac des open ceiling throughout living, dining, FUN LOVING 54 yr. old female looking for STEEL VIEW MFG: 30’ portable wind 50-65 yr. old male. Someone with same kitchen and laundry areas. Hardwood I s l e s n e a r G o o d s o i l , S K . P h o n e breaks, HD self-standing panels, silage/ interests: love outdoors, horses, large flooring, main floor and upstairs. Detached 306-843-3315, 306-843-7853. hay bunks, feeder panels. Quality portable dogs, travelling. Looking for honest loving double car garage. $559,000. For more p a n e l s at a f fo r d a b l e p r i c e s . S h a n e man to fall in love with. Please include info and photos call Ray at: 250-428-4835 306-493-2300, Delisle, SK. photo. Reply to: Box 5582, c/o The West- or email: rloetkeman@gmail.com TO BE MOVED. 1400 sq. ft., 3 bdrm bunern Producer, Saskatoon, SK. S7K 2C4 WATERFRONT DEVELOPMENT LAND. galow, exc. cond., new shingles July 2013, Four acres, 650’ frontage on Columbia Riv- double attached garage, 13 miles North er. Hotel, condominium, apartment poten- and 1 mile West of Spiritwood, SK. 306-883-2964, 306-883-8843. tial. $595,000. 250-365-3155 Castlegar BC TO BE MOVED. 1963 bungalow with 2 car SINGLE? MEET THE MATCHMAKER WANT SNOWBIRDS FOR a fully furnished, att. garage, 1300 sq. ft., main floor fully The only way it works! In-person inter- 2 bed, 2 bath, rancher condo on Osoyoos renovated, 2/3 hardwood floor. Selling views Aug. 28th and 29th in Regina and Lake, single garage, hot tub, NP, NS, with stove, fridge, furnace, water treat150 COWS TO WINTER: preferably in Saskatoon. Membership $700 plus taxes. $1300/mo. includes utilities. 3-6 mo. term ment system, hot water heater and sewnorth central Alberta, someone to winter 18 years experience. Have matched thou- only. 780-389-4083, Edmonton, AB. View a g e p u m p , a s k i n g $ 8 0 , 0 0 0 . C a l l and calve out 150 Simmental/Red Angus sands of people! Camelot Introductions, at solevitastrata.com 306-338-7114, Clair, SK. cows, start calving in Feb. Good herd. www.camelotintroductions.com or call Must have experience and references 204-888-1529 to book your appoint- WATERFRONT KOOTENAY LAKE, BC. Ser- TO BE MOVED, house for sale. Make us viced 3/4 acre in quiet subdivision. Build, an offer! Located at Porcupine Plain, SK. 780-349-9596, Westlock, AB. ment with an award winning Matchmaker! or park your RV. Reduced to $399,000. Phone 306-278-7115 or 306-469-0074. Phone 250-402-6807, Creston, BC. LOG HOMES, builders of quality handBEAUTIFUL WARM SOUTHERN B.C., house crafted log and timber frame homes. Call and large lot on water at Christina Lake, Jeff at 306-493-2448, Saskatoon, SK. $575,000. 520-820-5777, 250-447-9000. www.backcountryloghomes.ca

RTM

BUILDING SUPPLIES & CONTRACTING

NEW MODULER HOMES, Canadian built by Moduline, 16x60, $68,900. 20x76, $96,900. New sales lot opening soon in Yorkton, SK. www.affordablehomesales.ca or call 306-496-7538, 1-888-699-9280. THINKING MODULAR? Think Dynamic Modular Homes! The lowest prices in Sask. are in Alberta! Compare and save. We will not be undersold on identical product. Toll f r e e 1 - 8 7 7 - 3 4 1 - 4 4 2 2 o r v i s i t u s at www.dynamicmodular.ca 1996 GRANDEUR MOBILE home, 16x72’, in Gladmar, SK. 3 bdrm, 2 baths, 3 appliances, AC, all incl. Great cond. 306-969-4966.

WINDOWS! WINDOWS!

A COMPLETE FULL LINE OF WINDOWS!!! See our Showroom for the best selection & savings in Sask.

Take Home Windows Feature!

Low E Argon  No Extra Charge  Sealed Picture Window ............From $39.95 Horizontal Gliders .....................From $69.95 Vertical Gliders .......................From $115.00 Casement Windows ...............From $199.99 Basement Awning Windows ...From $144.79 Storm Doors ..........................From $159.99 Steel Insulated Doors .............From $139.99 Fibreglass Insulated Doors “Maintenance Free” ...............From $299.99 “Out swing” Insulated Doors From $199.99 Patio Door Units .....................From $499.99 Garden Door Units ..................From $789.99 Special Size Door Units 30” & 34” ..............................From $169.99

VINYL SIDING CLASS “A” #1 PRODUCT • • • •

Popular Profile Good Colors! 1st Grade Sq. Ft Matching Accessories Available!!!

.60 ¢

7 COLORS

Burron Lumber

SMART SPACIOUS STYLISH! At a great price. New modular showhomes in all shapes and sizes. Immediate delivery. Call 1-855-380-2266, craigshomesales.com

306-652-0343, Saskatoon, SK

MEDALLION HOMES 1-800-249-3969 Immediate delivery: New 16’ and 20’ modular homes; Also used 14’ and 16’ homes. Now available: Lake homes. Medallion Homes, 306-764-2121, Prince Albert, SK.

ON THE GREENS COTTONWOOD, AZ. Gated 55 plus manufactured home golf course community located in the heart of Verde Valley just 20 mins south of Sedona, 1 hr from Phoenix, Prescott and Flagstaff. All homes come complete with garage, covered deck and landscaping. Land lease fees include $1 million clubhouse, large indoor lap pool, hot tub and complete gym. Also includes water, sewer, trash pickup and reduced golf fees. For information call 1-800-871-8187 or 928-634-7003.

SHELTER 16x72 on double lot in Fiske, SK., Rosetown area. 3 bedroom, 1 bathroom. Totally redone in and out, new deck and garden shed, low taxes, $65,000. Call 403-741-6968 or cell: 403-340-9280. DO YOU HAVE a mobile home park that you would like to sell? If so please e-mail me: parkthemobile@gmail.com

2 QUARTERS BUSHLAND in Peace River Country for sale. Call Evelyn Petkus, Royal LePage Casey Realty, 780-836-3086, 780-836-6478, Manning, AB. SPORTSMAN’S PARADISE next to Meadow Lake Provincial Forest just minutes from Brightsand and Turtle Lake in NW Saskatchewan. Fully modern 2 bedroom cabin, 321 acres of ranchland, $429,000. M L S ® 4 9 6 9 8 . C a l l Ve r n M c C l e l l a n d 306-821-0611, www.wesellmidwest.ca Re/Max, Lloydminster, SK. BIG GAME OUTFITTING area for sale in Endeavour, SK. Zones 48 and 56. Includes opportunity of developing a lot in Porcupine Provincial Forest. Comes with winterized 4 bedroom trailer, equipped and furnished, $135,000 OBO. Will separate. Call 306-547-4330, Sunday-Thursday. READY TO MOVE SHOW HOME. 1594 sq. ft. Options include front overhang for deck, deluxe cabinets, stone front, vault, tiled shower. Swanson Builders (Saskatoon, SK. area). www.swansonbuilders.ca 306-493-3089.

PARADISE HILL FARM SUPPLY. Thriving business in NW SK. With lots of opportunity for expansion or diversification. Owners retiring. Video at www.mgtv.ca MLS49743. Vern McClelland or Brian Kimmel, RE/MAX Lloydminster 780-808-2700.

READY TO MOVE HOMES CUSTOM BUILD TO OUR PLAN OR YOUR PLAN or FOR HOMES AVAILABLE NOW SEE OUR WEBSITE OR CALL

WWW.WARMANHOMES.CA Please call for details

TOLL-FREE 1-866-933-9595 SASKATCHEWAN

NEW HOME WARRANTY

HOMES & COTTAGES HOMES & COTTAGES

BUNGALOWS

If you p u rc ha s e a n e w hom e from J&H Hom e s b y Au g u s t15, 2013 you m a k e n o p a ym e n ts a n d p a y n o in te re s tu n til you r hom e is d e live re d . Le tJ&H Hom e s tu rn you r d re a m hom e in to a re a lity! Dep o s itreq u ired . S o m e res trictio n s a p p ly.

starting at

90*

$

21(2)$ .,1'-867 /,.(<28

/sq. ft.

starting at

100*

$

Platinum Service Award /sq. ft.

Hague, SK. | (306) 225-2288

www.zaksbuilding.com

*Applicable taxes, moving, foundation, and on site hookups are NOT included

As k us a b o ut B UIL DER TR EN D BUILDER TREND GIVES YOU A BETTER HOM E BUILDING EX PERIENCE

TO LL FR EE:

J&H H OM ES ... W ES TER N C AN AD A’S M OS T TR US TED R TM H OM E BUILD ER S IN C E 1969

(306)652-5322 2505 Ave. C. N orth, Saskatoon

1-877-6 6 5-6 6 6 0

Ca llUs To d a y O rV isitw w w .jhho m es.co m


66 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

WARM SOUTHERN B.C., 200 acres of pristine wilderness, very private. Fish pond, 3 wells, $599,000. Private sale. Phone 520-820-5777, 250-447-9000.

INVESTMENT INCOME FARM, 17.52 irrigated acres, ranch style home, shop, hay shed. Priced to sell. 250-308-2110, Enderby, BC.

ALBERTA LAND FOR SALE: BROILER QUOTA for sale, call for details. You must see this acreage! 28+acre acreage with private access, 6 kms out of Brooks. Nicely landscaped with 500+ trees, a pond, 5 acres fenced and cross-fenced for pasture. 2626 sq. ft. custom built home. Very private and yet next to highway and the city of Brooks. (#2028). BROOKS AREA! 154.43 acres irrigated land on paved road SE of Brooks with T and L low pressure pivot and irrigation equipment, surface revenue (#2047). CROP FARM NW of Vauxhall with a complete set of farm buildings. 1400 sq. ft. home, garage, carport, corrals for 80 head, hay shed, older shop, 4000 bu. grain storage, 2 dugouts for water supply with water pressure systems, 147 acres, 115 acre BRID water rights. (#2025). QUARTER SECTION IRRIGATED LAND! 6 miles north of Brooks in the Duchess area, 150 acres pivot irrigated with Zimmatic pivot and nat. gas pumping unit. Land is fenced and currently in hay production or can be used for cattle. Annual surface revenue. (#2061). PRIME IRRIGATION LAND in the heart of Potato Country. 398.44 acres of land with 367.81 acres BRID water rights. 17,000 bu. steel grain bins, quonset, 1150 sq. ft. home. (#2055). Real Estate Centre www.farmrealestate.com or phone 1-866-345-3414.

OWN OSOYOOS, BC. Condo, furnished, 1 bdrm. + den, 6 appliances, water softener, gas fireplace, spacious open concept, neutral decor, pool. Possession 30 days. Great snowbird/summer vacation spot, 2 blocks from downtown, 1/2 block to b e a c h . G r o u n d f l o o r, p e t f r i e n d l y, $192,500. Call Joe 250-408-4407, or email: paddleout@telus.net 80 ACRE FARM with large ranch style home, shop barn, hay shed. Scenic and 160 ACRES GOOD FARMLAND, no buildquiet location. 250-308-2110, Lumby, BC. ings, $140,000. Approx. 15 miles north of Prince Albert, SK. 306-764-8134, 306-789-1590, 403-457-1441, leave msg. RED DEER/ SYLVAN LAKE, 125 acres on RM 45 RANCH: We have two adjoining listblacktop, 10 min. from city on Burnt Lake ings for a total of 6616 acres, 2 yard sites. Trail, prime location for new yard develop- Call 306-773-7379, John or Joel Cave, ment, $6000/acre firm 403-575-1146. Edge Realty Ltd., Swift Current, SK. 8 MINUTES TO PONOKA and new Agriplex, www.farmsask.com. quiet country setting on 106 acres, 2 ti- R M O F H A Z E L D E L , S K . : 1 6 0 a c r e s , tles. Newer 3 bedrm bungalow, 2 baths, SE-10-37-09-W2, bush/grassland, ideal AC, central vac, state-of-the-art stables in- for hunting w/cabin, 306-634-5032. clude: 16 stalls w/drains, infloor heat in alleyway, turnout area, tack room, office, FOR SALE BY TENDER: 160 acres in RM of bathrm, ribbons rm, 40x40’ workshop, 220 Arm River, SK. SE quarter of 14-26-27-W2. wiring. Pasture all new fencing. Trades 6000 bu. grain storage, 50’x80’ w/14’ metconsidered, $999,000. Red Deer, AB. al wall shed, 24’x40’ wood building, 24’x24’ RANCH FOR SALE in Northern Alberta, 2 story character home w/porch and ve160 acres, great area to raise cattle, hors- randa and well treed yard site. Written ofes or sheep. 1600 sq. ft. house, 40x60 fers to: Box 84, Imperial, SK, S0G 2J0. heated shop, misc. other outbuildings. Closing date September 15, 2013. Highest 500,000 gal. dugout/water system, new or best offer not necessarily accepted. 100’ deep well, drilled in 2008, feeds corral RM 49: 960 acres of Native pasture, all adand house. 780-672-0337, High Level, AB. joining. John or Joel Cave, Edge Realty IF YOU SPRAYED LIBERTY and received Ltd., 306-773-7379, Swift Current, SK. crop damage call Back-Track Investiga- www.farmsask.com tions for assistance 1-866-882-4779. RM MONTROSE, SK: 160 acres, 80 cultiFOR SALE BY TENDER: 1540 acres of graz- vated and 80 grassland, trees and bush. ing land, located north of St. Paul, AB. http://prairiecastle.wix.com/landforsale Tender packages can be requested by letter to R&D Farms, PO Box 3683, Vermilion, RM OF KEYS No.303, 6 quarters in a block, 5 deeded, 1 leased, 200 acres cultivated, AB. T9X 2B6. Gas well revenue. rest all native grass, all fenced, corrals, rivBEAUTIFUL RECREATIONAL QUARTER er through 3 quarters, utilities through w/yard, borders Clearwater River plus property. 306-542-2575, Veregin, SK. creek, west of Red Deer; Large cattle property, 2 homes, lots of water, good yard, MINERAL RIGHTS. We will purchase and surface lease income, exclusive; Ranch o r l e a s e y o u r m i n e r a l r i g h t s . and grain property west of Edmonton, ap- 1-877-269-9990. cndfree@telusplanet.net prox. 400 cow/calf and approx. 2500 acres. Have buyers for large farm proper- CARE HOME AT PRESENT, close to all ties, very confidential. Call if you are think- amenities, Pasqua hospital. 1854 sq. ft. on ing of selling, I specialize in agricultural 2 levels, full gyprocked concrete baseproperties. Don Jarrett, Realty Executives ment, main floor living room or bedroom, 5 bedrooms up, TV room, whole house Leading, 780-991-1180, Spruce Grove, AB. renovated w/new kitchen and dining 5 QUARTERS OF FARMLAND, fenced, room, 2 1/2 baths, main floor laundry, South of Sunset House, AB. Contact storage cabinets, office area, rear sitting 780-524-2578. room, new deck. Other possibilities. Large 298.76 ACRES all cultivated farmland 2.5 1 1/2 lots, large 16’ rear gate and small miles east of Tofield, AB. on 626. Good #2 gate, sheds, front garden and single garsoil, no bush, no stones, very flat, annual age. $680,000. 306-543-4286, Regina, SK. s u r f a c e l e a s e r e ve n u e $ 3 2 0 0 . M L S SASK. GRAIN FARM, 2080 acres heavy MH0013867. Southland Realty, call Len clay, full set of buildings. Surface leases. Rempel 306-741-6358, Medicine Hat, AB John Cave, Edge Realty Ltd. 306-773-7379 AGRICULTURAL LAND FOR SALE, 2880 Swift Current, SK. www.farmsask.com acres on Hwy. #23, beautiful mountain view, lots of water (3 artesian wells and RM 228/257: 11,000 acre ranch, full set of large creek). Private sale, brokers wel- buildings. Call 306-773-7379 John or Joel come. Call Don 403-558-2345, Brant, AB. Cave, Edge Realty Ltd, Swift Current, SK. www.farmsask.com suzannedepaoli@yahoo.com

L A N E

R E A L TY

C O R P.

For the m ost VALU E & EXPO SU RE that you deserve w hen selling your farm or ranch property,contact one of our Farm & Ranch Specialists today! BOB LANE - Broker (306) 569-3380 JASON SELINGER - Regina/South Central

(306) 539-7975

ED BEUTLER - Yorkton/Whitewood

(306) 620-7260

JASON BEUTLER - Yorkton/Estevan

(306) 735-7811

GARTH HENDRY - Moose Jaw/South Central

(306) 631-0802

JEFF HEGLAND - Saskatoon/Prince Albert

(306) 270-9050

DOUG JENSEN - Melville/Raymore

(306) 621-9955

STAN HALL - Davidson/Strasbourg/Humboldt

(306) 725-7826

MORWENNA SUTTER - Melfort/Wadena

(306) 327-7129

MURRAY MURDOCH - Outlook/Rosetown

(306) 858-8000

DARRELL HERAUF - Dairy/Poultry

(306) 527-9636

DALE MURDOCH - Swift Current/Kindersley

(306) 774-6100

DARREN SANDER - Battlefords/NW Sask.

(306) 441-6777

S a s ka tchew a n’s Fa rm & Ra nch S pecia lis ts ™ 108 Regis tered S a les S o Fa rThis Yea r!

Ph : 3 06 -56 9 -3 3 8 0

W ITH O V ER 30 YEARS IN THE BUS IN ES S “Now representing purchasers from across Canada,and around the w orld!”

Visitour w ebsite at:

w w w.la nerea lty.com

to view currentlis tings a nd virtua l tours

TIM HAMMOND REALTY, Grenfell, SK. Summerberry, 2 adjoining listings with a total of 29 quarters of productive F, G and H soil currently in tame hay/tame pasture. Johnston, MLS #457236 consisting of 2859 acres, 1829 cult., 635 hay/native, excellent corrals, outbuildings; Byma, MLS #455877 consisting of 1861 acres, 1199 cult., 266 hay and forage, but would make excellent grainland. Call Guy Shepherd, 306-434-8857. www.TimHammond.ca RM OF 494, 5 quarters of land adjoining, good water supply and fenced. 1/2 mile of lakefront. 306-427-2046, 306-883-7493, Shell Lake, SK. RM 184: 3 quarters, fenced, grass, spring, dugout, easy to grain, 5 miles South of Dubuc, SK. 306-877-2014 or 306-745-7505. SASK. LAND FOR SALE. MANKOTA, SK. Ranch near Mankota, 4481 total acres with 1598 deeded and 2883 acres lease land ideal for summer grazing or wintering cattle. Ravines, streams, and great access. MLS® 49310. (#2050). DOLLARD, SK. 150 cow/calf ranch SW Sask. with 318 acre deeded land and 1950 acre lease land with great panoramic views, located 12 miles west of Shaunavon, gravel pit and many more features, ideal cattle country. MLS® 49311. (#2049). ESTEVAN, SK. Organic grain farm close to town. Large home, second yard, hip roof barn, shop, quonset, prime land, approx. 3178 acres, organic status. (#2064). Real Estate Centre www.farmrealestate.com or phone 1-866-345-3414. RM 18: 10,720 acre grain farm, full set of buildings. Call 306-773-7379, John Cave, Edge Realty Ltd., Swift Current, SK. www.farmsask.com

RM 169: 1760 acres grain and pastureland. SASK GRAIN FARM North of Togo, SK. 306-773-7379, John Cave, Edge Realty on SK/MB border. 290 acres on SK. side, Ltd., Swift Current, SK. www.farmsask.com 483 acres on MB. side. Ph. Cottenie & Gardner Inc., 306-542-2565, Kamsack, SK. FOR SALE BY TENDER: RM #256, 2 quar- or tedgardner@sasktel.net ters SE-5-25-12-W3 and SW-5-25-12-W3,. Highest or any tender not necessarily ac- IF YOU SPRAYED LIBERTY and received cepted. Tenders close September 05, crop damage call Back-Track Investiga2013. Send tenders to: Box 982, Weyburn, tions for assistance 1-866-882-4779. SK. S4H 2Z9. For more info 306-231-5611. REALTY EXECUTIVES BATTLEFORDSFARMS FOR SALE: RM Fertile Belt: Mike Janostin. Wanted: Grainland, pasSome 4180 acres of grain land, 3 homes, ture or bushland in SK, have cash buyers. 97,000 + bu. of grain storage and other Ph 306-481-5574, www.mikejanostin.com outbuildings. The land is all in close prox- Email mikejanostin@realtyexecutives.com imity, has been very well farmed, lots of bush has been cleared; RM Keys: Some TIM HAMMOND REALTY. RM 622 Beaver 762 acres of grain land in a good growing River, 320 acres with 145 hay acres, 150 area, has a good tenant in place, w/a good pasture acres, 25 other acres. Modest 500 ROI, asking $780,000; RM Lumsden: 148 sq. ft. bungalow with 1 bed, 1 bath. Inacres of grain land, SAMA cultivated acres cludes: cattle corrals, handling system 140, located only 10 miles north of Regina, w/power, two sand point wells, and waterasking $250,000; RM Lumsden: 154 acre ing bowls. 5 1/2 miles East of Pierceland, parcel of land, 92 acres are zoned com- SK. and 1 1/2 miles North of Beacon Hill. mercial, balance is AG, located only 15 M L S # 4 3 3 1 3 4 . Tr e m e n d o u s va l u e at miles north of Regina on No 6 hwy, in- $350,000. Kevin Jarrett, 306-441-4152. cludes 2 houses plus a wide variety of FOR SALE BY TENDER: RM #74, 2 quarbuildings. Buildings have potential for mul- ters, SW-15-7-6-W3 and SE-15-7-6-W3. ti purpose business opportunities, asking RM #44, 1 quarter, NW-33-5-5-W3. High$950,000; RM Norton: 6 quarters of est or any tender not necessarily accepted. grassland, some land is within a controlled Tenders close Sept. 05, 2013. Send tendflood plain, which can produce some ex- ers to: Box 982, Weyburn, SK. S4H 2Z9. cellent hay crops in dry years. Asking For more information call 306-231-5611. $444,000. For more information contact Bob Young, Homelife Prairies Realty Inc, GOOD GRAIN FARM: 1020 acres near Emerald Park, 306-586-0099 or e-mail: Kamsack, SK 2200 sq. ft. home and 67,000 bushels of grain storage. Close to pavesaskfarms@sasktel.net ment. Consistently produces high yields of FARMLAND FOR SALE: SE 19-28-28 W3 canola and wheat. Ph: Gordon Gentles or and NE 14-28-29-W3, $5,300,000. 10,703 Jim McLachlan at 204-761-0511, Homeacres, 4303 deeded, 6400 leased. 2 yards Life Home Professional Realty Inc. sites, one w/new 1800 sq.ft., never lived in bungalow. Good water supply. Property is close to Alberta border and has 22 quarters of leased land in AB. Call Brad Edgerton, 306-463-7357, Edge Realty Ltd., Kindersley, SK. www.edgerealty.ca

RM 49: APPROX. 640 acres irrigation and dry land with buildings. 306-773-7379, John Cave, Edge Realty Ltd, Swift Current, SK. www.farmsask.com FOR SALE BY AUCTION on August 22, RM 45: APPROX. 4160 acre ranch. 2 yard- 2013, on behalf of Roy Thompson Est: sites. Full set of buildings. 306-773-7379, R M # 4 3 6 n e a r R i c h a r d , S K . John or Joel Cave, Edge Realty Ltd., Swift S-1/2-4-44-12-W3 grain and pastureland. Ivan White Auctions, 306-441-6954, North Current, SK. www.farmsask.com Battleford, SK. PL #910541. Details: 1/4 SECTION NE Sask, c/w 2 legal titles, www.globalauctionguide.com 21 kms from thriving community w/new school and most amenities, 60 acre parcel RM 105: APPROX. 320 acres grain land. w/approx. 1700 sq. ft. home and heated Selling by Tender. John or Joel Cave. shop. 100 acre parcel w/small recreational Edge Realty Ltd. 306-773-7379. Swift Curcabin. Would like to sell entire pkg., some rent, SK. www.farmsask.com TLC required. More details please call 306-230-6644, 306-278-2048, Porcupine, Plain, SK. All calls returned. COM PL ETE RAN CH RM 162: 480 acres of adjoining pasture S OUTHERN S AS K ATCHEW AN approx. 20 minutes West of Moose Jaw, Yea r ro u n d s elf-s u fficien tpro perty w ith SK. Call John or Joel Cave, Edge Realty Ltd., 306-773-7379, Swift Current, SK. 8 00 + co w ca lfca pa city, 49 72 + /- d eed ed a cres a n d 3200 + /- a cres lea s ed , www.farmsask.com m a chin ery a n d lives to ck ca n b e pu rcha s ed . FARM CHEMICAL/ SEED COMPLAINTS Plea s e ca ll M a rcel a t403-350-6 8 6 8 We also specialize in: Crop insurance appeals; Chemical drift; Residual herbicide; M a rcel L eBla n c Rea l Es ta te In c. Custom operator issues; Equipment malfunction. Qualified Agrologist on staff. Call RM 49/51: 6720 acre ranch, set of buildBack-Track Investigations for assistance ings. 306-773-7379, John Cave, Edge Realty, Swift Current, SK. www.farmsask.com regarding compensation, 1-866-882-4779.

FOR SALE

FOR SALE: 6 QUARTERS farmland in the BUYING OR SELLING FARMLAND. I have Yorkton, SK. area. For more information the farm experience to get the deal done. Call Darren Bostock Realty P.C. Inc. call 306-221-2208. 306-351-3900, Regina, SK., or email TIM Hammond Realty. RM 94 Hazelwood darrenbostock@myaccess.ca SW-14-10-6W2, 160 acre pasture/hay quarter with gravel For Sale by Tender. DEBDEN, BIG RIVER area: This approx. All gravel resources below elevation 3100 sq. ft. hunting lodge is set up on 154 778.25 sea level. Tested at 450’x450’ to 35’ acres of mainly heavy bush, with 140 acres deep (may be deeper) equalling an esti- fenced with high game fencing. The lodge mated 262,500 cubic yards. Including sur- has 5 bdrms, 2-1/2 baths, wood burning face lease with approx. $3100 annual reve- stove, elk chandelier, pine and log accents, nue. Tender closes 12:00 PM, Aug. 16, 21’ open ceilings, power, phone and well. 2013. Call 306-434-8857, Guy Shepherd, This lodge can be used for many different things, with the location it is great for Http:\\Gravel.TimHammond.ca hunting and fishing. Plus this parcel backs HALF SECTION OF FARMLAND in Maid- onto the Provincial forest both north and stone/Neilburg area. Approx. 290 acres east. One must view this property to see cultivated. Assessment Parcel 1) 72,000., the added value. MLS® 465295. For Parcel 2) 87,600. Price $320,000. Call more info or viewing call Lloyd Ledinski of 306-821-6659, Lloydminster, SK. Re/Max of the Battlefords, 306-446-8800 or 306-441-0512, North Battleford, SK. RM 45: 2560 acres grain and pastureland. 306-773-7379, John Cave, Edge Realty HUNTER’S PARADISE in the RM of MeetLtd., Swift Current, SK. www.farmsask.com ing Lake, approx. 15 miles NE of Hafford, Approx. 320 acres w/quite heavy bush, FARM LAND BY TENDER: Located 1/2 km. SK. loads of excellent pasture, water supeast of Ogema, Sask. SE-15-7-22-W2, yet ply, fencing. A hunter’s dream with deer, NE-15-7-22-W2 and NW-23-7-22-W2, moose, and bird hunting, fishing also home quarter. The home quarter includes nearby. bear, Just over an hour from Saskatoon, approx. 1250 sq. ft. bungalow plus numer- Prince Albert and North Battleford with an ous out buildings. Viewing of home quar- all weather road. ®471791. To view ter will be on August 17, and August 25, call Lloyd Ledinski,MLS Re/Max of the Battlefrom 1:00 to 4:00 P.M. Tenders will be ac- fords, 306-446-8800 or 306-441-0512, cepted on individual quarters, or the entire North Battleford, SK. farm. Clear possession to be provided by October 31, 2013. Highest or any tender RM OF SPIRITWOOD: Just listed five not necessarily accepted. Upon finalization quarters of deeded land mainly bush pasof the tender, a 5% non-refundable deposit ture. Possibility of 12.5 quarters of Crown will be required from the successful bid- Lease. Lots of openings, ideal water (3 der. Written tenders will be accepted until springs and small lake area). Mainly all 4:30 P.M. September 6, 2013, at the fol- fenced. Great big game hunting in the lowing office: Thorp & Company Chartered area. MLS ®468532. For more info. or Accountants, 2310 Scarth Street, Regina, viewing call Lloyd Ledinski, Re/Max of the SK. S4P 2J7, email: stan@thorpco.ca Battlefords 306-446-8800, 306-441-0512. Q u ick Clo su re – N o Co m m issio n

306-5 84 -364 0 in fo @ m a xcro p.ca

CALL

PU RCH ASIN G FARM LAN D

REN TERS W AN TED w w w .m a xcro p.ca

W ANTED

APPROX . 4000 ACRES

OF GOOD CROP PRODUCTION L AN D IN S AS K ATCHEW AN AN D AL BERTA Plea s e ca ll M a rcel a t403-350-6 8 6 8 M a rcel L eBla n c Rea l Es ta te In c. RM KEYS #303, south of Hyas, SK. 11 quarters in one block, 300 acres cult., rest in hay and pasture with good water supply and fences, very neat and clean 3 bedroom bungalow, good cattle facilities. Call 780-361-6879 or 780-361-6426. RM 110: 1120 acre ranch, set of buildings. 306-773-7379, John Cave, Edge Realty Ltd., Swift Current, SK. www.farmsask.com

RM OF REFORD: 327 acres: 80 verified to have gravel, possibly more; 188 acres cultivated w/60 planted to wheat, remaining cultivated acres seeded to tame grass, balance is partly fenced native pasture. 2300 sq. ft. bungalow built 1985. MLS®470122. Call Wally Lorenz, Re/Max of the Battlefords, 306-446-8800, North Battleford, SK. www.remaxbattlefords.com RM WALLACE #243: For sale 3 organic quarters, approx. 420 cultivated acres, well treed yardsite with creek, 2500 sq. ft. 2 storey home, 28x32’ garage, 35x75’ shed, 7 steel bins. Plus two 5 acre acreages. Located 1 mile off Hwy #9, 5 miles from Yorkton, SK. Phone 306-782-5895. RM 139: 6720 acre ranch, set of buildings. 306-773-7379, John Cave, Edge Realty Ltd., Swift Current, SK. www.farmsask.com LOCATED 8 MILES South of Spiritwood, SK. is this 1008 sq.ft. home with many upgrades. Hidden amongst the aspens, spruce, fruit trees and flowers on approx. 9.04 acres. Fully fenced and pasture for a couple horses etc., Excellent garden area with hot house and other old buildi n g s . We l l f o r w a t e r s u p p l y. M L S ®470193, for viewing call Lloyd Ledinski, Re/Max of the Battlefords, 306-441-0512 or 306-446-8800. RM LEASK #464: 29 quarters all adjoining but one. 4499.72 acres w/approx. 3164 cultivated to tame pasture and hay. Balance is natural pasture, wooded and sheltered areas, bodies of water, plus several dugouts. All mainly fenced with 3 and 4 wire and treated posts. The winter headquarters has a 36x51’ shop w/20x36’ attached ranch hand living quarters, natural gas, power, phone, well, silage pit, 4 cattle shelters and corrals. Ranch is located 2-1/2 miles SW of Leask on Hwy. #40 then 2-1/2 miles East. MLS® 468365. For further info. on this exc. cattle operation call Lloyd Ledinski, Re/Max of the Battlefords, 306-446-8800 or 306-441-0512, North Battleford, SK.

43 ACRES with 1/2 miles of shoreline on Stuart Lake, private, 5 acres cleared with beach, rest is forest. Development potential. $150,000, Onanole, MB. SASK GRAIN FARM North of Togo, SK. on SK/MB border. 290 acres on SK. side, 483 acres on MB. side. Ph. Cottenie & Gardner Inc., 306-542-2565, Kamsack, SK. or email tedgardner@sasktel.net

GOOD CATTLE FARM on the shores of Lake Manitoba. 512 acres deeded and 1,500 acres of Crown lease. The land is all in a block and contained on a peninsula. The owners produce enough feed on the farm for 150 beef cows. Mobile home, machine FARM/RANCH/RECREATION, buying or shed built 2009, insulated barn, corrals. selling. Call Tom Neufeld 306-260-7838, Tel: Gordon Gentles 204-761-0511 or Jim McLachlan 204-724-7753, HomeLife Home Coldwell Banker ResCom Realty. Professional Realty Inc., Brandon MB. 30 ACRES with large 2 storey home adja- www.homelifepro.com cent to Craven, has development possibilities; RM EDENWOLD, approx. 10 MANITOBA’S INTERLAKE: 640 deeded acres on #364 Hwy, 8 miles north Balgo- acres, 310 acres cult., cattle facilities, outnie, developed well; KRONAU, less than buildings and 3 bedroom bungalow. Call 20 minutes from Regina on 65 acres, 204-659-5842, St. Martin, MB. boasts 1480 sq. ft. fully developed bunga- EXCELLENT LIVESTOCK FARM extending low, heated shop, larger steel shed, horse to 1,578 deeded acres with 4,425 acres of barn, 2 wells along with Regina utility wa- Crown land. All the land is fenced and the ter supply; Price Reduced, #46 HWY, 1 farm has vg buildings and metal corral syskm east of Pilot Butte, home, outbuildings, tem. The farm can carry up to 400- 450 subdivided lands with development pos- cow/calf pairs. There is a small bungalow sibilities. RM South Qu’Appelle, 20 acres home. Gordon Gentles 204-761-0511 or on #10 Hwy; Seed cleaning and process- Jim McLachlan 204-724-7753. HomeLife ing plant 40 miles north of Regina, SK. Home Professional Realty Inc., Brandon, Contact: Brian Tiefenbach, 306-536-3269, MB. www.homelifepro.com 306-525-3344, NAI Commercial Real Estate (Sask) Ltd. MIXED FARM FOR SALE- retiring, The Pas, RM CANWOOD #494, 4 quarters, grain, MB. Clean, well maintained, all in one pasture and hay, lots of water, on school piece, no rocks. 1470 deeded acres, 900 bus route. 400 acres cult., power on 2 cultivated; 2640 acres long term Crown sites. House, 2 large garages, grain stor- rental, 500 cult. acres. 2 houses- 5 bdrm. age on home quarter. Close to lakes and house, wheelchair accessible and 1 bdrm. house. Heated shop, machine shed, hay Parkland. 306-747-2775, Shellbrook, SK. shed, pole barn, Hi-Hog chute system, PURCHASER TO MEET MOTIVATED sell- 40,000+ bu. grain storage, large 30,000 er, SE Sask., RM 153 and 123. 8 quarters: sq. ft. insulated tinned barn, machinery 5 hay and pasture, 3 cult., barn, house and and cattle available. Call 204-623-5029. shop. Option on 10 more quarters, all in one block. 403-888-0045, Whitewood, SK. HOBBY FARM LARGE enough for two families! 78 acres c/w 2 homes, 40x60’ shop, Jack@dobbynelectric.com Prairie Lane (Saskatoon Business) plus 62 BORDEN AREA, 160 acres, 130 cultivated, acres of cultivated land. 9725 Hwy. 9, St. 1772 sq. ft. house on 2 levels, built in Andrews. Judy Moyer, Century 21 Jeffer1986, a lot of renovating done. Steel quon- son & Assoc., 204-784-6604, Selkirk, MB. set with concrete floor, power, hog barn, horse barn, 5- grain bins. 130 acres leased. 2560 ACRES OF hay and pastureland, 7 deContact Bert, Sutton Group Saskatoon, eded, 9 leased, w/cattle facilities. Phone 204-732-2456, evenings, Rorketon, MB. 306-221-2892. RM 79: APPROX. 640 acres of grain land located North of Dollard, SK. John or Joel Cave, Edge Realty Ltd., 306-773-7379, Swift Current, SK. www.farmsask.com

Thin kin g o fBuying o r Selling Fa rm La n d ?

Harry Sheppard 3 06 -53 0-8 03 5 e -m a il: h a rry@ s h e p p a rdre a lty.ca Vis it our w e b s ite : w w w .s h e p p a rdre a lty.ca

LAN D FO R S ALE

RM # N ea res t To w n 34 Lampman 39 Ceylo n 42 W illo w Bu n ch 66 Griffin 66 Creelm a n 69 SO L D Pa n gm a n 69 Pa n gm a n 127 Vib a n k 130 SO L D Drin kw a ter 157 E d gely 216 Itu n a 248 Cu p a r 221 & 251 Pen za n ce & L ib erty 275 T heo d o re 277 L ero s s

# o f Acres 10,555 1,080 1,361 623 199 800 605 629 795 445 1,586 942 1,596 2,352 730

ACREAG ES FO R S ALE

RM # 34 159

S u tton G rou p-R E S U L TS R E A L TY - R egin a, S K

N ea res t To w n Lampman Gra n d Co u lee

# o f Acres 10 10.1


CLASSIFIED ADS 67

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

QUARTER SECTION near Inglis, MB. Mix of pasture and bush. 900 sq. ft. dwelling completely renovated. Various outbuildings, well sheltered yard, garden. Asessippi Ski and Lake of the Prairies minutes away. Call Karen Goralak Salesperson. 204-773-6797, 204-937-8357, NorthStar Insurance & Real Estate, Roblin, MB. www.north-star.ca

MULCHING - TREES, BRUSH, Stumps. Call today 306-933-2950. Visit us at: www.maverickconstruction.ca FOR RENT RM #256, 1/2 section, SE and SW-5-25-12-W3, pasture/hay, between Beechy and Dinsmore, 306-231-5611. FOR SALE BY TENDER: RM 346, Perdue, S K . 2 q u a r t e r s o f fe n c e d p a s t u r e , SW-6-36-10-W3 ext. 1 and 2, 152 acres; SE-6-36-10-W3 ext. 8, 104 acres, 40 cultivated. Creek runs through both quarters. Highest or any tender not necessarily accepted. Tenders close Sept. 1, 2013. Send tenders to: vallee@yourlink.ca or call 306-237-4892, Kinley, SK. WANTED TO RENT/BUY fenced pasture/ hayland for 10 horses with water immediately anywhere within 30- 40 minutes of Saskatoon, SK., call 306-461-4430. FOR RENT: 3 QUARTERS pasture near Langham, SK. 1 available immediately. Call 306-283-4899 leave message. FOR RENT RM #74, 1/2 section pasture/hay, SW and SE-15-7-6, new fence, two dug outs, low price. Between Woodrow and Glentworth, SK. 306-231-5611. FOR RENT RM #193, one quarter, half alfalfa and half pasture, NW7-21-2-W3. For more info. 306-231-5611, Eyebrow, SK.

WANTED: ACREAGE to buy, 3 acres or less. Must be very close to city of Moose Jaw, SK. Near major grid for winter access. Livable house on property preferred. Call 306-692-2764, evenings.

L OOK IN G F OR L AN D w /Aggrega te Potentia l In Sa ska tchew a n

Ca ll P O TZU S LTD. Phone: 306-782-74 23 Fa x: 306-786-6909 Em a il: info@ potzu s.com

ACREAGE FOR RENT: House and shop at Mildred, SK. 1450 sq. ft. bungalow features 3 bdrms up, 2 down, 3 bthrms, nat. gas fireplace, developed basement. 40x50 insulated shop w/16â&#x20AC;&#x2122; ceiling, 14â&#x20AC;&#x2122; tall overhead door, nat. gas heat, 220 power. Optional horse pasture and 22x30 hip roof barn. Phone 306-883-2443.

NEW UNUSED 2012 TIMER RIDGE Model 250RLS RV trailer 25â&#x20AC;&#x2122;, 2 axle, built for all SAWMILLS from only $4897 - Make year round living, 4 season pkg. For info Money and Save Money with your own and website ph 306-834-5590, Major, SK. bandmill. Cut lumber any dimension. In stock, ready to ship. Free Info and DVD: TANKLESS WATER HEATERS, instant, on www.NorwoodSawmills.com/168 or call demand. Showers, cabins, RVâ&#x20AC;&#x2122;s. Gas (natu- 1-800-566-6899 ext. 168. ral or propane) or electric. Edmonton, AB., 780-952-4884 www.firepitfundamentals.ca

13 ACRE ACREAGE south of Yellow Creek. Located near Melfort, St. Brieux, Humboldt, Prince Albert, Wakaw, SK. 1989, 1280 sq. ft. home, sheds, 30x80 insulated building. Evergreen shelter belt and many fruit trees. 1/2 mile to Rhona Lake and Hazel Lake. Fishing, cabins, boating. Close to Wakaw and St. Brieux school bus routes, $185,000. Call 306-279-2033.

2010 BIGHORN 5th Wheel, 38â&#x20AC;&#x2122;, 3 slides, all options, fireplace, king bed, 42â&#x20AC;? TV, Mumby hitch, 5500 Onan built-in generator, solar panel, no pets or smoking, best offer. Call 306-867-8445, Outlook, SK. 1995 SPECIAL EDITION truck camper, 8.9â&#x20AC;&#x2122;, rubber roof, forced air furnace, 2-way fridge, propane hot water heater. Bathroom with shower. North/south queen size RM 166: APPROX. 25 acres w/house, barn, bed. Lots of storage. 306-429-2710 or corrals, quonset. Call 306-773-7379, John 306-736-8642. Glenavon, SK. Cave, Edge Realty Ltd., Swift Current, SK. www.farmsask.com 2004 TERRY 5TH wheel trailer, model AX6, 36â&#x20AC;&#x2122;, aluminum frame, 4 slides, great floor plan, king bed, 2 electric fireplaces, used very little, asking $26,900. 780-632-7397 or 780-632-9862, Vegreville, AB. TRUCK CAMPERS: 2000 Citation Supreme, slide-out, AC, clean bed, bathroom, elec. jacks, exc. cond.; 1988 Cascade 8-1/2â&#x20AC;&#x2122;, hyd. jacks, bathroom, new fridge, exc. Battleford, SK. 306-441-7680, 306-937-7719.

LENTILS, CANARY AND CHICK PEAS.

WHY NOT KEEP MARKETING SIMPLE? You are selling feed grains. We are buying feed grains. Fast payment, with prompt pickup, true price discovery. Call Gerald Snip, Jim Beusekom, Allen Pirness, David Lea, or Vera Buziak at Market Place Commodities Ltd., Lethbridge, AB. Email: info@marketplacecommodities.com or phone: 1-866-512-1711.

WE BUY DAMAGED GRAIN Green and/or heated Canola/Flax, Wheat, Barley, Oats, Peas, etc.

O r d er N ow

Forea rly sea son d iscoun t. Typica l 750 b u. g ra in ca rt,

3,4 50

$

204 - 87 1 - 1 1 7 5 or 1 - 86 6 - 86 2- 83 04 w w w .triplesta rm fg.c a ELIAS SCALES MFG., several different ways to weigh bales and livestock; Platform scales for industrial use as well, nonelectric, no balances or cables (no weigh like it). Shipping arranged. 306-445-2111, 2011 BIGHORN 5th wheel, 40â&#x20AC;&#x2122;, 4 slides, North Battleford, SK. www.eliasscales.com air ride hitch, king size bed, fireplace, lots of cupboard space; 2011 GMC Denali, diesel, loaded, quad cab. 306-934-7573, Saskatoon, SK.

BUYING CANARY SEED, farm pickup. Call 1-877-752-4115, Naber Specialty Grains Ltd. Email: nsgl@sasktel.net

Schluter & Maack NEW CROP MUSTARD CONTRACTS

Yellow & Brown

Flexible Pricing with Guaranteed Delivery Dates Act of God Clause New Crop Lentil and Pea Contracts available as well. Old Crop movement available also.

1-306-781-4987

BESCO GRAIN LTD. Buyer of all varieties of mustard. Call for competitive pricing. Call 204-736-3570, Brunkild, MB. MUSTARD SEED AVAILABLE. Custom cleaning and bagging all types of mustard for seed. Color sorting available. Also looking for low grade mustard. Call Ackerman Ag - 306-638-2282, Chamberlain, SK.

1996 ROYAL CLASSIC 29â&#x20AC;&#x2122;, Ford 460, RM OF SLIDING HILLS, SW-08-29-01-W2, 120,000 miles, excellent, asking $19,500. approx. 10 acres, 4 bedroom bi-level, built 780-675-5452, Athabasca, AB. 1982. 1632 sq. ft. on 2 levels. Spacious 2- 2004 MONACO DIPLOMAT 40PDQ, 8.3 tiered deck. Livingroom adorned with de- Cummins, 330 HP, 12,000 miles, 4 slides, tailed pillars that looks into modernized auto, 7.5 KW Onan gen.- 147 hrs, satellite kitchen/dining area. Kitchen/dining system, solar panel, full air brakes, washequipped w/duraceramic floors, stunning er/dryer, loaded. Too many options to list! oak cupboards and island. Main floor laun- $100,000. For more photos please see dry. Walk-out basement incl. family room, www.can-amtruck.com Can-Am Truck Ex2 bdrms., 3 piece bathroom, large me- port Ltd 1-800-938-3323. DL #910420. chanical/storage area. Beautifully manicured yard. Price reduced $340,000. MLSÂŽ 465391. Call Cottenie & Gardner Inc. 306-542-2565, Kamsack, SK.

2005 TRIPLE E Commander A3712FGB, 37â&#x20AC;&#x2122;, 8.1 Vortec, 69,000 kms, 3 slides, 3 TVâ&#x20AC;&#x2122;s w/auto satellite, winter pkg, many exWELL MAINTAINED 1583 sq. ft. bungalow, tras, exc. cond., $71,500. No pets, no 4 bdrms, 2 bthrms, located on 5 acres just smoking. 306-421-5615, Estevan, SK. outside Wadena, SK., town water. Incl: heated shop, detac. garage, shed. Option 2005 MONACO CAYMAN 34PDD, 35â&#x20AC;&#x2122;, 5.9 to buy quarter of farmland w/shed. Cummins, 300 HP, 21,500 miles, auto, satellite, air over hyd. brakes, 5.5 KW 306-463-7769, 306-931-2570. Onan dsl. gen.- 148 hrs, exc. cond., 2 EVANSBURG close to Edmonton, AB. slides, $85,000. More photos on our webnewer house, large industrial shop, 4 lots, site www.can-amtruck.com Can-Am Truck $ 3 4 9 , 0 0 0 at $ 1 2 5 , 0 0 0 d ow n at 5 % . Export Ltd 1-800-938-3323. DL #910420. 1-888-709-0884. LEISURE TRAVEL MOTORHOME, 1999, SASKATOON AREA ACREAGEâ&#x20AC;&#x2122;sâ&#x20AC;&#x2122; 8 miles wide body Dodge 3500 chassis, new tires west, NE-23-37-7-W3rd. Leave message at SASKATOON, SK. AREA ACREAGE. 80 and batteries, 135,000 kms, all available acres, 15 minutes North. Modern 2+2 bi306-384-4512. level, 2 large heated shops, city water, ma- factory options plus air ride, power plant, ture yard site, $750,000. MLS, Don Dyck, king size bed, like new cond. Asking Outs ta nding 2870 s q/ft- Ra n ch s tyle $26,000. 306-692-6483, Moose Jaw, SK. Re-Max North Country, 306-221-1684. ho m e o n a b ea u tifu lly kep t5.87 a crea ge in the RM o fChes ter. Ho m e s ho w s b etw een 2002 TRAVELAIRE GENESIS, low mileage 9/10. 5 b d 3 b a th. RO w a ter trea tm en t (under 10,000 kms.), one owner, $20,000 s ys tem , geo therm a l hea ted , d o u b le OBO. 403-501-5727, Brooks, AB. a tta ched ga ra ge. 2 la rge o u tb u ild in gs . 2005 36â&#x20AC;&#x2122; SAFARI CHEETA, C7 Cat, 350 HP, M LS #46 995 7 6 spd. auto, 52,000 miles, 2 slides, air Im m a cula te 2937 s q/ft- 5 level s p lit. brakes, 8000 KW diesel generator, new S ho w s 12 o u to f10 o n 11.97 a cres . 3 b d , IF YOU SPRAYED LIBERTY and received tires in 2013, exc. cond., $105,000. 3 b a th. Co m p letely, p ro fes s io n a lly crop damage call Back-Track Investiga- 204-522-5656, 204-877-3618, Reston, MB. tions for assistance 1-866-882-4779. ren o va ted in 2004. RO w a ter trea tm en t s ys tem , in flo o r hea t. 2 la rge in s u la ted FARM CHEMICAL/ SEED COMPLAINTS hea ted s ho p s w ith co n crete flo o rs . On ly We also specialize in: Crop insurance ap- 2004 HARLEY V-ROD, 10,000 kms, new 10 m in s No rth o fRegin a . M LS #46 9479 peals; Chemical drift; Residual herbicide; tires and battery, Screaming Eagle exCustom operator issues; Equipment mal- haust, saddle bags, windshield, crash bars, Qualified Agrologist on staff. Call not licensed since 2008, immaculate cond, GLEN BOEHM E function. Back-Track Investigations for assistance $10,900 OBO. 204-937-7079, Roblin, MB. 3 06 -73 7-6 16 6 regarding compensation, 1-866-882-4779. HARLEY DAVIDSON LOVERS: 2007 Harw w w .ce n tury21.ca /gle n .b oe h m e 2011 ARGO 750, 8-wheel w/tracks, roll ley Davidson Classic Touring bike, upgradDOMREMY/WAKAW: 20 acres with 1532 bar, winch, bilge pump, extra seat, ed extras, below 1000 kms., like new, sq. ft. 1-1/2 storey home, beautifully land- $22,000. 306-982-4888, Prince Albert, SK. $21,500 OBO, many accessories available scaped yard, barn, shop, pasture ready for 403-239-4812, Calgary, AB. animals. Close to schools and amenities. 2009 HONDA 420, 4x4, AutoShift, good 15 min. to Wakaw Lake. $219,900. MLS condition, $5800 OBO. 306-421-6306, #467521. Call Norm Grodecki, Residential 306-457-2911, Benson, SK. Specialist, E&M Real Estate Group Inc., PARTING OUT Polaris snowmobiles, 1985 306-514-7997, Saskatoon, SK. to 2005. Edfield Motors Ltd., phone: 306-272-3832, Foam Lake, SK. 10.1 ACRES ONLY 8 miles west of Regina, very well kept house, buildings and yard site. Call Harry Sheppard, 306-530-8035, or go online: www.sheppardrealty.ca Sutton Group - Results Realty, Regina, SK. 6 ACRES, with 884 sq. ft. home, 2 bdrms, full bath, new sub floor and lino, heated all year, town water and sewer, low taxes, vaSEASONAL HOUSE FOR rent. Fully furcant. $199,000. 306-543-4286, Ituna, SK. nished, 3 bedroom, 3 bath. Avail Sept 1. to May/June, $1300 utilities incl. Peachland, ELK POINT, St. Paul County, AB. 7 acres, BC., 403-464-9839 or 778-479-4985. 20 yr. old house, $265,000 with $125,000 OUTLAW CLASSIC 21â&#x20AC;&#x2122;x8â&#x20AC;&#x2122; River Boat c/w down at 5%. 1-888-709-0884. custom built 454 V8 eng. (approx 500 HP), 40 ACRE PARCEL with 2500 sq. ft. home. Berkley JB12 pump, TT approx. 127 hrs. on Hay/pasture mix, some outbuildings, eng. and pump. Much more, must see! beautiful yard with lots of trees and plenty $27,500. 780-914-2069, Spruce Grove, AB. of good water, must see!! McMahon, SK. 2 BR. TOWNHOUSE, retired couple, NS, 306-774-0417, pcolney@sasktel.net LUND DELUXE SPECIAL 16â&#x20AC;&#x2122;, consol steer- NP, $800/month, Jan. 1- March 31, fully 9 ACRES, 12 miles North of Melfort, SK on ing and controls, power trim, fish finder, furnished. 250-756-1337, North Nanaimo. Hwy #6. 1615 sq. ft. bungalow, 3 bdrms., 50HP Mercury, 10HP Merc, Univision trail2 baths, landscaped yard, natural gas, city er, $4500. 306-567-3042, Davidson, SK. water. Asking $235,000. Ph 306-887-2159 2011 19â&#x20AC;&#x2122; TRIUMPH fishing boat, 150 Merc 20 ACRE YARD next to 40 hunting Crown- Optimax, fish finder, Livewell, tandem WOOD-MIZER PORTABLE SAWMILLS, land quarters. House, barn with hayloft. trailer, $28,500 + tax. Call Mark, Saska- eight models, options and accessories. 1-877-866-0667. www.woodmizer.ca Good water. 204-858-2555, Hartney, MB. toon, SK., 306-934-2121, 306-370-1337.

WANTED

GRAIN CART SCALES

Tillage R adish ÂŽ

28 ACRES, 2 storey house (2001), walkout bsmt., 4 bdrms., 3 baths, main floor laundry, shop 48x52â&#x20AC;&#x2122;. Offers. 780-682-2350, 306-467-2477, near Wetaskiwin, AB. PRICE REDUCED: Bladworth, SK, 17 acres, 1900 sq. ft. 1-1/2 storey house, addition 1982, 26x30â&#x20AC;&#x2122; garage, 52x80â&#x20AC;&#x2122; Behlen quonset, 22x60â&#x20AC;&#x2122; wooden quonset, 12x34â&#x20AC;&#x2122; wooden bin, 14x28â&#x20AC;&#x2122; storage building. 15 acres fenced pasture, corrals w/open faced shelters, water bowl. 306-561-7733. 40 CLEAR ACRES, 5 minutes north of City of Saskatoon, SK. One mile off 4 lane highway, power, water well, 1/2 mile air strip, 60x105â&#x20AC;&#x2122; equipment shed, 2 dugouts, many extras. Call for price 306-244-7003. 15 ACRES WITH 1360 sq. ft. home, mature shelterbelt, pasture, dugouts and private drive. 204-742-3781, Ethelbert, MB.

GrainEx International Ltd.

Call GrainEx International Ltd. for current pricing at 306-885-2288, Sedley SK. Visit us on our website at: www.grainex.net

Ca ll

80 ACRES, 3 miles NW of Saskatoon, SK., Corman Park, City of Saskatoon Planning Area. 2250 sq. ft., 2 storey split house built in 1980, on city water. Park like yard w/matures trees shelter belt. Sheds and shop w/mechanics pit. All in exc. cond., $750,000. 306-933-1121 or 306-222-3883

BINS TO CLEAN out before harvest? Newco Grain Ltd., is brokering barley, oats and wheat. Now is a good time to sell! Please call for further info. 1-800-661-2312.

Call

306.744.2332 or 403.633.9999

for your localretail location. w w w .friendlyacres.sk.ca

BOW VALLEY TRADING LTD.

1-877-641-2798 WANTED: FEED GRAIN, barley, wheat, peas, green or damaged canola. Phone Gary 306-823-4493, Neilburg, SK. PASKAL CATTLE FEEDLOT Company in Lethbridge area, looking for feed barley. Call Roxanne at 1-800-710-8803. LACKAWANNA PRODUCTS CORP. Buyers and sellers of all types of feed grain and grain by-products. Call 306-862-2723, Nipawin, SK.

NOW B UYIN G O ATS!

AL L GRAD ES Com petitive Ra tes P ro m pt P a ym en t

SweetGrass CONTRACTING Linden, AB

P AUL M O W ER 4 03 - 3 04 - 1 4 9 6

D AV E K O EH N

4 03 - 54 6 - 006 0

L IN D EN ,AL BER TA CAN AD A

HEATED CANOLA WANTED â&#x20AC;˘ GREEN â&#x20AC;˘ HEATED â&#x20AC;˘ SPRING THRASHED

LIGHT/TOUGH FEEDGRAINS â&#x20AC;˘ OATS â&#x20AC;˘ BARLEY

â&#x20AC;˘ WHEAT â&#x20AC;˘ PEAS

DAMAGED FLAX/PEAS

Malt Barley/Feed Grains/Pulses best price/best delivery/best payment

â&#x20AC;˘ HEATED TOP QUALITY ALFALFA, variety of grasses and custom blends, farmer to farmer. Gary Waterhouse 306-874-5684, Naicam, SK.

Licen s ed & bon d ed 1- 800- 2 58- 7434 ro ger@ seed - ex.co m BUYING YELLOW AND GREEN PEAS, all grades, farm pickup. Naber Specialty Grains Ltd., 1-877-752-4115, Melfort, SK. email: nsgl@sasktel.net

â&#x20AC;˘ DISEASED

GREEN CANOLA â&#x20AC;˘ FROZEN â&#x20AC;˘ HAILED â&#x20AC;&#x153;ON FARM PICKUPâ&#x20AC;?

WESTCAN FEED & GRAIN

1-877-250-5252 NUVISION COMMODITIES is currently purchasing feed barley, wheat, peas and milling oats. 204-758-3401, St. Jean, MB. GRAIN MARKETING HEADQUARTERS. BUYING OATS ALL GRADES, farm pick- WANTED HEATED CANOLA. No broker Buyers of all grains. On farm pricing. Quick up. Call 1-877-752-4115, Naber Specialty involved. Sell direct to crushing plant. payment assured. Call Cory 306-842-2406. Grains Ltd. Email: nsgl@sasktel.net Cash on delivery or pickup. Unity, SK. Call: Double Z Ag Sales, Weyburn, SK. LOOKING FOR: OAT seed. Please contact 306-228-7306 or 306-228-1502. BEST PRICESÂ FO R 306-736-8894, Regina, SK.

WANTED: WINTER TRITICALE seed off the farm. 316-249-1907.

BUYING RYE

G RA IN M A RKETIN G

Lacom be A B.

w w w.eisses.ca

1-888-882-7803

FEED BARLEY, WHEAT, OATS, RYE, TRITICALE, PEAS, LENTILS, HEATED OIL SEEDS

:HDUHDIXOOVHUYLFHIHHG JUDLQLQJUHGLHQW VXSSOLHULQFOXGLQJPHUFKDQGLVLQJ GLVWULEXWLRQ DGPLQLVWUDWLRQ

Priced at your b in.

&*&OLFHQVHGDQGERQGHG

PEARMAN GRAIN LTD. BUYING BROWN FLAX farm pickup. Call 1-877-752-4115, Naber Specialty Grains Ltd. Email: nsgl@sasktel.net

A lso b uying b arley, w heat etc.

M USGRAVE ENTERPRISES Ph : 204.8 3 5.2527 Fa x: 204.8 3 5.2712

CDC BUTEO RED WINTER, fdn. reg. cert., cleaned, available now! Moats, reg. Big WANTED: FEED/ OFF-GRADE Pulses and tough, heated green oilseeds and also Dog Seeds Inc. 306-483-2963, Oxbow, SK. cereals. Prairie Wide Grain, Saskatoon, REG. CERTIFIED ACCIPITER winter wheat, SK., 306-230-8101, 306-716-2297. seed treating, early order, volume discounts available. Visa/Mastercard. Call TOP PRICES 306-530-8433, Lumsden, SK. www.LLseeds.ca PAID FOR

TOP QUALITY CERT. alfalfa and grass seed. Call Gary or Janice Waterhouse 306-874-5684, Naicam, SK.

HEATED O R HIG H G REEN CANO LA.

Saskatoon

306-374-1968

*5$,1 %8<,1*)(('*5$,1

www.jglgrain.com 877-907-1517 e:info@jglgrain.com 720 Duchess St - Saskatoon, SK 306-374-1517


68 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

SOLID CORE ROUND alfalfa, alfalfa grass, green feed, grass, and straw. Delivered. Call 306-237-4582, Perdue, SK. C U S TO M B A L E H AU L I N G . Phone 306-567-7199, Kenaston, SK. WA N T E D : A L FA L FA / G R A S S lar ge round bales. We are interested in all qualities of hay delivered to the ranch. Call 306-638-3051, Bethune, SK.

Bale Scale “NO WEIGH LIKE IT”

Progressive Yard Works Ltd. 1-306-244-6911 3423 Millar Ave., Saskatoon, SK

U-DRIVE TRACTOR TRAILER Training, 25 years experience. Day, 1 and 2 week upgrading programs for Class 1A, 3A and air brakes. One on one driving instructions. 306-786-6600, Yorkton, SK.

MANUFACTURER OF EXCEPTIONAL QUALITY FIBERGLASS TANKS • Above ground and below ground • Sectional in-door water tanks • Sewage holding and two-compartment

COMBINE DUAL KITS IN STOCK, JD 94009600/10/CTS/CTSII kit w/o tires starts from $9,850; JD STS dual kit w/ new 20.8x38 tires, $15,046; CIH 1680-2588 kit w/ new 20.838 tires, $13,900. Trade in your singles for duals. Financing available. 1-800-667-4515. www.combineworld.com

2,395

$

Check Our Website

Spear Scale to fit 3 pt. hitch or skidsteer, quick detach and FEL units. Also Bale Movers, Truck Mount, Cattle Scales, Hopper Feeders.

ELIAS SCALE

Will Assist With Shipping

306-445-2111

North Battleford, Sask. Website: www.eliasscales.com

• 150 gallons to 10,000 gallons • Ask us about our easy burial “drop and go” 1000 gallon tanks Visit our website at:

www.progressiveyardworks.com

WANTED TO BUY: straight alfalfa bales, FIBERGLASS SEPTIC TANKS- Various sizrounds or squares. Picked up or delivered es available, starting from 250 gal. up to 34,000 gal. Visit Flaman store today or call to Ellinwood, Kansas. 620-786-0589. 1-888-435-2626, or www.flaman.com WANTED: LARGE ROUND bales, prefer 1600 lbs plus. Would also consider standing hay. Ryan 306-646-7743, Fairlight, SK. 1969 1200 sq. ft. FARMHOUSE, to be TA R P S / C O V E R S / A C C E S S O R I E S ! moved, 170 miles east of Saskatoon, SK. Manufacture and repair of all tarps and Clarence 306-382-8666 for more details. covers. Ph. Canadian Tarpaulin, Saskatoon, K . S e e : w w w. c a n t a r p . c o m o r c a l l : C anu ck Prem iu m N etw rap S1-888-226-8277 or 306-933-2343. N etwrap - H igh quality,im ported from G erm any TARPCO, SHUR-LOK, MICHEL’S sales, 67’’startin g at$205 service, installations, repairs. Canadian company. We carry aeration socks. We 64’’startin g at$200 now carry electric chute openers for grain Silage B alew rap -startin g at$84 trailer hoppers. 1-866-663-0000.

Pho ne:403-994-7207 or 780-206-4666 www.canadianh ayandsilage.com CUSTOM BALE HAULING with 2 trucks and t r a i l e r s , 3 4 b a l e s p e r t r a i l e r. C a l l 306-567-7100, Imperial, SK. HAY TO CUT for sale, Alfalfa and grass mixture. Contact 306-488-2103, Holdfast, SK. ALFALFA GRASS HAY, 5x5 bales, approx. 1200 lbs., $45/bale. 306-723-4775, Cupar, SK. LARGE HAY BALES for sale! 980 lbs, 144 good bales, $75; 71 rained on, $50. OBO 306-220-8054, Aberdeen, SK. 1-888-CAN-TARP (226-8277) (306) 933-2343 | Fax: (306) 931-1003

CANADIAN TARPAULIN MANUFACTURERS LTD.

BALE STACK COVERS

“Canadian Made”CALL FOR PRICING

Best Quality! – Protect your bales from the elements and reduce costly spoilage.

REPAIR SERVICE TO ALL INDUSTRIAL FABRIC PRODUCTS

10

UP TO

SEE WEBSITE FOR MORE DETAILS

%

OFF

BEFORE AUGUST 30TH 2013

www.cantarp.com

Email: sales@cantarp.com

WANTED CERT. OATS: Dancer, Triactor and Ronald. Call Saskcan Parent 204-737-3002, St. Joseph, MB.

ATTENTION TRAPPERS. Personal trapping instruction avail. For coyote and fox, w/snares or traps, 55 years experience, June 15th to Sept 30th. Call for details. Gilliland Lures. 204-634-2425, Pierson, MB

BIRD HUNTING, Zone #51 to #53, incl. decoys, blinds, trailer, etc. Allan Folden 306-747-3182, Shellbrook, SK.

POLY TANKS: 15 to 10,000 gallons; Bladder tanks from 220 to 88,000 gal; Water and liquid fertilizer; Fuel tanks, single and double wall; Truck and storage, gas or dsl. Wilke Sales, 306-586-5711, Regina, SK.

M AGNUM TANKS • U P TO 1 000 GAL L O N • ISO 9001 :2008 Appro ved • SINGL E W AL L SQ U AR E TANK • TR ANSP O R T CANAD A AP P R O V ED Available at Magnum Fabricating & our dealers

w w w .m a g n u m fa brica tin g .com

M AGN UM F ABR ICATIN G LTD . M a ple Creek, SK P h: 306-662-2198

NEW 20.8-38 12 PLY $795; 16.9-30 12 ply, $595; 18.4-38 12 ply, $789; 24.5- 32 14 ply, $1,749; 14.9-24 12 ply, $486; 16.9-28 12 ply, $558; 18.4-26 10 ply, $890. Factory direct. More sizes available, new and used. 1-800-667-4515, www.combineworld.com

HEAVY EQUIPMENT OPERATORS for late model Cat equipment: motor scrapers (cushion ride), dozers, excavators, rock trucks, graders (trim operators). Camp job. Competitive wages plus room and board. Valid drivers license required. Send resume, work references to: Bryden Construction and Transport Co. Inc., Box 100, Arborfield, SK S0E 0A0. Fax 306-769-8844, brydenconstruct@xplornet.ca EXCAVATION COMPANY REQUIRES experienced Heavy Equipment Operators and Class 1 drivers, for industrial projects west of Edmonton, AB. Must have minimum 10 years experience, working with grades, site prep, highway/road building experience environmental, tickets are an asset. Seasonal and full-time positions. Must be able to work with others, in a positive m a n n e r. P l e a s e f a x / e m a i l r e s u m e 780-963-4771, billsexc@telusplanet.net

F ull Tim e, P erm a n en t b eef c a ttle fa rm w o rker p o s itio n s to h elp w ith th e d a y to d a y a c tivities a t th e b eef feed lo t a n d ra n c h .

T he re s po n s ib ilitie s in clu d e b u t n o t lim ite d to the fo llo win g: d e te ct d is e a s e a n d he a lth pro b le m s in live s to ck, tre a t the a n im a ls , m o ve a n d s o rt a n im a ls , fe e d a n d te n d to live s to ck, ru n a n d m a in ta in fa rm in g e qu ipm e n t, fe n cin g, f e n ce re pa ir, a n d co n s tru ctio n . T he fo llo win g qu a lifica tio n s a re re qu ire d : s o m e ca ttle kn o w le d ge a n d ha n d lin g e xpe rie n ce , Cla s s 5 D rive rs Lice n s e (o r d e e m e d e qu iva le n t lice n s e fro m fo re ign co u n try). T he fo llo w in g qu a lifica tio n s w o u ld b e a n a s s e t b u t n o t re qu ire d ; Cla s s 1 D rive rs Lice n s e , e xpe rie n ce rid in g ho rs e s .   H o w to Ap p ly:

P lea s e s en d yo ur res um e a n d c o ver letter b y fa x 40 3 -9 3 8 -5175 o r b y e-m a il to : ec h o s a n d @ feed lo th r.c o m

NEW 23.1x26, diamond tread, $1200/pair. 780-962-5272, Acheson, AB. USED 710X38 TIRES and tubes, good for duals. Ask for Ray, 306-742-4576, six miles north of Wroxton, SK.

HELP WANTED ON MIXED FARM. Year round for the right applicant. Mechanically inclined an asset. Large new shop. Must be willing to do manual labour and operate and maintain equipment. Send resume to buggfarms@hotmail.com Paynton, SK. fax 306-895-4601.

WANTED: CIH SERIES 9300 QUADTRAC tracks any condition! Phone John at 204-825-2715, Pilot Mound, MB.

SHUR-LOK TRUCK TARPS and replacement NEW MODERN LATHE, 22”x80” swing tarps for all makes of trucks. Alan, w/DRO and 4” spindle bore, 3 phase, 306-723-4967, 306-726-7808, Cupar, SK. 220V. 3 jaw, 4 jaw, tool attachments and steady rest, follower rest and tool post included. $29,000 OBO; Also modern drill press and bandsaw, offers. Email Mark at: rmarksmith@sasktel.net or call ZENON PARK C&D is contracting the mow- 306-541-4422, Carnduff, SK. ing of approx. 35 miles of ditches for 2013. Send rates per mile for tractor and mower. Mail: Zenon Park C&D, Box 206, 50 TON SCOTCHMAN IRONWORKER, 5 Arborfield, SK. S0E 0A0. Deadline for ten- ye a r s o l d , $ 6 5 0 0 . 3 0 6 - 3 6 7 - 2 4 0 8 o r der is August 30th. Lowest or any offer not 306-367-4306, Middle Lake, SK. necessarily accepted. Phone 306-767-2572

Ec h o S a n d R a n c h in g (lo c a ted n ea r Ac m e, Alb erta ) is lo o kin g to fill

SEASONAL FARM WORKER on modern grain farm. Drivers license required. Farm knowledge and experience preferred. Salary negotiable. 306-648-7553, Kincaid, SK. HELP WANTED ON GRAIN FARM. Ability to operate and maintain large farm equipment. Wages negotiable. Starting August 1 through harvest. Phone 306-567-8558, fax resume to 306-567-4374, or email: mcnabb@yourlink.ca Davidson, SK.

LOOKING FOR A self motivated individual capable of working unsupervised. Duties include feeding 200 plus head of purebred Black Angus bulls and heifers, haying, silage, fencing, field work, operate and maintain equipment. Newer JD equipment. Older house included. $50,000 per year. Contact Tanya at 250-845-8474 or 250-845-3050, tdbelsham@gmail.com Located in Fort Fraser, BC.

3 06 -9 3 3 -1115

COMBINE OPERATOR or Truck Driver wanted for harvest. Exp. preferred, minimum Class 3A driver’s license required, wages based on experience, Sovereign, SK. Call Ron 306-831-9405, 306-935-4614 GRAIN FARM LOCATED near Coderre, SK. looking for 1A truck driver w/experience for harvest season and possible year round full-time employment. Previous farm experience a definite asset. Housing can be provided for spring and fall season. Call Derek at: 306-631-5302, Coderre, SK. or email: pepinfarms@gmail.com COMBINE AND GRAIN cart operators wanted. Starting approx. Aug. 15/2013. Accommodations available. Call Eric at 306-272-7038, Foam Lake, SK.

LARGE PROGRESSIVE 5TH Generation grain farm located 15 min. from Regina, SK. has opening for full-time year round and seasonal 1A Truck Drivers and Equipment Operators. Successful candidates will join our team and be tasked with hauling grain from bin to market during harvest and throughout the year. Drivers will also be hauling fertilizer during seeding operations. All short hauls, home every night. Equipment operators will be operating new top of the line farm equipment as well as other heavy duty equipment. Weekends off in non-peak season, flexible scheduling. Experience in Super B’s and Operating Equipment an asset. Top wages paid, accommodations avail. Call 306-535-7708.

GREAT JOB OPPORTUNITY! Hiring farm equipment operator, must be familiar with combine, swather 4WD tractor, air drill etc., on medium sized farm. Class 1 license an asset. Limited mechanical necessary. Housing may be available. Wages $20-30/hr. depending on experience. SEED PLANT AND Grain Farm Labourer, 306-542-8584, Kamsack, SK. full-time permanent position available at Veikle Seeds Ltd., Cut Knife, SK. Duties in- FULL TIME FARM/RANCH worker needed clude operation and maintenance of farm immediately, SW of Consol, SK. Must be machinery, general farm duties, operation able to work alone, handle cattle, operof seed plant. Experience preferred. Class ate/repair/maintain farm equipment. 1A an asset. Competitive wages offered. Housing available. Wages negotiable. E m a i l r e s u m e w i t h r e fe r e n c e s t o : Phone 403-502-0810. vike1@sasktel.net or call 306-398-4714. SEMI-RETIRED COUPLE REQUIRED to LARGE GRAIN FARM hiring experienced work on small farm, south east of Calgary. farm equipment operators, $20/hr. for Experience with cattle, horses and machinswather, combine, grain cart operators ery necessary. Accommodations supplied. and truck drivers. Valid drivers licence re- 403-236-7703, Rockyview, AB. quired, Class 1 preferred. Email resume to: ORGANIC FARM FULL-TIME permabiggrainfarm@gmail.com Bonanza, AB. nent position: Grace Hill Farms, a large FULL-TIME OPPORTUNITY on large family-owned organic grain farm and seed mixed farm. Must be able to maintain and cleaning operation is seeking an individual operate farm and cattle equipment. Must to join our team. The position requires ophave current driver’s license. Cattle experi- erating and maintaining large machinery ence and Class 1A an asset. Wages vary as well as grain cleaning. Must have: valid with experience and qualifications. Contact class 1A driver’s licence; experience in grain farming and heavy equipment mainRene at 306-642-7801, Lafleche, SK. tenance preferred; ability to work long CARPENTERS HELPERS and grass cut- hours during peak season; ability to be a ters wanted. Will train, room and board team player, but work independently. provided. Hutterites welcome. Call Jordy Housing available. For more info contact 780-934-9932 or 780-920-7360, Edmon- Dwayne or Doreen 306-264-3721. Please send resume to wefarm@gracehill.ca or ton, AB. fax 306-264-3726, Mankota, SK. FARM AT OLDS, AB requires immediately experienced Machinery Operator with WANTED FULL-TIME RANCH HAND cow/ Class 1 license. Housing and benefits pro- calf operation in remote location. Experivided. Please email resume and references ence with livestock, operating machinery and maintenance and farm labour an asto: doddbeef@gmail.com set. $14-$17/hour. Fax 780-981-2282 Keg CHRISTIAN GRAIN FARMER needs worker River, AB. or dmjgrade1@yahoo.ca w/1A, mechanical and construction experience. 306-692-4047, Moose Jaw, SK.

A R E YO U L O O K I N G F O R S K I L L E D Ranch or Farmhands? We have experienced agricultural workers and livestock workers who want to relocate to Canada. Please contact Warren Green for details, 1-866-952-9604. Members of ImmigraSET OF 4 20.8x42 tires with Case/IH rims. CANADA - CUBA FARM TOURS. Feb. tion Consultants Of Canada Regulatory Rims like new with older tires, $3000. 3rd to 17th. All inclusive. Deductible. 7 Council. Email: greenw@telusplanet.net 204-539-2066, Swan River, MB. nights 5 star, 7 nights country hotels, 3 Website: www.saskimmigration.com days Varadero, 8 day farm tour, 3 days Havana. Max 26. Farmers and family mem- CUSTOM HARVESTER looking for truck bers only. $3200/person, 2 sharing, plus driver’s, combine, and grain cart operators air. Early bird discount. Wendy Holm P.Ag, to go on Custom Harvesting Run that bewendy@wendyholm.com 604-947-2893, gins August 1st in Saskatchewan and ends in Northern Alberta. Operating four new www.wendyholm.com JD S670 combines and Peterbilt semis. I may help obtain 1A license, year round employment hauling logs, grain or crude oil. 306-421-9270 leave msg., or fax resume to: 306-456-2835, Bromhead, SK M id w es t US A ~ O ct2013 LARGE GRAIN AND Poultry Farm, North of Au s tra lia /N ew Zea la n d ~ Jan 2014 CLAMP ON DUALS 20.8 x 38 Titans in very Edmonton, AB. looking for a farm worker good cond’n, adapts to 30.5x32 inside with a potential future in farm manageK en ya /Ta n za n ia ~ J an 2014 rims, w/ adapters & hardware. $5,250. ment. We have an up-to-date beautiful Trades welcome. Financing available. In d ia ~ Feb 2014 farm. Class 1A, experience with livestock, 1-800-667-4515. www.combineworld.com large equipment and computers is necesS o u th Am erica ~ Feb 2014 sary. We offer accommodations. Wages will be discussed. Only serious applicants. V ietn a m /Ca m b o d ia /Tha ila n d Send resume to: Martin and Catharina, fax ~ M ar 2014 780-961-3967, or catacyr@hotmail.com Chin a ~ M arch 2014 or call 780-220-8144, Legal, AB. Irela n d & S co tla n d ~ June 2014 103 -3240 LARGE SOUTHEAST SK. grain farm is Uk ra in e Agricu ltu re To u r ~ June 2014 hiring full-time/part-time experienced Id ylw yld Dr. N . farm help w/Class 1A, up to $30/hour. Ph TIRE & S a s k a to o n Portion oftours m a y b e Ta x Ded uc tib le. W HEEL 306-634-4758, 306-421-1110, Torquay, FULL-TIME HELP WANTED for farming and cattle operation. Must be mechanically inSK. Email: duaneforrester@sasktel.net Se le ct Holi da ys clined and good with cattle. Housing proN EW STATE OF THE ART FACILITY 1- 800- 661- 432 6 vided, salary negotiable. Alexis Creek Area, • PAS S EN GER, L IGHT TRUCK , S EM I, BC. Email: jodi.williamson@caribooca.com W or ki ng Gener al M anager w w w .selectho lid a ys.co m AGRICUL TURE, CON S TRUCTION 250-392-2911, ask for Jodi. for feedlot and farm • M ECHAN ICAL & AL IGN M EN T FOR Duties CAR, BUS RV , TRUCK & TRAIL ER POSITION AVAILABLE on cow/calf opera• Operate feed tru ck , tracto rs m o st • TIRES /W HEEL S & CUS TOM DUAL & tion. Housing supplied. References and TRIPL E K ITS driver’s abstract required. Ph: Consort, AB farm equ ipm en t. 403-577-0011, u2dryad4@hotmail.com • TIRE V UL CAN IZIN G • So m e co m pu ter an d cattle • 24 HOUR M OBIL E TRUCK S FOR ON k n o wledge wo u ld be ben eficial. D6 DIESEL CAT, 318 engine, 12” Fairbanks   FARM HELP REQUIRED asap. Looking S ITE W ORK Morse volume pump, 5500 GPM, floating Health ben efits, ho u se an d for 1 full time and 2 seasonal employees platform, exc. cond., $4,000; 140’ 14” steel on large intensive grain farm. Experience co m pan y tru ck pro vided. GOODYEAR 620/70R42, 70%, ideal for pipe, 600’ 10” alum., $10,000 for pump preferred but willing to train. Excellent spare or duals, 306-268-4436, Viceroy, SK. and pipe. 306-244-8503, Saskatoon, SK.  Lo cated in cen tral Sask atchewan pay, based on experience. Forward reFor m ore info callLyle 3 520X85 R42 Goodyear radial tires, w/10 sumes to: friesenfarms@sasktel.net 403-381-3700 bolt rims, like new, $2500 OBO.; 1 new PTO WATER PUMP plus 14 alum. irrigation 306-287-8487, 306-383-7191, Watson, SK. Goodyear 900/60x32 metric combine tire p i p e s p l u s t r a i l e r, g o o d p r i c e . C a l l Or e-m ail: FARM FOREMAN NEEDED on 3000 head on new 10 bolt rim, $4250 OBO. Phone 306-290-6495, Saskatoon, SK. lyle@ prim roselivestock.com cow outfit. Must have mechanical, welding 306-747-2514 or 306-961-8061, Shelland cattle feeding skills. People managebrook, SK. FULL-TIME POSITION. Housing avail. N/S. ment skills an asset. Housing provided. WATER PUMPS, 1” to 6”, starting at $139. SEEDMASTER PACKER TIRES. Phone Ask about our selection of hose and fit- grain/cow operation. Assets Class 1 and Contact Dan at South Peace Ranches, 306-771-2527, Edenwold, SK. 250-793-7442, Dawson Creek, BC. tings. See your nearest Flaman store or cattle exp. 403-823-9977, Rosedale, AB. COMBINE DUALS: fits JD 9600, includes call 1-888-435-2626, Saskatoon, SK. LESANN LAND AND Cattle Company a BEARTRAP FEEDERS near Nanton, AB. is hubs, rims, bolts and 20.8x38 tires, like for an experienced pen checker. new, 2 sets, $3000/ea. 306-745-2737, FLYGT 3152 HT SUBMERSIBLE PUMP, family owned mixed grain cow/calf opera- looking tion in The Pas, MB., is looking for a full- Primary duties include but not limited to 306-745-9096, Esterhazy, SK. 1 5 H P, 4 3 a m p , 2 0 8 vo l t , $ 1 5 , 0 0 0 . time employee. Duties include: operating pen checking and bunk reading. CompetiG O O D U S E D T R U C K T I R E S : 8.25/ 587-794-4666, Ext. 138, Hanna, AB. and maintaining all livestock equipment, tive wages. Email resume with references 900/1000/1100x20’s; 11R22.5/11R24.5; haying, fencing, calving and some grain to btrapfeeders@platinum.ca 9R17.5. Fresh load arriving June 1. Pricing related duties. Cattle experience is a must. from $90. Call Ladimer, 306-795-7779, Class 1 and mechanical experience are an KF KAMBEITZ FARMS has vacancies for 2 Ituna, SK.; Chris 306-537-2027, Regina. asset. Must have valid driver’s licence. full time farm supervisors at our farm loHourly wage $18-$25 based on skills and cated near Regina, SK. Duties include: COMBINE TIRES: 2- 800-65R32 Goodyear Phone Joel: 204-623-4357, fax Training and supervising general farm latires and rims to fit STS JD, 9 out of 10 KORNUM WELL DRILLING, farm, cottage experience. bourers; Managing and maintaining grain and acreage wells, test holes, well rehabili- resume to: 204-623-6315, The Pas, MB. cond., $7000. 306-276-2442, Nipawin, SK. inventories; Carrying out seeding, spraying tation, witching. PVC/SS construction, exSPECIAL TIRE ORDER: Firestone deep pert workmanship and fair pricing. 50% POULTRY FARM: Located 10 mins. W of and harvesting operations, as well as performing general farm duties. $16-20/hr. Saskatoon, SK. looking for full time farm tread, 800/65R38, now $2500, reg. $5900, government grant now available. Indian labourer. Applicant must be responsible depending on experience. Please submit 99.9% tread, barley used. Call Dean at Head, SK., 306-541-7210 or 306-695-2061 and should have the ability to work inde- resumes by e-mail to: jason@kf1899.com 306-883-2992, Spiritwood, SK. pendently and be able to do physical la- or fax: 306-545-3262. REDUCED TO CLEAR new and used spe- STAUBER DRILLING INC. Water well bour. Living accommodations may be cialized tires 37.5/38-39, 30 ply; 24.5-32; drilling and servicing, Geotechnical, Envi- available for the right candidate. Wages COWBOY WANTED for large cow/calf 29.5-29; 33.5-33; 16R-21; 33.25-35. Many ronmental, Geothermal. Professional ser- negotiable depending on experience. operation in northern SK. Needs to be able other odd ball sizes avail. 204-667-2867, vice since 1959. Call the experts at Please reply with cover letter and resume to ride and rope, treat cattle on pasture. fax: 204-667-2932, Winnipeg, MB. Phone Mike 306-469-7741, Big River, SK. by e-mail to: farmjobs519@yahoo.ca 1-800-919-9211 info@stauberdrilling.com

RURAL & CULTURAL TOURS

2- FULL TIME PERMANENT positions at farm located near Spruce Grove, AB. One requires experience with livestock and machinery; two requires experience with potato production. Benefits package and competitive wages! Send resume or enquire to email: lewis@xplornet.com

ROY HARVESTING now hiring Combine Operators and Truck Drivers for the 2013 harvest. Call Chuck 306-642-0055 or Chris 306-642-0076, Glentworth, SK. POSITION AVAILABLE, Cypress Hills, SK. area. Background and yearling grasser operation. Modern facilities and equipment. Good working environment. Class 1 preferred. Wages negotiable depending on experience. 306-295-4138, 306-295-7473. POUND-MAKER, a large scale integrated feedlot/ethanol facility operating at Lanigan, Sask. has immediate openings in various areas including cattle processing, equipment operators and feed truck drivers. Pound-Maker offers a comprehensive benefit package that includes a health benefits plan and pension. Compensation will be based on experience. Please forward resumes to: Pound-Maker Agventures Ltd., P.O. Box 519, Lanigan, SK. S0K 2M0. Fax: 306-365-4283 or email: pma@pound-maker.ca GENERAL FARM LABOURER for our 4000 acre contemporary grain farm with current equipment. We are looking for a self-motivated exp. Farm Labourer. Experience in all farm activities including driving trucks, tractors, and using farm equipment an asset. Other duties would be: machinery and building maintenance, yard and farm work. Must be able to work with limited supervision. Would be willing to train. Valid driver’s license is required. Position can be full-time or seasonal (negotiable). 8 hrs. a day unless dictated by the season or weather. Some weekend work is required. Wages $15-$20/hr. depending on experience and ability. Please contact Stan or Donna Yaskiw, Birtle, MB. 204-796-1400, 204-842-5252. SWATHER OPERATORS REQUIRED, Southern Sask. Housing provided. View our website: www.goswath.com Ph:306-536-5118


CLASSIFIED ADS 69

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

FARM MANAGER/ LABOURER for our 4000 acre contemporary grain farm with current equipment. We are looking for a self-motivated experienced person to run our farm. Experienced in all farm activities including seeding, spraying, harvesting, etc., as required. Mechanical aptitude and welding skills considered assets. Applicant should have good communication skills and be able to manage one or more employees. Valid driver’s license is required. Nine hour days, except variations dictated by season, and weather, or job timeliness. Weekends off except when the farm work dictates otherwise. Position can be full-time or seasonal (negotiable). Wages $20-$30/hr. We would consider, for the right employee, help in getting started farming or a co-farming arrangement. Please contact Stan or Donna Yaskiw, Birtle, MB. 204-796-1400 or 204-842-5252.

SEASONAL GRAIN FARM Labourer, Aug. 15 to Oct. for harvest season. Experience preferred. Competitive wages. Fax resume with references to 306-398-2567 or call 306-398-4714, Cut Knife, SK. COMBINE OPERATORS AND TRUCK DRIVERS needed for harvest on large grain farm. Accommodation available. Call Jim 403-575-0069, t4gerbers@yahoo.ca Coronation, AB.

CENTRAL AB GRAIN farm full-time permanent or seasonal. Applicant must have: experience with large modern equipment, grain handling, seeding and harvest operations, and strong mechanical skills, valid driver’s license, Class 1 an asset, progressive attitude and good communication skills. Offering: competitive wage based on experience, potential for off-farm housing and pasture. Phone 403-364-2129, E-mail 3L CATTLE COMPANY Ltd. is a mixed cattle resumes to: masonfarms@netago.ca or and farming operation. We are seeking fax to 403-364-2004, Delia, AB. qualified individuals for a Ranch Hand. Applicants must have knowledge of and ex- FULL-TIME FARM POSITION, starting perience with cow/calf and/or feedlot Sept. 1, 2013 available on our mixed situations. Horsemanship and roping is im- grain/cattle operation in Southern AB. We portant. You must supply own tack. Duties are seeking a self-motivated, reliable and would include calving, branding, pasture nonsmoking employee with experience in and feedlot treating of cattle, fence repair farm equipment and feedlot cattle. Must and helping w/haying crew if needed. have a driver’s license, a Class 3 would be Wages negotiable based on experience. an asset. Wages negotiable on experience Accommodations available. Start immedi- and possible housing available. Please ph ately. Fax resume, Attn. Shannon, to: Tracy at 403-964-2350, Rolling Hills, AB. 306-874-2457, ph. 306-874-5627, Naicam. FULL-TIME AND SEASONAL help wanted EMPLOYMENT OPPORTUNITY Full-time o n m e d i u m s i z e d g r a i n f a r m , e x p . and seasonal people to assist in operating w/equip. and trucking an asset, wages nea large modern grain farm. Preference giv- gotiable. Housing available. 780-847-3792, en to experience. Mechanical knowledge Marwayne, AB. and Class 1 driver’s license an asset. Wages based on experience, range $12-20/hr. WANTED: FARM LABOURERS able to but not limited to. Housing avail. Apply to: run farm equipment on cattle/grain farm. G a l v i n F a r m s L t d . , 2 0 4 - 7 4 8 - 8 3 3 2 , F u l l - t i m e wo r k ava i l a b l e . C a l l M i ke 306-469-7741, Big River, SK. john@galvinfarms.com Virden, MB. HARVEST HELP WANTED: Combine and truck operators. Aberdeen, SK. Phone 306-253-4443. E-mail or fax resumes to: 306-253-4798, powertongs@hotmail.com

FARM LABOURER ABLE to run farm equipment on a cattle and grain farm. Full-time work available. Call Andrew 306-795-2710, Goodeve, SK.

TIRED OF WHERE you are? Looking for a new place to work? Christian family with large grain farm in southern SK. is looking for a full-time farm family to help in farm operation. Excellent wages. Good farm location and community to raise a family. Call 306-267-6110, fax 306-267-4526 or email: hillcrestent@sasktel.net

FULL-TIME AND SEASONAL WORKERS needed on mixed grain and cattle operation. Must have driver’s license, experience required. References an asset. 10 mins. from Calgary, AB., call 403-274-0271, jmiller@efirehose.net

SEASONAL HARVEST HELP. Farm experienced to maintain, operate and repair farm machinery. Valid driver’s license required, Class 3A an asset. Must be hardworking, honest and dedicated. Position available immediately, no accommodations but close to Calgary, AB and other small towns. Fax resume to: 403-279-6957, Ph 403-680-4318. harmeson@platinum.ca

EMPLOYMENT OPPORTUNITY

HUNTER’S PARADISE GRAINFARM, located in Mossbank, SK, seeks motivated independant employee, experience in operating large farm machinery and Class 1A license an asset. Great wages available for experienced applicant, refs required. Email resume to Mike: nagelm44@hotmail.com or phone 306-354-7822. LARGE MIXED FARM and ranch requires full-time employee. Experience with cattle and equipment operation and maintenance an asset. Housing available on site, suitable for a family. Call 780-376-2241, Strome, AB. www.rawesranches.com

PARTS PERSO N REQ UIRED

P AYM EN T C L ERK AN D OF F I C E AS S I S TAN C E

W ellEsta blished M u ltilin e Agricu ltu ra lDea lership in Ea st Cen tra lAlberta IsLo o kin g Fo rAn Ho n est,Aggressive & Am bitio u s

PARTS PERSO N . Agricu ltu ra lBa ckgro u n d a n d Co m pu terExperien ce W o u ld Be An Asset. Fu ll-Tim e Po sitio n , $15 to $20 per ho u r.Ben efits,(a fter6 m o n th perio d ).

Plea se Fo rw a rd Resu m es to M a rc a t G ra tto n Co u lee Agri Pa rts Ltd ., B o x 4 1,Irm a ,AB T0B 2H 0 o r S en d Fa x to 780-75 4 -2333.

w here you can earn extra incom e at your flexible schedule plus benefits that takes only little of your tim e. R equirem ents • M ust have access to the internet • M ust be Efficient and D edicated Send your resum es to

hrim cglobalinckbates@ gm ail.com This great opportunity is lim ited.

C ro p Pro d u c tio n S e rvic e s C a n a d a is a d ivis io n o f Agriu m (w w w .Agriu m .c o m ), a n d o n e o f the la rge s t fa rm m a rke t re ta ile rs in No rth Am e ric a . Ou r m is s io n is to b e the tru s te d a n d re c o gn ize d le a d e r in the a gric u ltu ra l in d u s try, the firs t c ho ic e fo r e ve ry c u s to m e r a n d pro d u c e r. A gro w th c o m pa n y w he re e m plo ye e s c a n a c hie ve s u c c e s s a n d d e ve lo p to the ir m a xim u m po te n tia l. M a ke the m o ve to jo in o u r m o re tha n 8000 e m plo ye e s a c ro s s C a n a d a a n d the US a n d b e gin gro w in g yo u r c a re e r. We currently have an opening for a Full Time

OPERATIONS SUPPORT to join our team at our Didsbury, AB location. The successful candidate will possess the following qualifications: • Possess a valid Class 1A driver’s license with air brake endorsement. • Provide a valid driver’s abstract. • Farm or Ag experience preferred, but not required. • Candidate must work well with others in a team environment. • Provide high levels of customer service. • Ability to work long hours in busy season. • All candidates will be required to pass mandatory drug and alcohol testing. • Strong organizational and time management skills. • Ability to read rural maps accurately. • Will be required to maintain accurate records of product delivery. Interested applicants should send their resume in confidence to:

www.cpsagu.com/careers

Liquid Manure Drag Hose OperatorsW anted. Work will commence about mid-August. Good Wages! All Living Expenses Paid – Accommodation provided. Must possess a strong work ethic – farming background preferred but not necessary. Must have a valid Driver’s Licence. Call: (780) 674-0720 Or Fax Resume to (780) 674-3651 ~ for further information ~

FULL-TIME EMPLOYEE required on grain and cattle farm at Crossfield, AB. M u s t h av e f a r m e x p e r i e n c e . C a l l 403-946-4434.

IM C G lobalInc.is offering a position of

No phone calls please.

RM OF ROSEDALE No. 283 is accepting applications for an experienced full-time Road Foreman. Will have a working knowledge of road maintenance and construction, equipment operation and have a basic mechanical aptitude. Have the ability to operate a grader, buggy, dozer, loader, etc. Having a Class 1A license would be an asset. Strong leadership and supervisory skills required. Be a pro-active planner who identifies and documents all needs of the municipality. Prepare and maintain reports as directed by the Administrator. Salary will be negotiated based on qualifications. The RM offers a comprehensive benefits package. Please forward your resume with a covering letter including three work related references to the address below. The position will remain open until a suitable applicant is employed. The position is to be filled by November 1, 2013. We thank all who apply, however, only those individuals with interviews will be contacted. Administrator, RM of Rosedale No. 283, Box 150, Hanley, SK. S0G 2E0; BIG GAME HUNTING GUIDE in BC for phone: 306-544-2202, fax: 306-544-2252, October. Return travel, room and board email: rm283@sasktel.net Hanley, SK. paid. Good wage. 250-480-1202, Victoria, BC. office@rocky-mountain-outfitter.com MAINTENANCE POSITON at South Sask. Quality Processors. Tasks include: basic welding/fabrication, replacing bearings, lubrication, etc. Facility is 1 mile West of Regina. Fax/email resume: 306-935-2224, stoneyridge@sasktel.net Please include Is a pro gre s s ive , e xpa n d in g wage expected and references.

GRATTON COUL EE AGRIPARTS L TD.

a gric u ltu ra l s a lva ge pa rts c o m pa n y s pe c ia lizin g in la te m o d e l tra c to r a n d c o m b in e pa rts a n d lo c a te d a tIrm a , Alb e rta . W e a re looking for

M E CH ANICAL AS S E M BL E R S

(4 va ca n cies ) Perm a n en t, fu ll tim e p o s itio n s -44 hrs p er w eek. S a la ry $19.25 to $20.00/hr. Va lid d rivers licen s e. Previo u s exp erien ce a n a s s et. To a pply fo r a po s itio n w ith u s , plea s e e-m a il res u m e to : m a rc@ gcpa rts .co m o r s en d fa x to 78 0-754-2333 Atten tio n : Alvin W a n n echk o

DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s

D A R M A N I B I N S

BIN CREW S W AN TED

EAR N UP TO $4,5 00/D AY Du e to H IG H D EM AN D D AR M AN I is recru itin g m o re b i n crew s

QUAL ITY W ORK M AN S HIP ON L Y

Co n ta ct: DARM

AN IS ET UP DIV IS ION

w w w .d a rm a n i.ca 1-8 6 6 -6 6 5-6 6 77 All a rea s - S K /AB/M B

DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s ---- DARM AN I - Bu ild in g Be tte r Bin s

REGISTER TODAY!

INVESTING IN AGRIGULTURE AND FOOD 2013 North American Consulting School (NACS) The Greenwood Inn & Suites, Calgary Alberta November 20–21, 2013

D A R M A N I B I N S

CONSTRUCTION CREW, farm, residential and commercial, in Leduc, AB. area looking to hire. Pay rates vary in skill and knowledge. Hutterites welcome, living arrangements available. Call 780-886-6312. 4 EXPERIENCED COOKS required. Fulltime year round shift work, $12-15. per hour. 2 years experience preparing meals in restaurants and/or culinary degree. Apply at: Manitou Springs Hotel and Mineral Spa at 302 McLachlan Ave, Manitou Beach, PO Box 610, Watrous, SK. S0K 4T0, email to: dhmanitousprings@sasktel.net or fax to: 306-946-3622.

PLANT M ANAGER PULSE PLANT In d ia n H ea d , S K .

W e a re s e e kin g a n e xpe rie n ce d M a n a ge r to wo rk with o u r cu rre n t te a m to m a n a ge the o pe ra tio n s o f a P u ls e P la n t fa cility. T his po s itio n re po rts to the P u ls e Cro p M a rke t D e ve lo pm e n t M a n a ge r a n d is in vo lve d in the d a y to d a y o pe ra tio n s o f pu ls e cro p pro cu re m e n t, in ve n to ry m a n a ge m e n t, lo gis tics , s pe cia l cro p pu rcha s in g/s a le s a n d re la te d pa pe rwo rk. W e o ffe r a co m pe titive s a la ry, in ce n tive s a n d a fa m ily b e n e fits pa cka ge . In te re s te d a pplica n ts m a y a pply to :

p gfc a reers @ p a ters o n glo b a lfo o d s .c o m Paterson GlobalFoods Inc. is an EqualOpportunity Em ployer and encourages Fem ales, Disabled, Aboriginaland visible M inorities to apply. PROFESSIONAL FARM Manager Piper Farms Ltd., Creston, BC. Permanent fulltime position for Manager of 3800 acre grain, canola, Timothy hay/seed farm. Agricultural training and pesticide applicator course. Will be responsible for all aspects of farm management including crop planning, seeding, harvesting, and marketing. Competitive salary/benefits. Include references. Apply to: gwentelling@gmail.com

MOUNTAIN COIL TUBING Ltd. is looking for coil tubing and fluid pump operators for Oilfield downhole services. Call 587-253-0115, Strathmore/Grande Prairie, AB. Email resume, references, and drivers abstract to: tschwab@mountaincoil.com

Contact AgriBiz, Event Management at 306.249.3512 cmc-canada.ca/go/nacs

Lloydminster, AB Requires 5 Service Rig Derrick Hands @ $29.50/hr – 40 hrs/wk and 12 Service Rig Floor Hands @ $27.00/hr – 40 hrs/wk, for work in the Lloydminster area.

Please fax resume to 780-871-6908 or email: royalwel@telus.net Presented by DAVY CROCKETTS OILFIELD SERVICES Ltd. is immediately seeking trainee Power Tong Operators. Experienced power tong operators will be given preference; Also Shop Hand required. Must be willing to reside in the Valleyview/ Grande Prairie, AB and surrounding area. Must have clean drivers license w/abstract and H2S. Please e m a i l r e s u m e w i t h 3 r e fe r e n c e s t o rairth5@gmail.com or call 780-957-3101.


70 CLASSIFIED ADS

LOCALLY OWNED IN HINTON, AB, Looking for Tank Truck DRIVERS or OWNER Operators for transporting oilfield fluids throughout West Central Alberta. We have grown and adapted to meet the needs of our clients with a highly skilled team of respected professionals. We strive to perform our jobs in a safe and environmentally responsible manner while exceeding the expectations of all our customers. Applicants must provide the following: Current resume including driving experience or equipment owned; Copy of Valid Class 1 Licence, Current Safety Certificates and Current Driver Abstract. All successful applicants must pass a pre-employment drug screening. Please forward all correspondence to Mike Bamber at mikejdc@telus.net or fax 780-865-4478

THE WESTERN PRODUCER, THURSDAY, AUGUST 8, 2013

LOOKING FOR JOURNEYMAN or exp. Heavy Duty Mechanics to work in the shop and/or in the field. Competitive wages/benefits. 306-230-8469, Marwayne,AB. AUTOMOTIVE TECHNICIAN WANTED for high volume 9 day general automotive repair shop. Competitive wages, medical plan, Monday to Friday, 8 to 5. Fax resume to 306-763-5059 or apply in person at Walters Service, 164 16th Street West, Prince Albert, SK, ph. 306-764-1686. HEAVY DUTY MECHANIC wanted sign on bonus $1000. Paskal Cattle Company seeking a licensed heavy duty mechanic for our main shop in Picture Butte. job duties include: servicing and maintaining truck fleet of 20 highway trucks and 20 cattle liners; mounting and servicing roto-mix feedmixers; servicing and maintaining all types of feedlot equipment i.e. payloaders, feed trucks, skidsteers, pickups, pumps, etc. Paskal Cattle offers qualified candidates: opportunity to work for family run operation; competitive wages; benefits package after 3 months. Qualified candidates please contact Shawna email: bgm5@telus.net call 403-732-5641 Ext 1, Picture Butte, AB.

TH OR H ILD CO-OP is recru itin g for

A GR O S A L ES S P EC IA L IS T R e p o r ting to th e A g r o M a na g e r, th e S a le s S p e c ia listp la ys a k e y le a d e r sh ip r o le o n o ur te a m a nd m ust: â&#x20AC;˘ H a ve a str o ng w o r k ing k no w l ed g e o f se e d , c h e m ic a l a nd A g r o no m i c p r a c tic e s â&#x20AC;˘ Be a b l e to p r o vi de p r ic e q uo te s a nd sa le s info r m a tio n o n a ll g r a i n h a nd l i gn a nd sto r a g e e q uip m e nt M usth a ve a n a g r ic ultur a l b a c k g r o und . P r e fe r e nc e g ive n to p o st-se c o nd a r y e d uc a tio n in A g r o no m y o r A g r ib usine ss fie ld . C o m p e titive c o m p e nsa tio n a nd b e ne fits p a c k a g e . W a g e s ne g o tia b le o n e xp e r ie nc e . P l ea se fo r w a r d r e sum e to : Kory Kra l ka y, Gen era l M a n a ger Phon e: 780-398-3975 e-m a il: gm @ thorhild coop.com

TRAILER TECHNICIAN WANTED - sign on bonus $500. Paskal Cattle Company is seeking a trailer technician for our main shop in Picture Butte. Duties include: servicing and maintaining 20 cattle liners; assisting with servicing and maintaining 20 highway trucks; servicing and maintaining all types of feedlot equipment; assisting with roto-mix mounting and servicing; Paskal Cattle offers for qualified candidates: opportunity to work for family run operation, competitive wages, benefits package after 3 months, work Monday to Friday 8:00AM to 5:00PM. During busy seasons hours may fluctuate. Qualified candidates can please contact Shawna by email: bgm5@telus.net or call 403-732-5641, EXT. 1, Picture Butte, AB. WE ARE LOOKING for a Journeyman Automotive Tech to come join our team, fulltime. 7 bay 3 person shop in sunny Grand Forks, BC. For info. on wages please call Tom at Tomkat Automotive 250-442-2289, or fax resume to 250-442-2884. HD TRUCK MECHANIC required for small trucking company in Lloydminster, AB area. License an asset, competitive wages. John 780-846-0002 or fax 780-846-0005. OK TIRE in Southey has an opening for an experienced shop person. We sell, install and repair all types of tires and do vehicle maintenance. We offer competitive wages and company benefits. Southey, SK. Call: 306-726-5712. UTILIZE YOUR EXPERTISE to teach others! SIAST Kelsey Campus in Saskatoon, has an opening for a full-time Agricultural Machinery Technician Instructor. In this role you will prepare and deliver lessons, assignments, lectures and demonstrations for the Agricultural Machinery Technician program. You will be ready to succeed in this role if you have Grade 12 or equivalent, Journeyperson Certificate in the Agricultural Machinery Technician trade and 2 years recent/relevant postJourneyperson experience as an Agricultural Machinery Technician. Applications will be accepted until 11:59 PM. on August 16, 2013. All submissions should reference competition #P00557. For details please see the careers section of our website www.goSIAST.com

CLASS 1A DRIVER required to operate tandem truck in the Saskatoon area. Experience an asset, but willing to train the right individual. Competitive wages and LARGE PROGRESSIVE 5TH Generation benefit plan. Fax resume and abstract to: grain farm located 15 min. from Regina, SK. has opening for full-time year round 306-668-6610 email: larry.allpro@shaw.ca and seasonal 1A truck drivers. Successful HEAVY TOW TRUCK driver wanted with candidates will join our team and be minimum Class 3 license and air brakes. tasked with hauling grain from bin to marClass 1 license preferred. Please e-mail ket during harvest and throughout the resumes to: allrig@allrigtowing.com or year. Drivers will also be hauling fertilizer during seeding operations. All short hauls, fax to: 204-275-3443, Winnipeg, MB. home every night, weekends off in nonpeak season, flexible scheduling. Experience in Super Bâ&#x20AC;&#x2122;s an asset. Top wages paid. Call 306-535-7708. IMMEDIATELY: Class 3A and 1A drivers CLASS 1A HD Tow Truck Driver required to haul water on drilling rigs. Must have all for Lloydminster, AB, area. Permanent fullsafety tickets and clean abstract. Experi- time position. Will train. Abstract required. ence preferred. Competitive wages. Fax John 780-846-0002 or fax 780-846-0005. resumes to: 306-826-5623, or phone: 306-826-5751 between 7:00 AM and 6:00 CLASS 1A DRIVER, full-time position, hauling grain and fertilizer in SK and AB. PM, Marsden, SK. Benefits after 3 months. Contact Guy Trucking Ltd. at 1-888-304-4888, email: dee.guytrucking@sasktel.net

Tru ck Driver sW a n ted ~Big g a r Tr a n s p or t~

Co m pa n y Drivers& Lea sed O pera to rs to pu llSu perBâ&#x20AC;&#x2122;sin bu lk gra in & fertilizerd ivisio n Co m petitive w a ges& ben efits& Sign in g Bo n u s S en d Resu m e & DriversAbstra ctto ro d p a cik@ tra n sa llg ro u p .co m o r fa x:3 06 -24 2-2077 C a ll:Ro d Pa cik 3 06 -24 9-6 85 3 3 06 -3 81-6 5 3 5 ROY HARVESTING now hiring Combine Operators and Truck Drivers for the 2013 harvest. Call Chuck 306-642-0055 or Chris 306-642-0076, Glentworth, SK. SELECT CLASSIC CARRIERS immediately requires Leased Operators with new model 1 tons and 5 ton straight trucks/ tractors, and Company Drivers; Also require 1 driver with 5L or Class 1 license for operating a haul and tow. Transporting RVs/general freight, USA/Canada. Clean abstract required. Competitive rates. Fuel surcharge/benefits. 1-800-409-1733.

WANTED: DRIVERS/OWNER Operators for grain and fertilizer hauling, based in Kenaston, SK. Phone Leon at TLC Trucking 306-252-2004 or 306-567-8377.

EVEREST TRUCKING LTD. Now hiring class 1A and owner operator for livestock hauling in AB. and SK. Experience an asset. Fax resume w/drivers abstract: 780-853-6872 TRUCKING COMPANY LOOKING for semi or call Larry 780-853-6330, Vermilion, AB. vac, body job and steamer operators. Top wages paid to right individual, Class 1 an LONG HAUL SEMI drivers and O/O reasset, but not required. Also looking for quired to haul RVs and general freight. lease operators to pull semi vac trailers. D r i ve r s p a i d 4 0 ¢ / r u n n i n g m i l e a n d 306-753-7198, Macklin, SK. pick/drop/border. O/O paid 85% of gross revenue. Benefits, company fuel cards and CLASS 1 AND 3 TRUCK DRIVERS need- subsidized insurance. Must have valid ed for harvest on large grain farm. Accom- passport and ability to cross border. Call modation available. Jim 403-575-0069, Jeremy at 1-800-867-6233, Saskatoon, SK. t4gerbers@yahoo.ca Coronation, AB. www.roadexservices.com

GEN ERAL M AN AGER  N UTRASUN FOODS 

The Com pa ny P a te rs o n Glo b a lFo o d s In c. (P GF) is a Ca n a d ia n co rpo ra tio n w ith b u s in e s s in the gra in , fo o d a n d fe e d s e cto rs . W e a re s e e kin g to e xpa n d o u r pre s e n ce w ithin the fo o d in d u s try fro m the b a s is o fo u r s u b s id ia ry, N u tra S u n Fo o d s In c.

The Cha llenge As the S e n io r M a n a ge r a t the flo u r m ill in Re gin a , S a s ka tche w a n yo u w ill o ve rs e e the o ve ra ll b u s in e s s o f the m ill. Re po rtin g to the D ire cto r, As s o cia te d Co m pa n ie s , yo u w ill b e re s po n s ib le fo r pla n n in g pro d u ctio n a ctivitie s , d ire ctin g o pe ra tio n s a t the m ill in clu d in g s ta ffin g, a n d yo u w ill b e in vo lve d in s a le s a ctivitie s in clu d in g pricin g, ris k m a n a ge m e n t a n d n e w m a rke t d e ve lo pm e n t. Yo u r b u s in e s s s e n s e a n d e xpe rie n ce w ill e n a b le yo u to le ve ra ge P GFâ&#x20AC;&#x2122;s co m pe titive a d va n ta ge s to e xpa n d o u r pre s e n ce w ithin the m illin g in d u s try.

The Skills Yo u w ill ha ve a m in im u m o f 5 ye a rs pro d u ctio n m a n a ge m e n t e xpe rie n ce w ith pre fe re n ce give n to ca n d id a te s w ho ha ve e xpe rie n ce in a fo o d a n d /o r gra in e n viro n m e n t. Ca n d id a te s s ho u ld ha ve d e m o n s tra te d m a n a ge ria l le ve l le a d e rs hip e xpe rie n ce . A d e gre e in b u s in e s s , fo o d s cie n ce o r o the r re la te d d is ciplin e s w o u ld b e co n s id e re d a n a s s e t.

The Rew a rds P a te rs o n Glo b a lFo o d s o ffe rs a co m pe titive e xe cu tive co m pe n s a tio n pa cka ge tha t re w a rd s s u cce s s .

Resu m e Su bm ission Re s u m e s m a y b e s u b m itte d o n o r b e fo re Au gu s t 1 0th, 201 3 to : pgfcareers@patersonglobalfoods.com or faxed to 204.926.9586 Paterson GlobalFoods Inc. is an EqualOpportunity Em ployer and encourages Fem ales, D isabled, Aboriginaland visible M inorities to apply.

RETIRED MALE: EXPERIENCED operator of farm equipment and heavy equipment. No cattle or labour work, available immediately. Call: 780-426-5142 or cell: 780-984-2545, Edmonton, AB.

Western Ag Professional Agronomy delivers PRS CropCastâ&#x201E;˘, a complete crop selection, nutrition and yield forecasting service that empowers farmers with the knowledge to Grow More ProďŹ t.

Gibson *LEVRQ Energy (QHUJ\ ULC 8/& is LV aD progressive, SURJUHVVLYH growth JURZWK oriented, RULHQWHG North 1RUWK American midstreamRLOoil & FRPSDQ\ gas company. The Lloydminster/ $PHULFDQ PLGVWUHDP  JDV  :H DUH FXUUHQWO\ VHHNLQJ Bonnyville branchUHVXOWV is currently seeking dedicated, HQWKXVLDVWLF RULHQWHG LQGLYLGXDOV safety IRUoriented RXU /OR\GPLQVWHU%RQQ\YLOOH$UHD%UDQFK full time Contract Carriers for our Bonnyville Area.

2:1(523(5$7256 4XDOLILFDWLRQVUHTXLUHG x x x

9DOLG&ODVVOLFHQVH \HDUVGULYLQJH[SHULHQFHLVDQDVVHW 2LOILHOGH[SHULHQFHLVDQDVVHW

*LEVRQ(QHUJ\8/&RIIHUVDFRPSHWLWLYHFRPSHQVDWLRQSDFNDJH ,QWHUHVWHGFDQGLGDWHVDUHLQYLWHGWRDSSO\YLDRXUZHEVLWH ZZZJLEVRQVFRPRUE\)D[DW

SALES AND NUTRITION CONSULTANT

 EM F N u trition is se e kin g a n E n e rg e tic, C u stom e r Se rvice O rie n te d , a n d P rofe ssion a l, An im a l N u trition C on su lta n t for ou r Sa ska tche w a n Te rritory. Ba se d ou t of the SA SK ATO O N office , you w ill tra ve l the provin ce d e live rin g hig h qu a lity se rvice a n d se llin g the se rvice s a n d prod u cts tha t w e provid e . Y ou r re spon sib ilitie s w ill in clu d e , M a in ta in in g cu rre n t b u sin e ss, w hile prospe ctin g a n d d e ve lopin g n e w opportu n itie s throu g h the m a rke tin g of ou r prod u cts to the live stock in d u stry,W ork close ly w ith prod u ce rs provid in g in form a tion tha t w ill a ssist the m in in cre a sin g the profita b ility of the ir b u sin e sse s. Bu ild , prom ote , a n d m a in ta in positive cu stom e rre la tion s.   If you posse ss the follow in g the n w e w a n t to he a r from you ; D iplom a or D e g re e in A g Bu sin e ss, A n im a l N u trition , C om m e rce , Bu sin e ss Ad m in istra tion , or re la te d e d u ca tion a n d / or e xpe rie n ce Stron g V e rb a l & W ritte n com m u n ica tion skills Sa le s, M a rke tin g , M e rcha n d isin g or R e ta il e xpe rie n ce . Stron g com pu te r skills in M S O ffice (W ord , E xce l, P ow e r P oin t) P re viou s e xpe rie n ce w ith live stock. Tra ve l is re qu ire d , so a va lid d rive râ&#x20AC;&#x2122;s lice n ce a n d a ve hicle in g ood w orkin g ord e ra re re qu ire d .   In te re ste d a pplica n ts a re e n cou ra g e d to a pply w ith d e ta ile d re su m e a n d cove rle tte r.   P lease forw ard resu m es to: 71 5 M a rion Street W in n ipeg ,M B,R 2J 0K 6 or: hr@ ea stm a n feed s.com or F a x: (204)233-7245  

We are seeking applicants interested in joining our growing team in the following full time position:

Professional Agronomy Consultant OPPORTUNITIES AVAILABLE IN WESTERN CANADA AND NORTH DAKOTA Western Ag Professional Agronomy provides a profitable, rewarding and flexible career opportunity for independent agronomists who will work collaboratively with farmers to Grow More ProďŹ t.

To apply: Please submit a cover letter and resume to professionalagronomy@westernag.ca Scan the QR code for full job posting.

westernag.ca/careers â&#x201E;˘ PRS and PRS CropCast are trademarks of Western Ag Group of Companies 13058 08.13

7(55,725<6$/(65(35(6(17$7,9( +LJK*URZWK2SSRUWXQLW\ 0DVVORDG7HFKQRORJLHV,QFLVDG\QDPLFOHDGLQJHGJHPDQXIDFWXUHURIKLJKTXDOLW\ ZHLJKLQJHTXLSPHQWIRUWKHDJULFXOWXUDOPLQLQJDQGWUDQVSRUWDWLRQLQGXVWULHV 0DVVORDGLVDOODERXW23325781,7,(6ÂŤRSSRUWXQLWLHVIRUGHYHORSLQJDQGHQKDQFLQJ LWV SURGXFW RIIHULQJV IRU H[SDQGLQJ LWV PDUNHWV DQG FXVWRPHU EDVH DQG RSSRUWXQLWLHV IRUWDOHQWHGSURIHVVLRQDOVZKRZDQWWREHSDUWRIDYDOXHVEDVHGRUJDQL]DWLRQWKDWWUXO\ YDOXHVLWVSHRSOHDQGUHZDUGVWKHPEDVHGRQWKHLUSHUVRQDOFRQWULEXWLRQVWRWKHFRP SDQ\ÂśVVXFFHVV :HDUHQRZVHHNLQJDQH[SHULHQFHGDQGKLJKO\HIIHFWLYHKDQGVRQ6DVNDWFKHZDQ7(5 5,725<6$/(65(35(6(17$7,9(5HSRUWLQJGLUHFWO\WRWKH3UHVLGHQWWKH7HUULWRU\ 6DOHV5HSUHVHQWDWLYHZLOOEHDQRXWVLGHVDOHVSHUVRQUHVSRQVLEOHIRUJURZLQJVDOHVRI RXUIDUPVFDOHSURGXFWVWKURXJKIDUPHTXLSPHQWGHDOHUVE\ 'HYHORSLQJVWURQJUHODWLRQVKLSVZLWK6.IDUPHTXLSPHQWGHDOHUV (VWDEOLVKLQJDJUHHPHQWVZLWKGHDOHUVWRFDUU\0DVVORDGIDUPVFDOHV 3URPRWLQJDQGJURZLQJVDOHVRI0DVVORDGIDUPVFDOHV :HZHOFRPHDSSOLFDQWVIRUWKLVSRVLWLRQZKRFDQGHPRQVWUDWH 6WURQJWLHVZLWKWKHIDUPLQJDQGIDUPHTXLSPHQWGHDOHUFRPPXQLW\ $WUDFNUHFRUGPRWLYDWHGE\VHOOLQJ $SDVVLRQIRUH[FHOOHQFHLQPHHWLQJFXVWRPHUQHHGV $PLQLPXPRI\HDUVRIH[SHULHQFHLQDVHQLRUUROHLQDUHODWHGIXQFWLRQ $GHVLUHDQGFDSDELOLW\WRWDNHRZQHUVKLSLQWKHSRVLWLRQDQGWRFRQWULEXWHWRWKH FRPSDQ\ÂśVÂżQDQFLDOVXFFHVV 6XSHULRU(QJOLVKODQJXDJHDQGFRPPXQLFDWLRQVNLOOV VSRNHQFRPSUHKHQVLRQ ZULWWHQ

&DQDGLDQOHJDOZRUNLQJVWDWXV 6,1QXPEHU DQG'ULYHUÂśV/LFHQVH 7KHVXFFHVVIXODSSOLFDQWZLOOEHUHZDUGHGZLWKDJHQHURXVSDFNDJHRIEDVHVDODU\DQG FRPPLVVLRQVZLWKVLJQLÂżFDQWSRWHQWLDOIRUJURZWK,QWHUHVWHGDSSOLFDQWVVKRXOGVXEPLW WKHLU UHVXPHV DQG FRYHU OHWWHU RXWOLQLQJ VNLOOV H[SHULHQFH LQWHUHVWV DQG FXUUHQWH[ SHFWHGUHPXQHUDWLRQE\HPDLO2QO\FDQGLGDWHVLQYLWHGIRULQWHUYLHZZLOOEHFRQWDFWHG 0DVVORDG7HFKQRORJLHV,QFZZZPDVVORDGFRP (PDLOODUU\#PDVVORDGFRP


THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

SUBSCRIBE. SUBSCRIPTION/RENEWAL ORDER FORM

Name

Account #

I would like to give a GIFT SUBSCRIPTION to:

Address Name

City/Town Phone (

Postal Code )

Address

Year of Birth

Email

City/Town

Province

Postal Code

Phone (

One Year:

One Year:

Two Years:

I’m an active farmer/rancher

I’m interested in agriculture

)

Two Years:

Name

I would like to pay by (check one):

Cheque enclosed

Visa

Mastercard

MONTH

CARD NUMBER

Address

YEAR

EXPIRY DATE

City/Town

Province

Postal Code

Phone (

One Year:

Signature

)

Two Years:

Date

Subscription Prices

One Year Two Years

Subscription Prices

One Year Two Years

SK & AB residents (GST 5% inc.) MB residents (GST 5% & PST 7% inc.)

$87.07 $92.87

ON residents (HST 13% inc.) BC residents (HST 12% inc.) NS residents (HST 15% inc.)

$93.70 $92.87 $95.36

$161.95 $172.75

$174.29 $172.75 $177.38

Per copy retail add taxes $4.25 United States US/year $179.66 All other countries CDN/year $358.19

MY BILLING INFORMATION: Name

I would like to pay by (check one):

Account #

Cheque enclosed

MONTH

Address City/Town Phone (

Visa

CARD NUMBER

Postal Code )

Year of Birth

Mastercard YEAR

EXPIRY DATE

Signature

Date

Email

Mail to: The Western Producer, Box 2500, Saskatoon, SK S7K 2C4 or Call 1-800-667-6929

What’s the bottom line? Keep yours in sight with the

Prairie Farm Account Book

2(#$ &5" */ $ 0 .

93&$

1 S B JS

JF ' B S

The Prairie Farm Account Book is designed for farm and ranch use. Whether it’s your primary bookkeeping method or a supplement to computer programs, the Prairie Farm Account Book is a simple, portable and affordable ledger to help you keep the books straight.

03%4

N " D D

P V O U

#PPL

$0





Prairie Farm Account Books P.O. Box 2500, Saskatoon, SK S7K 2C4 or call toll-free 1-800-667-6929

SK & AB MB ON BC

$19.43 taxes inc. $20.72 taxes inc. $20.91 taxes inc. $20.72 taxes inc.

71


72

NEWS

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

STATELY STRUCTURE SURVIVES

A stone house sits surrounded by fields of flax and canola north of Edenwold, Sask. |

CHERYL PADY PHOTO

AG CANADA | BUDGET CUTS

POTASH CARTEL | GLOBAL IMPACT

Russia’s Uralkali rocks potash sector by pulling out of cartel Uralkali says Belaruskali made deliveries outside of the partnership

Opposition wants details on how cuts affect Agriculture Canada and CFIA programs and services BY BARRY WILSON OTTAWA BUREAU

REUTERS AND WESTERN PRODUCER STAFF

MOSCOW, Russia — Canadian potash producers, the Saskatchewan government and rural communities benefiting from the billions spent on new and expanding mines are trying to assess the impact of the breakup of a potash cartel in the former Soviet Union. Russia’s Uralkali quit one of the world’s two big potash cartels July 30, heralding a price war for the key crop nutrient and pummelling the shares of companies that produce it. The breakup of the Belarusian Potash Company (BPC), a joint venture with Belarus partner Belaruskali, leaves North America’s Canpotex as the dominant potash export venture. The BPC joint venture started to crumble this year as rumours emerged that both companies were selling potash outside the partnership. The two firms previously denied those rumours. Uralkali said it pulled out because Belaruskali had made key fertilizer ingredient deliveries outside the partnership. The breakup could cause rivals to cancel new production projects if it leads to sustained lower prices, but it may also bring cheaper fertilizer to farmers, at least those in India and China. “It is as if Saudi Arabia decided to leave OPEC; oil prices would fall immediately,” said Dmitry Ryzhkov, an equity sales trader at Renaissance Capital. BPC and Canpotex usually settled for deals at similar prices when in negotiations with big buyers like India and China, and they had no qualms about turning off the supply spigot when buyers looked likely to gain the upper hand. Canpotex members regularly curtail production to control inventory. To g e t h e r BP C a n d Ca n p o t e x accounted for almost 70 percent of global potash sales.

Ottawa ‘hiding truth’ on budget cut impacts

It is as if Saudi Arabia decided to leave OPEC; oil prices would fall immediately. DMITRY RYZHKOV RENAISSANCE CAPITAL

Uralkali now promises to raise production and sales, even as potash prices are already in decline. It plans to boost sales to 13 million tonnes in 2014 and 14 million in 2015 from 10.5 million this year by expanding market share in China, India and Brazil. Weaker potash prices this year and rising construction costs had already caused some planned mine construction in Canada to be delayed or shelved. A big question now is what BHP Billiton will do regarding its $14 billion Jansen project in Saskatchewan. The project is expected to produce eight million tonnes a year, which was 15 percent of global potash production last year. That project, as well as expansions at existing mines and the new K&S

Legacy project north of Moose Jaw, Sask., have pumped money, jobs and housing demand into a number of rural communities. Royalties from potash production are also a significant contributor to Saskatchewan’s bottom line. The province’s current budget forecast puts revenue from potash royalties at $520 million, or 4.5 percent of total provincial revenue of $11.6 billion. Premier Brad Wall said the province would have to lower its royalty revenue forecast but added the reduction would be mostly offset by gains in other areas, including stronger than expected oil revenue. Uralkali speculates that the breakup of its cartel could drive global potash prices down about 25 percent to around $300 per tonne, but that does not mean North American prices will fall that low. For example, weak demand in 2010 pushed Potash Corp.’s average realized price for the year to $316, but that was a combination of a North American price of $364 and an offshore price of $285. This summer, potash retail prices in North America are well above $550 per tonne.

Agriculture Canada and the Canadian Food Inspection Agency are defying a demand from the parliamentary budget officer that they provide more details on the impact of their budget cuts. Interim PBO Sonia L’Heureux has asked all departments and agencies twice since April for detailed information on the impact of budget cuts imposed in the 2012 federal budget. In late July, she reported that many had not complied by the latest deadline. Agriculture Canada and the CFIA were listed as “refusal to comply,” while the Canadian Dairy Commission offered “no response.” It could open the way for NDP leader Thomas Mulcair, who asked the PBO to do the analysis, to take the delinquent departments to court. The non-compliers insist they are not delinquent and provided all the information that the PBO asked for within the position’s legislative mandate. The federal government created the PBO position five years ago to act as an independent analyst of federal government finances and spending. Almost from its creation, first parliamentary budget officer Kevin Page clashed with the government as he critiqued its spending and deficit reduction plans and demanded detailed information about government statements on the effect of their financial decisions and veracity of their projections. Page was not reappointed when his five-year term ended earlier this year. For the moment, chief parliamentary librarian L’Heureux, who is acting until a new permanent PBO is appointed, is carrying on in Page’s legacy, demanding detailed information on the impacts of billions of dollars worth of budget cuts announced last year. In response, Agriculture Canada

presented information that indicated cuts will cause 617 job cuts at the department by next year with several hundred additional cuts at the CFIA. The descriptions of the budget and staff cuts were vague, arguing “efficiencies” and “streamlining” and eliminating unnecessary programs. In its submission on significant cuts to the science, innovation and adaptation branch, for example, the department’s response said it has “found ways to save money by operating fewer facilities while still maintaining the same level of service to Canadians and farmers.” It said research priorities will be “better aligned” with industry research priorities and some lowerpriority programs will be eliminated. “We will continue to maintain centres, labs, greenhouses and farms across the country, but it is time for this network to reflect the real needs of the sector,” said the Agriculture Canada submission. L’Heureux is demanding more specific information about how the cuts will affect programs, services and employees. Liberal agriculture critic Frank Valeriote argues that the need for more transparency about the impacts of cuts is even more critical at the CFIA. In a letter to agriculture minister Gerry Ritz, he said the CFIA should be instructed to provide the information the PBO has demanded because the impact of cuts on food inspection is key. “Despite a senior vice-president informing staff that there would necessarily be a front line impact with the significant cuts made and information we have had to glean from access to information requests showing fewer front line veterinarians, you have continued to argue that there has been no noticeable impact, all the while refusing to release the necessary information to confirm your statements,” he wrote. “This cannot stand.” Valeriote said in an interview that the government is “hiding the truth about the impact of their cuts.”


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

73

WEED WORK

CANADIAN FEDERATION OF AGRICULTURE | COMMODITY PRICES

Program cuts, price declines could put farmers at risk Risk management | CFA calls on feds to review farm safety net programs BY BARRY WILSON OTTAWA BUREAU

MONTREAL — With early signs of softening agricultural commodity prices, Canadian Federation of Agriculture directors are calling on governments to commit to a review next year of the effectiveness of weakened safety net programs. There are also warnings that cuts in the level of program coverage could entice farmers into direct political action and protest rallies that have not been seen for years. When Growing Forward 2 launched April 1, the support offered by mainstay programs AgriStability and AgriInvest was substantially reduced based on a 2012 agreement between federal and provincial agriculture ministers at a Whitehorse meeting. CFA directors meeting July 31 for their annual summer meeting argued in interviews that farmers did not fully grasp the impact of business risk management cuts last year because commodity prices were high and safety nets were not on their minds despite farm leader warnings. “I think by this time next year, producers will be feeling the effects of falling incomes and they will suddenly be aware that they have lost some of the protection they had,”

RON BONNETT CFA PRESIDENT

said Ontario Federation of Agriculture president Mark Wales. CFA president Ron Bonnett said the architects of the cuts seemed to be basing decisions on the political assumption that prices would stay strong for years. However, some prices are already softening, and projections in the United States are for a prolonged period of corn prices 30 to 40 percent below recent highs. “I think when that dawns on them, there will be some anger and it will be the time when some cracks start to appear in the system,” said Bonnett. “We might get to the place where farmers are ready to put their tractors back on the road again. Sometimes it takes a crisis to wake people up.” During the Montreal board meeting, Agricultural Producers Association of Saskatchewan delegates proposed a resolution “that the federal and provincial governments conduct a performance review of the GF2 business risk management programs

CANADIAN FEDERATION OF AGRICULTURE | MARKETING

Quebec farmers earn more through collective marketing, says official BY BARRY WILSON OTTAWA BUREAU

MONTREAL — With a significantly smaller agricultural sector than neighbouring Ontario, Quebec agriculture consistently records one of the highest net farm incomes in the country. In 2011, Quebec’s $1.2 billion in net farm income was the strongest in the country. Ontario recorded net farm income of $880 million that year. Last week, Quebec farm leader Marcel Groleau told his fellow directors on the Canadian Federation of Agriculture board the not-so-secret reason for his province’s success. “One of the major reasons is implementation of our collective marketing system,” the president of the Union des Producteurs Agricoles told the summer meeting of the CFA board July 31 when it met in Montreal. “This has been a good way for us.” Many provinces have dismantled most of their single desk agricultural marking agencies over the years other than supply management, including Ontario’s wheat board and the Prairies’ hog boards. However, Quebec has shown no signs of following suit. Most of the province’s far mers market their produce through a marketing board, some mandatory and some voluntary. “This is one of the strengths of Que-

bec agriculture,” said Groleau. “It gives us market strength and that is all the more important now with the concentration of processors.” He said the province’s important hog sector survived the years of industry downturn in better shape than most provinces because of its collective marketing. “We lost some farms for sure, but we maintained the industry.” He said the first farm marketing legislation was approved in 1956 and it has become the Quebec model, supported by governments and farmers ever since. It also helps that the Quebec government offers one of the country’s most farmer-friendly and financed provincial support programs. The UPA is now working with the newly elected Parti Quebecois government as it promotes a food sovereignty plan for Quebec and industry development plans, which would expand food production but also increase promotion of Quebec products to Quebec consumers. With the government support comes significant regulations on environmental practices, land use and land ownership. Groleau said the UPA supports the government direction, which helps the industry but also expects it to take responsibility for producing safe food in sustainable ways.

during the 2014-15 program year to determine if changes are necessary to improve the effectiveness of the programs.” There were no dissenting votes. Bonnett said part of the problem was that governments offered little analysis of the impacts of the cuts if their assumptions about continued strong prices were wrong. During the debate leading to the GF2 agreement, critics including some farm leaders argued it was simply a way to help governments with their deficit problems rather than a vision for the industry. But last week in a speech to the U.S. Grains Council meeting in Ottawa, federal agriculture minister Gerry Ritz argued the shift away from income support programs was a strategic decision by ministers to change the industry. “GF2 pushes more of the spending envelope away from the reactive and towards proactive areas like innovation, market development and competitiveness,” he told the largely American audience holding their first grains council meeting in Canada.

Lillian Bozarth tackles the weeds in her garden on her farm north of Sexsmith, Alta., with a hoe and by hand. Bozarth has had the garden in the same spot in the farmyard for decades. | RANDY VANDERVEEN PHOTO


74

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

CROP TRIALS | BRASSICA CARINATA

Elite mustard needs marketing to entice buyers Few brassica carinata users | The crop can be straight combined and production costs are less than canola BY KAREN BRIERE REGINA BUREAU

INDIAN HEAD, Sask. — Brassica carinata is proving itself in trials and commercial fields, but there still aren’t many buyers of the industrial oilseed. “There’s lots of interest, but not users,” said Ken Mudry of Paterson Grain, which markets the crop for Agrisoma, the company that commercially introduced the Ethiopian mustard a couple of years ago. This is just the second year of contracts, he added, and there is a lot of marketing work to do. Forty growers in southern Saskatchewan and Alberta contracted 6,700 acres last year. Last fall, the National Research Council successfully flew a Falcon 20 jet with 100 percent carinata biofuel, and in January Popular Science magazine named it one of the top 25 scientific events of 2012. “It is an elite model at the moment,” Daryl Males, Agrisoma’s director of plant breeding and agronomics, told producers at the recent Indian Head Agricultural Research Foundation field day. IHARF research manager Chris Holzapfel said the crop is treated similar to canola in most respects, but differs in one major aspect: “It is

Visitors to a recent field day at the Indian Head Agricultural Research Foundation examine a crop of brassica carinata. | excellent for straight combining.” Carinata doesn’t shatter as much as canola does. In fact, Males said it is the most shatter tolerant of all brassicas. However, it requires patience at harvest. “It dries quickly but the stems stays green and you need it to be brown,” Males said. Holzapfel said yields are 90 to 95 percent of canola. In 2011 trials,

yields were consistently more than 50 bushels per acre, but that dropped to about 30 bu. per acre last year, as did canola yields because of disease pressure. Two varieties — AAC A100 and A110 — were available this year. Males said the breeding program has resulted in rapidly changing varieties with significant increases in oil content and decreases in glu-

cosinolate content. Mudry said one variety could yield seeds with 50 percent oil content, which could be a game changer in terms of the biofuel market. Gaining European Union certification is critical because of a cap on aviation emissions that will be in place by 2020. The meal is not yet licensed for use in Canada. Mudry said carinata contracts are

KAREN BRIERE PHOTO

priced comparably to canola. “But your production costs are less so the return should be quite favourable,” he said. Males said grower satisfaction was high last year, and the oil is what the aviation industry wants. He said Westjet alone would require 1.2 million acres of crop. “We probably can’t overproduce for biofuels,” he said.

TIMING


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

75

CROP REPORT ALL CONDITIONS AS OF AUG. 2. VISIT WWW.PRODUCER.COM REGULARLY FOR UPDATED CROP REPORTS

MANITOBA SOUTHWEST Persistent wet conditions in the region, particularly near the U.S. border, have hindered crop development. Lower yields are expected because standing water has drowned out portions of many fields or put the crop under stress. The excess moisture has also increased disease pressure. Producers are reporting blackleg lesions on canola. Some cattle producers are struggling with soaked pastures and hay land. Other pastures are thriving in the wet and cool conditions. NORTHWEST Excess moisture will restrict yield potential in the region. A number of areas received 50 to 100 millimetres of rain in late July. Crop development varies, depending on rain amounts, field drainage and soil type. Frequent rains have delayed haying progress. Producers are reporting average to above average forage yields. Hay quality is below average. CENTRAL

crops such as corn and soybeans. The cooler weather has benefitted canola and flax crops. The bloom period for many fields has been much longer than previous years. Growers have reported blackleg leaf lesions and basal cankering on canola. EASTERN Soybean crops have podded. In general, the crop looks good but some growers are reporting root rot or iron chlorosis. Corn crops are in the silking stage. Producers are reporting excellent corn stands. The crop is more than two metres high in some areas. Hay conditions are rated as good. Haying progress is ahead of other regions of the province. INTERLAKE Producers will soon be harvesting winter wheat in the southern Interlake. Warmer temperatures are needed to ripen winter wheat and propel soybean development. Armyworms are pressuring crops in the northern half of the region. Pasture conditions rated as average.

SASKATCHEWAN

Below normal temperatures were the dominant weather feature of late July and early August. Cooler weather slowed growth of heat loving

SOUTH Cool temperatures have slowed

crop development. Nighttime temperatures as low as 4 C were reported in Odessa, and heavy morning dew and rain have slowed hay operations. Hay quality is diminishing. Severe hail damage occurred in the Kisbey and Stoughton areas. Hail damage was also reported in Bengough, Liseiux, Assiniobia, Cabri and Tyner. Pulses are starting to turn in the southwest.

is reporting up to half of crop acres have surplus moisture. Crops in western regions are behind because of cool weather. Grasshoppers are damaging crops in the Barthel, Meadow Lake, Dorintosh and Pierceland areas. Hay quality is generally good but swaths are deteriorating in wet weather.

Lloydminster have some farmers closely monitoring their fields. Continued rain has made haying difficult as many farmers struggle to bale between showers. Canola has generally finished flowering, and crops look good. Grain silage harvest has begun. Overall, crops look good.

ALBERTA

CENTRAL

CENTRAL

PEACE

Warmer weather is needed to advance crops, but cool temperatures extended flowering in eastern areas, which could result in good yields. Temperatures in eastern areas dropped as low as 5 C, while western areas saw 4 C. Winter cereal crops are beginning to turn. Ascochyta and sclerotinia in pulses and smut in cereals are damaging crops. In the west, farmers are looking for rain to help fill crops. Haying has progressed quite well in the west because of the dry conditions. Quality is good in about twothirds of the hay crop in the east and 80 percent in the west.

Crop conditions continue to be favourable with frequent showers and warm temperatures. Crops are generally looking good, but farmers are encouraged to monitor for disease. Canola has finished flowering in most areas, but there are pockets of late seeded crops with canola still flowering. The Peace region canola survey wrapped up at the end of July. Inspectors were looking for lygus bugs, diamondback moths, bertha armyworms, grasshoppers, aster leafhoppers and cabbage seedpod weevils. Farmers are encouraged to monitor their fields for pests. The moist weather delayed haying with many fields receiving rain several times. Some silage operations are starting to get underway.

NORTH Some areas are reporting wet fields and crops with stress from excess moisture. The east in particular has seen haying interrupted by rain and

NORTH Reports of lygus bugs near

IS EVERYTHING. ROUNDUP® BRAND AGRICULTURAL HERBICIDES offer unsurpassed control of perennial weeds such as Canada thistle, quackgrass and sowthistle in a preharvest application. But, it’s important to get the timing of your application just right to be effective. For tips on how to better assess weed and crop staging, and to download a copy of our Preharvest Staging Guide, go to www.roundup.ca. ALWAYS READ AND FOLLOW PESTICIDE LABEL DIRECTIONS. Roundup® is a registered trademark of Monsanto Technology LLC, Monsanto Canada, Inc. licensee. ©2013 Monsanto Canada, Inc.

+

Hail has knocked out several promising fields in central Alberta, while other producers received only rain. Farmers have their fingers crossed that they can avoid the hail and harvest what’s looking like a promising crop in most of the region. Canola has finished flowering in most parts of the region. Wheat crops are also looking promising, but harvest is still weeks away. SOUTH Harvest has begun in parts of the region. There are reports of wheat harvests near Medicine Hat and that barley swathing has begun near Lethbridge. Haying has wrapped up. Some spraying of glyphosate has begun. Winter wheat harvest is set to start with high yields anticipated. Potato harvesting has started. Reglone has been applied to some peas because harvest is expected to begin shortly.


76

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

PRODUCTION

ACCURATE SWEEP TESTS REQUIRE GOOD TECHNIQUE An insect management specialist is providing a refresher course in proper sweep techniques to provide an accurate insect count. | Page 78

PR ODUC TI O N E D I TO R: M IC HAEL RAINE | P h : 306- 665- 3592 F: 306-934-2401 | E-MAIL: M IC H AEL.RAIN E@PRODUC ER.C OM

WEATHER MONITORING | EXPANSION

Weather station coming to RM near you WeatherFarm expands | Producers can log on to website for local weather, wind speed and direction, humidity

After a weather station is installed in the rural municipality, producers can access real time weather information through the console such as wind speed, wind direction, temperature, humidity, pressure, heat index and indoor temperature. | ROBIN BOOKER PHOTOS BY ROBIN BOOKER SASKATOON NEWSROOM

WeatherFarm, the densest weather monitoring network on the Prairies with more than 850 stations, continues to expand. Spencer Smit, the company’s western network representative, said he has just completed two new installs. The stations were placed in rural municipalities that belong to the Agricultural Producers Association of Saskatchewan, which is running a program that provides all member RMs with a weather station. “If you’re in a RM and you want it to become a member of APAS, you should contact them, because then a Davis weather station will be installed in the RM. Then on the website, www. myrm.ca, you will get your local RM weather,” Smit said. The solar powered weather stations provide convenient, immediate and local weather readings. “The whole idea of the network is that it is a very dense network,” Smit said.

“Anywhere you go when you look on a map, there will be a weather station nearby. It’s based on hyper localization, so you can get your weather from right in your backyard, as opposed to another network weather station that could be 30 kilometres away.” Monitoring stations are ideally placed in an open area where they are exposed to the prevailing winds. They then send the sensor readings wirelessly to an electronic console, which is located in the home or office, depending on the customer. A repeater can be installed to give the signal a boost if it is interfered with by obstacles such as grain bins. Users can access real time weather information through the console such as wind speed, wind direction, temperature, humidity, pressure, heat index and indoor temperature. The self-draining rain gauge provides precipitation readings. “Live real time data is very useful when deciding what to spray, when to spray

and how much to spray,” Smit said. “If you farm somewhere where you don’t actually live, you can just look on the website or on your phone so you can see what the weather is out there and save yourself a trip.” Historical data can be viewed on the console hourly, daily, monthly and yearly. It allows users to see if the temperature dropped below zero on the previous night, when the first frost came the previous year, how much rain the station received in a given month compared to the same month historically and when the wind has been picking up. The console also sends the weather data into the WeatherFarm network, where it is stored and used to build forecasts. The information, including current weather conditions and forecasts at each of the stations, is then offered free through the WeatherFarm website. Forecasts for each region are built by using information from the five closest stations. Owners of the weather stations

WHERE FARMERS MEET www.OutdoorFarmShow.com

info@outdoorfarmshow.com

also have access to the historical data on the WeatherFarm database, which they can request through the website. CWB recently sold WeatherFarm to a partnership between Glacier Media and Weather INnovations. WIN operates several networks of weather and environmental monitoring stations in Canada, which provide data to growers, governments, academic researchers and crop insurance corporations. It also develops and maintains crop specific weather advisory websites, including WeatherCentral.ca for grain growers in Ontario, MBpotatoes.ca for Manitoba potato farmers and sites for tomato, grape, tender fruit and sugar beet growers in Eastern Canada and Europe. Weather information from the We at h e r Fa r m. c o m n e t w o rk i s already carried on Glacier Media’s agricultural websites, including The Western Producer. Smit said the company is working to strengthen the network and

TM

@outdoorfarmshow

Canada’s Outdoor Farm Show

1-800-563-5441

expand the services it offers prairie farmers, such as modelling tools that will help farmers decide when to apply fungicides and pesticides. “We are redoing the website,” he said. “There are a lot of things we are adding. We are working on historical data. We are working on improving the radar and mapping. We are continuing to maintain the network. We have about 850 weather stations across the Prairies. Currently we are working on visiting every station and maintaining them, and getting them back online if their off line and resolving any issues.” For more information, visit weatherfarm.com.

Visit us online at www.producer.com to see a video about this story.


PRODUCTION

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

77

TOP LEFT: The Twister’s halfinch thick steel frame gives it strength to take on heavy clay soil. ABOVE: Independent springloaded arms each carry a pair of discs. Spring pressure is 650 p.s.i. with no load, and increases to 1,400 p.s.i .under full pressure. LEFT: Twister has the ability to hydraulically angle the coulters all the way to nine degrees. | MANDANKO PHOTOS

EQUIPMENT | VERTICAL TILLAGE

Vertical tillage machine enters heavy clay zone

Strength behind Twister | Operators in heavy clay areas can adjust the normal zero disc angle up to nine degrees STORIES BY RON LYSENG WINNIPEG BUREAU

Farmers learned long ago that tillage equipment designed for light soil often ended up on the scrap metal pile after it hits heavy clay soil. Over the decades, that fact fostered a unique manufacturing niche running parallel to the mainstream that specialized in robust equipment for heavy clay soil. These designers focused on farmers in the heavy clay regions of the Red River Valley, Regina Plains and Peace River. Mandako Agri Marketing of Plum Coulee, Man., is one of those companies, and its Twister Vertical Tillage machine is one of its latest tools

aimed at farmers who have to cope with heavy clay. Mandako claims it’s the heaviest vertical till machine on the market. The strict definition of “vertical tillage” refers to a disc that runs at a zero degree angle to straight forward and only tickles the surface to a maximum depth of three inches, thus leaving distinct straight lines on the surface. However, Lou Peters of Mandako said that strict interpretation of vertical tillage does not fit the needs of producers on heavy clay. He said a tillage machine must always be engineered to meet the needs of the end user. With that guiding thought, the company designed the Twister to do things that other

vertical tillage machines cannot. Vertical till discs normally run at zero degrees, but when the Twister gets into heavy residue or rough ground, the operator can remotely change the disc angle up to nine degrees from straight ahead. Peters said that with all that frame stress, the Twister frame does not twist, even though operators typically run at 10 m.p.h. “All framing is half inch thick rectangular tubing, so speed is not a problem,” he said. “There’s never a need to add weight because we’ve built the weight into the frame, where it does some good. Instead of just carrying the weight, it’s part of the frame. It’s added strength, not just added load.”

Operators can select any disc angle from zero to nine degrees. In the fall, they typically run the aggressive nine degree angle to destroy as much of the residue as possible. “Guys normally run at the recommended depth of two to three inches. That does a good job of chopping the B.t. corn roots and turning the stalks,” he said. “I’d say half or more of the residue is covered in the fall. Soil contact helps the bacteria break it down. In the spring, you just need one pass with the discs running at zero to have a nice seed bed. The most popular setup seems to be a rolling basket with a tine harrow.” Each arm is independent of the others, which eliminates problems with

ganged systems that don’t provide even pressure. Each arm normally carries two wavy discs and is spring loaded. Static pressure is 650 pounds per sq. inch. Under full load, the pressure is 1,400 p.s.i. Producers can order concave discs, serrated edge blades and rotary harrow finishers supplied by Phillips, formerly Phoenix. Peters said his company has sold more than 130 units in the two years since Twister has been on the market. The list price is $2,200 per foot, and the machine is available in sizes from 12 feet up to 40 feet, he added. For more information, contact Peters at 204-829-3348 or visit www. mandakoagri.com.

EQUIPMENT | VERTICAL TILLAGE

What is zone tillage?

is pleased to announce the appointment of Rob Chomyn as the new Canadian Marketing Manager. Rob will be responsible for the overall marketing and communications strategy for Novozymes BioAg Canada.

JODI DEJONGHUGHES AGROLOGIST

used in the fall to run coulters directly over rows of crop that’s just been harvested. “You still don’t run deep,” he said. “The Twister is really heavy duty, but it’s not intended to go deep. You still run at two or three inches. But the secret is that you run at 10 m.p.h. We’ve had agronomists check these fields and they always tell us that the fracturing goes down 12 inches or more, but only if you’re running fast like that.” The strip is usually about five inches wide. The gap between the zone till strips should remain unaffected with 100 percent residue cover.

Rob is a veteran in the Canadian agronomy and financial arena with 30 years of experience. He is a Saskatchewan native who grew up in Saskatoon and graduated from the University of Saskatchewan with a Bachelor of Commerce – Finance degree. Rob will work out of the Saskatoon office, strategically positioning and effectively marketing Novozymes BioAg’s comprehensive and proven portfolio of biological products. You can reach Rob directly by phone at 306-657-8282 or by email at RCH@novozymes.com.

Learn more about Novozymes BioAg at

1-888-744-5662 | www.bioag.novozymes.com Novozymes is the world leader in bioinnovation. Together with customers across a broad array of industries we create tomorrow’s industrial biosolutions, improving our customers’ business and the use of our planet’s resources. Read more at www.novozymes.com.

All rights reserved. 13033 08.13

© 2013 Novozymes. 2013-11393-01

Twister customers in North Dakota and Minnesota use their Mandako Twister tools to do something they call zone tillage. “Subsoil tillage or subsoiling is one strategy for ameliorating compaction below a ‘normal’ depth of tillage at eight to 12 inches,” said agricultural extension agent Jodi DeJong-Hughes of the University of Minnesota. “The goal of this very aggressive tillage operation is to break up compacted layers in the soil profile to a depth of 16 to 20 inches and help with water infiltration and root growth. “Zone tillage is a specific form of deep tillage designed to only disturb the soil in a narrow band directly below the crop row. The soil and residue in the inter-row are undisturbed providing surface cover and protecting the soil against erosion.” Dwight Johnson sells Mandako Twisters for North Country Marketing in Fargo, N.D., covering North and South Dakota. He said zone tillage machines are

Novozymes BioAg


78

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

PRODUCTION

ABOVE: Alberta Agriculture insect management specialist Scott Meers demonstrates effective sweeping techniques in a canola plot at the Crop Diversification Centre in Brooks July 31. It’s best to sweep for lygus bugs just after canola has flowered, when plants are entering the pod stage. BELOW LEFT: Meers suggests three-foot nets with 15-inch diameter hoops are most effective. BELOW CENTRE: Gerald Armstrong tries his hand at canola sweeping during the July 31 Canola Galla event at the Crop Diversification Centre in Brooks. BELOW RIGHT: An effective canola crop sweep will collect blossoms and stems, which must be carefully examined for insects to get an accurate sense of lygus bug infestation. | BARB GLEN PHOTOS

CANOLA | INSECTS

Accurate sweep tests require good technique Lygus bugs | Officials recommend growers check 10 locations in fields that are larger than 100 acres BY BARB GLEN LETHBRIDGE BUREAU

BROOKS, Alta. — Canola crops are approaching the stage where lygus bugs can do their damage, and accurate counts obtained by sweep tests allow producers to make spraying decisions. There’s no numerical threshold to determine whether to spray for lygus, said Scott Meers, an insect management specialist with Alberta Agriculture. “The threshold is where you get equal dollars back compared to the

cost of spraying,” Meers told those at a Canola Galla field day July 31. The Canola Council of Canada has no numeric guide either, noting in its insect scouting guide that “economic thresholds can vary from four to over 30 per 10 sweeps depending on crop and insect stage, cost of control and canola price.” However, no decision can be made without measuring the extent of the problem, and Meers provided a refresher course in proper sweep techniques that will provide an accurate insect count.

He recommended a 15-inch diameter hoop on a three-foot net to provide a reasonable sweep radius. “Hold it like a hockey stick,” said Meers. Walk at a steady pace through the crop, making 180-degree sweeps, hip to hip in a uniform arc. If the crop is particularly thick, producers may want to make two passes while doing 90-degree sweeps. “The key to a sweep is that every time, the net goes through new material. If you are not in fresh material, you are not going to get accurate counts.”

Meers recommended 10 sweeps in about six spots in a field, though the number will depend on how many fields are involved. The canola council recommends checking at least 10 locations in fields larger than 100 acres. “If you do only one set of 10 sweeps (per field), the chance of getting the wrong answer is greater than getting the right answer,” said Meers. He also cautioned against sweeping too deeply into the crop. Sweeps should pass through the top onequarter to one-third of the standing

crop. If deeper, cabbage seedpod weevils can be knocked off the plants, giving an inaccurate count. However, sweeping for weevils ideally takes place when the crop is 10 to 20 percent in bloom. Meers recommended waiting for dew to dry and temperatures to rise before sweeping for lygus, when the insects are more mobile. Allow any flying insects to escape the net after each series of 10 sweeps, and then sort through the plant material to identify and count all remaining insects.


PRODUCTION

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

79

EQUIPMENT | ROLLERS

Machine rocks ’n’ rolls while rolling rocks Four-way knuckle system | Large land roller folds and unfolds without operator having to back up or get out of the tractor BY RON LYSENG WINNIPEG BUREAU

The demand for bigger implements has caught up with rollers, some of which can exceed 100 feet yet fold to a transport width of less than 13 feet. Like all other implements that have up-sized in recent years, the growth of field rollers was only possible with the introduction of new technology. Rite Way land rollers have grown in size while keeping their ability to follow the contour of the land by incorporating a new four-way knuckle system to link the individual rollers together. Four-way knuckles let each individual roller section run independently, thus hugging the topography and maintaining maximum soil contact. “This allows us to produce a seven section roller that’s 90 feet wide, but we can build them over 100 feet if we wish to do so,” says Rite Way’s Marjorie Strandlund. The company’s latest generation of rollers has been available for about four years. “One of the main features differentiating Rite Way land rollers from others is our patented auto fold system that lets you fold and unfold while moving forward only,” Strandlund said. “The hydraulic steering cylinders on the transport wheels out at the tips steer the wings into the working position as you drive forward. It takes a little more than one minute to fold or unfold. You never need to back up or even get out of the tractor.” The ability to fold and unfold without backing up makes the Rite Way roller an ideal fit behind seeding rigs, which are sometimes nearly impossible to back up. Strandlund said another part of Rite Way’s strategy is to build large diameter rollers that are shorter. The large 42 inch diameter drum rolls over the landscape easier than small diameter drums. A large diameter drum makes fewer revolutions and does a better job of pressing rocks into the ground compared to smaller drums in the 36 inches diameter range. She said wide drum sections may be fine on a perfectly flat field with no rocks, but the slightest knoll or rock can lift most of the drum off the ground, resulting in large skips. Shorter drum sections maintain better soil contact. The four way knuckle system allows

The operator folds and unfolds the big landroller without ever having to back up. The forward only feature is a function of this hydraulic cylinder. each drum section to pivot side to side as well as up and down. “Tractor requirement is three to four horsepower per foot of roller, but that’s just to pull the implement,” she said. “When you’re pulling any implement this big and this heavy, you really need a much bigger tractor so the roller doesn’t get away from you.” Strandlund said awareness of the benefits continue to spread as more producers invest in rollers: • Retain moisture by sealing surface and leaving less surface exposed to the drying effect of wind. • Enhance root system growth by squeezing air pockets out of fluffy soil, thus eliminating dead airspace. • Press stones into the ground and level out the field for easier spraying and harvest. Research shows that a rolled level field lets the combine harvest three more bushels per acre. • A rolled field reduces the odds of your combine swallowing a rock and also reduces the amount of gritty dust entering the combine. • For bean growers, sealing the surface stops oxygen from accessing the iron in the soil, thus reducing the yellowing in beans. • Rolling B.t. corn stalks and root balls in the fall helps them break down so the field is ready for the next year’s crop. • Rolling isn’t just for corn and beans. All zero till fields are rough and hard on equipment, even cereal fields. Rolling them after seeding saves on equipment maintenance costs. For more information, contact Rite Way at 306-337-4440 or visit www. ritewaymfg.com.

The extreme flexibility on contoured land is only possible because the four-way knuckles and the two-point, anti-twist linkage allow each roller section to move independently of the adjacent sections.

In the transport position, the new generation of Rite Way rollers fold down to a width of less than 13 feet. When the roller gets into the field, the operator activates the steering hydraulics on the outer transport wheels. As he drives forward, these steering transport wheels pull the wings out to the working mode. | RITE WAY PHOTOS


80

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

LIVESTOCK L IV EST O C K E D I TO R : B A R B G LEN | P h : 403- 942- 2214 F: 403-942-2405 | E-MAIL: BARB.GLEN @PRODUC ER.C OM | TWITTER: @BA R B GLE N

Properly managed grazing improves the soil as animals remove the tops of plants, drop waste and then move on to a new area, leaving nutrients and litter behind. |

JEANNETTE GREAVES PHOTO

GRASSLAND MANAGEMENT | HOLISTIC APPROACH

Proper grazing mimics nature: expert Preventing desertification | ‘Rested grasslands tend to die,’ says a soil specialist who admits an about-face in his thinking BY BARBARA DUCKWORTH CALGARY BUREAU

The father of holistic grazing management admits he started out fanatically opposed to livestock roaming the grasslands of his native Rhodesia. “I was one of the people who opposed cattle ranching because as a wildlifer, I had seen the damage they were doing to wildlife,” Allan Savory told a recent Calgary meeting sponsored by the Alberta Livestock and Meat Agency. “I was a very fanatical young scientist.” Trained as a wildlife biologist, Savory was an early advocate of game ranching in the mid-1950s, when livestock was removed and wildlife restored to manage grasslands in Africa. “It became a multibillion-dollar industry in Africa and parts of Texas, and tragically, it was one case in my life where I was horribly wrong,” he said. “I have been wrong many times and I have had to change.” His inspiration to solve the case of eroded land around the world came

ALLAN SAVORY GRAZING MANAGEMENT EXPERT

from French agronomist Andre Voison, who understood that cattle naturally rotated on pasture. It was more about the amount time cattle spent on the land rather than the number that grazed a particular spot. The land deteriorated if the animals were not there. Savory’s work on holistic farm management has gained adherents around the world, but he admits it took some trial and error to get it right. Meanwhile, millions of acres of land have reverted to desert because of the unintended consequences of poor management policies. He foresees a “global tsunami” with more desertification and more people going hungry. He said agriculture is vital to feed people, but it has become compart-

mentalized at a time when the entire industry needs to work together. Soil erosion is a major problem around the world, and he said poor agricultural practices caused most of it. Monoculture farming, in which large tracts of land are exposed to the elements, is unsustainable, he added. Soil scientists estimate millions of tonnes of soil are lost each year and billions of acres of land burned to remove trash. Fire exposes the soil and also contributes to air pollution. Savory’s solution is to bring livestock back to the land because he believes a lack of properly managed grazing brings desertification. Biodiversity returns when the forage is rested and grazed. Grazing animals remove the tops of plants, but the plant chemistry shifts to chemical oxidation without that action and plants die. When the grass dies, nature fills the vacuum with crusted soil, shrubs and tap-rooted plants such as thistle. “Rested grasslands tend to die,” he said.

Savory said grasslands occupy 18 percent of the global land base. Planting more trees is beneficial because they cycle carbon, but grasslands store it in the soil. His solution for desertification came from his military training, which allowed him to apply what he knew about battlefield planning to draw up grazing plans. A rancher can use a chart to determine which land to use, how many animals are needed to consume the available forage and length of time in a paddock. This information can then help him decide how and where to move cattle next. Some of the early grazing plans failed, but the concepts started to work as Savory and others learned to understand that nature functions in patterns. He decided agriculture had to mimic nature. Grasslands were originally grazed by large herbivores, which collected in herds to protect themselves from large predators that kept them moving along. The animals dropped urine and

feces on the grass while their hoofs trampled plants and soil. This forced them to move on after they had chewed off the tops of plants, which meant nutrients and litter were left behind to restore the soil and hold rainwater. Savory emphasized that grazing plans must have objectives that fit each farm and ranch so every decision makes economic, environmental, social and scientific sense. The plans also need to be flexible. “What might be right this year may not be right next year, so you are constantly planning,” he said. His practices have been spread by farmers teaching each other. He founded the Centre for Holistic Management in 1984, which later became the Savory Centre. In 2009 he formed the Savory Institute. The work includes demonstration ranches that implement holistic management with livestock grazing and planning to restore eroded grasslands. The institute is also leading programs in 12 countries where farmers have started hubs of excellence to teach the concepts to each another.


LIVESTOCK

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

81

SWINE | CODE OF PRACTICE

Producers object to parts of draft pig code Open sow housing | Proposals in the draft code of practice could affect viability, say some producers BY ED WHITE WINNIPEG BUREAU

Some farmers hope to remove mandatory changes to pig housing and handling in the draft pig code, says an industry leader. Rick Bergmann, Manitoba Pork Council vice-chair and a member of the Canadian Pork Council board of directors, said producers aren’t willing to agree to forced changes that will make their financial situation worse. “Producers have been sharpening their pencils over the last few years and they’re very aware of the details of pork production. If there’s anything that will financially hurt them, we’ll be very, very opposed,” Bergmann said. “(The final code) has to be something that is palatable to the industry. If it’s not palatable to the industry, it can’t happen.” It’s clear that the pig code committee is going to have a challenge that might have vexed Solomon in reaching consensus in developing a final version. The period for public response to the proposed pig code was scheduled to end Aug. 3, so now the committee, comprising representatives of farm, industry, retailer and animal welfare organizations, will need to wade through hundreds of submissions and see what parts of the draft code, released at the beginning of June, are generally acceptable and what parts are contentious. It’s already obvious that sow housing will be a key matter of differing opinions. Animal rights activists have been lobbying for a quicker end to gestation stalls than the 2024 date sent in the draft code. They also want to eliminate gestation stalls for the entire pregnancy period of the animal. The draft code allows gestation stalls for a few weeks after insemination in order to reduce miscarriages. However, many hog farmers don’t want the final code to contain any mandatory ban of gestation stalls, even if it occurs more than a decade from now and allows for temporary

Open sow housing systems, such as this one at the University of Manitoba, may become more commonplace if the new pig code includes mandatory changes to how hogs are raised. | FILE PHOTO post-insemination crating. Bergmann said farmers who have contacted him want the final code to have fewer mandatory changes. Mandatory practices, rather than recommended or “best practices,” are more prominent in the draft code than in some previous livestock industry codes. Bergmann said producers are concerned that they could lose export sales if their international competi-

tors don’t adopt some of the practices and barn designs that might cost money. “The more restrictive we are, it really will hurt sustainability in the Canadian industry,” said Bergmann. “If the proposed draft would be approved as is, what I’ve heard from producers is that there would be a grave concern.” The gestation stall debate is one of the highest profile debates about

agriculture involving the public. Some argue that switching from gestation stalls to open housing is inevitable as the public becomes more concerned about animal welfare. Others argue that public concern is shallow and only registers in public opinion polls because of activist lobbying. They say farmers could win the stall debate if they defend stalls and fight against the activists.

Bergmann said he doesn’t want to see hog industry representatives support a final code that contains a mandatory 2024 banning of gestation stalls and doesn’t think farmers need to believe that the draft code will become the final code. “The draft is just a draft and it is only a proposal,” said Bergmann. “The producers who have called me need some things changed to not put them out of business.”

SWINE | HEALTH

Threat of infectious hog disease will only increase, says vet Porcine epidemic diarrhea virus | Cooler temperatures will give the disease a better chance at surviving trips across the border on trucks BY ED WHITE WINNIPEG BUREAU

As he walked out of a southwestern Ontario hog barn, Dr. Greg Wideman was happy he hadn’t seen any signs of porcine epidemic diarrhea virus. It wasn’t a surprise: no cases of the super-infectious disease have appeared in Canada, even though proven cases in the United States are approaching 400 and it has spread across all significant hog production zones in the U.S. However, it didn’t help Wideman relax about the disease because recent research and the season make him worry about the coming months. “About one in five trucks that goes

to a U.S. hog slaughter facility comes out of it with the disease on it,” said Wideman, president of the Canadian Association of Swine Veterinarians. “It’s still pretty early days with this disease, so we still have a lot to learn.” Research conducted by swine veterinary specialist James Lowe of the University of Illinois found that 17 percent of the almost 700 trailers sampled at seven Midwest slaughter plants in mid-June carried the disease, and 11 percent of uninfected trailers that arrived left carrying the virus. Lowe said this demonstrates that trucking can be a vector for the disease and that what arrives on the truck and goes into the plant can spread to clean trucks.

Hog truck traffic between Canada and the U.S. is heavy. There used to be much more before country-oforigin labelling slowed trade, but millions of Canadian pigs still travel to American slaughter plants and feeder barns and then return to Canadian farms. The disease keeps appearing in new places in the U.S., with Tennessee and Texas being newly added to the list. Wideman said the challenge of keeping PEDV out of Canada will become tougher after the summer, when cooler temperatures give the disease a better chance of surviving the trip from the U.S. to Canada on an infected truck. Trucks are easier to

clean and dry in the summer, and many diseases are more resilient in cold temperatures. Canadian veterinarians are looking for the disease, and all swine practitioners know about it. The Canadian Swine Health Board provides information and links about PEDV, and the Canadian Swine Intelligence Network is helping connect people within the industry. No place that has been infected has yet been able to eradicate the disease. North American veterinarians and hog experts had hoped it could be eliminated entirely, but its spread across all of the Midwest to North Carolina and into the South make it unlikely. Experts say the disease also appears

to be tougher than originally thought, surviving transportation better than expected. Europe has been unable to eradicate the disease, and it is believed to be endemic in China. PEDV can be brutally lethal for piglets, killing up to 100 percent of infected animals. However, in older pigs it is just a temporary growthhalting affliction. Pigs are believed to develop the disease after consuming feces-tainted materials. Wideman said rigorous biosecurity at the barn and ensuring trucks are clean before entering the yard are essential steps for controlling the disease.


82

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

LIVESTOCK

CATTLE | PARASITE CONTROL

Tiny discovery brings back memories of big-time pest Warble fly | While insecticides have helped producers manage a pest that once caused millions in damages, grubs could be hiding on organic farms BY MARY MACARTHUR CAMROSE BUREAU

Entomologist Gar y Anweiler brought back a flood of memories for bug experts and cattle producers when he caught a fly in July near Edmonton and posted its picture online asking for identification. Anweiler had captured a warble fly, which at one time caused millions of dollars in damage to the Canadian cattle industry but has now virtually disappeared. It turns out Anweiler’s warble fly likes rodents, not cattle, but the picture set in motion a discussion of warbles, government programs, farm kid methods of warble collection and highway signs announcing warble control areas that were once commonplace across the province. Warbles were the scourge of cattle producers and packing plants before the introduction of effective insecticides. An Alberta Agriculture warble document estimated that warble flies and their grubs caused $6 million in damage in Alberta during the 1980s from lost cattle weight gain, milk production and hide damage.

The female warble fly closely resembles a bee. The warble fly, often called heelfly, would lay its eggs near cattle’s heels in May and June. The eggs would hatch and the larvae would burrow through the skin and wander through the cattle’s tissue until spring, when they would chew a breathing hole through the hide on the cattle’s back. The larvae would remain on the back for four to 10 weeks and then drop off in the spring and develop into flies. John Milne, a Fairview rancher and former Alberta district agriculturist, said he remembers as a child heating

INSECTO CONTROL INSECTS Treat empty bins, Top Dress Safely and Economically

ASK YOUR DEALER FOR Why buy Insecto? To make more $

INSECTO

No License Required to Buy & Use

Canada - 800-663-5416 USA & Canada - 800-332-2002 www.insecto.com

• Environmentally Friendly • Allowed in Human and Animal foods • PCP #22489, OMRI Listed

pop bottles and placing the open end on the back of the cow where the warble had chewed a hole. As the air inside the bottle cooled, it would suck the warble out of the cow’s back and into the bottle. “We heard people say you could do it and we tried it, but most of the time we just popped them with our fingers,” said Milne, who was in charge of the warble control program at St. Paul and later at Fairview in the 1970s. He said the warble flies would drive cattle wild. “When the flies were flying in June and July and laying their eggs, these animals would go nuts. You’d see them racing around the fields with their tails in the air. You don’t see that any more.” It was the job of provincial employees like Milne to ensure cattle producers complied with the provincial warble control program designed to eradicate the pests. Doug Colwell, a research scientist with Agriculture Canada in Lethbridge, said government programs, insecticides and packing plant and auction market inspection programs worked together to virtually eliminate warbles by the 1990s. A 1996 beef quality audit showed that less than .008 percent of carcasses showed evidence of warble grubs. Colwell estimated that 50 to 60 percent of cattle in Canada were infested with warble grubs in the 1950s and 1960s. The targeted warble programs reduced infection to about five percent, while the introduction of ivermectin in the 1980s virtually eliminated the problem. Colwell once joked to producers that ivermectin was so effective in controlling warbles that all a cattle producer had to do was show cattle the label on the bottle and grubs

TOP LEFT: Warble flies and grubs, uncommon finds today, caused millions of dollars in damages to the Canadian cattle industry through lost weight gain, milk production and hide damage in the 1980s, when this poster was commissioned. TOP RIGHT: The pest was a problem as far back as the Second World War, when this image was distributed to producers. ABOVE: A cow’s back, infected with warble grubs, shows lumps with holes in them where the animal has been shaved. | AGRICULTURE CANADA PHOTOS

would die. Colwell recently published a report from a three-year study in 2008-10 that showed warble grubs still exist in Western Canada. “Clinically they have disappeared. I can talk to lots of veterinarians who have graduated in the last 10 years who have never seen one, but serological evidence suggests they are still out there.” Colwell took blood samples from 1,500 calves from Manitoba to British Columbia that were coming off their first year of pasture. He was looking for the presence of antibodies that could confirm warbles in the calves. While serology testing has its limitations, Colwell said the results were enough to convince him that the warble pest is still around. The serology showed 30 to 75 percent of the animals tested positive for the warble grub. Evidence of the grub was higher in the dry year of 2009 than in the wetter years of 2008 or 2010, he said. The findings reinforced results from similar data collected in 2001. “It made me relatively comfortable in saying that they’re hiding out there.” Colwell said he’s not sure where the flies may be hiding, but when a U.S. colleague needs warble infested cattle for a drug trial, he goes looking in herds near organic cattle producers. “That may be in fact where cattle grubs are hiding out.” Warbles are still considered a pest under Alberta’s pest act and must be controlled. Colwell said enforcing warble control may be difficult because so few people run their hands over the backs of the cattle at the right time of the year to search for the grubs. Camrose cattle producer Bob Pre-

IN THE 1980S, WARBLE FLIES COST ALBERTA PRODUCERS

$6 million stage said one of his first jobs as a newly minted University of Guelph agriculture graduate was to measure the efficacy of the insecticide Grubex in cattle in Ontario’s Grey and Bruce counties. In the study, one-third of the cattle were treated with an existing cattle drench, a third were treated with the new Grubex and one third were left as a control. It was part of his job to return in February and count the number of warble grubs protruding from the backs of cattle. The largest number of grubs he found on the backs of an untreated control animal was 265. The study was supposed to last two years, but Prestage said they had difficulty finding cattle producers willing to leave one third of their cattle untreated a second year because of the success of the product. Colwell said he is not concerned there will be a resurgence of warbles like in the 1950s, but veterinarians and cattle producers should be aware that warble flies are still out there. “It is easy to control if there was an outbreak,” he said. “I do think it needs to be at the back of people’s minds, simply because it is still there. There is a generation of veterinarians who have never seen one and have never put their hand on one. All the veterinarians that remember what they look like are mostly retired.”


LIVESTOCK

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

83

EQUINE | TRAINING

Horse trainers get new challenge Colt starting | Contest gives young trainers 60 days to get colts ready for sale BY BARB GLEN LETHBRIDGE BUREAU

WATERTON, Alta. — A typical horse trainers’ challenge gives participants three days to take a horse from untried to under saddle. Marc Garner wondered about that. As an instructor at Lethbridge College, the horse breeder knows that cramming for an exam might yield a passing grade, but the information is unlikely to be retained. After pondering a suggestion from a friend, he and his sister, Melody, father, Jim, and mother, Angel, who operate Rocking Heart Ranch near Waterton Lakes National Park, launched a new type of horse trainers’ challenge. They selected 10 young horse trainers in Western Canada, provided each of them with one of their ranch’s young horses, and gave them 60 days to train the animals for riding and basic manoeuvres. The trainers’ efforts will be judged by professionals, and the 10 horses, plus another five from Rocking Heart Ranch, will be sold Aug. 24 in Taber, Alta. The winning trainer will receive a $5,000 prize, with second and third placers winning a team roping saddle and silver buckle, respectively. “Most trainers will tell you, to properly and thoroughly start a young horse, you need 60 days,” said Garner. So the family decided to help young trainers while increasing the profile of their horse breeding program. “This colt starting challenge is the first of its kind in Western Canada,” Garner said. “It is summarizing 108 years of what we’ve been doing and that is just raising versatile and dependable horses that, in time, the entire family can use. And I believe we’ve employed 10 of

Canada’s most promising trainers.” Jon Blackmore of Magrath, Alta., is one of those trainers. In the random draw for horses, Blackmore drew RHR Valentine Blu Te, a gelding he said is training well. “He’s a good, quiet horse,” Blackmore said July 22. “I can do most everything with him already. I think this horse will sell for more than I can afford.” Rod Olsen of Cardston, Alta., trains horses for a living and has participated in trainers’ challenges of the shorter variety. He said the 60-day challenge is unique, and the filly he drew, BB Hickory Hancock, is working nicely and will be ready for Aug. 24. Both trainers, as well as fellow trainer Calvin Bevans of Lethbridge, say they would consider buying their respective horses, although price will be the deciding factor. “She doesn’t have a mean side to her,” Bevans said about Weavers Cee Heaven, the filly he drew. “She’s very calm and very attentive.” The Garners have a process by which trainers can bid on the animals they trained, with plans to ensure it is transparent to all potential bidders and buyers. The Aug. 24 event will also involve a 4-H component, which is of special interest to Melody Garner-Skiba, a 4-H alumnus. Club members who register will be allowed to judge the 10 horses and by doing so, enter a draw for a horse, a saddle and tack. Though the 4-Hers’ results will not be used to determine the winning trainer, the experience may help build their enthusiasm and interest in horses. “We’re engaging them and trying to help educate them and show them that there’s a future in horses,” said Garner-Skiba.

Marc Garner eyes one of the foals in the family horse herd on the ranch just outside Waterton Lakes National Park. He and his sister, Melody, and parents, Jim and Angel, have organized a colt starter challenge that will culminate in a competition and sale Aug. 24. | BARB GLEN PHOTO

THE TRAINERS • • • • • • • • • •

Barry Arnestad, Claresholm, Alta. Calvin Bevans, Lethbridge, Alta. Jon Blackmore, Magrath, Alta. Renee Gareau, Camrose, Alta. Clem Lowry, Perryvale, Alta. Sid Matsalla, Yorkton, Sask. Maria Michel, Revelstoke, B.C. Terrel Oler, Canyon, B.C. Rod Olsen, Cardston, Alta. Jaquelene See, Edson, Alta.

“We want 4-H kids to stay enthused about the horse industry.” She shared her brother’s concern about keeping young people interested in agriculture in general and horses in particular. Garner-Skiba remembers her own childhood love of horses, which has continued throughout her life. “If a girl falls in love with a horse, she won’t fall in love with a boy quite as soon … so if I can help more little girls fall in love with horses and keep their dads’ hair from growing grey.…” The professional judges for the event, all from Alberta, are Dr. Heather-Lynn Smith of Taber, Rose Perozak of Fort Macleod and Ryan Smith of Champion.

ORDER NOW. BUY EARLY. SAVE BIG.

ORDER NOW. BUY EARLY. SAVE BIG.

Order a Model Year 2014 New Holland air drill and cart NOW and take advantage of special incentives that reward early buyers – in addition to published offers! The earlier you buy, the better the deal*. You also get these Built My Way benefits: MODELS FACTORY-BUILT TO YOUR REQUEST THE LATEST INNOVATIONS AND IMPROVEMENTS FROM NEW HOLLAND THE BEST FINANCIAL PACKAGE

CATTLE HEALTH | RATIONS

*Check with your local New Holland dealer for timing.

Mitigating ruminal acidosis in cattle problematic BY BARBARA DUCKWORTH CALGARY BUREAU

BANFF, Alta. — Typical feedlot diets rich in highly fermentable grain may help cattle gain weight fast but can also play havoc with their digestive systems. Ruminal acidosis is often cited as the most common digestive disorder affecting feedlot cattle, although its true prevalence is not fully understood, researcher Greg Penner of the University of Saskatchewan told a recent beef conference in Banff. The condition occurs when grain is fermented in the rumen and changes the pH value. It produces too much acid, which erodes the gut lining and decreases nutrient absorption. It may also lead to secondary effects such as going off feed, diarrhea, liver abscesses, depression and laminitis. “If it drops below pH five, we start to see more detrimental effects and at this point we would classify it as

acute luminal acidosis,” Penner said. “We think these effects are having larger systemic implications for the whole animal.” Penner and other researchers are looking for ways to mitigate some of the excess acid effects. “If we are feeding very highly fermentable diets, rumen acidosis is something we need to manage.” Medicated feed and ionophores such as monensin and lasolacid are widely used in Western Canada to counter the problem. Adding fibre or increasing fat content so that energy is not reduced is another approach to reducing starch. Adding more forage to the diet can add more fibre, but Penner said it is not clear whether small increases in the forage inclusion rate have a large enough effect to improve rumen pH. One study offered more alfalfa hay, which did reduce acid. However, the feedlot industry is not interested because more forage is costly and

slows weight gain. “That is certainly met with disapproval from the industry,” he said. Experiments have looked at replacing some barley grain or silage with dried distillers grain. The approach reduced dr y matter intake, but researchers saw little effect on acidosis levels. “DDGs have a fairly high fermentability and so they don’t have a lot of effect on rumen acidosis.” Another approach is to add high fat byproduct pellets such as wheat screenings and off grade canola. These helped improve the pH balance and did not reduce performance because the cattle still received adequate energy. Another approach is to add high fat byproduct pellets such as wheat screenings and off grade canola to help improve the pH balance. “This looks like it could be one strategy where we could improve the response,” Penner said.

Rocky Mountain Equipment Barrhead, Westlock, Camrose, Red Deer, AB ................................ 855-763-1427 Vanee Farm Centre Inc. Lethbridge, AB .............................................. 403-327-1100 Linden Agri-Centre Ltd. Linden, AB ..................................................... 403-546-3814 Tri-Ag Implements Ltd. Wainwright, St. Paul, Consort, AB ................ 780-842-4408 Mazergroup 12 Locations, MB .......................................... 204-728-2244 E. Bourassa & Sons Assiniboia, Radville, Pangman, Weyburn, Estevan, SK................................... 877-474-2491 Markusson New Holland of Regina Emerald Park, SK .......................................... 800-819-2583 Novlan Bros Sales Paradise Hill, SK............................................ 306-344-4828 © 2013 CNH America LLC. New Holland is a registered trademark of CNH America LLC.


84

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

AGFINANCE

CDN. BOND RATE:

CDN. DOLLAR:

1.7810%

$0.9627

2.10%

0.985 0.975 0.965 0.955 0.945 6/28

1.90% 1.70% 1.50% 1.30% 6/28

7/8

7/15 7/22 7/29

8/2

7/8

Bank of Canada 5-yr rate

7/15 7/22 7/29

8/2

Aug. 2

A G F IN ANC E E D I TO R : D ’ A RC E M C M ILLAN | P h : 306- 665- 3519 F: 306-934-2401 | E-MAIL: DARC E.M C M ILLAN @PRODUC ER.C OM | TWITTE R: @ D AR CE MCMILLAN

TRADE | EXPORTS

AG STOCKS JULY 29 - AUG.2

Think-tank condemns tariffs

Tepid U.S. job growth in July indicated that the U.S. Federal Reserve would continue its stimulus bond buying program in the near term. The weak natural resources sector weighed on the TSX. For the week, the TSX composite fell 0.4 percent, the Dow Jones rose 0.6 percent, the S&P 500 rose 1.1 percent and the Nasdaq climbed 2.1 percent.

Supply management | Conference Board report slams high dairy, poultry tariffs

Cdn. exchanges in $Cdn. U.S. exchanges in $U.S.

GRAIN TRADERS NAME

BY BARRY WILSON OTTAWA BUREAU

A business-oriented research organization has joined a chorus calling for Canada to end its defence of high supply management tariffs in trade talks. In a new report that is part of a process to launch a proposed national food strategy next year, the Conference Board of Canada also complains that Canada has higher import tariffs or quotas on meat and grain than do other exporting countries. However, its main focus in the July 31 report written by Kristelle Audet is what she considers the damage that high chicken, dairy and egg tariffs have on other sectors that are denied more export trade access because of Canada’s protectionism. “Canada’s maintenance of extremely high barriers to trade and commodities is holding back opportunities for trade in other less-protected agricultural commodities like pork and beef,” she wrote. “Countries will not allow access to Canadian agricultural products as long as we maintain these barriers to trade.” The conference board said its next report will examine how to reform supply management policies, which have regulated dairy, poultry and egg production for decades while allowing price-setting and high import barriers to keep the sector stable. “Arguably, it is time for Canada to

EXCH

ADM NY Alliance Grain TSX Bunge Ltd. NY ConAgra Foods NY W.I.T. OTC

CLOSE LAST WK 37.57 15.89 76.67 37.04 13.15

36.67 15.25 74.76 36.74 13.15

PRAIRIE PORTFOLIO NAME

EXCH

Assiniboia FLP OTC Ceapro Inc. TSXV Cervus Equip. TSX Input Capital TSX Ridley Canada TSX Rocky Mtn D’ship TSX

CLOSE LAST WK 61.62 0.05 19.52 1.79 12.11 13.09

61.62 0.05 19.70 1.93 12.15 14.00

FOOD PROCESSORS NAME

EXCH

BioExx Hormel Foods Maple Leaf Premium Brands Smithfield Sun-Rype Tyson Foods

TSX NY TSX TSX NY TSX NY

CLOSE LAST WK 0.013 43.01 13.85 19.04 33.33 7.43 28.52

0.03 41.44 15.34 18.95 33.19 7.42 27.15

FARM EQUIPMENT MFG. NAME

The Conference Board of Canada says high import tariffs and quotas are complicating trade negotiations and keeping Canadian products out of some international markets. | FILE PHOTO find other mechanisms to insure farmers’ incomes,” wrote Audet. She said other countries, usually net food importers, maintain much higher barriers than Canada as they try to protect their small farm sectors. The European Union and the United States also maintain protectionist policies. However, she argued that Canada rates as a significant protectionist

when compared with other major exporters such as China, Australia and New Zealand. “Unless we are willing to put our supply management system on the table, free trade agreements with key Asian markets could be difficult to reach,” said the report. “Protecting supply managed industries also limits the opportunities for Canadian food exporters in developed

markets like the European Union.” While the conference board bills itself as an independent research organization, it is financially supported in its agricultural work by a who’s who of Canadian food companies as well as Agriculture Canada and Farm Credit Canada. The financial contributors have no say over the content of the final reports.

EXCH

AGCO Corp. NY Ag Growth Int’l TSX Buhler Ind. TSX Caterpillar Inc. NY CNH Global NY Deere and Co. NY Vicwest Fund TSX

CLOSE LAST WK 57.68 37.51 5.80 84.30 48.35 83.40 11.75

54.34 36.94 5.95 82.06 44.18 82.81 11.90

FARM INPUT SUPPLIERS NAME

EXCH

Agrium TSX BASF OTC Bayer Ag OTC Dow Chemical NY Dupont NY BioSyent Inc. TSXV Monsanto NY Mosaic NY PotashCorp TSX Syngenta ADR

CLOSE LAST WK 86.5 90.51 119.5 36.22 59.92 1.60 97.46 40.98 30.04 79.89

90.76 87.93 111.91 34.70 57.66 1.56 100.51 52.61 38.14 80.13

TRANSPORTATION GRAIN | MARKETING

Open market attracts new grain brokers from outside Canada BY BRIAN CROSS SASKATOON NEWSROOM

Canada has seen an increase in the number of licensed grain brokers that are buying and selling Canadian grain following the elimination of single desk grain marketing. Figures provided by the Canadian Grain Commission show that 14 companies have been granted new grain dealer licences in Canada since Aug. 1, 2012. As of last week, 83 companies held grain dealers licences in Canada, up from 73 a year earlier. Four existing licensees did not seek licence renewals during the past 12 months. Documents posted on the CGC website suggest that most of the new

licences were granted to companies based in the United States or to Canadian-based subsidiaries of foreign companies. New grain dealers operating in Canada include The Andersons Inc. of Ohio, Dakota Midland Grain of North Dakota, Lansing Trade Group of Kansas, Walsh Grain of Wisconsin, Markit Grain Group of Minnesota, GrainCorp Operations, a subsidiary of Australian grain handler GrainCorp, and CHS Canada, a subsidiary of the U.S.-based farmer cooperative CHS. The Andersons Inc. and Lansing Trade Group recently finalized a deal to acquire Thompsons Ltd., a grain and food grade bean handling company in Blenheim, Ont. The deal, which closed July 31,

gives The Andersons and Lansing equal ownership in Thompsons, which has 12 locations in Ontario and Minnesota. According to the Canada Grain Act, grain dealers as well as operators of primary, terminal, process and transfer elevators must be licensed by the grain commission or be granted an exemption. A grain dealer’s licence is generally issued to any company that buys, sells or handles western grain but does not operate grain handling facilities such as primary elevators or terminals. The number of grain brokers operating in Australia also rose noticeably after the elimination of single desk wheat marketing. In some cases, it led to concerns

over payment security, particularly when farmers were selling grain to new companies that had a limited track record in the industry. As part of a comprehensive review of its services and fee structures, the grain commission has proposed changing its existing bond-based producer payment protection program. Work aimed at introducing a new security program, most likely an insurance based model, is continuing. According to the commission, producers will continue to be covered under the current security program until the new program takes effect.   A complete list of companies licensed by the grain commission can be viewed on its website at www. grainscanada.gc.ca.

NAME

EXCH

CN Rail CPR

TSX TSX

CLOSE LAST WK 104.36 130.28

103.24 130.72

Toronto Stock Exchange is TSX. Canadian Venture Exchange is TSX Venture or TSXV. NAS: Nasdaq Stock Exchange. NY: New York Stock Exchange. ADR: New York/American Depository Receipt. OTC: Over the counter. List courtesy of Ian Morrison, financial advisor with Raymond James Ltd. in Calgary. Member of CIPF. Equity prices are from Thomson Reuters and OTC prices from Union Securities Ltd, Assiniboia Farmland LP. Sources are believed to be reliable, but accuracy cannot be guaranteed. Within the last year, Raymond James provided paid advice regarding securities of Cervus Equip. Contact Morrison at 877-264-0333.

CNH income up CNH Global posted net income of $473 million in the quarter ended June 30, up 33 percent from the same period last year. Agricultural equipment net sales rose 13 percent on good volume and improved pricing. Construction equipment sales fell six percent. CNH launched several new tractors and combines during the period.


AGFINANCE

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

85

ENTREPRENEURSHIP | SELLING YOURSELF

Build your business by putting yourself out there — then listen THE BOTTOM LINE

GLENN CHEATER

H

ad Ryan Albright started potato farming at a good time, things might have been much different. Instead, a market crash a decade ago pushed the young New Brunswicker out of his comfort zone and helped him learn skills he used to establish two successful businesses. A decade ago, Albright’s dream was that one day, he and brother Matthew and cousin Shaun would take over the potato and grain farm near Woodstock operated by his father, grandfather, and uncle. Then fate intervened: potato prices soared. “That was followed by a glut. I think we went from one of the highestpriced years in history to probably the worst year in history,” recalls Albright. “We had a huge portion of our crop that we just had to dump for cow feed.” It was a six-figure loss, and the family desperately wanted to avoid the roller-coaster open market by signing more of its acreage to production contracts. But no one was giving out new contracts locally. Then the 22-year-old discovered there were a host of chip companies in states such as Pennsylvania and Massachusetts, and thought, “why not ask them?” So he lined up appointments by phone, packed his truck and headed south. “I probably called 100 companies, including processors, chip companies, packers and brokers, and got around 30 appointments, everything from tiny operations to billion-dollar corporations,” says Albright. “I was just hoping someone would give me a chance.” To save money, Albright and wife, Cara, camped along the way. While his wife waited in parking lots, he’d pitch men twice his age on why they should buy spuds from this Canadian kid. It was, to say the least, nervewracking.

Plunging prices encouraged Ryan Albright to first find new markets for his family’s potatoes and later get into chip processing. Back row: Wayne Albright, left, Ryan, Matthew (with son Anders) and grandfather Lorne. Front row: Uncle Robert and cousin Shaun. | GLEN CHEATER PHOTO “But you can’t let on you’re nervous, you have to show confidence all the time,” he says. “They know their business inside and out, and you have to know yours or they’ll never have confidence in you.” Unfamiliar with the jargon of potato processing, Albright focused on how to “really listen,” and quickly learned it was an invaluable skill. Processors usually began by insisting they were perfectly happy with their current potato suppliers. Then they might make casual mention of some sort of issue, giving Albright an opening: could a potato grower do something, whether in growing, grading, packing, storing or shipping, to address that issue? By the time he headed home, Albright’s scorecard read like this: 70 percent of the companies he called refused to see him and 90 percent of his meetings ended with a “thanks for coming by.” “But we did get three deals, two

chip companies and a broker, and that’s how we got started,” he says. “The next year, we rolled the dice and built a state-of-the-art building because you need good storage for chip potatoes.” Carleton Country Spud Distributors was a success, and the two brothers and their cousin bought the family farm just two years later. Last year, it shipped more than 25 million pounds of seed and chip stock potatoes from the Maritimes, Quebec, Ontario and Maine throughout the eastern United States and Canada. But guess what? Albright wasn’t done. When it came to entrepreneurship, he no longer had to pretend to be confident. He was. In 2006, the trio began to develop Covered Bridge Potato Chips, named after the famous covered bridge in nearby Hartland. Many of the bridge’s 100,000 annual visitors have toured the plant since

its opening in 2009, spreading the word about its premium kettlecooked dark russet chips. The company now ships more than 450,000 large bags monthly across Canada and much of the U.S. His camping days are over, but Albright is on the road at least one and a half weeks a month, meeting customers and distributors, taking in trade shows and making good use of the speaking and listening skills he has developed. He argues they are key for any business, including farming, and says young people in particular need to gain experience dealing face to face with customers, buyers, suppliers and fellow farmers. “You’ve got to get away from shyness because if you don’t put yourself out there, you’re never going to make things happen,” he says. “To develop a company, you need to do it, you need to be the person who gets out and is the face of the company.”

MAPLE LEAF FOODS | FINANCIAL RESULTS

Maple Leaf blames losses on high feed costs, poor sales WINNIPEG (Reuters) — Maple Leaf Foods reported a disappointing quarterly loss, hurt by weak returns on raising pigs. North American hog farmers have been hard pressed to survive losses in the past year because of pig prices that were inadequate to cover the at-times soaring costs of feed tied to last year’s U.S. drought. Maple Leaf and its privately held Canadian rival, Olymel, have each bought large corporate hog farms to secure future supplies. “They’ve got a lot more pigs there that are losing money,” said Robert Gibson, an analyst at Octagon Capital. Maple Leaf chief executive officer Michael McCain said hog produc-

tion returns are one of the key reasons for the company’s year-overyear decline. The weak results follow a disappointing first quarter, when the company also posted a surprising loss tied to high feed costs and lower meat sales. Net earnings for the second quarter fell to nil, or a loss of two cents a share, from a profit of $26 million, or 17 cents, a year earlier. Sales of $1.214 billion were down 3.7 percent. Maple Leaf’s protein group, which includes both its meat products and agribusiness units, posted a $9.8 million adjusted operating loss in the quarter, down from year ago adjusted operating earnings of $33.4 mil-

lion. Adjusted operating earnings are a non-International Financial Reporting Standards measure used by Maple Leaf. Its bakery group was a bright spot, with adjusted operating earnings rising nearly five percent year over year to $32.7 million. Maple Leaf, maker of Dempster’s Bread and Klik luncheon meat, reported earnings of two cents, down sharply from 23 cents last year, when adjusted to exclude one-time costs such as restructuring. Analysts had on average expected Maple Leaf to earn 15 cents a share on sales of $1.278 billion, according to Thomson Reuters. The Toronto-based company is car-

rying out a $560 million multi-year program to upgrade its meat operations to compete with U.S. rivals.

Download the free app today.

Your road trips may be short: to your lender when seeking a loan for expansion, a retired neighbour whose land you want to rent or an input dealer who gives deals to preferred customers. But the success of those meetings, and perhaps your farm, might come down to how well you present yourself … and listen. Archived columns from this series can be found at www.fcc-fac.ca/learning. Farm Credit Canada enables business management skill development through resources such as this column, and information and learning events available across Canada.

Trait Stewardship Responsibilities Notice to Farmers Monsanto Company is a member of Excellence Through Stewardship® (ETS). Monsanto products are commercialized in accordance with ETS Product Launch Stewardship Guidance, and in compliance with Monsanto’s Policy for Commercialization of Biotechnology-Derived Plant Products in Commodity Crops. This product has been approved for import into key export markets with functioning regulatory systems. Any crop or material produced from this product can only be exported to, or used, processed or sold in countries where all necessary regulatory approvals have been granted. It is a violation of national and international law to move material containing biotech traits across boundaries into nations where import is not permitted. Growers should talk to their grain handler or product purchaser to confirm their buying position for this product. Excellence Through Stewardship® is a registered trademark of Excellence Through Stewardship. ALWAYS READ AND FOLLOW PESTICIDE LABEL DIRECTIONS. Roundup Ready® crops contain genes that confer tolerance to glyphosate, the active ingredient in Roundup® brand agricultural herbicides. Roundup® brand agricultural herbicides will kill crops that are not tolerant to glyphosate. Acceleron® seed treatment technology for corn is a combination of four separate individuallyregistered products, which together contain the active ingredients metalaxyl, trifloxystrobin, ipconazole, and clothianidin. Acceleron® seed treatment technology for canola is a combination of two separate individually-registered products, which together contain the active ingredients difenoconazole, metalaxyl (M and S isomers), fludioxonil, thiamethoxam, and bacillus subtilis. Acceleron and Design®, Acceleron®, DEKALB and Design®, DEKALB®, Genuity and Design®, Genuity Icons, Genuity®, RIB Complete and Design®, RIB Complete®, Roundup Ready 2 Technology and Design®, Roundup Ready 2 Yield®, Roundup Ready®, Roundup Transorb®, Roundup WeatherMAX®, Roundup®, SmartStax and Design®, SmartStax®, Transorb®, VT Double PRO®, YieldGard VT Rootworm/RR2®, YieldGard Corn Borer and Design and YieldGard VT Triple® are trademarks of Monsanto Technology LLC. Used under license. LibertyLink® and the Water Droplet Design are trademarks of Bayer. Used under license. Herculex® is a registered trademark of Dow AgroSciences LLC. Used under license. Respect the Refuge and Design is a registered trademark of the Canadian Seed Trade Association. Used under license. ©2013 Monsanto Canada Inc.


86

MARKETS

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

CATTLE & SHEEP

GRAINS Slaughter Cattle ($/cwt)

Steers 600-700 lb. (average $/cwt)

Grade A

Alberta

Live July 26-Aug. 1

Previous July 19-25

Year ago

Rail July 26-Aug. 1

121.00 116.53-128.44 n/a 104.00-111.75

n/a 111.30-130.28 n/a 103.00-111.75

109.90 109.91 n/a n/a

198.75-200.25 205.00-211.00 n/a n/a

199.75-200.00 205.00-212.00 n/a n/a

n/a 115.13-125.23 n/a 100.00-108.50

n/a 114.92-125.65 n/a 100.00-109.00

109.11 95.51 n/a n/a

198.00-199.50 204.00-210.00 n/a n/a

199.75-200.25 204.00-211.00 198.50 n/a

$145

Steers Alta. Ont. Sask. Man. Heifers Alta. Ont. Sask. Man.

$140

*Live f.o.b. feedlot, rail f.o.b. plant.

$155 $150 $145 $140 $135 6/28

7/8

7/15 7/22 7/29

8/2

Saskatchewan $150

$135 $130 6/28

7/8

7/15 7/22 7/29

8/2

Manitoba $150 $145 $140 $135 $130 6/28

Canfax

Feeder Cattle ($/cwt)

n/a

n/a

n/a

n/a

7/8

7/15 7/22 7/29

8/2

Heifers 500-600 lb. (average $/cwt) Alberta $145

Steers 900-1000 800-900 700-800 600-700 500-600 400-500 Heifers 800-900 700-800 600-700 500-600 400-500 300-400

Sask.

Man.

Alta.

B.C.

no sales 124-149 130-152 138-150 no sales no sales

110-137 128-142 130-147 134-155 138-165 no sales

125-139 130-145 136-150 140-155 145-160 148-170

124-135 125-140 129-144 141-149 no sales no sales

115-129 117-135 122-132 no sales no sales no sales

110-127 118-143 120-140 124-144 no sales no sales

120-135 125-140 127-142 129-145 130-150 135-160

119-129 124-132 128-135 130-137 no sales no sales Canfax

Average Carcass Weight

$130 $125 6/28

n/a 7/8

7/15 7/22 7/29

8/2

July 27/13 869 789 692 938

Canfax

Steers Heifers Cows Bulls

Saskatchewan $140 $135 $130 $120 6/28

7/8

n/a

n/a

7/15 7/22 7/29

8/2

Manitoba $140 $135 $130 $120 6/28

YTD 13 871 817 676 911

YTD 12 872 820 679 1027

U.S. Cash cattle ($US/cwt)

$125

$125

July 28/12 869 809 702 1049

n/a

n/a

7/8

7/15 7/22 7/29

n/a 8/2

Slaughter cattle (35-65% choice) Steers National n/a Kansas n/a Nebraska n/a Nebraska (dressed) n/a Feeders No. 1 (800-900 lb) Steers South Dakota n/a Billings n/a Dodge City 141-148.25

Cattle / Beef Trade

Cash Futures -4.52 n/a -1.52

-4.74 n/a -1.95

Canadian Beef Production million lb. YTD % change Fed 1037.5 -9 Non-fed 169.1 -10 Total beef 1206.5 -9

Exports % from 2012 425,421 (1) +29.6 165,142 (1) +63.1 82,959 (3) -19.3 115,697 (3) -12.5 Imports % from 2012 n/a (2) n/a 15,328 (2) -30.1 103,160 (4) +9.8 132,366 (4) +8.0

Sltr. cattle to U.S. (head) Feeder C&C to U.S. (head) Total beef to U.S. (tonnes) Total beef, all nations (tonnes) Sltr. cattle from U.S. (head) Feeder C&C from U.S. (head) Total beef from U.S. (tonnes) Total beef, all nations (tonnes)

(1) to July 20/13 (2) to May 31/12 (3) to May 31/12 (4) to July 27/13

Canfax

Agriculture Canada

Close Aug. 2 Live Cattle Aug 120.65 Oct 124.48 Dec 127.00 Feb 128.90 Apr 130.28 Feeder Cattle Aug 153.73 Sep 157.00 Oct 159.15 Nov 160.03 Jan 158.73

121.80 125.85 128.65 129.93 130.85

-1.15 -1.37 -1.65 -1.03 -0.57

119.98 124.38 127.28 130.45 134.10

152.60 156.00 158.10 158.93 159.05

+1.13 +1.00 +1.05 +1.10 -0.32

138.95 138.95 140.13 142.80 146.50

Est. Beef Wholesale ($/cwt) This wk Last wk Yr. ago n/a 220-221 207-209 Canfax

Sheep ($/lb.) & Goats ($/head) July 26 Base rail (index 100) 2.01 Range off base 1.98-2.24 Feeder lambs 0.90-0.95 Sheep (live) 0.10

Previous 2.01 2.09-2.19 0.90-0.95 0.10

July 29 1.66-2.00 1.40-1.78 1.62-1.71 1.60-1.70 1.10-1.50 1.40-1.70 0.75-0.95 0.80-0.90 70-110

New lambs 65-80 lb 80-95 lb > 95 lb > 110 lb Feeder lambs Sheep Rams Kids

Index 100 Hog Price Trends ($/ckg) Alberta $200 $195 $190 $185

1.57-1.75 1.49-1.87 1.54-1.66 1.59-1.62 1.28-1.50 1.40-1.70 0.60-0.78 0.65-0.90 70-110

Aug. 5 Wool, new crop >80 lb Wool, new crop <80 lb Hair lambs Fed sheep

$180 6/28

n/a 7/8

n/a

n/a

7/15 7/22 7/29

8/2

$200

Sltr. hogs to/fm U.S. (head) Total pork to/fm U.S. (tonnes) Total pork, all nations (tonnes)

$195 $190 $185 $180 6/28

(1) to July 20/13 7/8

7/15 7/22 7/29

(2) to May 31/12

Canada 11,349,719 11,491,348 -1.2

To date 2013 To date 2012 % change 13/12

Fed. inspections only U.S. 62,404,571 62,021,766 +0.6 Agriculture Canada

$190 $185 $180

n/a 7/15 7/22 7/29

8/2

Aug Oct Dec Feb

Close Aug. 2 99.25 83.95 80.80 83.33

Close July 26 97.78 84.80 81.85 83.60

n/a 184.21

Man. Que.

n/a 190.57 *incl. wt. premiums

+1.47 -0.85 -1.05 -0.27

Year ago 89.55 75.85 73.95 80.93

% from 2012 -0.8 +9.6 +1.1

Import n/a 116,241 (3) 122,693 (3)

% from 2012 n/a -0.4 +0.2 Agriculture Canada

Apr May Jun Jul

EXCHANGE RATE: AUG. 2 $1 Cdn. = $0.9627 U.S. $1 U.S. = $1.0387 Cdn.

7/15 7/22 7/29

8/2

Durum (Oct.) $310 $305 $300 $290 6/28

7/8

7/15 7/22 7/29

8/2

Milling Wheat (Oct.) $320 $300

$240 6/28

7/8

7/15 7/22 7/29

8/2

Close Aug. 2 84.23 87.85 90.18 88.55

Trend 0.00 -0.15 +0.43 -0.05

Year ago 87.80 95.50 97.70 97.30

Aug. 2 20.75-21.25 13.75-15.00 18.00-18.75 20.75-22.75 16.90-17.75 19.75-24.00 16.00-16.75 12.80-13.00 10.80-11.00 7.70-8.00 7.60-7.85 10.75-11.00 6.25-8.60 38.75-40.75 35.75-37.75 28.30-29.75 26.00-28.00 23.80-25.00 25.75-26.75 20.75-21.75 21.75-23.75

Avg. 20.85 14.50 18.35 21.50 17.54 22.13 16.50 12.96 10.96 7.82 7.76 10.92 7.11 39.75 36.42 29.27 26.78 24.60 26.35 21.35 22.42

July 29 23.10 16.00 17.30 22.14 18.20 23.19 18.83 12.96 10.96 8.49 8.46 13.17 7.11 40.07 36.42 30.23 26.69 24.60 27.70 22.70 23.92

Cash Prices

Canola (cash - Nov.) No. 3 Oats Saskatoon ($/tonne) No. 1 Rye Saskatoon ($/tonne) Snflwr NuSun Enderlin ND (¢/lb)

$650 $600 $550

July 31 July 24 Year Ago n/a 201.30 186.17 n/a n/a 165.15 20.90 21.75 n/a

$500 $450 6/28

7/5

7/12 7/19 7/26

USDA

No. 1 DNS (14%) Montana elevator No. 1 DNS (13%) Montana elevator No. 1 Durum (13%) Montana elevator No. 1 Malt Barley Montana elevator No. 2 Feed Barley Montana elevator

$90 $60 $30 $0 $-30 6/28

7/5

7/12 7/19 7/26

U.S. Grain Cash Prices ($US/bu.)

8/2

Canola (basis - Nov.)

Aug. 2 6.88 6.68 7.28 5.76 4.32

8/2

Grain Futures Feed Wheat (Lethbridge) $290 $280 $270 $260 $250 6/28

7/5

7/12 7/19 7/26

8/2

$640 $620 $600 $580

n/a $560 6/28 7/5

n/a 7/12 7/19 7/26

8/2

Barley (cash - Oct.) $300.0 $285.0

Basis: $61

$255.0 $240 6/28

7/5

7/12 7/19 7/26

8/2

Canola and barley are basis par region. Feed wheat basis Lethbridge. Basis is best bid.

Corn (Sept.) $570 $540 $510 $480 $450 6/28

7/8

7/15 7/22 7/29

8/2

$1540 $1470 $1400 $1330 7/8

7/15 7/22 7/29

8/2

Oats (Sept.) $400 $380 $360 $340 $320 6/28

Close July 26 84.23 88.00 89.75 88.60

Laird lentils, No. 1 (¢/lb) Laird lentils, Xtra 3 (¢/lb) Richlea lentils, No. 1 (¢/lb) Eston lentils, No. 1 (¢/lb) Eston lentils, Xtra 3 (¢/lb) Sm. Red lentils, No. 2 (¢/lb) Sm. Red lentils, Xtra 3 (¢/lb) Peas, green No. 1 ($/bu) Peas, green 10% bleach ($/bu) Peas, med. yellow No. 1 ($/bu) Peas, sm. yellow No. 2 ($/bu) Maple peas ($/bu) Feed peas ($/bu) Mustard, yellow, No. 1 (¢/lb) Mustard, brown, No. 1 (¢/lb) Mustard, Oriental, No. 1 (¢/lb) Canaryseed (¢/lb) Desi chickpeas (¢/lb) Kabuli, 8mm, No. 1 (¢/lb) Kabuli, 7mm, No. 1 (¢/lb) B-90 ckpeas, No. 1 (¢/lb)

Cash Prices

$1260 6/28

(3) to July 27/13

Trend

7/8

Soybeans (Aug.)

Index 100 hogs $/ckg

Chicago Hogs Lean ($US/cwt)

$195

7/8

To July 27

8/2

Manitoba

$175 6/28

Export 480,994 (1) 145,025 (2) 497,099 (2)

$180 6/28

Chicago Nearby Futures ($US/100 bu.)

Hogs / Pork Trade

Saskatchewan

$185

$270.0

0.85-0.90 0.93 0.75-0.83 0.15-0.30

Hog Slaughter

Alta. Sask.

$190

Flax (elevator bid- S’toon)

Ontario Stockyards Inc.

Fixed contract $/ckg

Sep 01-Sep 14 Sep 15-Sep 28 Sep 29-Oct 12 Oct 13-Oct 26 Oct 27-Nov 09 Nov 10-Nov 23 Nov 24-Dec 07 Dec 08-Dec 21 Dec 22-Jan 04 Jan 05-Jan 18 Jan 19-Feb 01

$195

SunGold Meats

HOGS Maple Leaf Hams Mktg. Aug. 2 Aug. 2 156.07-157.98 n/a 156.55-157.98 n/a 155.90-157.34 n/a 149.69-153.04 n/a 145.68-147.11 n/a 140.90-142.82 n/a 140.90-146.16 n/a 146.64-146.64 n/a 143.77-143.83 n/a 144.79-147.18 n/a 150.53-151.01 n/a

$200

$260

Close Trend Year July 26 ago

Sask. Sheep Dev. Bd.

Due to wide reporting and collection methods, it is misleading to compare hog prices between provinces.

Source: STAT Publishing, which solicits bids from Maviga N.A., Legumex Walker, CGF Brokerage, Parrish & Heimbecker, Simpson Seeds and Alliance Grain Traders. Prices paid for dressed product at plant.

Barley (Oct.)

$280

Chicago Futures ($US/cwt)

USDA

Basis

Alta-Neb Sask-Neb Ont-Neb

To July 27 Fed. inspections only Canada U.S. To date 2013 1,468,995 18,423,634 To date 2012 1,615,529 18,584,627 % Change 13/12 -9.1 -0.9

Montreal Heifers n/a n/a n/a n/a Trend n/a n/a steady/+2

Pulse and Special Crops

ICE Futures Canada

$295

Cattle Slaughter

$140 $135

Previous July 19-25

7/8

7/15 7/22 7/29

8/2

Minneapolis Nearby Futures ($US/100bu.) Spring Wheat (Sept.) $800 $780 $760 $740 $720 6/28

7/8

7/15 7/22 7/29

8/2

Aug. 2 July 29 Trend Wpg ICE Canola ($/tonne) Nov 493.60 490.40 +3.20 Jan 497.40 493.80 +3.60 Mar 502.20 497.60 +4.60 May 504.90 500.10 +4.80 Wpg ICE Milling Wheat ($/tonne) Oct 257.00 256.00 +1.00 Dec 260.00 259.00 +1.00 Mar 267.00 266.00 +1.00 Wpg ICE Durum Wheat ($/tonne) Oct 296.00 296.00 0.00 Dec 300.00 301.00 -1.00 Wpg ICE Barley ($/tonne) Oct 189.00 194.00 -5.00 Dec 194.00 199.00 -5.00 Chicago Wheat ($US/bu.) Sep 6.6050 6.5150 +0.0900 Dec 6.7300 6.6325 +0.0975 Mar 6.8250 6.7325 +0.0925 May 6.8750 6.7925 +0.0825 Chicago Oats ($US/bu.) Sep 3.3875 3.3600 +0.0275 Dec 3.2650 3.2725 -0.0075 Mar 3.3250 3.3175 +0.0075 Chicago Soybeans ($US/bu.) Aug 13.3100 13.6750 -0.3650 Sep 12.1275 12.7200 -0.5925 Nov 11.8150 12.2000 -0.3850 Jan 11.8725 12.2550 -0.3825 Chicago Soy Oil (¢US/lb.) Aug 42.38 42.47 -0.09 Sep 42.49 42.58 -0.09 Oct 42.60 42.67 -0.07 Chicago Soy Meal ($US/short ton) Aug 412.1 438.9 -26.8 Sep 385.2 411.5 -26.3 Oct 357.2 376.0 -18.8 Chicago Corn ($US/bu.) Sep 4.7600 4.8925 -0.1325 Dec 4.6375 4.7325 -0.0950 Mar 4.7650 4.8600 -0.0950 May 4.8425 4.9400 -0.0975 Minneapolis Wheat ($US/bu.) Sep 7.4125 7.3425 +0.0700 Dec 7.5000 7.4575 +0.0425 Mar 7.6200 7.5825 +0.0375 May 7.6950 7.6550 +0.0400 Kansas City Wheat ($US/bu.) Sep 7.0675 6.9025 +0.1650 Dec 7.1875 7.0075 +0.1800 Mar 7.2675 7.0950 +0.1725

Year ago 618.00 621.10 621.90 615.50 301.00 308.00 318.00 311.50 316.00 264.50 269.50 8.9125 9.0375 9.0500 8.8100 3.7800 3.7800 3.7975 16.5625 16.3575 16.2875 16.2500 52.04 52.28 52.47 531.6 509.9 497.3 8.1000 8.0750 8.0875 8.0200 9.4450 9.5400 9.6175 9.6500 8.9600 9.1775 9.2450

Canadian Exports & Crush (1,000 To tonnes) July 31 Wheat n/a Durum n/a Oats n/a Barley n/a Flax n/a Canola n/a Peas n/a Canola crush 97.7

To July 21 231.4 25.7 13.6 1.3 1.2 71.0 0.1 117.3

Total to date n/a n/a n/a n/a n/a n/a n/a 6695.7

Last year 13375.3 3564.9 1202.4 1206.6 260.2 8580.7 1605.5 6724.7


WEATHER A foal stays close by mom in a pasture in the Peace region of Alberta, where moist weather this summer has kept pastures in good shape. |

SIDE BY SIDE |

THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 8, 2013

RANDY

VANDERVEEN PHOTO

PUBLISHER: SHAUN JESSOME EDITOR: JOANNE PAULSON MANAGING EDITOR: MICHAEL RAINE Box 2500, 2310 Millar Ave. Saskatoon, Sask. S7K 2C4. Tel: (306) 665-3500

ADVERTISING

TEMP. MAP

TEMPERATURE FORECAST

PRECIP. MAP Much above normal

Aug. 8 - 14 (in °C)

ADVERTISING RATES Classified liner ads: $5.85 per printed line (3 line minimum) Classified display ads: $6.50 per agate line ROP display: $9.25 per agate line

Aug. 8 - 14 (in mm)

Above normal

Churchill

Churchill Prince George

Prince George

Normal

Edmonton

Edmonton Calgary

Saskatoon Regina

Below normal

Vancouver

Calgary

Regina

The Western Producer reserves the right to revise, edit, classify or reject any advertisement submitted to it for publication.

CANADIAN HERITAGE ACKNOWLEDGEMENT

Saskatoon

Winnipeg

Winnipeg

Much below normal

The numbers on the above maps are average temperature and precipitation figures for the forecast week, based on historical data from 1971-2000. Maps provided by WeatherTec Services: www.weathertec.mb.ca n/a = not available; tr = trace; 1 inch = 25.4 millimetres (mm)

Assiniboia Broadview Eastend Estevan Kindersley Maple Creek Meadow Lake Melfort Nipawin North Battleford Prince Albert Regina Rockglen Saskatoon Swift Current Val Marie Yorkton Wynyard

Precipitation last week since April 1 mm mm %

25.1 22.5 25.3 23.5 24.6 26.9 22.1 21.5 21.6 24.3 22.8 24.7 23.7 24.6 24.2 25.9 23.6 22.4

0.0 2.5 0.3 33.0 1.6 0.0 3.3 0.6 0.8 0.3 2.3 0.0 0.0 0.0 0.0 1.5 1.3 1.1

7.3 7.7 5.7 8.0 6.2 6.3 3.1 7.7 7.8 3.5 6.5 4.5 7.2 6.4 5.1 4.8 8.9 7.1

175.3 225.3 234.6 357.2 178.6 253.3 172.0 230.9 242.5 193.7 299.4 177.6 239.1 182.1 202.4 275.3 179.4 184.2

85 100 118 160 99 135 84 114 112 98 141 87 119 94 105 155 78 88

Newsroom toll-free: 1-800-667-6978 Fax: (306) 934-2401 News editor: TERRY FRIES e-mail: newsroom@producer.com News stories and photos to be submitted by Friday or sooner each week. The Western Producer Online Features all current classified ads and other information. Ads posted online each Thursday morning. See www.producer.com or contact webmaster@producer.com Letters to the Editor/contact a columnist Mail, fax or e-mail letters to joanne.paulson@producer.com or newsroom@producer.com. Include your full name, address and phone number for verification purposes. To contact a columnist, write the letter in care of this newspaper. We’ll forward it to the columnist.

Return undeliverable Canadian addresses to Subscriptions, Box 2500, Saskatoon, Sask. S7K 2C4

If you’d like to buy a photo or order a copy of a news story that appeared in the paper, call our librarian at (306) 665-9606. ™

Printed with inks containing canola oil

Member, Canadian Farm Press Association

Publications Mail Agreement No. 40069240

MANITOBA Temperature last week High Low

Brooks Calgary Cold Lake Coronation Edmonton Grande Prairie High Level Lethbridge Lloydminster Medicine Hat Milk River Peace River Pincher Creek Red Deer Stavely Vegreville

EDITORIAL

Coming Events/ Stock Sales/ Mailbox Please mail details, including a phone number or call (306) 665-3544. Or fax to (306) 934-2401 or email events@ producer.com

ALBERTA Temperature last week High Low

$4.25 plus taxes

We acknowledge the financial support of the Government of Canada through the Canada Periodical Fund of the Department of Canadian Heritage.

LAST WEEK’S WEATHER SUMMARY ENDING AUG. 1 SASKATCHEWAN

1-800-667-7770 1-800-667-7776 (306) 665-3515 (306) 653-8750

HOURS: Mon.& Fri. 8:30 a.m. – 4:30 p.m. Tues., Wed., Thurs. 8:30 a.m. – 8 p.m. e-mail: advertising@producer.com Advertising director: KELLY BERG Classified sales mgr: SHAUNA BRAND

PRECIPITATION FORECAST

Subscriptions: 1-800-667-6929 In Saskatoon: (306) 665-3522 Fax: (306) 244-9445 Subs. supervisor: GWEN THOMPSON e-mail: subscriptions@producer.com

SUBSCRIPTION RATES Within Canada: One year: $82.92 + applicable taxes Two years: $154.24 + applicable taxes Sask. / Alberta add 5% GST. Manitoba add 5% GST & 8% PST. Ontario add 13% HST. B.C. add 12% HST. Nova Scotia add 15% HST. United States $179.66 US/year All other countries $358.19 Cdn/year

President, Glacier Media Agricultural Information Group: BOB WILLCOX Contact: bwillcox@glaciermedia.ca Phone: (204) 944-5751

Classified ads: Display ads: In Saskatoon: Fax:

SUBSCRIPTIONS

Per copy retail

The Western Producer is published at Saskatoon, Sask., by Western Producer Publications, owned by Glacier Media, Inc. Printed in Canada.

Vancouver

87

26.6 24.9 23.3 25.0 24.6 25.2 24.0 25.8 23.5 28.4 26.6 23.9 25.4 22.6 22.1 25.9

5.4 3.9 7.1 3.5 3.6 6.7 5.4 4.2 5.9 6.6 7.0 9.2 3.7 4.1 0.0 4.9

Precipitation last week since April 1 mm mm %

1.7 2.0 6.6 0.3 5.4 8.7 5.5 2.3 0.4 0.5 6.6 4.2 9.2 0.8 14.7 0.2

249.8 347.5 199.8 224.4 249.8 217.0 177.5 282.9 218.5 253.6 262.8 248.0 264.1 286.0 428.8 192.6

145 149 93 118 104 108 100 146 106 151 128 129 101 108 184 94

Temperature last week High Low

Brandon Dauphin Gimli Melita Morden Portage La Prairie Swan River Winnipeg

23.4 24.2 24.1 23.2 24.1 24.3 23.6 24.2

Precipitation last week since April 1 mm mm %

8.0 10.6 8.3 9.0 9.6 11.2 9.7 9.7

23.5 1.1 16.5 12.7 7.2 32.4 1.4 8.4

305.5 322.9 200.0 309.0 322.9 299.8 311.1 253.2

131 141 82 140 127 122 128 99

5.0 8.7 12.8 8.1 3.3

0.7 11.9 0.0 0.0 1.9

226.3 279.5 139.4 175.8 187.4

130 139 119 124 93

BRITISH COLUMBIA Cranbrook Fort St. John Kamloops Kelowna Prince George

29.5 24.9 34.3 32.2 30.4

All data provided by Agriculture and Agri-Food Canada’s National Agroclimate Information Service: www.agr.gc.ca/drought. Data has undergone only preliminary quality checking. Maps provided by WeatherTec Services Inc.: www.weathertec.mb.ca

This August, ask your Salford dealer about program discounts & special financing options on Precision Seeding Equipment.

Call your Salford dealer today, or visit

www.salfordmachine.com Salford, Ontario • 1-866-442-1293


88

AUGUST 8, 2013 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

Introducing the new Case IH 5-series Early Riser® planters. Often imitated, our Early Riser planter has gone beyond picket fence stands to deliver yield impacting photocopy plants. That’s because instead of introducing fancy gadgets, we focused on what matters most: Your land. Specifically, how the right agronomic design at planting can make a difference at harvest. From good soil-to-seed contact and proper depth, to accurate spacing and uniform soil pressure, our planters are engineered with just one thing in mind — higher yield. Now that’s something that can’t be duplicated. Learn more about Early Riser planters by visiting your Case IH dealer or go to www.caseih.com/earlyriser5wp813.

BE READY.

©2013 CNH America LLC. All rights reserved. Case IH is a registered trademark of CNH America LLC. www.caseih.com

20130808