Issuu on Google+

Tripoli Berdarah BENGHAZI, Libya (Waspada): Sekitar 400 orang tewas, 2.000 orang lainnya cedera dalam pertempuran tiga hari antara pasukan pemberontak oposisi dan pasukan yang setia kepada Moammar Khadafi di Tripoli, ibukota Libya, kata pemimpin dewan pemberontak Rabu (23/8). Khadafi dari persembunyiannya menyatakan tekadnya

Lanjut ke hal A2 kol. 5

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

KAMIS, Kliwon, 25 Agustus 2011/25 Ramadhan 1432 H

No: 23607 Tahun Ke-65

PPP Tengok Angin MEDAN (Waspada): Nama Fadly Nurzal masuk sebagai salah satu kandidat yang diusung sebagai calon wakil gubernur Sumatera Utara (Cawagubsu). Namun, saat dikonfirmasi Waspada, jawaban Ketua PPP Sumut ini masih mengambang, sepertinya Fadly masih menengok arah angin. Namun, secara pribadi, FadlyNurzal mengaku tidak terlalu Lanjut ke hal A2 kol. 3

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harga Eceran: Rp2.500,-

3.000 TKI Asal Sumut Mudik

Sindikat Pembius Beraksi Di Bandara

MEDAN (Waspada): Dari 15.000 Tenaga Kerja Indonesia (TKI) asal Sumatera Utara yang bekerja di sejumlah sektor industri di Malaysia, sekitar 3.000 di antaranya bakal mudik menjelang Lebaran 2011. “Puncak arus mudik TKI dari Malaysia diperkirakan terjadi pada H-2,” kata Amir Hakim, staf Pos Pengendalian (Posdal) TKI di terminal kedatangan luar negeri Bandara Polonia Medan ketika dikonfirmasi Waspada, Rabu (24/8). Amir memastikan sekitar 3.000 TKI akan merayakan Idul Fitri bersama keluarga di kampung halamannya. “Tidak hanya TKI asal Sumut yang bekerja di industri Selangor dan Sebrang Free Penang, bahkan TKI asal Aceh juga bakal pulang kampung melalui Bandara Polonia,” ujarnya. Menurut Amir, 3.000 TKI tersebut dikirim melalui sejumlah Perusahaan Pengerah Tenaga Kerja Indonesia (PPTKI) di Sumut. Mereka dikontrak bekerja di perusahaan Malaysia selama dua tahun. “Sebagian dari mereka sudah ada yang mudik sejak minggu lalu. Bahkan, jumlah TKI yang mudik sejak Rabu (24/8) pagi hingga malam mencapai 150 orang,” ujarnya seraya menambahkan para TKI ini menggunakan penerbangan Air Asia, Fire Fly, Sriwijaya Air bahkan Malaysia Airlines System (MAS). Sementara itu, Bahriunsyah, staf Bea Cukai Bandara Polonia Medan saat dikonfirmasi Waspada mengatakan, banyak TKI asal Sumut yang sudah pulang ke kampung halamannya. Umumnya, para TKI tersebut ditempatkan di Selangor dan Penang.(m32)

JAKARTA (Antara): Sindikat pembius, kini mulai beraksi di Bandara. Aksi tersebut tujuannya untuk menguras harta benda korban setelah anggota komplotan tersebut berpura-pura kenal calon korbannya. Namun, aparat Polda Metro Jaya berhasil menggagalkan aksi sindikat tersebut setelah menangkap Sugiyanto dan Sutikno. Keduanya sindikat spesialis pembiusan yang sasarannya penumpang pesawat yang tiba di Bandara Internasional Soekarno-Hatta, Tangerang. “Pelaku mengincar penumpang pesawat yang akan keluar dari Bandara SoekarnoHatta,” kata Kepala Bidang Humas Polda Metro Jaya, Komisaris Besar Polisi Baharudin Djafar, di Jakarta, Rabu (24/8). Djafar mengatakan tersangka berpurapura menjadi penumpang yang menawarkan pulang bersama kepada penumpang pesawat yang menjadi calon korban. Direktur Reserse Kriminal Umum Polda Metro Jaya, Komisaris Besar Polisi Gatot Edy Pramono, menuturkan Sugiyanto dan Sutikno merupakan satu sindikat. Gatot menjelaskan awalnya Sutikno menawarkan pulang bersama dengan penumpang lain menggunakan taksi dari Bandara Soekarno-Hatta menuju keluar Jakarta. Tersangka mengajak istirahat calon korban di tempat jualan jamu di kawasan Rawasari, Jakarta Pusat. “Saat itu, tersangka menawarkan jamu dicampur air mineral yang sudah campur obat tidur Sanax,” ujar Gatot.

Antara

DIPADATI PENUMPANG: Sejumlah pemudik berusaha menerobos masuk ke dalam kereta yang tiba di Stasiun Pasar Senen, Jakarta, Rabu (24/8). Menjelang Lebaran tahun ini, pemudik masih meminati moda angkutan umum jenis Kereta Api untuk pulang ke kampung halaman meski harus berdesak-desakan.

Lanjut ke hal 2 kol. 7

4 Perampok Ngaku Polisi Gol BELAWAN (Waspada): Aksi kejahatan di Sumatera Utara, kini makin meningkat. Bahkan pelakunya sering menggunakan modus baru untuk melumpuhkan korbannya. Salah satu di antaranya mengaku aparat. Seperti yang dilakukan empat perampok mengaku polisi, seorang di antaranya memakai pakaian dinas Polri. Namun, tak lama setelah beraksi, petugas Polsek Medan Labuhan menangkap keempat orang itu dari tempat berbeda, Rabu (24/8).

‘’ Para perampok itu ditangkap setelah melakukan aksinya terhadap korban Yusrizal, 30, warga Jalan Platina VII, Kel. Titipapan, Kec. Medan Deli,’’ kata sumber di kepolisian. Informasi diperoleh, polisi pertama kali menangkap B, 34,

warga Jl. Pancing I, Kel. Besar, Kec. Medan Labuhan. Saat dilakukan pengembangan, polisi menangkap M, 34, warga Jl. Perwira II, Gang Amal, Kec. Medan Timur, D, 35, warga Gang Padi Kel. Tanjung Mulia Kec. Medan Deli, dan E, 30, warga

Jl. Krakatau Ujung Kec. Medan Timur. Dari keempat perampok tersebut, polisi menyita barang bukti mobil Toyota Avanza BK 1371 KW, pakaian dan atribut polisi yang dipakai saat melakukan aksi perampokan, dan

Diduga Maling Lembu Tewas Ditembak Polisi GALANG (Waspada): Seorang lelaki bernama Mul alias AD, 31,diduga maling lembu warga Desa Nagarejo, Kec. Galang Deliserdang, tewas ditembak polisi, Rabu (24/8) malam sekira pukul 20:00. Mul ditembak polisi persis mengenai tulang rusuk sebelah kiri, karena Mul berupaya melakukan perlawanan saat hendak ditangkap. Selanjutnya, mayat pria yang sudah masuk DPO ini dibawa ke RSUD Deliserdang, Lubukpakam. Menurut sumber Waspada, Mul selama ini selain centeng kebun PTP Lonsum, juga penadah lembu hasil curian, sehingga polisi terus mengintai Mul. Hal ini diketahui dari dua

tersangka sebelumnya yang telah diamankan polisi dalam kasus yang sama. Berdasarkan pengakuan ini, polisi terus melakukan pengembangan, dan Rabu malam (24/8),polisi mencium keberadaan Mul. Tanpa buang waktu, polisi langsung membekuk Mul di Tanah Merah, Galang. Namun saat dibekuk, Mul, melakukan perlawanan, sehingga polisi menembak lelaki tersebut, tepat bersarang di rusuk kirinya, Catatan polisi, Mul dituduh mencuri atas pengaduan HS di Polsek Galang, Jumat (12/8). Dalam pengaduan itu disebutkan, satu ekor lembu miliknya dicuri dari kandangnya, di Dusun III Desa Nagarejo, Kamis (11/8)

Harta Terbaik Oleh Muhammad Arif Fadhillah Lubis, SHI, MSI SUATU waktu, Rasululah SAW duduk di atas mimbarnya, para sahabat duduk di sekeliling beliau. Rasulullah SAW bersabda, “Wahai sahabat-sahabatku! Di antara pelbagai hal yang sangat kukhawatirkan atas diri kalian sepeninggalku kelak adalah kemewahan duniawi yang dianugerahkan kepada kalian.” Salah seorang sahabat bertanya, “Wahai Rasul! Apakah kenikmatan tersebut bisa mengakibatkan keburukan?” Lanjut ke hal A2 kol. 2

Dua Tahanan Kejari P. Sidimpuan Kabur P. SIDIMPUAN (Waspada): Dua tahanan melarikan diri (kabur) dari sel Kejaksaan Negeri Padangsidimpuan, Selasa (23/8). Hingga Rabu (24/8), pihak Kejaksaan dan polisi masih melakukan pengejaran dan belum ditemukan. Kepala Kejaksaan Negeri Padangsidimpuan, Freddy Azhari Siregar, SH, M.Hum sejak kejadian tidak bisa dihubungi. Sedangkan bawahannya tidak berani memberi keterangan tanpa izin Kajari. Informasi dihimpun, tahanan yang melarikan diri Hardisanto Lintang alias Anto, warga Jl. SM Raja, Gang Air Bersih, Kel. Sitamiang Lama, Kota Padangsidimpuan. Hardisanto merupakan tersangka kasus narkotika golongan I jenis ganja. Dia tertangkap tangan memiliki ganja saat berada di ruang pintu utama Lapas Kelas IIB Padangsidimpuan di Salambue.

Lanjut ke hal A2 kol. 6

Lanjut ke hal 2 kol. 2

Idul Fitri Berpotensi Dirayakan Berbeda

Harga Gula Pasir Naik

Lanjut ke hal A2 kol. 6

terjadi saat korban memperbaiki sepedamotor tetangganya. Usai memperbaiki korban mencoba laju sepedamotor milik Abdul Manan, tetangganya tersebut.

Prof. Thomas Djamaluddin Dari LAPAN:

sekira pukul 21:30. Dengan pengaduan itu, petugas menemukan seekor lembu diduga hasil curian dari seorang penadah, Ba alias Jambrong. Dari keterangan Ba, polisi mengamankan Ir sebagai tersangka pencuri lembu. Selanjutnya dari keterangan kedua tersangkainidisebutnamaMul.(a07)

MEDAN (Waspada): Pasar murah yang digelar di seluruh kelurahan di Kota Medan segera berakhir, dan dampaknya mulai terlihat dengan naiknya harga beberapa kebutuhan pokok seperti gula pasir. Berdasarkan pantauan di beberapa swalayan besar di inti Kota Medan, Rabu (24/8), harga gula pasir mulai tidak seragam. Ini merupakan tanda-tanda akan adanya kenaikan. Harga gula pasir di swalayan tidak sama dengan di pasar tradisional yang selalu memakai sistem kemasan kiloan. Sedangkan di swalayan, gula pasir dibandrol dengan

sepedamotor Yamaha RX King BK 6815 EM milik korban. Saat ini keempat tersangka masih menjalani pemeriksaan. Kanit Reskrim Polsek Medan Labuhan AKP Oktavianus ketika dikonfirmasi mengatakan, perampokan terhadap Rizal

Waspada/Rustam Efendi

EMPAT tersangka perampok yang mengaku polisi diamankan di Polsek Medan Labuhan, Rabu (24/8).

Chandra Dan Ade Diancam Bunuh, KPK Persilakan Polri Mengusut JAKARTA (Waspada): Ketua Komisi Pemberantasan Korupsi Busyro Muqoddas mengatakan, pihaknya belum mempunyai rencana untuk melaporkan ancaman pembunuhan terhadap Wakil Ketua KPK Chandra M Hamzah dan mantan Deputi Penindakan KPK Ade Rahardja kepada kepolisian. Namun, menurut Busyro, jika kepolisian ingin mengusut

kasus tersebut, pihaknya akan mempersilakannya. “Karena ini, kan bukan delik aduan. Jadi, misalnya kalau kepolisian mau mengusut, itu haknya polisi,” ujar Busyro di Gedung Mahkamah Konstitusi, Jakarta, Rabu (24/8). Sebelumnya, terungkap adanya rencana pembunuhan terhadap Wakil Ketua KPK Chandra M Hamzah dan man-

tan Deputi Penindakan KPK Ade Rahardja berasal dari reka-man pembicaraan yang diputar Komite Etik KPK. Anggota Komite Etik KPK, Syafii Maarif mengatakan, ancaman tersebut terkait tindakan KPK mengusut kasus korupsi wisma atlet yang melibatkan M Nazaruddin, mantan Bendahara

Lanjut ke hal 2 kol. 3

JAKARTA (Antara): Idul Fitri tahun ini berpotensi dirayakan berbeda-beda oleh umat Islam, yakni 30 Agustus dan 31 Agustus, berhubung pada saat ini posisi bulan cukup rendah untuk dilihat, kata Prof Dr Thomas Djamaluddin. “Tinggi bulan saat Maghrib pada akhir Ramadhan di wilayah Indonesia sekitar dua derajat atau kurang.” kata Deputi Sains, Pengkajian dan Informasi Kedirgantaraan pada Lembaga Penerbangan dan Antariksa Nasional (LAPAN) Prof Dr Thomas Djamaluddin di Jakarta, Rabu (24/8). Ia mengatakan, ormas Islam seperti Muhammadiyah dengan kriteria “wujudul hilal” memang sudah menghitung (hisab) dan menetapkan sejak jauh hari bahwa Idul Fitri jatuh pada 30 Agustus. Namun ormas lainnya, seperti Nahdlatul Ulama termasuk pemerintah mengharuskan selain hisab, perlu adanya kriteria “imkan rukyat” (visibilitas bulan sabit) dan sidang itsbat. “Tetapi karena hilal sangat rendah, maka kemungkinan besar rukyat pada 29 Agustus akan gagal melihat hilal, sehingga

Ramadhan digenapkan 30 hari dan diprakirakan Idul Fi-tri jatuh pada 31 Agustus,” katanya. Ditegaskannya, kalender nasional memang mencantumkan 30 dan 31 sebagai libur Idul Fitri,

Lanjut ke hal 2 kol. 1

Doa Untuk Husin Sitorus LIMAPULUH (Waspada): Persidangan banding Husin Sitorus yang hari ini, Kamis (25/8) digelar Mahkamah Rayuan Syah Alam Malaysia, menimbulkan empati dari masyarakat Batubara. Mereka mengharapkan pemerintah serius menyelamatkan warganya dari tiang gantungan. Ketua PD Alwashliyah Batubara Ir. Kusmayadi kepada Waspada, Rabu (24/8), menegaskan persoalan Husin Sitorus tidak bisa dianggap enteng dengan hanya mengutus pejabat setingkat Kabag. “Pemkab Batubara tidak bisa jalan sendiri menghadapi

Lanjut ke hal A2 kol. 6

Ada-ada Saja Hantu Gentayangan Bikin Mogok Kerja PARA pekerja yang ditugasi merenovasi sebuah bangunan museum di Napoli, Italia, mogok dan berhenti bekerja karena mengaku di tempat itu banyak hantu gentayangan. Museum Arkeologi Nasional, kini telah mengundang paranormal dari seluruh dunia untuk memecahkan misteri tersebut. Para pekerja bangunan yang bermalam di tempat itu

Lanjut ke hal A2 kol. 1

erampang Seramp ang - Ati-ati mau royo banyak lampok - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

Dua Tahanan Kejari P. Sidimpuan Kabur

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

P. SIDIMPUAN (Waspada): Dua tahanan berhasil lolos dan kabur dari sel Kejaksaan Negeri Padangsidimpuan, Selasa (23/8). Hingga Rabu (24/8), pihak Kejaksaan dan Kepolisian masih melakukan pengejaran dan belum berhasil ditemukan. Kepala Kejaksaan Negeri Padangsidimpuan, Freddy Azhari Siregar, SH, M.Hum sejak kejadian tidak bisa dihubungi. Sedangkan bawahannya tidak berani memberi keterangan tanpa izin Kajari. Informasi dihimpun, tahanan yang melarikan diri Hardisanto Lintang alias Anto, warga Jalan SM Raja, Gang Air Bersih, Kelurahan Sitamiang Lama, Kota Padangsidimpuan. Hardisanto merupakan tersangka kasus narkotika golongan I jenis ganja. Dia tertangkap tangan memiliki ganja saat berada di ruang pintu utama Lapas Kelas IIB Padangsidimpuan di Salambue. Hardisanto melarikan diri saat akan menjalani persidangan di Pengadilan Negeri Padangsidimpuan dengan registrasi perkara No.580/Pid.sus/2011/PN/Psp. Petugas mengetahuinya sudah tidak berada di sel, saat hendak dibawa ke persidangan. Tahanan lain yang melarikan diri adalah Muhammad Juman Nasution alias Mamad, warga Desa Hasahatan Jae, Kecamatan Barumun, Kabupaten Padanglawas. Dia tersangka kasus pencurian dengan pemberatan dengan perkara No.433/Pid.B/2011/PN Padangsidimpuan.

KAMIS, Kliwon, 25 Agustus 2011/25 Ramadhan 1432 H z zNo: 23608 Tahun Ke-65

Terbit 24 Halaman

PENGAMANAN MUDIK

Lanjut ke hal A2 kol 7

Dua Anggota Sindikat Pembius Penumpang Pesawat Ditangkap

400 Orang Tewas 2.000 Cedera Khadafi Perintahkan Warga Bebaskan Tripoli, Usir Setan

Lanjut ke hal A2 kol 2

AP

PARA pejuang pemberontak terlihat di dalam kompleks utama kediaman Moammar Khadafi di Bab al-Aziziya di Tripoli, Libya, Selasa (23/8).

Kemenlu Kehilangan Kontak 19 WNI Di Libya JAKARTA (Waspada): Libya dalam kondisi genting. Kekuasaan rezim Moammar Khadafi yang bercokol 42 tahun terancam. Pemberontak mengklaim menguasai ibu kota Tripoli. Di sisi lain, Khadafi telah berikrar tak bakal menyerah. Baginya hanya ada dua pilihan: menang atau mati sebagai martir. Situasi Libya makin mengkhawatirkan. Sebab, Menteri Lanjut ke hal A2 kol 6

Al Bayan

Kabura Maqtan Oleh: Tgk. H. Ameer Hamzah DALAM kehidupan sehari-hari mungkin bersua orang-orang yang banyak ilmu tetapi kurang sekali mengamalkannya. Penampilan dan gayanya jauh sekali dengan ilmu yang dimilikinya. Mereka hanya pandai bicara, tetapi lain di mulut dan lain pula di hatinya. Mulutnya manis seperti madu, tetapi hatinya busuk seperti bangkai. Mereka pandai menanam tebu di bibir, menyembunyikan yang sebenarnya. Mereka menyuruh orang lain untuk berbuat kebajikan, tetapi dirinya bergelimang dalam dosa besar. Kadangkadang mereka menguatkan bicaranya dengan dalil-dalil dari Alquran dan hadits untuk meyakinkan orang, padahal dia melanggarnya diam-diam. Misalnya, mereka bilang menyimpang uang di bank haram dan riba hukumnya, tetapi diam-diam dia juga berurusan dengan bank yang dikatakan riba itu. Mungkin juga ia seorang penceramah, ia menyuruh orang supaya banyak bersedekah, ternyata dia tak pernah

Lanjut ke hal A2 kol 2

Anak-anaknya Gelar Doa Bersama LIMAPULUH (Waspada): Persidangan banding Husin Sitorus yang hari ini, Kamis (25/8) disidangkan di Mahkamah Rayuan Syah Alam Malaysia menimbulkan empati dari masyarakat Batubara yang mengharapkan pemerintah serius menyelamatkan warganya dari tiang gantungan. Ketua PD Alwashliyah Batubara Ir. Kusmayadi kepada Waspada, Rabu (24/8), menegaskan persoalan Husin Sitorus tidak bisa dianggap enteng dengan hanya mengutus pejabat setingkat Kabag. “Pemkab Batubara tidak bisa jalan sendiri menghadapi masalah Husin Sitorus. Mereka harus minta bantuan pemerintah pusat khususnya presiden untuk melakukan diplomasi dengan raja Diraja Malaysia,” tegas Kusmayadi. Dibeberkannya, kalau sekedar menolong warga dengan cara seperti itu hanya akan menaburkan uang pemerintah tapi hasilnya tidak maksimal. Mengurusi persoalan antar negara ini juga bukan levelnya pemerintah kabupaten. Sementara itu anak tertua Husin Sitorus, Siti Aisyah mengatakan, seluruh keluarga malam ini akan melakukan doa bersama di rumah Husin. “Kami seluruh anak - anak ayah akan doa bersama malam ini. Hanya aku dan adik - adik, kalau manggil - manggil orang tak mungkin kondisi kami juga seperti inilah,” kata Aisyah. (c05)

Tripoli Berdarah

BENGHAZI, Libya (Waspada): Sekitar 400 orang tewas dan 2.000 orang lainnya cedera dalam pertempuran tiga hari antara pasukan pemberontak oposisi dan pasukan yang setia kepada Moammar Khadafi di Tripoli, ibukota Libya, kata pemimpin dewan pemberontak Rabu (23/8). Khadafi dari persembunyiannya menyatakan tekadnya Rabu untuk berjuang ‘sampai menang atau mati syahid,’ pada saat pejuang pemberontak berusaha untuk mengakhiri serangan yang berpencar-pencar oleh para pendukung Khadafi di ibukota yang tegang.

Hari Ini Nasib Terpidana Mati Husin Sitorus Diputuskan

Waspada/Hamdani

Seorang anggota Brimob melakukan patroli di gerbong kereta api, Rabu (24/8). Menjelang perayaan Idul Fitri 1432 H, pihak kepolisian memperketat pengamanan arus mudik guna mengantisipasi tindak kejahatan.

4 Perampok Ngaku Polisi Ditangkap B E L A W A N ( Wa s p a d a ) : E m p a t perampok yang kerap mengaku polisi saat menjalankan aksinya ditangkap petugas Polsek Medan Labuhan dari tempat yang berbeda, Rabu (24/8).

Gula Pasir Naik MEDAN (Waspada): Pasar murah yang digelar di seluruh kelurahan di Kota Medan segera berakhir, dan dampaknya mulai terlihat dengan naiknya harga beberapa kebutuhan pokok seperti gula pasir. Berdasarkan pantauan di beberapa swalayan besar di inti Kota Medan, Rabu (24/8), terlihat harga gula pasir mulai tidak seragam. Ini merupakan tanda-tanda akan adanya kenaikan. Harga gula pasir di swalayan tidak sama dengan di pasar tradisional yang selalu memakai sistem kemasan kiloan. Sedangkan di swalayan, gula pasir dibandrol dengan tarif tidak sama karena disesuaikan jenisnya serta merek yang tertera dalam kemasannya. Harga yang dipasarkan di swalayan saat ini mulai bergerak naik antara Rp200 hingga Rp500 per kemasan, yakni dari harga Rp12.500 naik menjadi Lanjut ke hal A2 kol 1

Para perampok itu melakukan aksinya terhadap korban Yusrizal, 30, warga Jalan Platina VII, Kelurahan Titipapan, Kecamatan Medan Deli. Polisi pertama kali menangkap tersangka B, 34, warga Jalan Pancing I, Kel. Besar, Kec. Medan Labuhan. Kemudian dilakukan pengembangan dan menangkap M, 34, warga Jalan Perwira II Gang

Amal Kec. Medan Timur, D, 35, warga Gang Padi Kel. Tanjung Mulia Kec. Medan Deli, dan E, 30, warga Jalan Krakatau Ujung Kec. Medan Timur. Dari keempat perampok tersebut disita barang bukti mobil Toyota Avanza BK 1371 KW, pakaian dan atribut polisi yang dipakai saat melakukan aksi perampokan, dan sepedamotor Yamaha RX King BK

6815 EM milik korban. Saat ini keempat tersangka masih menjalani pemeriksaan. Belum ada keterangan polisi mengenai penangkapan keempat perampok yang mengaku polisi tersebut. Kapolsek Medan Labuhan Kompol Sugeng Riyadi dan Kanit Reskrim AKP Oktavinus saat dihubungi melalui HP tidak dapat dikonfirmasi. (h03)

PPP Mau Wagubsu Dari Parpol Pendukung M E D A N ( Wa s p a d a ) : Nama Fadli Nurzal ma-suk sebagai salah satu kandidat yang diusung sebagai calon Wakil Gubernur Sumatera Utara (Cawagubsu). Saat dikonfirmasi Waspada, Ketua PPP Sumut ini tidak membantah kabar tersebut. Namun, secara pribadi, Fadli Nurzal mengaku tidak terlalu mengejar jabatan itu, apalagi sampai melakukan intrik-intrik politik. ‘’Itu cenderung tidak amanah,’’ katan y a k e p a d a Wa s p a d a d i Medan, Rabu (24/8). Bagi PPP, kata Fadli, bersedia menduduki jabatan tersebut bila diinginkan oleh Parpol pendukung Syampurno lainnya. Bila mayoritas Parpol pendukung menginginkan kader lain, PPP akan ikhlas. Namun, menurut Fadli, sebaiknya yang menjadi Wagubsu, bila waktunya masih memungkinkan adalah salah

seorang kader dari 11 Parpol pendukung Syampurno. Karena hal itu akan membuat citacita serta penjabaran visi-misi Syampurno menjadi terjaga. “Karena kita (11 Parpol) mendukung Syampurno kan karena memiliki kesamaan pandangan dan idealisme,’’ kata Fadli. Menurut Fadli, setiap

orang berpeluang dicalonkan sebagai Wagubsu dengan beberapa syarat. Misalnya, bila waktu masih memungkinkan, serta melalui proses pemilihan yang dilakukan 11 Parpol pendukung pasangan Syamsul Arifin-Gatot Pujo Nugroho (Syampurno). Lanjut ke hal A2 kol 2

SKB Moratorium PNS Ditandatangani JAKARTA (Antara): Surat keputusan bersama penundaan sementara rekrutmen pegawai negeri sipil (moratorium PNS) ditandatangani seusai rapat di Kantor Wakil Presiden, Jakarta, Rabu (24/8). SKB tersebut ditandatangani oleh tiga menteri, yaitu Menteri Keuangan Agus

Martowardojo, Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi EE Mangindaan dan Menteri Dalam Negeri Gamawan Fauzi. Penandatanganan SKB ini sempat tertunda karena dirasa belum sempurna.

JAKARTA (Antara): Aparat Polda Metro Jaya menangkap Sugiyanto dan Sutikno, sindikat spesialis pembiusan yang sasarannya penumpang pesawat yang tiba di Bandara Internasional Soekarno-Hatta, Tangerang, Banten. “Pelaku mengincar penumpang pesawat yang akan keluar dari Bandara Soekarno-Hatta,” kata Kepala Bidang Humas Polda Metro Jaya, Komisaris Besar Polisi Baharudin Djafar, di Jakarta, Rabu (24/8). Djafar mengatakan tersangka berpura-pura menjadi penumpang yang menawarkan pulang bersama kepada penumpang pesawat yang menjadi calon korban. Direktur Reserse Kriminal Umum Polda Metro Jaya, Komisaris Besar Polisi Gatot Edy Pramono, menuturkan Sugiyanto dan Sutikno merupakan satu sindikat. Gatot menjelaskan awalnya Sutikno menawarkan pulang bersama dengan penumpang lain menggunakan Lanjut ke hal A2 kol 3

Waspada/Muhammad H. Ishak

PEDAGANG BANDEL: Meski telah disebarkan seruan bersama oleh pihak Muspika Idi Rayeuk, Kabupaten Aceh Timur, namun para pedagang musiman di bulan Ramadhan tetap membuka dan berjualan di sejumlah jalan utama di pusat Kota Idi sebelum pukul 16:00. Bahkan, banyak pedagang mulai berdagang dalam segala bentuk penganan berbuka sejak pukul 11:00. Kondisi itu telah dilakukan sejak awal Ramadhan, padahal Satpol-PP/WH serta Tim Terpadu dari Muspika Idi Rayeuk, telah melakukan penertiban dan ultimatum sebanyak tiga kali selama Ramadhan 1432 H. Tampak seorang IRT berjalan disisi penjual makanan dan minuman musiman di Kota Idi, Rabu 24/8).

Hasil Bahtsul Masail Para Ulama

Kopi Luwak Halal Bila Disamak

REDELONG (Waspada): Biji kopi luwak (biji kopi yang diambil dari kotoran musang) halal untuk dikonsumsi asalkan setelah melalui proses penyucian. Penegasan tentang kehalalan kopi luwak diputuskan melalui Forum Bahtsul Masail (pembahasan masalah) yang digelar, Selasa (23/8) di Kab. Bener Meriah. Forum Bahtsul Masail yang dilaksanakan di Masjid Bale Atu, Kec. Bukit, Bener Meriah, diikuti ratusan peserta, terdiri dari kalangan ulama, imam kampung, kepala kampung serta pelaku usaha di daerah itu. Kegiatan yang difasilitasi Majelis Permusyawaratan Ulama (MPU) Bener Meriah itu dilakukan untuk menjawab masih adanya perbedaan pandangan serta pro kontra mengenai hukum mengonsumsi kopi luwak. “Kopi luwak tergolong dalam mutanajjis. Artinya, barang yang asalnya suci terkena najis. Dan, apabila disucikan dan dibersihkan barang tersebut akan kembali suci serta halal untuk dikonsumsi,” kata Ketua MPU Bener Meriah Tgk Syarqawi Abdus Samad, Rabu (24/8). Menurut Tgk Syarqawi Abdus Samad, Forum Bahtsul Masail memutuskan kopi luwak halal untuk dikonsumsi Lanjut ke hal A2 kol 1

Lanjut ke hal A2 kol 6

Ada-ada Saja

Mogok Kerja Karena Banyak Hantu PARA pekerja yang ditugasi merenovasi sebuah bangunan museum di Napoli, Italia, mogok dan berhenti bekerja karena mengaku di tempat itu ada banyak hantu. Museum Arkeologi Nasional, kini telah mengundang paranormal dari seluruh dunia untuk memecahkan misteri tersebut. Para pekerja bangunan yang bermalam di tempat itu mengaku mendengar suarasuara jeritan mencekam, dan Lanjut ke hal A2 kol 5

“Sesungguhnya telah kami turunkan Alquran pada kamu pada malam kemuliaan. Tahukah kamu apa malam kemuliaan itu? Malam kemuliaan itu lebih baik dari seribu bulan. Pada malam itu turun malaikat-malaikat dan Jibril dengan izin Allah mereka untuk mengatur segala urusan. Malam itu penuh kesejahteraan sampai terbit fajar.” (Al Qadar ayat 1-5)

Banda Aceh & Sekitarnya Kamis, 25 Ramadhan 1432 H Berbuka : 18.52 Wib Imsak : 05.07 Wib

Serampang - Hati-hati dengan Polisi, eh cop dengan perampok - He.... he....he....


Berita Utama

A2 Garuda Bantah Rekrut Pramugari Korea Tanpa Busana

WASPADA Kamis 25 Agustus 2011

TAHLILAN 40 HARI

Aceh Korban Broker Karbon

JAKARTA (Antara): PT Garuda Indonesia Tbk membantah tuduhan bahwa dalam rekrutmen pramugari di Korea ada pelamar yang diminta tampil tanpa busana. “Sama sekali tidak benar bahwa ada pelamar yang diminta tampil tanpa busana saat wawancara rekrutmen pramugari di Korea,” kata Kepala Komunikasi Perusahaan PT Garuda Tbk Pujobroto saat dihubungi di Jakarta, Rabu (24/8). Sebelumnya, The Korea Herald yang pertama memberitakan informasi rekrutmen tersebut. Isi berita kemudian diberitakan ulang oleh media Singapura The Straits Times, Rabu (24/8). Menurut laporan media tersebut, para pelamar diminta tampil tanpa busana saat wawancara dengan Garuda Indonesia di Korea Selatan. Para wanita muda tersebut diminta agar melepaskan pakaian kecuali celana dalam untuk sesi yang disebut ‘tes kesehatan’.

Gula Pasir Naik ....

Rp13.000 per kg. Sementara harga gula di pasar tradisional yang memakai sistem kemasan kiloan sebelumnya Rp10.200 naik menjadi Rp1.700 per kg. Beberapa pedagang memperkirakan kemungkingan naiknya harga gula pasir ini seiring berakhirnya pasar murah yang digelar dihampir seluruh pelosok daerah kelurahan.Sebenarnya, pasar murah sangat ampuh menekan kenaikan gula serta kebutuhan pokok lainnya di pasaran. Humas Perum Badan Urusan Logistik (Bulog) Divre Sumut Rusli, membenarkan, pengendalian harga di pasaran dapat ditekan dengan menggelar pasar murah, serta operasi pasar (OP). Hal ini dapat dibuktikan terhadap beras yang setiap dilakukan pasar murah atau OP harga di pasaran langsung stabil. Impor Minim Sementara penyebab lain tidak akan terkendalinya harga karena minimnya distribusi. Selama puasa ini tidak ada gula impor masuk ke Sumatera Utara. Kekosongan ini ditimpali dengan masuknya belasan ribu ton gula pasir produksi pabrik gula nasional. Data bongkar muat barang dari daftar kunjungan kapal yang dikeluarkan Pusat Pelayanan Satu Atap (PPSA) di

Kopi Luwak ....

berdasarkan referensi atau dalil dari Kitab Al Muhadzab, Kitab Al Bujayromi, Kitab Al Syarwani, Al Bajuri, Al Majmuk dan beberapa kitab lainnya. Apalagi, kopi kotoran musang ini masih bisa tumbuh jika ditanam kembali. “Kalau tidak melalui proses penyucian, hukum mengkonsumsi kopi luwak ini haram,” kata Ketua MPU Bener Meriah ini. Persoalan mengenai hukum mengkonsumsi biji kopi dari kotoran musang (kopi luwak) masih menjadi polemik di sejumlah kalangan. Untuk itu, tambah Tgk Syarqawi Abdus Samad, persoalan tersebut patut untuk ditanggapi oleh para ulama, tokoh masyarakat maupun pelaku usaha di Bener Meriah dengan cara menggelar Forum Bahtsul Masail. “Bener Meriah, merupakan sentra produksi kopi. Dan, kopi luwak menjadi salah satu produksi dari kabupaten ini. Melalui forum ini diperjelas tentang hukum kopi luwak itu,” paparnya. (cb04)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. b6, Bxc5. 2. Bd8+, Bc8. 3. Bf7-f8, BxBd8. 4. BxB+mat.

Jawaban TTS: TTS Topik

S U A K L B E N A R M H A H U T A E M R B A O B A K A A S H A U M

Santapan Ramadhan

R G A J A I A R A H M A G U N U A M A H M I U T I K H T I S A R A B U L A H L F I R

N N A H A A T L A N G L E R A S A K A S I B A B L I D A U S

Jawaban Sudoku: 9 2 3 8 5 1 6 4 7

4 7 8 3 2 6 5 1 9

6 1 5 7 4 9 8 3 2

1 9 4 2 8 5 7 6 3

2 5 7 6 3 4 9 8 1

3 8 6 9 1 7 2 5 4

7 4 2 5 6 3 1 9 8

5 3 9 1 7 8 4 2 6

8 6 1 4 9 2 3 7 5

Pelabuhan Belawan, sebelum maupun memasuki Ramadhan, tidak ada gula impor masuk di pintu gerbang ekonomi Sumut itu. Walau gula pasir dari luar negeri tidak masuk, namun kebutuhan gula pasir di Sumatera Utara dapat terpenuhi dengan lancarnya distribusi dari antar pulau yang merupakan hasil produksi pabrik gula nasional. Humas PT Pelabuhan Indonesia I Cabang Belawan Azmi Jauhari menjelaskan, gula pasir yang masuk ke Pelabuhan Belawan sebahagian besar diperoleh dari Pelabuhan Panjang Lampung, termasuk daerah yang paling besar memproduksi gula, selebihnya gula dari Jawa. “Berdasarkan data, jumlah gula produksi pabrik gula nasional di Lampung yang telah masuk ke Pelabuhan Belawan selama Ramadhan mencapai 18.000 ton. Sementara gula impor nihil,” katanya. Humas Perum Badan Urusan Logistik (Bulog) Divre Sumut Rusli menyebutkan, gula pasir impor masuk ke Pelabuhan Belawan, apabila kran impor mendapat izin dari pemeritah, sama dengan beras. Tidak setiap saat ada impor karena sesuai kebijaksanaan pemerintah pengimporan gula dan beras dibatasi dan dikendalikan. Demikian juga dengan pelaksanaannya, kalau ada keluar izin impor, yang dibenarkan menanganinya adalah importer yang dihunjuk diantara PTPN I-IX dan Badan Usaha Milik Negara. ( m35)

400 Orang Tewas ....

Pemberontak mengatakan mereka sekara ng menguasai hampir seluruh Tripoli, namun tembak menembak sporadis masih terdengar Rabu dan kaum loyalis Khadafi menembaki pemberontak yang menguasai kompleks kediaman pemimpin Libya itu sehari sebelumnya. Jalanan kota masih terlihat sepi Rabu, dengan taburan puing-puing peninggalan perang bertaburan di mana-mana, dan para pejuang pemberontak berjaga-jaga di pos-pos pemeriksaan dalam jarak beberapa ratus meter. Sementara itu, para pemimpin pemberontak, melakukan langkah awal usaha pembentukan pemerintah baru di Tripoli. Selama perang saudara enam bulan di Libya, para pemimpin oposisi telah mengukuhkan pemerintahan sementara mereka, Dewan Transisi Nasional di Benghazi, Libya Timur, yang jatuh ke tangan mereka tak lama setelah meletusnya perlawananan terhadap Khadafi Februari lalu. Kaum pemberontak berjuang melawan loyalis di beberapa tempat di kawasan selatan dan tengah ibukota, ter-

MUI: Pemerintah Harus Berikan Upah Penyalur Zakat JAKARTA (Antara): Sekretaris Komisi Fatwa Majelis Ulama Indonesia (MUI), Dr. H. M Asrorun Niam menilai, seharusnya para penyalur zakat (amil) mendapat upah dari pemerintah agar ‘amil tidak mengambil keuntungan dari zakat tersebut. Menurut Asrorun, saat peluncuran buku Himpunan Fatwa Zakat MUI di Jakarta, Rabu (24/8)mengatakan, perlu adanya pengawasan dan audit syariah mengenai keuangan, pengelolaan, dan pendistri-

busian zakat, supaya penyampaian kepada orang yang menerima zakat (mustahik) dapat disalurkan dengan tepat. Dijelaskan Asrorun, jika pemerintah tidak memberikan upah untuk amil, maka amil tersebut dapat memperoleh honor dari bagian zakat yang dikelolanya dengan sewajarnya. “Mengenai besarnya upah, tidak dapat diukur dengan persentase, namun bayarannya itu sebesar posisinya amil pada saat dia mengelola

zakat,” tambah. Selain adanya audit dan pengawasan yang diperuntukan buat amil, lanjut dia, amil itu sendiri harus bisa memberikan panduan mengenai zakat kepada masyarakat dan buku Himpunan Fatwa Zakat MUI ini dapat dijadikan rujukannya. Dikatakannya, amil memegang kunci yg sangat sentral dalam mendayagunakan dana zakat dalam menyalurkan ke mustahik guna menjadi rakyat yang sejahtera.

Dua Anggota ....

taksi dari Bandara SoekarnoHatta menuju keluar Jakarta. Tersangka mengajak istirahat calon korban di tempat jualan jamu di kawasan Rawasari, Jakarta Pusat. “Saat itu, tersangka menawarkan jamu dicampur air mineral yang sudah campur obat tidur Sanax,” ujar Gatot. Kemudian tersangka bersama korban melanjutkan perjalanan menggunakan kendaraan sewa yang meru-pakan sindikat lainnya. Setelah korbannya tidak

sadarkan diri, para tersangka mengambil barang berharga milik korban. Petugas menangkap para tersangka berdasarkan laporan salah satu korban yang melaporkan kejadian pembiusan tersebut kepada Polda Metro Jaya. Tersangka Sugiyanto dan Sutikno di diciduk petugas di Batu Ampar Kecamatan Kramatjati, Jakarta Timur, Selasa dinihari (23/8). Tersangka dikenakan Pasal 365 Kitab Undang-undang Hukum Pidana (KUHP) ten-

tang pencurian dengan kekerasan Gatot menyatakan petugas masih mengejar beberapa pelaku lainnya yang masih buron, yakni Katro, Alex, Roni dan Heri Subagyo. Selain menangkap tersangka, polisi menyita barang bukti berupa dua unit komputer jinjing, satu jam tangan, 14 kartu Anjungan Tunai Mandiri, 4 Surat Tanda Nomor Ke n d a ra a n ( S T N K ) , d u a bungkus jamu, satu unit koper dan beberapa lembar mata uang asing.

masuk satu garis front baru ke timur bandara internasional. Dua bom meledak mengguncang Tripoli ketika satu jet NATO melintas di atasnya. Di mana keberadaan Khadafi masih belum diketahui namun dia telah mengeluarkan satu pesan perlawanan pada Selasa malam. Dalam pidato yang disiarkan, dia mengatakan dio telah membuat ‘taktik mundur’ dari Bab Al-Aziziyah, namun laporan Wyre Davies dari BBC dari kota itu menyebutkan, tidak seorang pun yang percaya versi kejadian yang disebutkan Khadafi. Para penembak mahir proKhadafi muncul di Bab alAziziya setelah kompleks kediaman Khadafi itu jatuh ke tangan pemberontak dan pertempuran untuk menguasai sepenuhnya kawasan itu masih terus berlangsung. Khadafi diperkirakan masih memiliki satu kekuatan di dua kota lainnya,Sirte dan Sebha, 650 km di selatan ibukota, di mana pertempuran meletus pekan ini. Takkan berakhir Pemimpin Dewan Peralihan Nasional (NTC), Mustafa Abdel Jalil mengatakan kepada stasiun televisi France-24 bah-

wa pasukannya berhasil menahan kira-kira 600 petempur pro-Khadafi. “Tapi pertempuran takkan berakhir sampai pemimpin Libya itu sendiri mendekam di penjara,” katanya. “Menurut keterangan yang kami terima, jumlah orang yang tewas selama operasi yang telah berlangsung selama tiga hari ialah lebih dari 400, dan 2.000 orang lagi cedera,” kata Abdel Jalil tanpa menjelaskan apakah dia berbicara mengenai kedua pihak, demikian laporan pers Rabu. “Kami menangkap sebanyak 600 prajurit Khadafi,” katanya. Abdel Jalil mengatakan dia menduga Khadafi sendiri telah meninggalkan Tripoli dan menyatakan ia tak cukup berani untuk tetap tinggal dan bertempur. “Saya harap dia akan ditangkap hidup-hidup dan diadili sehingga dunia dapat mengetahui kejahatannya,” tambahnya. Jurubicara militer gerilyawan Kol. Ahmed Bani Selasa mengatakan NTC berencana memindahkan markasnya dari Benghazi ke Tripoli dalam waktu dua hari, demikian l a p o ra n s t a s i u n t e l e v i s i Aljazeera.

Gerilyawan pada hari yang sama merebut kompleks Khadafi, Bab Al-Aziziya di Tripoli, setelah pertempuran sengit dan menjarah satu kendaraan lapis baja di dalam barak luas tersebut. Tetapi keberadaan Khadafi dan putra-putranya masih tak didiketahui. Namun Gaddafi berbicara melalui stasiun televisi lokal, dan mengatakan Bab Al-Aziziya hancur dibom oleh NATO. Pembelotan Para diplomat Libya dan mahasiswanya melempari potret Khadafi sambil meneriakkan “Permainan sudah usai!” dan bendera pemberontak berkibar di Kedubes Libya di Manila Rabu, sebagai bagian dari pembelotan terhadap pemimpin yang telah berkuasa selama 40 tahun itu. Ketika pemberontak menyerbu Tripoli dan kekuasaan Khadafi serta pengaruhnya amblas di luar negeri, Konsul Libya Faraj Zarroug di Manila mengatakan 85 persen dari 165 misi diplomatik negeri itu di seluruh dunia telah mengakui pemerintah sementara pemberontak, Dewan Transisi Nasional. (dari berbagai sumber/m10)

PPP Mau ....

hal ini 11 partai politik. Peraturan menyebutkan calon wakil kepala daerah dipilih dari Parpol pendukung atau pihak yang diusulkan Parpol pendukung. ‘’Artinya boleh kader dari 11 Parpol pendukung Syampurno atau dari luar Parpol pendukung yang disepakati 11 Parpol pendukung,’’ katanya. Sementara itu, peluang Ketua Partai Demokrat (PD) Sumut H.T.Milwan, menduduki jabatan Wagubsu masih besar. Informasi yang diperoleh Waspada, jabatan Wagubsu

masih berpeluang diisi karena waktunya masih memungkinkan. Aturan menyebutkan, jabatan wakil kepala daerah masih bisa diisi 18 bulan sebelum berakhir masa periode. Pasca batalnya penyampaian hak interpelasi oleh DPRDSU beberapa hari lalu, menimbulkan kembali isu jabatan Wagubsu. Disebutsebut Partai Demokrat telah melakukan deal politik dengan Plt. Gubsu Gatot Pujo Nugroho, untuk menempatkan HT. Milwan, sebagai Wagubsu. (m12)

Kabura Maqtan ....

kamu kerjakan (QS. AshShaff:2-3). Selain itu, Allah juga mengutuk cendekiawan yang menyembunyikan ilmu Alquran, tidak mau mengajarkan kepada orang lain. “Sesungguhnya orang-orang yang menyembunyikan apa yang telah Kami turunkan, berupa keterangan-keterngan yang jelas dan petunjuk, setelah Kami menerangkannya kepada manusia dalam al-Kitab, mereka dilaknati Allah dan dilaknati pula oleh semua makhluk yang dapat melaknatinya. (QS. al-Baqarah:159). Menurut ramalan Rasulullah dalam beberapa haditsnya,

akan datang suatu masa akan lahir manusia-manusia yang hanya pandai berkata tetapi tidak berbuat, banyak ilmunya tetapi tidak mau mengerjakannya. Mereka akan menggunakan agama untuk mencari makan, bukan untuk mengharapkan pahala di sisi Allah. Alangkah meruginya mereka itu, tetapi begitulah yang mereka pilih. Menurut hadits riwayat Abu Dawud dan Ibnu Majah, manusia yang tidak mengamalkan ilmunya, hari akhirat nanti, jangankan masuk surga, bau harum surga saja tidak sempat mereka cium. Nauzubillahi minzalika!

Kalau bicara hari ini, lanjut Fadli, maka waktu untuk mengangkat Wagubsu masih mungkin, karena akhir periode Syampurno hingga Mei 2013. Tapi, proses pemilihan Wagubsu belum dapat dilaksanakan sekarang, karena menunggu keputusah hukum tetap Gubsu non aktif Syamsul Arifin. Proses perekrutan calon Wagubsu selanjutnya, menurut Fadli Nurzal, dilakukan lewat mekanisme Parpol pendukung Syampurno. Dalam bersedekah. Ia menyuruh istri dan gadis orang berjilbab, padahal istrinya dan gadisnya tidak berjilbab. Mungkin juga ia seorang pejabat yang menyuruh masyarakat supaya berhemat, ternyata dia menghambur-hamburkan uang secara mubazir. Kepada orang-orang yang tidak sesuai perkataan dengan perbuatan inilah Allah menyeru: Hai orang-orang yang beriman, mengapa kamu mengatakan apa yang tidak kamu perbuat? Kabura maqtan indallah (Amat besar kemurkaan di sisi Allah), bahwa kamu mengatakan apa yang tidak

Ada-ada Saja ....

suhu udara yang mendadak dingin dan bahkan beberapa pekerja melihat penampakan hantu. Arsitek yang bertanggung jawab atas pekerjaan itu, Oreste Albareno, tak yakin dengan pengaduan para pekerjanya dan ingin meyakinkan mereka dengan bermalam di museum itu. Namun akhirnya dia mendapat pengalaman sama seperti anak buahnya dan yakin bahwa tempat itu memang angker, harian Italia Il Mattino melaporkan. “Saya berhasil mengambil

Waspada/Surya Efendi

Karyawan dan karyawati Waspada Group melaksanakan tahlilan 40 hari wafatnya Almarhumah Hj Adianiwati di lantai 3 Bumi Warta Harian Waspada di Medan, Rabu (24/8). Almarhumah merupakan isteri dari Komisaris Utama Harian Waspada, Tribuana Said, MDS. Usai tahlilan dan doa, acara juga diisi dengan ceramah Ramadhan dan berbuka puasa bersama.

JAKARTA (Waspada): Aceh menjadi korban broker karbon Hutan Ulu Masen. Pihak Carbon Conservation menjadikan hutan Ulu Masen sebagai agunannya dalam jual beli saham perusahaan broker. “Ini keterlaluan. Pihak yang mendapatkan manfaat dari inisiatif perdangan karbon Hutan Ulu Masen adalah sang broker Carbon Conservation,” kata Direktur Eksekutif Greenomics Indonesia Elfian Effendi kepada Waspada di Jakarta, Rabu (24/8). Untuk itu, tambah putra Aceh ini perjanjian antara Pemerintah Aceh dengan Carbon Conservation (broker karbon) tentang perdagangan karbon Hutan Ulu Masen harus dibuka ke publik. Dengan demikian, terangnya, publik bisa memiliki pemahaman tentang mekanisme perdagangan karbon, dan bagaimana masyarakat dapat menerima manfaatnya. “Yang terjadi sekarang, broker karbon sudah mendapat fresh money (uang tunai) dan jutaan lembar saham dari perusahaan tambang emas asal Kanada yang beroperasi di hutan Aceh,” kata Elfian. Elfian mengingatkan melalui perdagangan karbon yang meliputi beberapa kabupaten di Aceh, warga sekitar Ulu Masen tidak memperoleh apa-apa. Pemuda enerjik ini mengutip pernyataan Gubernur Aceh Irwandi Yusuf, Aceh tidak memperoleh faedah dari perjualan karbon. Justru sang broker yang meneguk kepentingan bisnis. “Ini contoh konkrit masyarakat dan hutan Aceh dikorbankan menjadi objek dari kepentingan bisnis karbon di Ulu Masen,” ungkapnya serius. Sebelumnya di Banda Aceh, Gubernur Aceh Irwandi mengaku tidak percaya janji yang diberikan negaranegara maju terkait pemberian dana dari kompensasi perdagangan karbon dunia. Katanya, negara maju memainkan isu kompensasi perdagangan karbon melalui upaya pelestarian kawasan hutan termasuk di Aceh. (cmh)

SKB Moratorium ....

daerah. Jadi tidak kaku langsung nol, tidak begitu,” katanya. Ia menambahkan, moratorium juga dikecualikan bagi daerah yang memiliki belanja pegawai di bawah 50 persen dari APBD. Namun menurut dia, juga tetap selektif. Dalam SKB tersebut, menurut dia juga disebutkan agar seluruh instansi dan lembaga pemerintah serta seluruh pemerintah daerah mengajukan rencana strategis susunan formasi PNS selama lima tahun ke depan. Rencana strategis tersebut harus diajukan sebelum 31 Desember 2011. Ia juga menambahkan akan adanya pengaturan terhadap PNS agar tidak terjadi penumpukan di suatu daerah. Menurut dia, selama ini terjadi penumpukan di daerah tertentu dan kekurangan di daerah lainnya. Menurut dia, moratorium ini, juga harus menjadi satu kesatuan dengan reformasi birokrasi yang digulirkan. “Intinya juga bahwa moratorium tidak terlepas dari program reformasi birokrasi dimana area perubahan yang menonjol dalam reformasi birokrasi adalah pertama kelembagaan atau struktur organisasi,” katanya. Juru Bicara Wakil Presiden Yopie Hidayat seusai rapat

moratorium mengatakan, seluruh lembaga dan instanasi pemerintah termasuk pemerintah daerah diberi waktu empat bulan untuk melakukan kajian dan analisa kebutuhan formasi PNS yang akan dimasukan dalam rencana strategis. Menurut dia, pemerintah juga akan menyiapkan sanksi bagi mereka yang tidak mengajukan rencana strategis hingga 31 Desember 2011. “Kalau mereka tidak mau melakukan itu, tahun depan mereka tidak dikasih budget, tidak dikasih anggaran untuk menerima pegawai. Ada sanksinya itu. Jadi mereka tidak punya hak untuk mengajukan, gitu. Jadi itu harus selesai. Jadi ini serius, tidak main-main,” katanya. Sementara itu, jumlah PNS di Indonesia saat ini sebesar 4,7 juta jiwa atau 1,98 persen dari rasio penduduk masih moderat dibandingkan dengan negara-negara maju lainnya seperti Singapura yang rasionya mencapai di atas dua persen. Sedangkan PNS yang pensiun pada 2011 ini, menurut Menteri Pemberdayaagunaan Aparatur Negara dan Reformasi Birokrasi EE Mangindaan, sebesar 107 ribu dan pada 2012 sebesar 114 ribu PNS yang akan pensiun.

Kemenlu ....

menlu, Michael Tene, di DPR RI, Jakarta, Rabu (24/8). 19 Orang WNI tersebut, lanjut Tene, rata-rata adalah pembantu rumah tangga (PRT). Mereka tidak berada di satu lokasi, tetapi tersebar di seluruh Libya. Sebetulnya saat 19 WNI masih di Libya, ternyata Kemenlu sudah menginstruksikan seluruh jajaran Dubes di Lbiya, untuk meninggalkan negara tersebut. Kedubes RI yang berkedudukan di Tripoli dikosongkan. “Kedubes sudah dikosongkan sejak Maret. Setelah semua warga yang tercatat di evakuasi,” kata Tene. Meski begitu, koordinasi

tetap dilakukan melalui perwakilan RI di Tunis. “Sejak maret upaya membantu di koordinasikan lewat Dubes Tunis,” kata Tene. Menurut Tene, Kemenlu tetap tidak bisa memaksa 19 WNI tersebut untuk pulang jika mereka tidak mau. “Kita tidak memaksa kalau ingin bertahan. Mereka yang tahu kondisi,” kata Tene. Ada berbagai alasan para WNI yang menolak pulang ke tanah air. “Ada bermacammacam, saat dievakuasi Mei lalu tidak ingin dipulangkan. Merasa aman, ada kerjaan. Ada yang tidak diketahui kedutaan,” kata Tene. (vn)

gambar dengan ponsel saya - gambar menunjukkan penampakan seorang gadis kecil, tapi tidak ada seorang pun gadis kecil di lokasi,” ujar Oreste yang dilansir Orange, Rabu (24/8). “Tidak ada pekerja yang membawa putrinya ke lokasi - tempat ini mer upakan kawasan aman yang terkunci hingga tak mungkin ada anak kecil yang bisa menyusup masuk,” tambahnya. Para ahli dalam hal ini rencanya akan tiba September mendatang untuk menyelidiki kebenaran masalah tersebut. (orange/rzl)

Sebelumnya dia telah menjalani hukuman dalam kasus narkoba. Muhammad Juman Nasution alias Mamad melarikan diri dari sel Kejari Padangsidimpuan setelah selesai mengikuti sidang. Beberapa saat setelah kejadian, Kajari Padangsidimpuan Fredi Azhari Siregar,

Dua Tahanan ....

S H , M . Hu m s u d a h c o b a dikonfirmasi wartawan sejak pukul 16:00 hingga pukul 18:30, namun tidak berhasil. Menurut ajudannya Hary Sairya A.Md, Kajari masih sibuk. “Kajari masih sibuk, masih banyak surat-surat yang diperiksa dan ditandatangani,” ujar Hary. (a27)

Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi EE Mangindaan mengatakan, moratorium PNS kali ini tidak bersifat kaku. Untuk jabatan-jabatan tertentu dan formasi yang dirasa sangat dibutuhkan akan ada pengecualian. “Yang kami maksudkan penundaan sementara adalah kami menunda sementara ini tetapi tidak kaku, tapi selektif. Masih ada beberapa jabatan yang tetap kami akomodir dalam rekrutmen tahun ini dan berikutnya,” katanya. Ia mencontohkan beberapa formasi yang memiliki pengecualian misalnya tenaga guru dan dosen. Banyaknya guru dan dosen yang akan pensiun membuatnya harus diisi kembali. Begitupula dengan tenaga kesehatan di unit pelayanan terpadu daerah. Selain itu juga jabatan khusus dan mendesak seperti di lembaga pemasyarakatan sipir. “Jangan sampai tidak ada sipir dan sebagainya,” katanya. Begitu pula jabatan untuk keselamatan masyarakat, pelayanan publik. “Misalnya di terminal kami buka secara terbatas dan terpenting yang tidak ada orangnya kami adakan dan sebagainya itu jadi pengecualian di pusat dan di Luar Negeri Inggris, William Hague mengungkapkan kekuatan rezim memiliki senjata pemusnah massal, juga rudal Scud B yang bisa meledakkan sebuah kota. Situasi Libya juga menjadi perhatian Indonesia. Sebab, masih ada WNI yang masih ada di negara itu. Kementerian Luar Negeri menyatakan masih ada 19 WNI di Libya yang belum bisa dihubungi atau kehilangan kontak. “Ada 19, terpantau dari Tunis. Komunikasi terakhir hari Senin, kondisi baik. Selasa komunikasi terputus, telefon tidak bisa. Tapi akan terus dicoba,” ujar Juru Bicara Ke-


Berita Utama

A2

WASPADA Kamis 25 Agustus 2011

Hasil Bahtsul Masail Para Ulama

Kopi Luwak Halal Bila Disamak

Waspada/Surya Efendi

TAHLILAN 40 HARI: Karyawan dan karyawati Waspada Group melaksanakan tahlilan 40 hari wafatnya almarhumah Hj Adianiwati di lantai 3 Bumi Warta Harian Waspada di Medan, Rabu (24/8). Almarhumah merupakan istri dari Komisaris Utama Harian Waspada, Tribuana Said, MDS. Usai tahlilan dan doa, acara juga diisi dengan ceramah Ramadhan dan berbuka puasa bersama.

6 TKI Tewas Disambar Petir PETALING JAYA, Malaysia (Waspada): Enam pria TKI (Tenaga Kerja Indonesia ) tewas akibat disambar petir di tempat kerja mereka di Malaysia. Lima lainnya mengalami luka bakar, dan kini dirawat di rumah sakit di Negara jiran tersebut. Pada insiden berbeda yang terjadi Senin kemarin, awalnya petir menewaskan tiga TKI tersebut, dua lainnya menderita luka bakar. The Star melaporkan Selasa (23/8), petir menyambar saat mereka tengah bekerja ketika hujan deras mengguyur perkebunan di Sungai Choh dekat Kuala Kubu Baru. Korban tewas adalah Adik Rohmat, 28, Roni Dwi Jatmiko, 28, dan Sugiran 29. Dua orang lainnya yang dilaporkan berumur 25 dan 40 tahun masih belum diketahui identitasnya. Menurut Kepala Polisi Hulu Selangor, Inspektur Norel Azmi Yahya Affandi, korban cedera dibawa ke klinik terdekat untuk mendapat perawatan akibat luka bakar yang mereka derita.Pada hari yang sama dan waktu yang hampir bersamaan, tiga TKI lainnya juga tewas tersambar petir di Jalan Reaktor, Persiaran Kerjaya, Glenmarie. Dalam insiden ini tiga orang juga mengalami luka-luka. Keenam korban yang berusia 20an dan 40 tahun, dilaporkan sedang berteduh di dalam pondok peristirahatan mereka saat petir tiba-tiba menyambar. Korban tewas diketahui bernama Hazarin, 29, Surady, 31, dan Mohd Nasir 46. Sedangkan korban luka diketahui bernama Dashir, 28, Rossey, 25, dan dan istri Surady bernama Som, 20.Saksi mata mengatakan, para korban sebelumnya diperintahkan oleh mandor mereka untuk berhenti bekerja dan berteduh saat hujan lebat mulai turun. (ts/rzl) “Saya berhasil mengambil gambar dengan ponsel saya - gambar menunjukkan penampakan seorang gadis kecil, tapi tidak ada seorang pun gadis ke-cil di lokasi,” ujar Oreste yang dilansir Orange, Rabu (24/8). “Tidak ada pekerja yang membawa putrinya ke lokasi - tempat ini merupakan kawasan aman yang terkunci hingga tak mungkin ada anak kecil yang bisa menyusup masuk,” tambahnya. Para ahli dalam hal ini rencanya akan tiba September mendatang untuk menyelidiki kebenaran masalah tersebut. (orange/rzl)

Ada-ada Saja ... mengaku mendengar suarasuara jeritan mencekam, dan suhu udara yang mendadak dingin dan bahkan beberapa pekerja melihat penampakan hantu. Arsitek yang bertanggung jawab atas pekerjaan itu, Oreste Albareno, tak yakin dengan pengaduan para pekerjanya dan ingin meyakinkan mereka dengan bermalam di museum itu. Namun akhirnya dia mendapat pengalaman sama seperti anak buahnya dan yakin bahwa tempat itu memang angker, harian Italia Il Mattino melaporkan.

tersebut dengan tetap berpijak pada dalil-dalil syar’i. Yakni titik temu antara faham rukyat dan hisab dengan konsep kriteria visibilitas hilal (imkan rukyat),” katanya. Berdasarkan tawaran titik temu tersebut, semua pihak diajak untuk membangun sistem kalender Hijriyah yang mapan yang setara dengan sistem kalender Masehi dan penyatuan di tingkat nasional akan menjadi contoh untuk memperluas di tingkat regional dan global, ujarnya.

Idul Fitri Berpotensi ... namun kepastiannya tetap menunggu sidang itsbat yang dihadiri seluruh pimpinan ormas Islam. Ia mengakui, perbedaan penentuan hari raya di Indonesia berpotensi menimbulkan keresahan di masyarakat, karena itu perlu ada solusi untuk menyatukan kriteria penentuan 1 Syawal. Menurut dia, penyelesaian perbedaan penentuan hari raya bukan dengan memperdebatkan perbedaan dalil tentang rukyat (pengamatan) dan hisab (perhitungan), karena terbukti hal itu tidak pernah membuat tercapainya kesepakatan. “Astronomi bisa digunakan untuk menemukan titik temu

4 Perampok Ngaku ...

Ketika melintas di Jalan Marelan Raya, tiba- tiba mobil Daihatsu Xenia warna hitam memepet korban. Kemudian keempat tersangka yang mengaku polisi menudJawaban Problem Catur, uh korban memiliki narkoba jenis sabu-sabu. TTS Dan Sudoku Tersangka E yang saat itu mengenakan pakaian polisi Dari Halaman Sport. bersama kawanannya meminta surat-surat kendaraan korban. Jawaban Problem Catur: Namun, korban tidak bisa menunjukkannya. Selanjutnya 1. b6, Bxc5. tersangka melarikan kendaraan korban. “Jadi yang mem2. Bd8+, Bc8. buat korban yakin adalah penampilan E yang menge3. Bf7-f8, BxBd8. nakan pakaian polisi,” kata 4. BxB+mat. Oktavianus. Menurut Oktavianus, ke empat tersangka gol alias dijebJawaban TTS: loskan ke sel tahanan Mapolsek Medan Labuhan. Mereka TTS Topik Santapan Ramadhan diancam melanggar pasal 365 S U R G A J A N N A H KUHP. (h03) A K L B E N A R M H A H U T A E M R B A O B A K A A S H A U M

I A R A H M A G U N U A M A H M I U T I K H T I S A R A B U L A H L F I R

A T N G E R A S A K A S

Jawaban Sudoku: 9 2 3 8 5 1 6 4 7

4 7 8 3 2 6 5 1 9

6 1 5 7 4 9 8 3 2

1 9 4 2 8 5 7 6 3

2 5 7 6 3 4 9 8 1

3 8 6 9 1 7 2 5 4

7 4 2 5 6 3 1 9 8

5 3 9 1 7 8 4 2 6

8 6 1 4 9 2 3 7 5

Kecuali Guru Dan Dosen JAKARTA (Antara): Surat keputusan bersama penundaan sementara rekrutmen pegawai negeri sipil (moratorium PNS) ditandatangani seusai rapat di Kantor Wakil Presiden, Jakarta, Rabu (24/8). SKB tersebut ditandatangani oleh tiga menteri, yaitu Menteri Keuangan Agus Martowardojo, Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi EE Mangindaan dan Menteri Dalam Negeri Gamawan Fauzi. Penandatanganan SKB ini sempat tertunda karena dirasa belum sempurna. Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi EE Mangindaan mengatakan, moratorium PNS kali ini tidak bersifat kaku. Untuk jabatan-jabatan tertentu dan formasi yang dirasa sangat dibutuhkan akan ada pengecualian. “Yang kami maksudkan penundaan sementara adalah kami menunda sementara ini tetapi tidak kaku, tapi selektif. Masih ada beberapa jabatan yang tetap kami akomodir dalam rekrutmen tahun ini dan berikutnya,” katanya. Ia mencontohkan beberapa formasi yang memiliki pengecualian misalnya tenaga guru dan dosen. Banyaknya guru dan dosen yang akan pensiun membuatnya harus diisi kembali. Begitupula dengan tenaga kesehatan di unit pelayanan terpadu daerah. Selain itu juga jabatan khusus dan mendesak seperti di lembaga pemasyarakatan sipir. “Jangan sampai tidak ada sipir dan sebagainya,” katanya. Begitu pula jabatan untuk keselamatan masyarakat, pelayanan publik. “Misalnya di ter-

Chandra Dan Ade ... Umum Partai Demokrat. Namun, Syafii enggan mengomentari lebih lanjut isi percakapan dan nama si pengancam. “Tanya ketua (Komite Etik) supaya enak. Pokoknya, saya tahu informasi itu. Saya sudah dengar atau tidak, itu tidak penting,” kata Syafii. Nazaruddin Diperiksa Hari Ini KPK telah menjadwalkan

PPP Tengok ... mengejar jabatan itu, apalagi sampai melakukan intrik-intrik politik. ‘’Itu cenderung tidak amanah,’’ katanya kepada Waspada di Medan, Rabu (24/8). Bagi PPP, kata Fadly, bersedia menduduki jabatan tersebut bila diinginkan oleh Parpol pendukung Syampurno lainnya. Bila mayoritas Parpol pendukung menginginkan kader lain, PPP akan ikhlas. Namun, menurut Fadly, sebaiknya yang menjadi Wagubsu, bila waktunya masih memungkinkan adalah salah seorang kader dari 11 Parpol pendukung Syampurno. Karena hal itu akan membuat cita-cita serta penjabaran visi-misi Syampurno menjadi terjaga. ‘’Karena kita (11 Parpol) mendukung

A L LENTERA RAMADHAN ... A Mendengar pertanyaan tersebut, Nabi MuL hammad SAW diam saja. Ternyata Sang Rasul

I B L I D A U S A B

SKB Moratorium PNS Ditandatangani

SAW waktu itu sedang menerima wahyu. Beberapa saat kemudian, Sang Nabi SAW mengusap keringat yang membasahi tubuh beliau karena menerima wahyu. Tak lama kemudian, Rasulullah SAW bertanya, “Dimanakah orang yang bertanya tadi?” Lalu Rasulullah SAW bersabda tanpa menunggu jawaban dari orang yang bertanya tadi, “Kenikmatan tidak mengakibatkan kejelekan, seperti halnya rerumputan dan sayur mayur tidak mematikan atau membuat sakit hewan yang memakannya. Hewan yang memakannya hanya akan membesar kedua sisi lambungnya, kemudian ia menghadap ke arah matahari, buang air besar dan kecil, dan merumput lagi. Sesungguhnya harta itu hijau dan manis. Dan harta terbaik seorang Muslim adalah yang sebagiannya diberikan kepada orang miskin, anak yatim, dan orang-orang yang sedang menempuh perjalanan. Barang siapa yang mengambil harta orang lain bagaikan orang makan namun tidak pernah kenyang, harta yang diambil di luar haknya itu pada hari kiamat kelak akan menjadi saksi yang memberatkannya.” Demikian hadis yang bersumber dari Abu

REDELONG (Waspada) : Biji kopi luwak (biji kopi yang diambil dari kotoran musang) halal untuk dikonsumsi asalkan setelah melalui proses penyucian. Penegasan tentang kehalalan kopi luwak diputuskan melalui Forum Bahtsul Masail (pembahasan masalah) yang digelar, Selasa (23/8) di Kab. Bener Meriah. Forum Bahtsul Masail yang dilaksanakan di Masjid Bale Atu, Kec. Bukit, Bener Meriah, diikuti ratusan peserta, terdiri dari ka-

langan ulama, imam kampung, kepala kampung serta pelaku usaha di daerah itu. Kegiatan yang difasilitasi Majelis Permusyawaratan Ulama (MPU) Bener Meriah itu dilakukan untuk menjawab masih adanya perbedaan pandangan serta pro dan kontra mengenai hukum mengonsumsi kopi luwak. “Kopi luwak tergolong dalam mutanajjis. Artinya, barang yang asalnya suci terkena najis. Dan, apabila disucikan dan dibersihkan barang

Tripoli Berdarah ...

Nasional (NTC), Mustafa Abdel Jalil mengatakan kepada stasiun televisi France-24, pasukannya berhasil menahan kira-kira 600 petempur pro-Khadafi. “Tapi pertempuran takkan berakhir sampai pemimpin Libya itu sendiri mendekam di penjara,” katanya. Jurubicara militer gerilyawan Kol. Ahmed Bani Selasa mengatakan NTC berencana memindahkan markasnya dari Benghazi ke Tripoli dalam waktu dua hari, demikian laporan stasiun televisi Aljazeera. (dari berbagai sumber/m10)

JAKARTA (Waspada): Ratna Fairus alias Iyut Bing Slamet divonis satu tahun penjara atas kasus penggunaan narkoba. Vonis atas mantan penyanyi cilik era 70-an ini lebih ringan ketimbang tuntutan jaksa, yakni 7 tahun penjara dan denda Rp1 miliar. “Divonis satu tahun hukuman penjara. Iyut akan menjalani sisa masa tahanan 7 bulan lagi,” kata pengacara Iyut, PriyagusWidodo di Pengadilan Negeri Jakarta Barat, Rabu (24/8). Menurut Priyagus, ringannya vonis karena perbedaan pasal yang diajukan. “Perbedaan pengenaan pasal. JPU kemarin pasal 112 ayat 1, minimal 5 tahun,” ujar Priyagus.(vvn)

untuk berjuang ‘sampai menang atau mati syahid,’ pada saat pejuang pemberontak berusaha untuk mengakhiri serangan yang berpencar-pencar oleh para pendukung Khadafi di ibukota yang tegang. Pemberontak mengatakan mereka sekarang menguasai hampir seluruh Tripoli, dan tembak menembak sporadis masih terdengar Rabu, dan kaum loyalis Khadafi menembaki pemberontak yang menguasai kompleks kediaman pemimpin Libya itu sehari sebelumnya. Sementara itu, para pemimpin pemberontak, melakukan langkah awal usaha pembentukan pemerintah baru di Tripoli. Selama perang saudara enam bulan di Libya, para pemimpin oposisi telah mengukuhkan pemerintahan sementara mereka, Dewan Transisi Nasional di Benghazi, Libya Timur, yang jatuh ke tangan mereka tak lama setelah meletusnya perlawananan terhadap Khadafi Februari lalu. Keberadaan Khadafi masih belum diketahui, namun dia telah mengeluarkan satu pesan perlawanan pada Selasa malam. Dalam pidato yang disiarkan, dia mengatakan dio telah membuat ‘taktik mundur’ dari Bab Al-Aziziyah, namun laporan Wyre Davies dari BBC dari kota itu menyebutkan, tidak seorang pun yang percaya versi kejadian yang disebutkan Khadafi. Khadafi diperkirakan masih memiliki satu kekuatan di dua kota lainnya,Sirte dan Sebha, 650 km di selatan ibukota, di mana pertempuran meletus pekan ini. Takkan berakhir Pemimpin Dewan Peralihan

pemeriksaan terhadap tersangka kasus dugaan penerimaan suap proyek pembangunan wisma atlet di Jakabaring, Palembang, Muhammad Nazaruddin pada Kamis (25/8). “Nazaruddin rencananya Kamis diperiksa,” kata Juru Bicara KPK, Johan Budi, di Jakarta, Rabu (24/8). Mantan Bendahara Umum Partai Demokrat ini dalam dua kali pemeriksaan dengan Komite Etik KPK tidak mau ber-

bicara banyak. Hal ini karena pimpinan lembaga antikorupsi belum mengabulkan permintaannya untuk dapat berpindah tempat tahanan dari Rutan Mako Brimob Kelapa Dua Depok ke Rutan Cipinang Jakarta Timur. Menurut Johan, tidak masalah jika nantinya Nazaruddin tetap bungkam saat menjalani pemeriksaan oleh penyidik. Pemeriksaan di KPK akan tetap dilanjutkan. (kps/ant)

Syampurno kan karena memiliki kesamaan pandangan dan idealisme,’’ kata Fadly. Menurut Fadly, setiap orang berpeluang dicalonkan sebagai Wagubsu dengan beberapa syarat. Misalnya, bila waktu masih memungkinkan, serta melalui proses pemilihan yang dilakukan 11 Parpol pendukung pasangan Syamsul Arifin-Gatot Pujonugroho (Syampurno). Kalau bicara hari ini, lanjut Fadly, maka waktu untuk mengangkat Wagubsu masih mungkin, karena akhir periode Syampurno hingga Mei 2013. Tapi, proses pemilihanWagubsu belum dapat dilaksanakan sekarang, karena menunggu keputusah hukum tetap Gubsu nonaktif Syamsul Arifin. Proses perekrutan calon Wagubsu selanjutnya, menurut Fadly Nurzal, dilakukan le-

wat mekanisme Parpol pendukung Syampurno. Dalam hal ini 11 partai politik. Peraturan menyebutkan calon wakil kepala daerah dipilih dari Parpol pendukung atau pihak yang diusulkan Parpol pendukung. ‘’Artinya boleh kader dari 11 Parpol pendukung Syampurno atau dari luar Parpol pendukung yang disepakati 11 Parpol pendukung,’’ katanya. Sementara itu, peluang Ketua Partai Demokrat (PD) Sumut H.T.Milwan, menduduki jabatan Wagubsu masih besar. Informasi yang diperoleh Waspada, jabatan Wagubsu masih berpeluang diisi karena waktunya masih memungkinkan. Aturan menyebutkan, jabatan wakil kepala daerah masih bisa diisi 18 bulan sebelum berakhir masa periode. Pasca batalnya penyampaian hak interpelasi oleh DPRDSU beberapa hari lalu, menimbulkan kembali isu jabatan Wagubsu. Disebut-sebut Partai Demokrat telah melakukan deal politik dengan Plt. Gubsu Gatot Pujonugroho untuk menempatkan HT. Milwan sebagai Wagubsu. (m12)

minal kami buka secara terbatas dan terpenting yang tidak ada orangnya kami adakan dan sebagainya itu jadi pengecualian di pusat dan di daerah. Jadi tidak kaku langsung nol, tidak begitu,” katanya. Ia menambahkan, moratorium juga dikecualikan bagi daerah yang memiliki belanja pegawai di bawah 50 persen dari APBD. Namun menurut dia, juga tetap selektif. Dalam SKB tersebut, menurut dia juga disebutkan agar seluruh instansi dan lembaga pemerintah serta seluruh pemerintah daerah mengajukan rencana strategis susunan formasi PNS selama lima tahun ke depan. Rencana strategis tersebut harus diajukan sebelum 31 Desember 2011.

Iyut Bing Slamet Divonis 1 Tahun

Sa’id Al-Khudhri diriwayatkan Bukhari. Hadis di atas menjelaskan betapa khawatirnya Rasulullah SAW akan umatnya yang “cinta gila” akan harta sehingga memperolehnya dengan berbagai cara seperti korupsi, manipulasi, ribawi dan cara-cara tercela lainnya. Kekhawatiran Nabi Muhammad SAW tersebut menegaskan kembali akan ayat-ayat Alquran yang tidak sedikit mengingatkan hancurnya manusiamanusia terdahulu karena kecintaan berlebihan terhadap harta yang diamanahkan kepada manusia sehingga ia kikir dan dengki. Tentang hal tersebut bisa dilacak pada surah Muhammad (47) ayat 37 dan 38, juga pada surah Al-Fajr (89) ayat ke-20. Rasulullah SAW menerangkan pula bahwa harta terbaik bagi umat Islam bukanlah harta mewah. Harta terbaik seorang Muslim adalah harta yang disalurkan manusia yang sangat memerlukan. Islam tidak membiarkan golongan manusia lemah dibiarkan tanpa kepedulian. Alquran, di antaranya dalam surah Al-Haqqah (69) ayat 33 dan 34, Al-Fajar (89) ayat 17-18 dan Al-Ma’un (107) ayat 1-2, menerangkan ancaman neraka karena keengganan memuliakan anak yatim dan keengganan mengajak untuk memberikan nafkah pada golongan lemah (dhu’afa). Marilah kita mulai di bulan Ramadhan ini menjadikan harta kita menjadi harta terbaik! Semoga bermanfaat! Wallahu Al-‘Alim.

Dua Tahanan Kejari ... Hardisanto melarikan diri saat akan menjalani persidangan di Pengadilan Negeri Padangsidimpuan dengan registrasi perkara No.580/Pid.sus/ 2011/PN/Psp. Petugas mengetahuinya sudah tidak berada di sel, saat hendak dibawa ke persidangan. Tahanan lain yang melarikan diri adalah Muhammad Juman Nasution alias Mamad, warga Desa Hasahatan Jae, Kec. Barumun, Kab. Padanglawas. Dia tersangka kasus pencurian dengan pemberatan dengan perkara No.433/Pid.B/2011/PN Padangsidimpuan. Sebelumnya dia telah menjalani hukuman dalam kasus narkoba. Muhammad Juman Nasution alias Mamad melarikan diri dari sel Kejari Padangsidimpuan setelah selesai mengikuti sidang. Sedangkan, ajudan Kajari Hary Sairya A.Md mengatakan, Kajari masih sibuk.’’ Banyak surat yang diperiksa dan ditandatangani,” ujar Hary. (a27)

Doa Untuk ... masalah Husin Sitorus. Mereka harus minta bantuan pemerintah pusat khususnya Presiden untuk melakukan diplomasi dengan Raja Diraja Malaysia,” tegas Kusmayadi. Katanya, mengurusi persoalan antar negara ini bukan levelnya pemerintah kabupaten. Sementara itu, anak tertua Husin Sitorus, Siti Aisyah mengatakan, seluruh keluarga malam ini (Rabu malam) melakukan doa bersama di rumah Husin. (c05)

Garga Gula Pasir ... tarif tidak sama karena disesuaikan jenisnya serta merek yang tertera dalam kemasannya. Harga yang dipasarkan di swalayan saat ini mulai bergerak naik antara Rp200 hingga Rp500 per kemasan, yakni dari harga Rp12.500 naik menjadi Rp13.000 per kemasan. Sementara harga gula di pasar tradisional yang memakai sistem kemasan kiloan sebelumnya Rp10.200 naik menjadi Rp1.700 per kg. Beberapa pedagang memperkirakan kemungkingan naiknya harga gula pasir ini seiring berakhirnya pasar murah yang digelar dihampir seluruh pelosok daerah kelurahan. Sebenarnya, pasar murah sangat ampuh menekan kenaikan harga gula serta kebutuhan pokok lainnya di pasaran. Humas Perum Badan Urusan Logistik (Bulog) Divre Sumut Rusli, membenarkan, pengendalian harga di pasaran dapat ditekan dengan menggelar pasar murah, serta operasi pasar (OP). Hal ini dapat dibuktikan terhadap beras yang setiap dilakukan pasar murah atau OP harga di pasaran langsung stabil. Impor Minim Sementara penyebab lain

tersebut akan kembali suci serta halal untuk dikonsumsi,” kata Ketua MPU Bener Meriah Tgk Syarqawi Abdus Samad, Rabu (24/8). Menurut Tgk Syarqawi Abdus Samad, Forum Bahtsul Masail memutuskan kopi luwak halal untuk dikonsumsi berdasarkan referensi atau dalil dari Kitab Al Muhadzab, Kitab Al Bujayromi, Kitab Al Syarwani, Al Bajuri, Al Majmuk dan beberapa kitab lainnya. Apalagi, kopi kotoran musang ini masih bisa tumbuh jika ditanam kembali. “Kalau tidak melalui proses penyucian, hukum mengkonsumsi kopi luwak ini haram,” kata Ketua MPU Bener

Meriah ini. Persoalan mengenai hukum mengkonsumsi biji kopi dari kotoran musang (kopi luwak) masih menjadi polemik di sejumlah kalangan. Untuk itu, tambah Tgk Syarqawi Abdus Samad, persoalan tersebut patut untuk ditanggapi oleh para ulama, tokoh masyarakat maupun pelaku usaha di Bener Meriah dengan cara menggelar Forum Bahtsul Masail. “Bener Meriah, merupakan sentra produksi kopi. Dan, kopi luwak menjadi salah satu produksi dari kabupaten ini. Melalui forum ini diperjelas tentang hukum kopi luwak itu,” paparnya. (cb04)

Garuda Bantah Rekrut Pramugari Korea Tanpa Busana JAKARTA (Antara): PT Garuda Indonesia Tbk membantah tuduhan bahwa dalam rekrutmen pramugari di Korea ada pelamar yang diminta tampil tanpa busana. “Sama sekali tidak benar bahwa ada pelamar yang diminta tampil tanpa busana saat wawancara rekrutmen pramugari di Korea,” kata Kepala Komunikasi Perusahaan PT Garuda Tbk Pujobroto saat dihubungi di Jakarta, Rabu (24/8). Sebelumnya, The Korea Herald yang pertama memberitakan informasi rekrutmen tersebut. Isi berita kemudian diberitakan ulang oleh media Singapura The Straits Times, Rabu (24/8) Menurut laporan media tersebut, para pelamar diminta tampil tanpa busana saat wawancara dengan Garuda Indonesia di Korea Selatan. Para wanita muda tersebut diminta agar melepaskan pakaian kecuali celana dalam untuk sesi yang disebut ‘tes kesehatan’. Berita itu menyebutkan, dalam tes tersebut, seorang dokter pria meraba payudara para gadis muda tersebut untuk memastikan apakah ada yang menggunakan implan di dalamnya. Bagi Garuda Indonesia, penggunaan implan berbahaya bagi penerbangan. Menurut Pujobroto, pihaknya melaksanakan pemeriksaan kesehatan terhadap para calon awak kabin sesuai standar pemeriksaan yang berlaku dalam industri penerbangan. Disamping itu, kata Pujobroto, dokter melakukan pemeriksaan sesuai dengan standar profesi dan terikat sumpah dokter. “Pada saat melakukan pemeriksaan, dokter juga selalu didampingi oleh staf lokal, wanita (warga negara Korea), yang membantu menyampaikan penjelasan berkaitan dengan pemeriksaan kesehatan itu,” katanya. Pujobroto menyebut, proses seleksi terhadap 27 calon pramugari di Korea telah dilaksanakan Garuda pada tanggal 27 Juli 2011. “Lima peserta diantaranya tidak berhasil lulus untuk mengikuti tahapan seleksi selanjutnya,” kata Pujobroto.

Kemudian tersangka bersama korban melanjutkan perjalanan menggunakan kendaraan sewa yang merupakan sindikat lainnya. Setelah korbannya tidak sadarkan diri, para tersangka mengambil barang berharga milik korban. Petugas menangkap para tersangka berdasarkan laporan salah satu korban yang melaporkan kejadian pembiusan tersebut kepada Polda Metro Jaya. Tersangka Sugiyanto dan Sutikno di diciduk petugas di Batu Ampar Kecamatan Kra-

matjati, Jakarta Timur, Selasa dinihari (23/8). Tersangka dikenakan Pasal 365 Kitab Undang-undang Hukum Pidana (KUHP) tentang pencurian dengan kekerasan Gatot menyatakan petugas masih mengejar beberapa pelaku lainnya yang masih buron, yakni Katro, Alex, Roni dan Heri Subagyo. Selain menangkap tersangka, polisi menyita barang bukti berupa dua unit komputer jinjing, satu jam tangan, 14 kartu Anjungan Tunai Mandiri, 4 Surat Tanda Nomor Kendaraan (STNK), dua bungkus jamu, satu unit koper dan beberapa lembar mata uang asing.

tidak akan terkendalinya harga karena minimnya distribusi. Selama puasa ini tidak ada gula impor masuk ke Sumatera Utara. Kekosongan ini ditimpali dengan masuknya belasan ribu ton gula pasir produksi pabrik gula nasional. Data bongkar muat barang dari daftar kunjungan kapal yang dikeluarkan Pusat Pelayanan Satu Atap (PPSA) di Pelabuhan Belawan, sebelum maupun memasuki Ramadhan, tidak ada gula impor masuk di pintu gerbang ekonomi Sumut itu. Walau gula pasir dari luar negeri tidak masuk, namun kebutuhan gula pasir di Sumatera Utara dapat terpenuhi dengan lancarnya distribusi dari antar pulau yang merupakan hasil produksi pabrik gula nasional. Humas PT Pelabuhan Indonesia I Cabang Belawan Azmi Jauhari menjelaskan, gula pasir yang masuk ke Pelabuhan Bela-

wan sebahagian besar diperoleh dari Pelabuhan Panjang Lampung, termasuk daerah yang paling besar memproduksi gula, selebihnya gula dari Jawa. “Berdasarkan data, jumlah gula produksi pabrik gula nasional di Lampung yang telah masuk ke Pelabuhan Belawan selama Ramadhan mencapai 18.000 ton. Sementara gula impor nihil,” katanya. Humas Perum Badan Urusan Logistik (Bulog) Divre Sumut Rusli menyebutkan, gula pasir impor masuk ke Pelabuhan Belawan, apabila kran impor mendapat izin dari pemeritah, sama dengan beras. Tidak setiap saat ada impor karena sesuai kebijaksanaan pemerintah pengimporan gula dan beras dibatasi dan dikendalikan. Demikian juga dengan pelaksanaannya, kalau ada keluar izin impor, yang dibenarkan menanganinya adalah importer yang dihunjuk diantara PTPN I-IX dan Badan Usaha Milik Negara. (m35)

Sindikat Pembius ...


Nusantara

WASPADA Kamis 25 Agustus 2011

IKPP Produksi Kertas Halal Untuk Alquran TANGERANG (Waspada): Menggunakan suatu produk harus jelas kehalalannya. Dalam proses pembuatannya pun harus demikian. Terlebih dalam mencetak Alquran, kitab suci umat Islam. Karenanya, PT Indah Kiat Pulp and Paper (IKPP) mengembangkan kertas halal khusus untuk Alquran, yang sudah mendapat sertifikat halal dari Majelis Ulama Indonesia (MUI). “Kita ingin memberikan rasa aman bagi konsumen akan ke-

halalan produk yang digunakan. Mulai dari bahan baku, proses pembuatan, hingga hasil akhir. Ini juga sebagai nilai tambah bagi perusahaan,” kata Lusiana Gomulia, Head Mill PT Indah Kiat Pulp and Paper (IKPP), Tangerang, usai mendapat kunjungan dari Menteri Tenaga Kerja dan Transmigrasi, Muhaimin Iskandar, Selasa (23/8). Untuk sertifikat halal untuk perusahaan kertas, baru IKPP yang mendapatkannya. Tak heran, banyak yang memesan

kertas dari perusahaan ini untuk dicetak menjadi Alquran. Sebagian besar dari Timur Tengah. Wakil Perdana Menteri Iran pun sempat berkunjung ke pabrik ini untuk melihat secara dekat proses pembuatan kertas untuk Alquran ini. “Kertas itu diproses mengedepankan kehalalan, mulai dari sisi bahan baku, proses produksi, penyimpanan, hingga distribusi. Saya bersyukur sertifikat halal ini menjadi nilai tambah karena banyak yang percaya pada

Capim KPK Tak Perlu Diputuskan Di Setgab JAKARTA (Waspada): Wakil Ketua DPR RI Priyo Budi Santoso mengatakan, calon Pimpinan KPK tidak wajib dibicarakan di Sekretariat Gabungan (Setgab) Koalisi Partai Politik. Bahkan dia tidak setuju apabila Setgab ikut-ikutan memutuskan nama. “Setgab jangan untuk memutuskan nama. Saya menyarankan tidak perlu. Nggak enak sama PDIP dan par-

tai lain,” ujar Priyo Budi Santoso, di Gedung DPR RI Jakarta, Rabu (24/8). Politisi Partai Golkar ini juga tidak ingin ada mencoba mendikte DPR dalam memilih pimpinan KPK. “Kalangan siapapun jangan mendikte DPR. Kami akan pilih orang yang terbaik, kami bukan tukang stempel pemerintah, kalau nggak baik kami kembalikan,” tandasnya.Yang menjadi

permasalahan saat ini, menurutnya, dimana pemerintah hanya mengirimkan 8 nama, padahal menurut UU nya harus 10 nama. “Karena Pak Busyro sudah lolos maka harusnya 9 nama. Masalah ini nanti akan dicarikan jalan keluar, katanya. Diakuinya, hasil pansel ini sudah cukup baik dimana delapan nama yang diusulkan memiliki reputasi yang baik.(aya)

produk kertas kami,” imbuh Luciana. Dijelaskan, kertas khusus Alquran ini memiliki tekstur dan kualitas cetak khusus, sehingga dalam penggunaan normal dapat bertahan hingga 100 tahun. Diproduksi menggunakan sinar Tech atau lebih dikenal dengan Quran Paper (QPP). Menakertrans pun menyempatkan diri menyerahkan wakaf Alquran kepada Pondok Pesantren Madinatunnajah, Serpong, Tangerang. Hendra Gunawan, Managing Director Corporate Affairs Communication APP menambahkan, sepanjang bulan suci Ramadhan 1432 H ini, APP melalui sejumlah Mill yakni IKPP Tangerang Mill dan Serang Mill, serta PT Tjiwi Kimia Tbk, melaksanakan Wakaf Quran kepada sejumlah pondok pesantren, majelis taklim dan lembaga pendidikan lainnya di seluruh Indonesia. Hingga saat ini, APP telah mewakafkan sekitar 20 ribu Al Quran. (dianw)

A3 Sudah 188.652 Calhaj Lunasi BPIH JAK ARTA ( Waspada): Hingga hari keenam (Selasa, 23/8), sudah 188.652 orang melunasi biaya penyelenggaraan ibadah haji (BPIH) 1432 H/ 2011. Rinciannya 172.538 orang berasal dari jamaah haji regular dan 16.114 orang jamaah BPIH Khusus (ONH Plus). Untuk setoran BPIH hari keenam, kurs dolar AS yang tertera di Bank Indonesia Rp8.587. Untuk tahun ini, pemerintah Arab Saudi memberika kuota kepada Indonesia sebanyak 211.000 orang Direktur Pelayanan Haji, Zainal Abidin Supi mengatakan itu kepada waratwan di kantor Kementerian Agama RI, Lapangan Banteng, Jakarta, Rabu (24/8). Zainal mengatakan pada hari keenam, provinsi Jawa Barat merupakan daerah terbanyak yang telah melunasi BPIH dengan jumlah 33.949 orang, menyusul Jawa Timur 29.464

orang dan Jawa Tengah 26.905 orang. Sementara calon jamaah haji dari Sumatera Utara yang telah melunasi BPIH sebanyak 7.214 orang, provinsi Aceh 3.370 orang. Zainal Abidin Supi juga meminta, agar jamaah reguler yang telah menyetor lunas BPIH, selambat-lambatnya 3 hari telah mendaftar ulang ke kantor Kementerian Agama Kabupaten/ Kota tempat domisili. Data yang diperoleh dari Sistem Komputerisasi Haji Terpadu (Siskohat) Kemenag, jumlah calhaj yang telah melunasi BPIH berdasarkan provinsi adalah: Aceh 3.370 orang, Sumut 7.214 orang, Sumbar 3.872 orang, Riau 4.521 orang, Jambi 2.345 orang, Sumsel 5.669 orang, Bengkulu 1.438 orang, Lampung 5.512 orang. Kemudian DKI Jakarta 6.184 orang, Jabar 33.949 orang, Jateng 26.905 orang, DI Yogya 2.871 orang, Jatim 29.464 orang, Bali 549 orang, NTB 4.030 orang,

NTT 575 orang. Kalbar 2.143 orang, Kalteng 1.190 orang, Kalsel 3.496 orang, Kaltim 2.486 orang, Sulut 567 orang, Sulteng 1.538 orang, Sulsel 6.566 orang, Sultra 1.490 orang, Maluku 470 orang, Papua 852 orang, Bangka Belitung 844 orang, Banten 7.819 orang, Gorontalo 753 orang, Malut 975, Kepri 904 orang, Sulbar 1.258 orang, Papua Barat 574 orang, dan TPHD/TKHD 145 orang. Tranportasi Lokal Di tempat terpisah, Sekretaris Ditjen PHU Cepi Supriatna mengatakan, untuk tahun ini tak ada lagi pelayanan transportasi lokal dari pondokan ke Masjidil Haram PP (pulangpergi), lantaran hampir seluruh jamaah Indonesia menempati pondokan ring I, yaitu jaraknya paling jauh 2,5 km. Terkecuali untuk kawasan Mahbaz Jin, karena jaraknya memang di atas 2,5 km. Jamaah haji Indonesia pada musim haji 2011 ini sekitar 82 persen menempati ring I.

Hanya sedikit yang berada di luar ring I. Cepi Supriatna menjelaskan, pelaksanaan ibadah haji tahun ini berbeda. Perbedaan yang menonjol tadi adalah hampir semua jamaah haji Indonesia berada di ring I yang berarti pula memudahkan jamaah untuk lebih banyak melaksanakan kegiatan ibadah di Masjidil Haram. “Karena jamaah haji Indonesia hampir seluruhnya berada di ring I, maka pihak Panitia Penyelenggara Ibadah Haji (PPIH), meniadakan pengembalian dana sisa selisih uang pemondokan, karena harga sewa pondokan rata-rata berada di atas plafon. “Riil sewa pondokan rata 3.700 riyal, sementara plafon sewa hanya 3.400 riyal” tuturnya sambil menambahkan, tahun lalu persoalan dana pengembalian selisih sewa pemondokan kerap menjadi masalah dan menuai protes dari jamaah. (j06)

Serikat Pekerja Sepakat Penyelenggara Jaminan Sosial Tidak Dilebur JAKARTA (Waspada): Serikat pekerja/buruh sepakat agar empat BUMN penyelenggara jaminan sosial tidak dilebur, tetapi mereka masih berbeda pendapat tentang status badan hukum apakah BUMN atau badan publik yang menjalankan prinsip-prinsip waliamanah atau tetap BUMN. Hal itu terungkap saat Seminar Nasional Quovadis Badan Penyelenggara Jaminan Sosial yang diselenggarakan Lingkar Diskusi Ketenagakerjaan di Jakarta, Selasa (23/8). Seminar menampilkan empat pembicara tokoh serikat pekerja/buruh. Mereka adalah Ketum Federasi Serikat Pekerja BUMN Abdul Latief Algaff, Ketua Serikat Pekerja Nasional

Joko Heryono, Ketua Majelis Pengawas Organisasi KSBSI Rekson Silaban dan Sekjen Komite Aksi Jaminan Sosial (KAJS) Said Iqbal. Dalam paparan dan tanya jawab, muncul persamaan pandangan empat BUMN penyelenggara jaminan sosial, yakni PT Jamsostek, PT Taspen, PT Asabri dan PT Askes tidak perlu dilebur. Abdul Latief menilai empat BUMN tersebut sudah melaksanakan tugasnya dengan baik, diawasi dengan ketat oleh lembaga pengawas negara sehingga menjalankan prinsipprinsip terbuka, transparan dan bisa dipertanggungjawabkan. Dia juga menilai keempatnya sudah menjalankan sembilan prinsip penyelenggaraan SJSN,

yakni kegotongroyongan, nirlaba, keterbukaan, kehatiahatian, akuntabilitas, portabilitas, kepesertaan wajib, dana amanat dan semua manfaat kembali kepada peserta. Khusus pada yang terakhir, Latief mengatakan bahwa PT Jamsostek, misalnya, sejak beberapa tahun lalu sudah tidak memberikan deviden kepada pemerintah dan dananya dikembalikan kepada pekerja. Sementara Joko menilai, jika menilik kepada dasar hukum dan peraturan perundangan yang ada maka status badan hukum yang layak untuk menjalan sembilan prinsip tersebut adalah BUMN. Sementara Rekson menilai pembahasan RUU BPJS sudah

menyimpang dari permasalahan utama, yakni program jaminan sosial bukan membahas badan penyelenggaranya. Dampak dari pembahasan badan penyelenggara, maka muncul ide liar untuk melebur empat BUMN yang ada sehingga muncul resistensi dari pekerja yang mengancam penarikan dana di PT Jamsostek jika program perlindungan mereka dialihkan ke badan penyelenggara lain. Said Iqbal pada kesempatan yang sama mengatakan bahwa pihaknya tidak menghendaki empat BUMN yang ada dilebur, tetapi dia menghendaki agar status badan hukumnya diubah menjadi badan publik di bawah presiden. (j04)


A4

Luar Negeri

WASPADA Kamis 25 Agustus 2011

India Berusaha Hentikan Mogok Makan Aktivis Menghebohkan

Militer Israel: Serangan Udara Hantam Kelompok Bersenjata Gaza

NEW DELHI, India (AP): Pemerintah India berusaha Rabu (24/8) untuk menghentikan mogok makan delapan hari yang dilakukan oleh seorang aktivis populer dan menyerukan kepada semua pihak di Parlemen agar memperdebatkan tuntutan aktivis itu agar dibuat UU anti-korupsi yang kuat. Mogok makan Anna Hazare telah menarik dukungan puluhan ribu orang bagi protes yang dilancarkannya di jantung ibukota dan aksinya telah menjadi inspirasi bagi rapat-rapat umum kecil di seluruh India. Aksi itu juga merupakan ujian bagi pemerintah yang dilanda kontroversi setelah serangkaian skandal yang melibatkan pejabat tinggi dari pemerintahan dan partai-partai oposisi utama, dan mengungkapkan miliaran dana dan pendapatan yang hilang. ParapembantuHazaremengadakanputarankeduaperundingan dengan para pejabat pemerintah Rabu. Kiran Bedi, seorang penyelenggara protes, mengatakan tidak ada deal yang dicapai dengan pemerintah. Hazare, 74, menunjukkan dia segera menghentikan mogok makannya jika pemerintah berjanji secara tertulis untuk mendorong para pengawas dengan kekuasaan atas perdana menteri dan pihak yudikatif. Pada saat yang bersamaan, dia menolak untuk membiarkan dokter memberinya makan dengan bantuan alat dan para pembantunya meminta pendukungnya untuk berdoa bagi kesehatannya. Namun dia tampak sehat dan semangat Rabu pagi ketika dia berpidato di depan para pendukungnya selama hampir 20 menit. “Sampai sekarang, pemerintah tidak berkeinginan baik. Jadi saya memutuskan sampai nafas terakhir saya, sampai pemerintah memperhatikan masalah ini, saya tidak akan kembali. Saya tak peduli meski saya harus mati,” katanya. (m10)

JERUSALEM(AP):KekerasandisepanjangperbatasanGaza-Israel makin menghangat Rabu (24/8), dengan serangan udara Israel atas beberapa sasaran militan dan tembakan roket militan ke Israel. Media Israel melaporkan bahwa pasukan keamanan telah menurunkanpasukanbantuankekawasanitu.Satufestivalmusikyangakan diadakan di kota selatan Ashkelon telah dibatalkan, sesuai dengan rekomendasi militer agar tidak mengadakan kumpulan-kumpulan besar massa pada saat situasi tegang seperti sekarang ini, kata militer. Kelompok militan itu langsung diterjang rudal dari jet tempur Israel, sesaat mereka melancarkan serangan roket. Meski diketahu serangan itu mengenai kedua gerilyawan, tidak dijelaskan apakah keduanya dalam keadaan tewas. Sebelumnya, pada serangan udara terpisah Israel dilaporkan mengakibatkan seorang militan tewas. Korban tewas itu berasal dari faksi Jihad Islam dan kematiannya pun sudah dikonfirmasi oleh pejabat keamanan Hamas, demikian diberitakan Rabu. (m10)

Oposisi Syria Berusaha Bersatu

Chavez: Kami Hanya Akui Khadafi CARACAS,Venezuela (AP): Presiden Hugo Chavez mengatakan, Venezuela akan tetap mengakui Moammar Khadafi sebagai pemimpin Libya dan menolak mengakui pemerintah sementara pimpinan pemberontak. Chavez menyampaikan halitudi saat pemberontak Libya berhasil menguasai kompleks kediaman Khadafi di ibukota Libya, Tripoli setelah beberapa jam berlangsung perang sengit. Sementara keberadaan Khadafi masih belum diketahui. “Kami hanya mengakui satu pemerintah: yang dipimpin Moammar Khadafi,” kata Chavez berbicara dalam pidato yang disiarkan televisi. Dia mengecam peran NATO dan pemerintah AS dalam konflik Libya. “Jelas, kita tengah menghadapi kegilaan imperialis,” kata Chavez sambil mengecam gempuran udara yang dilancarkan NATO. Chavez menuding negara-negara di AS dan Eropa memanfaatkan strategi menyulut konflik dalam negeri dengan tujuan merampas kekuasaan dari negara-negara kaya minyak. “Mereka mengadu domba. Mempersenjatai pihak ini dan itu, menggempurnya dengan bom dan lalu kuasai negaranya,” kata Chavez, menggambarkan tujuan pemerintah AS dalam konflik tersebut. “Mereka menjarah negara itu, mereka merampok cadangan internasional dan menguasai minyaknya,” kata Chavez. “Tindakan ini mencabik-cabik hokum internasional dan membawa dunia kembali ke Zaman Batu.”(m23)

Rencana Kuwait Bangun Pelabuhan Sulut Ketegangan Dengan Irak UMM QASR, Irak (AP): Irak dan Kuwait, dua negara yang berbagi satu perbatasan kecil dan sejarah besar saling curiga dan terlibat satu kali perang, kembali tegang. Kali ini mereka bertikai soal rencana Kuwait membangun pelabuhan besar yang menurut Irak mencuri jalur pelayaran negaranya di Teluk. Meski kisruh kali ini kemungkinan tidak akan menjurus ke konflik, kondisi saat ini mirip dengan perang kata yang mendorong invasi Irak terhadap Kuwait tahun 1990 dan menunjukkan hubungan tidak harmonis yang masih ada meski Saddam Hussein telah tiada. “Dengan proyeknya ini, Kuwait sama dengan ingin mengakhiri hubungan antara Irak-Kuwait,” kata Aliyah Nisayef, anggota dewan Irak yang mengumpulkan tandatangan dari anggota parlemen yang menentang rencana pembangunan pelabuhan itu, akan termasuk terbesar dan membayangi usul Irak untuk menarik pelayaran ke pantai Teluknya yang kecil. Satu delegasi Irak baru-baru ini kembali dari Kuwait setelah mengawasi pelabuhan itu dan diperkirakan akan menyampaikan laporankepadaPMNourial-Malikimingguini.Kuwaitmengumumkan rencana tahun 2007, ketika Irak masih dilanda perang sekte, untuk membangun pelabuhan Mubarak al-Kabir yang menelan biaya AS$1,1 miliar di Pulau Bubiyan, salah satu pulau terbesar di Teluk. Namun sampai Kuwait meletakkan batu pertama April lalu, Irak baru menyadari rencana tersebut. Sejak itu berbagai macam tuduhan dan kemarahan ditujukan kepada Kuwait yang dituding mencoba menutup jalur pelayaran Irak dan menghalangi rencana proyek pelabuhan Irak. Menanggapi tuduhan tersebut, Kuwait mengatakan proyek mereka akan menguntungkanseluruhkawasantersebutdanmenuduhkalanganpenentang Irak akan menghadapi resiko lambatnya pemulihan hubungan mereka. Minggu lalu, puluhan pengunjukrasa Irak berkumpul hanya beberapa meter dari perbatasan Kuwait untuk mengecam rencana pembangunan pelabuhan itu. Menteri Dalam Negeri Kuwait, Sheik Ahmad Al-Humoud Al-Sabah, mengingatkan pasukan keamanan ‘tidakakanmentolerir’setiapusahaunjukrasayangmelintasiperbatasan, menurut kantor berita Kuwait. Proyek tersebut termasuk yang terbesar di Teluk dan suatu hari nanti akan menyaingi Abu Dhabi dan Dubai sebagai hub transit antara Eropa, Timur Tengah dan Asia. Otoritas Kuwait mengatakan, pelabuhan itu diharapkan mulai beroperasi tahun 2015 sebagai langkahpertamadalamvisibernilai100miliardolaruntukmenciptakan jaringan zona perdagangan dan gedung-gedung pencakar langit yang dibentuk sedemikian rupa setelah mega proyek Teluk lainnya.(m23)

Jepang Protes Kapal-kapal China Di Perairan Sengketa TOKYO, Jepang (Antara/AFP): Jepang mengajukan protes kepada Beijing setelah dua kapal China memasuki perairan dekat gugusan pulau disengketakan yang dikelola Jepang di Laut China Timur pada Rabu (24/8). Para penjaga pantai Jepang mengatakan, dua kapal patroli perikanan pada pagi itu menerobos ke dalam zona 12-mil laut di sekitar kepulauan yang dianggap Jepang sebagai wilayah perairannya. Kepulauan itu, yang disebut Senkaku di Jepang, Diaoyu di China dan juga diklaim olehTaiwan - telah menjadi sumber sengketa diplomatik pada saat Jepang juga menyuarakan keprihatinan tentang meningkatnya kekuatan angkatan laut China. Wakil Menteri Luar Negeri Jepang Kenichiro Sasae Rabu memanggil Duta Besar China ChengYonghua dan memprotes insiden itu, kata juru bicara pemerintah Tokyo. “Jepang menegaskan tidak ada pertanyaan bahwa Kepulauan Senkaku merupakan bagian integral dari wilayah Jepang, secara historis dan hukum internasional,” kata Kepala Sekretaris Kabinet Jepang Yukio Edano. “Kami menyerukan pihak China untuk bertindak dengan cara yang tepat dan mengambil pandangan yang luas didasarkan pada hubungan Jepang-China,” katanya dalam konferensi pers rutin. Pada September lalu, Beijing memutuskan semua kontak tingkat tinggi dengan Tokyo setelah Jepang menahan seorang kapten kapal nelayan China yang bertabrakan dengan kapal-kapal penjaga pantai patroli Jepang di perairan yang sama. Jepang akhirnya membebaskan kapten itu di bawah tekanan kuat dari China, langkah yang membantu meredakan ketegangan. Pihak penjaga pantai mengatakan, salah satu dari dua kapal patroli China terlihat pada sekitar pukul 06:15 waktu setempat Rabu, sekitar 30 kilometer (19 mil) dari salah satu pulau itu. Penjaga pantai mengatakan bahwa ketika kapal patroli mengeluarkan peringatan kepada kapal China, salah satu dari mereka lewat radio menjawab: “Diaoyu dan pulau-pulau sekitarnya merupakan bagian integral dari wilayah China.

Reuters

PARA pendukung calon presiden Singapura Tony Tan mengenakan topi bersimbol pemilihannya, meneriakkan slogan-slogan dalam satu rapat umum kampanye pemilihan umum di distrik pusat perdagangan di Singapura Rabu (24/8).Singapura menyelenggarakan Pemilu Presiden ke-7 Sabtu depan. Inzet: Tony Tan, salah seorang dari empat calon presiden.

Pertemuan Thailand Dan Kamboja Dimulai Bahas Penarikan Mundur Pasukan Keduanya BANGKOK, Thailand (Waspada): Pertemuan Komite Daerah Perbatasan (RBC) antara Thailand dan Kamboja dimulai Rabu (24/8). Pertemuan ini akan menyoroti isu penarikan mundur pasukan kedua negara di wilayah sekitar kuil Preah Vihear. Pertemuan RBC ke-15 ini diketuai Komandan Pasukan Thailand II Letjend Tawatchai Samutsakhon dan Deputi Kepala Staf Militer Kamboja yang juga menjabat sebagai Komandan Pasukan Thailand IV Letjend Chea Mon. Pertemuan RBC diadakan di Hotel Sima Thani di Kota Nakhon Ratchasima. Pertemuan ini juga dihadiri oleh Deputi Menteri Pertahanan Kamboja Jendral Neang Pha.Demikiansepertidiberitakan Bernama, Rabu. Pertemuan RBC mendiskusikan15isutermasukdiantaranya masalahkeamanandiperbatasan

Thailand dan Kamboja. Disoroti pula masalah penarikan mundur pasukan kedua negara ini di wilayah sekitar kuil Preah Vihear. Pertemuaninijugaakanmencoba untuk membangun kerangkakerjauntukpertemuanKomite Perbatasan Umum (GBC) antara ThailanddanKambojayangakan dijadwalkan di Phnom Penh, Kamboja pada September mendatang. Niat baik antara kedua negara yang tengah bersengketa ini mulai muncul di saat Yingluck Shinawatra terpilih sebagai PerdanaMenteriThailandyangbaru. Pemerintah Kamboja pun saat

itu melayangkan surat ke Pemerintah Thailand yang berisikan undangan pertemuan GBC. PM Kamboja Hun Sen menegaskan, isu perbatasan ini tidak akan diangkat lagi dalam forum ASEAN selanjutnya. Konflik perbatasan antara Thailand dan Kamboja semakin memperburuk hubungan kedua negara ini. Beberapa bulan yang lalu, kedua negara ini tengah menambah jumlah pasukannya di wilayah perbatasan. Kamboja ajak Thailand Perundingan itu jauh sebelumnyatelahdiusulkanKamboja. Menhan KambojaTea Banh telah mengajak Menhan ThailandYuthasak pertengahan bulan ini untuk menghadiri forum Komisi Perbatasan Umum (GBC) untuk menyelesaikanmasalahsengketa. Yuthasakmenyatakan,dirinya

mendengar kabar, surat undangan untuk pertemuan GBC dilayangkan oleh Menhan KambojatersebutkeDepartemenPertahanan Thailand, demikian dilansir The Nation ketika itu Thailand dan juga Kamboja sebelumnyasudahsepakatuntuk melanjutkan dialognya terkait masalah penarikan mundur pasukannya yang ada di sekitar kuil Preah Vihear. Keinginan dua negara yang bersengketa ini untuk bertemu dinilai menjadi awal dari proses perdamaian Thailand dan Kamboja. PM Kamboja Hun Sen juga menegaskan, apa yang terjadi beberapa tahun belakangan ini antara Thailand dan Kamboja sudah usai, dan saat ini kedua negara tersebut akan mengadakan pertemuan bilateral demi mengendurkan ketegangan. (okz)

Kebakaran Rumah Di Australia, 11 Orang Tewas BRISBANE, Australia (AP): Satu kebakaran terjadi di sebuah rumah di timur Australia yang menewaskan 11 orang, termasuk delapan anak-anak, dari dua keluarga,demikianmenurutsejumlah pejabat. Tiga orang berhasil meloloskan diri dari kebakaran itu, yang terjadi di satu rumah bertingkat dua sekitar tengah malam di LoganCity,selatanBrisbane,ibukota negara bagian Queensland, kata perwira polisi Noel Powers. Kebakaran itu dimulai pada bagian bawah rumah bertingkat tersebut, namun sebab terjadinya kebakaran tersebut masih belum diketahui.

Delapan anak-anak dan remaja termasuk di antara korban tewas, dengan korban paling muda adalah seoang anak usia 3 tahun,kataPMQueenslandAnna Bligh. “Saya telah berbicara dengan salah seorang pria pagi ini yang istri dan lima anak-anak belum ditemukan,” kata Bligh. Salah seorang pria yang berhasil meloloskan diri telah dibawa ke rumah sakit untuk menjalani perawatan karena luka bakar pada wajahnya, sementara seorang pria kedua masih berada di lokasi kejadianmeskidiamengalamiluka di bahunya. Seorang pria lainnya tidakterlihatcedera,kataKomisaris

Besar Stephen Hollands. FaiumuTafeaga mengatakan keponakannya Misi Matauaina selamat dengan melompat dari jendelasetelahrekansekamarnya membangunkan dia. Rekan Matauaina dan dua anak-anak mereka, yang berusia 3 dan 6, tidak diketahui di mana berada, kata Tafeaga. Elma Hiddleston, yang mengatakan dia adalah bibi dan sepupu dari korban tewas, menangis di luar bangunan yang hangus itu. “Saya tidak percaya itu benar-benar terjadi,” kata Hiddleston. “Saya yang memelihara mereka. Sebelas orang — jumlah itu terlalu banyak bagi saya.”

Para penyelidik mengangkat mayat pertama dari rumah itu Rabumalam.Satuvanmembawa mayat dua anak berhenti sejenak di jalanan di luar rumah itu agar para keluarga dapat menjenguk mereka. (m10)

BEIRUT,Lebanon(AP):OposisiSyriayangrentantelahmengambil langkah-langkah menuju pembentukan satu dewan nasional, namun perpecahan serius dan saling tak percaya masih membayang di antara para anggotanya sehingga mencegah mereka untuk membentuk satu front persatuan melawan rezim Presiden Bashar Assad. Oposisi Syria, yang terpecah oleh ketegangan sektarian dan ideologis, Rabu (24/8) telah membuat berbagai keuntungan yang belum pernah terjadi sebelumnya terhadap rezim, tetapi tidak adakepemimpinanyangjelasataulandasanyangmelampauituntutan bagi lebih bebas dan agar Assad mengundurkan diri. Di NewYork, Prancis, Inggris, Jerman dan Portugal mengajukan rancangan sanksi terhadap Syria, sementara Rusia mengatakan belum saatnya Perserikatan Bangsa-Bangsa mengambil tindakan, menurut laporan beberapa kantor berita. Satu rancangan resolusi yangjugamendapatdukungankuatdariASitu,Selasatelahdikirimkan kepada 15 anggota Dewan Keamanan PBB untuk pertama kalinya pada saat rapat konsultasi terkait krisis di Syria, kata sejumlah utusan. “Satu rancangan resolusi telah didistribusikan kepada para anggota Dewan Keamanan,” kata utusan Prancis dalam akunTwitternya. “Nama Presiden Syria Bashar al-Assad, ada di dalam resolusi, ada juga seruan untuk embargo persenjataan terhadap Syria,” kata seorang diplomat Barat yang tidak mau disebutkan namanya. Sementara itu utusan RusiaVitaly Churkin mengatakan Moskow merasa belum saatnya untuk memberlakukan sanksi yang dimaksud negara-negara Barat terkait kekerasan yang berlangsung selama lima bulan di Syria. Pandangan tersebut juga disampaikan utusan China, sementara India dan Afrika Selatan juga menyatakan keberatannya. Para diplomat Barat sendiri mengatakan mereka merencanakan serangkaian negosiasi yang intensif sebelum proses penentuan keputusan diambil dengan pemungutan suara. Sejumlah diplomat juga mengatakan kepada Reuters bahwa rancangan resolusi itu juga berisikan ancaman untuk membawa kasus kekerasan di Syria tersebut ke Mahkamah Kriminal Internasional di Denhaag. (m10)

Ledakan Amunisi Tewaskan Enam Tentara Rusia Tewas ROSTOV-ON-DON, Russia (AP): Satu ledakan amunisi lama di satu pangkalan militer di bagian selatan Rusia menewaskan enam tentara dan menciderai 12 lainnya Selasa (23/8). Ledakan itu terjadi di saat tentara tengah membersihkan amunisi lama di pangkalan Ashuluk di wilayah Astrakhan, kata jubir Kementrian Gawat Darurat Oleg Ivanov. Penyebab ledakan masih diselidiki, kata Kantor Jaksa Militer Rusia. Para pejabat mengatakan, kemungkinan terjadi salah penanganan amunisi tersebut, lapor kantor berita RIA Novosti. Banyak di antara korban cidera dalam kondisi gawat, menurut direktorat dinas gawat darurat regional. April lalu, peluru artileri 76 milimeter meledak di pangkalan yang sama, menewaskan seorang tentara, lapor ITAR-Tass.Di bulan April juga terjadii ledakan mesiu seberat 40 kilogram di satu pangkalan militer dekat kota Lipetsk, yang terletak di selatan Moskow, menewaskan empat orang, kata RIA Novosti. Di musim panas ini sebelumnya dilaporkan terjadi dua kebakaran di gudang amunisi yang menyebabkan kerusakan berat dan sejumlah korban. Di wilayah Udmurtia, kebakaran itu berlangsung hampir dua hari. Sekitar 28.000 orang dievakuasi dari rumah mereka dan sekitar 50 orang dirawat di rumahsakit.(m23)

Militan Pakistan Eksekusi Mata-mata AS MIRANSHAH, Pakistan (Waspada): Militan Pakistan membunuh pengungsi Afghanistan di bagian utara Pakistan yang dituding sebagai mata-mataAS.JasadpriaAfghanistanyangdilubangipeluruditemukan di jalanan di Kota Datta Kheil yang terletak di Provinsi Waziristan, Pakistan. Demikian seperti diberitakan ANI, Rabu (24/8). Sebuah kartu ATM dari bank Afghanistan dan catatan ditemukan di samping jasad korban. Catatan itu berisikan tulisan tangan yang menyatakan, korban tertangkap basah melakukan aksi mata-mata untuk AS. Militan di ProvinsiWaziristan sudah membunuh puluhan warga desa, pejabat pemerintah setempat serta pengungsi dari Afghanistanyangdidugamata-mata.ProvinsiWaziristanmemangmenjadi sarang al Qaida dan jugaTaliband i Pakistan. AS bahkan menyatakan wilayah tersebut adalah tempat paling berbahaya di dunia. AS juga kerap melancarkan serangan udara untuk memberantas para militan tersebut. Namun, operasi AS justru dikecam banyak warga Pakistan karena menewaskan warga sipil.(okz)

Gempa Landa Pantai Timur AS WASHINGTON, AS (Antara/ Reuters): Gempa kuat melanda Pantai Timur Amerika Serikat, dan getarannya terasa sampai ke Kanada merusak bangunanbangunan terkenal di ibu kota negaraitudanmenyebabkanpara karyawankantorlarikejalan-jalan. Tidak ada laporanlaporan kerusakan besar atau korban cedera serius akibat gempa berkekuaan 5.8skalaRichter,yangterjadisekitar 145kmbaratdataWashingtonD.C. Itu adalah gempa terkuat di Virginia sejak tahun 1897. Pentagon, Gedung Putih dan Gedung Capitol Amerika Serikat diWashington dikosongkan, dan ribuankaryawanlarikejalan-jalan di Pantai Timur (East Coast) saat gempamelandapadajammakan siang yangmenyebabkanbarangbarang di toko dan kantor jatuh. “Kami terhuyung-huyung,” kata Larry Beach, yang bekerja di Badan Pembangunan Internasional AS (USAID) di Washington Selasa (23/8). Para karyawan federal dipulangkan lebih awal. Katedral NasionalWashington, yang banyak terdapat makam para presiden AS, tiga puncak menara di menara tengah retak. Pantai Timur AS jarang mengalami gempa sekuat gempa Selasa itu. Survei Geologi AS

(USGS) mengatakan gempa itu berkekuatan 5,8 skala Richter, menurun dari perkiraan awal 5,9 skala Richter. Gempa berkekuatan 5,5 skala Richter dapat menyebabkan kerusakan parah pada gedung-gedung dan bangunan-bangunan lainnya. Selain gempa di Virginia,ada sembilan gempa di daerah itu segera setelah itu yaitu sekitar Cokedale, Colorado, dekat perbatasan New Mexico. “Hari ini kami menga-lami dua gempa kuat di banyak daerah negara ini,” kataDavidWald,seorangahligeofisika di USGS. Gempa di barat, berkekuatan 5,3 skala Rchter, dalam dua kali 24 jam lalu menghantam enam negara bagian barat, terutma Colorado dan New Mexico, tetapi juga daerah-daerah Kansas, Oklahoma serta Texas, katanya. Selain dilanda gempa, East Coast juga dalam siaga menghadapi Topan Irene yang akan datang dari Karibia dan dapat melanda daerah itu akhir pekan ini. Gempa itu membuat tempat-tempat lilin bergoyang di gedung Capitol AS dan lantai Senat AS bergetar sebelum staf menuju ke luar. Beberapa kerusakan ringan dapat terlihat di gedung bundar,di bawah kubah Capitol.

Layanan telefon terhenti di seluruhwlayahitusementarajaringan macet menghambat para pengguna telepon genggam tidak dapat menelefon. Juga ada ada kekhawatiran keamana nuklir apabila satu dari empat generator disel darurat dipusatlistriktenaganuklir(PLTN) North Anna diVirginia rusak akibat gempa itu yang secara otomatis operasi fasilitas itu terhenti. PLTN yang dioperasikan oleh Dominion Resources itu dirancanguntukdapatbertahandalam gempa berkekuatan 6,2 skala Richter,katajurubicaraperusahaan itu. Dominion melaporkan tidak ada kerusakan penting pada fasilitas itu. Di NewYork, getaran gempa memicu pengosongan gedunggedung pengadilan, City Hall dan menyebabkan pekerjaan di lokasi bangunanWorldTrade Centre dihentikan.Menara-menarapengawas di Bandara John F.Kennedy International Airport di NewYork CitydanbandaraNewwarkLiberty di New Jersey juga diksosongkan, dan penerbangan terhenti sebentardiWashington,Philadelphia dan NewYork. Gempa juga terasa sampai ke Toronto, Kanada. Gedung-gedung di Boston dikosongkan.

Reuters

POTJAMAN Na Pombejra (tengah), mantan istri PM terguling Thaksin Shinawatra, tiba di Pengadilan Kriminal di Bangkok Rabu (24/8). Dia telah dibebaskan dari tuduhan menggelapkan pajak.

Mantan Istri Thaksin Bebas Dalam Kasus Gelapkan Pajak BANGKOK, Thailand (AP): Satu pengadilan Thailand membebaskan mantan istri PM terguling Thaksin Shinawatra dari kasus penggelapan pajak yang ditimpakan padanya tiga tahun lalu. Mahkamah Banding Bangkok menolak dakwaan tahun 2008 atas Potjaman Na Pombejra dan hukuman tiga tahun penjara atas dirinya karena menggelapkan pembayaran pajak. Mahkamah juga membebaskan sekretarisnya Kanchanapa Hong-hern yang telah dihukum dua tahun penjara atas tuduhan yang serupa.

Kasus itu melibatkan satu transfer saham pada 2007lalukepadasaudaraangkatPotjaman,Bannapot Damapongsenilai546jutabaht(kira-kiraAS$18juta). Mahkamah Rabu memperkuat dakwaan bersalah atasdiriBannapotkarenatidakmembayarpajakatas penghasilannyadariakuisissaham. Namunhukuman itu dikurangi dari tiga tahun menjadi The court on Wednesday upheld Bannapot’s guilty verdict for not payingtaxonhisearningsduatahunpenjarapercobaan. Ketiganya bebas tanpa jaminan sementara penyelesaian banding itu. (m10)


Sport Bayern Makin Yakin

A5

WASPADA

Kamis 25 Agustus 2011

ZURICH (Waspada): Gol tunggal striker Jerman Mario Gomez menit ketujuh di Zurich, Selasa (Rabu WIB), sudah cukup bagi Bayern Munich untuk mendapatkan tempat di babak penyisihan grup Liga Champions. Klub raksasa Jerman itu mempecundangi FC Zurich 1-0 pada leg kedua playoff, sehingga melaju dengan keunggulan agregat 3-0. FC Hollywood masuk dalam daftar klub yang akan diundi Jumat (26/8) besok di Monaco, sebagai satu dari 10 pemenang laga playoff dan bergabung dengan 22 klub yang otomatis maju ke babak utama. Bintang Bayern Franck

Ribery pun makin yakin dengan permainan dan peluang timnya. “Ini lebih baik dibanding musim lalu. Atmosfernya jauh lebih baik dan saya menikmati peran sebagai bagian dari tim,” bebernya. Menurut gelandang Prancis itu, The Bavarians bahkan bisa lebih dahsyat lagi dengan membenahi beberapa aspek. “Kami belum 100 persen, masih ada pekerjaan yang harus dilaku-

kan,” jelas mantan maskot Marseille itu. Bayern berharap dapat melaju hingga final Liga Champions, yang partai puncaknya berlangsung di markas mereka, Allianz Arena. Tapi Munich memiliki beberapa masalah di Zurich, kendati tuan rumah jarang mengancam gawang mereka yang dijaga Manuel Neuer. Pelatih Jupp Heynckes mengawali duel dengan menurunkan delapan pemain Jerman, tetapi tidak didukung bintang Belanda Arjen Robben, yang sedang berjuang mengatasi masalah di punggungnya. Striker Kroasia Ivica Olic juga mengalami cedera pinggung, sehingga harus istirahat delapan minggu. Teraktual, FC Hollywood menanti dengan cemas apakah

Hasil Leg II Play-off LC, Selasa (Rabu WIB) APOEL Nicosia (Siprus) vs Wisla (Polandia) *APOEL menang adu penalti 3-2 Genk (Belgia) vs Maccabi Haifa (Israel) *Genk menang adu penalti 4-1 Malmo (Swedia) vs Dinamo Zagreb (Kroasia) *Dinamo menang adu penalti 4-3 Villarreal (Spanyol) vs OB Odense (Denmark) *Villarreal menang agregat 3-1 FC Zurich (Swiss) vs Bayern Munich (Jerman) *Bayern menang agregat 3-0 Mario Gomez masih dapat bermain setelah sempat terjengkang menit 45. Urat kaki Gomez bermasalah, padahal dia pencipta gol kemenangan tim tamu di Stadion Letzigrund. “Dokter mengatakan masalahnya tak parah. Mungkin hanya syaraf yang terjepit. Saya

Kapal Selam Kuning Pantas Lolos MADRID ( Waspada): Villarreal tampil superior saat menggunduli OB Odense 3-0 dalam laga leg kedua play-off Liga Champions di markasnya sendiri, El Madrigal Stadium. Kemenangan telak Selasa (Rabu WIB) tersebut, memastikan langkah tim Kapal Selam Kuning ke babak penyisihan grup dengan keunggulan agregat 3-1. Sukses di Madrigal sekaligus balasan atas kekalahan 1-0 pada leg pertama pekan lalu di Odense, Denmark. El Entrenador Villarreal, Juan Carlos Garrido, mengklaim anak asuhnya memang pantas menang serta lolos, karena selalu mendominasi laga. “Villarreal selalu superior sejak awal hingga akhir. Itu terlihat di dua laga, baik waktu kami tandang maupun saat menjamu mereka di sini,” ujar Garrido, seperti dikutip dari laman UEFA, Rabu (24/8). “Kami pantas lolos, tapi kami tak mampu mencetak gol di Odense. Hal itu seolah akan terjadi lagi di sini seperti yang tersaji di babak pertama, tapi ternyata tidak,” katanya menambahkan. Setelah bermain 0-0 sepanjang babak pertama, The Yellow Submarines baru bisa memecah kebuntuan melalui gol Giuseppe Rossi menit 50, menuntaskan kerjasamanya dengan Cristian Zapata dan Nilmar. Striker Italia itu kembali menyarangkan bola untuk memantapkan keunggulan tuan rumah menit 66. Bek veteran Spanyol Carlos Marchena kemudian melengkapi dominasi Kapal Selam Kuning dengan golnya menit 80. Kisah sukses kebangkitan Villarreal diikuti APOEL Nicosia, yang menggebuk wakil Polandia Wisla Krakow 3-1. Hasil itu membuat APOEL melaju dengan agregat 3-2, mengatasi defisit skor 0-1 pada leg pertama pekan lalu di Krakow. (m15/goal/uefa) Reuters

Empat Klub Liga Utama Tersingkir LONDON (Antara/AFP): Empat klub Liga Utama Inggris, termasuk tiga yang baru dipromosikan, tersingkir dari kompetisi Piala Liga, Selasa (Rabu WIB), setelah melakoni laga putaran kedua. Norwich City dipermalukan 0-4 di kandang sendiri ketika menghadapi pimpinan Liga 1 MK Dons. Quens Park Rangers (QPR) kalah 0-2 saat menjamu tim tier ketiga Rochdale di Loftus Road. Para pemain Swansea juga mengakhiri laga dengan wajah murung, setelah kalah 1-3 pada laga tandang di lapangan klub Liga 2, Shrewsbury. Klub liga elit Sunderland mengakhiri mimpi untuk berjaya di kompetisi domestik, akibat kekalahan menyakitkan 0-1 pada perpanjangan waktu saat melawan klub “Championship” Brighton. Pelatih Norwich, Paul Lambert (foto) mengganti semua 11 pemainnya. Tetapi tim Canaries itu tetap kandas 0-2 pada babak pertama, justru lewat gol dari mantan pemainnya, Luke Chadwick dan Sam Baldock. Gol kedua Chadwick terjadi setelah duel berlangsung satu jam dan Daniel Powell membuat angka menjadi 4-0 tujuh menit kemudian. Sedangkan Rochdale memberi peringatan kepada QPR ketika Jean-Louis Akpa Akpro mencetak angka pada awal laga babak kedua dan Gary Jones membuat angka menjadi 2-0 sembilan menit sebelum laga usai. Swansea sempat memimpin melalui Shane CansdellSherrif, yang mencetak gol ‘bunuh diri’. Tetapi Marvin Morgan, pahlawan Shrewsbury, menyamakan kedudukan pada babak pertama.

3-1 2-1 2-0 3-0 0-1

kira saya akan bisa kembali bermain pada Sabtu,” tutur Gomez kepada Bundesliga.de. The Bavarians bakal melanjutkan petualangannya di Bundesliga dengan mengunjungi kandang Kaiserslautern. Aksi dan semangat Gomez mendapat simpati dari gaffer Heynckes. “Sangat penting bagi kami bisa mencetak gol cepat (Go-

AP

GELANDANG Franck Ribery (kiri) dan Bastian Schweinsteiger (kanan) merayakan kemenangan Bayern Munich di Letzigrund Stadium, Zurich, Swiss, Rabu (24/8) dinihari WIB. mez) dalam itu. Gol itu telah membuat kami memimpin dengan kedudukan 3-0,” pungkas Heynckes.

“Setelah gol itu, tim ini bermain semakin menegangkan. Padahal, sangat penting buat Bayern Munich untuk lolos ke

babak penyisihan grup Liga Champions,” katanya menambahkan. (m15/ant/afp/uefa)

Cedera Pique Berita Buruk Barca

STRIKER Villarreal Giuseppe Rossi (atas) menaklukkan kapten Odense Anders Moller Christensen di El Madrigal Stadium. -AP-

MADRID (Waspada): Barcelona menerima berita buruk jelang laga Piala Super Eropa melawan FC Porto di Monaco, Jumat (26/8) malam. Sebab bek andalan El Barca, Gerard Pique (foto), dipastikan absen dalam laga antar juara Liga Champions dengan jawara Liga Europa itu, karena cedera hamstring. Setelah hanya main 45 menit saat El Catalan membantai Napoli 5-0 di Joan Gamper Trofi, Pique cedera saat menjalani sesi latihan Selasa sore waktu Spanyol. Menurut Goal, Rabu (24/ 8), bek tangguh El Matador itu mesti menepi selama tiga pekan untuk pemulihan. Bek berusia 24 tahun itu juga sejatinya belum dalam tampil pada dua laga pembuka kompetisi La Liga Primera 2011/ 2012, menghadapi Villarreal dan Real Sociedad. Tandem maut Pique di jantung pertahanan The Catalans, Carles Puyol, pun masih butuh waktu tiga pekan lagi untuk pemulihan cedera. Untungnya, La Liga 2011-12 belum bisa

bergulir akhir pekan ini. Pasalnya, Asosiasi Pesepakbola Spanyol (AFE) memutuskan tetap masih melakukan aksi mogok. La Liga harusnya sudah digelar sejak 20-22 Agustus lalu. Namun AFE melakukan mogok sebagai bentuk protes, karena hingga saat ini masih ada klub yang belum membayar gaji pemainnya. “Saya mengerti kalau orang mau menyaksikan sepakbola. Tapi pertama-tama kita harus pikirkan para pesepakbola yang mengalami masa sulit,” ujar juru bicara AFE Luis Gil kepada The World Football. Menurut data AFE, sekitar 200 pemain di dua divisi teratas Liga Spanyol belum sepenuhnya menerima pembayaran dari klub. Secara keseluruhan, klub berutang 50 juta euro

kepada mereka. Dalam tuntutannya, AFE meminta jaminan agar pemain bisa keluar dari kewajiban kontraknya jika tidak dibayar dalam waktu tiga bulan berturut-turut. Tapi itu ditolak oleh Professional Football League (LFP). “Kami selalu bilang bahwa kami dalam batas kemampuan finansial. Tapi kami akan mencoba mencari titik kompromi,” dalih Presiden LFP Jose Luis Astiazaran. Sejumlah klub papan atas di dua divisi tersebut, sudah mencoba melakukan pertemuan untuk mencegah pemogokan. Namun hingga pertemuan terakhir di markas AFE, Madrid, belum ada kesepakatan yang tercapai. “Kedua pihak masih jauh dari kesepakatan, tapi kami masih terus bekerja,” beber Luis

AP

Gil.

Pemain yang ikut mogok termasuk bintang Barcelona dan Real Madrid, Lionel Messi dan Cristiano Ronaldo. Ini merupakan aksi mogok pertama sejak 27 tahun, sehingga menghambat pembukaan kompetisi. (m15/ goal/thewf )


Sport

A6

WASPADA Kamis 25 Agustus 2011

Fulus Anzhi Bisa Tak Sebanding Dengan Risiko Eto’o

AP

ROMA (Waspada): Klub gurem asal Rusia, FC Anzhi Makhachkala, membuat kehebohan dengan mendatangkan dengan harga sangat mahal striker Inter Milan Samuel Eto’o. Anzhi membeli Eto’o (foto) senilai 25 juta euro ditambah gaji 20,5 juta euro per tahun serta bonus-bonus lainnya. Fulus dimaksud menjadikan striker Kamerun itu sebagai pesepakbola dengan gaji tertinggi di dunia. “Hari ini tercapai kesepakatan antara Anzhi dan Inter terkait transfer Samuel Eto’o,” demikian pernyataan resmi Anzhi, Rabu (24/8). “Kami berterima kasih kepada manajemen Inter Milan yang bersikap profesional dalam proses perundingan. Kini, transfer telah benar-benar disepakati oleh kedua belah pihak,” tambah pernyataan tersebut. Sungguh menggiurkan, namun fulus dari Anzhi bisa tak sebanding dengan risiko keamanan dirinya. Menurut Bleacher Report, Rabu (24/8), Provinsi Dagestan sebagai markas Anzhi,

Nasri Gabung

Terancam Tidak Ikut Liga Champions Asia nuhi, kita siap-siap saja dengan konsekuensi gagal tampil di LCA,” papar Sihar. Meski begitu, PSSI belum menyerah dan masih akan berupaya agar AFC bisa meloloskan Indonesia. Tentunya dengan memberikan alibi yang tepat kepada AFC, sehingga sepakbola Indonesia tidak sampai dilarang tampil di ajang bergengsi antarklub di Asia tersebut. “Kita lihat saja nanti. Yang jelas, harus ada alibi kuat untuk menyelamatkan sepakbola kita dari sanksi,” tegas Sihar. Menanggapi hal tersebut, pengamat sepakbola nasional asal Medan, Bukti Sihotang, meminta semua pihak menjadikan masalah ini sebagai pembelajaran “Tidak hanya pengurus PSSI. Klub juga harus bisa melihat masalah ini secara bijak. Dengan gagal tampil di LCA, tentu kerugian besar bagi klub dan sepakbola nasional,” kata Bukti. Masih kata pria lulusan IISIP Jakarta ini, salah satu contoh klub tidak bersikap dewasa adalah adanya dualisme kepengurusan seperti yang terjadi di kubu Persija Jakarta dan Arema In-

Waspada/Yuslan Kisra

donesia. “Sekiranya bisa lebih dewasa dalam bersikap, mestinya tidak perlu terjadi dualisme kepengurusan. Pertanyaannya, kenapa baru sekarang muncul dualisme seperti itu? Ada apa sesungguhnya yang terjadi?” tanya Sihotang. Senada itu, Daniel Siahaan mengatakan sejatinya klub harus mengikuti semua aturan yang telah digariskan AFC. Jika saja memang harus menyetorkan dana deposit, semua klub harus patuh. Hanya saja, pengurus PSSI pun diminta transparan dalam menerapkan kebijakan. “Dengan begitu, klub bisa lebih memahami keinginan dan syarat AFC. Apa memang benar uang deposit itu harus disetorkan ke rekening PSSI? Semua harus dijelaskan secara transparan,” koar Siahaan, a wartawan olahraga asal Balige itu. (yuslan)

LONDON (Waspada): Kendati penyerang Argentina Sergio Aguero dan gelandang Prancis Samir Nasri sudah gabung Manchester City, manajer Roberto Mancini tetap belum puas untuk belanja pemain. Mancini masih mencari bintang anyar lagi untuk ditempatkan di lini tengah. Sasarannya gelandang AS Roma Daniele De Rossi untuk menggantikan posisi Patrick Vieira yang segera pensiun. “Saya butuh sesuatu yang lain di lapangan tengah, karena kami masih memiliki pilihan yang terbatas,” ucap Mancini dalam ESPN, Rabu (24/8). “Kami punya (Gareth) Barry, (Nigel) De Jong, (James) Milner dan (Yaya) Toure. Tapi jika Anda mempertimbangkan kompetisi di Liga Inggris, Liga Champions dan Piala FA, itu belum cukup,” ujarnya lagi. Nama De Rossi sudah lama dikaitkan dengan The City. Tapi realisasinya selalu gagal, karena Roma tak mau melepas gelandang elegan Italia tersebut. “Daniele De Rossi akan benar-benar sempurna untuk tim ini dan saya menilai dia sebagai salah satu gelandang ter-

Fiorentina Beli Murah The Tank

Antara

STRIKER Timnas U-23, Andik Vermansah (10), berusaha melewati bek Bali Devata, Jun Hee Bok (kiri), dalam laga ujicoba di Stadion Gelora 10 Nopember Surabaya, Selasa (23/8) malam.

Timnas U-23 Menang Tapi Monoton SURABAYA ( Waspada): Meski tampil monton, Tim Nasional U-23 asuhan Rahmad Darmawan berhasil menundukkan Bali Devata 4-2 dalam laga ujicoba di Stadion Gelora 10 Nopember, Surabaya, Selasa (23/8) malam. Gol pembuka Garuda Muda tercipta saat pertandingan memasuki menit keempat. Memanfaatkan umpan datar Zulham Zamrun, striker Persebaya, AndikVermansyah, melepaskan tendangan keras yang gagal dihalau kiper Devata, Ngurah Komang Arya. Sayang, permainan apik Timnas U-23 hanya bertahan

15 menit, karena setelah itu praktis Bali Devata menguasai pertandingan. Menit 17, klub Bali itu menyamakan kedudukan lewat Ilia Spasojevic. ‘Garuda Muda baru kembali unggul pada menit 39 berkat gol bunuh diri Spasojevic saat ingin menyapu sepak pojok Johan Juansyah. Tampil monoton, sejumlah penonton yang memenuhi stadion bahkan sempat mencemooh anak-anak besutan RD. Di babak kedua, timnas tampil lebih baik setelah masuknya Kim Kurniawan dan Mahardiga Lasut. Alhasil, Garuda Muda bisa memperlebar keunggulan pada

menit 71 lewat aksi Ramdhani Lestaluhu. Beberapa saat jelang pertandingan usai, Yongki Aribowo memastikan kemenangan Timnas U-23. Di akhir laga, Bali Devata memperkecil skor menjadi 4-2 lewat penalti Spasojevic. Dalam pertandingan tersebut, apresiasi layak diberikan pada dua pemain naturalisasi, yakni Diego Michiels dan Ruben Wuarbanaran. Selama 65 menit tampil di lapangan, keduanya banyak memberikan kontribusi untuk tim yang diproyeksikan mendulang medali emas pada SEA Games di Jakarta, November mendatang. (m33/ini)

BUENOS AIRES (Antara/ AFP): Klub Argentina Velez Sarsfield, Selasa (RabuWIB) mengumumkan, telah mencapai kesepakatan untuk menjual striker asal Uruguay Santiago ‘The Tank’ Silva ke Fiorentina. “Kami menerima fax dari Fiorentina yang menginformasikan bahwa mereka akan membayar klausul pelepasan yang ditetapkan dalam kontrak Santiago Silva,” kata Presiden Velez Fernando Raffaini. “Pemain bersangkutan mengatakan kepada kami bahwa dia merasa ini merupakan satu kesempatan untuk mencoba peruntungannya di Eropa,” tambahnya. Laporan media menyebutkan, La Viola hanya membeli murah dengan harga sekitar 2,5 juta dolar AS (1,7 juta euro) bomber berumur 30 tahun tersebut. Silva mengikuti jejak mantan rekan setimnya di Velez Ricardo Alvarez (Inter Milan) dan Maximiliano Moralez (Atalanta), meninggalkan juara Clausura itu untuk mentas di Liga Seri A. Dijuluki The Tank, Silva sering berpindah-pindah klub. Setelah mengawali karirnya di Uruguay, dia sempat membela Corinthians (Brazil), Energie Cottbus (Jerman), dan Beira Mar (Portugal).

Siwo PWI Berperan Majukan Yamaha MEDAN (Waspada): PT Alfa Scorpii Medan mengungkapkan, Siwo PWI Sumut berperan besar dalam kemajuan PT Alfa Scorpii, sebagai main dealer Yamaha di Sumatera Utara. “Oleh karena itu, pihaknya

mengucapkan terima kasih kepada wartawan olahraga di Kota Medan. Kami dari PT Alfa Scorpii mengucapkan terima kasih kepada rekan-rekan wartawan olahraga yang telah banyak membantu kami selama

Waspada/Ist

Yong Ting Lee, didampingi Service Manajer PT Alfa Scorpii Zainal Arifin Harahap menyerahkan plakat kepada Ketua SIWO PWI Sumut SR Hamonangan Panggabean di acara buka puasa bersama.

Uang satu tong Itulah risiko nyata yang wajib dihadapi Eto’o, mantan mesin

gol Barcelona dan Real Mallorca. Menurut gelandang AC Milan Gennaro Gattuso, dirinya juga pernah ditawar klub tersebut dengan dana jutaan euro. “Tidak ada yang berbicara mengenai Anzhi pada bulan Februari. Saya telah pergi ke Dagestan untuk melakukan pembicaraan, dan mereka menawari uang satu tong kepada saya, tapi saya tidak memikirkannya,” ungkap Gattuso kepada Milan Channel. Dia akhirnya menolak tawaran Anzhi sekaligus memilih bertahan di San Siro Milan. “Adriano Galliani (Wakil Presiden Milan) ingin saya terus berada di Milan, tetapi tidak menghentikan saya dalam mencari uang banyak,” kenang Gattuso. “Ini membuktikan mereka semua peduli pada diri saya. Selain itu, keluarga saya tidak senang pindah ke Rusia dan di sini (Italia) juga ada bisnis saya yang telah mempekerjakan 50 orang,” katanya menambahkan. (m15/vvn/goal/m-chan)

Mancini Belum Puas Belanja

Klub Gagal Penuhi Aspek Finansial JAKARTA (Waspada): Ketua Komite Kompetisi PSSI, Sihar Sitorus (foto), mengaku tidak bisa berbuat banyak terkait dana deposit yang belum juga disetorkan klub. Padahal deadline waktu penyetoran dana yang juga salah satu syarat ikut kompetisi profesional tersebut sudah diundur. “Sampai saat ini, baru ada dua klub yang sudah menyetorkan dana deposit, yakni Madiun Putra dan Pro Duta. Yang lain masih sebatas janji-janji saja,” kata Sihar saat ditemui Waspada di Kantor PSSI, Senayan, Jakarta, Rabu (24/8). Sebagai imbas dari belum adanya setoran deposit tersebut, pengusaha muda asal Sumut ini mengatakan sepakbola Indonesia terancam tidak bisa tampil di Liga Champions Asia (LCA) hingga tiga tahun ke depan. Sebab klub-klub Indonesia sudah dipastikan gagal memenuhi satu dari sekian syarat AFC. “Tanpa adanya setoran dana deposit tersebut bisa saja disiasati dengan laporan keuangan yang diaudit. Ini vital sebagai salah satu syarat. Karena belum dipe-

rawan kekerasan dan brutalisme. Area itu sejak pertengahan 1990 sudah didera kekerasan separatis yang berasal dari tetangga Rusia, Republik Chechnya. Februari 2011, seorang wanita coba meledakkan pos polisi dengan bom bunuh diri. Enam orang dilaporkan terluka dan satu tewas. Menurut The Jerusalem Post, seorang separatis lain terbunuh saat terjadi kontak senjata dengan polisi di Makhachkala. Aksi hooligan pun masih melibatkan klub dimaksud pada pertandingan Liga Rusia. Anzhi pernah terlibat kerusuhan ketika melawan Zenit St. Petersburg pada 24 Juli 2011. Karena alasan keamanan ini pula, para pemain Anzhi tinggal di Moskow. Tiap kali Anzhi menggelar laga kandang, mereka terpaksa terbang ke kota itu, yang jauhnya 2011 kilometer dari Moskow.

ini,” ungkap Service Manager PT Alfa Scorpii, Zainal Arifin Harahap. Dia menyatakan demikian dalam acara buka puasa PT Alfa Scorpii bersama wartawan olahraga yang bergabung di Siwo PWI Sumut di Hotel JW Marriott, Jl Putri Hijau Medan, Selasa (23/8) malam. Dikatakan, sama seperti tahun-tahun sebelumnya, PT Alfa Scorpii sebagai dealer resmi Yamaha kembali menggelar buka puasa bersama Siwo PWI Sumut. Dalam kata sambutan lainnya, Zainal Arifin mengatakan, PT Alfa Scorpii memang rutin menggelar kegiatan ini untuk meningkatkan tali silaturahmi. “Melalui buka puasa bersama ini, kita berharap agar tali silaturahmi yang telah terjalin selama ini dapat ditingkatkan,” ujar

Zainal yang didampingi Divisi Manager Promotion & Motorsport , Yong Ting Lee. Ketua Siwo PWI Sumut SR Hamonangan Panggabean didampingi Wakil Ketua Jonny Ramadhan Silalahi juga mengucapkan terima kasih kepada pihak PT Alfa Scorpii yang telah menggelar buka puasa bersama ini. “Kami juga berharap agar tali silaturahmi yang telah terjalin selama ini dapat ditingkatkan di masa mendatang,” kata Monang. Menurut Monang, buka puasa yang digelar ini merupakan bukti kepedulian PT Alfa Scorpii kepada wartawan olahraga. Karena itu, pihaknya barharap agar Alfa Scorpii sebagai main dealer Yamaha semakin sukses di masa mendatang. (m47)

MANAJER City Roberto Mancini tak mau terganggu dengan gabungnya Samir Nasri dari Arsenal. baik di dunia,” ungkap Mancini. “Tapi saya mulai curiga, dia akan tetap bertahan di Roma sepanjang karirnya, seperti yang dilakukan oleh Francesco Totti,” tambah pelatih asal Italia itu. Mengenai masuknya Nasri, Mancini mengaku tidak akan pusing dalam menentukan tim inti. Mantan alenatorre Inter Milan dan Lazio itu menilai, banyaknya jadwal laga justru membuat kedatangan Nasri akan sangat membantu The Eastland.

“Itu bukan masalah bagi saya. Masalah muncul jika Anda tidak punya pemain yang bagus. Untuk manajer, memang tak mudah karena semua pemain ingin bermain,” jelas Mancini. “Tapi, jika Anda bermain di empat kompetisi dan punya satu laga setiap tiga hari, maka ada tempat bagi setiap pemain. Terkadang pemain membutuhkan istirahat, penting untuk memainkan level tertinggi di Liga Champions,” katanya menambahkan.

Nasri gabung City, setelah Arsenal setuju untuk menjualnya dengan bandrol yang masih dirahasiakan. “Arsenal dapat mengkonfirmasi, telah menyetujui persyaratan bagi Samir Nasri untuk pindah ke Manchester City,” bunyi pernyataan The Gunners. Gelandang Prancis berusia 24 tahun itu sudah pergi ke Manchester untuk pemeriksaan medis, setelah menghabiskan tiga tahun bersama London Reds sejak pindah dari Olym-

Reuters

pique Marseille. Kepergiannya merupakan pukulan berikutnya bagi arsitek Arsenal Arsene Wenger, yang sudah lebih dahulu kehilangan kapten Cesc Fabregas, gelandang Emmanuel Eboue dan bek Gael Clichy. “Musim panas ini sangat sulit, karena kami harus menghadapi negosiasi transfer Cesc Fabregas dan Nasri. Itu membuat kekosongan, kami kehilangan dua pemain besar,” beber Wenger.(m15/espn/afp/rtr)


Sport

WASPADA Kamis 25 Agustus 2011

A7

Rahudman Kembali Janji Soal Teladan MEDAN (Waspada): Saat ini, Stadion Teladan menjadi sarana olahraga yang mendesak dibenahi untuk mendukung niat PSMS Medan ikut serta di kompetisi level I mendatang. Namun, hingga kini belum ada jadwal tepat untuk realisasi pembenahan stadion kebanggaan Kota Medan itu.

Sony Pimpin Srikandi Merah Putih HO CHI MINH CITY, Vietnam (Waspada): Tunggal putra Indonesia, Sony Dwi Kuncoro (foto), lolos ke babak ketiga turnamen bulutangkis Vietnam Terbuka Grand Prix, Rabu (24/ 8). Diunggulkan di tempat 15, Sony menyingkirkan Cheng Po Wei (Taiwan) 21-11, 21-13. Di babak ketiga Kamis (25/8) ini, Sony yang kerap didera cedera punggung akan menghadapi pemenang pertandingan antara Sukamta Evert (Indonesia) dengan unggulan kedua asal Jepang, Sho Sasaki. Selain Sony, AlamsyahYunus juga meraih tiket babak ketiga, Melawan pemain India, Prannoy HS, Alamsyah yang ditempatkan sebagai unggulan keempat itu lolos dengan kemenangan 17-21, 21-16, 21-12 dalam tempo 55 menit. Dengan kemenangan ini, Alamsyah akan menghadapi Nan Wei (Hong Kong). Unggulan delapan tunggal putri, Maria Febe Kusumastuti, langsung tersingkir pada putaran pertama setelah dikalahkan Ayumi Mine (Jepang) 19-21, 17-21. Pebulutangkis Jepang peringkat 263 dunia tersebut hanya membutuhkan waktu 40 menit untuk menyisihkan tunggal Indonesia yang berposisi pada peringkat 42 dunia itu. Tunggal putri Pelatnas lainnya, Renna Suwarno, juga tersisih dari turnamen berhadiah total 50 ribu dolar AS itu. Renna gagal mengatasi Fu Mingtian (Singapura) yang menang 16-21, 21-9, 17-21. Kekalahan juga dipetik Bellaetrix Manuputty yang pekan lalu menyumbangkan medali emas di ajang Universiade di Shenzhen, China. Melawan unggulan tiga dari Taiwan, Tai Tzu Ying, Bellaetrix kalah 21-18, 17-21, 12-21. Dengan demikian, tunggal putri tinggal menyisakan Desi Hera dan Aprillia Yuswandari. Bila Desi maju ke putaran kedua dengan menundukkan unggulan ketujuh Linda Zechri

Antara

(Bulgaria) 21-15, 21-2 dalam 31 menit, Aprillia menyingkirkan Chan Hung Yung (Hongkong) 17-21, 21-14, 21-13. Di ganda campuran, dua wakil Merah Putih akan bertarung memperebutkan tiket perempatfinal dikarenakan Irfan Fadhilah/Weni Anggraini dan Rhoma Putra Eka/Aris Budiharti saling berhadapan di putaran kedua. Sedangkan Riky Widianto/Shendy Puspa Irawati, yang menang atas Lo Lok Kei/Chan HungYung (Hong Kong) 21-19, 21-18, akan bertemu unggulan kedua dari Singapura, Chayut Tricharat/Yao Lei. Langkah mulus didapat ganda putri Anneke Feinya/Nitya Krishinda. Pasangan pelatnas Cipayung ini menang mudah atas Shevon Jamie Lai/Chiew Sien Lim (Malaysia) 21-13, 21-9. Selanjutnya, unggulan kelima ini akan bertemu pasangan India, Aparna Balan/Siki Reddy. (m33/ant)

Menjawab hal itu, Wali Kota Medan, Rahudman Harahap, kembali mengoarkan janji merenovasi Teladan secepatnya. Bahkan anggaran untuk perbaikan stadion tersebut akan dirangkum dalam APBD senilai Rp100 miliar untuk renovasi infrastruktur baik Teladan maupun pembangunan sport center Kota Medan. “Kita akan perjuangkan dari dana APBN. Tentunya yang mendesak perbaikan sarana olahraga itu salah satunya adalah StadionTeladan,” ujarnya dalam acara buka puasa bersama KONI Medan dengan insan olahraga di Hotel Garuda Plaza Medan, Rabu (24/8). Mengingat perbaikan Stadion Teladan mutlak dilakukan secepatnya agar PSMS bisa lolos verifikasi dari PSSI dan AFC,

Waspada/Austin Antariksa

KONDISI Stadion Teladan yang kian memprihatinkan perlu segera dibenahi guna mendukung niat PSMS Medan tampil di kompetisi mendatang. Rahudman menjanjikan pihaknya akan lakukan pembenahan secara bertahap sekalipun dengan dana terbatas. “Selain memperjuangkan dana APBN, kita juga akan memperbaiki Stadion Teladan agar nanti dapat lolos verifikasi

pura. Kami butuh bantuan doa dari masyarakat Indonesia. Jika tercapai ini akan menjadi sejarah dalam bola basket putri yang sebelumnya tidak pernah terjadi,” kata mantan Ketua Umum PB Perbasi, Noviantika Nasution, yang kini anggota FIBA Asia Women Representative. Menurut Asisten Manajer Timnas, Cecilia Dwi Maya Siswari, pada kuarter awal pemain bermain dengan tempo yang lambat sehingga membuat serangan kurang agresif. Namun, perubahan formasi dan pola permainan menjadikan Jacklien Ibo cs mampu unggul 17-14. Di kuarter kedua, pelatih menginstruksikan pemain meningkatkan serangan. Dengan disiplin tinggi,Wulan Ayunigrum memimpin teman-temannya. Poin demi poin terus diraih. Hasilnya, kuarter kedua ini ditutup

timnas dengan keunggulan 35-21. Unggul dalam dua kuarter pertama dan bangkitnya Uzbekistan membuat pertahanan timnas melemah. Uzbekistan pun memperpendek selisih poin menjadi 48-50. Meski demikian, semangat timnas putri tidak menurun. Berkat pertahanan kokoh dalam satu menit terakhir, Indonesia menjaga keunggulan mereka. “Kunci kemenangan ini adalah disiplin. Meski sedikit lambat pada kuarter pertama, pelan tapi pasti anak-anak mampu menguasai dan memenangkan pertandingan,” kata Cecilia. Pada pertandingan tersebut, top skor timnas disandang kapten tim,Wulan Ayuningrum, yang mengoleksi 20 angka disusul Jacklien Ibo 17 poin 11 rebound. (m33/ant)

JAKARTA (Waspada): Munas PP IMI dipastikan bakal digelar pada 16-17 Desember mendatang di Solo. PP IMI beserta Pengprov IMI Solo akan segera membentuk kepanitiaan menyusun segala persiapan menggelar pesta demokrasi induk organisasi olahraga automotif nasional tersebut. Munas kali ini sangat penting karena akan mengagendakan pemilihan Ketua Umum PP IMI baru dan pertanggungjawaban dari pengurus lama. Untuk pendaftaran calon ketua umum sendiri kemungkinan akan dimulai Oktober nanti. “Idealnya dua bulan sebelum munas, panitia pendaftaran calon ketua umum sudah ter-

bentuk. Dalam waktu dekat, kami akan membentuk panitianya. Nantinya, sebagian besar dari Jawa Tengah selaku tuan rumah kali ini,” kata Juliari Batubara, Ketua Umum PP IMI di Jakarta, Selasa (23/8) malam. Dikatakan, Munas nanti akan dijadikan ajang evaluasi terhadap kinerja pengurus lama. Selain itu, Juliari mengaku puas karena bisa mundur di saat prestasi pebalap nasional sedang melejit dan bangkit. “Jadi bisa dibilang, saya mundur dengan happy ending. Ini sangat menyenangkan dan melegakan ketimbang mundur dengan tekanan publik atau pihak lain,” kata Ari, sapaan akrabnya.

Problem Catur

TTS TOPIK

Putih melangkah, mematikan lawannya empat langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1 A

B

C

D

E

F

Ari sendiri tak bisa lagi mencalonkan diri karena sudah menjabat selama dua periode. Untuk calon penggantinya, Ari mengaku tak punya jagoan atau tak tahu siapa yang akan menjadi kandidat kuat. Pada kesempatan itu, PP IMI juga memberikan santunan kepada anak yatim dan penghargaan kepada dua pebalap nasional, yaitu Rafid Topan dan Wawan. Kedua pebalap ini tengah mempersiapkan diri tampil pada Asian Nations Cup di Jepang, 28 Agustus nanti. “Saya menargetkan juara lagi di Jepang nanti karena ini membawa nama bangsa,” kata Topan. (yuslan)

G

H

terealisasi. “Selain Teladan harus diperbaiki. Kita juga perlu sport center. Dengan adanya sport center, olahraga Kota Medan diyakini bakal lebih berprestasi,” tandas Opunk, sapaan akrab Zulhifzi. (m33)

Renovasi Sarana Olahraga

Waspada/ist

MEDAN (Waspada): Untuk melakukan renovasi sarana olahraga dan pembuatan sport center di Kota Medan, Pemko Medan sedang memperjuangkan dana Rp100 miliar dari Anggaran Pendapatan Belanja Negara (APBN). Demikian dikatakan Wali Kota Medan Drs Rahudman Harahap MM (foto), saat acara buka puasa bersama KONI Medan dan insan olahraga di Garuda Plaza Hotel Medan, Rabu (24/8). Menurut Wali Kota, sarana olahraga di kota ini memang kurang memadai, termasuk Stadion Teladan. Namun menurutnya, Pemko akan terus berusaha untuk memperbaiki sarana tersebut. Dikatakan, selain memperjuangkan dana APBN, dengan anggaran terbatas pihaknya juga

sehingga prestasi olahraga Kota Medan semakin baik di masa mendatang,” ucap pria yang akrab disapa “Opunk Ladon” itu. Opunk menilai sarana olahraga Kota Medan saat ini memang butuh perbaikan. Oleh karena itu, pihaknya berharap agar sport center yang selama ini diidam-idamkan dapat terealisasi daalm waktu dekat. “Dengan adanya sport center, olahraga Kota Medan diyakini bakal lebih berprestasi,” tandasnya. Buka puasa tersebut turut dihadiriWakil Ketua DPRD Kota Medan, Wakil Wali Kota Medan Drs Dzulmi Eldin, Ketua PWI Sumut M Syahrir, Penasehat KONI Medan Affifudin Lubis, sejumlah pengcab olahraga, pengurus PSMS, atlet, dan undangan lainnya. (m47)

akan memperbaiki Stadion Teladan agar lolos verifikasi AFC dan PSMS Medan tetap bisa bermain di stadion tersebut. Melalui buka puasa bersama tersebut, Rahudman mengharapkan, tali silaturahmi antara sesama dapat ditingkatkan dalam mengembangkan olahraga Kota Medan. “KONI Medan patut didukung semua pihak dalam melahirkan atlet berprestasi. Mari kita bergandengan tangan untuk meningkatkan prestasi olahraga Kota Medan ini,” ungkapnya. Ketua KONI Medan, Drs Zulhifzi Lubis, mengatakan, meski dalam bulan Ramadhan, KONI Medan tetap beraktivitas seperti biasa. Dikatakan, atlet juga tetap melakukan latihan. “Karena itu, Ramadhan ini diharapkan membawa hikmah,

Peringkat Indonesia Naik Enam Tangga, Belanda Teratas ZURICH (Waspada): Hasil lumayan didapat Indonesia dalam daftar peringkat yang

dikeluarkan FIFA, Rabu (24/8). Pasalnya, pasukan Garuda naik enam tangga menjadi posisi 131,

PSSI Sumut Kritik PSSI Penunjukan Caretaker

IMI Pilih Munas Di Solo

pembenahan tersebut. Sebelumnya, Ketua KONI Medan, Zulhifzi Lubis, menilai sarana olahraga Kota Medan saat ini memang butuh perbaikan. Karena itu, pihaknya berharap agar sport center yang selama ini diidam-idamkan dapat

Pemko Perjuangkan APBN

Basket Putri Berpeluang Cetak Sejarah Asia NAGASAKI, Jepang (Waspada): Tim bola basket putri Indonesia berpeluang mencetak sejarah di ajang turnamen 24th FIBA Asia Women yang berlangsung di Nagasaki, Jepang, Rabu (24/8). Setelah menang atas Sri Lanka dan Malaysia, tim Merah Putih kembali meraih hasil gemilang dengan menaklukkan Uzbekistan 68-65. Meski sempat kalah dari Kazakhstan, tim putri Indonesia berpeluang menoreh tinta emas jika pada laga Kamis (25/8) ini mampu mengalahkan Singapura. Dengan mengalahkan Singapura, Wulan Ayuningrum cs akan menjadi juara di level dua sekaligus meraih tiket playoff promosi ke level 1 melawan peringkat enam di level 1 antara India atau Lebanon. “Mudah-mudahan tim kita bisa menang melawan Singa-

AFC sekaligus PSMS Medan dapat menjadikannya sebagai home base,” ujarnya menyadari harapan masyarakat Medan agar PSMS bisa berlaga di kompetisi level tertinggi. Kendati begitu, Rahudman belum bisa menjanjikan realisasi

MEDAN (Waspada): Keputusan PSSI menetapkan Bernhard Limbong sebagai caretaker PSSI Sumut dinilai menyalahi mekanisme organisasi. Hal itu disampaikan Idrus Junaidi yang sempat menjadi Pelaksana Tugas (Plt) Ketua Pengprov PSSI Sumut, Rabu (24/8). Idrus menilai keputusan PSSI memilih Limbong sebagai caretaker dan mengambil alih pengawasan PSSI Sumut, juga berimbas dirinya bertugas mempersiapkan pelaksanaan Musyawarah Olahraga Provinsi Luar Biasa (Musorprovlub) PSSI Sumut. Idrus mengatakan, sebelum menetapkan caretaker, PSSI seharusnya lebih dulu membekukan kepengurusan PSSI Sumut. Menurut Idrus, pengangkatan Limbong tidak menjadi masalah, namun dia menilai roda organisasi yang dijalankan PSSI sudah keliru. “Sedikit koreksi untuk PSSI dalam menjalankan organisasi, jangan bersalahan karena nanti Musprovlub jadi cacat hukum,” paparnya. Pembekuan sebelum pengambilalihan, menurut Idrus, adalah hal yang ditempuh di setiap organisasi. Dia mencontohkan, pembentukan Komite Normalisasi (KN) PSSI yang lalu juga dilakukan setelah kepengurusan Nurdin Halid cs dibekukan. “Buat dulu pembekuan terhadap Pengprov PSSI Sumut, seperti saat kepengurusan Nurdin Halid dibekukan. Bukan membentuk KN, baru membekukan Nurdin Halid,” ujar Idrus lagi. (m33)

SANTAPAN RAMADHAN

Mendatar

1. Pintunya dibuka selama Ramadhan, akan menjadi tempat kekal bagi umat Muhammad, kecuali yang enggan masuk ke dalamnya. 3. Surga (Arab). 6. Karunia; Orang masuk surga karena ______ dari Allah, bukan karena amalnya (HR Muslim dari Abu Hurairah dan Jabir r.a.) 7. Tulis Benar atau Salah. Mayoritas penghuni surga adalah orangorang miskin dan orang-orang sengsara hidupnya di dunia. (Hadis: Yang dinamakan miskin, tidak termasuk orang yang meminta-minta kepada manusia). 8. Jabal (Ash Shu’uud adalah jabal api setinggi 70 tahun perjalanan, terus menerus dipanjat orang kafir sebagai upaya lari dari neraka). 10. Neraka yang diperuntukkan bagi pengumpat dan pencela yang mengumpulkan harta dan menghitung-hitungnya (QS Al Humazah). 13. Jannatul _____ (Pilih: Mirad, Marut atau Miras) adalah surga untuk mereka yang kafir, kemudian beriman. 15. Jannatul _____ (Pilih: Ikhtiyar, Ikhtisas atau Ikhdinas) adalah surga untuk siapa saja yang dikehendaki Allah, termasuk orang-orang hilang ingatan). 17. Abu _____, sahabat Rasulullah yang dijamin masuk surga.

sementara Belanda sukses menggeser Spanyol dari puncak. Diambil dari situs resmi FIFA, Belanda merebut posisi Spanyol sebagai tim terbaik dunia saat ini. Salah satu penyebab lengsernya David Villa cs dikarenakan kekalahan La Furia Roja dari Italia pada laga ujicoba beberapa waktu lalu. Di lain pihak, kemenangan

Jerman atas Brazil juga membuat posisi Der Panser stabil di posisi tiga diikuti Inggris dan Uruguay. Tim Samba sendiri harus rela melorot dua tangga ke posisi enam. Di kawasan Asia Tenggara, Indonesia hanya menjadi tim terbaik keempat di bawah Vietnam yang justru naik 16 tingkat. Tim terbaik Asia Tenggara masih dipegang oleh Thailand

(120), lalu Singapura danVietnam (129). Juara Piala AFF, Malaysia, hanya menempati peringkat 146 dunia. Untuk peringkat AFC, Indonesia duduk di posisi 20 tim terbaik Asia. Dengan demikian, 10 Besar peringkat FIFA dihuni Belanda, Spanyol, Jerman, Inggris, Uruguay, Brazil, Italia, Portugal, Argentina, dan Kroasia. (m33/ini)

Antara

TIMNAS Indonesia naik enam tingkat sekaligus lolos 20 besar tim terbaik di Asia saat ini. 18. Dalam QS 111, dia yang akan masuk neraka bersama isterinya, tukang fitnah. 20. Puasa (Para ahlinya masuk dari pintu surga Ar Rayyan). 21. Nama surga utama (mohon yang ini kepada Allah ketika berdoa, kata sabda Rasulullah).

Menurun

1. TulisBenar atau Salah: Penghuni surga masih diwajibkan berpuasa. 2. Bawaan Dajjal yang tidak boleh diminum karena itu adalah api. 3. Neraka paling bawah. 4. Lawan kata haram. 5. Tenda (Di surga terbuat dari permata, lihat juga No. 10 Menurun). 9. Tempat siksa berapi (Ada tujuh pintu yang jarak satu sama lainnya sejauh 70 tahun perjalanan). 11. Dinding (tingginya di neraka 40 tahun perjalanan). 12. Salah satu jenis permata (berbentuk kemah sepanjang 60 mil untuk orang mukmin di surga). 14. Bilal bin ____ (Pilih: Kabah, Rabah atau Tabah), disebut “ahli surga”, tak pernah putus wudhunya dalam masa yang lama. 16. Diusir dari surga akhirnya akan masuk neraka (Setan dan pengikutnya masuk neraka jahanam). 19. ___ bin Abu Talib, termasuk 10 sahabat Rasulullah yang dijamin masuk surga.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu 15 menit. Jawabannya lihat di halaman A2 kolom 1.

9

6 1 8 5 4 3

1 6 7

9 8 3 6

3

8 4 2 5

8 1 4

8 2 1 4 4 8

5 h218


Sport

A8

WASPADA Kamis 25 Agustus 2011

Wozniacki Tak Peduli Gempa NEW YORK, AS (Waspada): Gempa bumi membuat pertandingan dihentikan dan terpaksa ada evakuasi di New Haven Terbuka. Meski demikian, kondisi itu tidak menghentikan petenis nomor satu dunia, Caroline Wozniacki (foto), maju ke putaran kedua dengan kemenangan 6-3, 6-0 atas Polona Hercog (Slovenia), Rabu (24/8). Setelah mengalami kekalahan di Toronto dan Cincinnati,

Wozniacki akhirnya menemukan bentuk permainannya pada

Rossi Berharap Tuah Ducati

AP

20 Besar Unggulan AS Terbuka 1. Caroline Wozniacki (Denmark) 2. Vera Zvonareva (Rusia) 3. Maria Sharapova (Rusia) 4. Victoria Azarenka (Belarus) 5. Petra Kvitova (Rep Ceko) 6. Li Na (China) 7. Francesca Schiavone (Italia) 8. Marion Bartoli (Perancis) 9. Samantha Stosur (Australia) 10. Andrea Petkovic (Jerman)

11. Jelena Jankovic (Serbia) 12. Agnieszka Radwanska (Polandia) 13. Shuai Peng (China) 14. Dominika Cibulkova (Slovakia) 15. Svetlana Kuznetsova (Rusia) 16. Ana Ivanovic (Serbia) 17. Anastasia Pavlyuchenkova (Rusia) 18. Roberta Vinci (Italia) 19. Julia Goerges, (Jerman) 20. Yanina Wickmayer (Belgia)

INDIANAPOLIS, AS (Waspada): Mampu menjadi juara MotoGP Indianapolis pada 2008 silam jelas menjadi kenangan positif buat Valentino Rossi (foto). Kemenangan itu pun terasa semakin spesial karena The Doctor meraihnya di debut perdana pada Sirkuit Indianapolis Motor Speedway. Kini, tiga tahun berselang dan Rossi akan mencoba untuk mengulang sukses di sirkuit legendaris milik Negeri Paman Sam itu, Minggu (28/8) nanti. Rossi pun sadar balapan nanti tidak akan mudah, lantaran trek yang sulit ditaklukkan. Kendati sukar, ada AP angin segar yang berhembus jelang balapan nanti. VR46 mengindikasikan Indianapolis sangat cocok dengan karakteristik tunggangannya, yakni Ducati GP11.1. Antusiasme Rossi pun semakin menggebu melihat grafik menanjak Ducati dalam balapan dan kualifikasi di MotoGP Republik Ceko dua pekan silam. “Indianapolis trek yang sulit, meskipun itu tidak persis salah satu trek favorit saya, kami akan lihat bagaimana performa kami dengan Ducati,� kata Rossi, Rabu (24/8). Rossi boleh ambisius menatap balapan di GP Indianapolis, menyusul hasil positif yang didapatnya di Brno dua pekan silam. Walau tidak meraih kemenangan, setidaknya pembalap 33 tahun tersebut telah menunjukkan sinyal kebangkitan. (m33/auto)

laga di lapangan keras itu. Pada laga pemanasan terakhir menjelang AS Terbuka itu, petenis Denmark tersebut menang dalam tempo 73 menit. Dalam usaha menyabet gelar keempat di New Haven,Wozniacki itu mengawali permainan dengan lamban sebelum memimpin 5-3. Tak lama berselang, Wozniacki melancarkan servis untuk memenangi set pertama.

Sangratulalumenunjukkankelas permainannya dengan menekan Hercog untuk memenangi set kedua dengan skor telak. Sebelumnya, pendukung harus menunggu untuk menyaksikan pertandingan setelah tertunda akibat gempa bumi dengan kekuatan 5,9 SR yang menggoyang kawasan teluk timur Amerika Serikat (AS). Gempa itu sendiri berpusat di

Virgina dan terasa di Connecticut plus menggoyang kampus Universitas Yale. Di laga lain, petenis Rusia ElenaVesnina membuat kejutan kala mengalahkan unggulan ketujuh dari Serbia, Jelena Jankovic, 6-4, 2-6, 6-4. Sementara itu, Francesca Schiavone (Italia) menang mudah 6-2, 6-2 atas petenis Rumania, Monica Niculescu. (m33/ap)


Medan Metropolitan

WASPADA Kamis 25 Agustus 2011

B1

9 Napi Korupsi Dapat Remisi MEDAN (Waspada) : Sebanyak 9 narapidana kasus korupsi di Sumatera Utara, memperoleh remisi atau potongan masa tahanan dari Kementrian Hukum dan Hak Azasi Manusia (Kemenkum dan HAM) Sumut.

SALAH satu penampilan akrobat Oriental.

Waspada/ist

Akrobat Oriental Meriahkan Lebaran Di Hillpark MEDAN (Waspada): Akrobat Oriental yang popularitasnya sudah mencapai berbagai negara akan menyemarakkan perayaan Lebaran di Hillpark, Sibolangit. Informasi yang diperoleh Waspada, Rabu (24/8), selama Lebaran, obyek wisata Hillpark akan dibuka untuk umum setiap hari dengan menyuguhkan berbagai hiburan. Selain akrobat Oriental, pusat hiburan itu juga menyuguhkan live band, parade maskot, magic show, dance dan games berhadiah. Sejumlah wahana permainan juga sudah ditambah guna memeriahkan suasana Lebaran tahun ini. Untuk tiket masuk, menurut Manager Hillpark Awi, pengunjung akan dimanjakan dengan harga tiket yang semurah mungkin. ‘’Ada dua kategori tiket yang kita siapkan. Pertama tiket seharga Rp20.000 dengan fasilitas gratis soft drink. Kemudian, tiket seharga Rp60.000 dengan fasilitas gratis soft drink dan 15 wahana permainan yang ada di Hillpark,’’ katanya. Awi menambahkan, guna menyemarakkan masa liburan selama Lebaran, Hillpark telah mengemas acara semeriah mungkin untuk kepuasan pengunjungnya.(m09)

FK BUMN-Askes Gelar Pasar Murah MEDAN (Waspada): Untuk menstabilkan harga kebutuhan pokok menjelang Hari Raya Idul Fitri 1432 H, Forum Komunikasi (FK) BUMN dan PT Askes (Persero) Regional I menggelar pasar murah, Selasa (23/8). General Manager PT Askes Regional I Sumut-Aceh Dr. H. Ikhsan, MM mengatakan, kegiatan tersebut sesuai Instruksi Menteri Negara BUMN No: S-436/MBU/2011 tanggal 25 Juli 2011. Sebagai salah satu BUMN, PT Askes (Persero) Regional I bekerjasama dengan FK BUMN diminta berpartisipasi membantu pemerintah menstabilkan harga bahan pokok menjelang hari besar keagamaan, seperti Idul Fitri 1432 H. Pasar murah yang digelar PT Askes dan FK BUMN tersebut menjual 500 paket bahan pokok. Setiap paket terdiri dari 10 kg beras, 2 kg gula putih dan 2 liter minyak goreng. Total keseluruhannya yakni beras 4 ton, gula putih 1 ton dan minyak goreng 1 ton. “Pasar murah yang dilaksanakan FK BUMN Sumut diharapkan dapat membantu masyarakat ekonomi menengah ke bawah dalam memenuhi kebutuhan pokok dan mencegah pedagang menaikkan harga menjelang Idul Fitri,” ungkapnya.(m25)

Kepala Divisi Pemasyarakatan Kementrian Hukum dan HAM Sumut Elly Lukman, Rabu (24/8) mengatakan ke sembilan narapidana itu berada di beberapa lembaga pemasyarakatan (lapas) dan rumah tahanan (rutan) se-Sumatera Utara. “Dua di Rutan Sipirok, satu di Rantau Prapat, satu di P Brandan, empat di Tj. Pura, dan satu di lapas militer. Dengan masa remisi mulai 15 hari hingga dua bulan,” ujarnya. Menurut Lukman, pihaknya tidak menutup kemungkinan adanya tambahan narapidana yang mendapatkan remisi lebaran pada tahun ini. Sesuai dengan pengajuan dari lembaga pemasyarakatan maupun rumah tahanan negara yang mengajukan para napinya untuk mendapatkan remisi lebaran ataupun Hari Raya Idul Fitri.

“Pemberian remisi bagi napi, merupakan penghargaan hukuman yang diberikan kepada mereka selama menjalani hukuman. Dimana mereka menunjukan prestasi, dedikasi, dan disiplin tinggi dalam mengikuti program pembinaan,” ujarnya. Hal itu sesuai dengan persyaratan yang ditentukan dalam UU No 12 Tahun 1995 tentang persyaratan dan Keputusan Presiden No 174 Tahun 1999 tentang remisi. Dan dilakukan pemerintah tidak hanya setiap tanggal 17 Agustus, melainkan juga pada hari-hari besar keagamaan lainnya seperti hari Raya Idul Fitri, Natal,Waisak dan Nyepi. Dikatakan Lukman, narapidana kasus korupsi yang mendapatkan remisi adalah mereka yang terbukti melakukan korupsi dengan kerugian negara di bawah Rp1 miliar. “Sedangkan

Sumbangan Ramadhan Fair Disalurkan Kepada Anak Yatim BELAWAN (Waspada): Sebanyak Rp23.038.000 dana sumbangan penonton pertunjukan Upik pada pembukaan R a m a d h a n Fa i r M a b a r, dibagikan kepada 230 anak yatim dari empat kecamatan di Medan Utara. Penyerahan itu dilakukan secara simbolis di aula Kantor Kecamatan Medan Deli oleh

Sekcam Indra Mulia Nasution, Selasa (23/8). Sedangkan untuk Kecamatan Medan Marelan bantuan diserahkan kepada Thamrin Lubis, Kecamatan Belawan diterima Selamet Panjaitan dan untuk Kecamatan Medan Labuhan diserahkan kepada H Mahmudin, ketiganya Kasi Kesra. Camat Medan Deli Hj Yus-

IAIN Terbitkan Buku Khotbah MEDAN (Waspada): Lembaga Pengabdian Masyarakat (LPM) IAIN-SU menerbitkan buku khotbah Idul Fitri 1432 H/ 2011 M dalam berbagai topik aktual sebagai menyahuti perkembangan masyarakat di era globalisasi. Menurut Ketua LPM IAINS U D R H Ha s a n M a n s u r Nasution MA, penulis khutbah selain dirinya juga ada Prof DR

Lahmuddin Lubis M.Ed, Prof DR Amroeni Dradjat M.Ag, Drs H Bukhari Muslim Nasution MA, dan Drs Muhammad Husni Ritonga MA. Dikatakannya, buku khutbah tersebut tidak diperjualbelikan, melainkan dibagikan kepada para khatib secara gratis untuk menjadi tambahan bacaan para ustadz dalam menyambut Idul Fitri. (m41)

3.000 TKI Asal Sumut Bakal Mudik MEDAN (Waspada): Dari 15.000 Tenaga Kerja Indonesia (TKI) asal Sumatera Utara yang bekerja di sejumlah sektor industri di Malaysia, sekitar 3.000 di antaranya bakal mudik menjelang Lebaran 2011. “Puncak arus mudik TKI dari Malaysia diperkirakan terjadi pada H-2,” kata Amir Hakim, staf Pos Pengendalian (Posdal) TKI di terminal kedatangan luar negeri Bandara Polo-

nia Medan ketika dikonfirmasi Waspada, Rabu (24/8). Amir memastikan sekitar 3.000 TKI akan merayakan Idul Fitri bersama keluarga di kampung halamannya. “Tidak hanya TKI asal Sumut yang bekerja di industri Selangor dan Sebrang Free Penang, bahkan TKI asal Aceh juga bakal pulang kampung melalui Bandara Polonia,” ujarnya. Menurut Amir, 3.000 TKI

tersebut dikirim melalui sejumlah Perusahaan Pengerah Tenaga Kerja Indonesia (PPTKI) di Sumut. Mereka dikontrak bekerja di perusahaan Malaysia selama dua tahun. “Sebagian dari mereka sudah ada yang mudik sejak minggu lalu. Bahkan, jumlah TKI yang mudik sejak Rabu (24/ 8) pagi hingga malam mencapai 150 orang,” ujarnya seraya menambahkan para TKI ini

menggunakan penerbangan Air Asia, Fire Fly, Sriwijaya Air bahkan Malaysia Airlines System (MAS). Sementara itu Bahriunsyah, staf Bea Cukai Bandara Polonia Medan saat dikonfirmasi Waspada mengatakan, banyak TKI asal Sumut yang sudah pulang ke kampung halamannya. Umumnya, para TKI tersebut ditempatkan di Selangor dan Penang. (m32)

Perubuhan Masjid Al Ikhlas Langgar PP No. 24 Tahun 1997 MEDAN (Waspada) : Sidang gugatan perubuhan Masjid AlIkhlas digelar di Gedung Pengadilan Tata Usaha Negara Jln. Listrik, Kamis (25/8). Sidang tersebut beragenda mendengarkan jawaban dari pihak tergugat yaitu pihak Badan Pertanahan Nasional (BPN). Ketua Tim Advokasi Umat Islam HMK Aldian Pinem SH, MH, ketika ditemui di kantornya, menegaskan, sesuai jawaban dari pihak BPN tersebut, pihaknya menemukan bahwa perubuhan mesjid Al-Ikhlas sangat bertentangan dengan Peraturan Pemerintah (PP) No 24 tahun 1997, tentang Agraria. “Ada empat point yang

menjadi persoalan dalam perubuhan masjid tersebut,” ujar Aldian kepada Waspada di kantornya, Senin (22/8). Sebelum mengeluarkan sertifikat hak pakai, lanjut Aldian, seharusnya pihak Badan Pertanahan Nasional melakukan investigasi ke lapangan. Apakah di lahan yang diajukan hak pakainya terdapat rumah ibadah atau tidak. Jika ada, pihak BPN tidak boleh mengeluarkan sertifikat hak pakainya. “Kita melihat bahwa pihak BPN tidak pernah melakukan investigasi ke lapangan dan langsung mengeluarkan sertifikat hak pakai,” tambahnya. Selain itu, dalam pengelua-

ran sertifikat hak pakai itu terdapat jangka waktunya. “Dalam perkara ini, kita juga tidak melihat adanya jangka waktu dalam pemakaian lahan tersebut,” tambah Aldian. Tak hanya itu, dalam pengeluaran sertifikat hak pakai, pihak BPN juga harus meminta surat silang sengketa (persetujuan) dari pihak pengaju sertifikat hak pakai itu yang berguna untuk mengantisipasi adanya keberatan dari pihak lain (tetangga). Terakhir, sketsa dalam sertifikat hak pakai yang dikeluarkan tidak boleh kosong.“Artinya, denah atau sketsa yang dibuat harus sesuai dengan kondisi di

lapangan,” tambahnya lagi. Aldian juga menyayangkan sikap BPN yang memasukkan lahan mesjid seluas 1600 m2 ke dalam lahan yang diajukan sertifikat hak pakainya hingga merugikan umat Islam. “Lahan yang diajukan sertifikat hak pakainya jadi bertambah luas hingga 9825 m2. Karena di dalam lahan itu sudah termasuk tanah mesjid seluas 1600 m2,” ujarnya seraya menambahkan dalam sidang yang akan hari ini, pihaknya akan mengajukan replik dari Badan Kenaziran Mesjid untuk menyangkal jawaban dari pihak BPN dan Menhan tersebut. (m38)

Kenaikan TDL Seperti Simalakama MEDAN (Waspada): Rencana kebijakan pemerintah terkait kenaikan Tarif Dasar Listrik (TDL) sebesar 10 persen per April 2012, bagi industri dan rumah tangga pengguna daya listrik di atas 900 watt seperti simalakama bagi konsumen. Sebab kenaikan TDL dapat dikategorikan positif bila mengacu pada tiga indikator fundamental. Ketiga indikator tersebut, kata Direktur Lembaga Advokasi dan Perlindungan Konsumen (LAPK) Farid Wajdi, pertama, elektrifikasi yaitu kenaikan yang dilandasi penambahan jaringan listrik baru bagi

masyarakat yang belum mengakses pasokan listrik. “Kedua,perusahaan‘se-trum’ ini masih lemah sisi keuangan sehingga perlu ditingkatkan lagi. PLN dinilai sebagai perusahaan “sakit” karena bernafas dalam lumpur. Kenaikan dinilai logis bila motifnya untuk merevitalisasi fungsi dan kinerja pelayanan. Optimalisasi pelayanan tentu akan berimbas pada penghematan ongkos produksi industri dan rumah tangga,” katanya kepada Waspada, Minggu (21/8). Ketiga, lanjut Farid, motifnya pengurangan subsidi demi penyehatan APBN. Subsidi

bagi mereka yang merugikan negara lebih dari Rp1 miliar maka akan dikenakan Peraturan Presiden No. 28 Tahun 2006, dimana narapidana tersebut tidak akan mendapatkan remisi pada hari besar keagamaan,” sebutnya. Sebelumnya Kemenkum dan HAM menyatakan adanya tambahan remisi umum sebahagian (RUS I) narapidana sebanyak 342, remisi umum susulan bebas (RUS II) sebanyak 45, remisi umum (RU I) korupsi sebanyak 20, remisi umum bebas (RUS II) korupsi sebanyak 6 orang. “Untuk remisi khusus sebahagian (RK I) korupsi sebanyak 9 orang, sedangkan remisi khusus bebas (RK II) korupsi tidak ada,” ujar Lukman. Dia menerangkan, remisi umum akan dikeluarkan pada HUT RI atau pada 17 Agustus, sedangkan remisi khusus diumumkan pada hari besar keagamaan. “Jadi untuk tahun ini yang mendapat remisi khusus ini sebanyak 9 orang bagi mereka yang terkena tindak pidana korupsi,” lanjutnya. (m38)

dialihkan pada pemberdayaan sektor lain, semisal pendidikan, kesehatan serta peningkatan sarana-prasarana infrastruktur publik. Di sisi lain, kenaikan dapat sebagai faktor negatif jika tidak mampu melakukan ekspansi elektrifikasi. Menurutnya, selama ini kenaikan TDL dinilai kontraproduktif dengan kinerja pelayanan PT PLN secara keseluruhan. Alhasil, pasokan dana sedemikian besar terserap dalam pengelolaan buruk dan rentan pada penyelewengan penggunaan anggaran. Energi korupsi pun semakin besar menyerap

potensi TDL, padahal kenaikan TDL harusnya berbanding lurus dengan kepuasan pelayanan. Kalau tidak ada peningkatan pelayanan maka rencana kenaikanTDL itu terasa seperti teror psikologis bagi masyarakat. “Pemerintah harus turun tangan dan tidak cukup sekadar menaikkan TDL. Beban ongkos produksi untuk membayar listrik sangat signifikan pada sektor industri.Industrikkecilmenengah bakal terjun bebas kalau tidak disokong dengan kebijakan kemudahan dan fasilitas memadai, mengingat kompetisi global makin tajam,” katanya. (m41)

darlina, S.Sos mengatakan, untuk kecamatan Medan Labuhan, Medan Marelan dan Medan Belawan, jumlah anak yatim yang menerima pembagian dana sumbanganitusebanyak30orang untuk setiap kecamatan. Sementara untuk Kecamatan Medan Deli jumlah penerima sebanyak 40 orang yang dibagi pada masing-masing kelurahan sebanyak 20 orang, kecuali untuk Kelurahan Mabar berjumlah 40 orang. “Jumlah penerima di Mabar lebih besar karena mereka tuan rumah. Sedangkan, sisanya yakni Rp38 ribu untuk biaya administrasi,” tutur Yusdarlina. (h03)

Waspada/Amir Syarifuddin

PLT Gubsu Gatot Pujonugroho dan Menkominfo Tiffatul Sembiring bersama ratusan jamaah membaca ayat suci Alquran dalam proses itikaf di Masjid Agung Medan, Selasa (23/8) dinihari.

Ratusan Jamaah Itikaf Bersama Menkominfo Dan Plt Gubsu MEDAN (Waspada): Ratusan jamaah melakukan itikaf (berdiam di masjid) bersama Menteri Komunikasi dan Informasi Ir H Tiffatul Sembiring dan Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, di Masjid Agung Medan, Selasa (23/8) dinihari. Prosesi itikaf tersebut merupakan bagian dari agenda kedatangan Menkominfo ke Medan dalam rangkaian peringatan Nuzul Quran yang diadakan di Masjid Agung Medan. Usai mendengarkan ceramah dari Tifatul Sembiring, Senin (22/8) malam, ratusan jamaah baik lakilaki maupun perempuan mulai mempersiapkan diri untuk melaksanakan itikaf di sisi bagian dalam maupun bagian teras luar masjid. Imam Masjid Agung Medan Dr H Abdullah AS mengatakan, di setiap malam ganjil di sepuluh hari terakhir Ramadhan, Masjid Agung Medan memang memfasilitasi jamaah yang ingin beritikaf di masjid. Mulai dari panduan zikir, shalat tahajud berjamaah hingga makan sahur. “Khusus malam ini karena bersama Pak Menteri dan Pak Plt Gubernur, jumlah jamaah yang hadir lebih ramai. Kalau pada malam ganjil sebelumnya hanya berkisar 340 jamaah, malam ini jumlahnya hampir seribu jamaah,” ujarnya. Rangkaian proses itikaf malam itu meliputi zikir, membaca Alquran, melaksanakan shalat

sunat, tahajud berjamaah, dan makan sahur bersama. Khusus untuk malam itikaf bersama Menkominfo dan Plt Gubsu tersebut proses zikir berjamaah hanya dilakukan satu gelombang sebelum tahajud. Sementara setelah shalat tahajud, proses zikir berjamaah diganti dengan bertahannuz (menyendiri) yakni proses menyendiri untuk bermuhasabah maupun berdoa memohon keampunan dan mendekatkan diri kepada Allah di dalam masjid. Pelaksanaan shalat tahajud berjamaah pada malam itikaf tersebut, diimami langsung oleh Menkominfo Tifatul Sembiring. Usai melaksanakan shalat tahajud berjamaah, Plt Gubsu dan Menkominfo terlihat melanjutkan ibadah dengan membaca Alquran di mihrab bagian depan dalam masjid hingga menjelang sahur. Selain diikuti ratusan jamaah, itikaf malam ke-23 Ramadhan di Masjid Agung Medan tersebut juga diikuti oleh anggota DPR RI dari Fraksi PKS Anshori Siregar dan Chairul Apt. Terlihat hadir juga sejumlah pengurus DPW PKS Sumut, Ketua Umum HM Hafez, Lc, MA, Sekretaris Umum SatryaYudhaWibowo serta anggota Fraksi PKS DPRD Sumut dan Kota Medan. Usai bersantap sahur dan shalat subuh berjamaah, Plt Gubsu beserta masyarakat jamaah itikaf, satu per satu meninggalkan masjid melakukan aktivitas kerja seperti biasa.(m28)

Lulusan AMIK MBP Diminati Perusahaan Bonafit TAK banyak perguruan tinggi di Indonesia yang mampu menciptakan sarjananya (alumni) sebagai langganan perusahaan ternama maupun BUMN, termasuk pegawai negeri sipil (PNS). Hanya sebuah kualitas dan profesionalisme yang mampu menghasilkan sarjana jempolan yang selalu dilirik perusahaan bonafit. Akademi Manajemen Informatika Komputer Medan Business Polytechnic (AMIK MBP) Medan merupakan salahsatu perguruan tinggi yang mampu menempatkan posisinya di jalur langganan itu. Pengalaman dan keseriusan menjadikan AMIK MBP berhasil menyejajarkan kualitasnya dengan peguruan yang lebih tua, bahkan peguruan tinggi negeri sekalipun. Untuk saat ini saja, kampus yang berdiri di Jalan Letjend Jamin Ginting No 285-287 Padangbulan, Medan itu sudah berhasil keluar sebagai Pemenang Hibah Komptetisi Besaing (PHK) A-1 dari Dirjen Dikti pada tahun 2004-2005, Pemenang Hibah Komptetisi Bersaing (PHK) Peningkatan Mutu Pendidikan dari Dirjen Dikti tahun 2006, Pemenang Hibah Komptetsi Bersaing (PHK) Teknologi Informai dan Komunikasi (TIK) dari Dirjen Dikti tahun 2006, Penerima Penghargaan Tut Wurihandayani Award, serta penerima penghargaan Indonesia Development Award. Keberhasilan itu tak terlepas dari konsep (AMIK MBP) Medan sebagai suatu peguruan tinggi swasta yang komitmen menciptakan Sumber Daya Manusia (SDA) yang profesional, terampil, kreatif, dan inovatif di bidang informatika sesuai dengan kebutuhan pasar, serta mampu bersaing di era globaliasi yang semakin kompetitif. Sehingga bukan hal mustahil bila alumni AMIK MBP selalu dilirik perusahaan bonafit untuk dijadikan tenaga ahli. AMIK MBP mengelola program pendidikan kuliah singkat dan siap kerja dengan jenjang pendidikan D1 dan D3 jurusan Manajemen Informatika dan Teknik Informatika yang masing-masing jurusan telah terakeditasi dari BAN-PT Direktorat Jenderal Pendidikan Tinggi Negeri tanpa melalui ujian negara.

Kampus AMIK MBP Jalan Letjend Djamin Ginting No. 285-287 P. Bulan Medan. Pengakuan dari pemerintah itu dapat dibuktikan dengan kepecayaan masyarakat dan dunia industri terhadap AMIK MBP. Hingga tahun akademik 2010-2011 kampus ini telah meluluskan alumninya sebanyak 5642orangdantelahbanyakyang bekerja, baik di instansi pemerintah maupun instansi swasta, BUMN, Polri,TNI, Bank, dan lain sebagainya yang telah menyebar di seluruh wilayah Indonesia. Khusus tahun 2010 lulusan AMIK MBP Medan diterima di instansi pemerintah sebagai PNS sebanyak 225 orang, antara lain Kejaksaan, Pemprov, Pemko, guru dan sebagainya. Dalam menerapkan sistem pendidikannya, AMIK MBP disesuaikan dengan misi menjadi lembaga pendidikan terbaik pada bidang informatika, seperti mengadopsi sistem pendidikan untuk program D3 selama 3 tahun (6 semester = 115 SKS) dan untuk Program D1 selama 1 tahun (2 semester = 42 SKS). Menerapkan Sistem Kredit Semester (SKS) dalam mempercepat proses penyelesaian studi. Seistem pendidikan terdiri dari 75 persen raktik dan 25 persen teori. Menerapkan kurikulum berbasis kompetensi (KBK) yang disesuaikan dengan

kebutuhan pasar/industri. Strategi dan metode pembelajaran menggunakan metode ceramah, diskusi, demonstrasi secara tejadwal dan terstruktur. Untuk menunjang program pendidikan, AMIK MBP telah dilengkapi laboratorium computer multimedia (LCD, OHP, Laptop, Topex), laboratorium windows yang terkoneksi ke jaringan inernet, laboratorium jaringan (networking), dan laboratorium bahasa. Untuk perpustakaan, kampus ini telah tersedia perpustakaan manual dan elektronik, perpustakaan terkoneksi ke jaringan internet, tersedia buku-buku pegangan kuliah (diklat), tersedia textbooks, dan tersedia buku jurnal dan majalah ilmiah yang popular. Dan yang terpenting, AMIK MBP telah membina kerjasama dengan dunia industri/perusahaan seperti Bank BNI, Bank Niaga,k PT Telkom, IBM, Microsoft, Gama Tecno-UGM,

USM dan perusahaan-perusahaan ternama lainnya. Untuk beasiswa, kampus ini yang paling royal memberikan bantuan kepada mahasiswanya. Buktinya, untuk melaksanakan Tri Dharma Perguruan Tinggi, AMIK MBP tak hanya memberikan beasiswa kepada mahasiswa berprestasi, melainkan juga untuk mahasiswa kurang mampu. Masing-masing beasiswa itu akan didukung sumber dana dariYayasan MBP, Dirjen Dikti, Kopertis Wilayah I, dan perusahaan mitra kerja. Seluruh sarana pendukung itu semakin komplit dengan keberadaan gedung yang luas, asri dan milik sendiri. Belum lagi lokasi yang strategis dekat dengan kampus USU, ruangan full AC, kantin musolah, kantin, dan aula plus sarana olahraga. Dalam kesempatan ini AMIK MBP Mengucapkan Selamat Menunaikan Ibadah Puasa Ramadhan 1432 H(*)

Untuk saat ini penerimaan mahasiswa baru memasuki gelombang kedua yang telah dibuka 6 Juli 2011 hingga 8 Agustus 2011. Sedangkan gelombang tiga dibuka 8 Agustus 2011 hingga 12 Oktober 2011. Untuk masa pembekalan mahasiswa baru dijadwalkan 13 hingga 15 Oktober 2011.


Medan Metropolitan

B2

WASPADA Kamis 25 Agustus 2011

Enam Mahasiswa IAIN Terancam Dipecat MEDAN (Waspada): Akibat melakukan aksi unjuk rasa dan penutupan pintu gerbang kampus sehingga pegawai, dosen, maupun mahasiswa tidak bisa masuk untuk beraktivitas pada pelaksanaan Orientasi Pengenalan Akademik Kampus (OPAK) di Institut Agama Islam Negeri (IAIN) Sumatera Utara pada 12 Agustus 2011, enam mahasiswa terancam dikembalikan kepada orangtua atau dipecat. Hal tersebut disampaikan Rektor IAIN Prof. Nur Ahmad Fadhil Lubis dalam silaturahmi dengan wartawan di Ruang Sidang kampus IAIN, kemarin. Pada kesempatan itu, Rektor didampingi Pembantu Rektor (Purek) I Prof Dr Hasan As’ari, Purek II Prof Dr Dja’far Sidik, Purek III Prof Lahmudin Lubis serta staf dan kepala bagian di lingkungan IAIN lainnya. Keenam mahasiswa itu dinilai melakukan tindak pidana dan melanggar tata tertib keislaman IAIN, sedangkan beberapa mahasiswa lainnya sekedar ikut-ikutan. “Aksi dilakukan tanpa pemberitahuan. Berdasar tatib, tiga hari sebelum menggelar aksi seharusnya diberitahukan. Selain itu dalam Tatib IAIN tidak dibenarkan melakukan aksi pada hari Jumat. Kebetulan OPAK berlangsung pada Jumat,” ujarnya. Purek III Prof Lahmudin menambahkan, penggembokan pintu gerbang dan pembakaran ban oleh mahasiswa tersebut merupakan salah satu tindak pidana yang menghalang-halangi pegawai maupun dosen untuk menjalankan tugasnya. Selain itu, mahasiswa tersebut juga mengganggu dan mengancam mahasiswa yang

akan masuk ke kampus. “Mereka, mengancam mahasiswa baru bagi siapa yang masuk mengikuti OPAK akan dibunuh,” kata Lahmudin. Akibat kejadian itu, mahasiswa baru pada hari pertama masuk, pada hari kedua tidak berani datang. Selain itu juga, beberapa oknum mahasiswa, saat rektor akan memberikan kata sambutan, mikroponnya dirampas dan kontak listrik dicabut. Perilaku seperti ini, ujarnya, melanggar kode etik keislaman. Para mahasiswa yang melakukan demo juga tidak berpuasa. Mereka merokok dan minum. Karena itulah, pihak IAIN melaporkan ke Kapolsek setempat. Namun secara akademis, para dekan diminta menginventarisir mahasiswanya yang terlibat dalam aksi tersebut. Setelah itu, katanya, mahasiswa yang mengikuti aksi juga diberikan sanksi ke dalam tiga kategori sanksi teguran lisan, teguran administrasi dan pemecatan. Seperti yang diketahui, aksi yang dilakukan puluhan mahasiswa itu menuntut transparansi pengelolaan dana IAIN. Para demonstran menduga ada korupsi yang terjadi di IAIN yang dilakukan sejumlah petinggi IAIN. Menanggapi tudingan korupsi tersebut, rektor mengatakan, anggaran yang ditunjukkan para demonstran adalah anggaran 2010. Dia mengatakan, tidak benar adanya korupsi sebesar Rp72 miliar oleh sejumlah petinggi IAIN itu. (m41)

Waspada/Hamdani

PEMUSNAHAN PRODUK ILEGAL: Ribuan produk pangan dan kosmetik ilegal (tidak memiliki izin edar) dibakar di halaman Balai Besar Pengawas Obat dan Makanan (BBPOM) Medan, Rabu (24/8). Selama bulan suci Ramadhan, tim BBPOM Medan melakukan sampling terhadap produk pangan kadaluarsa dan tidak memiliki izin edar.

BBPOM Musnahkan Produk Bermasalah MEDAN (Waspada): Balai Besar Pengawas Obat dan Makanan (BBPOM) Medan memusnahkan ribuan produk bermasalah terdiri dari makanan kemasan, kosmetik dan obat tradisional, Rabu (24/8) pagi. Pemusnahan barang bukti senilai Rp102 juta tersebut berlangsung di halaman BBPOM Medan. Data diperoleh Waspada, produk kosmetik yang dimusnahkan terdiri dari 25 jenis sebanyak 1.509 kemasan. 6 Jenis obat tradisional yang mengan-

dung bahan kimia obat sebanyak 730 kemasan, serta 96 jenis produk pangan sebanyak 9.280 kemasan. Produk pangan yang dimus-

nahkan tersebut antara lain Susu Kedelai 330 ml, Popcorn Cracker, Jasmine Tea, King Logan Mamata, Milo 500 gram, biskuit Heong Peah dan Peanut Butter Sandwich. Produk kosmetik asal luar negeri yang tidak memiliki izin edar yakni Hazeline Snow, HazelineWhite and Natural, Citra Cream, Dove Soap,Vitamin C 99 dan Chiumin Bleaching. Sedangkan produk obat tradisional yang mengandung bahan kimia obat antara lain kapsul Asam Urat, kapsul

Linu Rat dan lainnya. “Ada 127 jenis produk yang dimusnahkan terdiri dari produk pangan, kosmetik dan obat tradisional. Produk tersebut diamankan sejak 2010 hingga pertengahan 2011. Nilai produk yang dimusnahkan yakni pangan Rp80 juta, kosmetik Rp20 jutadanobattradisionalRp2juta,” jelas Kepala BBPOM Medan Agus Prabowo kepada wartawan. Menurut Agus, produk yang dimusnahkan tersebut tidak memiliki izin edar, mengan-

dung bahan kimia obat (BKO) serta produk pangan kadaluarsa dan kemasannya rusak. Produk bermasalah ini diamankan dari 21 sarana di Sumatera Utara. Ada produk yang berasal dari luar negeri. “Selain produk yang dimusnahkan, masih ada ribuan produk bermasalah lainnya disimpandigudangBBPOMsenilaiRp1 milliar lebih. Sambil menunggu proses pengadilan, kita akan minta izin untuk memusnahkannya,” demikian Agus. (h02)

Malam Pergantian Tahun Habiskan Rp650 Juta MEDAN (Waspada): Pemerintah Kota Medan menganggarkan sebesar Rp650 juta untuk kegiatan pesta rakyat malam pergantian tahun pada 31 Desember mendatang. Anggaran itu hanya dihabiskan dalam satu malam. Kepala Dinas Kebudayaan dan Pariwisata Kota Medan Busral Manan kepada Waspada, Senin (22/8) mengatakan, anggaran sebesar itu digunakan untuk menggelar berbagai kegiatan, seperti festival budaya, pesta kembang api, dan penampilan artis ibu kota. Diungkapkannya, lokasi

kegiatan pesta malam pergantian tahun baru belum dipastikan apakah di Lapangan Merdeka atau Lapangan Benteng. “Belum tahu.Nanti ditenderkan dan ditentukan. Belum tentu di Lapangan Merdeka, karena tidak bisa digunakan sembarangan. Bisa saja di Lapangan Benteng atau lainnya,” katanya. Busral mengatakan, anggaran ini memang harus bersumber dari APBD. Apabila bersumber dari partisipasi pengusaha hiburan malam dikhawatirkan akan kembali menuai persoalan, seperti

tahun lalu. Kegiatan ini pun murni untuk hiburan masyarakat Kota Medan. Hanya, jenis dan bentuk kesenian yang akan ditampilkan belum bisa dipastikan. “Kalau dana partisipasi (pengusahared) lagi, takut bermasalah, ribut. Jadi, kami ambil dari APBD saja. Intinya untuk hiburan masyarakat. Seperti apa nantinya, saya belum tahu,” tuturnya. Ketua Komisi C DPRD Medan Jumadi mengatakan, secara pribadi dirinya menolak anggaran sebesar itu untuk kegiatan hura-hura dan tidak

ada manfaatnya. Menurut dia, anggaran sebesar itu tidak pantas dihabiskan hanya satu malam. Di sisi lain, masih banyak masyarakat yang kesulitan membeli beras di pasar murah. “Kami sudah menolak anggaran ini dialokasikan, tapi namanyaprosesdemokrasi,dana tersebut lolos juga. Ini tidak sesuai dengan kondisi sekarang, masih banyak masyarakat meninggalkan HP, baju, biar bisa beli beras murah dengan harga Rp24.000 untuk beberapa kilogram. Lebih baik dana itu dialokasikan untuk pasarmurahbiarsubsidisemakin besar,” ujarnya.

Politikus PKS ini menyarankan, untuk membiayai malam pergantian tahun, Pemko bisa melibatkan pihak ketiga, seperti pengelola hotel dan hiburan malam. Bila acaranya ramai dan semarak, maka mereka juga yang mendapat imbasnya, tepatnya seperti tahun lalu. “Buat saja seperti tahun lalu, tapi transparanlah, berapa disumbangkan, untuk apa saja, siapa penyumbang. Ributnya tahun lalu kan karena tidak jelas pendapatan, pengeluaran, dan sumbernya. Masing-masing oknum bermain,” sebutnya. (m50)

SMK Dr. Sjahrir Buka Puasa Bersama MEDAN (Waspada): Yayasan Pendidikan Dr. Sjahrir Medan sebagai pengelola SMK Dr. Sjahrir, Sabtu (20/8) mengadakan acara buka puasa bersama anak yatim Panti Asuhan Mamiyai AlIttihadiyah di gedung sekolah tersebut Jln.Perbaungan/Jln. Madong Lubis Medan. Acara diprakarsai siswa SMK Dr. Sjahrir tersebut dihadiri orangtua siswa serta masyarakat setempat. Sebelum berbuka, Al-Ustadz Awaluddin Pulungan, SH menyampaikan ceramah dengan tema “Mensyukuri Kehidupan dan Hargailah” dan mengajak umat Islam senantiasa bersyukur kepada Allah SWT. Sementara itu, Ketua Dewan Pembina Yayasan Pendidikan Dr. Sjahrir, Dra. Lily, MBA, MH menyambut baik ide para siswa SMK yang melakukan kegiatan sosial dan berbagi kasih dengan saudara-saudara mereka di panti asuhan. Lily berharap anak didik SMK Dr. Sjahrir selalu peduli kepada sesama dimanapun mereka berada, baik saat masih sekolah maupun setelah menyelesaikan pendidikan. Usai berbuka puasa, pihak Yayasan Pendidikan Dr. Sjahrir juga memberi bingkisan kepada anak-anak panti asuhan berupa paket perlengkapan sekolah. Lily mengatakan, untuk kegiatan tersebut, ketiga putrinya rela mengeluarkan sebagian tabungan mereka untuk diberikan kepada anak-anak panti asuhan tersebut. (m22)

Waspada/Ist

KETUA Dewan Pembina Yayasan Pendidikan Dr. Sjahrir, Dra. Lily, MBA, MH didampingi Kepala SMK Nurhajati, ST, SPd dan Dewan Pembina lainnya Janlie, SE, Ak memberikan cendera mata secara simbolis kepada anak-anak Panti Asuhan Mamiyai AlIttihadiyah.

Waspada/Ist

KETUA DPW PAN Sumut Syah Affandin foto bersama Ketua DPD PAN Medan dan pengurus lainnya pada acara buka puasa bersama dan pemberian santunan kepada yatim piatu di Rumah PAN Medan Jln. Brigjen Katamso, Selasa (23/4).

PAN Medan Jadi Contoh Baik MEDAN (Waspada): Ketua DPW PAN Sumut Syah Affandin memberi apresiasi kepada jajaran DPD PAN Medan karena menyelenggarakan berbagai kegiatan di bulan suci Ramadhan ini. “Hari baik, bulan baik, mari kita teruskan silaturahmi ini,” ajak Affandin kepada seluruh kader PAN yang hadir pada acara buka puasa bersama dan pemberian santunan bagi yatim piatu di Rumah PAN Medan di Jln. Brigjen Katamso, Selasa (23/4) dalam. Sejalan dengan peringatan Hari Ulang Tahun (HUT) PAN, Affandin mengajak seluruh kader meningkatkan kinerja organisasi. “Saya bangga dengan DPD PAN Medan yang menjadi motor dan contoh baik bagi pengurus daerah lainnya,” ujarnya. Sementara, Ketua DPD PAN Medan H. Ahmad Arif, SE, MM

mengatakan, bulan Ramadhan adalah momentum untuk saling memberi dan mempererat silaturahmi warga Medan. Silaturrahmi merupakan ajaran Islam guna mempererat persaudaraan. Hadir dalam acara itu, Asisten Kesos Pemko Medan Mussadad, Sekretaris DPD PAN Medan Kuat Surbakti, Ketua PD Muhammadiyah Adri. K, Ketua Asyiah Sumut Hj. Ellinita, unsur pengurus DPD PAN Kota Medan Bahrumsyah, Edwin Sugesti, Husni Lubis, Zulham, SH. Selain itu, Arif juga menyampaikan rasa syukur karena pelaksanaan Ramadhan PAN Fair yang sudah dijadwalkan selamasebulaniniberjalanlancar. “Kegiatanbukapuasagratissetiap haridiRumahPANsudahberjalan dengan baik,” katanya. Menurut Arif, PAN Kota Medan telah merampungkan

bagian terpenting dari tertib organisasi yaitu konsolidasi dan verifikasi partai. Semester awal 2011, PAN Medan telah bekerja efektif mempersiapkan perangkat organisasi hingga ke tingkat ranting. Sementara itu, Ketua Panitia Zulkarnaen Yusuf menjelaskan, rangkaian kegiatan Ramadhan PAN Fair itu antara lain pemberian bantuan kepada masjid dan mushalla, pemberian santunan kepada anak yatim piatu, Sahur On The Road oleh DPC PAN Medan Area (21 Agustus), buka puasa bersama dengan pelaksana DPC PAN Sunggal (21 Agustus). Pada 24 Agustus digelar di DPC PAN Medan Barat. Selanjutnya, 25 Agustus buka puasa bersama dengan pelaksana DPC PAN Medan Tembung dan DPC PAN Medan Belawan di kediaman H Kamaluddin,Wakil Ketua DPRDSU dari Fraksi PAN. (m08)

Sat Pol PP Razia Gepeng MEDAN (Waspada): Satuan Polisi Pamong secara rutin agar Kota Medan benar-benar Praja (Sat Pol PP) Kota Medan merazia gelan- kondusif. “Bos yang memper-kerjakan Gepeng dangan dan pengemis (Gepeng) serta anak masih dicari, apabila kelihatan pasti ditangkap,” punk yang berkeliaran dan mangkal di pinggir ujar seorang petugas. Pantauan dilapangan, Gepeng dan pengaJalan H Adam Malik, Rabu (24/8) sore. Petugas Sat Pol PP dengan mengendarai men yang terkena razia langsung digiring dan mobil patroli dan truk mencari mencari Gepeng dinaikkan ke dalam truk dan dibawa ke kantor yang berkeliaran dan mangkal di pinggir jalan. Sat Pol PP Kota Medan. (m36) Setiba di Jln. H Adam Malik, petugas melihat Gepeng dan anak punk sedang mengamen di persimpangan traffic light. Tiga personel Sat Pol PP langsung mengejar Gepeng dan pengamen tersebut sehingga mereka kocar-kacir menyelamatkan diri. Bahkan, diantaranya ada sembunyi di dalam parit karena takut tertangkap. Dari razia yang dilakukan itu, terjaring beberapa Gepeng terdiri dari wanita usia 48-60 tahun dan seorang pria berusia 28 tahun diamankan bersama barang bukti gitar. Menurut petugas Sat Pol Waspada/Ismanto Ismail PP, razia atau pembersihan PETUGAS Sat Pol PP Kota Medan menjaring seorang pengamen Gepeng dan anak punk dan dinaikan ke truk di Jln. H Adam Malik Medan, Rabu (24/8) tersebut terus dilakukan sore.

Soksi Miliki Kepedulian Sosial MEDAN (Waspada): Plt Gubernur Sumatera Utara H Gatot Pujo Nugroho mengatakan, Dewan Pimpinan Daerah II Sentral Organisasi Karyawan Swadiri Indonesia (Depidar II Soksi) di Sumut memiliki kepedulian sosial yang sangat tinggi selama bulan suci Ramadhan 1434 Hijriyah. Ini dibuktikan dengan berbagai kegiatan sosial yang dilakukan organisasi masyarakat (ormas) itu dengan melaksanakan kunjungan Safari Ramadhan ke beberapa kabupaten/kota di Sumatera Utara,” kata Plt Gubsu yang diwakili Kadispora Sumut Ristanto pada acara silaturahim danbukapuasabersamapengurusSoksi,Pengprov Pelti Sumut, tokoh masyarakat dan anak panti asuhan, di Medan, Senin (22/8) malam. Acara tersebut juga dihadiri OK Khaidir (DPD Partai Golkar Sumut), Ketua Depidar II Soksi Sumut Indra Alamsyah, Ketua Harian Depidar Wira Karya Indonesia (WKI) Sumut Sangkot Sirait, Sekretaris Pengprov Pelti Sumut Hadi Suyono dan wakilnya Army A Mazid, Sekretaris Soksi Sumut Indrayani Nasution dan H Marzuki (Eksponen 66). Plt Gubsu mengungkapkan, merasa bangga dan senang apa yang telah dilakukan Depidar Soksi dalam bulan suci Ramadhan ini karena kegiatan yang dilaksanakan sangat menyentuh hati masyarakat. Oleh karena itu, dia berharap kegiatan sosial seperti ini tidak hanya diadakan

pada bulan puasa, tetapi juga pada hari-hari biasa sehingga lebih mendekatkan Depidar Soksi di hati masyarakat. “Mari kita tunjukkan Depidar Soksi Sumut lebih dekat dengan masyarakat, ini tentu saja dibarengi dengan sikap pengurus jangan sampai mengecewakan rakyat,” kata Plt Gubsu. Sementara itu, Ketua Depidar II Soksi Sumut Indra Alamsyah mengatakan, kegiatan silaturrahim dan buka puasa ini dilaksanakan bukannya hanya untuk para anggota organisasi tersebut, tetapi juga mengundang anak-anak Panti Asuhan Al-Ikhlasiyah. Menurutnya, Depidar Soksi tidak hanya memperhatikan masyarakat yang kurang mampu tetapi juga bagi anak-anak yatim dan fakir miskin. “Memperhatikan anak-anak yang kurang mampu, bukan hanya tanggung jawab pemerintah tetapi juga Depidar Soksi merasa terpanggil untuk membantu menyantuni mereka dengan member bantuan akan digunakan pada hari raya Idul Fitri,” kata Alamsyah. Sedangkan Al Ustadz Bahran Tanjung menyampaikan tausiyah Ramadhan yang intinya ormas tersebut akan diberikan kekuatan yang berlipat ganda dan anggota yang semakin banyak. “Contoh baik dan terpuji yang dilakukan seperti ini akan semakin memajukan dan mensukseskan Depidar Soksi Sumut dari pengurus sebelumnya,” katanya. (cwan)

Kopkar Merpati Pos Beri Bantuan Betor MEDAN (Waspada): Koperasi Karyawan Pos mengimbau seluruh anggotanya agar bahu (Kopkar) Merpati Pos memberi bantuan becak membahu untuk membesarkan koperasi bermotor (betor) kepada anggotanya guna tersebut. “Koperasi Merpati Pos tidak ada apa-apanya meningkatkan kesejahteraan mereka. Bantuan betor tersebut diserahkan secara simbolis oleh tanpa anggota. Keberadaan anggota merupakan Kepala Kantor Pos Medan Ahmad Ridwan, SE, aset bagi kemajuan Kopkar Merpati Pos,” kata Alpian, didampingi Direktur PT.Viva Mas Motors di Jln. Balaikota Medan, Selasa (23/8). Usai menyerahkan bantuan, Ridwan Christian “Asen” Chandra.(m25) mengatakan, program ini sesuai visi dan misi Kopkar Merpati Pos, yaitu meningkatkan kesejahteraan karyawan dan membangun kebersamaan. “Kita berharap, anggota yang menerima bantuan betor tersebut bisa memanfaatkannya dengan baik sehingga dapat membantu kebutuhan rumah tangga,” ujarnya. Sementara itu, Ketua Serikat Pekerja Pos Indonesia Cabang Medan Tarmidi, meminta seluruh anggota Kopkar Merpati Pos agar Waspada/ist terus membangun komuKEPALA Kantor Pos Medan Ahmad Ridwan, SE, didampingi nikasi guna memajukan koperasi, dengan satu tekad Direktur PT. Viva Mas Motors Christian “Asen” Chandra, Ketua “Dari Kita dan Untuk Kita”. Serikat Pekerja Pos Indonesia Cabang Medan Tarmidi, bersama Sementara itu, Alpian Ketua Kopkar Merpati Pos Alpian, menyerahkan bantuan betor selaku Ketua Kopkar Merpati secara simbolis kepada anggota Kopkar Merpati Pos.


Medan Metropolitan

WASPADA Kamis 25 Agustus 2011

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 14.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Hongkong (1,3,5,7)

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7431

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 23.15

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Hongkong (1,3,5,7) QZ-7.430 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakartaa 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00

Flight

Pukul

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Pemilik Diskotik LG Jadi Tersangka Langgar Jam Operasional MEDAN (Waspada): Reskrim Unit Judi Sila Polresta Medan melakukan pemeriksaan terhadap pemilik diskotik Lee Garden (LG) di Jalan Nibung Baru, Kecamatan Medan Baru, sebagai tersangka dalam kasus menjual minuman eceran tanpa izin dan melanggar jam operasional, Rabu (24/8). Pemeriksaan terhadap LS, 38, dan G, 36, sebagai tersangka terkait penggerebekan diskotik LG beberapa waktu lalu. Keduanya tampak tegang ketika menjalani pemeriksaan. Tak hanya itu, keduanya sibuk mengutakatik handphone seperti menghubungi seseorang. LS yang dikenal sebagai putra dari Korea ini diperiksa karena telah melanggar jam operasional yang telah ditentukan pada saat Operasi Pekat

2011. Tak hanya itu, Lee Sam juga telah sengaja dan tanpa ijin mengedarkan minuman eceran di dalam diskotik miliknya. Kepada penyidik, LS berkelit soal kepemilikan tempat. Pria bertubuh tambun itu mengaku usaha itu milik ayahnya, padahal LS diketahui merupakan seorang manager di diskotik yang kerap beroperasi hingga pagi hari. Sebelumnya Unit Judi Sila Polresta Medan menggerebek

diskotik LG karena telah melampaui jam tayang yang ditentukan. Hasilnya, personel yang dipimpin Kanit VC/Judi Sila Polresta Medan AKP Hartono, SH mendapati berbagai macam minuman keras yang sedang diracik. Seminggu sebelum penggerebekan itu, LS pernah menantang AKP Hartono yang bersama personelnya sedang memantau diskotik tersebut. Sementara itu, Kanit VC/ Judi Sila Polresta Medan AKP Hartono mengaku sedang memeriksa LS. “Saat ini dia diperiksa sebagai tersangka. Kalau soal dia melobby pejabat disini (Polresta Medan), saya tidak tahu. Biar saja lah, yang penting kasusnya kita proses,” katanya.(m39)

Polisi Amankan Kapal Pengangkut 100 Ton BBM MEDAN (Waspada): Kapal berbendera Indonesia yang mengangkut 100 ton bahan bakar minyak diduga ilegal diamankan petugas Direktorat Polair Polda Sumut dari perairan Kuala Tanjung, Asahan, Senin (22/8). Kapal MT Cosmic bernomor lambung 11 tersebut berangkat dari Batam, Kepulauan Riau, dengan tujuan Kuala Tanjung. Pihak kepolisian yang mencurigai barang bawaan MT Cosmic, kemudian melakukan penahanan berikut nahkodahnya Johanes Tanjung ke Direktorat Polair Poldasu atas tuduhan pelanggaran kepabeanan. “Aktivitas kapal itu disinyalir melanggar pasal 1 Undang Undang nomor 17 tahun 2006 tentang perubahan atas Undang Undang nomor 10 tahun 1995 tentang kepabeanan dan pasal 103 huruf A dan pasal 103 huruf C,” sebut Direktur Polair Polda Sumut Kombes Ario Gatut kepada wartawan, Rabu (24/8). Namun Ario tidak menyebutkan asal bahan bakar itu. Karena, kata dia, kapal dan nakho-

danya langsung diserahkan ke Direktorat Polair Baharkam Polri untuk diperiksa lebih mendalam. Mengenai nilai muatan kapal diduga bernilai Rp7,8 miliar. “Kalau memang terbukti melanggar hukum, jelas negara dirugikan lebih dari Rp7,8 miliar,” katanya. Sementara Kasubbid Pengelola Informasi dan Dokumentasi (PID) Humas Poldasu AKBP MP Nainggolan menyebutkan, saat ini Direktur Reskrimsus Poldasu Kombes Pol Sadono Budi Nugroho tengah melakukan gelar perkara keberhasilan itu di Mako Direktorat Polair di Belawan. “Gelar perkara dilakukan untuk mencari bukti pelanggaran yang dilakukan nakhoda Kapal MT Cosmic,” katanya. Gerebek Gudang Ilegal Di tempat terpisah, Poldasu menggerebek satu gudang ilegal di Jln, Alumanium Raya depan komplek perumahan TNI AL Barakuda, Tanjung Mulia Hilir, Medan Deli, Rabu. Keterangan dari lapangan menyebutkan, selama ini warga

curiga dengan aktifitas gudang tersebut. Namun, mereka tidak berani berbuat macam- macam karena di gudang itu sering terlihat lelaki berbadan tegap berambut pendek mirip tentara. Sementara itu, Ketua KNPI Medan Deli Ahmad Solihin mengaku telah lama mendapat laporan dari warga kalau di gudang itu sering kedatangan truk pengangkut minyak. “Cocok juga gudang itu digerebek karena selama ini kata mereka tangki minyak sering kencing di gudang itu,” sebutnya. Kanit Reskrim Polsek Medan Labuhan AKP Oktavianus membenarkan adanya pengerebekan gudang yang dilakukan petugas Poldasu, dan pengerebekan tersebut tidak melibatkan petugas dari Polsek Medan Labuhan. “Polda yang gerebek dan data ada pada mereka,” katanya. Sementara Kabid Humas Poldasu Kombes Heru Prakoso dihubungi mengaku mengetahui informasi itu, tetapi dia belum bisa menjelaskan karena belum menerima laporan penangkapan. (m27/h03)

Jadwal Perjalanan Kereta Api No KA

Nama KA

Kelas

Dari

Tujuan

U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

B3

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru AKP Dony Alexander sidak ke SPBU dan Pos Polisi Bandara Polonia, Rabu (24/8) sore.

Kapolsek Medan Baru Sidak SPBU MEDAN (Waspada): Kapolsek Medan Baru AKP Dony Alexander, SH,SIK inspeksi mendadak (sidak) ke SPBU 142011166 Jln. H Adam Malik dan Pos Polisi Bandara Polonia Medan, Rabu (24/8) sore. Kunjungan Kapolsek didampingi BKO Satgas Preventif Poldasu untuk wilayah hukum Polsek Medan Baru AKP Risya Mustario SH,SIK, Kanit Intelkam Polsek Medan Baru AKP R Sihotang SH, Panit Sabhara Iptu Raswan SH, untuk melihat kesiapan dan pengamanan di

SPBU dan Pos Polisi Bandara Polonia. Kedatangan mereka disambut dua personel Brimob Poldasu dan satpam SPBU. Menurut Dony, kunjungan tersebut untuk melihat dari dekat personel yang melakukan pengamanan di SPBU maupun di Pos Polisi Bandara Polonia. Selain itu, Kapolsek untuk memberi sport kepada personel dan memberi pengarahan kepada personel Brimob dan satpam agar tetap disiplin melakukan pengamanan agar tidak terjadi hal yang tidak

diinginkan. Disebutkannya, Polsek Medan Baru menurunkan puluhan personel bekerjasama dengan Pemko Medan dan instansi terkait lainnya dalam pengamanan bulan suci Ramadhan hingga Hari Raya Idul Fitri. Dony mengimbau masyarakat yang akan berpergian merayakan hari raya Idul Fitri, agar memperhatikan keamanan rumahnya dan jangan memakai perhiasan emas yang berlebihan karena bisa mengundang aksi kejahatan. (m36)

Waspada/Rudi Arman

LS, 38 dan G, 36, terlihat diinterogasi Kanit Judi Sila Polresta Medan AKP Hartono (kanan), Rabu (24/8).

Dua Hari Ops Toba Terjadi 553 Pelanggaran Lalin MEDAN (Waspada): Dalam dua hari pelaksanaan Operasi (Ops) Ketupat Toba 2011 yang dilaksanakan jajaran Poldasu dan instansi lain di Sumut, telah terjadi 553 pelanggaran lalu lintas, dengan ker ugian materi diperkirakan Rp17.500.000. “Selama Ops Ketupat Toba 2011 yang dimuali 23 Agustus, telah terjadi 553 pelanggaran. Namun secara umum, situasi keamanan dan ketertiban masyarakat serta keselamatan dan kelancaran lalu lintas masih tetap terkendali dan kondusif,” kata Kasubbid Pengelola Informasi dan Dokumentasi (PID) Humas Polda Sumut AKBP MP

Nainggolan kepada wartawan, Rabu (24/8). Dijelaskannya, 553 pelanggaran itu terdiri dari 382 tindakan langsung (tilang) dan 171 teguran. Sedangkan enam kasus laka lantas juga terjadi, mengakibatkan satu korban meninggal dunia, tiga luka berat dan empat luka ringan. Sementara, dari hasil kegiatan Turjawali dan Gakkum yang dilakukan Satgasda di seputaran wilayah kota Medan diketahui telah terjadi 115 pelanggaran terdiri 100 tilang dan 15 teguran. “Selain lakalantas dan pelanggaran berlalu lintas, tidak ada peristiwa kriminal yang menonjol di wilayah Kota Medan,” kata Nainggolan.(m27)

Tiga Kantor Dibobol Maling MEDAN (Waspada): Tiga rumah toko (ruko) berlantai III yang dijadikan kantor Bank BNI, Showroom Gemilang dan PT. Soho Farmasi di Jln. Setiabudi, Pasar III, Tanjungsari Medan, Rabu (24/8) dinihari, dibobol maling. Informasi Waspada peroleh di lapangan, pelaku melakukan aksinya pada dinihari. Pertama kali maling membobol kantor PT. Soho Farmasi. Pelaku masuk dari lantai III, namun setelah mengobrak-abrik kantor itu tidak ada menemukan barang berharga. Selanjutnya, maling tersebut masuk ke kantor showroom mobil yang lokasinya hanya 1 meter dari lokasi semula dengan cara merusak jendela di lantai III. Dari showroom

itu, pelaku menyikat uang Rp1.500.000 dari laci salah satu meja di lantai I. Menurut seorang pekerja di showroom, maling mengambil uang biaya untuk mengurus surat kendaraan. Usai membobol showroom itu, maling tersebut kembali melakukan aksinya di kantor BNI satu dinding dengan showroom tersebut. Tapi, dari bank tersebut pelaku tidak berhasil mengambil uang. Mendapat informasi pencurian tersebut, Kapolsek Sunggal AKP Budi Hendrawan SH,SIK bersama Kanit Reskrim AKP Victor Ziliwu SH,SIK dan personelnya turun ke Tempat Kejadian Perkara (TKP) melakukan pemeriksaan di lapangan. (m36)

Enam Tersangka Curanmor, Togel, Narkoba Diringkus MEDAN (Waspada): Selama tiga hari, petugas Reskrim Polsek Percut Seituan meringkus enam pelaku tindak pidana pencurian sepedamotor, judi togel, dan pemakai sabu-sabu dari tiga lokasi terpisah di Medan Tembung dan Percut Seituan. Informasi yang diperoleh di kepolisian, Rabu (24/8), keenam tersangka masing-masing berinisial Tu alias Di, 21, warga Jalan Pancing Kelurahan Sidorejo Medan Tembung, AMS, 27, warga Jalan Bromo Lorong Karya Medan Denai, SR, 25, warga Jalan Bromo Medan Denai. Kemudian tersangka RHS alias Geleng, 26, warga Jalan Walet III Perumnas Mandala, YPN, 40, warga Jalan Bandarsetia Gang Swadaya Percut Seituan, dan Am, 23, warga Jalan Tuasan Kelurahan Sudirejo Medan Tembung. Dari keenam tersangka, polisi menyita 2 unit sepedamotor Revo BK 6596 OT dan Supra BK 2967 CG, 1 handphone, 1 paket sabu-sabu, 1 lembar kertas rekapan togel dan uang tunai Rp61 ribu. Kanit Reskrim Polsek Percut Seituan AKP Faidir Chaniago mengatakan, tiga tersangka Tu alias Di, AMS, dan SR mencuri sepedamotor milik seorang mahasiswa di rumah kos Jalan William Iskandar, Kelurahan Sidorejo, Medan Tembung, Senin (22/8) sekira pukul 10:00. Ketiganya mencuri sepedamotor tersebut saat pemiliknya memarkirkan kendaraan di bawah tangga rumah kosnya. Sebelum masuk ke kamar kos, korban menggunakan kunci pengaman di bagian cakram depan, namun kunci kontak tertinggal di bagasi sepedamotor. Melihat kunci kontak tertinggal, tersangka Tu alias Di langsung mencurinya. “Setelah berhasil menyikat sepedamotor tersebut, tersangka Tu dan AMS menyuruh SR untuk menjual sepedamotor hasil curian tersebut,” kata Faidir. Namun, saat hendak menjual

sepedamotor tersebut, ketiga tersangka ditangkap. Sementaraitu,tersangkaAm,wargaJalanTuasan, Medan Tembung, ditangkap ketika hendak melarikan sepedamotor di DusunV, Desa Sei Rotan, KecamatanPercutSeituan.TersangkaAmmelakukan aksinya, Senin (22/8) sekira pukul 21:30. Saat itu Am melihat sepedamotor di halaman rumah seorang warga Dusun V, dalam kondisi stang terkunci namun kunci kontaknya masih lengket. Dia langsung mencurinya. Namun, baru beberapa meter mendorong sepedamotyor tersebut, tersangka Am diteriaki maling sehingga ditangkap dan dibabakbelurkan warga. Dari tersangka Am, polisi menyita sepedamotor Revo BK 6596 OT sebagai barang buktinya. SedangkantersangkaYPNditangkappolisi,Rabu (24/8),ketikasedangmenulisnomor-nomortebakan ke dalam kertas rekap judi toto gelap (togel) di Jalan Bandarsetia Gang Buntu, persis di lokasi pangkalan angkot KPUM 19 Desa Bandarsetia. Menurut Faidir, tersangka YPN yang berada di dalam warung kopi sedang sibuk menulis angka-angka tebakan togel ke beberapa lembaran kertas rekap. “Belum selesai menulis ke dalam kertas rekap, polisi langsung menyergapnya, berikut barang bukti 1 pulpen, dua lembar kertas rekap dan uang Rp61 ribu, “ ujarnya. Di tempat terpisah, petugas Reskrim Polsek Percut juga meringkus tersangka RHS alias Geleng karena memiliki 1 paket sabu-sabu, Selasa (23/ 8) sekira pukul 23:00. Malam itu, tersangka yang mengendarai sepedamotor melintas di Jalan Garuda Perumnas Mandala. Saat melintas, polisi yang sedang melakukan razia menyetop tersangka dan kemudian dari dalam kantong celananya polisi menemukan 1 paket sabusabu. Polisi juga mengamankan sepedamotor Supra BK 2967 CG sebagai barang bukti. (h04)


Opini

B4 TAJUK RENCANA

Jangan Sampai Terjebak Dalam Transaksi Politik

P

asca gagalnya penggunaan hak interpelasi oleh anggota DPRDSU terhadap Plt. Gubsu Gatot Pujo Nugroho banyak sorotan beterbangan belakangan. Tentu saja sorotan itu lebih ke persoalan politik yang banyak di dalamnya ada embel-embelnya. Yang paling keras menyebutkan Partai Demokrat (PD) memanfaatkan interpelasi sebagai alat tawar kepada, agar Ketua Demokrat Sumut HT Milwan menjadi Wagubsu. Disebut-sebut PD akhirnya mengambil sikap menolak interpelasi karena sudah ada deal dengan Plt Gubsu dalam hal jabatan Wagubsu. Selanjutnya sikap ini disampaikan ke Fraksi PD di DPRDSU untuk dilaksanakan. Namun, kata Tahan Manahan Panggabean, Sekretaris DPD Partai Demokrat Sumut dalam proses penolakan usulan hak interpelasi ini, tidak ada tekanan sedikit pun dilakukan baik oleh fraksi maupun PD kepada anggotanya. Keputusan diambil setelah fraksi dan partai mengikuti proses yang berlangsung sekian waktu, hingga sampai pada sebuah kesimpulan. ‘’Andai kata FPD memutuskan menerima interpelasi, maka 23 anggota fraksi lainnya juga harus ikut keputusan itu. Sama seperti keputusan saat ini, empat anggota fraksi, termasuk saya harus sepakat dengan keputusan fraksi menolak interpelasi,’’ kata Tahan Manahan Panggabean. Beberapa waktu yang lalu politisi Partai Golkar Mulkan Ritonga menyayangkan tudingan sejumlah tokoh mengaku pakar, seolah interpelasi yang digulirkan dewan sebagai upaya mencampuri tugas Plt Gubsu dalam mengangkat pejabat di lingkungan Pemprovsu. “Kita juga tahu ada kewenangan Plt Gubsu soal pengangkatan pejabat struktural, namun karena pengangkatan itu tidak melalui mekanisme di Baperjakat maupun melanggar PP No11/2000, dewan wajib melakukan pengawasan melalui hakhak yang melekat pada diri dewan,” tegas Mulkan. Mulkan juga menyayangkan jika ada pakar menuding interpelasi sebagai “interpulus”, atau sarana untuk transaksi politik.“Ini bukan soal kepentingan anggota dewan terhadap pejabat, tapi terkait tugas Intisari dan fungsi dewan selaku pengawas,” ujar Mulkan Sebenarnya kalau dipandang secara jangan sampai ada tengah, insiden interpelasi DPRDSU penyanderaan politik garis sebenarnya tidak perlu terjadi jika Plt Gubsu yang berujung kepada dan fraksi-fraksi di DPRD Sumut telah transaksi politik yang terbentuk saling pengertian tentang tugas, dan hak masing-masing. pada akhirnya merugikan kewenangan Karena Plt Gubsu, H Gatot Pujo Nugroho, rakyat Sumut. ST sebelum ini dan sampai sekarang sejak pertengahan 2008 yang lalu adalah Wakil Gubernur Sumatera Utara mendampingi Gubsu (non aktif) H Syamsul Arifin, SE Akan tetapi ternyata transisi politik yang terjadi tidak mampu diimbangi kemampuan antisipasi kedua pihak untuk saling melakukan adaptasi dan saling memahami. Tidak saling memahami ini ditandai dengan bentuk hubungan disharmoni antara kedua lembaga yang dalam perkembangannya menjelma menjadi usul 16 anggota dewan mengajukan hak interpelasi kepada Plt Gubsu yang dianggap telah melanggar peraturan dalam kebijakan mutasi dan promosi 110 pejabat eselon 3 dan 4 sekaligus menonjobkan 26 pejabat yang sebagian besar (menurut pengusul) adalah pemegang KPA atau kuasa pengguna anggaran. Inilah yang kemudian menjadi usul hak interpelasi yang kemudian gagal. Namun di balik kegagalan inilah bisa nantinya tidak terjadi transaksi politik. Artinya jangan sampai malah Plt Gubsu dan dewan tersandera dengan kepentingannya masing-masing. Memang harus dilihat tradisi transaksi dalam politik di Indonesia sudah kelewatan dan tidak lagi menunjukkan politik yang berwawasan kebangsaan. Banyaknya masalah yang melanda bangsa Indonesia karena sebagian besar elit politik nasional tidak lagi menunjukkan perilaku yang berwawasan kebangsaan. Itu dapat dilihat dari keanehan gara-gara interpelasi tidak kunjung diparipurnakan berdampak kepada agenda-agenda politik lain yang berguna bagi rakyat secara langsung seperti pembahasan KUA/PPAS RAPBD perubahan tahun anggaran 2011 dan KUA/PPAS RAPBD tahun anggaran 2012 belum berjalan walaupun konon khabarnya dokumen-dokumen dan bahan-bahan sudah diantar ke DPRDSU. Kita berharap mudah-mudahan keterlambatan pembahasan KUA/PPAS RAPB Tahun anggaran 2012 oleh DPRD Sumut tidak dijadikan alat tawar kepentingan politik bagi siapapun dalam menyikapi interpelasi. Oleh karena itu, jangan sampai ke depan atau di sisa akhir jabatan baik itu H Gatot Pujo Nugroho, ST maupun anggota DPRDSU sama-sama tersandera sehingga pembangunan daerah diabaikan. Sudah saatnya harus ada kesadaran bersama bukan kesadaran dan kemauan masing-masing sehingga perjalanan daerah ini tidak semakin terpuruk ke belakang.****

APA KOMENTAR ANDA SMS 08974718101

Faks 061 4510025

Email komentar@waspada.co.id

+6281376228044 Pak Arifin Srg yth, bid’ah bukan semua dholalah. Masjidilharom dulunya zaman Rosul terbuat dari pelepah dan daun kurma, dan tak ada perintah agar dibangun semewah sekarang... Itu namanya apa bapak sayangku ? Wsslam. +6283199572197 Pada hakikatnya, setiap individu Muslim menderita RUGI BESAR jika malam ini TIDAK menegakkan Sholat Tarawih. Bukan omong kosong. Janji Robbuka Robbana itu, amat sangat benar. Realy in the END DAY next ! Bebas dari ‘Alam Siksa oleh Sang Pencipta karena melaksanakan Puasa dan Sujud di dalam Shalat hingga akhir bulan ini SECARA IKHLASH # Telewords by Shokhib Muslim ~ Menjelang Malam Selikur. +6281376228044 Pak Arifin yth, 23 raka’at pun di zaman Umar nya dilaksanakan, ini bid’ah..kata beliau, tp Bid’ah hasanah. Dan kapan nabi taraweh 11 rakaat pak ? Wsslam. +6281264100513 Na’uuzu billaahi min zhaaliq tsumma na’uuzu billah, di lingkungan pejabat IAIN Sumut saja budaya atau idiologi KORUPSI ... !!! pun berkembang biak dengan khusyu’, di sana tempat berkumpulnya para SAg , MAg , Doctor - Doctor Agama , Prof2 agama, jangan-jangan ini bagian dari PERBANDINGAN MAZHAB atau IAIN Sumut sudah alih profesi dari IAIN (Institus Agama Islam Negeri) Sumut menjadi IAIN (INGKAR ALLAH INGKAR NABI). Lanjutkan!!! +6282161971487 Waspada jaya.Sdh saatnya para penegak hukum.Melacak dana di bank BNI dekat USU.Krn diindikasikan mengendapkan dana tj propesi guru swasta dgn pejabat disdiksu. Buktinya pencairanya brtahap dan memakan waktu hampir satu bln. Lain lagi yg no rekeningnya salah perbaikanya hampir satu bulan. Tentunya dananya ngendap jg.Ini prlu ditelusuri pihak penegak hukum untk prbaikan dunia pendidikan. +6281376649967 Halo Brigadir Erwin Panjaitan,manusia biadab,semoga malikat izrail cepat mencabut nyawamu,..! +6285370962457 Pak Kapolresta P.Sidimpun, tolong hentikan judi togel di ds Pal 4 P.koling di warung2 kopi, karena sangat meresahkan, apa lagi pada bulan Ramadhan ini. +6285297371251 WAH,WAH,WAH NAZARUDDIN~NAZARUDDIN. Dari jauh komentarmu nggak tanggung-tanggung, sementara di dalam negeri ini jadi BUNGKAM, ada apa semua ini? apa lu DIN, sudah diancam, KALAU diancam bilangin aja DIN siapa yg ngancam lu, biar jelas dinegri ini, siapa yg SALAH, LU harus ingat DIN, mati hanya satu kali DIN. YG Pasti ALLAH di pihak yg benar,tapi kalau lu yg salah DIN. LU rasain lah azab yg sangat pedih. SEMOGA WASPADA SENANTIASA SUKSES & JAYA.

WASPADA Kamis 25 Agustus 2011

Setahun Kepemimpinan Syahrul-Rapolo Oleh Shohibul Anshor Siregar Dalam hal ketak-sudian berkantor di Sipirok Ongku P Hasibuan adalah master panutan bagi Syahrul.

S

yahrulMPasaribu(Syahrul)-Aldiz RapoloSiregar(Rapolo)pasangan yanggenapsatutahunmemerintahTapsel ini memang memakai semboyan Sarasi dalam kampanye mereka—untuk memaksudkan harmoni dalam bahasa lokal. Tapi harmoni pasangan ini benar-benar berkeping-keping karena beda rencana dan kemauan tentang perwujudan Sipirok sebagai ibukota Tapsel sebagaimana ditegaskan oleh UU Nomor 37 dan 38 Tahun 2007. Menjaga keserasian pasangan dalam pemerintahan adalah amat sulit di Indonesia. SBY-JK saja gonjang-ganjing, sebagaimana halnya Syamsul dan wakilnya Gatot Pudjonugroho semasa yang disebut pertama masih aktif. Indonesia memang sudah membuktikan kualitas kinerja dan kadar harmoninya akan selalu sarat dengan faktor objektif dan faktor subjektif. Beberapa isu awal Selain itu secara normatif dalam pelantikanituSyamsuljugamengingatkan Syahrul- Rapolo agar menjaga hubungan dengan segenap elemen dan mampu memanfaatkan potensi sumber daya manusia Tapsel setempat maupun yang ada di perantauan. Potensinya amat besar jika pandai-pandai memenejnya, karena sejak zaman kolonial orang-orang daerah ini sudah banyak yang tercerahkan dan memegang posisi strategis dalam pemerintahan, politik dan dunia usaha. Syamsul juga amat tahu bahwaTapsel bukan cuma daerahyangkayasumberdayaalam,tetapi juga terkenal religius dan berbudaya yang kuat dengan basis dalihan na tolu-nya. Isupertamayangmenjadititikandalan komunikasi politik Syahrul setelah dilantik ialahtentangwarisandefisitpuluhanmiliar. Semuapihakdibuattahusoaliniyangtampaknya dimaksudkan untuk melukiskan betapa bobroknya pemerintahan lokal sebelumnya dan betapa sulitnya mencari solusi untuk akselerasi pembangunan Tapsel. Isu ini menebar pesimisme yang dalam. Mungkin juga Syahrul ingin memposisikanAPBDhanyasebagaitrigerbelaka yang karena itu tak boleh dijadikan satusatunya andalan membangun daerah. Ini tentusangatmenggembirakan.Hanyasaja yang tersiar kemudian Syahrul tercatat hanya berhasil meneriakkan hal ini untuk semacam kepentingan “rengek-rengek” seputar peluang memperoleh kucuran

dana internal (pemerintahan), apakah provinsi atau pusat. Lobbyuntukinimenjadiujianpertama bagi Syahrul yang kerap mengingatkan banyak orang tentang pengalamannya sejak tahun 1980-an di lembaga legislatif. Sampai kini lobby itu masih belum terlihat melebar ke sayap lain, katakanlah untuk mengundang investasi dari pihak wiraswasta. Ini penting dicatat, karena jika di suatu daerah kelompok pengusaha yang berjaya hanyalah karena keberuntungan akses khusus ke APBD, sebetulnya tak ada yang harus dibanggakan tentang itu. Sekaitan dengan pengembangan ekonomi daerah ini pertanyaan yang amat penting segera diajukan adalah tentang persepsi terhadap instrumen ekonomi seperti BUMD (Badan Usaha Milik Daerah). Seyogyanyalah instrumen ini diposisikan tepat dalam menstimulus pertumbuhan dan perkembangan ekonomi daerah dan kewirausahaan aktor-aktor lokal. Pemberdayaan aktor lokal bisa dimaksudkan sekaligus untuk menghadapi sengitnya persaingan yang secara niscaya menghadirkan aktor-aktor nasional dan bahkan internasional dalam kancah yang begitu menciutkan nyali. Gagal dengan misi ini bermakna tak cuma mengukir sejarah buruk, sebagaimana nasib buruk hampir semua BUMD yang kerap hanya dimamah-manjakan oleh APBD, sambil menjadikannya semacam Anjungan Tunai Mandiri (ATM) bagi para pejabat sebagaimana pernah dihebohkan dan yang ruparupanya sudah lama menjadi kebiasaan yang menasional. Jika Tapsel hanya mereplikasi pengalaman-pengalaman tak menggembirakan itu, maka segera Syahrul perlu diingatkan tentang bakat dan pengalaman lobby-nya yang sudah kadung terberita-luaskan itu. Kini isu warisan defisit anggaran puluhan miliar telah hilang ditelan arus informasi yang silih berganti. Isu berat kedua yang mengemuka pasca pelantikan Syahrul-Rapolo ialah tentang pemin-

dahan ibukota dan pusat pemerintahan Tapsel dari kota Padangsidimpuan ke Sipirok. Harap dicatat, bahwa di kantor yang ditempati sekarang, bupati dan seluruh aparatur tentulah seperti tamu saja dengan keterbatasan nyata. Mereka tak memiliki kewenangan sama sekali jika selangkah saja mereka keluar dari kantor itu. Katakanlah listrik mereka padam, air ledeng mereka macat, atau kantor yang mereka tempati itu kebanjiran karena selokan tumpat. Mereka, para tamu di kota Padangsidimpuan ini, hanya dapat menunggu “kebaikan hati” dinas-dinas Pemko Padangsidimpuan untuk membantu mereka. Ini mirip dengan sebuah pemerintahan di pengasingan. UU Nomor 37 dan 38 Tahun 2007 yang memisahkan Paluta dan Palas dari Tapsel memang tidak cuma menunjuk Sipirok menjadi ibukota dan pusat pemerintahan Kabupaten indukTapsel. Karena pada salah satu pasalnya termuat perintah memindahkan pusat pemerintahankeSipirokpalinglambat 18bulansetelahperesmian pemekaran. Menggali“kuburan politik” Dalam hal ketaksudian berkantor di Sipirok Ongku P Hasibuan adalah master panutan bagi Syahrul. Ongku tak sudi ke Sipirok, meskipun berhadapan dengan desakan masyarakat dan juga DPRDSU, para anggota DPD dari Dapil Sumut dan Gubernur Sumut sendiri yang masingmasing pernah menyurati secara resmi. Pusat pemerintahan Tapsel bagi Syahrul tak bergeser dari lokasi yang ditunjuk Ongku. Meskipun tentunya sadar benar melanggar UU dan mendapat penolakan dari masyarakat, tetapi anehnya lebih kedua Bupati terutama Syahrul kerap seperti hendak menggambarkan kebingungan tentang posisi sesungguhnya Sipirok dalam peta Tapsel. Padahal salah satu dari sejumlah persyaratan administratif yang diwajibkan terpenuhi dalam proses pemekaran suatu wilayah ialah lokasi ibukota yang terlebih dahulu disepakati dan ditentukan secara definitif berdasarkan kajian teknis, tidak asal tunjuk. Itulah sebabnya kemudian ruh UU 37 dan 38 tampak begitu

pasti mencantumkan limit waktu 18 bulan untuk pemindahan pusat pemerintahan tersebut. Kedua bupati dalam periode yang berbeda ini tidak saja sama-sama bersikukuh ingin ibukota Tapsel adalah Sipirok yang mereka persepsikan sendiri bersama para pembantu-pembantu mereka. Selain itu secara kentara tampak adausahamemposisikanperlawanan dari pendukung Sipirok ibukotaTapsel sebagai aspirasiminoritasbelakayangtakmungkin diutamakandibandingkeinginankalangan terluas dari masyarakatTapsel. Ini sebuah upaya politik untuk menciutkan gugatangugatan rencana pembangunan kantor di tempat yang lebih disenangi oleh Bupati diluar Sipirok. Syahrul sendiri dan orang-orang dekatnya tentu tidak akan mengakui bahwa mobilisasi dukungan terhadap kemenangan pasangan Sarasi dari incumbent, yang merupakan kejadian langka dalam perhelatan politik di Indonesia, terkait erat sikap Ongku yang tak mau memindahkan pusat pemerintahan ke Sipirok. Tetapi banyak orang yang percaya bahwa dengan kasus ibukota ini Syahrul sedang menggali “kuburan” politiknya sendiri. Lagi pula, konflik seperti ini bukan tidak menyita banyak energi dan potensi pula mendasari mudahnya kemunculan konflik-konflik lain. Bukan tidak ada selentingan tentang keinginan mengubah UU No 37 dan 38 tahun 2007 agar Syahrul legitimated menunjuk lokasi perkantoran bupati di luar Sipirok. Ini seperti hendak menafikan eksistensi Paluta dan Palas. Penutup Dengan “memerdekakan” Paluta dan Palas, Tapsel baru adalah daerah kecil dengan permasalahan kompleks. Di sinilah terdapat jalan buruk Aek Latong yang menjadi noktah nasional itu, yang sekaligus dapat menggambarkan betapa tertinggalnya Tapsel dilihat dari pembangunan infrastruktur. Mudahmudahan saja Syahrul tidak kehabisan waktu di Kilang Papan (lokasi pertapakan kantor Bupati yang ia rencanakan), dan obligasi moral memajukan Tapsel secara akseleratif sesuai harapan masyarakat .tidak pernah surut. Tetapi satu tahun pemerintahan Syahrul-Rapolo masih belum menampakkan fakta-fakta yang mendorong setiap orang mengacungkan jempol. Penulis adalah Dosen Sosiologi Politik FISIP UMSU. Koordinator Umum ‘nBASIS.

Pj.Gubsu, DPRDSU & Pemerintah Pusat Oleh Ahmad Taufan Damanik ...saya mendorong kedua belah pihak—GPN dan DPRD Sumut— melakukan koordinasi intensif dalam membangun Sumut. Lupakanlah soal interpelasi...

S

ejak awal pengangkatan Gatot Pudjonugroho sebagai Pj.Gubsu, sebagian anggota dewan telah menabuh “genderang perang” politik. Dimulai dari kritik atas isu diharmonisasi antara Gatot Pudjonugroho (GPN) dengan Syamsul Arifin (SA), maupun persoalan kapasitas pribadi lainnya. Kritik politik ini terkesan mencari-cari isu politik yang bisa dipakai menyerang dan terlalujauhmasukkeranahpribadi,bukan isu kepentingan publik lagi. Selanjutnya, kritisisme atau serangan politik semakin meningkat tensinya setelah GPN mengajukan tiga nama baru calon Sekda mengimbangi tiga nama sebelum-nya yang sudah diajukan SA serta melakukan mutasi besar-besaran di jajaran pemerintahan. Ada banyak kecurigaan, pertanyaan, mungkin juga keanehan dan tak kurang juga kepentingan tertentu yang terganggu dengan kebijakan GPN tersebut. Meski kemudian interpelasi gagal diteruskan,namunhubunganyangkurang harmonis ini masih saja membayangi pemerintahanGPN.Interpelasi,selainsulit mendapatkan kesepakatan di kalangan dewan, sesungguhnya juga tidak membahayakan posisi GPN karena UU 32 tahun 2004 mengatur kekuasaan eskekutif lebih sulitdijatuhkandibandingkanUU22/1999 yang lebih liberal. Bahkan bila sampai diteruskankehakangketdanhakmenyatakan pendapat sekalipun, tetap saja sulit menjatuhkan pimpinan eksekutif, kecuali tersangkutpidanabaikmakar,korupsiatau pidana lain. Namun, dari kacamata politik, serangan politik semacam interpelasi atau penegasianpolitiklainnyadaridewan,apalagi bila didukung media dengan gencar dan sistematis, tentu saja akan berdampak kepada kredibilitas kepemimpinan GPN. Ia bisa saja terkurung dalam isolasi lawanlawan politiknya. Adagium politik mengingatkan kita tentang pentingnya legitimasi politik dalam kaitannya dengan efektifitas suatu kepemimpinan atau pemerintahan. Kehilangan legitimasi politik (meski secara legal masih tetap bertahan di kekuasaan) sama halnya dengan kehilangan kekuasaan. Tak ada enerji memerintah, sehingga kebijakan-kebijakan menjadi sulit direalisasikan karena mendapatkan perlawanan maupunpengabaian.FilsufpolitikJerman Jurgen Habermas menjelaskan soal legitimasi ini dalam kaitannya dengan kemampuan pemimpin politik mempertahankan stabilitas politik dan kemampuannya untuk memperoleh dukungan publik. Bila keduanya melemah maka legitimasi pemerintahan semakin memudardan itu berarti daya memerintah atau

power to govern semakin tak diwujudkan. Tampaknya tanda-tanda ke arah ini sudah mulai terjadi. Mulai terasa ada pembangkangan diam-diam dari internal birokrasi yang itu berakibat kurang solid dan menurunnya kinerja Pemprovsu. Sekali lagi, meski ini baru tandatanda awal, GPN mesti lah mewaspadai gejala ini bila tak ingin terpuruk di sisa pemerintahan Syampurno yang dipimpinnya kurang dari dua tahun ke depan. Perlu dicatat bahwa keterpurukannya secara politik akan sekaligus berakibat negatif kepada elektabilitasnya di Pilkada tahun 2013. Juga akan ikut berdampak negatif kepada partainya, PKS di Pemilu 2014 nanti. Tapi lebih dari itu – dan ini yang terpenting bagi kita warga Sumut— tidak efektifnya pemerintahan GPN merupakan petaka lanjutan bagi masyarakat Sumatera Utara yang hingga saat ini masih belum juga mendapatkan peningkatan kesejahteraan. Meski angka pertumbuhan ekonomi Sumut kelihatan normal, tapi di berbagai sektor kita belum juga bangkit. Angkaangka kemiskinan, pengangguran dan berbagai persoalan di sektor tani, nelayan dan buruh masih buruk. Infrastruktur jauh tertinggal dibandingkan provinsi lain di Sumatera, demikian juga sarana dan prasarana lainnya. Intervensi pusat memperkeruh Di berbagai kesempatan Mendagri Gamawan Fauzi menyatakan kepeduliannya atas politik uang dan transaksional di era demokrasi liberal yang semakin menggerus substansi demokrasi dan sebaliknya memperparah kondisi bangsa ini, khususnya daerah. Tapi aneh ia justru tak melihat potensi politik sebaliknya bisa terjadidiSumutdengankemunculanGPN yang bebas dari politik uang dan karena itu dimungkinkan berjalan lurus tanpa perlu melakukan transaksi politik. Gamawan tahu persis transaksi politik semacam ini sudah sangat membahayakan pemerintahan dan pembangunan daerah karena ratusan pejabat daerah saat ini tersangkut pidana korupsi. Sebaliknya, GPN pun kurang mampu menjelaskan posisi itu kepada pemerintah pusat bahwa ia memiliki kebijakan yang berbeda dari pejabat daerah lazimnya saat ini. Karena itu bukan dukungan yang didapat tetapi justru masalah, bahkan yang terakhir surat peringatan dari Mendagri. Surat peringatan ini kembali mendesak GPN secara politik, sebaliknya anggota dewan merasa semakin mendapatkan pembenaran untuk terus menyerang. Saya mencoba mendudukkan masalah dengan mengambil dua contoh

kasus yang krusial di antara Pemprovsu yang dipimpin GPN dengan pemerintah pusat. Pertama soal pengajuan tiga nama baru oleh GPN dimana Kemendagri terlihat buang badan dan membiarkan GPN diserang secara tidak proporsional. Semua tahu bahwa pengangkatan Sekda adalah domain pemerintah pusat, daerah hanya mengusulkan calon. Gubernur non-aktif SA sudah mengajukan tiga nama calon dan ketiganya sudah diuji, bahkan sudah sampai di tangan Tim Penilai Akhir yang dipimpin Wakil Presiden. Namun, setelah SA masuk penjara, pemerintah pusat membuka kesempatan bagi GPN untuk mengajukan tiga nama baru. Kedua, soal mutasi yang berakibat munculnya surat teguran Mendagri kepada GPN. Berbeda dengan banyak pihak yang mendukung surat teguran tersebut, saya memberikan pandangan yang berbeda. Menurut saya, sekalipun ada PP 49/2008 pasal 132A yang melarang pelaksana tugas melakukan mutasi kecuali dengan ijin tertulis Mendagri, PP ini sebetulnya bertentangan dengan UU 32/2004 serta semangat otonomi daerah dan prinsip demokrasi. GPN tidak sama dengan pejabat sementara kepala daerah lainnya yang ditunjuk oleh atasannya untuk mengisi kekosongan jabatan karena pejabat definitif mengikuti Pilkada atau karena hal lain terjadi kekosongan kekuasaan di satu daerah. Pejabat sementara seperti ini adalah pegawai negeri senior yang memang bawahan Mendagri di dalam struktur birokrasi. Tapi pejabat sementara semacam GPN duduk dengan predikat Pelaksana Tugas Gubsu adalah pemimpin yang dipilih rakyat melalui Pilkada, bukan ditunjuk oleh birokrasi Kemendagri. Karena itu, GPN memegang mandat rakyat sehingga legitimasi kekuasaannya berbeda dengan pejabat sementara yang ditunjuk oleh atasannya di birokrasi. Tetapi anehnya, ada banyak pejabat sementara yang ditunjuk oleh Kemendagri bahkan melakukan mutasi, namun tak satu surat teguran pun pernah dilayangkan Mendagri kepada mereka. Pasal 132 A semestinya lebih tepat buat mereka karena mereka bawahan Mendagri di dalam struktur birokrasi dan mereka tidak merepresentasikan kedaulatan rakyat (people sovereignty). Deal politik baru Karena itu, di dalam konteks prinsip demokrasi dan otonomi daerah inilah saya mendorong kedua belah pihak— GPN dan DPRD Sumut—perlu melakukan koordinasi yang intensif di dalam membangun Sumatera Utara. Lupakan lah soal interpelasi yang sudah menyita perhatian dua bulan terakhir ini. Kedua belah pihak perlu memikirkan masa depan Sumut. Kita juga berharap, GPN lebih berani mengambil inisiatif membangun komunikasi politik dengan dewan, juga menggalang kekuatan dukungan dari sebanyak-banyaknya

elemen sosial politik di luar parlemen/ partai politik. Yakinkan anggota dewan tentang rencana ke depan apa yang mau dilakukan, jelaskan pula “deal politik baru” apa yang ditawarkan. Galang juga kekuatan Pemkab dan Pemko yang cukup lama tak punya “pemimpin-fasilitator” di tingkat provinsi dan karena itu jalan sendiri-sendiri. Katakan apa yang ingin dicapai ke depan dan apa yang bisa dikerjakan bersama. Sumut sudah lama kehilangan pemimpin dan terlalu lama memiliki penguasa, yang sering kali malah korup dan tak amanah.Yakinkan lah semua elemen masyarakat bahwa GPN berbeda. Tapi seorang pemimpin tidak mungkin dikenal berbeda dari penguasa sebelumnya, jika tidak menunjukkan pemikiran dan tindakan yang berbeda serta mampu mengkomunikasi makna substantif perbedaan itu kepada mitra kerja di pemerintahan yakni dewan,birokrasi, Pemkab/Pemko dan yang tak kalah pentingnya publik luas. Penulis adalah Dosen Ilmu Politik FISIP USU, Direktur Rumah Politik ANDALAS.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Partai Demokrak bidik jabatan Wagubsu - Alamak ke sana arahnya, he...he...he * Masyarakat mudik harus lapor Kepling - Asal jangan kena biaya administrasi * Kondisi stok bahan pokok tak terpantau - Harga pun tak terkendali

oel

D Wak


Opini

WASPADA Kamis 25 Agustus 2011

B5

Kemerdekaan Yang Hakiki Surat Terbuka Untuk Bapak Presiden Setelah kami membaca dan memahami maksud surat edaran Menteri Pendayagunaan Aparatur Negara Republik Indonesia No.SE/15/M.PAN/4/ 2004 tanggal 26 April 2004 tentang Larangan Pengalihan PNS dari Jabatan Guru Ke Jabatan Non Guru terutama pada point 3, 4 dan poin 7 yang jika dilanggar bisa berakibat fatal bagi Pemerintah Kabupaten Labuhanbatu. Surat Edaran tersebut ditujukan kepada seluruh gubernur dan bupati seIndonesia dengan maksud dan tujuan agar ditindaklanjuti dan dipatuhi, guna meningkatkan mutu pendidikan di Negara Republik Indonesia dengan salah satu cara tidak membenarkan mengalihkan PNS dari jabatan guru ke jabatan non guru. Karena secara umum di Indonesia masih kekurangan tenaga pendidik (guru), khususnya di Kabupaten Labuhanbatu, di sisi lain guru dinilai tidak mempunyai kompetensi untuk menduduki jabatan struktural, dan hal ini akan bisa berpengaruh pada kinerja organisasi. Namun pada saat ini Pemerintah Kabupaten Labuhanbatu Sumatera Utara, larangan tentang pengalihan PNS dari jabatan guru ke jabata non guru tersebut sama sekali tidak berlaku. Kepala Dinas Pendidikan Labuhanbatu diangkat dari Jabatan Guru Kepala SMKN 1 Rantau Utara, bahkan seluruh perangkat jabatan eselon III di lingkungan Dinas Pendidikan Kabupaten Labuhanbatu semuanya dari unsur guru, begitu juga pejabat eselon IV sebagian besar dari kalangan guru. Demikian juga Kepala Unit Pelaksna Teknis Pendidikan Keca-matanm semuanya dari unsur jabatan guru. Anehnya lagi pejabat-pejabat yang selama ini sudah memilki sertifikat untuk menduduki jabatan kepemimpinan seperti Diklat Adum, Adumla, SPMA dll tetapi di non jobkan dengan alasan yang tidak jelas dan digantikan dari kalangan jabatan guru-guru yang tidak pernah sama sekali mengikuti Diklat kepemim-pinan. Sehubungan hal tersebut di atas, kami bermohon kepada bapak, agar kiranya mengingatkan Bupati Labuhanbatu yang menjabat sudah hampir 1 tahun supaya mengevaluasi kembali seluruh pejabat yang dimutasi. Menurut evaluasi kami, dampak dari mutasi tersebut , dunia pendidikan di Kabupaten Labuhanbatu bertambah tidak baik, hal ini dibuktikan dengan adanya beberapa permasalahan hukum, baik pidana maupun PTUN. Selanjutnya kami mohon agar menugaskan kembali seluruh guru-guru yang menduduki jabatan struktural ataupun yang beralih dari jabatan guru ke jabatan non guru terhitung mulai 25 April 2004 sampai sekarang ini, supaya bertugas kembali melaksanakan proses belajar mengajar di sekolah, karena saat ini Kabupaten Labuhanbatu sangat-sangat kekurangan guru, hal ini sesuai dengan maksud surat edaran Menpan RI No. SE/15/M.PAN/4/2004, tanggal 25 April 2004. Demikian kami sampaikan permasalahan ini kepada Bapak Presiden semoga dapat mengambil sikap tegas atas permasalahan ini, sehingga apa yang dicita-citakan khususnya mencerdaskan kehidupan bangsa melalui jalur pendidikan lebih cepat tercapai. Hormat kami, AH, Pemerhati Pendidikan Labuhanbatu

Dedi Sahputra

Foliopini

dedisahputra@yahoo.com

Privat Majelis tengah malam itu ramai luar biasa. Jauh lebih ramai dari sebelumnya. Saya tidak tahu. Mungkin keramaian orang malam itu adalah untuk menyongsong tanazalul-l malaa’ikatu warruuhu fiihaa, suatu gelombang malaikat yang berbondong-bondong turun di tengah kesunyian malam. Atau mereka datang karena menyongsong pembesar dari Jakarta yang memang sedang datang. Ini bisa jadi “petaka” karena mereka akan mengabaikan pesta pora para malaikat malam itu. Tapi bisa jadi pula keberbondong-bondongan orang malam itu untuk tujuan keduanya, menyambut pejabat sekaligus “menikmati” lailatul qadar. Kalau yang ini fifty-fifty. Tapi baiklah, saya pun merasa lebih nyaman untuk ber-husnuzhon saja. Semua yang hadir malam itu adalah orang-orang yang ingin ikut merasakan keriuhrendahan pesta rahmat dalam keheningan—bersama rombongan ribuan, jutaan malaikat yang turun secara bergemuruh dari langit—dipimpin Sang Ruh, Jibril As. Para malaikat ini turun atas izin resmi dari Allah SWT. Para malaikat itu masing-masing membopong berlaksa-laksa rahmat bagi siapapun manusia yang menginginkannya, merindukannya dan memiliki kesiapan untuk menerimanya. Benar..., hanya bagi orang yang punya kesiapan untuk menerima saja. Maka perasaan saya tidak punya pilihan lain kecuali harus bahagia berada di tengahtengah para perindu itu. Hati saya berujar, selain Rasulullah SAW dan keluargaku, maka orang-orang Mukmin itu adalah orang-orang yang aku harapkan bisa bertemu di yaumul akhir kelak—mereka yang merindukan berpestapora dalam kesunyian lailatul qadar. *** Politik Sakoku (isolasi) pun lenyap seiring runtuhnya kekuasaan Shogun Tokugawa. Maka muncullah Kaisar Meiji memimpin bangsa Jepang. Di titik ini Jepang mulai mengenal modernisasi, melalui Restorasi Meiji. Sejak itu bangsa ini cuma kenal kerja keras dan disiplin sebagai kewajiban. Dan wushh.., Jepang jadi negara terdepan di dunia. Maka saya bisa fahami kalau ada menyebut; Soal disiplin dan kerja keras, belajarlah ke Jepang. Tapi siapakah yang menyangka kalau guru terbaik dalam kedua hal itu ada di dalam diri kita sendiri. Cobalah, di suatu malam yang hening, Anda bangkit diam-diam, jangan tahu orang tua, saudara, anak dan istri atau suamimu. Langkahkah kaki pelanpelan sehingga semut pun tak terbangun. Kemudian cobalah duduk santai, pejamkan mata, aktifkan pendengaran dalam volu-

me maksimal. Dengarkan suara denyut jantungmu berdetak. Nanti engkau akan mendengar irama yang stabil secara terus menerus. Dari awal hidupmu, dia telah terus berdenyut tanpa henti, dengan irama yang stabil pula. Antara satu denyutan dengan denyutan sebelum dan sesudahnya, dia punya jarak yang sama. Begitu seterusnya. Jantung bekerja keras dengan disiplin untuk memompakan darah ke sekujur tubuh. Yang dengan kerja keras dan disiplin itu, dirimu terbentuk. Maka jika engkau tidak disiplin dan tak mau bekerjakeras, itu artinya engkau sedang mengabaikan dirimu sendiri. Hanya jika engkau mengabaikannya, maka denyut itu akan melambat atau semakin cepat. Kekeliruanmu dalam bersiplin hanya akan membuatnya sema-kin keras bekerja. Tapi dia tetap disiplin untuk berde-nyut. Bayangkan kalau kemalasanmu dan ke-seenakan-mu itu dibalasnya dengan berhenti berdenyut, maka engkau akan tinggal sejarah. Jadi dalam soal disiplin dan kerja keras ini, kalau saja engkau punya sedikit lebih besar rasa malu kepada jantungmu. *** Padahal saya kadung memahami kemes-raan malam lailatul qadar itu cuma bisa diha-yati secara privat. Ada lagi kerja keras dan disiplin sebagai prasyarat mempersiapkan diri menerima kedatangannya. Ini seperti mengisi batere, supaya senter menyala; seperti memperbesar memory komputer supaya bisa menampung banyak data; Tanpa itu engkau cuma seorang penggembira . TV saja tak bisa menyala kalau tak ada tenaga listrik dan antena yang terpasang. Maka ketika kalau engkau merasa dadamu bergoncang hingga meledakkan tangismu, maka ledakkanlah sepuasmu, tapi cuma berdua dengan-Nya. Jangan biarkan orang lain tahu. Karena engkau harus merasa malu. Namun jangan salahkan sang pembesar yang memimpin qiyamul lail, karena tak tahan menahan guncangan itu. Dia mewek, nangis sesunggukan seperti anak kecil kehilangan permen. Dia tengah diterpa keindahan kemesraan cinta-Nya di antara lantunan ayat yang dibacanya. Tapi pak pembesar, please deh ah, kok bacaan ayatnya panjang amat? Kalau si Polan sangat menikmati mercintai istrinya, mereka cukup menikmati berdua saja. Kalau ada orang mengintip, maka serta merta dia menghentikan percintaannya itu dan menghalau si pengintip. Bukan malah menikmati ditonton orang ketika bercinta, disaksikan keperkasaannya. Mem-video-kannya. Ini pelaku para penggembira belaka. Maka lalai berdisiplin saja ternyata sudah sangat mengerikan. (Vol.245, 25/8/2011)

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

Oleh Albiner Siagian Ciri manusia yang merdeka lainnya adalah keterlibatan mereka dalam setiap keputusan yang menyangkut hajat hidupnya.

P

ada tanggal 17 Agustus 1945, enam puluh enam tahun yang lalu, Bapak Proklamator kita, Soekarno-Hatta, memroklamirkan kemerdekaan bangsa Indonesia. Itu adalah tonggak bersejarah dalam perjalanan bangsa ini. Mulai saat itu, kita menjadinegarayangberdaulatpenuh,tidak lagi terjajah oleh bangsa lain. Walaupun saya dilahirkan pada masa kemerdekaan, dalam pemahaman saya, ada perbedaan dan persamaan antara keadaan sebelum dan setelah merdeka. Perbedaannya, antara lain, adalah kalau sebelum merdeka kita ‘diperbudak’ oleh penjajah, saat ini hal itu tidak lagi. Kita tidak lagi menghamba kepada penjajah. Kalau dahulu, menurut cerita orang tua, para pendahulu kita dipaksa menghormat matahari terbit, sekarang itu tidak akan pernah lagi. Kita punya merah putih yang kepadanya kita mengarahkan tatapan. Lalu, apa persamaannya? Walaupun keadaanya berbeda dari saat sebelum merdeka, nuansa penjajahan masih terasa saat ini. Yang berbeda adalah bentuk dan intensitasnya. Sebagai contoh, untuk mendapatkan hak-hak dasar, itu masih memerlukan perjuangan keras bagi sebagian

masyarakat. Terbatasnya pilihan hidup merupakan bentuk penjajahan gaya baru di era modern ini. Antrean panjang untuk mendapatkan seliter minyak tanah adalah contoh masih terjajahnya rakyat oleh yang disebut sebgai ‘penjajah ekonomi’. Kerumunanorangberdesak-desakanmendapatkan uang receh dari penderma bukan pula pertanda makin luasnya pilihan rakyat. Kemerdekaan yang direbut dan diperjuangkan oleh para pahlawan kita dengan darah dan nyawa haruslah menjadi titik awal bagi bangsa ini menuju ke arah yang lebih baik. Kita yang dihadiahi kemerdekaan oleh para pejuang (bukan oleh penjajah), dituntut untuk mengisi kemerdekaan dengan sebaik-baiknya. Caranya adalah dengan membangun. Tujuannya adalah masyarakat yang sejahtera, yang merasakan keadilan, dan masyarakat bermartabat. Untuk dapat merasakan kesejahteraan, keadilan, atau untuk menjadi lebih bermartabat, masyarakat harus terpenuhi kebutuhan dasarnya. Hak asasinya juga tidak boleh dirampas, dikekang, atau diabaikan oleh pihak mana pun, termasuk oleh negara. Mereka harus menjadi masyarakat yang terbangun (developed people) dalam

arti yang luas. Menurut konsep pembangunan manusia, hakekat pembangunan adalah kesejahteraan manusia. Ini sesuai dengan tujuan kemerdekaan yang tertuang dalam pembukaan undang-undang dasar kita. Mahbub ul Hag, penggagas teori pembangunan manusia, menyatakan bahwa tujuan dasar pembangunan adalah memperluas pilihan rakyat (enlarging people’s choices). Pembangunan bukan sematamata diukur dari pertumbuhan ekonomi. Akan tetapi, lebih daripada itu, pembangunan harus menciptakan iklim yang memungkinkan manusia untuk menikmati hidup secara lebih sehat dan kreatif. Muaranya adalah manusia yang lebih sejahtera dan lebih bermartabat. Ini adalah ciri manusia yang udah mengecap kemerdekaan. Cara pandang terhadap pembangunan yang demikian sebenarnya bukanlah hal yang baru. Akan tetapi, hal ini sering dilupakan karena perhatian pembangunan lebih ditujukan pada kesejahteraan secara finansial. Para filsuf telah lama menekankan pada kesejahteraan manusia sebagai tujuan dan akhir dari pembangunan.BukankahAristoteles,seorangfilsuf Junani, telah berkata, “Wealth is evidently not the good we are seeking, for it is merely useful for the sake of something else.” Ciri manusia yang merdeka lainnya adalah keterlibatan mereka dalam setiap keputusan yang menyangkut hajat hidupnya. Di alam kemerdekaan dan demokrasi ini, seyogianya keputusan pemerintah dan penyelenggara negara harus benar-benar

mempertimbangkan suara hati rakyat. Sesungguhnya, rakyat tidak menyerahkan kekuasaannya kepada penyelenggara negara. Rakyat hanya menitipkannya supaya dikelola dengan baik. Itu bukan berartibahwapenyelenggaranegaraberhak memutuskan dan rakyat harus menerimanya, betapa pun pahitnya. Amartya Sen, seorang peraih Nobel bidang Ekonomi, dalam tulisannya pada Journal of Democracy 10.3 (1999), menyatakan ada tiga cara yang melaluinya demokrasi memerkaya kehidupan rakyat. Salah satunya adalah demokrasi memiliki perangkat nilai penting yang dengannya rakyat dapat mengekspresikan tuntutannya dalam keputusan politik maupun ekonomi. Keputusan yang menyangkut hajat hidup rakyat harus memihak rakyat dan harus melibatkan rakyat dalam mengambil keputusan tersebut. Keberhasilansuatupemerintahan,salah satunya, ditentukan oleh sejauhmana kebijakan pemerintah memperluas pilihan rakyatnya. Kebijakan pembangunan harus membangun rakyat dan menolong mereka untuk menjadi manusia yang terbangun dan bermartabat. Menurut konsep Indeks Pembangunan Manusia, ciri manusia yang terbangun adalah kondisi dimana rakyat lebih leluasa untuk memenuhi kebutuhannya akan hidup sehat dan lebih lama, lebih terdidik, dan lebih mampu menjangkau pelayanan dasar lain. Tanpa itu, berbagai pilihan tetap tidak tersedia dan berbagai kesempatan tetap tidak tercapai. Penulis adalah Pengajar Pascasarjana IKM FKM USU.

Belajar Dari Inggris Oleh Faisar Ananda Arfa Persoalan jamak yang menghinggapi setiap negara adalah pardigma yang keliru dalam definisi pembangunan yang terlalu berkonotasi pembangunan fisik.

K

erusuhanyangmelandabeberapa kota Inggris seperti London, Mancherster dan Liverpool mengingatkankitapadakejadianserupadinegara medio 1998. Namun yang menjadi keheranan sebagian orang adalah kenapa kejadian ini dapat menimpa negera sekaliber Inggris yang termasuk negara adidaya. Sebuahnegarayangdikategorikanmakmur dengan tingkat pendapat rata-rata penduduknya masuk kategori negara maju. TerlepasdarikeberhasilanInggrisdalam menangani kerusuhan tersebut, kejadian inidapatdianggasebagai earlywarning bagi pemerintah manapun di dunia. Bahwaq kerusuhan sosial itu seperti amukan api yang dapat meluluhlantakkan setiap bangunan kebangsaan dalam sekejap saja. Kesejahteraan rakyat Bagi kita yang pernah berjalan-jalan di kota-kota besar di Inggris mungkin akan terkaguam-kagummenyaksikanwajahkota yang dipenuhi bangunan megah, antik dan terkesan kuno dengan perawatan dan penataan modern. Ini menempatkan London sebagai salah satu pusat perbelanjaan dunia. Ditambah lagi persiapan kota menghadapi Olimpiade 2012 membuat kemegahannya bertambah. Namunsiapapunyangpernahmeneliti sebuah kota akan menyimpulkan bahwa

dibalikkelilingbangunan-bangunanmegah kota-kota besar terdapat kantong-kantong kemiskinan yang tertutupi penempilan kemegahan bangunan. Bak api dalam sekam, kemiskinan inilah yang sewaktuwaktu tanpa warning akan meluluhlan-takkan bangunanmegahtersebutbila ada pemicunya. Pemicunyabisasajamunculdari hal-halsepelesepertikecelakaan jalan raya atau tertembaknya seorang pejalan kaki oleh polisi. Faktaseringbicarapendeka-tan keamanan sajatidakcukupbilaperasaan keadilan masyarakat sudah cukup lama terkoyak menganga. Para pelaksana negara harus menunjukkan sikap empati yang dalam terhadap perbaikan nasib masyarakat di setiap lapisa. Tidak wajar bila fokus pemerintah hanya untuk masyarakat menengah atas saja. Masyarakat lapisan bawah adalah mereka yang sangat merasakan ketidakadilan pembangunan. Belajar dari Inggris, yang menimbulkan kerusuhan adalah masya-

rakat lapisan bawah yang mungkin sudah sampai pada kecemburuan alam bawah sadaryangterpendamlama—menyaksikan para selebritisnya hidup mewah, mobilmobil mewah berseliweran sementara mereka hanya bisa menatap. Makanan tersaji di restoran jauh dari jangkauan kantong sehingga mereka hanya bisa menelan air liur. Anak-anak mereka yang tidak mampu melanjutkan sekolah meskipun pintar sebab kursi-kursi di universitas telah dibeli orang-orang kaya. Barang-barang yang terpajang di mall dengan harga yang sukar dibayangkan kantong mereka. Ketika muncul faktortrigger-nyamakaibarat percikan api menyambar bensin menimbulkan kebakaran sosial yang besar. Bangsa Indonesia punyasilakelimayangberbunyi keadilan sosial bagi seluruh rakyat Indonesia, seyogianyainilahyangmenjadiacuanpemerintahdalam setiap membuat keputusan bidang ekonomi dan perdagangan. Sehingga rakyat bisa terhibur dan melihat memang pemimpinnya terus berusaha menciptakan keadilantersebut.Meskipunbelum tercipta paling tidak rakyat menyaksikan para pemimpinnya telah berusaha dan itu sudah cukup menghibur mereka bertahan dalam kesusahan. Paradigma pembangunan Persoalan jamak yang menghinggapi setiap negara adalah pardigma yang keliru

dalam definisi pembangunan yang terlalu berkonotasi pembangunan fisik. Akibatnya kota-kota di dunia berlomba-lomba melakukan pembangunan fisik bangunan dengan arsitektur yang canggih. Mereka berlomba menciptakan bangunan tertinggi diduniadalamupayamenciptakanpersepsi dan imej sebagai kota besar dan sukses. LihatpulajutaanTKIrelameninggalkan istri dan anak mereka bekerja sebagai pembantu dan tenaga kasar untuk memperbaiki taraf kehidupan. Di luar negeripun mereka menghadapi persoalan pelik, jauh dari suami atau istri membuat mereka tidak mungkin mempertahankan standar moralitasnya selama ini. Ditambah perlakuan perwakilan Indonesia di luar negeri yang lemah memberikan perlindungan. Begitupun dengan jumlah devisa masuk yang bahkan mungkin triliunan, paraTKI tersebut punya andil besar mengendalikan keamanan dalam negeri. Uang mereka membantukesabaranrakyatIndonesiabertahan melihatparapemimpinnyaberdebatmemperebutkan kursi, jabatan dan melupakan nasib rakyat. Belajar dari Inggris kita hanya berharap semoga kesabaran rakyat Indonesia tanpa batas sehingga negeri ini tetap aman walaupun dalam kesemuan. Sebab bila kesabaran masyarakat habis ketika melihat ketidakadilan dan kesemana-menaan serta ketidakacuhah pemerintah, maka pendekatan keamanan apapun tidak akan mampumenghentikankemarahanmereka.Makasediapayungsebelumhujanmerupakan filosofis yang wajib dianut pemerintah dalam menjalankan fungsi manajemen yang baik. Penulis adalah Dosen Filsafat Hukum PPS IAIN Sumut.

Menyoal Islamic Studies Oleh Teuku Zulkhairi Aneh bukan jika belajar Islam justru kepada orang-orang yang tidak beriman dan meragukan kebenaran Islam?

D

ewasa ini, negara-negara Barat telah berhasil memberi pesona kemajuannya di bidang ilmu pengetahun dan teknologi kepada dunia Islam. Kemajuan pesat Barat ini telah menjadi magnet kuat menarik minat umat Islam untuk belajar di negara mereka. Sehingga banyak umat Islam yang pergi ke beberapa negara maju di Eropa, Amerika dan Australia untuk belajar berbagai disiplin keilmuan seperti teknologi, science dan filsafat atau bahkan tentang agama Islam. Namun, hingga detik ini saya masih heran kenapa banyak intelektual Islam yang merasapentinguntukbelajarIslamkeBarat. Satu kerisauan yang dianggap aneh ketika hal ini saya pertanyakan kepada para alumnus Islamic Studies, atau para intelektual yang pernah belajar Islam di Barat. Jika tujuannya belajar bahasa Inggris, komputer, cara membuat mobil dan berbagai teknologi lainnya, saya pikir okelah. Yang mengherankan adalah, apa landasan jika kita menjadikan Barat sebagai guru belajar Islam? Dari beberapa diskusi kecil, terlihat seperti kebanggaan luar biasa bagi mereka yang telah belajar Islam di sana. Suatu pemandangan yang membingungkan saya untuk kali selanjutnya. Aneh bukan jika belajar Islam justru kepada orang-orang yang tidak beriman dan meragukan kebenaran Islam? Padahal Allah telah mengingatkan agar kita tidak mengambil orang-orang kafir sebagai guru agama Islam. Orang-orang Kristen,Yahudi, Budha, dan Hindu cukup waras untuk tidak belajar agama mereka kepada orang-orang yang bukan seagama dengan mereka.Yang ada adalah mereka datang kepada umat Islam untuk belajar Islam, dimana banyak cerita kemudian kita dengar banyak di antaranya yang akhirnya masuk Islam. Namun, apa sebab ada umat Islam belajar agamanyakepadamereka?Tidakwaraskah? Ketika menulis artikel ini, saya baru saja memperoleh informasiseorangmahasiswa dari negeri jiran yang gagal mendapatkan gelar doktoralnya (PhD) karena tidak bersedia menulis desertasi yang sesuai

pesanan supervisornya. Sebaliknya, ada satu mahasiswa lagi dari Bangladesh yang begitu mudah mencapai gelar doktoralnya danbahkanprofessorketikadengansenang hati menulis disertasi sesuai keinginan supervisor. Keterangan selanjutnya yang saya peroleh adalah, desertasi yang lulus tersebut intinya adalah sanjungan untuk metodolgiBarat,danberbagaikritikanuntuk metodologi kajian Islam ala dunia Islam (universitas Islam). Artinya, wajah Islam yang tergambarkan dalam tulisan tersebut telah sesuai dengan cara pandang Barat terhadap Islam. Saya pikir, Barat sejauh ini sudah memiliki sebuah konsep dalam memandang agama Islam. Atau Barat seakan sudah memberikan“bentuk”Islamitusendiri,agarIslam yang dikonsepkan/dibentuk olehnya bisa “lunak” terhadap mereka. Lunak terhadap budaya mereka, lunak terhadap berbagai kepentingan mereka. Dalam hal ini, umat digiring ke dalam kebiasaan/kepentingan mereka dengan pemikiran yang luar biasa. Dengan logika menyentuh, dan lebih hebatnya lagi kalau sudah menyitir ayat Alquran bahwa Islam itu“begini dan begini”. Inisudahbisadipastikan,lahirnyaaneka konseppemikiranituakanberpihakkepada Barat, seolah mereka berbicara:“sudahlah teman, jangan terlalu ekstrim terhadap kami, kalau kalian mau menerima sebagian kebiasaan kami, kalian juga yang akan menikmatinyabukan?”Tanpaterasa,disaat sepertiinisecaratidaklangsungataubahkan secara langsung iman kita telah tergadaikan dan kebangkitan Islam justru semakin terhambat. Muhammad Imarah dalam bukunya Ghazwul Fikri, menyebutkan ada beberapa ajaran Islam yang tidakdiadopsi Barat ketika mereka mempelajari sains Islam. Di antaranya, pertama, Barat tidak mengadopsi ajaranIslamyangmemadukansyariatIslam dengan kehidupan dunia. Mereka memisahkan dunia dari agama. Kedua, mereka tidak mengambil ajaran Islam yang mengutamakan kemaslahatan bersama, akan tetapi kehidupan mereka bersifat indivi-

dualis. Ketiga, Barat tidak mengambil ajaran yang mengutamakan akhlak dan ganjaran akhirat dalam amalan, akan tetapi mereka beramal sesuai syahwat mereka. Keempat, mereka tidak mengambil ajaran kekhalifahan sebagai sistem negara akan tetapi mereka mengambil sistem demokrasi. Jadi, sangatlah rugi jika umat Islamsekarangharusterkontamitasidengan nilai-nilai Barat ketika mereka mencoba mengadopsi peradabannya, seperti liberalisme, sekularisme, feminisme, dan lainlain. Padahal hal itu hanya akan mendekontruksi nilai-nilai keagungan Islam, yang telahdipegangteguhselamaberabad-abad. MengapaumatIslamtidakmencontohcara Barat dalam mengadopsi perdaban Islam, sebelum akhirnya mereka berhasil memegang peradaban dunia? Membenarkan apa yang disebut Muhammad Imarah, saya ingin mengutip sepotong ayat dan hadist. ”Janganlah orangorang Mukmin mengambil orang-orang kafir menjadi wali dengan meninggalkan orang-orangMukmin.Barangsiapaberbuat demikian, niscaya lepaslah ia dari pertolongan Allah” (Ali Imran:28). Begitu juga HadistRasulullahSAWyangberbunyi,“Yang aku takuti terhadap umatku ialah pemimpin-pemimpin yang menyesatkan”. (HR. Abu Dawud). Penting untuk kita catat, bahwa citacita tatanan dunia Islam yang maju dan beradab tidak hanya bertujuan untuk menciptakan kesejahteraan ekonomi dan intelektualitas yang tinggi., namun miskin spirtualitas seperti bangsa-bangsa Barat; tidak juga sebaliknya:Tinggi spirtualitas, namun lemah secara ekonomi dan intelektual seperti yang dialami oleh sebagian bangsa Timur.Islamtidakakanmajudenganmengadopsi total (tanpa filterisasi) semua paradigma dan metodologi (epistemologi, ontologi dan aksiologi) Barat, seperti Hermeunetika (cara tafsir Alquran dengan menggunakan metodologi Bibel), Pluralisme (paham yang intinya mengangap kebenaran agama sifatnya relatif) dan sebagainya. Sebagai bukti, secara historis kita bisa melihat, kejayaan Islam masa lalu dirintis para ulama dan umat yang memegang teguh ajaran Islam berlandaskan Alquran dan Sunnah. Misalnya saat kejayaan Islam di Abbasiyah,Turki Usmani maupun Andalusia.Semuakemajuandiraihdilandasisema-

ngat Alquran yang mengi-nspirasi menghasilkan banyak karya dan sumbangan peradaban manusia hingga era modern. Hal tersebut berbeda dengan apa yang terjadi di Barat, mereka mengawali kemajuannyadiabadpencerahan(renesaince) ketika mereka berhasil meninggalkan gerejanya (seculerism). Akibat tidak puas dengan doktrin gereja yang sangat membatasi mereka untuk berpikir, akhirnya GalileoseorangpemikirBaratmemberontak meski pada akhirnya ia mati di tiang gantungan. Selain Galileo juga banyak tokoh pemikir lainnya yang memberontak dan akhirnya harus mengakhiri hidupnya di tiang gantung sebagai hukuman karena melawan doktrin. Berbeda dengan Ibnu Sina, Ibn Rushd, Alkhawarizmi, Al-Kindi, Aljabar dan sebagainya yang membawa Islam ke puncak kemajuan dengan semangat Islam, semangatAlqurandanHadist.Bahkanparatokoh pemikirIslaminipulatelahturutmeletakkan peletak fondasi dasar kemajuan bangsa Barat.JaditugaskitasebagaiintelektualIslam adalah tetap teguh memegang nilai-nilai Islam dengan apapun resikonya dan mengambil nilai-nilai positif dari kemajuan Barat untuk kemudian mentransfernya ke dunia Islam, karena memang kemajuan Barat dari segi teknologi adalah juga sesuai dengan ajaran Islam. Saya pikir adalah kekeliruan yang besar ketika semua para-digma Barat tentang Islam ditelan mentah-mentah oleh sebagian intelektual Islam seperti Ulil Absar dengan komunitas Jaringan Islam Liberalnya di Indonesia. Apa yang saya tulis ini hanyalah sebuah kerisauan, keheranan sekaligus sebagai tanggung jawab moral saja. Bukan karena anti terhadap Islamic Studies.Terakhir, kita tidak dilarang memiliki pendapat atau bahkan menyebarkan pendapat tersebut. Yangdilarang/salah adalah ketika kita tidak bisa berpendapat atau berdialog dengan santun sesuai etika Islam yang telah diterjemahkan Rasulullah selama hidupnya. Semoga tulisan ini bisa membuka kembali ruang dialog tentang diskursus pemikiran Islamdalamkonteksbagaimanametodologi yang tepat untuk meraih kembali kejayaan Islam. Wallahu a’lam bishsawab. Penulis adalah Mahasiswa Pascasarjana IAIN Ar-Raniry, Banda Aceh.


B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive : Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 320i Limited Edition Th. 95. Mulus, S. Pakai. Hrg. 59Jt. Nego. Hub. 0821 6212 8233 CHEVROLET ZAFIRA 1.8 BENSIN THN 2002 DIJUAL Warna Hitam Metalik, Kondisi siap pakai, AC, Tape, DVD, MP3, Pajak panjang 1 thn penuh Harga 75 Jt/nego Peminat serius Hub. 0853.7000.0354 DAIHATSU Taft Badak Pick Up Thn. 82. Mobil siap pakai. Bak Plat Bunga Gerdang Aktif. @ 60 Jt. Nego. Hub. 0812 6525 760 DAIHATSU GRAN MAX, MINIBUS Thn. 2008, Silver. Over Credit, sdh Byr 17xRp. 3.017.000. Orisinil & Siap pakai. Blk DP/Nego. Hub. 061-7742 0125

ASTRA DAIHATSU

PROMO LEBARAN !!!

Ready: ALL NEW SIRION, XENIA, LUXIO & PICK UP Bunga Ringan & Proses Cepat Hub. Yusuf 0852 6168 1210 061 7777 9356

DAIHATSU Espass Minibus Thn. 96. Biru metalik, body mulus, ban baru. AC Dingin Rp. 36 Jt/Nego. Hub. 0812 6344 5757 DAIHATSU Taft GT 4x4 Wrn Hitam, Asli Medan Th. 90, mulus, 6 Speed, Ban 31, VR, PS, Jok Hdp Depan, sound Power, AC Dingin, Hrg. 49Jt. Nego. Hub. 0821 6246 7871

DAIHATSU FEROZA THN ‘94

5 CM 6 CM

Rp. 65.000 Rp. 78.000

OPEL BLAZER 97

Mulus. W. Biru tua met, BK Medan, lengkap, siap pakai. H. 50Jt. Nego. Balik DP 30Jt. Sisa 24 x Satu juta seratus empat puluh ribu. Hub. 0812 6477 946

OPEL BLAZER Lt. DOHC Injection Silver met Th. 96. Sgt orisinil dan mulus, mesin sehat, AC Dingin, asli Medan. Hrg. 45Jt. Nego Abis. Hub. 061.77700712

SUZUKI Katana Thn ‘92/93 W. Hijau Met, Siap pakai, AC, Tape, Harga Nego Hub. 0853.6214.2223 SUZUKI Carry Pick Up ‘05 DIjual, Warna Biru, Hrg 56 Jt Hub. 0813.6101.8855 DEALER RESMI SUZUKI MOBIL

Carry PU 1.5 FD, Rp. 8 Jt-an Angs. 2.672.000,APV Arena Rp. 11 Jt-an Angs. 4.073.000,Splash GL Rp. 13 Jt-an Angs. 4.069.000,Swift ST. Rp. 17 Jt-an Angs. 4.726.000,SX4 Rp. 20 Jt-an Angs. 5.510.000,Hub: 0812 654 0809 / 77722121 SUZUKI Katana 89” wrn hitam mulus, AC, Tape, VR, BR, Jok rapi, pajak panjang 2012. Hrg. 31Jt Nego. Rumah mewah ukuran 15 x 36M. Lantai 2. Full keramik, lihat fb zoelkifly82_@yahoo.co.id. Hub. 0852 60 79 1969

SUZUKI Minibus APV Thn. 2005 Dijual. W. Biru metalic AC, Tape, VR, Power Window, Power Steering, Sentral Lock mulus. Hrg. 85Jt. 500.000 Nego. HP. 0813 7031 0953

SUZUKI Katana GX Thn. 93, warna putih, cat & interior mulus, AC, Tape, Velg Racing, Power Steering, bawaan mobil, harga 42 Jt. HP. 0815 3136101, Flexi 061-77402356

HYUNDAI ACCENT THN ‘00

HONDA Jazz Thn 2004 Warna Abu² Muda Metalik, BK asli Medan, Manual Jl. Veteran No. 1045 Psr. 4 Helvetia 0812.6553.275 / 7640.5222

ISUZU Panther New Hi-Grade Thn ‘99 Warna Hijau, BK Medan, Hrg 82 Jt/nego Hub. 0812.6081.8019 MITSUBISHI Lancer Thn ‘82 Biru Komplit, Cantik/ Terawat Hub. 0852.6134.0601 Komp. TNI AU Jl. Jatayu 98 MITSUBISHI Lancer Evo IV Th. 1999. SE.i, Hijau gelap, over kredit. sdh byr. 18xRp. 3.120.000. Siap pakai. Blk DP/ Nego. Hub. 0812 656 5535 MITSUBISHI T120 SS Pick Up W. Putih. Thn. 2003. Mobil mulus, sehat, seksi bagus, siap pakai. @ 42 Jt. Nego. Hub. 0821 6754 7635 MITSUBISHI Kuda (Diesel) GLS Thn. 2000. BK Asli Mdn / Pajak baru. Fasilitas lengkap/Komplit. PS, PW,CL (remote) AC, Tape, BR, VR, 90% sgt mulus, sehat, terawat. Hub. 0812 6013 966 (Asen) Hrg. Rp. 85Jt/damai. NB: Siap pakai/mbl sgt. bagus, wrn: ungu metalic.

TOYOTA KIJANG SUPER COMMANDO THN ‘88/89 Abu-abu Metalik, Mulus, AC dingin, Siap pakai, Rp. 42 Jt/nego Hub. 0853.6230.0613

# TOYOTA BARU STOCK TERBATAS # AVANZA, GRAND NEW KIJANG, INNOVA, GRAND NEW FORTUNER, RUSH, YARIS, VIOS, ALTIS, CAMRY, HILUX. TERIMA TUKAR TAMBAH - PROSES CEPAT DAPATKAN DISCOUNT + HADIAH MENARIK

HUB: TOMMY 0813.7043.7766 TOYOTA Kijang Capsul Model LGX New Bensin 1,8 Th. 2003. Biru mika, sgt terawat, VR, BR, PS, PW, CL, Rmt, E.Miror. AC DB, S. Sistem pake power dan TV, full Acesories, Hrg. 133Jt. Nego Abis. Hub. 0812 6063 7823

TOYOTA Kijang Innova 2.0 G Thn. 2006 Warna silver, Plat B Body kaleng. Tangan 1 Hrg. 150Jt. Hub. 0852 7010 0168 - 0821 7144 2522

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih

SUZUKI THUNDER THN 2006 Warna Hitam, Mulus, Kondisi sehat, Stater, Engkol, Sudah di modif, Mono sex, Ban besar, Velg scorpio, Harga Rp. 5,5 Jt/nego Hub. 0812.6358.4779

BURSA BUTUH DANA

TOYOTA Vios Limo Thn. 2004, Silver plat B, mulus, Harga 79 Jt/Nego. Hub. 0813 6215 1688

GEBYAR DANA LEBARAN

TOYOTA Avanza G Over Kredit Thn 2011, Silver Met, Balik DP, 56 Jt/nego Sudah 7x bayar, Sisa 29x 4.691.000 Hub. 0812.6477.7088

TOYOTA Kijang Grend Extra Thn ‘96 Biru Met 1.8 Mobil Cantik, Siap pakai, 72 Jt/nego Hub. 0812.6525.760 TOYOTA SUPER KIJANG G Thn. 1994. Long, abu2 met. AC DB, P. Window, Orisinil & Siap pakai. Hub. 0812 6344 9555 TOYOTA Kijang Commando Long, 6 Speed, Thn ‘92, Hijau Met, Mesin sehat, Body mulus,VR, BR, RTP, AC Dingin, Hrg 50 Jt/ nego Hub. (061) 6967.9753 TOYOTA Kijang Capsul Tipe LX Thn 2001 akhir, Asli BK Mdn, Biru Met Hrg 98 Jt/ Telp. 786.3182 HP. 0812.6300.0077 TOYOTA L. Cruiser VS ‘95/96, Abu² Metalik, Jok kulit, Ban baru, BK Blank, Komplit & Terawat Hub. 0831.9968.7342

NEW TOYOTA

READY STOCK, PROSES CEPAT AVANZA, YARIS, INNOVA LUBIS

0813.8513.9900 (061) 7500.5003

TOYOTA Kijang Inova G 2007 Bensin, Manual, Silver, Pajak panjang, TV 3buah, Mulus, Cantik, Siap pakai BK Mdn Asli Rp. 178 Jt/nego Hub. 0852.9615.1588 TOYOTA Kijang Super ‘91. W. Hijau lumut, mulus, BK Asli Medan, AC, Tape, VR, BR, lengkap, siap pakai. 6 Speed. Harga 42Jt/Nego. Hub. 0812 6477 946

TOYOTA KIJANG GRAND EXTRA SHOT

Thn ‘93 Warna Abu² Metalik, AC double blower, PW, CL, PW, CD, Interior bersih, Jok kulit, Rapi, Body kaleng², Lepang, Mesin terawat, Cat mulus Hub. 0812.653.2880 Harga Rp. 68,5 Jt/nego (Buktikan) TOYOTA Kijang Grend Extra ‘95 Long, AC DB, Tape, PS, PW, CL, Abu² Met, Mulus luar dalam, BK Mdn asli HP. 0812.642.4995 Buk Suhar TOYOTA Kijang Kapsul SGX 1.8 Thn. 2001, W. Biru, mobil lampu & bumper & Grill sudah 2004, Cat & Interior mulus, TV, jok lapis, Velg Racing, AC DB Bawaan, Plat BB, Harga 102Jt. Nego. HP. 0815 313 6101. Flexi 061-77402356

Ingin Promosikan Produk Anda

Proses Cepat, Cair 1 Jam Tanpa Usaha. Jaminan: SHM, SK Camat, BPKB Mobil, Spd. Mtr. Truk. Bantu pelunasan BPKB Mobil/Over Leasing. Bunga Rendah dan Bergaransi. Hub. S8F

0618445 716, 0813 6229 00010813 7044 6633 BUTUH DANA TUNAI

Bunga: 0%, Pinjaman: 5 Jt s/d 2M, Proses s/d 15menit, Jaminan BPKB Sepmot & Mobil, Tanpa potongan komisi dll Hub. 0853.4859.5090 - 0857.5130.2761 (Situmorang)

BURSA

SERVICE/ASESORIS MOBIL

PROMO SARUNG JOK MOBIL

SPESIALIS ALAS DASAR, DOORTRIM, LANGIT-LANGIT, AUDIO, ASESORIES MOBIL & KACA FILM

TYPE MOBIL TYPE PROMO PROMO 1 PROMO II PROMO III PROMO IV

SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

Harian

WASPADA Media yang Tepat untuk Iklan Anda

SERVICE

BURSA

SEPEDA MOTOR

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

TOYOTA Innova V Thn ‘09/ 10, W. Hitam Met, Balik DP Rp. 129 Jt, Sdh byr 20 kali, Per bln, RP. 5.758.000, Pelunasan Rp. 148 Jt, Ass All Risk, Mbl Ctk sekali, Sprt baru, Komplit, Kembar Ponsel Jl. SM. Raja No. 200 (dpn UISU) 0857.6097.8888 / 785.1402

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

TOYOTA Kijang Super ‘90 akhir,Short, Merah, BK Medan asli, CDI, Cakram, Harga 42 Jt/damai Hub. 0852.9616.5574 TOYOTA Kijang Super Jantan ‘93, Hijau Metalik, AC, Tape, Siap pakai Hrg 48 Jt HP. 0812.6067.5890

11 CM Rp. 165.000 12 CM Rp. 180.000

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer.

TOYOTA ALTIS TYPE G THN. 01. W. Hitam, AC, Tape/CD, BR, VR (Import), BK Medan asli, body sgt mulus, jarang pakai, original. Mulai 0853 7015 9068

TOYOTA Kijlang Super Standart Long Biru Met, Thn ‘94 Dasboard sedan, VR, BR, PW, CL, RMT, RTP, AC double, S. Pakai, Hrg 56 Jt/nego Hub. 0821.6811.9388

Manual, Hitam, Balik DP Rp. 29 Jt, Sdh byr 8 kali, Sisa 28bln x Rp. 1.421.000, Pelunasan Rp. 34 Jt, Mblctk sekali, BK 20 GI, Pajak panjang Kembar ponsel Jl. SM. Raja No. 200 (depan UISU) 0815.3373.3688/ 785.1402

TOYOTA BARU 100% Innova Fortuner Model Baru, Avanza, Rush Yaris, Altis, Vios, Camry (Cash / Kredit). Hub. Putra Gea - Toyota HP. 0821 6569 2000

Hub. 0813.9717.8500

DAIHATSU Taft GT (4x4) 1988, BK Mdn asli, W. Hitam, AC DVD P. Window, Ban baru, Velg rac Hub Jl. Setia Budi No. 90H (Simp. Sei Blutu) HP. 0812.6025.8795 NB. Kondisi mobil siap pakai tdk ada rawat

HYUNDAI CAKRA ‘96 AKHIR

AVANZA, INNOVA, FORTUNER

PURBA : 0813 9736 0333

9 CM Rp. 126.000 10 CM Rp. 140.000

TOYOTA Vios Type G Thn. ‘04. W. Hitam, Lengkap, BK Mdn (BPKB 1 nama) sehat, mulus, orisinil, Tinggal pakai. Harga 132Jt. Hub. (061) 77731399

W. Abu² Met, 1500cc Mbl ctk sekali, Rp. 105 Jt

SUZUKI Carry Alexander ‘85 Dijual cepat, W. Hitam Metalic, VR, BR, Tape, Kondisi sangat mulus sekali, Siap pakai 0821.6604.1073

Hijau Metalik, BK Medan asli, AC dingin, Tape, Pelak Recing, Body kaleng mulus dan mesin okey Peminat serius hub. 0852.7630.2013, TP

Rp. 91.000 Rp. 104.000

SUZUKI APV DLX THN ‘06/ 07

W. Hitam, Rp. 39,5 Jt Hub. (061) 6998.1177

DAIHATSU Espass Roling Door Thn ‘95/96 Dijual, W. Silver Metalik, AC, Tape, Ban baru, Sangat mulus Hub. 0813.9642.3289

7 CM 8 CM

TOYOTA BARU

ELITE MOTOR

Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

AC AC

ELEKTRONIK JAYA TEKNIK

SERVICE: AC, KULKAS, M. CUCI, TV, CCTV, PARABOLA, BONGKAR, PASANG, BERGARANSI HUB: (061) 7791.3537/ 0813.7553.3375

AC

MADINA SERVICE CUCI - ISI FREON - REPARASI AC - KULKAS - MSN CUCI (061) 7797.2065 - 0813.6149.7921 SIAP DITEMPAT & BERGARANSI

PRATAMA TECHNIK

REPARASI/SERVICE AC SPLIT, WINDOW/CENTRAL, DISPENSER, MENGECAT KULKAS/

JUAL BELI AC BEKAS, DLL HP. 0812 6053 690 7352833 0812 6064 9333

AHLI TOSHIBA, SONY, POLYTRON, LG SAMSUNG, FUJITEC, TV CINA, dll 061 7362257 (HADI) atau 0882 6151 4252

TV

Kamis, 25 Agustus 2011

FAX.4561347 HARGA BELUM TERMASUK PPN 10%

BERKAS HILANG Surat Akta Pelepasan Hak Dengan Ganti Rugi No. 79/3/APH GR/TAB/1998. Tgl. 2 April 1988. a/n. AMINUDDIN

BURSA

BURSA

ELEKTRONIK BELI DNG HARGA TINGGI

LAPTOP, HANDYCAM, CAMERA, PROJECTOR Handicam Sony Hi-8=1Jt, Mini DV=2Jt, DVD/HDD=3Jt, Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Fax = @ 600rb. LCD Projector Optima, Tosiba @ 3Jt.

TV LCD, PS, DVD, AMPLI, COMPO

TV LCD 42” P. Sonic = 6.5Jt. 32”LCD/Samsung =2,8 jt 42” LCD P. Sony Wega=4,5Jt,34” Changhong = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb - 1,7 Jt. 14 - 21=300rb - 650rb, 17” LCD Monitor 1Jt, 22”=1,5jt, PS1=400rb, PS 2=800rb, DVD 200rb, Vortable = 700rb. Ampli-Gitar=700rb, Sansui-AU-7700 Technics-SU. 7600-EQ.Pioneer SG. 9800 TV.M=600rb

UD. SENANG HATI

Hub. 4517509 - 69677449 Jl. Sekip 67 A Jual/Beli/T.T. Baru/Bekas LAPTOP BARU - BEKAS MURAH !!

1. Sony Vaio Core i3 @ 2.13 Ghz/4/320/VGA Nvidia 2 Gb.........Rp. 3.9Jt 2. Acer 4741 Core i5M430@ 2.27 Ghz/2/500/VGA 1 Gb.............Rp. 4.4Jt 3. Apple Macbook 3.1 Core2Duo@ 2.2 Ghz Ram2 Gb................Rp. 4.3Jt 4. COMPAQ 510 Core 2 Duo T5870 @ 2.0 Ghz/Ram 2 Gb/320 Gb/ VGA 512 kondisi baru 100%........................................Rp. 3,5Jt 5.ACER Aspire 4930 G Core 2 Duo T9400@ 2,53 Ghz/Ram 4 Gb/ HDD 320 Gb/VGA NVidia G Force 1,5 Gb/14”........................Rp. 3,9Jt 6. Acer Dual Core 1 Gb/250Gb/Webcam......................Rp. 2.2Jt 7. DELL Inspiron 1545 Core 2 Duo T6400@ 2.0 Ghz/1/160/VGA 256/15” Bat ok...Rp. 2.9 Jt 8. ADVAN Van Book D 510 1 Gb/250 Gb/VGA 256/13,1” Baru...Rp. 2,2Jt 9. Note Book XWare Ram 1 Gb/HDD 40 Gb/100% mulus.......... Rp. 1.4Jt 10. N.Book HP Mini Atom Ram 2 Gb/HDD 160/Webcam mls perfect.........Rp. 1.9Jt 11. N. Book Yor @ 1.66 Ghz/1/80/Webcam 100% mulus..............Rp. 1,5Jt 12. LCD Projector Toshiba XGA bisa OHP Rp. 3.5Jt. NEC 2500 AL msh baru Rp. 3 Jt. Toshiba/Benq/Epson 2500 Al ...........................Rp. 2.5Jt 13. Print Canon Pixma MX 328 Copy, Scan, Fax. 100 % Baru.......Rp. 1,1Jt ELEKTRONIK BELI HARGA TINGGI Hub. CV. MARKET - Telp. 76324682 - 0812 65393000 Jl. Setia Budi No. 424 B dkt Bank BNI Psr. 4 T. Sari

PROMO 3HR *LAPTOP BARU + CAMERA=1XJT +MODEM=189RB*

Laptop Acer-Core2, Core3=Dtg nego/ Toshiba + Dvd + Camera =1.9 Jt Projctor 1x Jt, Lcd=550rb _Lcd Tv=795rb, Monitor 195 Rb LX300 +, LQ1170, LQ2170=? Prin color 389rb, tinta25rb krtas foto 17rb Komputer:P4=775rb (Servis-Upg-Jual-beli-TT) PH: (061) 7761.2336 Jl. Rantang20s

BURSA

PHOTO COPY

HILANG 1 (BUAH) BPKB

Mobil Toyota Kijang / Super IF 82 Diesel A/n. Nurbayti No. Polisi: BK 1389 MA - No. Mesin: 21-9599214 No. Rangka: MHF 11LF82Y0008485 Didalam tas hitam merek “Elgini” Hub. 0811.6203.698

PELUANG BISNIS

TOKO PERLENGKAPAN BABY SPECIALIS JUAL:

TERCECER

Laptop, TV, LCD, PS, Ampli, Spk, Kulkas, Projector, Handycam, Camera, AC & Keyboard, dll.

BURSA

PENDIDIKAN

1 (Satu) BPKB A/n. MARIM BARUS BK 9452 LL. No. BPKB 842998 No. Rangka 19797. No. Mesin 965293

TERCECER / HILANG

POLITEKNIK KESEHATAN

YAYASAN RUMAH SAKIT UMUM

Dr. RUSDI MEDAN

Izin Dikti No.71/D/0/2009 dan Rekomendasi PPSDM Depkes RI No. KH.03.05/1/4/0049/2009

www.poltekkesdrrusdi.com

Menyelenggarakan Program Pendidikan: - DIPLOMA (DIII) Jurusan Keperawatan - DIPLOMA (DIII) Jurusan Analisan Kesehatan - DIPLOMA (DIII) Jurusan Fisioterapi - DIPLOMA (DIV) Jurusan Fisioterapi Persyaratan: - Dasar pendidikan SMA (A1, A2/ IPA), MA (A2, A3/ IPA - Tidak buta warna baik partial maupun total - Tidak cacat fisik/ mental yang dapat mengganggu tugasnya sebagai Tenaga kesehatan - Tinggi badan minimal Laki-laki: 155cm, perempuan: 150cm - Pas photo hitam putih terbaru (6 bulan terakhir) uk. 4x6: 6 lembar Waktu pendaftaran: Dimulai dari sekarang s/d September 2011, setiap hari Senin s/d Sabtu jam 08.00-17.00Wib Tempat Pendaftaran: KAMPUS UTAMA: Jl. H. Adam Malik NO. 140-142 Medan Telepon/ Fax. (061) 661.4941 HP. 0813.6171.7389 - 0852.7018.2055 0813.6151.0938 Test Masuk: 8 September 2011 MENYAMBUT DIESNATALIS KE-24 Gratis uang pendaftaran + DISKON Uang Pembangunan

BUSANA BABY WOSHLAP/ POPOK BABY GENDONG BABY TAS BABY BANTAL/ KASUR BABY ASYUNAN BABY BABY STROLLER RANGKA AYUNAN BABY KERETA DORONG BABY MEJA MAKAN BABY TEMPAT TIDUR BABY DLL (LENGKAP)

TOKO FADIA

JL. PALANGKA RAYA NO. 9 DEKAT SIMPANG JL. PANDU PINTU KE 5 TELP. (061) 414.5191 MEDAN

PELUANG USAHA

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

BURSA

HILANG Kartu Pelaut / SID atas nama Ferry Harianto dengan nomer Kartu 6201 554169. Bagi yang menemukan Hub. Farry 0821 231 57844

BURSA

LOWONGAN BLUE BIRD Taksi, mmbthkn Pngmudi Lk/ Pr, usia 23-50thn, Tdk ada tato/bekas tato, SIM & KTP, Fas. komisi, bonus, insentif, GPS, Mess, Mobil baru, dll Sgr dtgn/ krm lmr ke Jl. Kapt. Muslim No. 92 Telp. (061) 7637.5840

MATERIAL ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150

DIBUTUHKAN

TELAH HILANG/TERCECER 1 Lbr Surat Kiosk Nomor 665 LantaiII Pasar Pusat Pasar Medan, SIPTB No. 511.3/3858/PDPKM/2009 An. NURMA NELY

Gadis/ Janda Kristen, Jaga anak di Medan, Gaji 700 Rb/ bln bersih Hub. Pak Jov 0812.6553.5559

DIBUTUHKAN

HILANG

Surat Tanah a/n. Hj. Hamidah. Alamat: Jl. Paduan Tenaga Gg. Genteng 2/15A Kota Matsumii dengan luas +/- 169 M2

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

BURSA

KONSTRUKSI

WC 0812 642 71725

MOBIL SEDOT

Jl. BRAYAN MEDAN

DIBUTUHKAN

TUMPAT/ SAL. AIR

Karyawan-karyawati untuk dipekerjakan di pabrik-pabrik yang ada di daerah Belawan, KIM, Mabar, Tembung dan Jl. Binjai Sunggal - Perwakilan 1: Jl. Marelan 3 Lk. XIV Medan 0821.6738.6227 - Perwakilan 2: Jl. Sei Mencirim Komp. Lalang Green Land 1, Rauza Water 0813.6122.1527

Bergaransi/ Setia Luhur 160 F

LOWONGAN KERJA

HP.

WC 0812 60444275 WC PAK ADI

DCR lls SLTA/ sdrj U/ didik & lsg dislrkan mjd Guru PG/ TK Hub: Jl. Karya Wisata No. 23A Johor Tp. 786.1690 Medan

JL. SETIA BUDI

Hub. TUMPAT / SEDOT WC/GRANSI

845.8996 0812.631.6631

SEDOT WC WC TUMPAT

HUB: (061) 7635.2865 0813.6151.3698

FD

CD

KIRIMKAN... DATA IKLAN MINI ANDA

DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)

TUKANG LAS

Dicari bebarapa tukang las, berpengalaman di bidang: - 1 Pembuatan pintu Plat besi - 2 pembuatan pintu Folding gate - 3 pembuatan pintu Press - 4 las struktur besi Lamaran selambatnya 10 hari, diantarkan ke Harian Waspada dengan Kode PINTU

MINI & EFEKTIF IKLANKAN PRODUK ANDA

PAGAR EURO

R

GALVANIS

EUROMESH BAJA U-50

R

KOLOM PRAKTIS EURO R BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

PRODUKSI:

PT. REZEKI PRIMA JAYA ABADI

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA


WASPADA Kamis 25 Agustus 2011

Ekonomi & Bisnis

B7

Lebaran, Pertamina Siapkan 246 SPBU Jalur Mudik MEDAN (Waspada): PT Pertamina (Persero) Marketing & Trading Sumatera Bagian Utara (Sumbagut) menyiapkan 246 SPBU jalur mudik untuk menjaga persediaan bahan bakar minyak (BBM) untuk transportasi maupun rumah tangga selama lebaran.

Waspada/Hamdani

HARGA SEMBAKO : Sejumlah warga berbelanja sayur mayur di pasar Central Medan, Minggu (21/8). Menjelang lebaran harga sembako diperkirakan akan mengalami kenaikan, seperti cabai akan mengalami kenaikan hingga Rp 30.000 yang saat ini masih berjumlah Rp. 16.000 perkilogram.

Bayar Pensiun PNS, Taspen Gelontori Rp4 Triliun JAKARTA (Waspada): Guna mempercepat pembayaran pensiun PNS, TNI/Polri pada September, PT Taspen (Persero) mengeluarkan dana mencapai Rp4 triliun. Pembayaran ini dipercepat pencairannya pada 26 Agustus mendatang. Sekretaris Perusahaan PT Taspen, Pask Suhartha. Suhartha menambahkan, anggaran sebesar Rp4 triliun tersebut dialokasikan guna membayar 2,25 juta pensiunan PNS, TNI/Polri di seluruh Indonesia. “Dana disediakan untuk percepatan pembayaran pensiun berasal dari dana APBN dengan

jumlah sebesar Rp4 triliun akan dibayarkan kepada 2,25 juta pensiunan di seluruh Indonesia,” ujarnya melalui keterangan pers di Jakarta, Rabu (24/8).Seperti diketahui, guna mendukung Hari Raya Lebaran, pemerintah mempercepat gaji PNS dan Pembayaran pensiun/tunjangan September 2011 semula akan dibayarkan pada 5 September 2011, dimajukan mulai 25-29 Agustus 2011 secara serentak di seluruh Indonesia. Adapun proses pencairan tersebut, lanjut dia, dapat dilakukan di tempat biasa mereka lakukan. (okz)

Hal tersebut disampaikan General Manager Fuel Retail Marketing Region I Gandhi Sriwidodo kepada wartawan di Gedung Serba Guna Pertamina Medan, kemarin. TurutdihadiridisituManager LPG & Gas Products Region IYudi Yanurwinda, Manager Aviation Affan Hidayat, Manager Supply & Distribution Erry Widiastono, Manager Lubricants Sales Ibnu PrakosodanManagerFuelIndustry & Marine Marketing Indra Edi Santoso. Dalam menyiapkan persediaan BBM tersebut, Pertamina menetapkan wilayah kerja pemasaranSumbagutmeliputilima Provinsi yakni Sumatera Utara dengan 94 SPBU, Aceh 40 SPBU, SumateraBarat58SPBU,Riaudan Kepulauan Riau 54 SPBU. Mengenai stok BBM selama menjelang dan setelah lebaran

Pertaminamenyiapkanpremium sebanyak 95.556 kilo liter (KL) dengan rincian Aceh 7.897 KL, Sumut 25.994 KL, Riau 10.495 KL, Sumbar 15.850 KL dan Kepri 35.220 KL. Sedangkan untuk stok solarsebanyak130.959KLdengan rincian Aceh 9.817 KL, Sumut 17.782KL,Riau16.524KL,Sumbar 33.944 KL dan Kepri 52.892 KL. Untuk kantong-kantong SPBU khusus jalur mudik di Sumut terdapat di Padangsidempuan untuk memenuhi kebutuhan BBM di Madina dan sekitarnya. Tebingtinggi sebagai lintasan daerah wisata, Cikampak untuk memenuhi kebutuhan di Labuhanbatudansekitarnyaserta Tanjungpura untuk me-menuhi kebutuhan di perba-tasan Aceh. “Pertamina telah mengambil langkah-langkah persiapan guna mengantisipasi timbulnya lonjakan pemakaian BBM dan

nonBBM.Kesiapaninidilaku-kan agar kebutuhan BBM untuk masyarakat konsumen selama merayakan Idul Fitri 1432 H senantiasa terpenuhi dengan lancardandalamjumlahcu-kup,” ujarnya. Dia menyebutkan, berdasarkan evaluasi dari tahun ke tahun ada kecenderungan peningkatan kebutuhan BBM seperti minyak tanah dan elpiji untuk sektor rumah tangga. Premium, pertamax dan solar untuk transportasidarat,mau-punavtur untuk sektor pener-bangan seiring dengan mening-katnya kebutuhan serta mobi-litas masyarakat. Daridata2010menunjuk-kan bahwa peningkatan kebu-tuhan BBMsektortransportasiyaitupremium diperkirakan akan terjadi pada H-7 hingga H+7. Untuk premium terdapat kenaikan sekitar 7 persen dari kebutuhan per hari. Sedangkan pada puncak arus mudik (H-1) dan arus balik (H+4), diperkira-kan kebutuhan akan mengala-mi kenaikan rata-rata sekira 15 persen. 20 SPBE Sedangkan konsumsi elpiji

kredit macet. Namun, ia menegaskan bahwa tidak semua petani mendapatkan keistimewaan tersebut agar tidak terjadi moral hazard terutama bagi para debitur yang benar-benar bisa melunasi kewajibannya. Sementara, Ketua Badan Anggaran (Banggar) DPR-RI Melchias Markus Mekeng mengatakan pemutihan Kredit UsahaTani (KUT) bisa dilakukan oleh pemerintah jika telah melewati proses audit Badan Pemeriksa Keuangan (BPK). Dia mengaku belum mendapat laporan atau surat dari pemerintah untuk melakukan pembahasan terkait dengan rencana pemutihan KUT sebesar Rp5,7 triliun. Menteri Koordinator (Menko) Bidang Perekonomian Hatta Rajasa sebelumnya menyatakan bahwa pemerintah akan melakukan pemutihan atas Kredit Usaha Tani (KUT) yang bermasalah, jumlahnya sekitar Rp5,7 triliun. Menurut Hatta, dalam melakukan pemutihan atas KUT yang gagal bayar, pemerintah memiliki dua mekanisme yang akan ditempuh. Pertama, membayar kewajiban para debitur KUTyangbermasalahkeperbankannasionalsebagai kompensasi atas KUT yang diputihkan. Kedua,menggunakanmekanismeadminis-trasi antara pembukuan pemerintah dan perban-kan, sehingga kredit petani itu dihapuskan.

Permintaan Properti Sepi MEDAN (Waspada): Ramadhan dan Raya Idul Fitri ini permintaan properti sepi bahkan jalan di tempat dan tidak terjadi permintaan signi-fikan. Ini banyak dialami beberapa pengembang, walaupun tidak berlaku secara umum. “Secara rata-rata permintaan properti tidak mengalami kenaikan yang signifikan,” kata Ketua Dewan Pengurus Daerah (DPD) Persatuan Perusahaan Real Estate Indonesia (REI) Sumatera UtaraTomiWistan dalam acara buka puasa bersama dengan 1.000 anak yatim piatu di gedung Asrama Haji Medan, baru-baru ini. TomiWistanmengatakan,halinidirasakan telah terjadi pergeseran/pertukaran permintaan ke konsumtif dengan datangnya bulan suci Ramadhan dan menyambut Hari Raya Idul Fitri. Sehingga masyarakat lebih banyak mengu-tamakan kebutuhan pokok seperti sandang dan pangan, apalagi kebutuhan tersebut lebih diutamakan dibanding kebutuhan papan yang mungkin masih bisa tinggal di rumah lama, orang tua, saudara, kontrakan atau kost. Bahkan biasanya pada Idul Fitri selain mengutamakankebutuhanpokok,sebagianorangmemilih untuk membeli mobil baru maupun bekas untuk digunakan pada saat lebaran. “Tetapi para

pengembang tidak perlu khawatir terhadap kondisi ini, justru saat ini para pengembang harus kreatif dalam berjualan memasarkan proyek mereka dengan memberikan promosi, diskon, hadiah atau voucher dan lainnya yang dapat merangsang para pembeli untuk memutuskan membeli rumah,” ujarnya. Apalagi lanjutnya, pada momen setiap menjelang lebaran biasanya para pekerja, karyawan, staf maupun direksi profesional selalu mendapatkan THR. Kesempatan ini harus dijadikan peluang agar segmen ini bisa tergarap dengan baik dan harus yakinkan diri bahwa kondisi seperti ini adalah yang paling tepat untuk menjual kepada segmen tersebut. MenurutTomiWista, bagi masyarakat/pembeli justru saat ini adalah paling tepat untuk membeli rumahbilamemangsudahsaatnyaatauadarencana padatahuniniuntukmemilikirumahsendiri.Karena saat ini juga biasanya para pengembang tidak menaikkan harga dan juga banyak kelebihankelebihan rangsangan yang diberikan pengembang kepada pembeli.“Jadi jangan tunda lagi beli properti mumpunghargabelumnaik,karenabiasanyasetelah lebaran harga properti akan mengalami kenaikan yang cukup signifikan,” ujarnya. (m41)

Pasar Murah BUMN Bantu Rakyat Kecil Sumut MEDAN (Waspada): Kementerian BUMN mengalokasi dana Rp110 miliar untuk menggelar pasar murah di 33 provinsi, termasuk Sumut. Kegiatan pasar murah dikemas dalam bentuk program BUMN Peduli. Komoditasyangdijualberupaberas,gula putih dan minyak goreng. Harga jual 30 persen lebih mu-rah dibandingkan harga pasar. Selisih Ist harga merupakan subsidi dari Badan Usaha Milik Negara Panitia tengah melayani masyarakat kurang mampu membeli kebutuhan pokok (sembako) di lokasi pasar (BUMN). ‘’Pasar Murah BUMN Peduli murah BUMN. menggunakan dana BUMN Peduli guna daerah penduduk yang kurang mampu di antaranya menyambut bulan suci Ramadhan, Hari Raya Idul di Medan, Belawan, Deli Serdang, Sergai, Tebing Fitri 1432 H dan Hari Natal &Tahun Baru 2012 untuk Tinggi Simalungun, Asahan, Labuhan Batu Selatan, menolong rakyat kecil di Sumut,’’ kata Syahrul A. Labuhan Batu Utara, Labuhan Bilik dan Mandailing Siregar,stafhumasPTPN-IVkepadaWaspada,Selasa Natal. Andi Wibisono (Sekretaris Perusahaan PTPN (23/8). Kementerian BUMN menggelontorkan dana IV)selakuWakilSekretarisForumKomunikasiBUMN subsidi untuk pelaksanaan pasar murah di Sumut Sumut mengatakan, pasar murah ini bertujuan sebesar Rp5 miliar yang dilakukan dalam bentuk membantu masyarakat yang kurang mampu dan penjualan sembako meliputi beras, gula putih, dan panitia tetap berkoordinasi dengan muspika setempat untuk menentukan lokasi, juga bertujuan minyak goreng. Dalam menyongsong Ramadhan dan Idul Fitri untukmenstabilkanhargakebutuhanpokokpangan 1432Hpasarmurahdimulai28Julisampai23Agustus menjelang hari-hari besar keaga-maan. Pasar Murah 2011, FK BUMN Sumut menggelon-torkan dana digelar pada H-10 s/d H-3 menjelang Idul Fitri dan Rp4,2 miliar lebih dengan subsidi Rp1,2 miliar, menjelang Natal & Tahun Baru 2012. BUMN wilayah Sumut yang telah berperan aktif dengan kuantum beras 300,3 ton, gula putih 105 ton dan minyak goreng 87.242 liter. Sampai dengan diantaranya PTPN IV, PTPN II, PTPN III, Pelindo I, H-3 sebelum lebaran diperkira-kan dana subsidi PT Jasa Raharja, PT KIM, PT ASKES, PT PERTANI, PT PLN, PT PP, PT Garuda Indonesia, PT BRI dan BUMN Peduli sudah mendekati Rp3,5 miliar. Aksi gelar pasar murah dilaksanakan di daerah- BUMN lainnya akan menyusul. (m03)

libur menjelang dan sesudah Idul Fitri mulai 29 Agus-tus hingga 3 September 2011. Selain itu pihaknya juga membentuk tim satgas/posko pemantauan distribusi BBM dan non BBM, menambah waktu pelayanan terminal BBM/DPPU, menyiapkan kantung SPBU yang dilengkapi mobil tangki standby untuk mengantisipasi kekosongan dan persiapanpersiapan lain-nya.(m41)

Waspada/Sugiarto

Salah seorang ibu rumah tangga sedang membeli paket sembako yang disediakan BRI Cabang Asia digelar di di KCP Krakatau, Selasa (23/8).

BRI Medan Gelar Pasar Murah

Pemutihan KU Bisa Selesai Awal 2012 JAKARTA (Waspada): Sekretaris Jenderal Kementerian Keuangan Mulia P Nasution mengatakan, pemutihan Kredit Usaha Tani (KUT) senilai Rp5,7 triliun bisa segera dilaksanakan dan diharapkan selesai pada awal 2012. “Ini sudah Agustus akhir, kalau bisa dalam sebulan dua bulan ini timnya sudah turun dan diharapkanbisadiselesaikandalamtahunini.Setelah semuaprosesberangsur-angsurdenganbankselesai, pada 2012 bisa diselesaikan semua-nya,” ujarnya di Jakarta, Rabu (24/8). Ia memastikan tidak semua petani mendapatkan pemutihan kredit tersebut karena semua harus dilakukan proses verifikasi terlebih dahulu apalagikredittersebut merupakan kredit yangsudah lama tertanggung oleh para debitur. “Tentu harus diverifikasi, karena ini sudah lama sekali, tidak bisa sembarangan. Tidak bisa gelondongan juga, jadi kalau benar harus dilihat lagi di buku bank itu, diaudit terus verifikasi satu persatu, kemudian baru bisa diusulkan untuk dihapuskan,” ujar Mulia. Ia mengatakan program ini merupakan komitmen pemerintah dan Bank Indonesia untuk membantu para petani khususnya yang ber-mukim di kawasanYogyakarta untuk bisa kembali bankable danbankmenyalurkan KUT tidak terbebani dengan

tahun lalu tercatat naik sebesar 8persenuntukPSO(LPG3Kg)dan 4 persen untuk non PSO (LPG 12Kg, 50Kg dan Mixed Bulk) dari kebutuhan rata-rata perhari menjelang Ramadhan dan Idul Fitri. Gandhi menyebutkan, pada tahun ini pihaknya juga akan menyiagakan sebanyak 20 SPBE/ SPPBE, 61 agen LPG 12Kg dan 21 agen LPG 3Kg di seluruh Region I untuk tetap beroperasi pada hari

Waspada/akmal az

PERALATAN pengolah limbah di lingkungan industri pembangkit listrik tenaga biomassa sawit (PLTBS) yang sudah selesai pembangunannya.

PTPN III Libatkan BPKP Bangun KISMK MEDAN (Waspada): Untuk mendapatkan kekuatan dari aspek legal dan memenuhi aspek GCG, seluruh kajian kela-yakan (FS), detail engineering design (DED) dan proses tender untuk kontraktor yang terkait dengan prosespembangunandiKawasan Industri Sei Mangkei (KISMK) ,manajemen PTPN III dari awal prosespembangunanmelibatkan instansi BPKP Ca-bang Sumatera Utara untuk mengevaluasi, mereview dan memberikan rekomendasi dari setiap kegiatan tersebut. Hal itu ditegaskan oleh Kabag Perencanaan dan Peng-kajian PTPN III Dr. Krisna Surya Buana didampingi Manejer KISMK Abdul Halim dan Kaur Humas

BURSA

PROPERTY

Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

RUMAH PERMANEN DIJUAL

11x22, KM 3, KT 3, RT 1, KT 1, Garsi mobil panjang 4 mobil masuk, Dpr 1 AC Jl. Perwira sebelah bank Sumut depan Kodam I Bukit Barisan Gatot Subroto Hub. 0852.6167.8082, H. 335 Jt/nego

RUMAH DIJUAL 2 UNIT

Komplek Metrologi Dekat Pajak Melati Harga 200 Jt/ Unit Nego Hub. 0813.7675.1553

RUKO CEMARA KEADILAN PERMAI

2 TKT COCOK UNTUK USAHA INTI KOTA DP 80 JUTA

Dijual 9 pintu Ruko Jalan Keadilan No. 2 Simp. Jalan Cemara, LB. 4x16m, Row depan 6M, Fasilitas: SHM, PLN, PAM, Cocok untuk usaha Praktek Dokter, Warnet, Gudang, Toko HP NB: 60 meter dari Jalan Cemara Jalan Lintas H. 450 Jt, KPR perbulan 4 Juta, Full keramik, SIap huni, ±50 Juta, Sisa 5 unit Hub: 7772.2123 / 7759.8123 HP. 081.165.1123

IrwadiLubispadawartawanakhir pekan lalu di Sei Mangkei. Tidak hanya BPKP, menurut Krisna lagi, lembaga pemerin-tah lainnya seperti Lembaga PengadaanBarangdanJasajugaikut mengawasi pembangunan KISMK. “Sejak awal PTPN III melibatkan instansi yang berkompeten di bidang pengawasan dalam pembangunan KISMK,” ujar Krisna. Pada bagian lain Manejer KISMK Abdul Halim menambahkan masterpalan KISMK dengan luas 2002,77 Ha saat ini dalam proses finalisasi oleh kementerian perindustrian. Begitu pula rencana strategis pengembangan KEK Sei Mangkei RUMAH DIJUAL 8x12, Keramik, Tiga kamar tidur, Teras, 1 Km mandi, Harga Rp. 115 Jt/nego alamat Gg. Melati No. 23 Delitua, SK Camat Hub. 0852.7587.4252 - (061) 6967.6667

serta FS ekonomi dan financial KEK Sei Mangkei juga dalam proses finalisasi oleh kementerian yang sama. Sedangkan FS analisis dampak lingkungan (AMDAL) KISMK seluas 2002,77 Ha dalam proses penyusunan oleh pusat studi lingkungan-USU. Krisnamenyebutkan,dengan sosialisasi secara terus menerus tentang keberadaan KISMK diharapkankalanganinvestordari mancanegara akan tertarik menanamkan investa-sinya sehingga daya saing produk hilir perkebunan milik pemerintah semakin kompetitif disbanding produk yang sama dari competitor. (m05)

MEDAN (Waspada): Dalam upaya membantu kebutuhan sembako menjelang hari raya Idul Fitri 1432 H bagi masyarakat kurang mampu, BRI mengadakan kegiatan pasar murah dengan tema ‘Sembako BRI Peduli’ di lima kantor cabang. Pasar murah tersebut sekaligus sebagai upaya memperlambat laju inflasi atau kenaikan harga sembako. Kepala KantorWilayah (Kakanwil) BRI Medan Don Simatupang didampingi Kabag Bisnis Ritel Dwijo Soedono, Selasa (23/8), menyebutkan, kegiatan ini serentak digelar di 5 Kantor Cabang BRI yaitu Kantor Cabang Iskandar Muda, Medan Asia, Lubuk Pakam, Binjai dan Stabat dengan total sembako yang dijual 1.000 paket. Setiap paketnya terdiri dari beras 10 kg, gula 2 kg, minyak goreng 2 liter, mie instan 1 dus dan kecap 1 botol dengan harga Rp10.000 per paket. “Sasaran penerima kegiatan pasar murah adalah masyarakat yang tergolong dalam kategori miskin dan sangat miskin, sehingga diharapkan masyarakat kurang mampu bisa terbantu secara langsung kebutuhan pokoknya. Kegiatan ini sekaligus memperlambat laju inflasi atau kenaikan harga sembako menjelang hari raya Idul Fitri,” ujarnya. Don Simatupang juga mengatakan, kegiatan serupa juga digelar secara serentak oleh 18 KantorWilayah Bank BRI tersebar di seluruh Indonesia meliputi 16 kota antara lain Banda Aceh, Medan, Padang, Pekanbaru, Palembang, Jakarta (3 wilayah), Bandung, Semarang, Yogyakarta, Malang, Surabaya, Denpasar, Banjarmasin, Manado, Makassar dan Jayapura. Dari pantauan Waspada di lokasi pasar murah ‘Sembako BRI Peduli’ di Cabang Medan Asia digelar di KCP Krakatau. Account Officer BRI Cabang Asia Fauzan M Ritonga didampingi Supervisor Penunjang Bisnis Narwan menyebutkan, untuk cabang Asia menyediakan 200 paket sembako yang terdiri dari beras, gula, minyak goreng, mie instan dan kecap. Dalam penjualan pasar murah ini, pihak BRI bekerjasama dengan kepala lingkungan di sekitar Jalan Krakatau untuk menentukan warga miskin yang berhak dengan memberikan kupon dari BRI untuk membeli sembako murah tersebut. “Tidak semua warga bisa mendapatkan paket sembako tersebut, hanya warga memiliki kupon yang dapat membeli paket sembako murah tersebut,” kata Fauzan. Salah seorang ibu rumah tangga, Janiyem saat dimintai tanggapanya dengan adanya pasar murah tersebut, dirinya merasa bersyukur bisa mendapatkan sembako murah tersebut untuk keperluan lebaran, karena harga-harga kebutuhan pokok yang ada selama ini cukup mahal. “Alhamdulillah sekali, dengan pasar murah ini saya merasa terbantu bisa membeli kebutuhan rumah apalagi menjelang lebaran ini semuanya bisa terpenuhi,” ujarnya. (m41)

BURSA

BURSA

TRAVEL/ WISATA

BURSA

PERABOT

KESEHATAN

ANDA BUTUH

DISEWAKAN RUMAH

JL. JERMAL III UJUNG NO. 8 MEDAN DENAI HUB. 0852.7763.6855 0852.6211.2259

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

ANTU DEN GAR ? ALAT B BANTU DENG

DIJUAL CEPAT

SPRING BED DIJUAL MURAH

MEL TRA HEARING AID MELTRA

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

BUSANA & ASESORIS

Rumah dan Tanah LT. 10,15x45m, SHM, Pinggir jalan, Lokasi dekat Unimed di Jl. Durung No. 119 Medan Hub. Ibu Sri, Srg HP. 0813.9684.5234 TANAH

TANAH RING ROAD MEDAN

Luas 750m² (25x30), SHM, RP. 1.100.000/m Hub. 0819.6060.870, TP

TANAH DIJUAL/ SHM Luasnya 2,6 Ha, Jl. Menteng VII dekat Komplek Menteng Indah

Hub. 0813.9710.7889 - 0821.6887.7159 0811.614.459

TANAH DAN RUMAH DIJUAL

Uk. 1204m, SHM DI JL. SEI ASAHAN HUB. 0812.6554.6515

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Harian

WASPADA

HUB.

JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

BURSA

PECI MAHKOTA

MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

PECI MURNI TEMPAHAN ISTIMEWA H. ADAM AKIL HSB

Jl. Setia Budi No. 49 A Tj. Rejo (061) 822.3975 Medan samping IPMD

Harian

WASPADA


B8

Ekonomi & Bisnis

66 Tahun Merdeka, Kemanakah Arah Perekonomian Indonesia? Oleh: Arisyi Fariza Raz Indonesia bukan negara tertua di bumi ini, tetapi sudah jelas bahwa 66 tahun bukanlah usia sebuah negara muda. Di usia ke 66 tahun ini, mungkin kita dapat mengatakan bahwa kita belum cukup puas terhadap proses permbangunan ekonomi di Indonesia. Bila kita melihat sejarah, Korea Selatan berumur 3 tahun lebih muda dari Indonesia, dan mereka sudah jauh lebih sukses di bidang sosioekonomi dibandingkan kita. Oleh karena itu, di hari ulang tahun negara kita ini, ada baiknya sedikit merenungi kembali sejauh mana proses pembangunan ekonomi bangsa ini. Jujur saja, bila kita mengikuti perspektif ekonom luar negeri, jelas banyak yang melihat bahwa Indonesia adalah negara yang potensial untuk menjadi salah satu raksasa ekonomi Asia di masa yang akan datang. Bila kita melihat statistik, memang jelas pertumbuhan ekonomi Indonesia cukup stabil, pendapatan per kapita naik dari tahun ke tahun, dan inflasi bisa terbilang stabil, walaupun jelas kita tetap mengalami seasonal shock dari waktu ke waktu. Beberapa saat yang lalu saya melihat sebuah wawancara di CNN oleh Ramy Inocencio. Di wawancara tersebut ia mengatakan bahwa saat ini Indonesia adalah “jangkar” dari perekonomian ASEAN. Ini dicerminkan dari membaiknya sistem kebijakan moneter, semakin besarnya masyarakat menengah, dan potensi pasar yang sangat besar di Indonesia. Selain itu, banyak juga yang mengatakan pondasi ekonomi negara kita ini sangat kuat melihat dampak krisis global 2008 dan gejolak ekonomi yang terjadi di Eropa dan Amerika tidak terlalu signifikan di Indonesia. Singkatnya, pandangan optimis dari luar negeri seperti ini sangat kita perlukan untuk membangun sentimen positif. Berbeda dengan sentimen positif ini, saya mencermati bahwa pandangan bangsa kita terhadap pembangunan ekonomi Indonesia tidak seoptimis itu. Di satu sisi, jelas yang lebih mengetahui keadaan negara kita ya kita sendiri, bukan orang asing. Contohnya, beberapa minggu yang lalu saya menerima sebuah artikel dari teman saya mengenai “pincang”-nya proses pembangunan negara kita. Menurut artikel tersebut, pertumbuhan ekonomi Indonesia terlalu bergantung kepada sektor servis (seperti perbankan) yang tidak terlalu banyak menyerap lapangan pekerjaan. Sedangkan pertumbuhan di sektor manufaktur dan agrikultur sedikit tersendat. Padahal, justru sektor ini lah yang lebih banyak menyumbangkan lapangan pekerjaan. Secara makro, memang pertumbuhan di sektor servis ini cukup baik, namun sayangnya hanya bisa dinikmati segelintir orang kaya/pemilik modal saja, sehingga cenderung mencerminkan meningkatnya kesenjangan pendapatan. Sebaliknya, jika pemerintah mampu menggenjot sektor manufaktur dan agrikultur, maka akan ada banyak lapangan pekerjaan baru tercipta yang dapat meningkatkan pendapatan per kapita penduduk, sehingga PDB Indonesia meningkat dan kesenjangan pendapatan berkurang.

Rental Mobil Laris MEDAN (Waspada): Sepanjang jalan tepat di depan Stasiun Besar Kereta Api Medan di sisi luar trotoar Lapangan Merdeka Medan berderet parkir mobil dengan berbagai jenis seperti Kijang Kapsul, Xenia, Avanza, Kijang Innova dan sebagainya. Sesekali pemilik mobil menyapa para pengendara

Kalaupun benar adanya pengingkatan kesenjangan pendapatan seperti yang mereka katakan, ini belum berarti tidak ada harapan kedepannya untuk menunjang sektor manufaktur dan agrikultur. Insentif dari pemerintah tentu sangat berperan besar dalam menunjang kedua sektor ini. Insentif ini dapat berupa subsidi, keringanan pajak, ataupun bantuanbantuan lainnya. Karena bila kita melihat sejarah ekonomi negara-negara industri baru seperti Korea Selatan dan Taiwan, keberhasilan mereka di bidang ekonomi tidak lain karena adanya pertumbuhan manufaktur yang kuat. Ini semua tidak mungkin berjalan efektif jika tidak ada dukungan kuat dari pemerintah. Walaupun pemerintah memiliki peran signifikan, ini tidak berarti masyarakat Indonesia tidak dapat berperan dalam proses ini. Di saat seperti ini lah jiwa wirausaha perlu dikembangkan sehingga lebih banyak lapangan kerja baru akan tercipta. Beberapa penulis mengatakan bahwa korelasi antara pertumbuhan ekonomi dan kesenjangan pendapatan cenderung seperti ditunjukkan oleh model Kurva Kuznet. Dalam kurva ini, kesenjangan pendapatan ada pada axis-y dan pendapatan ada pada axisx. Dari sini, kita bisa melihat bahwa di awal pertumbuhan ekonomi, kesenjangan pendapatan kecil karena hampir semua penduduk miskin. Di tengah-tengah pertumbuhan ekonomi, kesenjangan pendapatan akan meningkat karena sebagian penduduk menjadi lebih kaya seiring peningkatan taraf hidup masyarakat dan sebagian lagi masih akan tertinggal. Namun, di akhir dari proses pertumbuhan, konglomerat baru ini akan menciptakan lapangan kerja baru buat sebagian masyarakat yang pendapatannya masih rendah. Ini akan membuat golongan masyarakat menengah yang besar sehingga kesenjangan pendapatan kembali mengecil. Kurva Cuznet Memang, beberapa studi mengkritik relevansi dari model ini namun jelas ada juga yang mendukung di kasus-kasus tertentu. Tetapi optimisme tetap diperlukan agar negara kita dapat terus memandang maju ke depan. Singkatnya, pemerintah jelas masih memiliki peran paling penting dalam meningkatkan taraf hidup masyarakat Indonesia. Namun bukan berarti kita rakyat Indonesia tidak bisa turut andil di dalamnya. Semoga dengan jiwa wirausaha, kita dapat berperan dalam proses pembangunan ekonomi di negara kita. Dirgahayu 66 Tahun Indonesia Penulis Arisyi Fariza Raz M.Sc Development Economics and Policy, mahasiswa University Of Manchester, Inggris.

ROMBONGAN pemudik pelanggan Telkomsel foto bersama sebelum berangkat.

Waspada/ist

5.000 Pelanggan Telkomsel Ikut Mudik MEDAN (Waspada): Telkomsel memberangkatkan sekitar 5.000 pemudik dengan menggunakan lima moda transportasi terlengkap, yakni Kapal Laut, Kereta Api, Mobil Keluarga, Bus, dan Pesawat. Mudik akbar gratis TelkomselSiaga ini rutin terselenggara sebagai bentuk kepedulian sekaligus dukungan terhadap pemerintah dalam melayani masyarakat pemudik. GM Sales & Customer Service Regional Sumbagut Filin Yulia mengatakan: “Mudik akbar gratis merupakan puncak dari rangkaian kegiatan TelkomselSiaga 2011. Kami gembira dapat kembali menggelar mudik gratis dengan moda transportasi kapal laut, yang menjadikan kami sebagai satu-satunya operator yang menggelar mudik terlengkap di semua jalur baik darat, udara, maupun laut.” Di Sumatera, Mudik akbar gratis ditandai dengan melepas 700 pemudik menggunakan kapal laut yang berangkat menggunakan KM Kelud dari Pelabuhan Belawan menuju Pelabuhan Batam. Di hari yang sama, 600 pemudik kapal laut lainnya juga diberangkatkan dengan KM Labobar dari Pelabuhan Makassar menuju Pelabuhan Tanjung Perak Surabaya. Telkomsel memberangkatkan 700 pemudik kapal laut lainnya di dua rute berbeda, yakni menggunakan KM Lawit dari Pelabuhan Sampit Palangkaraya menuju Pelabuhan Tanjung Emas Semarang, serta KM Dobonsolo dari Pelabuhan Ambon menuju Pelabuhan Bau-Bau Sulawesi Tenggara. “Untuk memungkinkan para penumpang kapal dalam berkomunikasi lewat ponsel selama perjalanan mudik di jalur laut, kami telah mengimplementasikan inovasi teknologi GSM berbasis IP di 15 kapal Pelni melalui program Telkomsel Merah Putih. Di setiap kapal, Telkomsel meletakkan beberapa perangkat, seperti: antena parabola, modem VSAT IP, pico BTS, dan solar cell sebagai power supply atau baterai APB (Automatic Power Backup) di daerah yang sudah ada listrik”, tambah Filin. Mudik akbar gratis TelkomselSiaga 2011 juga melepas lebih dari 1.000 pemudik menggunakan Kereta Api yang diberangkatkan lewat dua jalur utama, yakni Jalur Utara (Argo Anggrek dan Sembrani) melewati Pekalongan, Semarang, dan Surabaya, serta Jalur Selatan (Argo Bima) melewati kota Cirebon, Purwokerto, Yogyakarta, Solo, Madiun, Kertosono, Jombang, dan Surabaya. Mudik akbar gratis TelkomselSiaga 2011 memberangkatkan sekitar 5.000 orang pemudik dengan 5 moda transportasi. Mudik

WASPADA Kamis 25 Agustus 2011

akbar kapal laut TelkomselSiaga memberangkatkan total 2.000 pelanggan Telkomsel dengan rute Ma-kassar – Tanjung Perak Surabaya (600 orang, menggunakan KM Labobar), Belawan Medan – Batam (700 orang, KM Kelud) pada tanggal 23 Agustus 2011, Ambon – Bau-Bau Sulawesi Tenggara (350 orang, KM Dobonsolo) pada tanggal 25 Agustus 2011, serta Sampit Palangkaraya – Tanjung Emas Semarang (350 orang, KM Lawit) pada tanggal 28 Agustus 2011. Mudik akbar kereta api TelkomselSiaga memberangkatkan lebih dari 1.000 pelanggan dari Stasiun Gambir pada tanggal 25 dan 26 Agustus 2011 dengan dua rute utama, yakni Jalur Utara dan Jalur Selatan. Mudik akbar mobil keluargaTelkomselSiaga memberangkatkan sekitar 100 pelanggan dari komunitas AXIC (AvanzaXenia Indonesia Club), TERUCI (Terios Rush Club Indonesia), NLC (Nissan Livina Club), dan Innova Community pada tanggal 25 Agustus, dari Senayan Jakarta menuju Yogyakarta. Para peserta akan memperoleh uang bensin Rp 500.000, uang saku Rp 500.000, dan saldo Tap-Izy senilai Rp 500.000 untuk kemudahan pembayaran ketika berbelanja di seluruh gerai 7-Eleven, Indomaret, Starmart, Solaria, Disc Tarra, dan Circle K. Mudik akbar bus TelkomselSiaga memberangkatkan 1.000 frontliner, mitra dealer dan outlet, serta komunitas Telkomsel dari Muhammadiyah serentak pada tanggal 27 Agustus 2011 dari Parkir Timur Senayan Jakarta dengan tujuan 6 jalur mudik utama di sepanjang Jawa. Pelanggan berangkat menggunakan bus eksekutif agar tetap nyaman selama perjalanan mudik Lebaran. Mudik akbar pesawat TelkomselSiaga akan memberangkatkan lebih dari 600 pelanggan menggunakan pesawat Garuda Indonesia dengan 3 rute, yakni Jakarta-Padang, JakartaSurabaya, dan Jakarta-Makassar. Mudik akbar dengan pesawat diberangkatkan pada tanggal 27 Agustus 2011 dari Bandara Soekarno-Hatta Jakarta. “Melalui program mudik akbar gratis TelkomselSiaga ini, Telkomsel berupaya memberikan kepedulian dalam melayani masyarakat khususnya pelanggan dan mitra Telkomsel, di mana mudik merupakan salah satu tradisi massal tahunan yang menjadi ciri khas bangsa Indonesia. Kami berharap upaya ini dapat membantu pemerintah dalam melayani masyarakat, sehingga para pemudik mendapat kesempatan untuk pulang ke kampung halaman bersama rekan dan keluarga dengan aman dan nyaman,” pungkas Filin.(rel/m19)

sepedamotor yang lewat dengan ramah dan menawarkan jasa sewa mobilnya. Tidak sulit untuk mencari mobil rental di kawasan tersebut, karena ciri khas mobil rental di kawasan tersebut bisa dilihat dari susunan parkirnya yang lurus memanjang sepanjang jalan Kereta Api dan sebagian ada yang parkir di dalam lapangan Merdeka di sisi jalan Bukit Barisan, persisnya di bawah rimbunan pohon tua, di depan Kantor Pos Besar dan BCA Medan. Sejak tahun 60-an hingga sekarang, kawasan lapangan Merdeka Medan terutama di Jalan Stasiun Kereta Api dan Bukit Barisan, identik dengan tempat ‘nongkrong’nya berbagai jenis mobil sewa (rental). Mereka selalu siap melayani masyarakat yang membutuhkan jasa mereka dengan cara yang cepat dan mudah. Apalagi menjelang lebaran 1432 H tahun 2011 ini, rental mobil menjadi sesuatu usaha jasa yang laris manis dan menjadi pilihan banyak orang baik untuk mudik lebaran maupun untuk jalan-jalan ke lokasi wi-

sata pada hari lebaran. Rudi, 35, salah seorang supir rental mobil di kawasan Lapangan Merdeka Medan, Rabu (24/8), mengakui untuk permintaan pelanggan rental mobil pada lebaran tahun ini sudah membooking selama lima hari mulai 1 September hingga 5 September dengan menggunakan tiga mobil miliknya. Ada yang membooking untuk dua hari, tiga hari maupun empat hari. Namun dia juga mangatakan, selama Ramadhan ini permintaan rental mobil cukup sepi, hal ini disebabkan persaingan antar pelaku usaha rental mobil yang kian hari semakin banyak. “Bulan puasa tahun ini sepi sekali, bahkan lebih parah dari tahun sebelumnya. Karena sudah dua minggu saya belum dapat sewa. Tapi kalo pas lebaran nanti sudah ada yang membooking,” ujarnya. Lelaki yang mengaku sudah sepuluh tahun menekuni usaha jasa rental mobil di Lapangan Merdeka Medan tersebut, me-

Peternakan Model Aceh Dikembangkan Di Pegunungan Krueng Simpo Juli BIREUEN (Waspada) : Pembangunan fisik tahap pertama kandung sapi untuk pengembangan peternakan model di Aceh dipusatkan di pegunungan Krueng Simpo Km-21 Kecamatan Juli Bireuen hampir rampung dikerjakan. Dijadwalkan awal tahun 2012 sudah dapat beroperasi untuk mengembangkan peternakan model dan tanaman, namun para kelompok tani ternak masih menghadapi kendala lantaran sarana jalan masuk sepanjang 1,5 kilometer ke lokasi wisata ternak Blang Mane kondisinya masih alami darurat sulit dilalui kenderaan roda dua maupun roda empat. Kadis Pertanian Peternakan Perkebunan dan Kehutanan Azmi Abdullah melalui Kabid Peternakan drh Afriza mengemukakan hal itu menjawab pertanyaan Waspada di kantornya Rabu (24/8). Dikatakan, pengembangan peternakan sapi dan tanaman di Krueng Simpo Kecamatan Juli dengan sumber dana APBN Otsus 2010-2011 sebesar Rp300 juta lebih merupakan program pusat langsung ke Satker Kabupaten Bireuen. Kadis Kesehatan Hewan dan Peternakan Provinsi Aceh memberikan dukungan sepenuhnya terhadap program pengembangan peternakan sapi dan tanaman di Krueng Simpo Kecamatan Juli lokasinya sangat cocok sebagai lokasi peternakan model di Aceh. Menurut drh Afriza, pembangunan kandang sapi hampir rampung sedangkan pengelolaan peternakan dan tanaman dikelola langsung petani ternak dan Dinas Peternakan hanya melakukan pengawasan. Jenis sapi yang dikembangkan, sapi Aceh, sapi Bali, sapi FH, sapi Brahmana kerbau Aceh, kambing dan kuda lokal, ujarnya (b16)

Kementerian Energi Jamin Pasokan BBM Lebaran JAKARTA(Waspada): Kementerian Energi dan Sumber Daya Mineral menjamin kelancaran distribusi bahan bakar minyak (BBM) saat lebaran nanti. Pemerintah telah menyiapkan kantong-kantong BBM Premium di beberapa lokasi dan menambah mobil tangki dari Solar ke Premium untuk kelancaran distribusi. Seperti dikutip dalam buku Panduan Ramadan-Lebaran 1432 Hijriah Sektor Energi dan Sumber Daya Mineral, Rabu, (24/8), Kementerian ESDM memprediksi masa puncak lebaran dimulai dari 26 Agustus4 September 2011. Masa puncak akan mengakibatkan kemacetan, sehingga menghambat laju mobil tangki untuk menyalurkan BBM dari depot ke SPBU dan dari SPBU kantong ke SPBU lainnya. Untuk itu, diperlukan dukungan Dinas Perhubungan agar memperlancar daerahdaerah rawan macet, longsor, dan perbaikan jalan serta dukungan pengamanan aparat kepolisian terhadap objek vital dalam hal ini instalasi depot, SPBU, dan SPBE. Kementerian ESDM menyiapkan 38 kantong BBM Premium untuk mengamankan pasokan BBM, terdiri atas 16 kantong BBM di Banten, Jawa Barat, sembilan di Jawa Tengah, tujuh di Jawa Timur, tiga di Lampung, dan tiga kantong BBM di Sumatera Selatan. Menteri ESDM, Darwin Zahedy Saleh, dalam inspeksi kesiapan lebaran beberapa waktu lalu mengatakan terminal BBM Cikampek siap menyuplai distribusi bahan bakar ke kantong-kantong BBM berada di sekitar Jawa Barat. Dengan demikian, beban operasional penyaluran terminal BBM Plumpang berkurang 20 persen.(vvn)

Waspada/Sugiarto

DUA orang pemilik mobil rental di Lapangan Merdeka Medan duduk di bagian belakang mobilnya sambil menunggu dan menawarkan jasanya menyewakan mobil. Foto diambil, Rabu (24/8). netapkan tarif sama dengan rekan-rekan lainnya di kawasan tersebut. Untuk tarif lebaran berbeda dengan hari-hari biasa untuk satu hari. “Untuk lebaran, kami menetapkan tarif mulai dari Rp500.000 per hari sesuai dengan jenis mobil dan daerah yang akan ditempuh. Itu sudah termasuk stok minyak dan sopirnya,” katanya. Hal senada juga dikatakan Hari, 65, dirinya sudah menerima bookingan dari pelanggan rental mobil selama tiga hari mulai 28-31 Agustus 2011. Untuk perharinya, pria yang merangkap sebagai sopir mobil Kijang Innova miliknya tersebut menetapkan tarif Rp500.000 per hari.

Pria yang juga sudah 10 tahun membuka usaha rental mobil di kawasan tersebut, tidak hanya mengantarkan pelanggan untuk mudik ke luar Kota Medan, tetapi juga melayani permintaan untuk berwisata seperti ke Berastagi, Parapat dan lainnya. Menurutnya, orang lebih memilih mobil rental Kijang Innova karena bisa lebih muat banyak untuk satu keluarga. Mengenai urusan administrasi, rental mobil di kawasan Lapangan Merdeka Medan tidak begitu sulit. Meskipun tidak memiliki ruko atau bangunan, rental mobil Lapangan Merdeka punya daya tarik tersendiri. Misalnya, urusan administrasi atau transaksi yang tidak terlalu

ribet. “Begitu terjadi kesepakatan harga sewa, sopir segera ‘stand by’ meluncur membawa penumpangnya ke tempat yang dituju. Kalau dibooking, pelanggan bisa memberikan uang panjar sesuai kesepakatan,” kata Hari. Ahmad, 26, warga Stabat salah seorang penyewa mobil mengaku sudah membooking satu unit mobil Panther untuk digunakan pada saat lebaran bersilaturahmi dengan keluarga yang ada di Banda Aceh selama tiga hari. “Dengan sewa mobil ini, kita bersama keluarga bisa bersilaturahmi sekaligus liburan jalan-jalan ke lokasi wisata,” katanya.(m41)

Jelang Lebaran, Omset Pedagang Kue Kering Naik IDI (Waspada): Menjelang Lebaran Idul Fitri yang tinggal beberapa hari lagi omset, sejumlah pedagang kue kering di pasar tradisional Kota Idi, Kabupaten Aceh Timur, Provinsi Aceh, naik karena permintaan konsumen semakin tinggi. Rizal, salah satu pedagang kue kering di Pasar Idi kepada Waspada, Rabu (24/8) mengatakan menjelang Lebaran omset sejumlah pedagang kue kering kini terus mengalami peningkatan. Kondisi tersebut disusul tingginya permintaan kue kering. “Kue kering tetap diminati konsumen, karena tahan lama, harganya terjangkau, mudah didapatkan, lebih-lebih sukai anak-anak,” katanya. Menurut Rizal, kue kering tetap menjadi pilihan makanan untuk hidangan tamu pada saat Lebaran. Pasalnya, kue kering praktis dalam penyajiannya, konsumen tidak repot dengan

tempat lain, karena kue kering tersebut sudah dipersiapkan kemasan menarik dan unik.“Ada yang sudah siap jual dalm bentu paket, ada juga dalam bentuk kiloan. Jadi persediaannya sesuai dengan permintaan,” katanya. Ahmad, pedagang lain di Kota Idi menambahkan, harga kue kering yang tersedia disana tergantung bahan, rasa, serta kemasan kue kering. Meski harganya menjelang lebaran mulai meningkat, namun masih bisa dijangkau semua kalangan. “Untuk harga mulai dari Rp20.000-Rp40.000 per kg per kemasan plastik. Memasuki pekan keempat, sambung Ahmad, penjualan kue kering semakin tinggi. Dalam satu hari kini terjual kurang dari 200 toples plastik rata-rata harganya kisaran Rp20.000Rp30.000 per toples plastik. “Sebelumnya paling sekitar kurang dari 40 toples per hari,”

katanya. Catatan Waspada, sebelum ramadhan kue kering di Kota Idi masih tergolong sangat terbatas rasa dan coraknya. Memasuki pertengahan bulan Ramadhan pasokan dalam kemasan kue mulai menarik. “Setiap tahun Kota Idi menjelang lebaran mulai H-10 hingga H-1 atau hari meugang permintaan kue kering meningkat tajam,” kata Ahmad seraya mengatakan, hampir seluruh jenis kue kering didatangkan dari Medan, Sumatera Utara. Nurul Iman, salah seorang pembeli kue kering di Pasar Kota Idi mengaku, kue kering menjadi pilihan keluarga sebagai sajian untuk tamu pada saat Lebaran nanti. “Kue kering harganya terjangkau, kini kue kering banyak pilihan rasa serta kemasan menarik, sehingga pembeli meminatinya,” tandasnya. (cmad)

19.000 Pemudik Di Jabotabek Pulang Hari Ini MEDAN(Waspada): Bicara”mudik gratis”, masyarakat biasanya akan teringat dengan mudik masal yang diselenggarakan PT Sidomuncul. Ribuan pedagang jamu sejabotabek dan keluarganya dilepas dari area Parkir Barat Pekan Raya Jakarta (PRJ) Kemayoran, lokasi yang dipakai untuk pelaksanaan acara mudik gratis. Awalnya lokasi yang dipakai adalah Parkir Timur Senayan, namun seiring waktu berjalan dengan bertambahnya jumlah peserta maupun armada yang digunakan lokasinya dipindahkan ke area yang lebih luas. Kegiatan mudik gratis merupakan satu fenomena menarik karena di area pemberangkatan sejak pk.05.00 telah diramaikan pemudik dengan berbagai barang bawaan seperti dos – dos yang berisi buah tangan untuk para kerabatnya, tas pakaian dengan ukuran besar, barang – barang elektronik maupun barang lainnya dalam ukuran besar. Secara antusias para pemudik mengikuti semua acara yang digelar panitia penyelenggara menjelang keberangkatan berupa hiburan musik dengan menghadirkan artis – artis ibu kota dan para bintang iklan Sidomuncul, pembagian doorprize, hingga puncak acara pelepasan pedagang jamu oleh pejabat berwenang seperti Menteri Perhubungan dan MenteriTenaga Kerja yang dapat dipastikan selalu hadir dalam kurun waktu belasan tahun terakhir. Kegiatan mudik gratis, pada akhirnya menjadi satu tradisi yang tidak saja diagendakan oleh Sidomuncul tapi juga oleh Departemen Perhubungan RI karena dinilai sebagai kegiatan yang dapat membantu pemerintah

dalam mengatasi masalah mudik lebaran bagi kalangan menengah kebawah. Selain itu juga merupakan bentuk partisipasi yang patut ditiru oleh perusahaan – perusahaan lain. Mudik Gratis Sidomuncul bagi pedagang jamu se-Jabotabek awalnya dimulai 1991. Saat itu pihak manajemen prihatin dengan masalah yang dihadapi para pekerja dari Jakarta yang ingin merayakan Hari Raya di daerah asalnya, tetapi selalu mendapati kesulitan masalah angkutan/kendaraannya. Untuk itu pihak manajemen Sidomuncul memberikan hadiah lebaran bagi pedagang jamu dalam bentuk menyediakan angkutan lebaran untuk mereka dan keluarganya secara gratis. Banyak pilihan pada saat itu, misalnya dengan memberikan Tunjangan Hari Raya (THR) atau dengan hadiah yang lain. Namun hal tersebut dirasakan kurang menyentuh pada substansi masalah yang mereka hadapi saat menjelang lebaran yaitu keinginan untuk dapat mudik secara murah, nyaman dan aman serta bisa berbarengan dengan teman seprofesi (sesama penjual jamu). Jadi, berdasar pemikiran tersebut PT Sidomuncul memberikan kesempatan bagi para pedagang jamu dan keluarganya untuk dapat mudik dengan gratis, tanpa syarat apapun asalkan mereka pedagang jamu boleh menjadi peserta mudik gratis. Jamu yang diperdagangkanpun tidak harus jamu dari Sidomuncul. Saat itu justru banyak para penjual jamu yang tidak / belum menjual produkproduk Sidomuncul. Jadi pedagang jamu mendapatkan tiket mudik gratis ke kota asalnya tanpa komitmen apapun. Dan untuk pertama kalinya mudik lebaran gratis dilaksanakan pada tahun 1991 diikuti oleh

2.500 orang dengan menggunakan 50 unit bis, diberangkatkan dari Lapangan Parkir Timur Senayan. Sejak saat itu PT Sidomuncul selalu menyelenggarakan Mudik Gratis bagi para pedagang jamu se-Jabotabek setiap tahunnya. Seperti tahun-tahun sebelumya bertempat di Lapangan Parkir Barat Pekan Raya Jakarta (PRJ) Kemayoran, Kamis, (25/8) Sidomuncul kembali meyelenggarakan kegiatan Mudik Gratis bersama Pedagang Jamu se-Jabotabek untuk yang ke-22 kalinya dengan diikuti oleh 19.000 pemudik. Pada kegiatan Mudik Gratis Sidomuncul ke-22 ini dilepas Menteri Perhubungan RI Freddy Numberi, Menteri Tenaga Kerja dan Transmigrasi RI Muhaimin Iskandar, Menteri Pemberdayaan Perempuan dan Perlindungan Anak RI Linda Amalia Sari Gumelar, Menteri Perdagangan RI Mari Elka Pangestu, Gubernur DKI Fauzi Bowo, WAKAPOLRI Nanan Soekarna, Kepala Badan Pengawasan Obat dan Makanan (POM) RI Dra Kustantinah Apt, M.App. Sc, Dr Meutia Hatta, dan Direktur Utama PT Sidomuncul Irwan Hidayat. Sebelum pelepasan para peserta mudik akan dihibur oleh bintang iklan Kopi Jahe Sidomuncul Group Band Wali dan bintang iklan dari Kuku Bima Energi Donny Kesuma, Rieke Diah Pitaloka, Ade Rai serta Lula Kamal, Sophie Navita dan Artika Sari Devi ikon dari produk Tolak Angin. Dengan menggunakan 300 unit bus, para pemudik selain dari Jakarta secara serentak akan diberangkatkan dari Bogor, Tangerang, Balaraja, Bandung, Cikampek dan Cibinong dengan tujuh kota tujuan yaitu Cirebon, Kuningan, Tegal, Banjar Negara, Solo, Wonogiri dan Yogyakarta. Awalnya kegiatan mudik gratis Sidomuncul yang di-

selenggarakan sejak 1991 hanya untuk para pedagang jamu bersama keluarganya. Namun seiring waktu berjalan pada tahun 2004 bersamaan dengan adanya divisi baru di Sidomuncul yaitu “Divisi Food” dengan produk perdananya minuman energi Kuku Bima Energi, Mudik Gratis Sidomuncul juga diikuti oleh pedagang asongan yang menjual produk-produk Sido Muncul. Direktur Utama PT Sido Muncul Irwan Hidayat mengatakan Mudik Gratis Sidomuncul selain telah menjadi tradisi perusahaan dan bagian dari ucapan terima kasih kepada para penjual jamu dan pedagang asongan, acara mudik gratis ini sebagai bentuk partisipasi untuk membantu pemerintah dalam hal transportasi dan masyarakat dalam menyambut Hari Raya. Sebagai perusahaan jamu dan farmasi PT Sidomuncul yang pada 11 November mendatang memasuki usia yang ke-60 tahun, terus mensosialisasikan produk-produknya dengan berbagai kegiatan CSR. Di Ramadhan ini Sidomuncul memberikan bantuan 5.000 paket sembako untuk kaum duafa di Blora. Dan melalui salah satu produk u n g g u l a n To l a k A n g i n , Sidomuncul berbagi kasih bersama bersama 5000 anak panti asuhan di lima kota di Jawa Tengah, Semarang, Jepara, Klaten, Pemalang dan Wonogiri dengan memberikan bantuan senilai Rp150 Juta. Di Jakarta, Tolak Angin bekerjasama dengan IWAPI kembali berbagi kasih bersama 2.500 anak panti asuhan dengan memberikan bantuan senilai Rp150 juta. Bantuan tersebut diberikan di Jakarta.(m06)


Sumatera Utara

WASPADA Kamis 25 Agustus 2011

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:31 12:44 12:32 12:39 12:38 12:35 12:32 12:27 12:34 12:34

‘Ashar 15:48 15:59 15:48 15:54 15:54 15:53 15:49 15:44 15:51 15:49

Magrib 18:36 18:51 18:37 18:46 18:45 18:39 18:37 18:32 18:39 18:40

‘Isya

Imsak

Shubuh Syuruq

Kota

19:49 20:04 19:49 19:58 19:57 19:50 19:49 19:44 19:52 10:52

04:55 05:06 04:56 05:01 05:01 05:01 04:56 04:52 04:58 04:57

05:05 05:16 05:06 05:11 05:11 05:11 05:06 05:02 05:08 05:07

L.Seumawe 12:37 L. Pakam 12:30 Sei Rampah12:29 Meulaboh 12:41 P.Sidimpuan12:29 P. Siantar 12:29 Balige 12:29 R. Prapat 12:26 Sabang 12:44 Pandan 12:30

06:21 06:33 06:22 06:28 06:28 06:28 06:22 06:18 06:25 06:23

Zhuhur ‘Ashar 15:52 15:57 15:46 15:57 15:47 15:46 15:47 15:44 15:59 15:48

C1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:44 18:36 18:35 18:47 18:33 18:34 18:34 18:30 18:51 18:35

19:57 19:48 19:47 19:59 19:44 19:46 19:46 19:42 20:04 19:46

04:59 04:54 04:53 05:04 04:55 04:54 04:55 04:52 05:05 04:56

05:09 05:04 05:03 05:14 05:05 05:04 05:05 05:02 05:15 05:06

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:30 12:32 12:42 12:34 12:31 12:38 12:27 12:37 12:30 12:29

18:34 18:37 18:49 18:39 18:37 18:44 18:32 18:42 18:34 18:34

19:46 19:49 20:01 19:51 19:49 18:57 19:44 19:54 19:46 19:47

04:56 04:57 05:04 05:00 04:55 05:01 04:51 05:01 04:55 04:53

05:06 05:07 05:14 05:10 05:05 05:11 05:01 05:11 05:05 05:03

Panyabungan 12:27 Teluk Dalam12:34 Salak 12:32 Limapuluh 12:28 Parapat 12:30 GunungTua 12:27 Sibuhuan 12:27 Lhoksukon 12:36 D.Sanggul 12:31 Kotapinang 12:25 AekKanopan 12:27

06:26 06:21 06:20 06:31 06:21 06:20 06:21 06:18 06:32 06:23

15:48 15:49 15:57 15:52 15:48 15:54 15:44 15:54 15:48 15:46

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:22 06:23 06:30 06:26 06:22 06:28 06:18 06:27 06:22 06:20

Zhuhur ‘Ashar 15:46 15:53 15:50 15:45 15:47 15:45 15:45 15:52 15:48 15:43 15:44

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:31 18:37 18:37 18:33 18:35 18:31 18:30 18:43 18:35 18:29 18:32

19:42 19:49 19:49 19:45 19:47 19:43 19:42 19:56 19:47 19:41 19:44

04:54 05:01 04:57 04:52 04:55 04:53 04:53 04:59 04:56 04:51 04:52

05:04 05:11 05:07 05:02 05:05 05:03 05:03 05:09 05:06 05:01 05:02

06:20 06:27 06:24 06:19 06:21 06:19 06:19 06:25 06:22 06:17 06:18

Pengamanan Lebaran Preemptive Dan Preventif TEBINGTINGGI (Waspada): Kepala Kepolisian Daerah Sumatera Utara Irjen Pol. Wisjnu Amat Sastro mengomandokan kepada jajarannya, agar penanganan keamanan lebaran dilakukan secara preemptive dan preventif. Hal itu harus dilakukan untuk menjamin kondusifitas kondisi dan situasi selama lebaran.

Perintahitudisampaikan,saat Kapolda melakukan peninjauan ke Pos PolresTebingtinggi di Simpang Beo, Kec. Rambutan, Kota Tebingtinggi,Rabu(24/8).Terlihat, menyambut Kapoldasu Wali

Waspada/Ist

KAPOLDASU Irjen Pol.Wisjnu Amat Sastro melakukan briefing terhadap personil Polres Tebingtinggi di Pos Simpang Beo. Kapoldasu mengimbau masyarakat menghindari aktivitas yang mengundang kejahatan. Foto direkam, Rabu (24/8).

Kantongi 3 Paket SS Ditangkap Polisi PANGKALANSUSU (Waspada): Petugas berhasil membekuk tersangka pemilik sabu-sabu, MAG alias Amin Badau, 26, warga Jalan Pembangunan, Kel. Berasbasah, Kec. Pangkalansusu, Senin (22/8) malam. Dari tersangka, polisi mengamankan tiga paket SS dan satu sepeda motor. Penangkapan ini berawal informasi yang didapat polisi bahwa tersangka membawa kristal haram dan sedang bergerak menuju P. Bradan, mengendarai sepedamotor Jupiter MX BK 5402 GP. Menerima info ini, Kanit Reskrim, Aiptu D. Situmorang bersama anggota melakukan pengejaran. Tepat di kawasan Desa Sei. Siur, petugas memerintahkan tersangka berhenti. Antara tersangka dengan polisi sempat terjadi pergumulan,sebabsaatdigeledah,MMmelawan,bahkanberusaha membuang barang bukti. Namun usaha pemuda itu sia-sia. Kapolsek, AKP Untung Robert melalui Kanit Reskrim, Aiptu D. Situmorang dikonfirmasi, Selasa (23/8) mengatakan, tersangka telah dijebloskan ke sel tahanan. Dari tersangka, disita barang bukti 3 paket (ji) SS dan satu sepeda motor.(a02)

Kota Ir. H. Umar Zunaidi Hasibuan,MMdanwakilnyaH.Irham Taufik, SH, MAP bersama jajarannya serta Kapolres AKBP Robert Haryanto Watratan, SH, S.Sos. Menurut Kapoldasu, Jalinsum sebagai titik utama pergerakan arus mudik dan balik masyarakat selama lebaran, harus kondusif setiap waktu. Menjaga suasana kondusifitas itu, polisi harus bekerja ekstra mengamankan jalur yang menjadi lintasan masyarakat.SimpangBeosebagaijalur transit, tambahWisjnu Amat Sastro, tidak boleh mengalami kendalakemacetan.Tapiharusdalam kondisi lancar setiap waktu. “Jangan lupa untuk terus berkoordinasidenganPolressekitar,misalnya Pematang Siantar, Simalungun maupun Sergai,” ujar Kapoldasu kepada Kapolres Tebingtinggi. Kesiapan personil polisi dalam menjaga keamanan selama lebaran, ujar Kapoldasu, dengan selalu mengawasi jalur perlintasan. “Jika ada yang mencurigakan, lakukan pemeriksaan. Atau ada pelanggaran berikan peringatan dan jangan langsung main tilang,” tegas Kapoldasu. Kapoldasu, membeberkan

pihaknya mengerahkan sekira 7.000 personil ditambah tenaga pengamanan dari berbagai organisasi kemasyarakatan. Untuk melakukan koordinasi atas pengamanan itu, Kapoldasu mengatakan, sudah mengunjungi sejumlahposkepolisian,sejakdari perbatasan Sumut di Kab. LangkatsertalautdiBelawan.Selanjutnya meninjau kesiapan di Jalinsum. Kepada masyarakat yang berlebaran, Kapoldasu mengi Qngatkan agar beraktivitas wajar dan tidak memancing orang untukberniatjahat.Misalnya,jangan memakai perhiasan berlebihan jika berbelanja, karena keadaan demikian memancing kerawanan. “Sekarang ini banyak orang yang tidak bekerja menghadapi lebaran. Kondisi itu bisa menimbulkan hal-hal negatif,” imbau Kapoldasu. Sementara Wali Kota Ir. H. Umar Zunaidi Hasibuan, MM, melaporkan kepada Kapoldasu, sudah memerintahkan camat dan lurah se Kota Tebingtinggi untuk mengawasi wilayahnya. Kemudian segera melaporkan kepada pihak berwajib situasi yang dinilai tidak kondusif selama lebaran.(a09)

Wali Kota Binjai Temukan Makanan Tak Layak Konsumsi BINJAI (Waspada):Wali Kota Binja Muhammad Idaham dan unsur Muspida, serta tim terpadu pengawasan peredaran barang dan jasa Kota Binjai menemukan puluhan produk makanan, minuman dan buah-buahan yang sudah tidak layak konsumsi masyarakat ketika sidak, Rabu (24/ 8) ke berbagai supermarket dan swalayan di kota Binjai. Wali Kota M. Idaham mengatakan operasi pasar modern dantradisionaldiKotaBinjaijelang lebaran, bertujuan memberikan rasa aman kepada masyarakat Binjai merayakan hari raya Idul Fitri 1432 H. Diakui kegiatan operasi pasar dilaksanakan dadakan untuk memberi pembinaan kepada penjual.“Kamimelakukanpengecekan paket parcel, produk makanan, dan minuman yang dijual pasar modern untuk keamanan masyarakat. Kami belum mene-

mukan paket parcel yang berbahaya dikonsumsi masyarakat di dua lokasi supermarket,” ujarnya. Dari Suzuya Binjai dan Great Market,Wali Kota Binjai beserta rombongan melakukan sidak ke Supermaket Ramayanan dan Hypermart Binjai Supermall.Ternyata tim terpadu pengawasan peredaran barang dan jasa Kota Binjai menemukan puluhan produk makanan dan minuman sudah rusak dan kadaluarsa di Supermarket Ramayana. Selain itu ditemukan buahbuahanrusakdiHypermartBinjai Supermall. Berkaitan hal ituWali Kota Binjai, M. Idaham menegaskanakanmenindakpengusaha yang masih memperdagangkan produk makanan, minuman dan buah-buhan rusak serta kadaluarsa. “Produk kadaluarsa dan rusak segera ditarik dari pere-

daran. Karena makanan, minuman dan buah-buahan yang rusak dan kadaluarsa bisa membayakan kesehatan masyarakat,” ujar Idaham. Jadi kami akan memberi tindakan peringatan pembinaan kepada pihak manajeman. Jika nanti dilakukan sidak kembali ternyata ditemukan hal serupa, maka pihak manajeman akan diberi sanksi tegas, Tim terpadu pengawasan peredaran barang dan jasa Kota Binjai akan terus memantau produkmakanan,minuman,dan buah-buahan hingga H-3 hari Raya Idul Fitri 1432 H. Tim juga akan melakukan pengawasan terhadap makanan, minuman dan kebutuhan lebaran seperti daging ayam dan daging sapi di pasartradisional,agarmasyarakat bisa terhindar dari makanan dan minuman yang menggagu kesehatan.(a04)

BESITANG (Waspada): Tim Penggerak PKK Kab. Langkat dalam Safari Ramadhan Peduli Sesama (SRPS) untuk yang terakhir di Ramadhan tahun ini, , Selasa (23/8), door to door mengunjungi warga pra sejahtera di Kecamatan Besitang. Ketua TP-PKK Ny. Hj. NuraidaNgogesadidampingipengurus PKK dan Kabag Humas Syahrizal, Camat Besitang, Nuriadi, berjalan kaki mendatangi rumah warga untuk memberi bantuan paket sembako dan tali asih bagi 10 keluarga kauh duafa. “Agar kita tahu kehidupan masyarakat dari dekat, untuk itu program tahun ini benar-benar kita lakukan door to door,” kata Nuraida sembari menelusuri jalanan becek dan sesekali menundukkan kepala karena melewati jemuran pakaian warga. Ketika menemui Suriati, 38,

janda lima anak di Lk IX Pekan Besitang, Ketua TP-PKK Langkat itu disambut haru dan tangis wanitayangsehari-harinyamengandalkan hidup mencari upah mencuci pakaian, setelah suaminya meninggal dunia lima tahun lalu akibat kecelakaan. “Sabar buk.., kita harus ikhlas menjalani hidup yang penuh cobaan ini. Yang terpenting, didik anak-anak agar mereka kelak menjadi anak yang berguna bagi orang banyak,” tutur Nuraida memberi dorongan semangat kepada Suriati. Pada kesempatan itu Suriati sempat curhat perihal kenakalan puteranya,Tama, yang masih duduk di bangku kelas 5 SD kepada Ketua TP-PKK. Mendengar curahankatasangibu,isteriBupatiLangkatlangsungmenemuianakyang saat itu mengurung diri di kamar. Nuraida menasihatinya sem-

bari menganjurkan untuk menyalami ibunya. “Salam dan minta maaf kepada ibumu yang melahirkan dan membesarkanmu,” katanya.Suasanaharutakterbendung begitu menyaksikan,Tama, memeluk ibunya untuk memohon maaf. Ketua TP-PKK Langkat dalam RSPS yang terakhir ini juga menyerahkan bantuan sembako dan kain sarung kepada 86 isteri Kepala Dusun/Kepala Lingkungan. Bantuan untuk perangkat pemerintahan terendah yang selama ini selalu luput dari perhatian atas prakarsa Camat Besitang didukungpengusahayangpeduli. Dalam kesempatan itu, Nuraida secara spontan memberikan tali asih kepada empat isteri Kepala Dusun (Kadus) yang telah mengabdikan diri lebih dari 20 tahun mendampingi suami mengurus dusunnya.(a02)

Waspada/HM Husni Siregar

BUPATI Deliserdang Drs H Amri Tambunan bersama Ketua TP PKK Ny. Hj. Anita Amri Tambunan beserta Wabup H. Zainuddin Mars dan Wakil Ketua TP PKK Ny. Hj. Asdiana, memberikan tali asih kepada para tokoh masyarakat, anggota KIM dan Kepala Desa/Lurah se Kabupaten Deliserdang, Selasa (23/8) malam di kompleks rumah dinas bupati.

‘Baru Yakin’ Wujudkan Kesetiakawanan Sosial Termasuk Tuntunan Agama Dan Jadi Contoh Daerah Lain LUBUK PAKAM (Waspada): Gerakan bedah rumah melalui program‘BaruYakin’, benar-benar sangat membanggakan Kabupaten Deli Serdang. Sebab melalui kegiatan dengan sasaran 10.000 rumah tak layak huni bagi keluarga kurang mampu menjadi rumah layak huni, sehat dan aman ini, mampu mewujudkan rasa kesetiakawanan sosial di tengah-tengah masyarakat. “Kegiatan ini tentu merupakan kebaikan yang termasuk dalam tuntunan agama dan perlu dikembangtingkatkan serta membudaya di tengah kehidupan masyarakat, dan diharapkan bisa menjadi contoh bagi daerah lain,” kata Ustazd Drs, H, Soritua Harahap, MM dalam tausyiahnya pada acara buka puasa bersama Pemkab Deli Serdang, di rumah dinas bupati Jalan Negara Lubuk Pakam, Selasa (23/8) malam. PemkabDeliserdangmelaksanakanbukapuasa bersama dengan para Kepala Desa/Lurah, Kelompok Informasi Masyarakat (KIM) serta tokoh masyarakat tergabung dalam Gerakan Masyarakat Peduli Pembangunan (GMPP) se Kab. Deliserdang. Selain Bupati Deliserdang Drs H. AmriTambunan bersamaWabup H Zainuddin Mars, juga hadir unsur Muspida, Sekdakab Drs H. Azwar S. M.Si, Asisten III H. Irham Dinni Nasution, S.Sos, Kepala Kantor Kementerian Agama (Kakan Kemenag) Deliserdang Drs H. Dus Berutu, MA, sejumlah pimpinan SKPD, Ketua TP PKK Ny. Hj. Anita Amri Tambunan, Wakil Ketua TP PKK Ny. Hj. Asdiana Zainuddin, Ketua DharmaWanita Persatuan Ny. Hj. Fauziah Azwar serta para Camat se Kab. Deliserdang diawali ceramah oleh Drs Soritua Harahap, MM. Kegiatan dilanjutkan shalat maghrib berjamaah, santap malam serta penyerahan bingkisan kepada Kepala Desa/Lurah,KIM dan GMPP. Menurut Drs H. Soritua Harahap, MM dalam tausiyahnya, ada dua kelompok manusia yang berbedaalam,yaituadayangsudahterlebihdahulu di panggil Allah SWT dan ada yang masih hidup.

Bagi mereka yang telah dipanggil Allah, pada bulan ramadhan ini mengharapkan makanan dan minuman yang lezat tetapi berupa kalimatkalimat toyyibah (kebaikan) dari keluarga yang masih hidup, seperti tadarus, ibadah kiyamullail maupun ibadah lainnya. “Selain itu orang-orang yang menyantuni anak yatim, penggali kubur dan nazir masjid sebagaimana dicontohkan pimpinan Pemkab Deliserdang pada ramadhan ini,” tutur Ustadz Drs. H. Soritua Harahap, MM. Kegiatan buka puasa bersama juga dilakukan Bupati Deliserdang Drs H Amri Tambunan dan Wabup H. Zainuddin Mars dengan para PNS di jajaran Pemkab Deliserdang, di rumah dinas bupati, Rabu (24/8). 300 Anak Yatim Sementara sebelumnya sekira dua ribuan kaum ibu dari 22 wilayah kecamatan se Kabupaten Deliserdang mengikuti pengajian akhir Ramadhan 1432 H, juga di rumah dinas Bupati Deliserdang, Selasa siang. Pada pengajian ke tiga dan terakhir di bulan suci ramadhan tahun ini diawali shalat Tasbih dipandu Al ustadz Drs. H. Jasman, dengan penceramah Muallimah Dra. Hj.Yusrah Jalil dilanjutkan pemberian bingkisan tali kasih kepada 300 anak yatim dan seluruh jamaah pengajian. KetuaTP PKK Deliserdang Ny. Hj. Anita Amri Tambunan didampingiWakil Ketua Ny. Hj. Asdiana Zainuddin, Ketua DharmaWanita Persatuan Ny. Hj. Fauziah Azwar menyampaikan terimakasih serta rasa bangga atas tingginya kepedulian kaumibudidaerahiniuntukmengikutipengajian mulai awal, pertengahan dan akhir ramadhan. Mualliamah Hj.Yusrah Jalil di hadapan ribuan kaumibuyangumumnyamenggenakanpakaian serba putih, mengajak jamaah mengaplikasikan nilai-nilai ibadah ramadhan dalam kehidupan sehari-hari, baik di lingkungan keluarga maupun masyarakat.(a06)

Door to Door Kunjungi Kaum Duafa

Waspada/Armansyah Th

KETUA Umum XTrim Doddy, didampingi Camat Hamparan Perak Faisal Nasution menyerahkan sembako yang dijual di pasar murah XTrim di desa Paluh Manan,Kec.Hamparan Perak.

Warga Serbu Pasar Murah XTrim Di Hamparan Perak H.PERAK (Waspada): Ratusan warga menyambut antusias kegiatan Pasar Murah yang digelar klub XTrim (Expedition Trail Mania)Indonesia,yangberlangsungdiduadesadiKec.Hamparan Perak, Kab. Deliserdang, kemarin (24/8). Kegiatan pasar murah sebagai bagian dari event klub XTrim berlangsung di dua desa, masing-masing desa Paluh Manan, dan Paluh Kuraw. Di desa Paluh Manan, yang dihuni 900 Kepala Keluarga (KK) XTrim menyalurkan 410 paket sembako yang dijual 50 persen dari harga pasar. Setiap paket yang meliputi besar 10 kg, plus sirop, gula dan minyak goreng seharga Rp 132.750, dapat ditebut warga tergolong tak mampu, dengan hanya membayar Rp 65 ribu. Sementara di desa Palur Kurow, yang berpenghuni 1.374 KK, disediakan 374 paket. Gelaran pasar murah berlangsung mulai pukul 09.00 pagi, namun tidak sampai tengah hari, stok yang tersedia nyaris kandas dibeli warga, dengan cara menukar dengan kupon yang sebelumnya telah mereka miliki. Kades Paluh Manan Syarifudin mengatakan, atas nama warga dia menyatakan terima kasih atas kegiatan dan kepedulian klub XTrim.“Kegiatan ini sangat membantu warga, apalagi menjelang hari raya Idul Fitri. Saya berharap pasar murah seperti ini bisa berlangsung di desa kami setiap tahunnya,” ucap Syarifudin. Ketua Umum XTrim Indonesia, Doddy, yang hadir langsung di tengah warga bersama Camat Hamparan Perak, Faisal Arif Nasution mengatakan, pasar murah ini merupakan rangkaian kegiatan klub yang digelar selama Ramadhan 1432 H. Dana dari pasar murah ini merupakan sumbangan dari para anggota XTrim bersama para simpatisan klub, yang digalang saat acara buka puasa bersama di Medan, dua pekan lalu. “Pasar murah ini berlangsung dua hari, di mana Kamis (24/8) hari ini, juga berlangsung acara serupa di Belawan,” tambah Doddy. Dikatakan, uang dari hasil pasar murah ini, nantinya juga kembali akan disalurkan kepada fakir miskin, anak yatim, serta mesjid/musholla. “Klub XTrim ini memang bukan sebuah perkumpulan yang sangat besar, tetapi kami senantiasa berusaha untuk berbuat sesuatu bagi masyarakat,” tambah Doddy. Dalam kesempatan ini Doddy tak lupa mengucapkan terima kasih kepada rekan sesama klub, dan juga para donator seperti H. Gatot Pudjonugroho, Gus Irawan, Kombes Pol Tagam Sinaga,Kombes Pol Murad Ismail, AKBP Endang H, Anuar Shah, Boyke Turangan, Ijeck, H. Zulhifizi Lubis dan lainnya. (m47)

Waspada/Asrirrais

KETUA TP-PKK Langkat Ny. Hj. Nuraida Ngogesa didampingi Camat Besitang dan Ny. Asih Nuriadi menyaksikan seorang anak yang tersentuh setelah diberi nasihat pada rangkaian RSPS terakhir di di Kec. Besitang, Selasa (23/8).

Waspada/Edi Gultom

BUPATI Sergai H.T Erry Nuradi didampingi Wabup H. Soekirman, Kapolres Sergai AKBP Arif Budiman,S.Ik,MH dan Kasdim 0204/DS Mayor HendraW memonitoring harga pasar dan ketersediaan bahan sembako menjelang Hari Raya Idul Fitri 1432 H di Pasar Tradisional Desa Sei Rampah, Kec. Sei Rampah, Selasa (23/8).

Jelang Hari Raya Idul Fitri

Bupati Sergai Monitoring Harga Sembako Di Pasar Sei Rampah SEI RAMPAH (Waspada): Untuk mengantisipasi lonjakan kenaikan harga dan persediaan bahan pokok menjelang Hari Raya Idul Fitri 1432 H, Bupati Serdang Bedagai H.T Erry Nuradi didampingiWabup H. Soekirman, Kapolres Serdang Bedagai AKBP Arif Budiman, S.Ik, MH, Kasdim 0204/DS Mayor HendraW mengadakan monitoring harga pasar dan pengendalian harga sembilan barang pokok (Sembako) di PasarTradisional Desa Sei Rampah, Kec. Sei Rampah, Selasa (23/8). Dalam monitoring itu, Bupati berdialog langsung kepada para pedagang mengenai harga Sembakosertahargakebutuhanlainmenjelanglebaran. Dari hasil pemantauan yang dilakukan pada beberapa pedagang ditemukan harga sejumlah kebutuhan pangan terdiri dari beras, gula pasir, minyak goreng dan mentega dan telur ayam tidak mengalami kenaikan harga. Harga daging sapi Rp80 ribu s/d Rp85 ribu/kg, daging kambing Rp60 ribu s/d Rp65 ribu/kg, daging ayam kampung Rp40 ribu/kg dan ayam ras Rp20 ribu/kg. Sedangkan harga ikan Rp20 ribu s/d Rp28 ribu/kg, mengalami kenaikan karena pasokannya menurun dan keadaan cuaca yang kurang baik. Dalam kunjungannya, Bupati Sergai melihat kondisidagingayamdansapitermasukmelakukan tes kandungan borak serta formalin, dan ternyata

tidak ditemukan daging yang tidak sesuai syarat kesehatan. Kehadiran Bupati Sergai H.T. Erry Nuradi didampingi Asisten Ekbangsos Drs. Amirullah Damanik, Kadisperindagsar Drs. Indra Syahrin, M.Si, Kabag Perekonomian Drs. Nasrul Azis Siregar, Kabag Humas Dra. Indah Dwi Kumala dan jajaran SKPD Pemkab Sergai disambut dengan antusias dan rasa bangga para pedagang dan pengunjung pasar, sebab untuk pertama kalinya Pasar Desa Sei Rampah mendapat kunjungan pimpinan dari daerah ini. Bupati juga bertatap muka dan berbincangbincang dalam suasana akrab dan santai dengan para pedagang. bahkan salah satunya pedagang ikan kering bernama Karim yang telah berusaha selama30tahun,yangmendukungkepemimpinan Erry Nuradi-Soekirman yang cukup fokus terhadap perkembangan perekonomian di kabupaten hasil pemekaran ini. Bupati H.T Erry Nuradi juga memberikan apresiasinya kepada para pedagang yang telah turutmemberikontribusiPendapatanAsliDaerah (PAD). Kepada pedagang juga disarankan terus memperhatikan kerapian dan kebersihan demi kenyamanan yang tidak hanya dirasakan pedagang, tapi juga pengunjung pasar.(a08)


Sumatera Utara

C2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Aji Wahyudi (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Feirizal Purba (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Menantu Dan Mertua Pengedar SS Diringkus Polres Asahan KISARAN (Waspada): Diduga mengedar shabu-shabu (SS), seorang pria bersama mertuanya di bawa ke Polres Asahan untuk menjalani pemeriksaan, Senin (22/8) sore, sebagai barang bukti tiga paket kecil diamankan. Informasi dihimpun Waspada, tersangka WR, 26, warga Tanjungbalai, diamankan Sat Narkoba Polres Asahan, di salah satu hotel Jalan Diponegoro. Dia merupakan salah satu pengedar yang selama ini diincar polisi. Saat pemeriksaan, tidak ada ada ditemukan barang haram itu, sehingga polisi menggiring tersangka ke rumah mertuanya, di Jalan Sumantri. Ditemani Kepala Lingkungan, personil melakukan penggeledahan, dan akhirnya menemukan tiga paket SS, dalam kotak rokok, dan diselipkan dalam saku kemeja. Namun, sebelumnya sang mertua melarang petugas menyentuh baju itu dengan alasan baru disetrika. Akibatnya, IT,56, digiring ke Mapolres untuk menjalani pemeriksaan intensif. Kapolres Asahan AKBP Masrzuki MM, dikonfirmasi Waspada, melalui Kasat Narkoba Napsanto, didampingi Kasubag Humas AKP R Berutu, membenarkan. (a15)

Lima Titik Rawan Laka Jalinsum Asahan-Batubara KISARAN (Waspada): Arus mudik 2011 diperkirakan akan didominasi sepeda motor, dan hasil pemeriksaan Sat Lantas Polres Asahan, ada lima titik rawan laka yang tersebar di sepanjang Jalinsum Asahan-Batubara yang siap menelan korban jiwa. Hal itu diungkapkan Kasat Lantas Polres Asahan, AKP Eko Hartanto, melalui Kanit Laka Ipda MP Pardede, ditemui Waspada saat memantau kondisi arus mudik menjelang lebaran di Jalinsum, Rabu (24/8). Menurutnya lima titik rawan ituberadadiKecamatanPulauraja (jalan turun naik dan berbukit), Airbatu (jalan lurus dan mulus), kepadatan penduduk di Kecamatan Simpangempat (Asahan) dan Tanjungkasuh (Batubara),

serta penyempitan jalan di Limapuluh, sehingga kondisi itu bisa menyebabkan terjadinya laka lantas. Karena itu masyarakat diimbau untuk selalu waspada saat berada di perjalanan, dengan memperhatikan kondisi kendaraan, dan menggunakan perlengkapan keselamatan seperti helm, serta tidak membawa barang terlalu banyak. “Untuk hari ini, arus mudik sudah mulai tampak, namun diperkirakan Sabtu (27/8) puncaknya.Yang mendominasi adalah kendaraan roda dua,” ungkap Pardede. Pardede juga menjelaskan, Polres Asahan mendirikan lima posko di sepanjang Jalinsum Asahan-Batubara, sehingga bila ada pengguna jalan merasa capek dalam perjalanan, disarankan untuk beristirahat di tempat yang telah disediakan dan tidak memaksakan diri. “Laka lantas yang sering terjadi kebanyakan

disebabkan lalai saat berkendara, sehingga kehilangan kendali. Sebab itu masyarakat harus menjaga stamina tubuh,” ungkap Pardede. Sedangkan untuk titik kemacetan,Pardedemengatakan hanyadisebabkanpersimpangan di Limapuluh, serta pasar tradisional di Indrapura, sehingga di kawasaniniseringmacet.Namun personil Sat Lantas telah disiagakan di berbagai titik, untuk mengamankan keadaan jalan agar lancar. “Kita terus memantau situasi arus mudik, dan berharap semua berjalan dengan baik. Semua itu kembali kepada masyarakat dalam kesadaran mematuhi rambu lalu lintas. Dengan menggunakan helm saat berkendara,” ungkap Pardede. Data yang dihimpun Waspada, pada arus mudik 2010 tercatat delapan orang tewas akibat laka lantas di Jalimsum Asahan-Batubara.Yang mendominasi adalah kendaraan roda dua.(a15)

Waspada/Sapriadi

PERSONEL Sat Lantas Polres Asahan mengatur jalannya arus mudik di depan Pos Katarina, Kisaran, Rabu (24/8). Puncak arus mudik diperkirakan pada Sabtu (27/8).

Mobil Dinas DPRD Terbengkalai Jadi Gunjingan Warga RANTAUPRAPAT (Waspada): Kondisi mobil dinas jenis Kijang Innova yang terbengkalai jadi pergunjingan masyarakat. Pasalnya, sudah beberapa hari mobil itu terparkir dengan kondisi kaca belakang pecah. Pantauan Waspada, mobil tersebut sangat riskandarisisikeamanandimanaterpakirdipinggir jalan dan kaca belakang pecah. Namun sepertinya tidak ada tindakan pengamanan yang dilakukan pemakai mobil ataupun Sekretariat Dewan. Padahal, mobil itu masih sangat baik sangat di sayangkan terbengkalai begitu saja, Mobil jenis kijang inova ini sama dengan mobil dinas Kepala SKPD di Pemkab Labuhanbatu. Beberapa warga yang berdomisili diseputaran Jalan Gajah Mada, Kec. Rantau Utara kepada Waspada, Selasa (22/8) mengatakan, kondisi mobil Inova BK 547Y (plat merah) mencerminkan sikap yang tidak peduli terhadap pemakai mobil. Sehingga mobil yang di beli dari uang rakyat itu terkesan tidak berharga sama sekali.”Mobil

itu mencerminkan perilaku yang kurang baik dan tidak menghargai asset Negara,”terang warga bernada kesal. Pendapat lain juga dilontarkan masyarakat. Lebih baik mobil itu disewakan (direntalkan). Mobil sangat laris dan hasil dari penyewaan itu bisa membantu orang susah. “Daripada hancur begitu tidak di urus, lebih baik di sewakan, hasilnya di berikan ke orang susah,”terang Harahap warga Gajahmada. Sedangkan Sekretariat Dewan (Sekwan) H Fuad Siregar ketika di konfirmasi mengenai kondisimobilBK547Yitu,tidakmemberijawaban. Kondisi mobil dinas DPRD sebelumnya juga ada yang hancur akibat kecelakaan yaitu mobil jenis Jeep Nisan Trail BK 12 Z yang dipakaiWakil Ketua DPRD sebelum pemekaran Labuhanbatu. Kini mobil itu hancur di parkirkan di Work Shop. HallainjugaterkaitkeberadaanmobildinasDPRD serta kendaraan roda dua belum di kembalikan ke sekretariat.(co7)

Mega Proyek ‘Siluman’ Kantor Kejari Rantauprapat Waspada/Syahri ilham Siahaan

KAPOLRES Labuhan Batu AKBP Hirbak Wahyu Setiawan bersama Bupati Labura H. Kharuddin Syah dan Kapolsek Kualuhhulu AKP Arifin Marpaung meninjau kesiapan Pos Pengamanan Operasi Ketupat Toba 2011 di Jalinsum Desa Damuli Pekan Kecamatan Kualuhselatan, Selasa (23/8).

Antisipasi Perampokan, Kapolres L. Batu Pantau Bank Tinjau Pos Pengamanan Di Labura RANTAUPRAPAT (Waspada); Mengantisipasi aksi perampokan, dan melihat kesiagaan personil melaksanakan pengamananmenjelangperayaanHari Raya Idul Fitri, Kapolres Labuhanbatu langsung memantau beberapa bank di kota Rantauprapat. Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan, S.Ik didampingi Kabag Ops Kompol R Pandiangan, Kasat Intelkam AKP Mijer dan Kasubag Humas AKP MT Aritonang langsung memantaubeberapabankdikota Rantauprapat, antara lain Bank Sumut, Bank BNI dan Bank Mandiri serta kantor Pegadaian. Dalam kunjungan tersebut, Kapolres Labuhanbatu bersama para perwiranya disambut masing-masing pimpinan bank serta Pegadaian. Kepada para pimpinan di instansi tersebut, Kapolres meminta agar terus berkoordinasi dengan pihak Kepolisianapabilamembutuhkan bantuan pengamanan. “Agar tetap memberi kenyamanan kepada masyarakat dengan suasana lebih kondusif, jangan segan minta pengawalan polisi,” ucap Kapolres Labuhanbatu AKBP Hirbak Wahyu Setiawan, S.Ik saat berdialog kepada nasabah yang lagi antri di bank yang dikunjungi.

Kepada Waspada, Selasa (23/ 8) Kapolres mengatakan, jelang perayaan Hari Raya Idul Fitri masyarakat banyak melakukan transaksi keuangan, untuk itu kita langsung memantau bank yang ada di Rantauprapat sebagai upaya antisipasi aksi kejahatan perampokan dengan memberi sosialisasi. “Dalamkegiatanpemantauan itukitajugalangsungmelihatkesiagaan para personil yang melakukan pengamanan di bank dan kantor pegadaian. Kita harapkan seluruh personil yang melakukan pengamanan di bank dan pegadaian,selalusiagadantetapmemberi pelayanan terbaik,” jelas Kapolres. Di Labura Sementara itu Kapolres Labuhan Batu AKBP HirbakWahyu Setiawan dan Bupati Labuhanbatu Utara H. Kharuddin Syah, SE juga meninjau pos PengamananOperasiKetupatToba2011 di Jalinsum Desa Damuli Pekan, Kecamatan Kualuhselatan, Selasa. Usai meninjau pos tersebut, Bupati dan Kapolres beserta jajarannya berbuka puasa bersama di rumah makan Miroso dan melaksanakan sholat magrib bersama dihalaman rumah makan tersebut. Kepada wartawan Kapolres

mengatakan untuk pengamanan Idul Fitri 2011 pihaknya telah menerjunkan dua pertiga dari personilPolresLabuhanBatuatau sekitar 700 personil di tambah delapan personil Brimob. “Kita telah menerjunkan dua pertiga dari jumlah personil Polres Labuhan Batu atau sekita 700 personil untuk pengamanan lebaran di tambah delapan personil Brimob untuk di sebar di tiga Kabupaten yaitu Labura, Labuhan Batu dan Labusel,” kata Kapolres didampingiWaka Polres KompolTetra,KabagOpsKompol R. Pandiangan dan sejumlah perwira. Kapolres juga minta pihak Dinas Kesehatan Labura segera menyediakan kotak P3K serta mobil ambulans di setiap pos pengamanan. Sementara Bupati Labura mengatakan siap berkoordinasi dengan Polres Labuhan Batu untuk pengamanan lebaran. Dia jugamenginstruksikanjajarannya mendukung setiap kegiatan yang positif yang berhubungan dengan pengamanan Idul Fitri. Di kesempatan itu Bupati langsung menginstruksikan Kepala Dinas Kesehatan Siti Roilan mempersiapkan satu unit mobil ambulans di seluruh pos pengamanan yang tersebar di Labura.(a17/c08)

Jembatan Timbang Pinangawan Buat Posko Simpati Arus Mudik KOTAPINANG (Waspada): Dinas Perhubungan Provinsi Sumut/ Jembatan Timbang di Pinangawan Desa Aek Batu membuat Posko Simpati untuk membantu arus mudik angkutan lebaran yang melintas. Posko Simpati disediakan kepada

pengemudi yang ingin beristirahat di Jembatan Timbang Pinangawan agar segar kembali untuk melanjutkan perjalanan. Menurut H. Zungkarnain, Kepala Timbangan Pinangawan Desa Aekbatu Kec. Torgamba, Kab. Labuhanbatu Selatan (La-

Inalum Latih IRT Menjahit Dan Komputer KUALATANJUNG (Waspada): PT.Inalum melatih ibu rumah tangga menjahit dan kursus komputer di Balai Besar Latihan Kerja Industri (BBLKI) Medan. Ke-10 pesertanya dari Desa Kuala Indah, Kuala Tanjung, Lalang, Pakam, Pakam Raya dan Medang. Senior Manager PT.Inalum Ir.H.Subagyo Ibnoe, Sabtu (20/8) dalam siaran persnya menjelaskan, dengan pelatihan ini Inalum berharap keahlian masyarakat sekitar dapat meningkat sehingga dapat berguna untuk bersaing menembus lapangan kerja yang semakin kompetitif. Pelatihan diselenggarakan berdasarkan kebutuhan dan kerjasama dengan kepala desa terkait serta BBLKI sebagai instruktur. Peserta direkomendasikan kepala desa. Selain mendapat sertifikat peserta juga secara otomatis terdaftar di website “Kios 3 in 1” milik BBLKI Medan yang merupakan website bursa pencari kerja.(c05)

WASPADA Kamis 25 Agustus 2011

Waspada/Hasanuddin

TIMBANGAN Pinangawan akan dijadikan Posko Simpati arus mudik.

busel), kepada Waspada Rabu (24/8), Posko Simpati disiapkan sejak Jumat (26/8) s/d tanggal 7 September 2011. “Selama Posko Simpati berlangsung penimbangan terhadap angkutan kenderaan barang ditiadakan,” katanya. Menjawab Waspada, Zungkarnain menyebutkan menyangkut tindakan yang diambil terhadap pelanggaran kenderaan angkutan barang yang melebihi tonase periode Januari s/d Juli 2011, sebanyak 358 kenderaan dan telah diajukan ke Pengadilan Negeri Rantauprapat. Kemudiankenderaanangkutan barang melebihi tonase juga didenda sesuai Perda Provsu 14 Tahun 2007 dan hasil uang denda telah disetorkan sebesar Rp2.990. 700.000 ke Bank Sumut Cabang Kotapinang. Kepala Timbangan mengharapkan para pengemudi mematuhi peraturan lalu lintas dan tidakmembawamuatanmelebihi jumlah berat yang tercantum di STUK karena ini demi keamanan dan keselamatan bersama.(a19)

RANTAUPRAPAT (Waspada): Pemandangan memprihatinkan terlihat di lokasi rehabilitasi dan pembangunan Kantor Kejaksaan Negeri (Kejari) Rantauprapat. Pasalnya, aktivitas pekerjaan yang berlangsung tanpa plank proyek, pertanda dibiayai Negara. Proyek itu di duga‘Siluman’ karena informasi terkait nilai proyek dan perusahaan yang melakukan pekerjaan serta sumber dana berasal dari mana dan kapan batas waktu pengerjaan proyek tersebut, lapan tendernya, tidak di ketahui sama sekali informasinya. Hal itu terungkap saat Waspada Selasa (23/ 8) berbincang dengan beberapa pekerja di lokasi proyek. Salah seorang yang mengaku mandor mengatakan, pekerjaan ini sudah lebih 2 minggu dan mengenai perusahaan yang mengerjakan berasal dari Medan dan tidak mengetahui kenapa tidak dipasang plank proyek. “Baru sekitar 2 minggu kami kerja, kalau masalah tidak di pasang plank proyeknya, saya tidak tau,”katanya polos seraya menambahkan mereka yang bekerja berasal dari Medan juga. Sementara, salah seorang pegawai Kejari yang

di konfirmasi, mengatakan kantor Kejari ini akan dibangun bertingkat dan dibesarkan. “Mau di bangun bertingkat bang, ini juga di besarkan,”katanya meminta namanya jangan di publikasikan. Untukmelihatsejauhapakegiatan perehaban dan pembangunan proyek di kantor Kejaksaan Negeri Rantauprapat yang di kerjakan tanpa plank proyek dan tidak terlihatnya ada nya pengawasan konsultan,BambangSudrajat SHKepalaKejaksaan Negeri Rantauprapat ketika di konfirmasi via SMS belum memberikan jawaban. Dilain pihak Haris NixonTambunan SHWakil Sekretaris Gransi (Gerakan Anti Korupsi) Labuhanbatu sangat menyayangkan adanya kecerobohan rekanan yang tidak memajangkan plank proyek. Ini merupakan preseden buruk bagi institusi kejaksaan. Seharusnya kejaksaan melakukan tindakan dengan cara menegur perusahaan yang melakukan pekerjaan tersebut. Kejaksaan harus membuat teguran adanya pelanggaran terkait proyek tersebut, masa tidak ada plank nya, tegas Haris.(c07)

Waspada/Rasudin Sihotang

INTENSITAS pengiriman barang menggunakan jasa Kereta Api yang masuk ke Kota Tanjungbalai mengalami peningkatan hingga mencapai 100 persen. Sebaliknya, pengiriman keluar masih seperti biasa. Foto direkam Rabu (24/8).

H-4 Jasa KA Stop Pengiriman Barang TANJUNGBALAI (Waspada): Pengiriman barang menggunakan jasa angkutan Kereta Api akan distop (dihentikan) empat hari menjelang hari Raya Idul Fitri (H-4). Demikian dikatakan Kifli dan Nasir, petugas jasa pengiriman barang CV.Tunas Unggul Intipratama di stasiun Kereta Api Tanjungbalai dikonfirmasi Waspada, Rabu (24/8). Untuk itu, diberitahukan kepada masyarakat yang akan melakukan pengiriman sebaiknya dilakukan sebelum waktu tersebut. Diterangkan Kifli, penghentian pengiriman dari KotaTanjungbalai disebabkan gerbong kargo yang seyogyanya membawa barang difungsikan untukmengangkutpenumpangyangakanmudik lebaranatupunsebaliknya.Penghentianmemang setiap tahun dilakukan untuk mengatasi lonjakan penumpang terutama pada arus puncak mudik. Untuk peningkatan volume, Nasir menerangkan dalam waktu beberapa hari terakhir, pengiriman barang mengalami kenaikan yang signifikan mencapai 100 persen. “Barang tersebut meliputi paket kotak, sepeda motor, dokumen dan lain-lain,” tutur Nasir. Kepala Stasiun Kereta Api Tanjungbalai N Sinuraya dikonfirmasi Waspada membenarkan hal itu. Menurutnya, penghentian pengiriman barang akan dimulai pada 25 atau 26 Agustus sebagaimana biasanya. Namun, Sinuraya menegaskan bahwa pihaknya belum menerima telegram dari Kantor Besar di Medan waktu penghentian pengiriman barang. “Sebagaiman pengalaman di tahun sebelumnya, pengiriman barang dihentikan pada H-4,namunhinggaH-6ini,kamibelummenerima telegram dari Kantor Besar Pusat di Medan terkait hal itu,” kata Sinuraya usai memberangkatkan

penumpang pada jadwal siang itu. Mulai Meningkat Sementara, arus penumpang yang tiba di stasiun KA kota kerang itu mulai mengalami peningkatandibandingbeberapaharisebelumnya. Siang itu saja, jumlah penumpang yang berasal dari Medan dan daerah lainnya seperti Lubuk Pakam,Tebingtinggi, Kisaran serta stasiun-stasiun kecil yang dilewati mencapai 600 orang. Sebaliknya,intensitaspenumpangdaristasiun tersebut dengan tujuan Medan belum mengalami kepadatan yang cukup signifikan. Sampai H-6, dari lima gerbong yang berkapasitas 106 tempat duduk, yang terisi hanya satu gerbong. “Sampai saat ini jumlah penumpang masih seratusandankemungkinanakanterusmeningkat hingga menjelang hari Raya Idul Fitri,” tuturnya. Keamanan Pemudik Di sisi lain, satu pos pengamanan didirikan tepat di depan stasiun sebagai tempat pengaduan jika mengalami tindak kejahatan maupun gangguan kesehatan. Di pos tersebut telah ditempatkansejumlahpersonilPolri,TNI,Pamong Praja serta petugas kesehatan guna memberikan kenyamanan dan keamanan para pemudik. Selain di pos, aparat keamanan baik yang berpakaian dinas maupun sipil di posisikan di sejumlahtempatdan diharapkanmampumencegah terjadinya tindak kejahatan seperti penjambretan, penipuan, percaloan, hipnotis dan lainnya. Dimana momen mudik seperti ini, tindak kriminal cenderung mengalami peningkatan. “Hingga saatinibelumadaterjaditindakkriminaldanmudahmudahan tetap terjaga hingga selesai nanti,” ujar seorangPolisibermargaPanjaitandenganpangkat Briptusembarimengawasipenumpangyangbaru tiba maupun akan berangkat.(a32)


Sumatera Utara

WASPADA Kamis 25 Agustus 2011

C3

Proyek PU Samosir 2011 Rp32 M Resmi Batal SAMOSIR (Waspada) : Dinas PU Kab. Samosir berdasarkan suratPltKadisPU24Agustus2011 akan menetapkan Panitia Pengadaan Penyedia Pekerjaan Konstruksi yang baru. Surat pemberitahuan dikeluarkan berdasarkan Surat Bupati Samosir No. 027/5647/ PEMB/VIII/2011 tanggal 23 Agustus 2011, Surat Inspektorat

Waspada/Ali Bey

WARGA bersiap pulang setelah membeli paket dalam pasar murah PTPN IV di RS Laras, Selasa (23/8).

PTPN IV Unit RS Laras Gelar Pasar Murah SERBELAWAN (Waspada): PTPN 4 Unit Rumah Sakit (RS) Kebun Laras menggelar pasar murah BUMN peduli dengan menyediakan1200 paket kepadaWarga Nagori Induk Naga Jaya I dan Naga Soppah, serta Naga Jaya II, Kec. Bandar Huluan, Kab. Simalungun, Selasa (23/8). Pasar murah itu disaksikan Manager Rumah Sakit (RS) Laras Drg. Samsul Anwar Nasution, dan KTU RS – Een, SE bersama staf serta beberapa karyawan dan perangkat Kantor Nagori setempat. 1.200 paket yang ditawarkan itu masing – masing berisi 5 kg beras, 2 kg gula putih, 2 kg minyak goreng, dengan harga per paket Rp54 ribu. Warga yang hadir mengambil paket di lengkapi dengan karcis dari panitia. Setelah itu kegiatan sama juga dilakukan di Kebun Dolok Ilir Laras dan Pabrik Mesin Tenera (PMT) Dolok Ilir, Senin (22/8) siang (c17)

Sepeda Motor Pegawai Dishub Pemko P.Siantar Hilang PEMATANGSIANTAR (Waspada): Sepeda motorYamaha Xeon BK 3287 TAC warna hitam milik pegawai Dishubkominfo Pemko Pematangsiantar LiminTarigan, 50, warga JalanTerong, Kel. Tomuan, Siantar Timur, hilang dicuri maling. Informasi dihimpun dan keterangan Polres Pematangsiantar, Selasa (23/8) menyebutkan, sepeda motor korban hilang dari garasi penyimpanannya di samping rumah, Senin (22/8) dinihari. Korban mengetahui sepeda motornya hilang sesudah dibangunkan isterinya sekitar pukul 03:05. Korban segera mencek sekeliling rumah, namun sepeda motornya tetap tidak ditemukan, leduali hanya menemukan satu celemek warnamerahyangdidugamilikpencuri.Akibatnya,korbanmengalami kerugian Rp 11 juta. Kasubbag Humas AKP Altur Pasaribu, Kasat Reskrim AKP Azharuddin dan Kapolsek Siantar Timur AKP M Sihaloho membenarkan.(a30)

DPC PKB Pakpak Bharat Safari Ramadhan Ke LP SALAK (Waspada): Pengurus Dewan Pimpinan Cabang (DPC) Partai Kebangkitan Bangsa (PKB) Kab. Pakpak Bharat baru-baru ini Safari Ramadhan ke Lembaga Permasyarakatan (LP) Sidikalang. Rombongan terdiri antara lain Ketua DPC PKB Pakpak Bharat Juanda Banurea (anggota DPRD) didampingi Ketua Dewan Syuro Joton Boangmanalu serta Sitorus pengurus kecamatan. Pertemuan dengan 27 penghuni LP itu digelar di Aula Pertemuan. Juanda mengatakan, tujuan mereka untuk menjalin tali silaturahmi sesama umat manusia terlepas dari apa yang telah dilakukan oleh para narapidana sebelumnya. Pertemuan ini merupakan yang ketiga kalinya dan telah dilaksanakan tiap tahun saat menjelang Lebaran dan Hari Natal. Sementara,SyahdinBerutumewakilinarapidanamengungkapkan, kedatangan Juanda Banurea beserta rombongan tidak terlupakan. Selaku anggota DPRD Pakpak Bharat tidak melupakan masyarakatnya.(a37)

Lahan Proyek Belum Ada, Pemenang Tender Diumumkan SALAK (Waspada): Lahan proyek pembangunan gedung Puskesmas Salak, Kec. Salak, Kab. Pakpak Bharat 2011 Rp383 juta lebih dari DAK (Dana Alokasi Khusus) belum ada, namun Unit Layanan Pengadaan (ULP) Barang dan Jasa telah mengumumkan pemenang tender. Proyek tersebut hingga kini belum dikerjakan karena belum ada kesepakatan pemilik lahan dan Pemkab dalam hal ini Tapem (Tata Pemerintahan). Kadis Kesehatan Pemkab Pakpak Bharat dr Tomas saat ditemui Waspada mengatakan, pekerjaan proyek pembangunan gedung PuskesmasSalaksejalandenganpembebasanlahan.Bilanantilahannya juga belum ada, proyek itu akan dibatalkan atau silpakan. Dalam hal ini, Dinkes belum berani mengeluarkan SPMK (Surat Perintah Mulai Kerja) kepada rekanan. Namun, surat perjanjian atau kesepakatan pemilik lahan dan Pemkab sudah ada dan menunggu langkah selanjutnya, kataTomas. Sedangkan Syahnan Sembiring yang menangani pertanahan pada Tapem Pemkab menyebutkan, luas areal 4141 m2 dan akan membayarnya dalam waktu dekat. JuandaBanureaanggotaDPRDPakpakBharatmenilai,seyogianya pemerintah terlebih dulu menyediakan lahan, baru membuat kegiatan.(a37)

Wakil Bupati Apresiasi Polres Tapteng SIBOLGA (Waspada):Wakil Bupati Tapteng H. Syukran Jamilan Tanjung,SE mengapresiasi Kapolres Tapteng menyatukan unsur Muspida Plus Sibolga dan Tapteng melalui buka bersama dan ini merupakan yang pertama kalinya digelar. Demikian dikatakan Syukran saat buka puasa bersama di asrama Polres, Minggu (21/8) yang juga dihadiriWali Kota Sibolga Drs. HM Syarfi Hutauruk, Kapolresta Sibolga AKBP Joas Veriko Panjaitan sertaunsurSKPD,pemuksmasyarakat,pemukaagama,tokohpemuda di kedua daerah serta lainnya. Syukran menyambut baik yang digelar dengan Pemko Sibolga dan PemkabTapteng difasilitasi KapolresTapteng untuk mewujudkan rasa kebersamaan sekaligus silaturahmi. Syukranjugamenyampaikanpermintaanmaafatasketidakhadiran BupatiTapteng disebabkan ada kegiatan lain yang secara bersamaan. Sementara, Kapolres Tapteng AKBP Dicky Patrianegara mengatakan, kegiatan ini bertujuan sebagai rasa kebersamaan dalam membangun komunikasi aktif sekaligus meningkatkan rasa solidaritas dalam bersilaturahmi. Kapolres juga mengatakan, mudah-mudahan tahun depan acara serupa dapat digelar di wilayah hukum Polres Tapteng, walaupun sekarang asrama polisi Polres Tapteng di Kota Sibolga, namun hal itu tidak masalah dan itulah indahnya rasa kebersamaan itu. DickyjugamenyayangkanseluruhSKPDPemkabTaptengdiundang namun tidak hadir, kemungkinan mereka (baca lupa karena pemerintahan sudah ganti dengan pemimpim yang baru, sindir Dicky. Sementara, Ustadz Ngadiman KS dalam tausiyahnya mengemukakan, hikmah bulan suci Ramadhan bagi umat Muslim yang beriman yang ditandai turunnya Alquran sebagai pegangan hidup dan mengamalkannya dalam kehidupan sehari-hari.(a24)

Kab. Samosir Nomor 700/149/ It.Kab/TL/VIII/2011 tanggal 19 Agustus 2011. DinasPUakanmenenderkan kembali ke 46 paket dalam waktu dekat setelah para panitia termasuk ketua panitia, diganti. Sebelumnya, Polres Samosir menangkap 6 oknum Panitia Lelang 46 Paket DPU Samosir di rumah salah seorang panitia lelang,

Juli 2011. Penangkapan menjelang pengumuman pemenang lelang atas 46 Paket senilai Rp 32 miliar. Saat penggerebekan Polres Samosir mengamankan barang buktikopsuratperusahaan,stempel dan uang dari rumah tersebut. Hingga berita ini dikirim, status ke enam oknum panitia yang ditangkap tersebut belum diketahui. (c11)

Di P. Siantar Jamkesmas Dan Jamkesda Tidak Efisien PEMATANGSIANTAR (Waspada): Program Jamkesmas dan Jamkesda tidak efisien di Kota Pematangsiantar, karena banyak pasien miskin yang menjadi pesertanya tidak bisa ditangani di RSUD Dr Djasamen Saragih. Para pasien itu sering dirujuk ke rumah sakit di Kota Medan dan tidak langsung mendapat pelayanan sehingga mengakibatkan pasien meninggal dunia. Demikian sorotan Fraksi Kebangsaan (FK) DPRD Kota Pematangsiantar dalam pemandangan umum terhadap nota pengantar Ranperda RPJMD 2010-2015 Pematangsiantar dalam rapat paripurna, Selasa (23/8). Sebelumnya, nota pengantar Ranperda RPJMD itu dibacakan Wali Kota, Senin (22/8). Rapat paripurna dipimpin Ketua DPRD Marulitua Hutapea, SE didampingiWakil Ketua Zainal Purba dan Timbul M Lingga, SH serta dibantu Sekretaris DPRD Mahadin Sitanggang, SH dihadiri Wali Kota Hulman Sitorus, SE, Wakil Wali Kota Drs Koni Ismail Siregar, Sekda Drs Donver Panggabean,MSi,parastafahli,asisten, kepala dinas, badan, kantor, bagian, camat dan lainnya.

Selain itu, FK melalui juru bicaranya EB Manurung, SH meminta agar dikaji ulang para Kepala SKPD Pemko karena sudah banyak kurang mendukung kebijakan Wali Kota. “Indikasinya, banyak Kepala SKPD yang tidak menghadiri undangan DPRD terkait rapat kerja dan dengar pendapat. Hal itu secara tidak langsung mengkondisikan keadaan ketidakharmonisan antara eksekutif dengan legislatif yang muaranya ketidakharmonisan antara Wali Kota dan DPRD,”katanya. FK juga meminta agar menata ulang perkantoran seluruh SKPD dan dijadikan satu atap hingga tidak jauh dari kantor Walikota. “Hal ini untuk mempermudahpelayanandankoordinasi antar dinas. Begitu pula tata ulang perkantoran DPRD, dimana sesuai perundang-undangan DPRD setara eselon II. Namun, kenyataannya setara honorer dalam hal fasilitas perkantoran, karena sampai sekarang tidak ada kursi dan meja kerja. Lalu,dengantidakdibukanya SMAN 6 membuktikan Pemko lamban memajukan pendidikan di Pematangsiantar dan nota

pengantar Wali Kota tentang RPJMD dinilai bersifat normatif danbiasa-biasasaja,kurangsesuai dengan visi dan misi Wali Kota. Sedangkan Fraksi Karya PeduliNurani(FKPN)melaluijuru bicaranya Dr Maruahal Sinaga, SpOGmenyatakan,sesuaivisidan misi 2010-2015 hingga saat ini, semua SKPD belum optimal melaksanakan tugas pokok dan fungsi serta bertanggungjawab. “Wali Kota agar mereformasi birokrasi dan sekaligus mengevaluasi kinerja masing-masing SKPDsehinggakebijakanstrategis pemerintah tercapai,”ujarnya. FKPN juga menuding Pemko tidak pernah berkoordinasi dengan DPRD yang melibatkan masyarakat sesuai PP nomor 16 tahun 2010 dan yang dituangkan dalam peraturan Tatib DPRD. Dimana harus ada persetujuan DPRD agar strategis dan arah pembangunan daerah yang populis hingga tidak menimbulkan keresahan masyarakat. Usai ke-lima fraksi membacakan pemandangan umum masing-masing, Ketua DPRD menyatakan rapat diskors dan akan dibuka kembali, Sabtu (27/ 8) guna mendengar nota jawaban Wali Kota.(a30)

Lilli Hamda Mendrofa Raih Toyota Avanza Undian Martabe SIBOLGA (Waspada) : Dirut PT Bank Sumut Gus Irawan Pasaribu menyerahkan hadiah utamaundianTabunganMartabe periode I/2011 satu unit mobil ToyotaAvanzakepadaLilliHamda Mendrofa,nasabahKantorCabang Pembantu (Kancapem) Pandan. Penyerahan itu juga disaksikanWali Kota Sibolga HM Syarfi Hutauruk, PBI Sibolga Muhamad Nur, Pinca Bank Sumut Sibolga Burhanuddin Siregar dan Ketua DPRD Sibolga Syahlul Umur Situmeang Kegiatan dirangkai penyerahan santunan asuransi jiwa Sipanda serta penyerahan zakat produktif dan konsumtif kepada ratusan fakir miskin dan gharim, Selasa (23/8) di Kantor Cabang Bank Sumut Sibolga. Dilanjutkan,penyerahansatu unitsepedamotorHondaScoopy kepada Sabar Jualiana Panggabean dan pemenang hadiah televisi LCD merk LG 32 Inchi kepada Sukiarto, Sarah Purnama Silalahi, KammalSimamora,Naja Tambunan, Tarmizi, Jumriati Panggabean dan BPNPM MPTA 2010. Pada kesempatan yang sama juga diserahkan, klaim Asuransi Jiwa Sipanda total senilai Rp86 juta, kepada 13 ahli waris nasabah yang meninggal dunia. Di antaranya, almh Nursita Simanullang Rp25 juta, alm Achmadi Rp10 juta, alm Syahrul Tanjung Rp10 juta, Dolares Pesta Reska Siregar Rp10 juta, Muhammad Irawadi Rp5 juta, Syahrul Gultom Rp5

juta, NursaimaSitompulRp5juta, Rasyida Pasaribu Rp5 juta, Appan Sihotang Rp5 juta, Syaifuddin PohanRp2,5juta,RosariaTimuria Ningsih Rp2,5 juta, Paido Tua Siregar Rp500 ribu dan Tetty Rp500 ribu. Gus Irawan Pasaribu mengungkapkan, seluruh nasabah penabung Martabe, Simpeda maupun tabungan Haji Makbul di Bank Sumut, secara otomatis telah resmi terdaftar menjadi peserta Asuransi Jiwa Sipanda. “Kepesertaan asuransi jiwa Sipandasetiappenabungtersebut secara otomatis tanpa harus membayar premi asuransi, sebab pembayaran premi ditanggung Bank Sumut sehingga mencapai Rp 29 miliar setiap tahun. Setiap nasabahpenabungyangmeninggal dunia, pembayaran klaim asuransinya akan diberikan langsung kepada ahli warisnya,” kata Gus Irawan. Menurutnya, kepesertaan nasabah di asuransi jiwa Sipanda tersebut ternyata tidak serta merta mengurangi keuntungan ataulabayangdiraihBankSumut. TerbuktidaripenghimpunanDana Pihak Ketiga (DPK) yang diraih Bank Sumut cenderung mengalami peningkatan dari tahun ke tahun. Menurutnya, semakin banyak dana masyarakat yang dihimpun, akan semakin banyak pula jasa yang diperoleh Bank Sumut, dan pada gilirannya nanti akan disumbangkan kembali kepadapemerintahmelaluipem-

berian deviden setiap tahunnya. Ia juga mengungkapkan, dari sekian kali penyerahan klaim asuransi jiwa Sipanda tersebut, banyak ahli waris nasabah yang merasa kaget dan terharu karena tiba-tiba saja diberikan klaim asuransi oleh Bank Sumut. “Makaitu,proteksibagisetiap nasabah berupa kepersertaan asuransi jiwa ini akan kami lanjutkan, karena sangat bermanfaat bagi masyarakat,” tuturnya. Selain itu, lanjut Gus Irawan, Bank Sumut concern menyalurkan zakat produktif dan zakat konsumtif yang di gulirkan sejak 2007. Dana zakat ini dihimpun oleh Lembaga Amil Zakat (LAZ) Bank Sumut dari karyawan Bank Sumutyangdisetorataudipotong dari gaji setiap bulan. “Bank Sumut cabang Sibolga menyerahkan zakat konsumtif kepada 140 fakir miskin masingmasingRp150ribudan25Gharim Masjid masing-masing Rp300 ribu. Kemudian zakat produktif masing-masing Rp500 ribu diberikan kepada 25 orang,” ungkap Gus Irawan. Walikota Sibolga HM Syarfi Hutauruk juga gembira atas kepedulian Bank Sumut kepada masyaraka terutama kepada para penggiat ekonomi mikro. “ Walikota juga menegaskan, mulai tahun ini pihaknya mewajibkansetiapPNSdiPemkoSibolga berzakat melalui pemotongan gajisetiapbulannyadanlangsung disetorkeBadanAmilZakat(BAZ) Sibolga,.(a23)

Waspada/Edoard Sinaga

PENYEMATAN tanda peserta latihan taktis Tim Intelijen Korem 022/PT oleh Danrem 022/PT Kolonel Inf Karsiyanto di Makorem 022/PT, Senin (22/8).

Latihan Taktis Intelijen Korem 022/PT PEMATANGSIANTAR (Waspada): Prajurit intelijen diharapkan mampu mengembangkan diri menjadi profesional menghadapi tugas semakin berat dan kompleks serta dihadapkan pada situasi dinamis. “Penyelenggaraan latihan taktis intelijen memiliki nilai positif, mengingat berbagai kemungkinan kontijensi yang timbul sewaktu-waktu di wilayah Korem 022/PT,” tegas Danrem 022/PT Kolonel Inf Karsiyanto saat upacara bendera sekaligus pembukaan latihan taktis intelijen Tim Intel Korem 022/PT di lapangan upacara Makorem 022/PT, Senin (22/8). Kompleksitas tugas, terang Danrem, tidak terlepas dari kemajuan teknologi informasi di tengah era transparansi, karena apa yang terjadi di suatu tempat akan dengan mudah dan cepat dapat diakses dan diketahui, termasuk tantangan berupa ancaman dari potensi gejolak sosial yang tinggi menuntut kerja keras, kesiap-siagaan dan kewaspadaan yang tinggi. Sementara, Kasi Intel Korem 022/PT Mayor Inf Nazri Ikhwan didampingi Kasi Ops Korem 022/PT Letkol Inf EH Limbong,

SSos mengharapkan latihan itu membawa manfaat yang positif, baik terhadap satuan maupun perorangan dan jangan jadikan keterbatasan sebagai hambatan dan rintangan untuk mencapai keberhasilan penyelenggaraan latihan. Mengenai materi latihan yang dilakukan di lapangan, sebut Kasi Intel, antara lain penjejakan, mengamati dan menggambar serta wawancara,. Pelaksanaan latihan untuk hari pertama di simpang Taman Makam Pahlawan, Siantar Square, Gedung Juang 45, Ramayana, Kantor PP arah stasiun kereta api dan Mess Pantai Timur sebagai titik akhir kegiatan. Sedangkan Kapenrem 022/PT Mayor Caj Drs Prinaldi menyebutkan. latihan taktis intelijen Tim Intel Korem 022/PT dilaksanakan tiga hari. “Latihan taktis itu merupakan kelanjutan dari latihan teknis yang sudah pernah dilaksanakan Korem 022/PT beberapa bulan lalu.” Hadir dalam kegiatan itu antara lain Kasrem 022/PT PT Letkol Arm Anton Irianto Popang, SH, para Kadisjan, para Kasi Korem 022/PT, perwira, bintara, tamtama dan PNS Makorem 022/PT.(a30)

Pelajar Tewas Korban Tubruk Lari PEMATANGSIANTAR (Waspada): Niko Saputra Batubara, 17, pelajar, warga Huta Dalam, Nagori Rambung Merah, Kec. Siantar, Kab. Simalungun tewas korban tubruk lari. Korban, saat itu menumpang sepeda motor yang dikendarai rekannya Andika Suhendra, 17, wiraswasta, warga sama dengan korban. Informasi dihimpun dan keterangan Polres Pematangsiantar, Selasa (23/8) menyebutkan, semula pengendara sepedamotor BK 6977 TX menubruk truk berhenti di jalan umum di Kelurahan Sumber Jaya, Kec. Siantar Martoba, Pematangsiantar, Senin (22/8) pukul 05:00. Tubrukan terjadi ketika sepeda motor yang dikemudikan Andika Suhendra menubruk sudut kanan belakang truk parkir

di pinggir jalan. Akibatnya, sepeda motor terjatuh ke badan jalan. Pada saat bersamaan, truk lain yang datang dari arah pusat kota melaju dengan kecepatan tinggi langsung menubruk tubuh korban yang tergeletak di badan jalan. Warga segera member pertolongan dan membawanya ke RSUD Dr Djasamen Saragih untuk mendapat perawatan. Sedangkan truk yang menubruk korban langsung melarikan diri. Begitu pula truk yang ditubruk langsung dilarikan sopirnnya. Korban mendapat perawatan, ternyata tidak bertahan lama dan akhirnya meninggal. Kasubbag Humas AKP Altur Pasaribu dan Kasat Lantas AKP Hendrik Situmorang, MM mengimbau agar sopir truk yang menubruk korban segera menyerahkan diri.(a30).

Hotel Di Berastagi Siapkan Kegiatan Khusus Idul Fitri BERASTAGI (Waspada): Guna menyemarakan Lebaran Idul Fitri 1432 Hijriah, Mikie Holiday Resort telah menyiapkan berbagai mata acara untuk memanjakan wisatawan yang berlibur di kawasan Berastagi. Hal ini diungkapSimon Barus selaku Manajemen Mikie Holiday Resort dan Funland kepada Waspada, Selasa(23/8) di Berastagi. Kegiatan itu, acara Theme Dinner 3 hari berturut turut di Azalea Restaurant – Mikie Holiday tanggal 30 hingga 31 Agustus dan 1 September 201. Disamping itu juga memberikan aneka makanan Sunda, Jawa, Padang serta hidangan lain dan sensasi hot & spicy dari makanan Nusantara di suasana Berastagi yang dingin nyaman dan asri. Di samping itu beberapa tema pasar malam bernuansa pedesaan dengan konsep jajanan pasar, gerobak bakso, sate, serta hidangan mewah andalan bihun bebek,

Hainan chicken rice dan beragam jenis makanan bersama pelayanan hotel bintang lima. Mikie holiday resort dan Funland juga menyajikan musik, kostum dan pakaian daerah. Simon juga mengatakan dari 27 Agustus 2011 sampai 11 September 2011 disajikan beberapa atraksi unggulan. Antara lain, Buzz Coaster, Dino Tracker, Koomba Dance , Shark Attack, Splash, T Rex, Flying Fish, dan masih banyak lagi wahana menantang dengan variasi lebih dari 30 macam dapat dimainkan hanya dengan membeli satu tiket berlaku untuk semua wahana selama sehari. Anda juga akan menemukan Dino Egg menikmati sensasi di dalam telur Dino sambil melayang dan berputar di udara. Kemudian, Sea Monster yang juga segera hadir di Funland. Lalu, Hill Gazebo di ketinggian 1500 meter untuk melihat pemandangan Kota Berastagi.(a36/c10)

Sidang lanjutan penganiayaan wartawan:

Saksi Mendengar Teriak Kesakitan Dari Ruang Tahanan P.SIANTAR (Waspada): Pengadilan Negeri (PN) Pematangsiantar kembali melanjutkan persidangan perkara penganiayaan wartawan olehmantanKapolresAKBPFa,Rabu(24/8)denganagendaketerangan saki. Saksi, MJ.Manurung, 39, kepada majelis hakim mengatakan, mendengar suara teriakan kesakitan dari ruang tahanan, setelah terdakwa AKBP Fa yang ketika itu Kapolresta Pematangsiantar, memasuki ruang tahanan. “Saya tidak melihat, tetapi saya mendengar teriakan dari ruang tahanan,” ungkap saksi yang juga anggota Polresta Pematangsiantar. Kejadian itu menurutnya sekitar pukul 16:00 pada 30 November 2010. Ketika itu dia sedang tugas piket dan menyaksikan Fa, turun dari lantai dua. Selaku anggota, dia bersikap dalam posisi siap sambil menyaksikan Fa melangkah menuju ke ruang belakang yang diyakininya adalah ke ruang tahanan. Beberapa saat kemudian mendengar ada suara teriakan dan saksimengakulangsungbergerakmenujukeruangtahanan.Selanjutnya dia melihat,ada tahanan yang kemudian dia ketahui adalah Andi Irianto Siahaan (wartawan) dalam keadaan tertunduk sambil memegang bagian perutnya di ruang tahanan yang dijadikan tempat olah raga Saksi melihat terdakwa Fa dengan menggunakan sarung tinju warna merah di salah satu tangannya sedang menghadapi Andi. Dan ketika terdakwa ingin memukul lagi sambil berkata,”disini ada aturan”, saksi berusaha menghalanginya dengan berucap,”cukup, Pak.” Kepada majelis hakim yang diketuai hakim Pastra J.Ziraluo, SH,saksi Manurung mengatakan tidak mengetahui langsung pemukulan dan dia juga mengaku tidak melihat ada luka pada tubuh Andi, walau dia sempat mencoba menuntun korban untuk berdiri. Saksi mengetahui, setelah terdakwa Fa meninggalkanTKP (tempat kejadian perkara), Andi mendapat perawatan seorang perawat

dan dokter marga Saragih yang bertugas di Polresta itu. Ditegur hakim Dalam persidangan lanjutan hari itu, saksi lainnya yang dihadirkan untuk didengar keterangannya adalah RS.Br.Simbolon, 47, PNS yang bertugas di bagian tahanan Polresta Pematangsiantar. Saksi kepada majelis hakim mengaku melihat langsung terdakwa Fa dan dia mengatakan, Fa hanya mendorong tubuh bagian perut, jadi bukan meninju bagian perut ketika peristiwa di ruang olah raga tahanan 30 November 2010 sekitar pukul 16:00 itu. “Setelah didorong Andi jatuh dan lemas dan dalam keadaan kesakitan berusaha menyembah Fa,’’kata boru Simbolon sambil memperagakan gaya Andi menyembah Fa,menyatukan ke dua tangan di depan keningnya ke arah Fa. Kalimat mendorong yang disebutkan saksi, oleh terdakwa Fa dibantah, dan diakui,kalau itu bukan didorong tetapi adalah pukulan ala tinju yang disebut,pukulan ‘jab’. Saksijugamengatakan,beberapaharisebelumkejadianpemukulan oleh terdakwa Fa, maka Andi ketika main-main tinju di ruang olah raga ada mengatakan,”ini muka Fatori”.Kalimat itu diarahkan ke karung berisi pasir yang digantung, dan karung itu dipukul Andi. Dan saksi mengaku menegur Andi dengan mengatakan,” kalau ngomong yang sopan”. Selain itu saksi menguraikan, dia sempat melaporkan ketidak patuhan Andi selaku tahanan yang tidak mau dipindahkan ke sel lain. Dan disebutkan, tindakan pemukulan yang dilakukan terdakwa Fa dan dilaporkan saksi pelapor Andi, berkaitan dengan masalah penolakan pemindahan sel tahanan. Ketika JPU R.Nainggolan, SH, bertanya kepada saksi, mengapa harus Andi yang dipindahkan, saksi mengatakan, tidak tahu. Dan ketika ditanya, mengapa Andi yang dipukul,saksi menjawab, karena Andi tidak mau pindah. Hakim ketua sempat menegur beberapa kali saksi RS.Boru

Simbolon yang dianggap dalam menjawab pertanyaan selalu tampak ragu-ragu dan suaranya terlalu pelan sehingga nyaris tidak terdengar. Hakim ketua juga sempat menanyakan kepada saksi, apakah dalam memberikan keterangan ada tekanan, terutama dari terdakwa yang juga adalah mantan pimpinannya di Polresta Pematangsiantar. Jika merasa tertekan dengan keberadaan terdakwa Fa yang duduk tepat di depan sebelah kanan saksi, di samping penasehat hukumnya, hakimdapatmemintaterdakwauntukkeluardariruanganitu.Namun, saksi mengatakan, tidak. Sidang dilanjut 7 September 2011 dengan menghadirkan lima saksi lain yang terdiri dari tiga anggota Polisi dan dua tahanan.(c16)

Waspada/Mulia Siregar

SAKSI MJ. Manurung memperagakan gaya terdakwa Fa, di depan majelis hakim dalam lanjutan sidang kasus penganiayaan wartawan, di PN.Pematangsiantar, Rabu (24/8).


Sumatera Utara

C4

WASPADA Kamis 25 Agustus 2011

Isi Mosi Tak Percaya 15 Anggota Dewan, Fitnah P. SIDIMPUAN (Waspada): Ketua DPRD Kota Padangsidimpuan, Aswar Syamsi SE, akhirnya bicara mengenai mosi tak percaya yang diajukan 15 anggota dewan terhadapnya. “Isi mosi tidak percaya itu fitnah,” katanya di kantor DPC Partai Demokrat, Jalan Kenanga, Kelurahan Ujung Padang, Kota Padangsidimpuan, Senin (22/8) malam. Hadir Ketua DPC Partai Demokrat Kota Padangsidimpuan H.KhoiruddinNasution,SE,Wakil Ketua IYul Asmara Pane, SE, Sekretaris Eksekutif Abdul Aziz, SH, danBendahara,SamuelNasution.

Aswar membenarkansetelah 15 anggota DPRD mengajukan mositidakpercayaataskepemimpinannya, Jumat (19/8), dia merasasangatshock.Sehingga,untuk sementara terpaksa memutus komunikasi dengan wartawan. Pasalnya, dalam kondisi yang tidak stabil dia takut salah menjawab pertanyaan wartawan. “Sebeluminimemangsayasudah dengar informasi akan ada mosi tidak percaya. Tapi yang saya tidak sangka, mosi itu mereka sampaikan saat sidang paripurna pertanggungjawaban penggunaan APBD 2010,” katanya. Syamsi menganggap sikap anggota dewan tersebut melanggar etika berdemokrasi di DPRD. Meski demikian, Ketua DPRD Padangsidimpuan ini menegaskan tidak menaruh dendam. Menu-

rutnya, mosi tidak percaya ini berawal dari pembahasan nota perhitungan penggunaan APBD 2010 di DPRD. Saat itu Ketua Fraksi Gabungan Karya Bersatu, Erwin Nasution, SH memprotes proyek pembangunan bronjong di belakang Pos Polisi di Simirik. Erwin yang juga Ketua Partai Amanat Nasional (PAN) Kota Padangsidimpuan mengaku merasa dirugikan akibat proyek itu. Dimana bronjong mempersempit aliran sungai dan membuat tanah di sekitar lokasi mengalami abrasi. “Saya sudah coba menjembatani saudara Erwin dengan pihakeksekutifdalamhaliniPemko Padangsidimpuan. Tapi karena tidak ada titik temu saya terpaksa diam saja,” katanya. Akibat proyek yang diperma-

salahkan Erwin itu, paripurna sempat ditunda beberapa hari. Bahkanadarencanaakandilakukanvoting,apakahmasalahituakan dibahas lagi atau diabaikan saja. “Anehnya saudara Erwin menyebarkan informasi bahwa saya mengirim SMS kepada Sekretaris Daerah (Sekda) Sarmadhan Hasibuan, yang menyebutkan agar Pemko tenang-tenang saja sebentar lagi dilakukan voting.Kalauvotingdilakukan,Pemko akan menang,” tutur Syamsi. Selaku pimpinan dewan, tegasnya, dia malah tidak menyetujuivoting.Jugatidakpernah mengirim SMS kepada Sekda Kota, dan setelah diselidiki justru anggota DPRD Mahmuddin NasutionlahyangmengirimSMS itu.“Berartisayadifitnah,”ujarnya. Terkait isi mosi tidak percaya

Wartawan Demo Larangan Liputan Di Lapas IIA Sibolga Anggota DPRD Minta Kanwil Hukum HAM SU Evaluasi Kalapas TUKKA, TAPTENG (Waspada) : wartawan dari berbagai media massa, baik cetak maupun elektronik Kota Sibolga dan Kab. Tapteng unjuk rasa ke Lembaga Pemasyarakatan (Lapas) Kelas IIA Sibolga, Selasa (23/8). Mereka menuntut Kalapas meminta maaf atas tindak kekerasandanlaranganterhadapwartawan saat meliput pemberian remisi kepada narapidana 17 Agustus 2011. Selainberorasi,wartawanjuga membawa sejumlah spanduk. Isinya mengecam keras tindakan petugasLapasSibolgayangmengangkangi Undang-undang pers nomor 40 tahun 1999 dan Keterbukaan Informasi Publik (KIP). Aksi ini merupakan buntut pelarangan wartawan pada upacara pemberian remisi kepada narapidana sebagai rangkaian HUT Ke-66 Kemerdekaan RI yang memicu terjadinya ‘perang mulut’ antara wartawan dengan petugas Lapas serta nyaris terjadi baku hantam, Rabu (17/8) lalu. Sharen Situmorang dalam aksinya mengecam tindakan arogansi petugas Lapas Sibolga yang melarang wartawan meliput aca-

ra pemberian remisi kepada napi. Bahkan Ia meminta Thomas Barajanan selaku Lapas Sibolga mundurdarijabatannyajikatidak mengerti tentang Undangundangnomor40tahun1999yang menjamin kebebasan pers. “Kalapas Sibolga yang dimengerti tentang UU nomor 40 tahun 1999 tentang kebebasan pers mundur saja dari jabatan. Karena saya selaku salah satu wartawan yang dilarang masuk dengan cara kekerasan, padahal datang meliput bersama rombongan bupati,’’ Sharen Situmorang. Namun, lanjutnya, karena saya memakai baju berlogo media saya lantas dicegat dan diusir, padahal ada wartawan yang tidak lengkap dengan identitas dibiarkan masuk dan saya sempat meminta petugas untuk mengeluarkan wartawan yang sudah terlanjur masuk sesuai pelarangan dari Dirjen Pemasyarakatan kalau memang Lapas mau menjalan surat edaran tersebut. Wartawan media cetak dan media elektronik yang bertugas di Sibolga dan Tapteng juga berkomitmenakanmembukasemua

kebobrokan yang selama ini terjadi di Lapas Sibolga seperti pungutan liar yang masih terus terjadi. Petugas Lapas Sibolga W SinulinggamewakiliKepalaLapas Kelas IIA Sibolga yang katanya sedang di Kota Medan hanya menjawab dengan permohonan maaf. Namun, perlu kami sampaikan, mengapa pada 17 Agustus 2011 ada pembatasan untuk wartawan dalam meliput, karena ada surat edaran Dirjen Pema-

syarakatan, katanya. Disebutkan W Sinulingga surat edaran Dirjen Pemasyarakatan menyatakan, setiap narapidana atau tahanan tidak diperkenankan diwawancara. Sementara, anggota DPRD Sibolga Jamil Zeb Tumory yang hadir saat wartawan unjuk rasa menyesalkan tindakan petugas Lapas Sibolga yang tidak konsisten dengan peraturan larangan peliputan sesuai surat edaran Dirjen Pemasyarakatan. (a23)

atas dirinya, Syamsi menyebut semua fitnah. Karena selama 2 tahunmemimpinDPRDdiamerasatelahbersikapadildanbijaksana. Tanggapi Setelah melakukan langkah penyelidikan secara internal, DPC Partai Demokrat akhirnya menanggapi surat mosi tidak percaya yang diajukan 15 anggota dewan terhadap kadernya yang kini menjabat Ketua DPRD Padangsidimpuan, H. Awar Syamsi, SE. Tanggapan tertulis berisi tiga poin penting itu dibacakan Ketua DPC Partai Demokrat Kota Padangsidimpuan,H.Khoiruddin Nasution, SE, pada konfrensi pers Senin (22/8) malam. Pertama, DPC Partai Demokrat Kota Padangsidimpuan telah menerima dan menganalisa surat tembusan mosi tidak percaya tersebut. Setelah dilakukan identitifikasi, disimpulkan hal-hal yang tertuang dalam surat tersebut semua terkait mekanisme kerja dan tugas pokok legislatif. Kedua, terkait Aswar Syamsi selaku Ketua DPRD Padangsidimpuan yang kader Partai Demokrat, yang bersangkutan telah dipanggildandimintaiketerangan secara resmi di internal partai. Terakhir, DPC Partai Demokrat berharap kepada semua anggota DPRD Kota Padangsidimpuantetapmelihatkepentingan pembangunan dan daerah sebagai skala prioritas dalam melaksanakan tugas-tugas pokonya.(a27)

Waspada/doc

CALON Mahasiswa baru STAIN Padangsidimpuan melihat pengumuan hasil kelulusan mereka, Jumat (19/8).

STAIN P. Sidimpuan Terima 917 Mahasiswa Baru P.SIDIMPUAN (Waspada): Sekolah Tinggi Agama Islam Negeri (STAIN) Padangsidimpuan pada Tahun Akademik 2011-2012 menerima 917 calon mahasiswa baru untuk enam program studi (Prodi) “Dari 1332 peserta ujian seleksi, hanya 917 yang dinyatakan lulus,” kata Ketua STAIN Padangsidimpuan, DR H Ibrahim Siregar MCL, didampingi Ketua dan Sekretaris Panitia Seleksi Mahasiswa Baru, Drs H Irwan Saleh Dalimunthe MA, dan DR H Sumper Mulia Harahap, MAg, Selasa (23/8). Ketua STAIN yang turut didampingi para penentu kelulusan, Fatahuddin Aziz Siregar MAg, Aswadi Lubis Msi, dan Muzakkir Khotib Siregar MA,lebihlanjutmenambahkan,hasilseleksitersebut telah diumumkan secara resmi, Jumat (19/8). Dijelaskannya, penjaringan calon mahasiswa baru tahun ini telah dilakukan melalui beberapa tahapan. Dari mulai tahapan pemberkasan, ujian

tulis, dan tes wawancara. Hal ini terlihat jelas dari kesiapan sumber daya manusia maupun sarana prasarana pendukungnya. Untuk itu segenap civitas akademika STAIN Padangsidimpuan agar berdoa supaya apa yang dicita-citakan terwujud. Sedangkan Ketua Panitia Seleksi Mahasiswa Baru/ Pembantu Ketua STAIN Padangsidimpuan Bidang Pendidikan dan Pengajaran, Drs H Irwan Saleh Dalimunthe MA, menambahkan 917 mahasiswa baru ini tersebar di 6 program pendidikan. Yakni, Program Pendidikan Agama Islam (PAI), Tadris Matematika (TMM), Tadris Bahasa Inggris (TBI), Komunikasi Penyiaran Islam (KPI), Ahwal Syakhsiyah (AS) dan Perbankan Syariah (PS). Sebelumnya Sekretaris Panitia, Dr H Sumper Mulia Harahap MAg, menyebutkan penentuan kelulusan calon nahasiswa baru ini telah dijamin kerahasiaan, kejujuran dan keadilannya.(a27)

Jangan Resah Bila Listrik Padam P. SIDIMPUAN (Waspada): Bagi pelanggan PT PLN Cabang Padangsidimpuan jangan resah bila listrik padam atau ada masalah kerusakan, tetapi segera laporkan pada petugas. Demikian Manager PT PLN Cabang Padangsidimpuan melalui Humas Asmar Luthfi Lubis kepada Waspada di kantornya, Sabtu (20/8) siang. Luthfi menjelaskan, untuk pelanggan PT PLN Cabang Padangsidimpuan mulai Agustus 2011 telah dapat melayani keluhan pelanggan dengan menghubungi nomor gangguan di beberapa Rayon dan Ranting masing-masing di Tapanuli Bagian Selatan (Tabagsel). Seperti di Rayon Padangsidimpuan kota meliputi wilayah Kota Padangsidimpuan, Pintu Padang,Batangtoru, Sitinjak dapat menghubunginomorgangguan0634-23105,kemudianRantingKotanopan nomor gangguan 0636-41247, untuk Ranting Panyabungan di telpon 0636-20139. (c13)

Idul Fitri, Polres Tapteng Kerahkan 400 Personil Gabungan PANDANTAPTENG(Waspada): Menyambut Hari Raya Idul Fitri 1 Syawal 1432 H, Polres TapanuliTengah mengerahkan 400 personil terdiri dari Polres, Brimob, TNI AD, Dinas Perhubungan, Satpol PP dan Kwarcab GerakanPramukadalam Operasi Ketupat Toba 2011. Hal itu dungkapkan Kapolres TapanuliTengah AKBP Dicky Patrianegara SH Sik MSi seusai gelar pasukan Operasi Ketupat Toba 2011 di Lapangan Bola Kaki Pandan, Senin (22/8). Dicky menyebutkan, dalam Operasi KetupatToba 2011, Polres menetapkan2titikpelayanandan pos keamanan, masing-masing di Jalan Padangsidempuan km 13 Kec. Pandan dan Jalan Sibolga

- Tarutung km 7 Kec. Sitahuis, Tapteng. Lebih dia Dicky mengatakan, bagi warga pengguna jalan baik arus mudik maupun arus balik diharapkan agar saling menghormati demi lancarnya arus lalu lintas, dan dalam hal itu warga penggunajalannantinyamelakukan perjalanan juga diimbau agar mendatangi tiap pos pam yang telah disediakan jika mengalami kesulitan pasalnya pihak pengamanan telah mempersiapkan pelayanan berupa pertolongan pertama antara lain makanan, obat-obatan, dan mobil ambulans Pemkab Tapteng. Dicky Patrianegara juga menyebutkan telah menyiapkan personil bersenjata lengkap guna

pengamanan tempat dinilai rawan berupa Bank, SPBU, Kantor Pegadaian, dan perusahaan, kendati sebelumnya telah meningkatkan kewaspadaan. Gelar pasukan ini dihadiri Bupati Tapanuli Tengah Raja Bonaran Situmeang SH Mhum, Danden POM 1/2 Sibolga Mayor CPM Golfrid Sipahutar, Dandim 0211/TT Letkol Czi Godman Siagian, Sip, Ka.Kwarcab Gerakan PramukaTapteng Pukka Sipahutar dan unsur TNI/Polri. Melepas tim ditandai dengan pemasangan tanda pita oleh Bupati Raja Bonaran Situmeang kepada 4 perwakilan tim operasi dari unsur Polri, POM 1/2 Sibolga, Satpol PP dan Dinas Perhubungan.

Kapolri Jenderal Timor Pradopo dalam amanat tertulisnya dibacakan Raja Bonaran Situmeang mengemukakan, Idul Fitri 1432 Hijriyah dirayakan umat Muslim di Indonesia dengan antusiasme yang tinggi serta dijadikan momentum untuk saling bersilahturahmi, khususnyadengankeluargayang berada dikampung halaman. Hal itu berdampak pada terjadinya peningkatan aktivitas masyarakat diberbagai tempat serta meningkatnya mobilitas manusiadanbarangyangberimplikasi pada timbulnya potensi gangguan keamanan dan ketertiban masyarakat (kamtibmas) yang harus mampu dikelola dengan baik. (a23)

Waspada/Zulfan Nasution

BUPATI Tapanuli Tengah Raja Bonaran memeriksa barisan pada upacara gelar pasukan Operasi Ketupat Toba 2011 di Lapangan Bola Kaki Pandan, Senin (22/8).

07.00 Sinema Pagi 09.00 DAHSYAT 11:00 Infotainment 12:00 Seputar Indonesia Siang 12.30 Sinema Siang 14.30 Kabar Kabari 15.00 Seputar Indonesia 15.30 Silet 16.00 Saladin 16.30 Larva 16.55 Masterclass Ramadhan 17.40 Kultum 18.00 Sinetron Ramadhan: Dari Sujud KE Sujud 19.00 Mega Sinetron Putri Yang Ditukar 20.30 Mega Sinetron : Anugerah 22.30 Box Office Movie The Transporter

CATATAN

07:00 Inbox 09.05 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV 14:30 Status Selebriti 15:30 Mutiara Hati Quraish Shihab 15.31 Cinta Dan Uya Sama Sama Kuya 17.00 SM*SH Ngabuburit 17:30 Mengetuk Pintu Hati, Azan Maghrib Doa Berbuka Puasa 18.00 Para PencariTuhan 19:30 SCTV Sinetron : Calon Bini 20.30 Islam KTP 22.00 Perempuan Pembawa 23.00 SCTV FTV UTama 02.00 Sabarrr (sahur bareng Rey Rey Reynaldi)

07:00 Upin & Ipin Met Pagi 08:00 Cerita Pagi 09:00 Cerita Pagi - 1 10:30 Diantara Kita 11:00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 1 4 : 3 0 Ta u l a d a n Ramadhan 15:30 Lintas Petang 16:30 Animal Battleground 17:00 Upin & Ipin Buka Puasa 18:00 Animasi Spesial : Shaun The Sheep 19:00 Animasi Spesial : Oscar Oasis 20:00 Sampeyan Muslim 21.00 Ranum 22:00Tarung Dangdut 00.30 LAyar Tengah Malam

07:00 Curious George 07:30 Mr. Bean 08:00 Mr. Bean 08:30 Dokumenter 09:30 Sinema Pagi 11:30 Topik Siang (Live) 12:00 Klik ! 13.00 Sinema Siang 15:30 Topik Petang Update (Live) 15:30 Mantap Ngabuburit (Live) 17:00 Pesbukers (Live) 18:35 Super Deal 2 Milyar 20:00KuisSiapaPalingBerani 21.30 Ultimate Guinness World Of Record 22:30 Ripley’s Believe It Or Not Season 1 23.00 Reality Legenda 00:25 Topik Malam (Live) 00:00 Lensa Olah Raga Malam

07.00 KISS Pagi 08.00 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 Drama Asia 13.30 Pasta 14.30 KiSS Ramadhan 15.00 Fokus 16.30 Arti Sahabat 17.45 Mamah On The Street 18.00 Khadijah dan Khalifah 19.00 Nada CInta 20.00 Antara Cinta Dan Dusta 21.00 Cahaya Cinta 22.00 Mega Sinema 01.00 Jihan 02.00 Jelajah Masjid 02.30 Ceramah Ceria Bersama Mamah

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.00 Headline News 10.05 Eleven Show 11.05 The Spring & Latern Festival 12.05 Metro Siang 13.05 Oasis 13.30 Jakarta Jakarta 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Suara Anda 19.05 Suara Anda 19.30 The Beauty Of Harmony 20.30 Genta Demokrasi 21.05 Top Nine News 21.30 The Destroyed In Seconds 22.05 Provocative Proactive 23.05 Inside 23:30 Metro Sports

07.30 Rangking 1 08.30 Derings 10.00 Happy Family 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Program Spesial 15.00 Keluarga Minus 16.00 Gong Show 17.00 Reportase Sore 18.15 Jika Aku Menjadi 19.00 Big Brother 20.00 Cinta Cenat Cenut 22.00 Bioskop TRANS TV 24.00 Bioskop TRANS TV 02.00 Reportase Malam

06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.00 Riwajatmoe Doeloe 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Mutumanikam 14.00 Yang Terlupakan 14.30 Jendela Usaha 15.00 Kabar Pasar 16.00 Ujung NEgeri 16.30 Tahukah Anda? 17.00 Kabar Petang 19.30 Editor’s Club 20.30 Apa Kabar Indonesia Malam 22.30 Ketemu Pepeng 23.30 Kabar Arena 02.30DamaiIndonesiaku

08.00 Naruto 09.30 Obsesi 10.30 Abdel DanTemon 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 14.00 Petualangan Panji 14.30 Deny Manusia Ikan 15.30 Berita Global 16.30 Jejak KebesaranMu 17.00 Kulkas Dua Pintu 17.45 Kultum 18.00 Spongebob 19.00 Mat Calo 20.00 Big Movies 22.00 Big Movies

07:30 Selebrita Pagi 08:00 Jalan-Jalan Selebrit. 08:30 Hitam Putih 09:30 Ups Salah 10:00 Spotlite 11:00 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Cita-citaku 14:00 Dunia Binatang 14:30 Jagomatika 15:00 Koki Cilik 15:30 Asal Usul Flora 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00 Jejak Si Gundul 17:30 Orang Pinggiran 18:00UpsSalahSambung 18:30 Hitam Putih 19:30 On The Spot 20:00 Opera Van Java 22:00BukanEmpatMata **m31/G


C5

WASPADA, Kamis 25 Agustus 2011

Semarak Ramadhan

25

Imsak 04:55 Subuh 05:05 Maghrib 18:36

Perusahaan Bakal Dikenakan Zakat BADAN Amil Zakat Nasional saat ini tengah menggodok peraturan guna menarik zakat bagi perusahaan yang ada di tanah air, seperti yang telah dilakukan Negara tetangga Malaysia. “Malaysia berhasil mengumpulkan zakat dengan nilai cukup signifikan dari perusahaan yang ada. Kita juga akan mencoba apa yang dilakukan Negara tetangga itu,” kata Ketua Komisi Pengawas Badan Amil Zakat Nasional Drs Achmad Subianto, MBA di Asrama Haji Medan dalam acara buka puasa bersama 1.000 anak yatim dan dhuafa, belum lama ini. Secara bersamaan juga kegiatan tersebut digelar di 11 kota seperti Padang, Pekanbaru, Jakarta, Bandung, Yogyakarta, Surabaya, Bali, Banjarmasin dan

Manado dengan mengumpulkan 11.000 amal yatim. Subianto menyatakan rasa optimisnya bahwa perusahaanperusahaan yang ada akan berkenan mengeluarkan zakatnya di masing-masing daerah. Karena pengeluaran zakat itu sama artinya membersihkan perusahaan dan menghindari bencana alam. “Bencana alam yang menimpa wilayah kita selama ini seperti tsunami mungkin saja disebabkan perusahaan-perusahaan yang ada tidak mau mengeluarkan zakat, “katanya.

Dia juga menyatakan keinginan Baznas membuat peraturan pengualaran zakat bagi perusahaan telah mendapat lampu hijau dari Presiden Soesilo Bambang Yudhoyono setelah mendengar tingginya hasil jumlah dana zakat yang dikumpulkan Negara tetangga Malaysia mencapai Triliunan rupiah. Bendahara Bazdasu, Ir Sahrul Jalal mengakui bahwa dana zakat yang terkumpul selama ini belum signifikan untuk memenuhi kebutuhan hidup anak yatim miskin dan kaum dhuafa di daerah ini.

“Selama ini Bazdasu hanya mampu menyantuni 200 anak yatim, sementara masih banyak lagi anak yatim miskin yang juga mengharapkan bantuan Bazdasu,” begitu kata Jalal. Jalal sangat berharap ada-nya kesadaran para muzakki untuk menyalurkan zakatnya ke Bazdasu agar dana yang terkumpul dapat disalurkan untuk fakir miskin dan anak yatim miskin. Ketua Panitia Penyelenggara penyantunan anak yatim, Drs. Syuaibun, MA pada kesempatan itu menyatakan, perlunya umat Islam konsen

untuk menyantuni anak yatim. Karena itu merupakan tuntutan ajaran Islam yang tertuang dalam Alquran. Sementara penceramah Prof. Dr Haidar Putra Daulay juga menekankan pentingnya menggaungkan zakat ke tengah-tengah masyarakat. Karena dalam sejarah Islam zakat merupakan sumber dana yang membuat kejayaan Islam pada masa lalu. “Pada zaman Nabi Muhammad SAW juga sempat memerangi orang-orang Islam yang tak mau mengeluarkan zakat,” katanya.(m26)

Warga PJB Harus Lakukan Kegiatan Bermanfaat Warga Jawa khususnya keluarga besar Paguyuban Jawa Bersatu (PJB) harus senantiasa melakukan kegiatan bermanfaat bagi masyarakat. Harapan itu disampaikan Ketua Umum PJB Sumut Drs H Adi Munasip, MM pada buka puasa bersama dan santunan anak yatim PJB di aula Perguruan Dharmawangsa Jln. KL Yos Sudarso, Sabtu (20/8). Kegiatan bertema, “Beramal, Cerdas, Beramal Ikhlas dan Kesabaran untuk Menuju Taqwa” itu diikuti ratusan warga Jawa, sementara santunan diberikan kepada 100 anak yatim.

Adi Munasip mengatakan, kegiatan buka puasa dan santunan seperti ini merupakan kegiatan rutin dilakukan PJB. “Sebenarnya, jika seluruh warga PJB hadir maka ruangan ini tidak akan cukup. Sayangnya masih ada sebagian dari warga PJB yang hari ini punya kepentingan lain yang tidak bisa ditunda. Bapak Plt Gubsu sendiri rencananya hadir, tapi karena ada beberapa undangan di tempat lain tidak bisa menghadiri acara ini,” kata mantan anggota DPRD Kota Medan itu. Sementara Ustadz Nasib Selmi dalam tausyah singkatnya

mengatakan, pentingnya kita memahami fungsi dari puasa Ramadha, yaitu petunjuk bagi kita semua. Mengenai tema kegiatan, ustadz mengatakan, kecerdasan itu memang penting karena itu kita harus belajar. “Belajar apa? Belajar semuanya, mulai dari mengaji, fisika, biologi bahasa Inggris dan semuanya,” ujarnya. Kemudian soal beramal dan ikhlas, dia mengatakan, memang seharusnya beramal dan akan lebih baik lagi apabila dilakukan secara ikhlas, karena apa yang diperoleh akan berlipat ganda. (m08)

Waspada/Ismanto Ismail

KETUA Pantai Nasdem Kota Medan Aner Siagian memberikan paket kue lembaran kepada warga kurang mampu di kawasan DAS Jln. Kejaksaan Medan, Selasa (23/8) sore.

Partai Nasdem Medan Berikan Ratusan Paket Kue Lebaran PARTAI Nasdem Kota Medan memberikan ratusan paket kue kepada warga kurang mampu di 21 kecamatan di Medan. “Pemberian paket kue kepada warga merupakan keperdulian, sekaligus meringankan beban warga kurang mampu dalam merayakan hari Raya Idul Fitri,” kata Ketua Partai Nasdem Kota Medan Aner Siagian kepada Waspada di Jln. Kejaksaan, Selasa (23/8) sore. Aner mengatakan, kegiatan ini dilakukan sejak 10 sampai 28 Agustus 2011. “Kita memberikan bantuan ini langsung kepada yang membutuhkan, dan tidak perlu desak-desakan,” kata dia disela-sela menyerahkan paket kue kepada warga yang tinggal kawasan daerah aliran sungai (DAS). Selain itu, pihaknya memberikan santunan kepada anak yatim di Panti Asuhan Jln. KL Yos Sudarso. Pantauan Waspada, warga yang menerima paket kue lebaran terlihat antri, namun tertib. Setelah menerima paket kue, mereka menyalami Aner Siagian. Sumini yang menerima paket kue lebaran mengatakan, Pantai Nasdem Kota Medan telah memperhatikan masyarakat yang membutuhkan bantuan. “Kami sudah lama kenal Aner Siagian, dia memang disenangi masyarakat karena selalu memperhatikan warga kurang mampu,” katanya. (m36)

Waspada/Ist

KETUA Umum PJB Sumut H Adi Munasip dan pengurus PJB, bersama anak yatim pada buka puasa bersama di aula Perguruan Dharmawangsa Jln. KL Yos Sudarso Medan, Sabtu (20/8).

AP

DUA anak laki-laki India ini dengan senang hati ikut dalam kegiatan mempersiapkan makanan untuk buka puasa di Masjid Jama New Delhi.

STM Alumni SMAN 8 Buka Puasa Bersama SERIKAT Tolong Menolong (STM) Alumni SMAN-8 Medan menggelar acara Milad ke-2 disertai buka puasa bersama di lantai 2 Garuda Plaza Hotel Medan, Minggu (20/8). Hadir para alumni SMAN 8 yang kini duduk di posisi strategis pemerintahan dan swasta seperti Drs M Syahrir (Ketua PWI Cabang Sumut), Ir Riyadil Akhir, M.Si (Kepala Bapeda Sumut), H Redwin, SH.M.Hum (Kabag Hukum Pemkab Deli Serdang) dan sejumlah alumni lain yang telah sukses. Ketua STM Alumni SMAN 8 Medan H Redwin didampingi Ketua Panitia Pelaksana H Zufkar, SE kepada sejumlah wartawan mengatakan, Milad ke-2 dan buka puasa bersama bertujuan mempererat hubungan tali silaturahmi serta memperkuat ‘ukhuwah islamiyah’ antara alumni. Redwin mengungkapkan, acara seperti ini merupakan agenda tahunan alumni SMAN 8 yang tergabung dalam wadah STM. Dengan acara ini diharapkan para alumni yang tersebar di sejumlah provinsi Indonesia bisa berkumpul. Sedangkan Zufkar menambahkan, selain bertujuan mempertemukan para alumni setiap tahun, STM Alumni SMAN 8 Medan juga memiliki program religi, antara lain, setiap tiga bulan sekali menggelar pengajian antar sesama alumni. “Kemudian kita juga memiliki program membantu para alumni yang tidak mampu ataupun yang sedang dalam kesusahan,” katanya. Sebelum buka puasa bersama, Setyo Budiman, seorang alumni menyampaikan dakwah kuliah tujuh menit (Kultum) yang intinya disebutkan, bulan suci Ramadhan memiliki makna dan arti penting dalam kehidupan. (cwan)

Waspada/ist

KETUA PWI Cabang Sumut Drs M Syahrir, salah seorang alumni SMAN 8, memberikan bantuan lebaran dan dana tali asih kepada sejumlah guru SMAN 8 di Garuda Plaza Hotel Medan, Minggu (20/8).

PC PMI Safari Ramadhan Sekaligus Serahkan Bingkisan TIM Safari Ramadhan Pimpinan Cabang Pemuda Muslimin Indonesia (PC-PMI) Kota Medan mengunjungi Masjid Al-Ikhlas Jln. Bersama Gg Swadaya, Medan Tembung, Sabtu (20/8). Dalam kunjungan itu, Ketua PMI Medan Rinaldi Amri menyerahkan paket bingkisan kepada nazir masjid berupa bahan minuman untuk kegiatan di masjid, baik tadarusan maupun berbuka puasa. PMI Medan juga memberikan uang bantuan untuk masjid. Rombongan diterima Ketua BKM Masjid Al-Ikhlas Sukirno, Kepling IX Kel Bantan M. Safii. Turut hadir Wakil Ketua PMI Medan Ahmad Yani, Dicky Ambon, Eriandi, Azhari Batubara, Sekretaris Muslim Kamal dan para ketua PAC antara lain, Eka Putra Siregar dari Medan Tembung, Ketua PAC Medan Denai Ahmad Fadli, Medan Helvetia Budi Nasution, Ketua PAC Medan Belawan Ahmad dan Ketua PAC Medan Deli Hari Ismail. “Ini merupakan program rutin setiap ramadhan untuk meningkatkan ukhuwah sesama umat Islam, sekaligus mempererat tali silaturahim,” ujar Sekretaris PMI Medan, Muslim Kamal. Sebelumnya, kegiatan sama dilaksanakan di Masjid Al-Ikhlas, Titi Papan dan tempat lainnya. Ustadz AhmadYani, dalam tausyahnya menyampaikan makna pentingnya menjaga shalat. Jangan sampai karena perkara kecil dapat membatalkan shalat,” kata dia. (m41)

Waspada/Ist

Zakat Usaha Merugi Soal: Assalamu’alaikumWr.Wb. Saya mengelola satu usaha. Jika usaha yang saya jalankan dalam kondisi merugi apakah saya tetap berkewajiban membayar zakat karena kalau dilihat dari sisi aset boleh jadi telah mencapai mungkin lebih dari nisab (jika zakat harus dikeluarkan tiap tahun).... (Andy Darmawan, Belawan) Jawab: Wa’alaikum salam wr. wb. Terima kasih atas pertanyaannya. Menurut ulama fiqih zakat perdagangan diwajibkan dikeluarkan zakatnya setiap tahun atas perniagaan dan yang memenuhi cukup nishab meskipun merugi. Tetapi jika usaha Bapak merugi dan kurang dari nisab maka tidak wajib zakat. Sebab dalam hukum Islam yang dilihat bukan rugi atau untungnya usaha yang dijalankan, tetapi apakah harta Bapak sudah cukup nisab atau kurang nisab. Dr. Yusuf Al-Qardhawi dalam Fiqh Zakatnya menjelaskan harta perdagangan adalah semua yang dipergunakan untuk diperjual-belikan atau segala sesuatu yang dibeli atau dijual untuk tujuan memperoleh keuntungan. Hadits mendasari kewajiban menunaikan zakat ini: “Rasulullah SAW memerintahkan kami agar mengeluarkan zakat dari semua yang kami persiapkan untuk berdagang.” ( HR. Abu Dawud) Dalam penunaian zakat yang perlu diperhatikan adanya niat, baik diucapkan jelas maupun secara sembunyi (dalam hati) saat mengeluarkan zakat perdagangan. Ulama menjelaskan persentase zakatnya sebesar 2,5% setiap tahun. Jumhur ulama Imam Syafi’i, Imam Abu Hanifah, Imam Ahmad, Tsauri dan Auzai menjelaskan, bila usaha sudah setahun maka hendaknya mengeluarkan zakat. Perlu diingat, menurut Dr. Yusuf Al-Qardhawi, modal dagang yang diwajibkan adalah modal berupa kekayaan cair atau bergerak. Bangunan dan perabot tak bergerak yang terdapat di dalam toko atau sejenisnya yang tidak diperjualbelikan tidaklah termasuk yang dihitung harganya dan tidak dikeluarkan zakatnya. Ulama-ulama fikih menyebutkan bahwa yang dimaksud dengan barang dagang adalah barang yang diperjualbelikan dengan maksud mencari keuntungan. Wallahu a’lam. LAYANAN JEMPUT ZAKAT (Khusus Kodya Medan): 08126375062 Pembayaran ZIS via Bank Zakat Infak/Sedekah BMI 211.00044.15 BMI 211.00002.15 BSM 006.002240.7 BSM 006.000832.1 BNI Syariah 009.2687629 BNI 005.7504808 BCA 022.1750828 Bank Sumut 100.02.04.0341445 Bank Mandiri 106.0002203803

KETUA PC Pemuda Muslimin Medan Rinaldi Amri menyerahkan bingkisan kepada Ketua BKM Masjid Al Ikhlas Sukirno dalam sebuah kunjungan safari Ramadhan 1432 H, Sabtu (20/8).

Rubrik Tan ya J a wa b any Ja MUI Medan Oleh: Drs. Kiai Muhyiddin Masykur (Sekretaris Bidang Fatwa MUI Kota Medan)

Pembangunan Kuburan Tanya: Bagaimana hukum membangun kuburan atau memagarinya dengan tembok ? Mohon penjelasan! Jawab: Kewajiban kaum muslimin yang masih hidup terhadap mayat orang Islam ada empat hal yang hukumnya fardhu kifayah, 1. Memandikan, 2. Mengkafani, 3. Menshalatkan, 4. Menguburkan. Adapun membangun kuburan atau memagarinya dengan tembok di bawahnya atau di atasnya hukumnya makruh bila tanah itu milik sendiri, dengan tidak ada keperluan semisal khawatir terjadinya pembongkaran, penggalian oleh binatang buas atau runtuh karena banjir. Apabila membangun kuburan tanpa ada keperluan seperti tersebut di atas dan dilakukan di tanah pekuburan musabbalah, yaitu sebidang tanah yang disediakan penduduk untuk mengubur mayat, baik diketahui asal mula pemiliknya atau tidak, tanpa ada ijab kabul wakaf atau dilakukan di tanah kuburan wakaf, maka hukumnya haram menurut madzhab Maliki, Syafi’i dan Hambali. Namun menurut madzhab Hanafi, membangun kuburan itu hukumnya makruh, baik di tanah sendiri atau tanah wakaf, hanya saja di tanah wakaf hukumnya sangat makruh. Ketentuan ini berdasarkan hadits Hasan dan Shohih “Rasulullah Saw melarang menembok kuburan, duduk di atasnya dan membangun di atasnya.” (HR. Muslim). Pada riwayat Nasa’i disebutkan: “Rasulullah telah melarang membuat rumah di atas kuburan dam membuat tulisan di atasnya.” Lain jika yang dibangun itu pekuburan para Nabi, Syuhada’, Alim Ulama’, wali dan orang sholeh, maka hukumnya boleh menurut sebagian Ulama’ walaupun di tanah musabbal, karena untuk memuliakan mereka, menghidupkan ziarah qubur kepada mereka, dan mengambil berkah dari amal-amal kebaikan mereka. (Kitab Fiqih alal Madzahibil Arba’ah I:487, I’anah Ath-tholibin II:120, dan Ibanah Al Ahkam II:252). Waallahu ‘alam


Aceh

C6

WASPADA Kamis 25 Agustus 2011

Kebutuhan Air Bersih Jelang Idul Fitri Tinggi

Polres Lhokseumawe Amankan Penjual Mercon

Upaya Lobi Anggaran Pusat Hanya Habiskan Dana Daerah

Pembacokan Penjahit Sepatu Diduga Bermotif Dendam

LHOKSEUMAWE (Waspada) : Menjelang Idul Fitri, kebutuhan air bersih di Aceh Utara dan Kota Lhokseumawe meningkat drastis. Untuk memenuhi kebutuhan pelanggan, perusahaan air minum milik Pemkab Aceh Utara harus meningkatkan pelayanannya. Direktur PDAM Tirta Mon Pase Aceh Utara, Zulfikar Rasyid, Selasa (23/8) menegaskan, kebutuhan air bersih menjelang Idul Fitri semakin meninkat. Bahkan seperti pengalaman sebelumnya, kebutuhan air bersih pada selama hari raya sangat tinggi. “Pening-katan kebutuhan air sudah dimulai sejak awal Ramadhan 1432. Namun untuk kebutuhan hari raya akan lebih besar,” jelasnnya. “Untuk menyambut Idul Fitri 1432 H, kita bekerja maksimal dalam mensuplai air ke pelanggan baik di wilayah Aceh Utara maupun Kota Lhokseumawe,” tambah dia. Namun untuk memaksimalkan pelayanan, pihaknya masih menghadapi kendala. (b17)

LHOKSEUMAWE (Waspada) : Aparat Kepolisian Polres Lhokseumawe, Minggu (21/8) menyita seratusan batang mercon milik pedagang di kawasan pasar Geudong, Kecamatan Samudera, Aceh Utara. Selain mercon, petugas juga mengamankan tiga penjualnya. Kapolres Lhokseumawe AKBP Kukuh Santoso melalui Kasat Reskrim AKP Galih Indragiri, Selasa (23/8) menuturkan, dalam razia itu, polisi berhasil mengamankan seratusan batang mercon berbagai ukuran dan jenis di kawasan pasar Geudong, Kecamatan Samudera, Aceh Utara. Namun, mercon yang disita tersebut tidak memiliki daya ledak yang tinggi. Pedagang yang diamankan itu Jolkarya dan Miswar, warga Desa Pulo Aceh, kemudian Usman, warga Kecamatan Samudera, Aceh Utara. Ketiganya kemudian dibawa ke Polres untuk dimintai keterangan. Kemudian setelah selesai Berita Acara Pemeriksa (BAP), mereka tidak ditahan.(b03)

LHOKSEUMAWE (Waspada) : Dinas Bina Marga Aceh Utara dinilai hanya mampu menghabiskan APBK untuk melobi bantuan anggaran pemerintah pusat. Pasalnya, tidak ada program apapun dari pemerintah pusat yang berhasil dibawa pulang. Demikian pendapat Badan Anggaran DPRK Aceh Utara terhadap Laporan Pertanggungjawaban Bupati mengenai APBK tahun anggaran 2010 yang dibacakan anggota dewan Ahmad Satari pada rapat paripurna di gedung dewan, Selasa (23/8). Banggar DPRK, tambahnya, meminta Kepala Dinas Bina Marga Aceh Utara Muhammad Tanwier menjelaskan kepada Banggar berapa banyak bantuan dan program dari pusat yang dibawa ke Aceh Utara. “Dalam hal ini dewan menagih janji kepala dinas yang ketika dalam rapat dua pihak pada pembahasan anggaran 2010 berjanji akan mendapatkan proyek besar dari pemerintah pusat,” kata anggota dewan dari Partai Demokrat ini.(b17)

BIREUEN (Waspada) : Motif kasus pembacokan Marhadi, penjahit sepatu asal Desa Cot Batee, Kuala, Bireuen diduga kuat karena dendam, karena korban beberapa waktu lalu pernah menegur pelaku Hariadi yang sudah menceraikan istrinya, tiba-tiba diketahui sudah hidup serumah lagi. Saat itulah, korban yang juga seorang aparatur desa setempat memperingatkannya. Namun, teguran korban sepertinya kurang diterima, sehingga terjadi kasus ini. Demikian diungkapkan Kapolres Bireuen AKBP HR Dadik J melalui Kapolsek Jeumpa Iptu PM Kataren yang didampingi Kanit Res Aiptu Mahdi Adam Senin (22/8). “Hasil pengembangan sementara, perkelahian antara dua warga Cot Batee tersebut diduga akibat tersulut dendam karena tidak menerima dinasehati supaya jangan campur dengan istri yang telah ditalak tiga,” kata Kapolsek. (cmh)

BI: Hati-hati Peredaran Upal Di Pasaran LHOKSEUMAWE (Waspada): Zulfan Nukman, Pemimpin Bank Indonesia (BI) Lhokseumawe mengingatkan para pedagang untuk ekstra hatihati menjelang Idul Fitri 1432 H. Pasalnya, peredaran uang palsu marak terjadi pada hari-hari tersebut. “Biasanya, para pengedar uang palsu suka mengedarkan uang palsu pada saat-saat sibuk. Tujuannya, agar masyarakat pedagang tidak sempat mencari tahu apakah uang itu palsu atau tidak. Imbauan ini, lebih kami tujukan kepada para pedagang K-5, seperti penjual gorengan dan lainnya,” tutur Zulfan Nukman mengingatkan. Untuk memastikan uang palsu atau tidak masyarakat pedagang cukup melihat, meraba

dan menerawang. Kata Zulfan, beredarnya uang palsu cukup meresahkan masyarakat, lebihlebih masyarakat kecil. Yang menjadi korban pengedar uang palsu bukan hanya dari kalangan masyarakat bawah, tapi juga kalangan elit, akibat tidak ada kehati-hatian. Sementara itu, seorang anggota TNI di Lhokseumawe yang enggan disebutkan namanya mengaku mendapatkan selembar uang palsu senilai Rp100.000. Uang palsu dia dapatkan dari salah seorang pedagang K-5. Pedagang meminta bantuannya untuk memastikan apakah uang itu palsu atau tidak. “Seorang pedagang K-5 meminta bantuan saya untuk mengecek keaslian uang itu ke bank. Karena merasa kasihan, maka saya bersedia menolongnya. Dan setelah saya cek ke bank ternyata itu uang palsu,” katanya. (cmun)

Warga Blang Poroh Hilang Di Hutan BIREUEN (Waspada) : Marzuki,35, warga Blang Poroh, Kecamatan Jeunieb, Bireuen, hilang di hutan kawasan pegunungan kecamatan setempat, Senin (22/8) malam setelah pergi bersama tiga temannya mencari buah jerneng (sejenis buah keladi). Informasi yang diperoleh Waspada dari Komandan satuan tugas komunikasi (Dansatgaskom) Radio Antar Penduduk Indonesia (RAPI) Bireuen, M Ruslan A Gani, hilangnya Marzuki setelah diberitahukan tiga orang rekan korban yaitu M Nazar dan Samsul, warga Blang Poroh serta MYusuf, warga Meunasah Leung, kecamatan yang sama Rabu (24/8) kepada salah seorang anggota korban yaitu Mulyadi yang juga anggota RAPI Bireuen yang selanjutnya diteruskan. Sebagaimana informasi dari pihak keluarga korban korban bersama tiga orang rekannya Senin (22/8) pagi pergi ke hutan untuk mencari buah jerneng untuk dijual yang kabarnya sekarang ini mahal harganya. “Ketiga temannya pulang, sedangkan Marzuki tidak pulang karena terpisah dengan ketiganya dan diduga kesasar dalam hutan,” kata keluarga korban sebagai-mana ditutur kembali Ruslan. (cmh)

Letusan Mercon Kejutkan Jamaah Tarawih LHOKSEUMAWE (Waspada) : Letusan mercon di wilayah Cunda Utara menyentak para jamaah yang sedang melaksanakan tarawih di meunasah-meunasah dan balai kampung, sehingga mengusik ketentraman beribadah. Dua hari sebelumnya, ledakan sudah terjadi selepas Maghrib sehingga mengganggu orang-orang yang sedang berbuka puasa. “Kalau kembang api ataupun mainan lain yang tidak bersuara, tidak masalah asal jangan dimainkan di tempat umum,” jelas tokoh masyarakat Cunda, Jumadil Khairat, Rabu (24/8). Ledakan yang terjadi selama dua kali itu memang tidak berlanjut lagi, tetapi sejumlah tokoh masyarakat telah mewantiwanti melalui pengumuman di masjid, meunasah dan balai, bahwa penduduk yang tidak melaksanakan tarawih diminta menghormati orang yang sedang menjalankan ibadah.(b12)

Waspada/Abdul Mukthi Hasan

MOBIL Avanza yang menghantam tembok tengah jalan depan Kantor Kejari Bireuen, Selasa (23/8), sehingga rusak parah bagian depannya, sopirnya luka di bagian kepala namun belum diketahui identitasnya karena setelah kejadian menghilang di lokasi.

Avanza Hantam Beram Jalan BIREUEN (Waspada) : Mobil Toyota Avanza silver BK 1246 ZE yang datang dari arah Medan ke Banda Aceh menghantam beram jalan di depan Kantor Kejaksaan Negeri Bireuen, Selasa (23/8) sekira pukul 03:00. Akibatnya sopir dan seorang penumpang mengalami pendarahan di kepala yang diduga kuat terantuk dengan kaca. Keterangan yang dihimpun, jalan di kawasan kantor Kajari Bireuen saat itu licin pasca diguyur hujan belum diketahui. Tibatiba datang mobil Avanza itu tiba-tiba langsung menghantam tembok jalan. Setelah mobil menghantam tembok tengah jalan itu, sopir dan seorang penumpang ke luar lalu lari ke samping kantor Kejari. Tiba-tiba mereka kembali lagi ke mobil sambil mengambil susuatu dari dalam mobil bungkusan di pintu belakang dan lari lagi hingga menghilang. Kapolres Bireuen AKBP HR Dadik Junaedi melalui Kasat Lantas AKP H Suharmadi didampinggi Kanit Laka Aiptu Mahdi Ahmad, Selasa (23/8) terkait musibah itu mengatakan, pasca mobil Avanza itu, mengalami kecelakaan tunggal itu anggotanya sudah berupaya mencari pengemudinya, namun belum ditemukana. (cmh)

Guru Bersertifikat Di Aceh Utara Pertanyakan Dana Sertifikasi LHOKSUKON (Waspada) : Sejumlah guru bersertifikat di Kabupaten Aceh Utara mempertanyakan dana sertifikasi periode JanuariAgustus 2011 yang hingga kini belum cair. Para tenaga pendidik ini mengaku sangat membutuhkan dana itu untuk menutupi berbagai kebutuhan menjelang Lebaran. Informasi dari Koalisi Barisan Guru Bersatu (Kobar-GB) Aceh Utara, jumlah guru yang sudah disertifikasi di Aceh Utara sekitar 2.500 orang. Dana sertifikasi itu sendiri seharusnya dicairkan per triwulan. Namun hingga triwulan III 2011, dana tersebut belum juga dicairkan oleh Pemkab Aceh Utara. “Harapan kami pemerintah segera merealisasikan hak para guru tersebut. Sebab, di kabupaten lain di Aceh, proses itu sudah selesai. Minimal, Pemkab Aceh Utara memberi penjelasan

resmi supaya persoalan itu jelas dan para guru tidak lagi berharap-harap cemas,” kata Ketua Kobar GB Aceh Utara Yursal, Rabu (24/8). Yursal menambahkan, selain masalah dana sertifikasi, untuk guru yang sudah disertifikasi pada 2009 juga mempertanyakan dana sertifikasi tahun 2010. Sebab dana yang telah dicairkan hanya untuk sepuluh bulan, terhitung JanuariOktober 2010. Sementara untuk 2 bulan lagi yakni November dan Desember 2010 hingga kini belum diterima. “Kondisi ini tidak sejalan dengan program pemerintah pusat yang ingin mensejahterakan guru melalui sertifikasi. Kalau kondisinya terus begini, semangat kerja para guru bisa down dan secara tidak langsung bisa mempengaruhi kualitas pendidikan di Aceh Utara,” tandasYursal. (cmus)

LBH Banda Aceh Pos Langsa Diharap Tetap Eksis

Waspada/Maimun Asnawi

SEORANG anggota TNI memperlihatkan uang palsu pecahan Rp100.000 kepada Waspada kemarin.

Diprotes, Pelibatan TNI Dalam Sengketa Aset Daerah Lhokseumawe-Aceh Utara BANDAACEH (Waspada) : Permohonan menjadi mediator oleh Walikota Lhokseumawe Munir Usman kepada Danrem 011/Lilawangsa Kolonel Inf Deni K Irawan dalam sengketa aset daerah dengan Aceh Utara, menuai protes sejumlah kelompok masyarakat sipil di Aceh. Kelompok masyarakat sipil Aceh yang terdiri dari KontraS Aceh, LBH Banda Aceh dan GeRAK Aceh, mendesak Walikota Lhokseumawe untuk segera menghentikan pelibatan TNI dalam penyelesaian masalah dalam pemerintahan sipil. “Sebagai orang yang terpilih melalui proses demokrasi, walikota harusnya menjadi pemegang kontrol atas militer dan bukan sebaliknya. Apalagi menarik-narik militer dalam masalah tata kelola pemerintahan

sipil,” jelas Hendra Fadli, Koordinator KontraS Aceh, Rabu (24/ 8). Selain itu, ketiga lembaga ini juga meminta Danrem 011/ Lilawangsa untuk menolak pelibatan TNI di luar agenda pertahanan negara. Selain itu, meminta semua pihak konsisten dengan undang-undang dan peraturan serta terus mendorong reformasi TNI dengan menempatkan TNI pada posisinya sebagai alat pertahanan negara. “Tindakan Walikota Lhokseumawe juga dinilai tidak sesuai UU No.11 Tahun 2006 tentang Pemerintahan Aceh. Seharusnya mediatornya Gubernur Aceh, sebab kedudukannya sebagai wakil pemerintah,” kata Hayatuddin, Kepala Divisi Advokasi Korupsi GeRAK Aceh.

Hayatuddin menegaskan, selain gubernur pihak yang dapat menjadi mediator dari Kementerian Dalam Negeri. Hal itu sesuai dengan UU No.32 Tahun 2004 tentang Pemerintahan Derah jo Peraturan Pemerintah No.78Tahun 2007 tentang Tata Cara Pembentukan, Penghapusan dan Penggabungan Daerah. Direktur LBH Banda Aceh Hospinovizal Sabri menyatakan, peran TNI sebagai alat negara bidang pertahanan, itu sesuai pasal 5 Undang-undang No.34 Tahun 2004 Tentang TNI. “Semua pihak termasuk pemerintah seharus mendorong reformasi TNI, bukan justru melibatkannya dalam agenda politik dan pemerintahan,” tegasnya. (b07)

Bobolnya Rp220 M Kas Pemkab Aceh Utara

PN Banda Aceh Berwenang Mengadili BANDA ACEH (Waspada): Majelis Hakim Pengadilan Negeri Banda Aceh menyatakan berwenang mengadili perkara terdakwa Bupati Aceh Utara Ilyas A Hamid dan Wakil Bupati Syarifuddin terkait kasus bobolnya anggaran Rp220 miliar dana kas Pemkab Aceh Utara. “PN Banda Aceh berwenang mengadili perkara ini dan kepada jaksa penuntut umum diperintahkan untuk melanjutkan sidang dengan menghadirkan saksi-saksi,” ungkap Ketua Majelis Hakim M Arsyad Sundusin, dalam putusan sela yang dibacakan dalam sidang lanjutan di PN Banda Aceh, Rabu (24/ 8). Dalam putusan sela yang dibacakan secara bergiliran dengan hakim anggota Taswir, hakim berkesimpulan selain menyatakan PN Banda Aceh berwenang mengadili perkara itu, juga menolak seluruh eksepsi yang diajukan para penasehat hukum terdakwa. Sebelumnya, tim penasehat hukum terdakwa II (Syarifud-

din,SE) dalam eksepsinya menyatakan, PN Banda Aceh tidak berwenang mengadili perkara ini, karena locus delicti di Pendopo Aceh Utara, yang merupakan daerah hukum Pengadilan Negeri Lhokseumawe. Selain itu, SK Ketua Mahkaman Agung RI Nomor :074/KMA/ SK/V/2011 tanggal 18 Mei 2011, perihal penunjukan PN Banda Aceh untuk memeriksa para terdakwa bertentangan dengan pasal 85 KUHAP. Menanggapi keberatan tim penasehat hukum, majelis hakim dengan tegas menolaknya. Pasalnya, diterbitkannya SK Ketua MA sesuai replik dari JPU sudah menurut prosedur hukum, karena atas permohonan surat dari Kajari Lhokseumawe. Begitu juga alasan keamanan atau tidak adanya perang, ditolak majelis hakim. Kecuali itu, keberatan penasehat hukum menyangkut adanya perkara lain yaitu gugatan perdata yang dilakukan Pemkab Aceh Utara terhadap Bank Mandiri di Jakarta dalam rangka

menuntut kembali uang Pemkab Aceh Utara sebesar Rp220 miliar, sehingga perlu ditangguhkan terlebih dahulu setelah ada putusan perdata yang mempunyai kekuatan hukum tetap. Terhadap alasan tim penasehat hukum terdakwa 1 (Ilyas A Hamid), di tepi majelis hakim, karena hal ini tidak dibenarkan. Pasalnya, sebut hakim, dakwaan jaksa adalah perbuatan tindak pidana yang diduga dilakukan oleh para terdakwa, sedangkan perkara perdata berdiri sendiri. “Jadi, tidak ada kolerasi antara perkara pidana dengan perdata,” tutur Arsyad Sundusin. Sementara tentang surat dakwaan jaksa penuntut umum yang dikatakan tim penasehat hukum terdakwa kabur dan tidak cermat, menurut hakim, surat dakwaan tersebut secara syarat materil disusun dengan cermat dan lengkap. Artinya, surat dakwaan JPU secara syarat materil terpenuhi sebagaimana pasal 143 KUHAP. (b06)

Arus Mudik Lebaran Di Bireuen Masih Sepi BIREUEN ( Waspada) : Hingga Selasa (23/9) suasana arus mudik lebaran di terminal bus antar provinsi dan bus L300 dalam propinsi kelihatan masih sepi. Pengamatan Waspada di teminal bus Bireuen baik siang maupun malam hari bus angkutan umum trayek Bireuen – Medan – Banda Aceh – Takengon tidak begitu ramai. Adi petugas loket bus antar Propinsi bus CV Kurnia mengatakan, penumpang mudik lebaran ke jurusan Medan masih sepi tidak begutu ramai dibanding dengan lebaran sebelum-

nya. Bangku-bangku bus jurusan Medan masih banyak yang kosong yang berangkat hanya penumapng biasa bukan pemudik lebaran. Diperkirakan arus mudik lebaran baru ramai pada 25 puasa hingga menjelang lebaran. Hal yang sama juga dikemukakan Asnawi petugas loket bus L-300 dalam provinsi jurusan Bireuen – Takengon – Banda Aceh – Langsa – Kuala Simpang belum begitu ramai, ujarnya. Angkutan Cukup Sementara itu, angkutan bus untuk kebutuhan masya-

rakat mudik lebaran Idul Fitri 1432 hijriah antara provinsi, dalam provinsi, antar kecamatan dan antar kabupaten cukup. Pihak pengusaha bus angkutan umum untuk semua jurusan sudah siap melayani penumpang ke tujuannya masingmasing namun arus mudik lebaran dari Bireuen ke kotakota lainnya hingga Selasa (23/ 8) masih sepi. Kadishub Bireuen Ir Ibrahim Ahmad, MSi melalui Kabid Perhubungan Iskandar Zein, BA mengemukakan itu menjawab Waspada di kantornya Selasa (23/8).(b16)

LANGSA (Waspada): Warga korban konflik pertanahan Gampong Sri Mulya, Kecamatan Peunaroen, Kabupaten Aceh Timur berharap agar kantor LBH Banda Aceh Pos Langsa tetap eksis berada di Kota Langsa. Sembiring, salah seorang korban konflik pertanahan dari Gampong Sri Mulya kepada Waspada di Langsa, Rabu (24/8) mengatakan, beberapa hari lalu mereka sempat kecewa ketika datang ke kantor LBH Banda Aceh Pos Langsa ternyata kantor telah kosong dan mereka tidak tahu alamat kepindahannya. Menurut Sembiring, mereka yang dimaksudkan itu adalah warga eks transmigran swakarsa mandiri yang menghadapi konflik pertanahan dengan salah satu perusahaan perkebunan berkaitan dengan status lahan dan ganti rugi rumah yang dulu digusur oleh pihak perusahaan. Mereka datang ke LBH Banda Aceh Pos Langsa untuk mencari keadilan karena selama ini lembaga tersebut yang menemani, mendampingi dan membela hak-hak mereka. Dan ketika diketahui kantornya tak ada lagi di Kota Langsa, kata Sembiring, mereka jadi kecewa dan nyaris

putus asa. Ketiadaan kantor LBH Pos Langsa memang disayangkan oleh banyak pihak. Iswantara Adi Nugraha, manajer SHEEP Foundation. “Di tengah banyaknya konflik struktural di Aceh Timur, Langsa dan Aceh Tamiang yang melibatkan rakyat dengan penguasa dan pengusaha, maka kehadiran LBH pos Langsa sangat dibutuhkan. Kehadiran mereka yang tidak hanya mendampingi korban saat berperkara di pengadilan tetapi juga melakukan penyadaran hukum dengan cara pertemanan yang intens dengan korban akan memampukan si korban sendiri untuk melakukan perlawanan di masa yang akan datang jika hak-hak Ekosob dan Sipol mereka terampas,” ujar Iswantara. Selaku elemen masyarakat sipil terorganisir yang selama ini membangun aliansi strategis maupun taktis dengan LBH Pos Langsa, pihaknya juga ikut meminta dengan sangat agar LBH Banda Aceh Pos Langsa dipertahankan eksistensinya. Mudah-mudahan tim leader bisa berpikir obyektif tidak hanya melihat dari aspek manajerial semata-mata, tambah Iswantara. (b22)

Baiturrahim Gelar Santunan Yatim Ke- 16 LHOKNIBONG, Aceh Timur (Waspada): Masyarakat bekerjasama dengan Remaja Masjid Baiturrahim Lhoknibong, Kecamatan Pantee Bidari, Aceh Timur, kembali menggelar kenduri akbar buka puasa bersama ke -16 sekaligus menyantuni ratusan anak yatim, di komplek Masjid itu, Selasa (23/8) petang. Pada kesempatan itu Kapolda Aceh Irjen Iskandar Hasan, menyumbang 210 paket bantuan untuk anak yatim plus seekor lembu jantan untuk bahan kenduri buka puasa bersama. Karena Kapolda berhalangan, proses penyerahan paket ini diwakili Wakapolres Aceh Timur Kompol Doni Wahyudi. Ketua Panitia Pelaksana, Mustafa Idris didampingi Sekretarisnya Baihaqi Abdaz, kepada Waspada, Rabu (24/8) menjelaskan, kegiatan merupakan agenda rutin tahunan yang digelar di Masjid Raya Baiturrahim Lhoknibong sejak

1996 lalu. Jumlah anak yatim dan piatu yang dibantu kali ini 212 orang. Sementara undangan buka puasa bersama yang hadir mencapai 1500 orang. “Ini terselenggara berkat dukungan dan kerjasama semua pihak, termasuk warga lokal dan donatur lain dari luar kecamatan dan kabupaten. Total dana yang terkumpul kali ini mencapai Rp70 juta. Masing-masing anak yatim menerima Rp200 ribu plus kain sarung,”sela Irham S Malem, Ketua Remaja Masjid Baiturrahim Lhoknibong. Pantauan Waspada, selainWakapolres Aceh Timur, kegiatan amal itu juga dihadiri Ketua DPRK Aceh Timur Tgk Alauddin, Anggota DPDRI Tgk Abdurrahman BTM, Kapolsek Pantee Bidari Ipda Candra Kirana Putra, Danramil Pantee Bidari Kapten Saldi Kadir dan Camat Pantee Bidari, Burhanuddin, SH.(cmus)

1.337 Anak Yatim Terima Santunan BIREUEN (Waspada): Sebanyak 1.337 anak yatim yang berumur enam tahun yang berada di 17 kecamatan di wilayah Bireuen, Kamis (25/ 8) menerima santunan yang diserahkan Bupati Bireuen melalui camat masing-masing. Anak yatim itu adalah, dari Kecamatan Samalanga 65 jiwa, Simpang Mamplam 97 jiwa, Pandrah 17 jiwa, Jeunieb 59 jiwa, Peudada 83 jiwa. Selanjutnya Jeumpa, 118 jiwa, Kota Juang

106, Kuala 77, Juli 111, Peusangan 150 jiwa, Peusangan Selatan 93 jiwa, Peusangan Siblah Krueng 65 jiwa, Kutablang 83 jiwa, Makmur 58 jiwa, Jangka 66 jiwa, Gandapura 90 jiwa, kecuali Peulimbang yang belum ada laporan. Kabag Kesra Bireuen, Said Abdurrahman kepada wartawan Rabu (24/8) mengaku, awalnya kita merencanakan akan menyantuni anak yatim di bawah 12 tahun, tapi kondisi anggaran sangat terbatas. (cmh)

Muhammad Nazar

Saya Akan Bangun Aceh Dengan Tiga Kata Kunci LHOKSEUMAWE (Waspatanpa kerja keras. Itu tidak mungda): H Muhammad NazarWakil kin terjadi. Buang jauh-jauh pola Gubernur Aceh bercita-cita pikir seperti itu agar kita bisa bamembangun peradaban untuk ngkit.Yang paling penting sekarang mensejahterakan Aceh dan anak-anak Aceh harus bisa ngaji,” melaksanakan pembangunan ucap Muhammad Nazar penuh yang benar. Agar cita-cita tersesemangat. but terwujud, maka harus meKe depan, Aceh harus bisa lenggunakan tiga kata kunci. pas dari berbagai ketergantungan Tiga kata kunci itu yakni dengan Kota Medan, Sumatera Utara. Program ini telah dimasukpertama jangan larut pada masa kan Pemerintah Aceh pada tahun lalu, lihat kekurangan dan ja2014. Agar cita-cita ini terwujud, ngan lihat pada kelebihan saja, serta hidupkan balai pengajian H MUHAMMAD NAZAR maka Pelabuhan Umum Krueng Wakil Gubernur Aceh Geukueh harus segera diaktifkan, dan meunasah. Allah, SWT meuntuk itu, Pemerintah Aceh telah merintahkan umat maanusia untuk mempelajari Alquran dan Hadist, kata menganggarkan dana untuk pengembangan pelabuhan tersebut senilai Rp1.250 triliun. Selain Nazar di Lhokseumawe baru-baru ini. Namun di Aceh yang paling banyak dipe- itu, Pemerintah Aceh juga menganggarkan dana senilai Rp20 triliun untuk perikanan. lajari oleh masyarakat adalah hadi maja (periLebih jauh orang nomor dua di Provinsi Aceh bahasa), hadi maja ini telah mengalahkan hadis ini juga mengatakan, ada empat kabupaten di nabi. Kata Nazar, hal-hal inilah yang harus segera Aceh telah menjadi kantong masyarakat miskin dihilangkan. yakni Aceh Utara, Pidie, Aceh Timur, dan Kabu“Kita selama ini larut pada kejayaan masa paten Bireuen. “Ke depan, siapa pun yang menlalu sehingga lupa untuk bangkit dan tak jarang jadi pemimpin harus mampu memerangi angka selalu melihat pada kelebihan saja. Jangan ber- kemiskinan dan kebodohan,” kata Muhammad pikir untuk bikin jalan dari emas, dapat uang Nazar. (cmun)


Aceh

WASPADA Kamis 25 Agustus 2011

7 Kg Daging Busuk Ditemukan Di Pasar Subulussalam

Partai Golkar Subulussalam Serahkan Bantuan SUBULUSSALAM (Waspada) : DPD Partai Golkar Subulussalam menyerahkan paket bantuan lebaran berupa beras, gula dan minyak goreng kepada ibu-ibu dan sejumlah penarik beca bermotor (Betor) di wilayah Pemko Subulussalam. Merah Sakti, Ketua DPD P-Golkar Subulussalam sesaat akan menyerahkan sekira 1.700 paket bantuan kepada penerima berharap dapat memanfaatkan dengan sebaik-baiknya, meski diyakini bantuan itu masih kurang sempurna. “Walaupun sedikit, kami berharap bantuan ini bisa dimanfaatkan dengan sebaik-baiknya,” papar Sakti selaku Wali Kota Subulussalam. Pantauan di lokasi, saat prosesi penyerahan bantuan yang mendapat pengawalan dari sejumlah personil Polres setempat, terjadi kemacetan arus lalu lintas dalam beberapa jam. Kendati begitu, acara berjalan aman, tertib dan terkendali. (b33)

SUBULUSSALAM (Waspada): Inspeksi mendadak (sidak)WakilWali Kota, Affan Bintang ke pasar tradisonal yang selokasi dengan Terminal Terpadu Subulussalam, Rabu (24/8), sita sekira 7kg daging sapi tak layak konsumsi (busuk) dari pedagang terkait. Udin, penjual daging yang disita kepada Affan didampingi LO Polresta Kompol Mirwazi dan Kadis Perindagkop UKM Darmansyah mengaku kalau daging yang disita disembelih dua hari lalu. Selain sidak ke penjual daging, sayuran dan pakaian, Affan juga melakukan pengecekan terhadap kepastian timbangan milik pedagang. “Kita mau pastikan timbangan pedagang, jangan sempat ada yang distel penjual demi mengeruk

Peringatan Nuzulul Quran Masjid Al-Muhajirin LAMLAGANG, Banda Aceh (Waspada) : Badan Kemakmuran Masjid (BKM) Al-Muhajirin, Dusun I, Desa Lamlagang, Kecamatan Banda Raya, Kota Banda Aceh, memperingati malam Nuzulul Alquran (turunnya Alquran), dihadiri ratusan jamaah masjid, Senin (22/8) malam. Acara dimulai usai shalat Isya, diawali dengan sambutan Ketua Panitia Peringatan Nuzulul Alquran, Fauzi, SH, dilanjutkan tausiyah agama oleh Ustaz Tgk. Musliadi. Usai tausiyah Nuzulul Alquran dilanjutkan dengan shalat tarawih sebanyak 20 rakaat. Ustadz dalam tausiyahnya mengajak para jamaah yang hadir untuk terus memperbanyak ibadahnya di sisa penghujung Bulan Ramadhan. “Mari kita mempergunakan kesempatan terbaik di bulan Ramadhan itu. Di mana Allah telah menjanjikan akan melipat gandakan pahala yang cukup banyak. Sementara Kapendam Iskandar Muda, Senin (22/8) sore melaksanakan acara buka puasa bersama dengan jajaran wartawan se-Kota Banda Aceh dan Aceh Besar. Sebelum buka buka puasa acara diisi dengan tausiyah agama yang disampaikab Ustadz Sri Dermawan.(b21)

Forum Alumni Dukung Lustrum Ke-50 FH Unsyiah BANDA ACEH (Waspada) : Forum Silaturrahmi Alumni Fakultas Hukum Universitas Syiahkuala (Unsyiah) angkatan 1985 mendukung pelaksanaan kegiatan Lustrum ke-50 fakultas itu yang digelar September mendatang. “Alumni FH Unsyiah angkatan 85 yang sekarang berdomisili di luar Aceh juga mendukung, bahkan mereka akan hadir pada hari puncaknya,” ungkap Zakaria Muda, Ketua Harian Forum Silaturrahmi Alumni FH Unsyiah itu, Senin (22/8) di Banda Aceh. Menurut Zakaria, sejumlah alumni FH angkatan 1985 banyak yang terlibat dalam kepanitiaan Lustrum fakultas yang telah berusia 50 tahun tersebut. “Sebagian agenda Lustrum telah berjalan,” sebut Ria Fitri, dosen FH Unsyiah dari alumni angkatan 85 ini. (b04)

560 Sapi Bantuan Mulai Disalurkan TAKENGEN (Waspada) : Memenuhi kebutuhan 1.500 hewan ternak untuk 100 petani di Ketapang II, Kec. Linge Aceh Tengah, sebanyak 560 ekor sapi mulai disalurkan. Hewan bantuan yang akan dikembangkan oleh masyarakat duafa dan pakir ini ratarata berumur 1,5-2 tahun. Demikian ungkap Kadis Peternakan dan Perikanan Aceh Tengah Absardi, Selasa (23/8) di Pasar Hewan, Lukup Badak, Aceh Tengah. “Sebelumnya, tahap pertama telah disalurkan hewan ternak jenis sapi bali sebanyak 400 ekor ke Ketapang II,” ujarnya. “Dan untuk tahap kedua, 160 ekor sapi akan kami salurkan (Rabu, 24/8). Hal ini dilakukan untuk memenuhi target penyaluran sapi ke petani sebanyak 50 persen tahun ini dari 1500 ekor sapi yang akan diberikan,” katanya. Menurutnya, selain masih dibutuhkan ratusan ekor sapi lagi untuk peternak sapi di wilayah peternakan Ketapang II, juga untuk areal Ketapang I masih mengalami kekurangan 285 ekor sapi.(cir/ b18/cb04)

Waspada/Tarmizi Ripan

KOMANDAN Distrik Militer (Dandim) 0109/ Singkil Letkol (Inf) Afson R Sirait memperkenalkan personilnya epada Danrem, Rabu (24/8).

Danrem 012/TU Terharu Nyanyian Indonesia Raya Di Singkil SINGKIL (Waspada) : Komandan Resort Militer (Danrem) 012/ TU Kol (Inf) PurnawanWidi Andaru merasa terharu saat menyanyikan lagu Indonesia Raya bersama masyarakat Aceh Singkil dan Subulussalam di aula Makodim, Ketapang Indah Singkil Utara, Rabu (24/8). “Saya merasa terharu lagu Indonesia Raya yang kita nyanyikan bersama tadi, karena terkait baru sepekan ulang tahun kemerdekaan Republik Indonesia yang ke-66,” sebut Purnawan Kebersamaan dengan kalangan masyarakat menyanyikan lagu kebangsaan tersebut merupakan kesan tersendiri bagi perwira menengah yang mempunyai wilayah tugas teritorial dari Sabang hingga ke Aceh Singkil. Kunjungan kerja Purnawan Widi Andaru ke Aceh Singkil yang disambut Dandim 0109/ Singkil Letkol (Inf) Afson R Sirait, Wakil Bupati H Khazali dan Wakil Wali Kota Affan Alfian merupakan perdana setelah bertugas empat bulan sebagai Danrem 012/ Teuku Umar. Danrem juga merasa prihatin dengan aksi kekerasan menggunakan senjata api yang terjadi belakangan ini seperti yang terjadi di Aceh Barat Daya dan Meulaboh, sembari meminta partisipasi masyarakat dalam menjaga keamanan lingkungan membantu aparat kepolisian. (b30)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan

15:45

GA 147 Medan/Jakarta

16:20

Y6 537 Medan

19:15

Y6 538 Medan

07:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

AK 305 Kuala Lumpur *

12:20

AK 306 Kuala Lumpur*

12:45

FY 3401 Penang **

14:10

FY3400 Penang **

14:30

Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

C7 keuntungan sendiri,” urai Affan. Ingatkan Pemilik Warung Dalam sidak itu, LO Polres Kompol Mirwazi yang menemukan pemilik warung sedang melayani penjual minta penjual dan pembeli menghormati suasana Ramadhan, dengan tidak berjualan makanan di siang Ramadhan. Bahkan terhadap dua orang pengunjung yang sedang minum kopi di sana, Mirwazi minta identitas dan diingatkan tidak mengulangi aksi serupa. Kepada pemilik usaha Toko Sepatu Kembar Jaya yang ditengarai belum memiliki izin usaha, Kadis Perindagkop dan UKM Darmansyah minta segera diurus. (b33)

Balapan Liar Di Aceh Tengah Meresahkan Waspada/Khairul Boangmanalu

PENJUAL daging tak layak konsumsi sekira 7kg saat akan menyerahkan dagangannya untuk disita ketika Wakil Wali Kota Affan Bintang melakukan sidak, Rabu (24/8).

Gajah Kembali Mengamuk Di Pijay MEUREUDU (Waspada): Kawanan gajah liar berjumlah sekitar 15 ekor kembali meyerang perkebunan warga di kawasan pegunungan Krueng Tijeu,Beuracan, Kabupaten Pidie Jaya. Demikian lapor Syamsuddin, 39 warga Beuracan, kepada Waspada, Rabu (24/8).

Akibat amukan Gajah ini, puluhan hektare (ha) kebun pisang dan Kakau (Coklat-red) serta tanaman palawija lainnya hancur diobrak-abrik. Kendati sudah sering diganggu kawanan gajah, namun Pemkab Pidie Jaya melalui dinas terkait tidak merenspon keluhan para petani yang mengaku merugi ratusan juta rupiah akibat banyak tanaman siap panen sudah dihan-

curkan binatang berbadan lebar dan berbelalai panjang itu. Syamsuddin, mengisahkan kawanan gajah pengrusak tanaman petani Beuracan itu acap kali berkeliaran di areal kebun warga dan sekitar permukiman penduduk. Binatang itu beraksi mulai sore hari sampai subuh. Ratusan batang tanaman, seperti pinang, Kakau hancur dimakan binatang itu. Selain memakan tanaman seperti pinang, kawanan gajah itu juga menghancurkan tanaman seperti kacang-kacangan, cabai, dan sebagainya hancur akibat dipijak kawanan gajah. “Warga sangat takut, karena kawanan gajah liar itu sering beraktifitas pada malam hari. Mereka meraung-raung. Bahkan menganggu kenyamanan jamaah ketika sedang menunaikan shalat tarawih,” kata beberapa warga sekitar pegunungan Beuracan, Pidie Jaya. Sulaiman, warga lainnya sangat mengharapkan Balai Konservasi Sumber Daya Alam

(BKSDA) Banda Aceh, segera turun tangan mengatasi gangguan gajah liar. Dia khawatir bila serangan terus terjadi bisa menimbukan korban jiwa manusia. Berbagai usaha telah dilakukan untuk mengusir binatang berbelalai panjang itu, baik dengan meledakkan meriam bambu atau karbit maupun dengan api obor tapi usaha itu malah sia-sia . Uniknya, strategi yang dicenjarkan kawanan gajah liar tersebut menghindari dengan memamfaatkan kesempatan manakala para petani tidak berada di tempat. “Terutama menjelang magrib dan kembali setelah Subuh sementara tanaman selama semalaman ratarata diobrak abrik 0,5 Ha hingga 1 Ha lebih,”jelasnya. Atas kondisi yang semakin mencemaskan, terang Sulaiman, warga sangat mengharapkan peran dan penanganan serius dari Badan Konservasi Sumber Daya Alam (BKSDA) Provinsi. (b20)

Realisasi APBA 2011 Lamban BANDA ACEH (Waspada): Hingga 24 Agutus 2011, realisasi penggunaan Anggaran Pendapatan dan Belanja Aceh (APBA) tahun 2011 masih rendah dari target. Dinas BMCK termasuk yang realisasinya rendah hanya 16,79 persen. Dalam rapat pimpinan yang dihadiri para SKPA, terkait program percepatan kegiatan (P2K) yang dipimpin Dr Taqwallah, Rabu (24/8) di kantor DPKKA Banda Aceh terungkap, realisasi keuangan baru 36,2 persen dari 42 persen yang ditargetkan per

24 Agusts 2011. Sedangkan realisasi fisik baru sebesar 36,3 persen dari yang ditargetkan mencapai 45 persen pada 24 Agutus 2011. Padahal target capaian per 24 Agutus 2011 fisik 45 persen dan keuangan 42 persen merupakan instruksi Gubernur Aceh. “Realisasi APBA 2011 dengan pagu anggaran Rp7,975 triliun masih rendah, karena hingga H-1 realisasi keuangan minus 5,9 persen dan fisik minus 6,7 persen,” tutur Taqwallah, Ketua Tim Program Percepatan

Kegiatan (P2K) pada rapim tersebut. Pada rapim yang dihadiri Asisten II Setda Aceh T Said Mustafa, terungkap SKPA yang masih rendah realisasi keuangan maupun fisik APBA 2011 di antaranya Dinas BMCK dengan realisasi terendah 16,79 persen disusul Dinas Kelautan dan Perikanan 26,46 persen. Berikut Dinas Pengairan baru mampu meralisasikan sekitar 30 persen serta Dinas Sosial 31,48 persen. (b07)

Penipuan Melalui HP Di Nagan Raya, Rp3 Juta Raib NAGAN RAYA (Waspada) : Penipuan melalui HP terjadi di Nagan Raya, modus penipuan itu dengan cara mengaku tertangkap bawa sabu-sabu. Kasus ini dialami M Isa, warga Desa Paya Undan, Kec. Seunagan, Kab. Nagan Raya. Kasusnya berawal ketika korban mendapat telepon di rumah dari seseorang yang mengaku dari polsek sudah menangkap MJ, anak korban. Penelepon itu meminta uang tebusan Rp50

juta untuk membebaskan MJ. Nomor HP pelaku 08126509 1844 serta memberi Bank BRI Cabang Kisaran dengan nomor rekening 03230100165953.3 atas nama Mulya. M Isa dengan tidak sadar memenuhi permintaan pelaku demi keselamatan anaknya MJ. “Anak Bapak Mj sudah kami tangkap dan sekarang berada di Kapolsek Seunagan bila ingin dibebaskan harus menyediakan uang sebesar Rp50 juta, jika

tidak anak bapak kami bawa ke Kapolres,’’ kata Isa sambil meniru perkataan penelepon gelap. Setelah itu korban hanya sanggup mentransfer sebanyak Rp3juta. Kapolres Nagan Raya AKBP Heri Heriyandi melalui Kapolsek Seunagan Ipda Dedi Supriyatno, Rabu (24/8) mengimbau masyarakat Nagan Raya jangan terlalu percaya dengan modus penipuan yang berbagai cara dilakukan. (cmjr)

Mauliddin, Petani Aceh Jaya Ke Istana Negara MAULIDDIN, 34, petani asal Desa Masen, Kecamatan Sampoiniet, Aceh Jaya, berhasil meraih penghargaan sebagai petani padi berprestasi tingkat nasional. Dia mendapatkan kesempatan untuk hadir pada upacara perayaan Proklamasi Kemerdekaan RI yang ke 66 di Istana Negara, beberapa waktu lalu. Selain itu, Mauliddin juga berkesempatan bertatap muka langsung dengan Presiden SBY pada saat temu ramah dengan putra-putri bangsa yang berprestasi dari seluruh Indonesia, Kamis (18/8) malam yang diadakan di Hall D, Jakarta International Expo Kemayoran. Maulidin merupakan salah seorang petani binaan Caritas Czech Republik (CCR) yang ma-

suk ke Aceh Jaya tahun 2008 untuk membantu mata pencaharian korban konflik dan musibah tsunami. Salah satunya dengan mengembangkan sistem pertanian organik Sistem of Rice Intensification (SRI). “Mauliddin sendiri bergabung dalam satu kelompok tani bernama ‘Cicoba’, sebuah kelompok khusus untuk menguji metode SRI,” ungkap Communication Officer CCR Isfani Yunus, Senin (22/8) . Pada awalnya, kata dia, lelaki ini merasa kurang tertarik dengan kegiatan SRI yang diperkenalkan Caritas, apalagi dengan metode ini menurut mereka aneh, karena di luar kebiasaan cara bercocok tanam. Walaupun awalnya skeptis, Mauliddin tetap mencoba mengikuti segala aktivitas kelompok, bahkan selalu hadir pada saat sekolah lapangan. Sebagai seorang pelatih lokal metode SRI, sebut Isfani, nama Mauliddin mulai dikenal

oleh petani di desa lain. Masyarakat dari desa lain mulai berdatangan untuk menimba ilmu pertanian dari Mauliddin, mereka belajar mengolah lahan dari proses awal hingga selesai. Pada awal 2010, Caritas secara resmi mengangkat Mauliddin sebagai fasilitator lokal SRI dengan tugas utama memberikan pelatihan bagi kelompok petani di desa lainnya. Pada pertengahan 2010, Balai Penyuluhan Pertanian (BPP) Sampoiniet di Patek, Aceh Jaya memutuskan mengirim profil Mauliddin sebagai calon petani teladan Aceh Jaya untuk mengikuti lomba petani teladan tingkat kabupaten dan provinsi. Dia terpilih sebagai petani terbaik di Aceh. Setelah screening dan seleksi yang dilakukan di Kementerian Pertanian RI, Mauliddin akhirnya terpilih menjadi satu dari 4 putra bangsa berprestasi dari Provinsi Aceh tahun 2011 yang mendapatkan penghargaan dari Presiden Republik Indonesia.(b07)

TAKENGEN (Waspada) : Setelah sempat terhenti selama setahun terakhir, aksi balapan liar kembali meresahkan dan menodai kegiatan ibadah warga di Pegasing Aceh Tengah. Ironinya kebut-kebutan sepeda motor berlangsung ketika umat Islam sedang melaksanakan ibadah shalat tharawih. Aktivitas ilegal terjadi di ruas jalan sepanjang 500 meter di antara Kampung Uning, Kayukul hingga Sp. Kelaping, Kec. Pegasing. Diduga pelaku (joki) balapan liar ini memanfaatkan jalur negara antar provinsi dari dan ke Takengen menuju Gayo Lues karena kondisi jalan beraspal lurus tanpa belokan. Suara raungan mesin kendaraan roda dua yang sedang berpacu dibarengi dengan sorak ria anak remaja belasan tahun kerap terdengar di antara kegiatan shalat Tarawih. Bahkan ada di antara mereka mencoba mengemudikan kendaraan ini dengan satu roda, mengangkat kepala sepedamotornya. Selain itu kroser edan yang memanfaatkan arena sarana umum itu kerap membahayakan pengguna jalan lainnya. Karena mereka juga ‘berlaga” tanpa lampu dan helm pengaman. “Kami cemas dan khawatir terhadap perilaku remaja ini. Mereka ngebut tanpa perhitungan.

Bahkan suara kereta mereka (sepeda motorred) selalu mengganggu warga yang melaksanakan shalat tarawih,” kata Tamrin, 39, Minggu (21/8) warga setempat usainya shalat tarawih. Bukan itu saja katanya, balapan liar itu telah berlangsung hampir setiap malam di bulan Ramadhan ini. Kendati belum pernah terjadi kecelakaan, namun akibat aksi itu kadang kala mengundang tangis balita dan mengganggu tidur para warga. Secara terpisah, Senin (22/8), Camat Pegasing Syarifuddin SP melalui Sekcam Maidin Melala menyayangkan aktivitas menyimpang sebagian kawula remaja itu. Aksi balapan liar ini juga telah pernah dibahas dengan beberapa tokoh kampong bersangkutan. Namun hal ini juga belum membuahkan hasil, mereka kabur ketika disweeping. Kapolres Aceh Tengah AKBP Edwin Rachmat Adikusumo, melalui Kasatlantas AKP M Nuzir S menjelaskan akan melakukan penertiban aksi balapan liar ini. Namun sebelumnya, pihak kepolisian juga telah mengadakan razia rutin setiap malam. Hal ini diharapkan mampu menciptakan kenyamanan beribadah bagi umat muslim. (cir)

Jamaluddin T Muku Bagi Paket Lebaran Di Aceh Tamiang KUALASIMPANG ( Waspada): Anggota DPR Provinsi Aceh ( DPRA) ,Drs.H.Jamaluddin T Muku membagi-bagikan paket lebaran kepada kaum duafa se Kabupaten Aceh Tamiang. Pembagian paket menyambut Hari Raya Idult Fitri 1432 H. Anggota DPRA ,Jamaluddin T.Muku ketika ditanya Waspada, Selasa ( 23/8) malam menyatakan,dirinya membagi-bagikan paket lebaran untuk kaum duafa di 12 Kecamatan dalam wilayah Kabupaten Aceh Tamiang. “ Tetapi khusus untuk Kecamatan Bendahara, Banda Mulia, Seruway,Kota Kualasimpang,Karang Baru, Kejuruan Muda langsung saya yang datang ke rumah-rumah kaum duafa seusau shalat Tarawih sampai pukul 02:00,” terang Jamaluddin. Menurut Jamaluddin ,kehidupan kaum duafa yang dikunjunginya benar-benar memang perlu mendapat perhatian dan perlu juga dipikirkan bagaimana solusinya. “ Tentu saja untuk mewujudkan semua itu diperlukan program terobosan yang handal dan memang harus ada orang yang mau melaksanakan program,” terang Jamaluddin T.Muku yang telah dideklarasikan Partai Demokrat sebagai kandidat Bupati Aceh Tamiang berpasangan dengan Drs Syuib Araby,US,MAP pada Pilkada Aceh Tamiang tahun 2012 nanti. Adapun paket lebaran dan zakat dari Jamaluddin T.Muku yang dibagi-bagikan untuk kaum duafa yang terdiri abang becak, fakir miskin, janda miskin dan kaum duafa lainnya di

Waspada/Muhammad Hanafiah

ANGGOTA DPR Provinsi Aceh, Jamaluddin T.Muku menyerahkan paket lebaran untuk kaum duafa di Kecamatan Kejuruan Muda, Kab.Aceh Tamiang, Selasa (23/8) malam. Kabupaten Bumi Muda Sedia itu adalah terdiri dari 500 lusin sirup, 500 potong kain sarung, uang zakat Jamaluddin dari gaji sebagai anggota DPRA sebesar Rp 10 juta dan ada juga paket sembako yang semuanya telah dibagi-bagikan kepada kaum duafa se Aceh Tamiang. (b24)

Situasi Politik Bakal Panas, KNPI Banda Aceh Serukan Pilkada Damai BANDA ACEH (Waspada) : Situasi politik khususnya dalam momentum Pilkada Aceh diperkirakan bakal kembali “memanas” pasca lebaran. Berkaitan dengan itu, KNPI Kota Banda Aceh menyerukan semua pihak untuk bersama menggalang tekad mendukung pelaksanaan Pilkada Aceh berlangsung damai dan demokratis. “Jangan sampai energi kita habis untuk Pilkada, padahal masih banyak hal lain yang menyangkut hajat hidup dan kesejahteraan rakyat yang semestinya tidak boleh dilupakan,” kata Ketua KNPI Kota Banda Aceh Sabri Badruddin di Banda Aceh, Selasa (23/8). Ditanya pendapatnya seputar tolak tarik jadwal Pilkada, Sabri yang ditemui usai acara buka puasa bersama Walikota Banda Aceh dan DPD KNPI Kota Banda Aceh beseta seluruh elemen pemuda di Kota Banda Aceh, menyatakan, menyerahkan sepenuhnya masalah ini pada ketentuan yang berlaku. “Pilkada harus berjalan damai tanpa boikotboikot dan kekerasan. Masalah siapa yang

terpilih, kita serahkan sepenuhnya pada rakyat,” ungkap Sabri yang juga anggota DPRK Banda Aceh. Sabri Badruddin mengharapkan seluruh bakal calon harus siap kalah dan siap menang. “Semoga semangat siap kalah siap menang tidak hanya slogan, atau jangan hanya siap menang tapi tidak siap kalah,” tegas Sabri. Sabri Badruddin menyatakan, secara institusi KNPI bersikap netral dan tidak mendukung siapapun yang maju sebagai Gubernur/Wakil Gubernur Aceh maupun Walikota/Wakil Walikota Banda Aceh mendatang. “Yang penting setiap program pembangunan kedepan harus tetap memiliki porsi yang optimal dalam pembinaan kepemudaan,” katanya. Dalam acara yang turut dihadiri Walikota Banda Aceh Mawardi Nurdin, Wakil Walikota Illiza Saaduddin Djamal, Ketua KNPI Aceh Ihsanuddin MZ, anggota DPRK, Muspida dan unsur kepemudaan itu juga dilakukan pemberian santunan anak yatim. (b07)

PWI Aceh Serahkan Tali Kasih Kepada Anak Yatim Dan Buka Puasa Bersama BANDA ACEH (Waspada) : Di bulan Ramadhan yang penuh berkah dan maghfirah, PersatuanWartawan Indonesia (PWI) Cabang Provinsi Aceh menyerahkan tali kasih (santunan) kepada anak yatim piatu, dan melaksanakan buka puasa bersama wartawan serta instansi pemerinta/ swasta. Kegiatan yang dirangkai dengan mendengar ceramah keagamaan, buka puasa bersama, salat berjamaah serta santap malam dilaksanakan di Kantor PWI Cabang Aceh di kawasan Simpang Limong, Jalan T. Angkasah No.5 Kuta Alam, Sabtu (20/8). Acara yang berlangsung sederhana namun khidmad dan penuh keakraban itu dihadiri langsung Ketua PWI Cabang Aceh, Tarmilin Usman, SE, M. Si beserta jajaran pengurus harian plus pengurus seksi lainnya, Dewan Penasehat, H. Harun Keuchik Lumiek, Ketua DKD (Dewan Kehormatan Daerah), H Adnan, NS, S.Sos, Kabag Humas Setdaprov Aceh, Usamah El-Madni, para wartawan se Banda Aceh dan Aceh Besar, anak

yatim dan ahli waris wartawan. Ketua PWI Cabang Aceh, Tarmilin Usman, SE. MSi mengatakan, kegiatan tersebut merupakan agenda tetap PWI berharap bisa menjadi wahanan untuk mempererat jalinan silaturrahmi antara sesama pengurus PWI, anak yatim, dan kurang mampu, janda wartawan, instansi, masyarakat dan juga wartawan yang non PWI. Sementara, dalam tausiyahnya Drs H Bustamam Ali mengingatkan bahwa sebagai makhluk yang diciptakan Allah dari tanah, hendaknya manusia tidaklah berlaku sombong dan angkuh. Sebab semua insan kedudukannya sama di mata Allah dan yang membedakannya hanya keimanan dan ketaqwaan. Dalam kesempatan itu pula Bustamam mengingatkan tentang lailatul qadar di mana umat yang semakin mendekatkan dirikepada Allah SWT di sepuluh hari terakhir bulan Ramadhan, mudah-mudahan diberi Allah SWT kepadanya satu malam yang lebih baik dari seribu bulan.(b21)


Aceh

C8

WASPADA Kamis 25 Agustus 2011

Harga Emas Di Aceh Timur Naik Tajam Permintaan Meningkat Hingga 80 Persen IDI (Waspada): Harga emas dalam sebulan terakhir terus memperlihatkan angkat kenaikan yang signifikan. Menjelang pekan keempat bulan Ramadhan yang juga H-5 Idul Fitri 1432 hijriah, harga emas Rp1.650.000 per mayam atau berkisar Rp495.000 per gram.

Waspada/Samsuar

SEJUMLAH pekerja sedang membongkar muatan bahan sembako dari sebuah truk di areal bongkar muat di gudang Ilion, Kota Langsa, Rabu (24/8). Menjelang Idul Fitri 1432 H, kebutuhan sembako warga Kota Langsa meningkat tajam.

Truk Penuh Gula Diduga Ilegal Diamankan BC Langsa LANGSA (Waspada): Sebuah truk dipenuhi muatan gula pasir ditarik ke kantor Bea dan Cukai Kota Langsa karena diduga muatan gula merupakan gula yang di impor secara ilegal, Rabu (24/8). Kepala Kantor Pengawasan dan Pelayanan Bea dan Cukai Langsa,Amri SH melalui keterangan tertulisnya yang diterima wartawan, mengatakan penemuan satu unit truk BK 9364 BK yang diduga membawa gula ilegal sekira pukul 20:00 oleh tim Bea dan Cukai Langsa dipimpin Ade Fitriansyah selaku Kasubsi Penindakan dan Penyelidikan, di halaman Gudang GIBSI Desa Matang Seulimeng. Namun saat ditemukan sopir dan kernet truk tidak berada di tempat.“Karena curiga akan muatan truk,maka petugas memeriksa lebih rinci terhadap muatannya dan ternyata benar barang bawaannya adalah gula impor dari negara luar,” ungkapnya. Kemudian,setelah hasil pengecekan lapangan sudah final, selanjut truk beserta muatannya disegel dan dibawa ke kantor Bea dan Cukai Langsa. Menurutnya impor gula dilarang masuk dari perairan di Aceh karena barang ini adalah termasuk barang pembatasan sesuai dengan Keputusan Menteri Perindustrian dan Perdagangan Nomor 527/MPP/KEP9/2004 Jo Per.Men Perdagangan No.18/M-DAG/PER/4/2007, serta Undang-undang nomor 7 tentang Kepabeanan pasal 102 huruf b dengan ancaman pidana paling singkat satu tahun penjaran dan pidana penjara paling lama 10 tahun dan denda paling sedikit Rp50.000 000 dan paling banyak Rp500 juta. (b25/b22)

Waspada / Syahrul Karim

YOESDINOER, pemrakarsa kegiatan acara berbuka puasa Wartawan dengan Walikota Langsa Drs Zulkifli Zainon, MM, Dan Dim 0104 Aceh Timur Letkol Inf. Mohammad Hassan dan anak yatim. Pada gambar Yoesdinoer saat melayani langsung anak yatim menjelang berbuka puasa di Café Stroom Langsa, Senin (22/8).

Wartawan Langsa Santuni Anak Yatim LANGSA (Waspada) : Wartawan memiliki andil yang tidak ternilai harganya dalam pembangunan bangsa. Jasa wartawan dalam menyampaikan informasi, memang sudah diakui berbagai kompunen di belahan dunia meski informasi yang disampaikan tersebut terkadang mengundang perdebatan dalam masyarakat. “Saya, dalam hal ini tidak menyalahkan wartawan, akan tetapi mempersoalkan sumbernya yang tidak konsisten. Malah ada sumber yang selalu berubah-ubah dalam setiap keterangannya,” tandas Drs H Ibrahim Daud yang mengisi tausiah (ceramah) pada acara buka puasa bersama antara wartawan Kota Langsa dan sekitarnya dengan Walikota Langsa Drs Zulkifli Zainon, MM dan Dan Dim 0104 Aceh Timur Letkol Inf. Mohammad Hassan di Café Stroom Langsa, Senin (22/8). Tgk. Ibda, demikian nama ustadz populer di Kota Langsa itu, menunjuk kasus Nazaruddin yang sempat membingungkan masyarakat. Menurut Ibda, hal itu terjadi karena Nazaruddin tidak konsisten dalam keterangannya bahkan terkadang selalu berubah-ubah. Ibrahim Daud menyebutkan, wartawan tidak salah karena sumbernya jelas. “Wartawan kan tukang tulis. Apa yang dibilang, itu yang ditulis. Jadi Wartawan menulis yang dikatakan sumbernya,” kata Ibda. Namun demikian, wartawan tidak terlepas dari dosa jika tidak dapat melaksanakan tugas jurnalis dengan baik. Sebagai manusia, wartawan juga tidak terlepas dari dosa apabila menyiarkan berita yang tidak benar. ‘’Saya berharap wartawan dapat menulis berita yang benar sesuai dengan kenyataan/peristiwa untuk menghindari dari azab dosa Allah SWT pada hari kemudian nanti. Hari ini wartawan telah berbuat yang terbaik dengan menjamu (memberi makan) orang yang berbuka puasa apalagi didalamnya ada anak yatim, katanya. “Cukup banyak pahala wartawan atas kegiatan ini,” tandasnya lebih lanjut. Acara berbuka puasa wartawan yang diprakarsai Yoesdinoer ini, sudah dilaksanakan secara berturutturut selama tiga tahun di tempat yang sama.Yang membedakan, kata Buyong, demikian nama akrab wartawan itu, acara buka berbuka puasa tahun ini turut mengundang anak yatim, sekaligus dalam kesempatan tersebut berkenan menyatuni mareka yang seluruhnya berjumlah 50 orang. “Jangan lihat jumlahnya, tetapi yang penting kebersamaan wartawan untuk merasakan kebutuhan anak yatim,” kata Buyong lebih lanjut. (b26)

Adi, Pemilik Toko Mas Tiara di Kota Idi, kepada Waspada, Rabu (24/8) menjelaskan, harga emas dalam sebulan terakhir terus memperlihatkan angka kenaikan. “Kenaikannya di luar perkiraan kami selaku pedagang emas, dan tidak tertutup kemungkinan H-2 Idu Fitri harga emas capai Rp1,8 juta sampai Rp2 juta per mayam,” ujarnya. Adi menyebutkan, harga emas yang kini harganya Rp495.000 per gram sebulan sebelum mamasuki bulan ramadhan hanya Rp335.000 per gram. “Ini harga emas jenis London A. Kalau harga emas kadar 24 dan 22 maka harganya di bawah dari harga emas jenis London A dan jenis London 99,” sebut Adi seraya mengatakan, harga emas mengikuti kurs dolar dan harga emas dunia secara umum. Ketika disinggung persentasi pembeli menjelang Lebaran Idul Fitri 1432 hijriah? Adi mengatakan, mulai pekan kedua bulan Ramadhan hingga pekan

PNS Jangan Tambah Libur LANGSA (Waspada) : Para Pegawai Negeri Sipil (PNS) dan tenaga honorer di lingkungan Pemkab Aceh Timur diminta tidak menambah hari libur lebaran pada hari raya Idul Fitri 1432 H, Rabu (24/8). “Bila ada PNS tetap membandel alias bolos, maka siapsiap menerima sanksi tegas,” ujar Kabag Humas dan Protokol Setdakab Aceh Timur T Munzar SE melalui Kasubbag Humas Syamsul Qamal. Terkait aturan tentang cuti bersama ini untuk indahkan oleh seluruh PNS dan tenaga honorer, Kabag Humas menjelaskan Bupati Aceh Timur melalui Sekretaris Daerah juga telah menyampaikan surat tertulis tentang cuti bersama tersebut . Dalam surat Nomor 061.2/ 5923 tertanggal 23 Agustus 2011, dinyatakan menindaklanjuti surat Gubernur Aceh Nomor 061.2/26206 Tanggal 22 Agustus 2011 hal cuti bersama berdasarkan Keputusan Bersama Menteri Agama, Menteri Tenaga Kerja dan Transmigrasi dan Menteri Negara Pendayagunaan Aparatur Negara dan Reformasi Birokrasi RI Nomor 03 Tahun 2011, Nomor KEP.135/ MEN/V/2011 dan nomor SKB/ 02/M.PAN-RB/5/2011 Tanggal 20 Mei 2011 ditetapkan bahwa Senin, 29 Agustus 2011 dan Kamis-Jumat 1 s/d 2 September 2011 sebagai cuti bersama Idul fitri 1 Syawal 1432 H. Pada hari libur cuti bersama tersebut, bagi unit/satuan kerja organisasi yang berfungsi memberikan layanan langsung kepada masyarakat dan mencakup kepentingan masyarakat luas agar mengatur penugasan pegawai, sehingga pemberian pelayanan kepada masyarakat tetap berjalan sebagaimana mestinya. (b25)

Tiga DPC PD Buka Puasa Dengan Anak Yatim LHOKSEUMAWE ( Waspada): Tantowi, Wakil Bendahara DPC Partai Demokrat Aceh Utara mengatakan, pihaknya menggelar kegiatan buka puasa bersama tiga DPC yakni Bireun, Lhokseuamwe dan Aceh Utara. Pada kesempatan itu, pihaknya juga menyantuni sekitar 40-an anak yatim. “Tujuan inti dari kegiatan buka puasa bersama untuk mempererat hubungan silaturahim dengan DPC Bireun, Lhokseuamwe dan Aceh Utara. Sehingga ke depan, ketiga DPC akan lebih kompak memikirkan perkembangan ke arah yang lebih baik,” kata Tantowi. Untuk anak yatim diberikan santunan berupa uang THR dan buka puasa bersama. Kegiatan ini rutin digelar setiap tahun, sebagai bentuk rasa syukur kepada Allah SWT. (cmun)

keempat atau H-5 permintaan dan pembeli emas di Kota Idi— Aceh Timur—meningkat tajam dari 50 persen hingga 80 persen dari hari-hari biasa. “Pembelinya lebih banyak dari penjual, karena rata-rata kita di Aceh menjelang lebaran emas adalah bagian dari pakaian di badan. Halimatussa’diah, salah seorang pembeli emas asal Peu-

reulak saat dijumpai Waspada kemarin mengaku, dirinya menjelang Ramadhan tahun ini membeli emas karena kelebihan biaya hidup dari suaminya, sehingga dari pada disimpan lebih baik dibeli emas sebagai perhiasan badan untuk dirinya dan anak gadisnya. “Untuk saya dua manyam kalung, dan cincin serta anting

untuk anak saya. Jika nantinya kepepet biaya hidup, emas ini bisa jual lagi, apalagi semakin lama harganya semakin mahal. Kalau kita simpan uang pasti habis,” sebut Halimatussa’diah seraya mengatakan, tahun lalu dirinya mampu membeli emas 5 mayam, sementara tahun ini hanya 4 mayam. Amatan Waspada, puluhan

warga sejak pagi menjelang pukul 10:00 sudah mulai memadati Kota Idi, dengan berbagai keperluan dan kepentingan. Sebagian diantaranya berkerumunan di toko-toko emas yang berjejeran di Jalan Iskandar Muda. Rata-rata warga yang berdatangan ke sana lebih banyak membeli emas daripada menjualnya. (cmad)

Puluhan Abang Becak Disuluh KB IDI (Waspada) : Guna memberdayakan dan memberikan pemahaman terhadap masyarakat awam di Kabupaten Aceh Timur, puluhan abang becak di Kota Idi dan sekitarnya diberikan pemahaman Keluarga Sejahtera (KS). Hal tersebut dianggap penting mengingat selama ini masyarakat awam jarang mendapatkan ilmu terkait KB (Keluarga Berencana). Kepala Badan Pemberdayaan Masyarakat, Perempuan dan Keluarga Sejahtera (BPMPKS), Jamaluddin, Rabu (24/8) mengatakan, penyuluhan dan sosialisasi terhadap puluhan abang becak untuk meningkatkan sumber daya manusia (SDM) lebih-lebih kegiatan itu menjadi program tersebut. Kata Jamaluddin, penyuluhan tersebut digelar Rabu (24/8) selama sehari penuh dengan melibatkan sejumlah pemateri, baik dari Dinas Kesehatan Aceh Timur maupun dari Ikatan Dokter Indonesia (IDI) setempat. (cmad)

Waspada/Muhammad H. Ishak

EMAS TINGGI: Adi seorang pemilik toko emas sedang melayani konsumennya, Rabu (24/8) pagi terlihat melayani pembelinya

PA Tak Punya Itikad Selesaikan Kasus Ketua DPRK Langsa LANGSA (Waspada) : Penolakan Dewan PimpinanWilayah (DPW) Partai Aceh Kota Langsa ikut bersama tim Dewan Perwakilan Rakyat Kota (DPRK) Langsa bertemu Sekretaris Jenderal (Sekjen) Kementerian Dalam Negeri di Jakarta memperlihatkan tidak ada kemauan PA untuk menyelesaikan persoalan itu. Hal itu menurut T Faisal, Ketua Kaukus Pemuda Lintas Timur, Rabu (24/8), sebagai sebuah ketidakjujuran dalam berpolitik, seharusnya PA, bersikap dewasa dan mengede-

pankan hati nurani untuk bertekad menyelesaikan persoalan yang membelik salah seorang kadernya yang dikatakan sebagai kader potensial. “Jangan beralasan mereka enggan ikut ke Jakarta karena mengunakan uang rakyat, untuk persoalan yang telah jelas, kalau semuanya sudah jelas tentu tidak akan terjadi konflik yang berlarut-larut seperti saat ini, karena ini ikut menghambat proses pembangunan di Langsa. Ini karena yang bersangkutan merupakan salah satu top leader di daerah ini yaitu Ketua

DPRK yang ikut mengambil kebijakan dalam proses pembangunan,” ujarnya. Menyangkut soal surat dari Kemendagri memang sudah jelas, namun karena menterjemahkan isi surat tersebut dengan kemauan sendiri sehingga menghilangkan makna sebenarnya isi surat tersebut. “Keberangkatan ke Jakarta merupakan jalan penyelesaian paling tepat, karena surat yang menjadi pegangan baik oleh anggota DPRK maupun pengurus DPW PA berasal dari Kemen-

dagri, maka kita harus mendengar langsung penjelasan surat dari sumbernya, sehingga tidak menimbulkan multitafsir lagi seperti saat ini,” ujarnya. Ditambahkan, terlepas saat ini Zulfri sedang mengajukan Peninjauan Kembali (PK) atas kasusnya ke MA, namun masalah ini merupakan urusan yang berbeda, jadi tidak adalasan untuk Zulfri tidak taat hukum. Dia mengharapkan kepada DPW PA agar tidak menutup mata, masih banyak kader yang cerdas dan potensial lain. (b25)

Program e-KTP Di Aceh Timur Terancam Gagal IDI (Waspada): Meski banyak daerah menargetkan program e-KTP selesai tepat waktu, tetapi untuk Kabupaten Aceh Timur, Provinsi Aceh, hingga saat ini program e-KTP yang dicanangkan pemerintah terancam gagal. Pasalnya, hingga akhir Agustus 2011 instansi terkait memastikan hanya 6 kecamatan yang sudah tiba peralatan e-KTP yang didatangkan dari pusat. Padahal, sebagai bentuk keseriusan pihak terkait, Dinas Kependudukan dan Catatan Sipil (DPCS) Aceh Timur, telah melatih tenaga-tenaga teknis yang mampu mengoperasikan peralatan e-KTP yang ditugaskan di kantor camat masingmasing. “Anggaran minim, dan hingga kini baru enam kecamatan yang baru memiliki peralatan pengumpul data warga, sedangkan 18 kecamatan belum,” ujar Kepala BKCS Aceh Timur, Drs. Najmuddin, MAP. Kepada Waspada, Rabu (24/ 8), Najmuddin (foto) menyebutkan, enam kecamatan yang telah tersedia alat pengumpul data warga yakni Kecamatan Serbajadi, Peunaron, Darul Ikhsan, Nurussalam, Simpang Ulim, dan Kecamatan Idi Tu-

nong. Sementara 18 kecamatan lainnya masih menunggu datangnya peralatan. “Terkait kapan datangnya peralatan untuk 18 kecamatan lainya kita sudah melakukan koordinasi ke pusat, namun pihak pusat mengatakan akan segera menyusul,” ujar Najmuddin seraya menambahkan, jika semua peralatan itu belum tiba dan dipasang di setiap kecamatan maka pembuatan e-KTP belum dapat berjalan semuanya. Masih menurut Najmuddin, keadaan data penduduk sampai dengan 30 Juni 2011 di Aceh Timur dalam 511 desa yang terdiri dari 45 kemukiman di Disdukcapil Aceh Timur jumlah penduduk 404.374 jiwa, lakilaki 203.951 jiwa, perempuan 200.423 jiwa dari 97.511 Kepala keluarga (KK). “Sedangkan jumlah wajib KTP 261.276, orang dengan rincian laki-laki 130.187 orang dan perempuan 131.089 orang,” kata Najmuddin seraya mengatakan, realisasi yang telah memiliki KTP 248.701 orang (95 persen) dari jumlah penduduk, sisa yang belum memiliki KTP hanya (5 persen). Akte Kelahiran Harus Ditertibkan Di sisi lain Najmuddin

mengatakan, untuk penertiban akta kelahiran sesuai dengan Kepres RI Nomor 25 Tahun 2008 dan Qanun Aceh Nomor 6 Tahun 2008 mulai Januari 2012. “Umur lebih dari 1 (satu) tahun harus ada ketetapan Pengadilan Negeri baru dapat dikeluarkan Akta Kelahiran,” katanya seraya menandaskan, pihaknya sebelum Desember 2011 membuka secara umum sesuai dengan ketentuan pembuatan akte kelahiran. (cmad) DRS. NAJMUDDIN, MAP Kepala BKCS Aceh Timur

Pemkab Aceh Timur Gelar Pawai Takbir Di Pendopo Peurelak LANGSA (Waspada): Menyambut Idul Fitri 1432 H, Pemkab Aceh Timur dijadwalkan akan menggelar pawai takbir dan shalat Idul Fitri, Senin (29/8) malam dan Selasa (30/8) pagi . Kasubbag Humas Aceh Timur Syamsul Qamal mengatakan untuk pawai takbir dipusatkan di Pendopo Peureulak dengan start dimulai pukul 20:00 dan peserta pawai takbir dengan menggunakan kendaraan bermotor ini akan mengelilingi sejumlah kecamatan dari Peureulak hingga Idi Rayeuk dan berakhir di Peureulak. Pawai ini juga turut dimeriahkan oleh sanggar rapai Bandar Khalifah Peureulak. Sementara untuk shalat Idul Fitri 1432 H ( Id) dipusatkan di Masjid Agung Darussalihin Idi Rayeuk, Selasa (30/8) pukul 07:00 dan bertindak sebagai Khatib Tgk H Abdullah Atiby (dosen Fakultas Dakwah IAIN Ar Raniry Darussalam Banda Aceh) dan imam Tgk M Yusuf Jamil.(b25)

PTPN-I Langsa Gelar Pasar Murah LANGSA (Waspada) : PT Perkebunan Nusantara I Langsa, Aceh, kembali menggelar kegiatan pasar murah selama sepekan hingga 25 Agustus mendatang. Pasar murah ini khusus bahan sembako yang sangat dibutuhkan masyarakat. Kegiatan pasar murah ini merupakan tahap kedua setelah sebelumnya juga dilaksanakan kegiatan serupa menjelang bulan Ramadhan lalu. Menurut Direktur SDM & Umum PTPN-I Ir H Siswadi, kemarin, jumlah paket sembako yang diprogramkan dalam pasar murah ini ada 4.400 paket. Setiap paket terdiri dari 5 kg beras, 2 kg gula pasir dan 1 liter minyak goreng dengan total harga pasaran Rp 71.500. Namun PTPN-I hanya menjual dengan harga Rp 50.000. Hal ini dilakukan sebagai bentuk rasa kebersamaan selain sikap peduli perusahaan kepada masyarakat lingkungannya, katanya. Untuk mensukseskan program peduli perusahaan dalam bentuk pasar murah ini, sebut Siswadi lebih lanjut, PTPN-I melaksanakan dengan sistem operasi antar langsung ke lokasi dimana masyarakat berdomisili sehingga kemudian diharapkan mareka lebih gampang memperolehnya.Wilayah operasi di semua titik strategis di Kota Langsa, Kabupaten Aceh Timur dan Kabupaten Aceh Tamiang, tambah Saifullah, SE, staf Humas yang menangani kegiatan itu. (b26)

Waspada/Syahrul Karim

DIREKTUR Sumber Daya Manusia & Umum PTPN-I Langsa Ir H Siswadi (baju batik sebelah kanan, memegang map merah) saat melepas armada angkutan paket sembako dari poskonya di depan Stadion Langsa ke titik pendistribusian kepada masyarakat di tiga daerah masing-masing di Kota Langsa, Aceh Timur dan Aceh Tamiang.

Waspada/Ibnu Sadan

Ketua LIRA Cut Lem memasang baliho kampanye di sejumlah tempat yang isinya mengimbau Jangan Membenarkan Yang Salah dan Jangan Lagi Bohongi Rakyat.

Kampanye Tunggal LANGSA (Waspada) : Ketua LIRA Kota Langsa Cut Lem melakukan kampanye tunggal dengan mengusung isu jangan membenarkan yang salah dan jangan lagi bohongi rakyat. Kampanye dilakukan Cut Lem tanpa melibatkan siapapun pihak lain, dengan tujuan ingin membangun kekuatan sipil guna mengontrol jalannya pemerintahan yang benar. Sistem kampanye yang dilakukan selama ini, selain berbicara langsung dengan masyarakat di sembarang tempat, juga membuat beberapa baliho yang dipasang pada tempat-tempat strategis, seperti layaknya calon walikota memperkenalkan dirinya kepada warga. Ketika Waspada menanyakan target yang hendak dicapai dengan kampanye tersebut, Rabu (24/8), Cut Lem menjelaskan, pihaknya berharap agar masyarakat sipil timbul kesadarannya bahwa selama ini mereka sering tertipu. (b22)

Layanan SIM Polres Aceh Utara Kembali Normal LHOKSUKON ( Waspada) : Setelah sempat terhenti hampir 3 bulan akibat gangguan teknis, layanan pembuatan Surat Izin Mengemudi (SIM) di Polres Aceh Utara kembali normal, Selasa (23/8). “Masyarakat yang ingin membuat SIM, termasuk yang sudah mengantongi resi, kita imbau segera ke Polres. Masalah teknisnya sudah teratasi,” kata Kapolres Aceh Utara AKBP Farid BE, melalui Kasat Lantas, Iptu Andri Permana, kemarin. Pada kesempatan itu, Kasat Lantas atas nama Kapolres Aceh Utara juga menyampaikan permohonan maaf kepada masyarakat atas gangguan teknis pembuatan SIM yang terjadi selama ini. Menurut Kasat Lantas, gangguan itu di luar dugaan dan terkait dengan jaringan online di kantor Pusat di Jakarta. (cmus)


Waspada, Kamis 25 Agustus 2011