Page 1

Prakiraan Cuaca Senin (24/5) Medan 26-340C

Berastagi 18-28 0C

R. Prapat 26-340C

Parapat 19-29 0C

P. Siantar 20-300C

Sibolga 22-33 0C


Hujan guntur

BMKG Polonia

WASPADA Demi Kebenaran Dan Keadilan

SENIN, Pahing, 24 Mei 2010/10 Jumadil Akhir 1431 H

No: 23158 Tahun Ke-64

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 28 Halaman (A1-8, B1-12, C1-8)

Harga Eceran: Rp2.500,-

Sri Mulyani: Saya Pasti Pulang...

Anas Rangkul Ibas Jadi Sekjen

”NAMANYA saja Sri Mulyani… sudah pasti saya akan menjalankan tugas mewakili Indonesia. Pasti... Aku ora minggat lan wis mesti mulih…. (Saya tidak minggat dan pasti pulang...). Kalimat itu meluncur begitu saja dari Sri Mulyani Indrawati, 47, dalam perbincangan santai suatu petang di rumahnya. Menteri Keuangan Terbaik Se-Asia versi Emerging Market Forum (2006, 2007, 2008) dan Menteri Keuangan Pilihan Antara Tingkat Dunia versi Euromoney (2006) itu akan bertolak ke New York pada 26 Mei. Ia akan menjalani tugas barunya sebagai Direktur Pelaksana Bank Dunia yang bertanggung jawab atas 74 negara di kawasan Amerika Latin dan Karibia, Asia Timur dan Pasifik, serta Timur Tengah dan Afrika mulai 1 Juni 2010 sampai 2014, menggantikan pejabat lama, Juan Jose Daboub dari El Salvador. Masa transisi selama satu bulan di kantor baru itu akan ia gunakan juga untuk mencari tempat tinggal. ”Saya sedang konsolidasi dengan anak-anak dan suami. Yang besar kan kuliah di Australia; yang kedua masuk Kedokteran UI, program reguler; yang bungsu kelas II mau ke kelas III SMP.” Saya Menang Perbincangan dalam beberapa kesempatan itu memperlihatkan identitas Sri Mulyani yang lengkap; sebagai anak, ibu, istri, ilmuwan, dan birokrat, dan... sebagai manusia biasa. Ia bisa tertawa lepas—di luar senyum khas yang oleh banyak orang ditafsirkan sebagai ”sinis”—juga bisa menangis saat pidato seusai serah terima jabatan. Lanjut ke hal A2 kol. 6

BANDUNG ( Waspada): Meski putra Susilo Bambang Yudhoyono (SBY), Edhie Baskoro (Ibas) mendukung Andi Mallarangeng, namun Ketua Umum Partai Demokrat terpilih Anas Urbaningrum tetap akan memberikan tempat istimewa bagi Ibas. Penunjukkanya sebagai Sekjen PD tinggal menunggu kesepakatan formatur. “Soal Ibas itu memang permintaan kami semua itu tergantung tim formatur dan Mas Ibas,” kata Juru Bicara Tim SukAntara ses Anas, Saan Mustopa. Hal itu dikatakan Saan dalam konferensi pers di Posko Anas di area Kongres PD II di Hotel Mason Pine, Padalarang, Bandung, Jawa Barat, Minggu (23/5). Dalam kesempatan itu, Saan menegaskan bahwa kedua kandidat lainnya pun, Andi dan Marzuki Alie, akan dirangkul oleh Anas dalam kepengurusan DPP PD. “Akan kita berdayakan. Tidak mungkin aset itu kita lupakan. Pasti kedua orang ini akan mendapat tempat yang terhormat,” jelasnya. Anas Harap Tak Ada Dendam Anas Urbaningrum kepada para pesaingnya berharap tidak ada perasaan dendam setelah kalah dalam proses pemilihan. “Terimakasih atas dukungan Bang Andi dan Pak Marzuki. Semoga tidak ada perpecahan, hard feelings. Kedua beliau adalah pendukung di kongres, semua adalah kader nomor satu Partai Demokrat,” jelas Anas di Hotel Mason Pine, Padalarang, Bandung, Minggu (23/5) malam.

Data Paspor Para TKW Banyak Dimanipulasi

Kemenhub Akan Pangkas Tarif Penerbangan Haji

KUALA LUMPUR (Antara): Data paspor para TKW yang bekerja di Malaysia banyak dimanipulasi. Hal ini terungkap dalam dialog antara Ibu Ani Yudhoyono dengan para TKI (tenaga kerja wanita) bermasalah, “Saat dialog antara Ibu Ani Yudhoyono dengan TKW yang bermasalah ketika meninjau ‘Rumah Kita’ atau Wisma TKW di belakang kedutaan, pekan lalu, terungkap banyaknya manipulasi data TKW dalam paspor,” kata Juru Bicara Eminent Person Group (EPG) Indonesia Dr Musni Umar di Kuala Lumpur, Minggu(23/5). Karena itu, kata dia, pembenahan rekrutmen dalam negeri adalah inti dari perbaikan dan pelayanan pekerja migran Indonesia. Misalkan, ada seorang TKW asal Palembang berusia 13 tahun, masih kelas 6 SD, sudah dikirim ke Kuala Terengganu. Dalam paspor tertulis

22 tahun. “Ia membakar rumah dan mengambil dua notebook serta mencuri uang keluarga majikannya,” kata dia. Selain itu, ada seorang ibu yang sudah di atas 50 tahun, tapi tetap bisa dikirim sebagai pembantu ke Malaysia karena melakukan manipulasi usia menjadi dibawah 45 tahun. Menurut Musni, majikan TKW itu mengeluh tapi tidak bisa mengeluarkannya karena sudah membayar mahal kepada agensi pemasok pembantu asing untuk mendapatkan seorang pembantu. “Lagipula majikan saat itu sangat membutuhkan pekerja,” kata Musni, yang juga dosen di Universitas Islam Jakarta. Menakertrans Muhaimin Iskandar saat meresmikan “Rumah Kita” di Kuala Lumpur mengaku akan menindak tegas PJTKI jika menjadi pelaku utama dari manipulasi data

Lanjut ke hal A2 kol. 1

Lanjut ke hal A2 kol. 3


ANAS TERPILIH: Ketua Umum Partai Demokrat terpilih, Anas Urbaningrum (tengah) mengangkat tangan Marzuki Alie (kiri) dan Andi Mallarangeng (kanan) saat memenangkan voting di Kongres II PD, Padalarang, Bandung, Minggu (23/5).

Anas Ketum PD JAKARTA (Waspada): Anas Urbaningrum berhasil mengungguli Marzuki Alie dalam pemungutan suara memperebutkan kursi Ketua Umum DPP Partai Demokrat (PD) periode 2010-2015 dalam Kongres II partai berlambang bintang tiga tersebut yang berlangsung di Hotel Mason Pine,Padalarang, Bandung,Jawa Barat, Minggu(23/5). Kemenangan Anas berlangsung pada putaran kedua pemilihan Ketua Umum DPP Partai Demokrat. Pada putaran pertama, tampil tiga kandidat

yakni Anas Urbaningrum, Andi Malarangeng dan Marzuki Alie. Pemilihan putaran pertama menghasilkan 236 suara

(45 persen) untuk Anas Urbaningrum, 82 suara (16 persen) untuk Andi Mallarengeng dan 209 suara (40 persen) untuk Marzuki Alie. Sejumlah 2 suara tak sah dan dua peserta tidak menggunakan hak suaranya. Karena tak ada yang meraih 50 persen plus satu suara dari 531 suara, maka diadakan pemilihan putaran kedua diikuti oleh Anas dan Marzuki. Pada pemilihan putaran kedua ini, Anas memperoleh 280 suara, sedangkan Marzuki Alie

dengan 246 suara. Sempat Ricuh Sebelumnya proses penghitungan suara memilih Ketua Umum Partai Demokrat sempat ricuh sehingga panitia menghentikan sementara proses penghitungan suara. Kericuhan terjadi saat posisi Anas Urbaningrum di suara 252 dan pesaingnya Marzuki Alie memperoleh 218 suara.

Lanjut ke hal A2 kol. 3

JAKARTA (Antara): Kementerian Perhubungan (Kemenhub) memastikan akan memangkas lagi tarif dasar penerbangan haji dari 1.595 dolar Amerika Serikat perjamaah. Direktur Jenderal Perhubungan Udara Herry Bakti S Gumay saat dihubungi di Jakarta, Minggu (23/5) mengatakan, itu masih mungkin dipangkas dan dilakukan dalam waktu dekat. “Peluangnya di ‘margin’ maskapai. Juga, merundingkan kembali jasa kebandaraan di King Abdul Aziz, Jeddah, sehingga kita bisa membayar lebih murah,” katanya. Namun, tentang jumlah pemangkasannya, Herr y belum bersedia merinci. “‘Kan masih proses. Jadi, belum ada angka,” katanya. Ia hanya memastikan, meski angka dari Kemenhub sudah disampaikan ke Menteri Agama, angka akhirnya kewenangan Menteri Agama dengan

maskapai. “Tugas kami hanya memberi masukan. Finalnya ada di mereka,” katanya. Herry mengatakan mendukung keputusan Kementerian Agama sebelumnya, yang menyatakan menghentikan wacana melakukan lelang penerbangan haji pada tahun ini. “Persiapan waktunya mepet. Selain itu, kedua maskapai, yakni Lion dan Batavia, masih diragukan bisa ikut ‘tender’ pada tahun ini,” katanya. Sebelumnya, Kementerian Agama menyatakan kemungkinan membatalkan rencana lelang penerbangan haji pada tahun ini. Artinya, Garuda Indonesia dan Saudi Arabian Airlines tetap menerbangkan jamaah pada tahun ini. Direktur Jenderal Penyelenggaraan Haji dan Umrah Kementerian Agama Slamet Riyanto menyebut perlu

Lanjut ke hal A2 kol. 6

Ainun Habibie, First Lady Yang Sederhana


KA TERJUNGKAL: Regu pertolongan China bekerja di lokasi di mana kereta api penumpang terjungkal di Dongxiang, Provinsi Jiangxi, timur China, Minggu (23/5).

BACA DI HALAMAN DALAM Transportasi Medan Mengarah Ke Massal Sejumlah kota metropolitan di Indonesia termasuk Medan akan diarahkan mengoperasikan angkutan massal, upaya mengurangi kemacetan lalu lintas. B1

Dua Terdakwa Korupsi Di Binjai Dituntut 54 Bulan Penjara Dua terdakwa korupsi di Pemko Binjai dituntut 54 bulan penjara ditambah denda Rp100 juta dan mengganti kerugian Rp434.525.300. C1

Mahasiswa Korban Konflik Terancam Dikeluarkan Sejumlah mahasiswa korban konflik di Unimus terancam dikeluarkan pihak akademik. Pasalnya, biaya kuliah mereka yang ditanggung pihak Pemkab setempat sudah dua bulan tidak dibayar. C3

JAKARTA (Waspada): Yunus Yosfiah, mantan Menteri Penerangan era Presiden BJ Habibie, memiliki kenangan tersendiri terhadap almarhumah Hasri Ainun Habibie, istri dari BJ Habibie. Menurut Yunus, Ainun Habibie adalah ibu negara yang memiliki sifat keibuan dan sederhana. Hal ini disampaikan Yunus saat melayat ke rumah duka di Jalan Patra Kuningan XIII, Minggu (23/5). “Sebagai orangtua, beliau sangat keibuan dan sederhana. Sebagai ibu negara di antara istri-istri di kabinet, saya rasa dia adalah panutan dalam berperilaku,” kata Yunus yang tampak berkemeja batik gelap. Hal yang tak terlupakan

oleh Yunus, ia mengenang Ainun Habibie sebagai sosok yang ramah dan murah senyum, tidak hanya kepada para pejabat negara, tetapi juga kepada siapa pun tanpa pandang bulu. “Sangat murah senyum dalam ungkapan serba teratur dan halus. Sosok ibu yang sangat mengayomi,” katanya. Hal serupa disampaikan oleh mantan hakim konstitusi Jimmly Asshidiqie. Ia mengatakan, Ainun Habibie adalah sosok ibu negara yang amat mencintai keluarga. “Beliau tidak pernah mencampuri urusan Pak Habibie sebagai Presiden. Sangat mencintai

Lanjut ke hal A2 kol. 3

Kereta Api Terjungkal, 19 Tewas BEIJING, China (AP): Satu kereta api penumpang terkena longsor dan terjungkal keluar rel Minggu (23/5) di timur China, yang menyebabkan sekurang-kurangnya 19 orang tewas dan mencederai lebih dari 70 lainnya, demikian menurut media pemerintah. Angka kematian terakhir melonjak dari laporan awal yang menyebutkan delapan orang tewas, ketika regu pertolongan menggali mayat-mayat penumpang lainnya di dalam gerbong yang tertimbun longsor, kata kantor berita Xinhua. Kereta api, yang meluncur ke daerah wisata Guilin itu, terjungkal sekitar pukul 02:00 Minggu dinihari di kawasan pegunungan dekat kota Fuzhou di timur provinsi Jiangxi, kata laporan China Central Television.

Lanjut ke hal A2 kol. 2


DOAKAN IBU AINUN: Ibu-ibu pengajian mendoakan almarhumah mantan ibu negara Hasri Ainun Habibie di kediamannya di kawasan Kuningan, Jakarta, Minggu (23/5).

Ibu Tiga Anak Tewas Gantung Diri


Ditanduk Tembus Ke Mulut Si Matador Tetap Hidup MADRID (Waspada): Seorang Matador Spanyol bernama Julio Aparicio, 41, membutuhkan dua operasi besar, setelah mengalami serangan brutal banteng, yang nyaris menewaskan di arena adu banteng Madrid. Opiparo, demikian banteng itu disebut menanduk tenggorokan Julio hingga ujung tanduknya tembus ke mulut (foto). Banteng berbobot setengah ton itu menyabet Julio hingga terjatuh. Lalu tanpa ampun, tanduknya yang tajam segera merobek lehernya dan menancap di tenggorokan Julio hingga tembus ke mulutnya. Banteng itu dengan amukannya menggangkat tubuh

Lanjut ke hal A2 kol. 1

TEBINGTINGGI (Waspada) Ibu tiga anak nekad mengakhiri hidup dengan gantung diri di kamar tidur rumahnya di Jalan Ir.H. Juanda, Ling.I, Kelurahan, Karya Jaya, Kec. Rambutan, Tebingtinggi, Minggu (23/5) sore. Menurut keterangan diperoleh Waspada, korban Lilis Aryati, 28, alias Yati pertama kali ditemukan tergantung dengan tali ayunan (tali jenis nilon) di atas tempat tidur kamar rumahnya oleh suaminya Rudi Hartono sepulang memancing di sungai. Percobaan bunuh diri, menurut warga, sudah sering dilakukan korban, namun selalu gagal karena dicegah keluarga. Di antaranya pernah mencoba gantung diri di belakang rumah persisnya di dekat kandang lembu. Kemudian diulangi dengan meminum racun

Lanjut ke hal A2 kol. 6

Bocah 13 Tahun Taklukkan Everest SEORANG bocah 13 tahun berhasil mencapai puncak Everest. Jordan Romero, (foto) bocah asal California AS itu pun dinyatakan sebagai orang termuda yang berhasil menaklukkan puncak gunung tertinggi di dunia. Romero berhasil mencapai puncak Everest hari Sabtu (22/5). Demikian seperti ditulis Reuters. Dalam tim pendakian ini, Romero ditemani ayahnya, Paul Romero. Sherpa atau guide asal Nepal juga ikut dalam pendakian ini. Gunung Everest menjulang setinggi 8.850 meter di atas permukaan laut. Sebelumnya rekor termuda pendakian gunung ini dipegang oleh Temba Tsheri, seorang pemuda Nepal berusia 16 tahun. Romero bukan asal-asalan mendaki gunung. Walau masih sangat belia, jam terbangnya sudah cukup tinggi. Dia tercatat pernah menggapai 5 puncak tertinggi dunia. Pun-


cak Kilimanjaro di Afrika, Elbrus di Eropa, Ancocagua di Amerika Selatan, Denali di Amerika Utara dan Cartenz di Indonesia.(dtc)

erampang Seramp ang - Belum saatnya orang luar pulau Jawa jadi Ketum - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Banda Aceh: Cuaca : Hujan Lokal Angin : Timur laut s/d Tenggara Kec. 10 s/d 30 km/jam

Provinsi NAD: Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pantai Barat: Berawan dan hujan ringan

Temperatur Maks/Min: 240C - 350C

BMKG Polonia

SENIN, Pahing, 24 Mei 2010/10 Jumadil Akhir 1431 H

No: 23158 Tahun Ke-64

Edisi Aceh

Terbit 28 Halaman (A1-8, B1-12, C1-8)

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim)

Anas Ketum Demokrat BANDUNG (Waspada): Anas Urbaningrum terpilih menjadi Ketua Umum (Ketum) Partai Demokrat untuk periode 2010-2015. Perolehan suara Anas yang menyentuh angka 266 suara pada putaran kedua itu menunjukkan perolehan sudah lebih dari 50 persen suara atau total 531 suara. Sorak-sorai pendukung terdengar bergemuruh di penghitungan suara pemilihan Ketua Umum Partai Demokrat, di Hotel Mason Pine, Bandung Barat, Jawa Barat, Minggu (23/5). Perolehan sementara untuk Ketua Fraksi Demokrat Anas Urbaningrum adalah 266 suara. Sedangkan suara untuk Marzuki Alie yang juga Ketua DPR mencapai 234 suara. Dengan posisi lebih dari 266 suara, artinya Anas memperoleh 51 persen suara. Perhitungan suara sempat dihentikan saat Anas Urbaningrum memperoleh 252 suara dan

Dikira Bom, Rupanya Telefon Genggam

Marzuki Alie 218 suara. Tibatiba sejumlah peserta mendatangi Anas untuk memberikan ucapan selamat. Sejumlah wartawan juga merangsek mendekati Anas. Puluhan petugas keamanan juga masuk sehingga suasana makin riuh. Dengan begitu, hasil sementara pemilihan Ketua Umum Demokrat itu akan menetapkan Anas Urbaningrum menjadi Ketua Umum Demokrat berikutnya, menggantikan Hadi Utomo. Kemenangan Anas ini Lanjut ke hal A2 kol. 3

Slank: Seni Ubah Pola Pikir Manusia BANDA ACEH (Waspada): Lewat seni lebih cepat mengubah pola pemikir manusia. Untuk itu konser damai ini di Banda Aceh bisa menghilangkan isu terorisme di Aceh, dan Aceh akan terus menjaga kedamaian, ungkap Kaka vokalis band Slank menjawab Waspada pada pertemuan dengan sejumlah wartawan di Hotel Nanggroe, Banda Aceh, Minggu (23/5). Kaka dan kawan-kawan optimis masyarakat Aceh bisa terus menjaga perdamaian, apalagi kata Kaka, di Aceh saat ini suasananya sedang sibuk dengan pembangunan sehingga masyarakat tidak mudah terpancing dengan isu yang tak jelas. “Saya yakin masyarakat Aceh pasti akan sibuk sendiri dengan pembangunannya, jadi otomatis mereka akan damai dengan sendirinya,” ujar Kaka. Slank identik dengan lagu kritikan, namun pada konser damai kali ini band ini membawakan lagu-lagu yang bertema tentang perdamaian. Sementara drummer Slank, Bimbim menjelaskan Slank akan mengeluarkan mini album barunya yang berjudul maju terus pantang mundur , direncanakan akan dikeluarkan 1 Juni mendatang melalui media handphone. Lanjut ke hal A2 kol. 7


KONSER ACEH DAMAI: Artis Maia dan Maican (grup musik Duo Maia) menghibur penonton saat konser Aceh Cinta Damai di Lapangan Blang Padang, Banda Aceh, Minggu (23/5). Konser damai itu juga diisi dengan pelepasan burung merpati yang dihadiri Gubernur Aceh Irwandi Yusuf, Pangdam Iskandar Muda, Mayjen TNI Hambali Hanafiah, Kapolda Aceh, Irjen Pol Fajar Prihantoro dan atraksi terjun payung dihadiri 15 ribu pengunjung.

Baca Halaman Dalam Dublin Port Gagal Investasi Di Sabang Perusahaan asing dari Irlandia Dublin Port yang bergerak di bidang pengelolaan pelabuhan, rencananya akan berinvestasi di Pelabuhan Sabang, namun sudah mengurungkan niatnya, meskipun sudah banyak menurunkan biaya operasional selama membuka perwakilannya di Sabang. Hal C4


PEMILIHAN KETUA UMUM DEMOKRAT: Kandidat calon ketua umum, (ki-ka) Anas Urbaningrum, Marzuki Alie, serta Andi Malarangeng mengangkat tangan sebelum pemilihan pada Kongres II PD, Padalarang, Bandung, Jawa Barat, Minggu (23/5).

Data Paspor TKW Banyak Dimanipulasi KUALALUMPUR (Antara): Dalam dialog antara Ibu AniYudhoyono dengan tenaga kerja wanita yang bermasalah, terungkap banyak manipulasi data paspor dalam pengirimannya ke Malaysia. “Saat dialog antara Ibu Ani Yudhoyono dengan TKW yang bermasalah saat meninjau `Rumah Kita` atau Wisma TKW di belakang kedutaan, pekan lalu, terungkap banyaknya manipulasi data TKW dalam paspor,” kata Juru Bicara Eminent Person Group (EPG) Indonesia Dr Musni Umar di Kuala Lumupur, Minggu (23/5). Karena itu, kata dia, pembenahan rekrutmen dalam negeri adalah inti dari perbaikan dan

pelayanan pekerja migran Indonesia. Misalkan, ada seorang TKW asal Palembang berusia 13 tahun, masih Kelas 6 SD, sudah dikirim ke Kuala Terengganu. Dalam paspor tertulis 22 tahun. “Ia membakar rumah dan mengambil dua notebook serta mencuri uang keluarga majikannya,” kata dia. Selain itu, ada seorang ibu yang sudah di atas 50 tahun, tapi tetap bisa dikirim sebagai pembantu ke Malaysia karena melakukan manipulasi usia menjadi dibawah 45 tahun. “Saya sendiri menemukan dan berdialog dengan seorang TKW Indonesia yang bekerja di kantin Universitas Malaya. Dia tidak bisa mem-

Oleh H. Ameer Hamzah Belumkah datang waktunya bagi orang-orang yang beriman, untuk tunduk hati mereka mengingat Allah dan kepada kebenaran yang telah turun kepada mereka...? (QS. al Hadid:16) Banyak orang mengakui beriman dan bertaqwa kepada Allah SWT. Mereka mendirikan shalat, bayar zakat, naik haji ke Baitullah, bahkan shalat tahajjud tengah malam. Sehari-hari tampil dengan atribut-atribut keislaman seperti memelihara janggut, bersurban, memakai peci, membaca khutbah, mengurus partai Islam, dan kadang-kadang menjadi panitia dalam urusan-urusan sosial dan keislaman. Terkesan

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 3

Tertangkap Mesum, Anggota Dewan Koma Dihajar Warga LANGSA (Waspada): Seorang anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) dari Kabupaten Aceh Timur, MY, 32, mengalami nasib sial, nyaris tewas dihajar warga karena berusaha kabur saat tertang-

kap basah sedang bermesum di salah satu rumah warga di Dusun Firdaus Desa Sungai Pauh, Langsa Barat, Minggu (23/5) dini hari. Hingga berita ini dikirim, yang bersangkutan masih mengalami koma dan sedang menjalani perawatan intensif di Rumah Sakit Umum Daerah (RSUD) Langsa. Sementara pasangan mesumnya, San, 25, warga Desa PB.Bromo, Langsa Barat, sudah diamankan aparat Polres Langsa, bersama satu pasangan mesum lainnya yang tertangkap bersamaan. Pasangan yang ditangkap bersamaan dengan oknum anggota dewan tersebut, berinisial

Sai, 33, penduduk Gampong Matang Seulimeng, Langsa Barat dengan pasangannyaWul, 25, warga Kecamatan Julok, Aceh Timur. Kepala Desa Sungai Pauh, Langsa Barat, Bahrum Nazar kepada wartawan menerangkan, peristiwa itu terjadi Minggu (23/5) dini hari sekira pukul 04.00 Wib. Kejadiannya berawal saat warganya menggrebek sebuah rumah karena merasa curiga dengan keberadaan dua pasangan non muhrim di rumah salah satu rumah warga setempat hingga menjelang pagi. Saat digerebek ternyata warga mendapati dua pasangan Lanjut ke hal A2 kol. 3

Tarif Dasar Penerbangan Haji Akan Dipangkas

Diduga Calo CPNS, Seorang IRT Ditangkap

JAKARTA (Antara): Kementerian Perhubungan (Kemenhub) memastikan akan memangkas lagi tarif dasar penerbangan haji dari 1.595 dolar AS (Rp 14,6 juta) per jamaah. Direktur Jenderal Perhubungan Udara Herry Bakti S Gumay saat dihubungi di Jakarta, Minggu (23/5) mengatakan, itu masih mungkin dipangkas dan dilakukan dalam waktu dekat. “Peluangnya di ‘margin’ maskapai. Juga, merundingkan kembali jasa kebandaraan di King Abdul Aziz, Jeddah, sehingga kita bisa membayar lebih murah,” katanya. Namun, tentang jumlah pemangkasannya, Herry belum bersedia merinci. “‘Kan masih proses. Jadi, belum ada angka,” katanya. Ia hanya memastikan, meski angka dari Kemenhub sudah

BIREUEN (Waspada): Seorang ibu rumah tangga (IRT) Riz, 26, beralamat Desa Kuta Baro, Kecamatan Kuala, Bireuen yang diduga calo Calon Pegawai Negeri Sipil (CPNS) paling dicari, ditangkap anggota Polres Bireuen belum lama ini saat berada di depan Meuligoe Bupati Bireuen. Pelaku disebut-sebut telah meraup Rp430 juta dari hasil aksinya. Aparat ikut menyita barang bukti dari Riz, berupa kuitansi penyerahan uang kepada pelaku sebanyak 20 lembar, nilainya mulai dari Rp10 juta sampai Rp40 juta. Lalu kuitansi peminjaman uang dari pelaku ke pihak lain, baju seragam warna coklat, baju mirip Satpol PP, tali pinggang aparat penegak hukum dan sepatu PDL. Kapolres Bireuen, AKBP T Saladin SH melalui Kasat Res-

disampaikan ke Menteri Agama, angka ahirnya kewenangan Menteri Agama dengan maskapai.“Tugas kami hanya memberi masukan. Finalnya ada di mereka,” katanya. Herry mengatakan, mendukung keputusan Kementerian Agama sebelumnya, yang menyatakan menghentikan wacana melakukan lelang penerbangan haji pada tahun ini. “Persiapan waktunya mepet. Selain itu, kedua maskapai, yakni Lion dan Batavia, masih diragukan bisa ikut ‘tender’ pada tahun ini,” katanya. Sebelumnya, Kementerian Agama menyatakan kemungkinan membatalkan rencana lelang penerbangan haji pada tahun ini. Artinya, Garuda Indonesia dan Saudi Arabian Airlines Lanjut ke hal A2 kol. 1

Hutan Lindung Dan KEL Terus Dirambah

Mata’ul Ghurur

baca dan menulis serta hanya bisa bahasa Jawa,” katanya. Menurut Musni, majikan TKW itu mengeluh tapi tidak bisa mengeluarkannya karena

JAKARTA (Waspada): Dua tas hitam yang diduga bom ternyata berisi pesawat telefon, kuitansi dan biskuit. Tas itu milik dua orang sales Karya Cipta Mandiri yang sedang berjualan di sekitar lokasi kongres. Kapolresta Cimahi, AKBP Rusdi Hartono menjelaskan polisi mendapatkan laporan pukul 15.30 Wib. Sekitar pukul 16.45 polisi mengamankan kedua tas tersebut. Setelah diperiksa ternyata kedua tas tersebut berisi lima buah tas telefon. “Apa yang dicurigai tidak ada. Setelah diperiksa ternyata isinya telefon rumah,” ujar AKBP Rusdi Hartono kepada wartawan, Bandung, (23/5). Sesaat setelah kejadian polisi mengamankan kedua sales pemilik tas tersebut. Pemilik tas tersebut bernama Jupriansyah, 29, dan Azwar, 21. Mereka

TAKENGON (Waspada): Hutan lindung dan Kawasan Ekosistem Leuser (KEL) di Aceh Tengah maupun Bener Meriah terus dirambah. Hasil monitoring LSM Mantap menyebutkan, ada 21 jenis kasus ilegal kehutanan ditemukan di dua kabupaten tersebut. Menurut Aramiko Aritonang, koordinator Advokasi Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 1


DIRAMBAH: Salah satu sisi hutan lindung di wilayah KEL yang dirambah.


LUKISAN DAMAI: Seorang remaja melukis sangsaka merah Putih yang berkibar di atas tiang kokoh, pada lomba melukis pesan damai di halaman Kantor Setdakab Aceh Timur, Idi Rayeuk, Minggu (23/5) siang.

Ratusan Remaja Melukis Damai IDI RAYEUK, Aceh Timur (Waspada): Ratusan remaja mengikuti lomba melukis pesan damai di halaman Kantor Sekretariat Daerah Kabupaten Aceh Timur, Idi Rayeuk, Minggu (23/5) siang. Lanjut ke hal A2 kol. 1

Lagi Gajah Ngamuk IDI, Aceh Timur (Waspada): Setelah puluhan hektar areal pertanian lenyap diamuk puluhan gajah di Peunaroen, kini satwa liar itu kembali menggnas dengan menghancurkan belasan hektar perkebunan di Kecamatan Banda Alam, Kab. Aceh Timur, Minggu (23/5). Menurut informasi warga, aksi keganasan gajah mulai terlihat sejak sepekan terakhir. Delapan ekor binatang berbadan jumbo itu datangnya dari arah timur. diperkirakan kawanan gajah itu satu dari beberapa kelompok gajah yang mengganas baru-baru ini di Lokop. Sasaran gajah awalnya terlihat di Desa jambo Reuhat, Panton Rayeuk T dan Lanjut ke hal A2 kol. 1

Pasca Tambang Telan 5 Jiwa Pekerja, Sawang Masih Berkabung TAPAKTUAN (Waspada): Suasana berkabung hingga hari kelima, pasca tewasnya lima pekerja tambang emas di pegunungan Gampong Panton Luas, Kecamatan Sawang, Kabupaten Aceh Selatan, Minggu (23/5) terlihat masih menyelimuti kawasan Sawang. Seribuan masyarakat dan pekerja tambang itu, tampak Lanjut ke hal A2 kol. 7

krim AKP Khairul Saleh yang didampingi KBO Reskrim Ipda Aji Wisa, Minggu (23/5) mengatakan, pelaku yang diduga calo sebagai CPNS itu ditangkap 7 Mei lalu. Sejak saat itu anggota memburu pelaku lainnya, sehingga terlambat dipublikasikan. ”Setelah pelaku ditangkap, puluhan korban yang pernah berurusan dengan pelaku serta telah menyerahkan uang berkisar Rp10 hingga Rp40 juta agar lulus sebagai PNS membuat laporan ke Polres Bireuen,” kata Kahirul Saleh. Menurut Khairul Saleh, kronologis penagkapan sang calo yang dikenal sangat lihai dan licin itu, berawal seorang korban melaporkan bahwa dirinya telah menyerahkan uang puluhan juta kepada pelaku yang katanya Lanjut ke hal A2 kol. 1

Aceh Selatan Kebobolan TAPAKTUAN (Waspada): Di tengah hiruk pikuknya tuntutan penutupan tambang biji besi PT Pinang Sejati Utama (PSU) Menggamat, Kecamatan Kluet Tengah, Kab. Aceh Selatan, ternyata secara diam-diam, perusahaan itu telah dua kali mengekspor biji besi ke China. Lanjut ke hal A2 kol. 3

Serampang - Belum tahu dia jagoan dari Aceh Waspada/Zamzamy Surya

Seribuan pelayat terlihat tumpah di sepanjang jalan Meulaboh-Tapaktuan ketika melayat ke rumah duka.

- He... he... he...

Berita Utama

A2 Tarif Dasar Penerbangan ... tetap menerbangkan jamaah pada tahun ini. Direktur Jenderal Penyelenggaraan Haji dan Umrah Kementerian Agama Slamet Riyanto menyebut perlu waktu sampai satu tahun sejak ditetapkan, jadi tidak mungkin dengan waktu sesingkat ini. “Kami sudah minta Kemenhub menentukan spesifikasi pesawat dan tarif penerbangannya,” kata Slamet. Slamet setuju dengan penilaian Kemenhub bahwa maskapai swasta, yang ingin mengikuti “tender”, belum bisa menyiapkan pesawat dalam waktu dekat. Padahal, penerbangan haji dimulai pada Oktober 2010, sehingga kalau Batavia atau Lion dipaksakan ikut menerbangan haji, dampaknya cukup besar.“Mudah-mudahan, tahun depan bisa digelar ‘tender’-nya,” katanya. Dia setuju menekan lagi ongkos naik haji pada tahun ini dengan cara memotong tarif penerbangan, yang saat ini menyumbang 52,7 persen dari ongkos naik haji.

Diduga Calo CPNS, ... sanggup mengurus menjadi PNS. Namun, setelah menunggu sekian lama sampai awal Mei belum ada kejelasannya. Akhirnya dia melaporkan ke Polres. Berbekal laporan itu, jajaran Polres Bireuen menindaklanjutinya dan saat itu, pelaku setiap dihubungi mengaku sedang berada di Medan, di Pekanbaru maupun daerah lainnya. ”Jumat (7/5) lalu pelaku berhasil ditangkap saat berada di depan Meuligo Bupati Bireuen,” katanya. Berdasarkan hasil penyelidikan sementara, lanjut Kasat Reskrim, pelaku menjalankan aksinya mulai Mei 2009 sampai Februari 2010. Saat beraksi Riz sering memakai seragam coklat mirip seragam pegawai kejaksaan. Korban umumnya berasal dari Kecamatan Peudada dan beberapa kecamatan lainnya di Bireuen, bukan orang di sekitar tempat tinggalnya. Uang hasil kejahatannya sebagian telah diserahkan kepada tersangka lain, sebagiannya lagi telah dibungakan. ”Pengakuan tersangka sering berbelit-belit kadangkadang membingungkan petugas,” kata Khairul Saleh, seraya meminta kepada warga yang merasa tertipu oleh tersangka untuk segera melapor ke Polres Bireuen. (amh)

Ratusan Remaja Melukis ... Kegiatan ini digelar Peace Generation Indonesia bekerjasama dengan lembaga Tranformasi Informasi (TRANSISI) Aceh serta didukung USAID melalui program SERASI. Lomba dibuka secara resmi oleh Ketua DPRK Aceh Timur Tgk Alauddin, disaksikan Staf Ahli Bupati Aceh Timur, Saifuddin Puteh dan pendamping dari Dinas Sosial Aceh Timur. Project Officer TRANSISI, Muhammad Hasan, menjelaskan, lomba melukis damai antara lain bertujuan memberi ruang partisipasi kepada remaja untuk mengkampanyekan perdamaian, membangun pemahaman tentang pentingnya perdamaian, dan melatih kemampuan mareka dalam mentransfer pengetahuannya tentang perdamaian melalui media gambar. “Pesertanya 100 orang, dibagi dalam 10 tim. Para peserta merupakan remaja yang pernah mengikuti pendidikan damai, beberapa waktu lalu. Hasil lukisan di sini nantinya kita bawa ke Banda Aceh untuk diperlombakan tingkat provinsi,” kata Hasan seraya menambahkan, kegiatan itu juga turut didampingi Children Media Center (CMC) Idi Rayeuk.(cmus)

Lagi Gajah Ngamuk ... Seuneubok Bayu, Kecamatan Banda Alam—Keude Geurobak. Jenis tanaman yang menjadi sasarannya yakni palawija, tanaman padi, pisang, pinang, coklat dan kepala sawit. Amukan gajah kerap terjadi sejak sore hingga pagi, namun beberapa diantaranya juga mengamuk disiang hari. Pemilik kebun yang kepergok dengan kawanan gajah mencoba melakukan pengusiran, namun ikhtiar warga tidak membuahkan hasil, bahkan warga balik diserang gajah. Akibat dari serangan gajah dalam sepekan terakhir disana, banyak penderes getah dan petani tidak barani ke ladang. Pasalnya, beberapa desa yang berdekatan dengan Desa Seuneubok Bayu, kini telah menjadi sarang gajah. “Kita juga telah terima laporannya, bahkan hingga kini delapan ekor gajah masih bersarang disana,” kata LSO Langsa, Drs. Bahtiar ZA. Kepada Waspada kemarin dia menjelaskan, informasi keganasan gajah di lokasi yang terpaut 25 Kilometer ke arah selatan jalan negara itu telah diterimanya sejak dua hari gajah berada disana. Namun pihaknya belum melaporkan ke BKSDA Aceh dan Dinas Kehutanan dan Perkebunan Aceh, sebab belum ada laporan tertulis. “Kita sedang menunggu laporan tertulis, kemudian kita akan teruskan ke instansi terkait,” sebut bahtiar seraya mengaku, gajah yang mengamuk kali ini di ujung timur Aceh, itu, salah satu dari kelompok gajah yang mengamuk di Peunaroen. Bupati Aceh Timur, Tgk. Muslim Hasballah melalui Camat Banda Alam, Abdul Aziz, SE, ketika dikonfirmasi Waspada membenarkan adanya amukan gajah dalam sepekan terakhir di wilayahnya. Bahkan, kondisi tersebut lazim terjadi seti-ap dua bulan sekali. “Iya benar, aparatur desa telah melaporkan ke kita, bahkan kita sudah perintahkan untuk mendata seluruh harta milik warga yang dirusak seperti tanaman,” kata Aziz seraya menandaskan, meski beberapa desa disana telah menjadi sarang gajah, namun hingga kini belum ada warga yang mengungsi. (cmad)

Mata’ul Ghurur ... memang sebagai seorang shaleh. Tetapi benarkah mereka shaleh dan sudah beriman sesuai yang dikehendaki syariah Allah? Tunggu dulu! Rupanya masih sangat jauh dengan kebenaran al-Quranulkarim. Sebab mereka tertipu oleh nafsunya, mereka masih menolak hukum Allah dan sangat membanggakan hukum taghut. Mereka masih hidup dengan riba dan menafikan etos kerja dan jual beli yang halal. Mereka menonton aurat di televisi dan anti jilbab, masih berkiblat kepada budaya kaplat dan menganggap usang budaya beradab. Mereka masih menghalalkan yang haram dan mengharamkan yang halal. Mereka masih cinta dunia dan takut mati. Jawaban Problem Catur, Sebenarnya, Allah telah TTS Dan Sudoku mengingatkan mereka Dari Halaman Sport. supaya jangan seperti orang-orang yang sebelumnya telah diturunkan al-kitab Jawaban Problem Catur: kepadanya, kemudian berlalulah masa yang panjang 1. ........, Mg1+. atas mereka, lalu hati me2, Rh3, Mh1+. reka menjadi keras. Dan 3. MxM, BxM+mat. kebanyakan di antara mereka adalah orang-orang yang fasik. Padahal, kehiJawaban TTS: dupan dunia ini penuh faTTS Topik Umum tamorgana, permainan, B E N G A W A N S O L O I melalaikan, sebagaimana A A A O R A U N firman Allah SWT dalam G E S A N G A S A H A N D A I E I T O ayat 20 surat al-Hadid yang I O S E L A I N U N artinya: M A N A L U L A K T E Ketahuilah, bahwa seA A P E R I S A I S sungguhnya kehidupan N I L A R S R I dunia itu hanyalah permaiA I P A S M E N P O R A nan dan suatu yang melaS T E O R T E M B A M M M A R I N A laikan, perhiasan dan berE E A O O T Y megah-megah antara kaM P A N I T E R A O M A mu serta berbangga-bangA A O A H ga tentang banyaknya harN E O L I B E R A L I S M E ta dan anak-anak, seperti Jawaban Sudoku: hujan yang tanaman-tanamannya mengagumkan 1 9 8 2 3 7 6 5 4 para petani, kemudian ta6 7 5 9 8 4 1 2 3 naman itu menjadi kering dan kamu lihat warnanya 4 3 2 1 6 5 8 7 9 kuning, kemudian ia men2 8 4 5 1 3 7 9 6 jadi hancur. Dan di akhirat 3 1 7 6 4 9 5 8 2 nanti ada azab yang keras 5 6 9 7 2 8 4 3 1 dan ampunan dari Allah serta keridhaan-Nya. Dan 8 2 1 3 7 6 9 4 5 kehidupan dunia ini tidak 7 5 3 4 9 1 2 6 8 lain hanyalah kesenangan 9 4 6 8 5 2 3 1 7 yang menipu.

Aksi Demo Sambut Delegasi GCF Di Ketambe KUTACANE (Waspada): Aksi demo menolak perdagangan karbon oleh Masyarakat Peduli Leuser, Sabtu (22/5) mewarnai kedatangan perwakilan delegasi Governor Climate and Forest Meeting (GCF) di hutan Taman Nasional Ketambe, Aceh Tenggara. Dalam orasinya yang disampaikan secara bergantian oleh Ubay, Kadafi dan beberapa anggota Masyarakat Peduli Leuser di pinggir jalan negara Blangkejeren-Kutacane, selain menyampaikan pernyataan sikap, juga menggelar teaterikal tentang penderitaan masyarakat di pinggiran Kawasan Ekosistem Leuser (KEL) Aceh Tenggara. Perdagangan karbon yang tengah digagas oleh GCF, kata Ubay, sama sekali tidak menguntungkan rakyat kecil. Terutama yang berdomisili di pinggiran kawasan KEL Aceh Tenggara dan hanya menguntungkan pihak luar saja.

Tertangkap Mesum, ... non muhrim itu di dalam dua kamar berbeda dalam rumah tersebut. “Saat warga menggerebek, kedua pasangan itu dalam keadaan berpakaian lengkap, tapi saat diperiksa dalam kamar yang dihuni oknum dewan Aceh Timur itu bersama pasangannya warga menemukan kondom yang telah dipakai dan di dalamnya berisi cairan sperma,” sebut Bahrum seraya menambahkan warga tahu MY oknum dewan Aceh Timur berdasarkan pengakuannya sendiri saat digerebek. Dijelaskannya, saat penggerebekan warga menemukan oknum anggota dewan bersama pasangannya keluar

Data Paspor TKW ... sudah membayar mahal kepada agensi pemasok pembantu asing untuk mendapatkan seorang pembantu. “Lagipula majikan saat itu sangat membutuhkan pekerja,” kata Musni, yang juga dosen di Universitas Islam Jakarta. Menakertrans Muhaimin Iskandar saat meresmikan

Anas Ketum Demokrat ... menimbulkan kegembiraan luar biasa bagi para pendukungnya di arena kongres. Atmosfir kegembiraan tak terbendung saat suara Anas melewati setengah dari total suara. Penghitungan suara putaran kedua berlangsung sangat sengit dan menegangkan. Di awal penghitungan putaran kedua ini, Marzuki Alie sempat memimpin. Perolehan suara Marzuki

Aceh Selatan Kebobolan ... Akibatnya, Aceh Selatan sebagai daerah produsen dilaporkan mengalami kebobolan ratusan juta rupiah dari sektor pemasukan daerah alias PAD karena ekspor itu luput dari pantauan dinas terkait. Camat Bakongan Timur,

Dikira Bom, Rupanya ... sekarang diamankan polisi di Polsek Padalarang untuk diperiksa. “Keduanya sales telefon Karya Cipta Mandiri. Keduanya tidak akan ditahan namun hanya memberikan keterangan,” ujarnya. Berdasarkan pantauan, akibat peristiwa ini polisi lebih mengetatkan pengamanan. Terlihat polisi lebih memperketat pintu Hotel Mason Pine, tempat Kongres II Demokrat dilaksanakan. (vvn)

Hutan Lindung ... kebijakan lingkungan LSM ManTAP (Masyarakat Transparansi Pembangunan Aceh), kepada Waspada Minggu (23/5), temuan itu setelah pihaknya melakukan monitoring ke lapangan sejak 20 April - 10 Mei. “ Dari 21 kasus ilegal kehutanan ini, 7 kasus terjadi di Aceh Tengah. Sementara 14 kasus lainnya berada di Bener Meriah. Baik berupa illegal logging, perambahan, pengalihan fungsi lahan dan pembukaan jalan di kawasan KEL,” sebut Aramiko. Untuk Aceh Tengah, ada 1 kasus illegal logging. 4 kasus perambahan. Satu kasus alih fungsi lahan, serta pembukaan jalan di kawasan KEL di daerah Arul Item Kecamatan Linge. Sedangkan di Kabupaten Bener Meriah dari 14 kasus temuan; 2 kasus illegal logging, perambahan 5 kasus. Sawmil illegal ada satu. Enam panglong terindikasi penampung

Hal itu disebabkan karena masyarakat adat ,sama sekali tidak dilibatkan dan hanya jadi penonton saja, sementara kesepakatan yang dibuat oleh GCF pada akhirnya akan membelenggu masyarakat karena dengan berbagai aturan. Pertemuan GCF itu sendiri, lanjut Ubay, hanya untuk menggolkan kepentingan negara maju saja yang sudah kesulitan akibat efek rumah kaca. Karena itu, negara maju seperti Amerika Serikat sangat membutuhkan karbon dari hutan Taman Nasional Leuser Aceh Tenggara. Pertemuan yang digagas GCF dengan misi perdagangan karbon dari hutan Leuser, sama sekalitidakadamenyangkuthajat hidup masyarakat hutan, bahkan keterlibatan masyarakat tidak diberi ruang sedikit pun. Selama ini sambung, Kadafi, pemerintah pusat dan pemerintah propinsi tidak pernah memberi jaminan pertumbuhan ekonomi masyarakat. Sehingga, jalur transportasi yang

menghubungkan Agara dengan Medan , Gayo Lues dan Singkil masih sangat memprihatinkan. Pertemuan GCFyang tidak melibatkan masyarakat adat dan tidak mengakomodir kepentingan masyarakat itu, merupakan bentuk penjajahan baru yang diterapkan oleh negara maju yang sangat membutuhkan karbon dari hutan leuser Aceh Tenggara, karena hanya menguntungkan satu pihak saja. Usai menyampaikan orasinya di pinggir jalan negara di kawasan hutan Ketambe dan menggelar teaterikal manusian berlumpur dan lehernya terikat tali, perwakilan masyarakat peduli Leuser yang berjumlah sekitar empat puluhan orang itu, juga membacakan pernyataan sikap. Pernyataan sikap masyarakat peduli Leuser tersebut diantaranya, mendesak pemerintah propinsi dan kabupaten agar lebih serius mendorong petumbuhan ekonomi ma-

syarakat, terutama yang menggantungkan hidup pada lahan dan hasil hutan Leuser. Perdagangan karbon yang tidak melibatkan masyarakat, merupakan bentuk penjajahan baru, karena ada larangan mengganggu hutan. Sedangkan negara-negara maju terus merusak udara dengan produksi industri mereka. Kedatangan peserta GCF tidak membawa pengaruh ekonomi, sosial maupun budaya bagi masyarakat Aceh Tenggara. Menuntut agar mengembalikan pengelolaan hutan kepada masyarakat dengan kearifan lokalnya, menuntut negara-negara maju penghasil polusi terbanyak memberikan kompensasi kepada daerah dan masyarakat yang mempunyai hutan secara proporsional. Menolak lembaga pemerintah atau swasta atas nama lingkungan di kawasan Leuser dari Aceh Tenggara, karena hal tersebut tidak memberikan manfaat kepada hutan dan masyarakat Leuser. (b27)

kamar, sementara pasangan non muhrim lainnya masih bersembunyi dalam kamar lainnya. Pada awalnya oknum anggota dewan ini sempat berusaha mengibuli warga dengan mengaku pasangannya itu adalah istrinya yang baru dinikahi secara siri. “Namun, setelah didesak dia mengaku kalau mereka belum menikah,” ungkap Bahrum. Kemudian, setelah warga mendengar pengakuannya yang berbelit mereka menjadi geram, namun atas permintaan dirinya sebagai kepala desa warga masih bisa menahan emosi dan tidak bertindak anarkis. Tapi selang beberapa menit kemudian, persisnya saat petugas Polres Langsa tiba di lokasi, dan bersama warga

hendak menggerebek pasangan lainnya yang masih bersembunyi di salah satu kamar rumah itu, tiba-tiba oknum anggota dewan tersebut berusaha kabur, lari lewat pintu belakang. Warga spontan mengejar dan langsung melampiaskan kemarahan dengan memukulnya hingga tidak berdaya. Aparat kepolisian yang sudah berada di lokasi, saat itu juga mengamankannya dari amukan warga. Lalu oknum itu diboyong ke RSUD Langsa karena kondisinya kritis. Sementara tiga tersangka pelanggar syariat lainnya juga ikut diamankan ke Mapolres Langsa untuk menghindari hal-hal yang tidak diinginkan. “Sebenarnya kalau dia

“Rumah Kita” di Kuala Lumpur mengatakan, akan menindak tegas PJTKI jika menjadi pelaku utama dari manipulasi data paspor. “Biasanya manipulasi dimulai dengan pembuatan KTP dengan data palsu,” katanya. Masalah rekrutmen TKI dan TKW di dalam negeri adalah sumber masalah pekerja migran Indonesia di luar neAlie memimpin sampai titik angka 117 suara. Setelahnya, Anas kembali memutar balik keadaan dan memimpin hingga posisi 51 persen lebih. Anas saat ini tercatat sebagai Ketua Dewan Pimpinan Pusat Partai Demokrat. Pria kelahiran Blitar, Jawa Timur, 15 Juli 1969 ini terpilih menjadi anggota DPR periode 2009– 2014 dari daerah pemilihan Jawa Timur VI. Anas juga sekaligus menjadi Ketua Fraksi dari Partai Demokrat di DPR RI. (vvn)

geri. Di antaranya yang banyak terjadi adalah manipulasi data paspor dan pelatihan. “Jika mereka mengalami nasib buruk di tempat bekerja, kita segera marah dan menuding, tetapi penyebab dan akar masalah di dalam negeri tidak diselesaikan dengan baik,” katanya. Masalah rekrutmen TKI di dalam negeri makin parah setelah dua institusi, yakni Kementerian Tenaga Kerja dan Transmigrasi dengan BNP2TKI saling adu kekuatan dan bersaing terkait kewenangan atas TKI. “Dualisme institusi ini harus segera diselesaikan, berikan sanksi keras bagi PJTKI dan oknum Imigrasi yang manipulasi data paspor TKI, dan sistem pelatihan ini harus segera diselesaikan, jika pelayanan dan perlindungan pekerja migran mau bagus,” kata Musni Umar.

(oknum dewan-red) tidak lari, warga tidak akan melakukan pemukulan, buktinya tiga pelaku lainnya tidak disentuh oleh warga. Tapi, karena dia lari maka warga marah dan memukulnya karena kesal apalagi sebelumnya saat memberikan keterangan dia banyak berbelit dan menipu,” terang Bahrum lagi seraya menambahkan, diduga tersangka lari karena takut apalagi bersamanya juga ditemukan alat pemakai sabu-sabu. Sementara itu Kapolres Langsa AKBP. Yosi Muhamartha melalui Kasat Reskrim AKP.Galih Indragiri, SIK kepada wartawan membenarkan penangkapan seorang oknum anggota DPRK Aceh Timur bersama rekan dan pasangan non muhrimnya oleh warga di Dusun Firdaus tersebut. Menurutnya, penangkapan itu dilakukan karena warga curiga dengan keberadaan pasangan non muhrim itu dirumah warga hingga menjelang pagi. “Benar warga telah mengamankan empat pelanggar syariat. Untuk menghindari hal-hal yang tak diinginkan tiga pelaku langsung kita amankan ke Mapolres. Sementara oknum anggota dewan yang telah menjadi amukan massa langsung kita larikan ke RSUD Langsa untuk penanganan medis,” sebut Galih. Sejauh ini pihaknya masih melakukan pemeriksaan terhadap tiga tersangka pelanggar yang telah diamankan, sementara untuk oknum dewan masih menunggu perkembangan penanganan pihak medis rumah sakit. “Kasus ini kita dalami dulu,” ujar Galih. (b22)

Sarmiadi, SE,MM yang dihubungi Waspada Minggu (23/ 5) membenarkan pihak PT PSU telah melakukan kegiatan biji besi ke China dalam beberapa pekan terakhir. “Saya tidak ingat tanggalnya, tetapi yang jelas mereka telah dua kali mengangkut batu biji besi negeri China,” kata Sarmiadi di sela-sela kesibukannya mengurus evakuasi jenazah karyawan PT PSU di daerah Seubadeh, Minggu sore kemarin. Ia mengaku tidak mengetahui persis kegiatan eksportir tersebut karena tidak pernah koordinasi. Malah surat teguran yang pernah dikirimkan Muspika kepada mereka soal dokumen perizinan dan koordinasi, itu pun dicuekin. Demikian pula jumlah biji besi yang diekspor maupun income daerah berupa royalty yang diberikan perusahaan,

Sarmiadi mengaku pihaknya tidak mengetahui persis. “Tetapi dengar-dengar biji besinya 48 ribu ton dan royaltinya tiga persen dari harga ekspor US$41/ton.” “Jadi sulit memantau kegiatan PT PSU ini, bayangkan di tengah terjadi musibah tewasnya karyawan mereka, kegiatan pengangkutan biji besi ini terus berlangsung,” kata Sarmiadi. Modus operandi mengangkut biji besi itu agar tidak terpantau aparat dan dinas terkait, menurut sumber Waspada, PT. PSU sengaja mentransitnya dengan menyewa tongkang dengan dalih kapalnya tidak bisa merapat karena dangkat sehingga terpaksa berlabuh di tengah laut. Sementara Kepala Dinas Pertambangan dan Energi SDM Aceh Selatan Mardhaleta, SE, M.M.Kes melalui Sekre-

tari Dinas Pertambangan dan Energi SDM Aceh Selatan Ir. H.Johan yang dihubungi Minggu, (23/5) mengakui pihaknya tidak mengetahui pasti kegiatan ekspor yang dilakukan perusahaan itu. Pasalnya, pihak manajemen PT. PSU Tapaktuan tidak pernah berkordinasi dengan pihaknya atas operasional yang dilakukan. “Kita undang saja berkordinasi, manajemen perusahaan tidak mau datang sehingga sedikit sekali informasi yang kami ketahui,” katanya. Tetapi Johan membantah daerahnya kebobolan dari sektor royalty karena perusahaan telah menyetor sebesar tiga persen dari harga jual sebesar US $41/ton, setara dengan Rp85 juta sekali ekspor. “Ekspor yang kita ketahui hanya dua kali dengan bobot 48.000 ton, selebihnya tidak terpantau,” kata Johan. (b19)

kayu hasil illegal logging. “Berdasarkan laporan masyarakat Samar Kilang Bener Meriah, dan temuan kami, kayu ilegal itu dihanyutkan melalui Krueng Jambo Aye yang mengalir sampai ke Sungai Arakundo Aceh Utara,” kata Aramiko. LSM MAnTAP mensinyalir kayu yang dihanyutkan itu, kemudian dipasok oleh pihakpihak yang tidak bertanggungjawab ke panglong atau sawmill kayu di kawasan Aceh Utara. “Hasil investigasi itu juga diperkuat keterangan Kapolres Bener Meriah yang telah melakukan operasi bersama tim gabungan, langsung di bawah komando Kapolres,” jelas Aramiko. Di Kabupaten Aceh Tengah terdapat kasus pengalihan fungsi lahan dari hutan lindung ke pemukiman, terjadi di Kala Wih Ilang, Kec. Pegasing. Program transmigrasi lokal untuk kaum duafa oleh Pemkab, ditemukan penga-

lihan fungsi hutan. Masyarakat yang sudah terlebih dahulu menebang hutan mendapat ‘restu’ dari Dinas Perkebunan dan Kehutanan Aceh Tengah. Ada 400 KK dari 8 kelompok tani (1 kelompok terdiri 50 warga). “Mereka diberikan dana pembersihan lahan (insentif ) senilai Rp7 juta,” sebut Aramiko. Ketika ditanya Waspada, kenapa LSM MAnTAP Aceh, hanya melakukan monitoring di wilayah tengah Aceh saja, “wewenang MAnTAP hanya di dua kabupaten tersebut,” sebut Aramiko. Kadis Perkebunan dan Kehutanan Aceh Tengah, Ir. Syahrial melalui Kabid Produksi dan Perlindungan Tanaman, Hermanto Sp, ketika dikonfirmasi Waspada, membenarkan sebagian hutan lindung yang telah diolah petani menjadi lahan pertanian. “Benar sebagian hutan lindung telah terpakai warga. Ke-

tika kami mengecek lokasi itu, warga di sana ternyata sudah lama menjadikan lahan di wilayah hutan lindung itu, sebagai kebun,” sebutnya. “Ada pertimbangan kemanusiaan yang membuat Dinas Kehutanan belum menindak warga di sana. Karena ada sumber ekonomi masyarakat duafa di lokasi itu,” jelasnya. Pihak Kehutanan telah mengusulkan ke Pemkab untuk menghentikan pengolahan lahan oleh warga di wilayah hutan lindung. “Usulan itu saat ini masih dalam proses dan pertimbangan Pemkab Aceh Tengah,” sebut Hermanto. Soal dana insentif pembersihan lahan seperti yang disebutkan LSM MAnTAP, Hermanto menyebutkan bukan Rp7 juta, melainkan hanya senilai Rp5 juta per kepala keluarga. “Bukan 400 KK, namun 500 KK yang mendapat bantuan dana pengolahan lahan itu,” sebutnya. (cir/b18)

WASPADA Senin 24 Mei 2010

Karyawan PT PSU Yang Hanyut Ditemukan Jadi Mayat TAPAKTUAN(Waspada): Karyawan PT. Pinang Sejati Utama (PSU) Tapaktuan, Kabupaten Aceh Selatan, Setiawan alias Ayang, 58, yang dilaporkan hilang ditelan ombak di perairan pantai Palabuhan Ikan (PPI) Gampong Ujong Pulo Rayeuk, Kecamatan Bakongan Timur, Jumat (21/5) sore lalu, ditemukan telah menjadi mayat, Minggu (23/ 5) siang kemarin. Camat Bakongan Timur, Sarmiadi, SE., MM., kepada Waspada yang menghubunginya sore kemarin mengakui jenazah warga turunan asal Batam itu, ditemukan para nelayan yang melakukan pencarian di perairan Seubadeh, sekitar tiga mil dari lokasi korban tenggelam ke arah selatan. “Kondisi korban ditemukan dalam posisi terapung dalam kondisi sangat menyedihkan,“ ucapnya seraya menambahkan, mayat korban lalu dibawa ke RSUD Yulidin Away Tapaktuan guna mendapat visum dokter. Dalam pencarian sebelumnya, masyarakat nelayan dibantu aparat kecamatan termasuk melibatkan penyelam

dan para normal alias orang pintar nyaris putus asa, karena gagal menemukannya. “Namun Minggu siang mayatnya terapung sehingga berhasil ditemukan,” katanya. Korban yang bertugas sebagai pengawas bahan material biji besi milik PT PSU yang tertumpuk di lokasi dermaga pelabuhan Ujung Pulo Rayeuk itu, dilaporkan hilang Jumat sore ketika ia mandi di sekitar dermaga. Sejumlah karyaman PT PSU kemudian mengetahui korban hanyut dan tenggelam setelah menemukan baju dan HP korban di lokasi dan sore itu juga dilakukan pencarian, namun gagal karena kondisi cuaca kurang mendukung. Usaha pencarian kembali dilanjutkan Sabtu hingga Minggu siang. Sekira pukul 14.00 wib, jasad korban ditemukan dalam keadaan terapung dan segara ke darat. “Saya belum tahu di mana korban dikebumikan karena masih menunggu keluarganya dari Batam, Kepri dan kini masih dalam perjalanan,” sebut Sarmiadi didampingi Kapolsek setempat AIPTU Wiji Sutrisno. (b19)

Buntut Bocah Tewas Di Galian Tower

PB HAM Pidie: Rekanan PLN Lalai SIGLI (Waspada): Peristiwa tewasnya Abdullah bin Usman, 13, dalam lubang tapak tower koneksi PT. PLN di Desa Balee Baroh Gapui, Kecamatan, Indrajaya, Pidie, Jumat (21/5) murni tindakan kelalaian rekanan. “Soalnya dalam mengerjakan proyek galian itu, pihak rekanan tidak memasang pengaman ataupun rambu-rambu peringatan,” demikian Staf Kampanye dan Advokasi PB –HAM Pidie, Said Safwatullah, SH kepada Waspada, Minggu (23/5). Berdasarkan pasal Kitab Undang-undang Hukum Pidana (KUHP) sesuai pasal 359, barang siapa karena kesalahannya (kealpaan-red) yang menyebabkan orang lain mati, maka dapat diancam pidana paling lama lima tahun atau pidana kurungan penjara satu tahun. Mengacu pada peraturan Perundang-undangan di bidang jasa konstruksi, rekanan diwajibkan memasang pengaman dan penghalang yang cukup, serta rambu-rambu peringatan. Tujuannya, mengamankan lokasi kerja dari pihak-pihak yang tidak berkepentingan dengan pekerjaan tersebut.

“Ini bukan begitu, setelah ada korban meninggal baru pihak rekanan memasang ramburambu atau pagar yang terbuat dari bambu,” kata Said Safwatullah. Kasus kelalaian pihak rekanan PT. PLN dalam pekerjaan galian lubang tapak tower koneksi sudah terjadi berulang kali di Pidie. Korbannya selalu bocah. Sebelumnya, Kamis (15/4) di galian tapak tower PLN di Desa Mane, Kecamatan Mane, Kabupaten Pidie juga menewaskan tiga bocah bersaudara yaitu Ernida, 10, Iska Fadhiah, 7, dan Faudal Ilmi, 6. Ketiga bocah ini putra putri pasangan Iskandar dan Fauziah. Ketiganya ditemukan warga sudah tidak bernyawa dalam galian proyek tapak tower PT. PLN yang jaraknya sekira 10 meter dari rumah mereka. Senada disampaikan Koordinator LBH Banda Aceh Pos Lhokseumawe Rahmat Hidayat, S.H yang menilai peristiwa jatuhnya korban jiwa karena terpeleset dalam lubang galian tower PLN merupakan perbuatan pelanggaran HAM. Di samping itu, LBH Banda Aceh Pos Lhokseumawe juga prihatin atas kejadian tersebut. (b20)

Slank: Seni Ubah ... Terkait pertanyaan tentang keinginan Slank membuat album tentang Aceh, kawan-kawan Slank masih mempelajari terhadap sebuah cerita tentang perempuan Aceh yang bermata biru tanpa memakai lensa, diyakini berada di Lamno, Kabupaten Aceh Jaya. “Kami sedang mencarinya dulu, kalo rencana sih ada tetapi belum pasti kapan akan dirilis albumnya,” kata Bimbim. Selain Slank, konser lagu perdamaian, Minggu kemarin di Blang Padang Banda Aceh, turut dimeriahkan duo Maia dan Mario Teguh, sang motivator yang terkenal di Metro TV. Konser perdamaian ini dipadati ribuan penonton dari Banda Aceh dan sekitarnya, membuat arus lalu lintas yang menghubungkan lapangan Blang Padang, macet total. (gto/b02)

Pasca Tambang ... melayat silih berganti ke rumah duka di Gampong Lhok Pawoh, Trieng Meuduro Tunong serta Sawang I. Hal ini bentuk solidaritas mereka termasuk memberi santunan teratas kepada keluarga korban. “Secara moral, kami dan pekerja tambang telah berusaha semaksimal mungkin baik melakukan pencarian maupun memberi petunjuk ketika mereka bekerja, namun atas kehendak Allah musibah datang dan itu bukan keinginan kita semua, melainkan sebuah resiko yang perlu kita perbaiki”. “Mohon dibuka mata dan lihat, hari ini 2.500 orang turun melayat dan memberi santunan ke setiap rumah duka, ini bukti bahwa kami peduli, kompak dan bertanggung jawab, justru itu statemen yang berbentuk memojok orang lain tolong direvisi,” tambah Mahlil tegas. Tgk. Mahlil Akbar, Ketua Koperasi Batu Ilham, kepada wartawan menyebutkan, ribuan pekerja melayat ke rumah itu bentuk solidaritas sesama pekerja tambang. Meski musibah itu ditanggapi pro-kontra dalam masyarakat, namun murni kecelakaan sehingga tak perlu dicari penyebab atau penanggung jawab. “Musibah ini bukanlah tangungjawab sepihak melainkan tanggungjawab bersama pemerintah daerah dan masyarakat,” kata Mahlil saat mendampingi ribuan penambang melayat ke rumah duka, almarhum T. Mansur di Desa Lhok Pawoh, Minggu sore kemarin. Ia mengaku, kendatipun belum mengantongi izin resmi tetapi pihaknya sedang mengrus perizinan dan saat ini masih dalam proses. “Wadah kita juga memiliki badan hukum., meski seluruhnya belum ada di tangan,”sebutnya seraya menambahkan usaha penambagnan rakyat ini telah memperkecil pengangguran karena telah tercipta lapangan kerja serta terhindar dari perbuatan yang tidak diinginkan seperti, narkoba, pencurian dan kenakalan lainnya. Sementara Tgk. Rizwan Is, Ketua DPW Partai Aceh, Kabupaten Aceh Selatan, didampingi mantan Wakil Panglima KPA (Wapang), Tgk. M. Nasir yang ikut dalam rombongan pelayatan meminta Pemkab mencari solusi terbaik demi kelanjutan operasional tambang. “Tambang emas di pengunungan Panton Luas, Sawang adalah tambang rakyat dan bukan illegal alias liar. Seharusnya pihak terkait turut mendukung, bekerja sama dan membantu rakyat dalam pengurusan izin,”katanya, seraya menanmahkan mengurus izin ternyata tidak semudah membalik telapak tangan. Menurut dia, jika pemerintah simpang siur memberi tanggapan, dikhawatirkan rakyat akan marah dan timbul gejolak, tentunya akan timbul polemik baru di tengah masyarakat, sehingga perlu pertimbangan secara bijak dan kearifan. (b19)

Prakiraan Cuaca Senin (24/5) Medan 26-34 C

Berastagi 18-28 C

R. Prapat 26-34 C

Parapat 19-290C

P. Siantar 20-300C

Sibolga 22-330C





Hujan guntur

BMKG Polonia

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

z Edisi Tapanuli SENIN, Pahing, 24 Mei 2010/10 Jumadil Akhir 1431 H z No: 23158 Tahun Ke-64z

Terbit 28 Halaman (A1-8, B1-12, C1-8 ) z zHarga Eceran: Rp 2.500,-

5 Rumah Terbakar

Waspada/Idaham butar butar

Sejumlah warga dan anak-anak sedang mencari barang berharga di tengah puing-puing bekas rumah terbakar di Desa Aliaga Kecamatan Huraja Tinggi, Kabupaten Padanglawas.

H U TA R A J A T I N G G I (Waspada): Tiga pintu rumah warga di Desa Aliaga, Kecamatan Hutaraja Tinggi, Kab. Padanglawas yang dihuni empat rumah tangga ludes dilalap api. Tidak ada barang peralatan rumah tangga yang terselamatkan, namun kejadian itu tidak ada korban jiwa. Sementara di pinggir Jalan Lintas Sumatera Desa Lumbanjulu, Kec. Tobasa dua rumah juga musnah dilalap si jago merah. Keterangan yang dihimpun Waspada di lapangan, Minggu (23/5), kebakaran di Hutaraja Tinggi terjadi sekitar pukul 03:15, saat warga masih tidur. Tiba-tiba Amiruddin Dalimunthe menantu korban yang tengah menonton TV Lanjut ke hal A2 kol 6


PEMILIHAN KETUA UMUM DEMOKRAT. Kandidat calon ketua umum, (ki-ka) Anas Urbaningrum, Marzuki Alie, serta Andi Malarangeng mengangkat tangan sebelum pemilihan pada Kongres II PD, Padalarang, Bandung, Jawa Barat, Minggu (23/ 5). Selanjutnya pemilihan dilaksanakan dengan cara voting manual untuk menentukan ketua umum Partai Demokrat periode 2010-2015. Pada putaran kedua Anas terpilih sebagai Ketua Umum mengungguli Marzuki Alie.

Anas Disambut Gegap-gempita

NU Sibolga Kecam Demo Anarkis SIBOLGA (Waspada): Pj Ketua PC NU Kota Sibolga, Drs H Alpian Hutauruk, MPd didampingi Sekretarisnya Zulhamsyah Panjaitan di Kantor PC NU Kota Sibolga, Sabtu (22/5) di Jl Hijrah No. 01 Sibolga menyesalkan dan mengecam demo anarkis. Peristiwa demo anarkis terjadi setelah 2 hari Pemilukada telah mencoreng wajah Kota Sibolga kita sangat prihatin dan menyesalkan terjadinya pengrusakan serta pem-

bakaran asset pemerintah tersebut. Karena bagaimanapun, yang rugi adalah warga Kota Sibolga sebab pelayanan kepada masayarakat akan terganggu beberapa saat, termasuk hilang dan terbakarnya berkas-berkas penting milik pemerintah masyarakat Sibolga. Tentu uang rakyat, melalui dana APBD yang akan mengganti kerugian yang diperkirakan ratusan juta rupiah tersebut,” ujar Alpian Hutauruk

Menyinggung Konferensi ke XIV 24 Juni mendatang Alfian mengakui akan membahas tiga agenda utama diantaranya mengevaluasi Program Kerja PC NU Kota Sibolga Periode 2005-2010, menyusun Program Kerja Periode 20102015, dan memilih Pengurus Periode 2010-2015. Sedangkan peserta yakni 4 MWC (Majelis Wakil Cabang) NU Kecamatan dan Pengurus Lanjut ke hal A2 kol 5

PADALARANG (Waspada): Kemenangan Anas Urbaningrum sebagai Ketua Umum Partai Demokrat 2010-2015 disambut gegap-gempita para pendukungnya. Teriakan yel-yel dan nama Anas terus digaungkan. Setelah penghitungan suara selesai, berkumandang lagu Mars Partai Demokrat yang dinyanyikan oleh seluruh kader peserta kongres. Anas langsung merangkul Marzuki dan Andi yang duduk bersebelahan. Anas juga menggandeng tangan Andi dan Marzuki serta mengangkat tangan bersama ke atas. Wajah Marzuki terlihat masih tegang setelah dikalahkan Anas. Sementara itu, para pendukung Anas langsung merangsek ke depan sambil terus mengelu-elukan nama jagoannya. Perolehan suara Anas yang menyentuh angka 266 suara

itu menunjukkan perolehan sudah lebih dari 50 persen suara atau total 531 suara. Pendukung terdengar bergemuruh di penghitungan suara pemilihan Ketua Umum Partai Demokrat, di Hotel Mason Pine, Bandung Barat, Jawa Barat, Minggu (23/5). Perolehan untuk Ketua Fraksi Demokrat Anas Urbaningrum adalah 280 suara. Sedangkan suara untuk Marzuki Alie yang juga Ketua DPR mencapai 246 suara. Dengan selisih 24 suara. Perhitungan suara sempat dihentikan saat Anas

Anas: Semoga Tidak Ada Perpecahan BANDUNG ( Waspada): Anas Urbaningrum (AU) resmi terpilih menjadi Ketua Umum Partai Demokrat. Kepada para pesaingnya, Anas berharap tidak ada perasaan dendam setelah kalah dalam proses pemilihan. “Terimakasih atas dukungan Bang Andi dan Pak Marzuki. Semoga tidak ada perpecahan, hurt feelings. Kedua beliau adalah pendukung di kongres, semua adalah kader nomor satu Partai De-

mokrat,” jelas Anas di Hotel Mason Pine, Padalarang, Bandung, Minggu (23/5) malam. Sementara itu, Marzuki Alie mengucapkan selamat kepada Anas atas terpilihnya menjadi ketua umum. Ketua DPR tersebut berharap Anas mampu bekerjasama dengan dirinya selama memimpin PD. “Selamat kepada Anas karena telah memenangkan kontestansi ini,” kata Marzuki. Andi Mallarangeng yang dikalahkan pada putaran per-

tama juga tidak lupa menyampaikan ungkapan selamat kepada Anas. “Saya berikan selamat. Saya yakin bung Anas mampu membawa Partai Demokrat ke depan,” imbuhnya. “Namanya demokrasi. Siapa pun boleh beri dukungan,” tambah AM. Anas Urbaningrum resmi terpilih menjadi Ketua Umum Partai Demokrat dengan perolehan 280 suara, sedangk a n Ma r z u k i A l i e h a n y a mengantongi 248 suara. (dtc)

Lanjut ke hal A2 kol 1

WN Malaysia Bawa 2 Kg Shabu Senilai Rp4 M

Waspada/Munir Lubis

DIRESMIKAN: Bupati Madina H Amru Daulay,SH meresmikan sejumlah paket proyek/kegiatan TA 2009 dialokasikan di Kecamatan Kotanopan, baru-baru ini.Kedatangan Amru bersama istri ke kecamatan itu disambut masyarakat dengan antusias ditandai dengan pemberian kalungan bunga.

Bupati Madina: Program PNPM-MP Membebaskan Rakyat Dari Kemiskinan PANYABUNGAN (Waspada): Bupati Mandailing Natal H Amru Daulay, SH mengakui, program nasional pemberdayaan masyarakat mandiri pedesaan ( PNPMMP) merupakan salah satu upaya penanggulangan kemiskinan karena pelaksanaanya berjalan bertahap dan berkesinambungan. “PNPM-MP itu dilaksanakan masyarakat sendiri mulai

dari perencaan, pelaksanaan, pengawasan sampai pemeliharaan, karena tidak mungkin orang lain lebih tahu tentang kebutuhan pembangunan di desa dari pada masyarakat itu sendiri,” kata Amru Daulay melalui Kabag Humas M Taufik Lubis,SH di Panyabungan, Minggu (23/5). Hal itu disampaikan Taufik sejalan dengan adanya kunjungan kerja Bupati Madina

BACA DI HALAMAN DALAM BK DPRD Paluta Kecewa Anggota Dewan Aniaya Wartawan B12 Penentu Pilkada Madina Ada Di Tangan Masyarakat B12 Pembangunan KawasanPerkantoran Pemkab Palas Segera Terwujud B12

H Amru Daulay ke sejumlah kecamatan terdapat di daerah itu untuk meresmikan proyek / kegiatan tahun anggaran 2009 dialokasikan ke setiap kecamatan yang salah satu di antaranya pembangunan didanai dari program PNPMMP. Dijelaskan, program PNPM merupakan gerakan bersama untuk meningkatkan kesejahteraan rakyat,agar masyarakat luas semakin terpenuhi kebutuhan hidup seharihari. Oleh karena itu program ini di Madina harus sukses setiap tahunnya. Menurutnya, pembangunan dibiayai program PNPM Lanjut ke hal A2 kol 1

JAKARTA (Antara): Petugas Kantor Pelayanan dan Pengawasan Bea dan Cukai, Juanda Surabaya menangkap dua Warga Negara Malaysia yang kedapatan membawa dua kg shabu atau methamphetamine. Kepala Humas Direktorat Jenderal Bea dan Cukai (BC), Evi Suhartantyo dalam keterangannya di Jakarta, Minggu (23/5) menyebutkan, petugas mengamankan dua warga Malaysia itu Sabtu (22/5) malam. Dua warga Malaysia dimaksud adalah LKT dan TKP yang menumpang pesawat Cathay Pacific Nomor CX 781 HK. Modus yang digunakan pelaku adalah dengan “body streaping” di mana masingmasing pelaku membawa satu kg shabu. “Nilai dua kg shabu yang dibawa dua pelaku mencapai sekitar Rp4 miliar,” kata Evi. Sebelumnya pada per-

tengahan Mei 2010 ini, Kantor Pelayanan dan Pengawasan Bea dan Cukai Juanda juga menggagalkan penyelundupan shabu-shabu dari Malaysia yang dibawa seorang Tenaga Kerja Indonesia (TKI) asal Lumajang. Petugas menyita barang bukti dari seorang tersangka berinisial S dengan barang bukti shabu seberat 50 gram. Modus operandi yang digunakan oleh tersangka (kurir) yaitu memasukkan shabu senilai Rp100 juta itu ke dalam satu kemasan susu bubuk. Namun, penyelundupan shabu-shabu itu akhirnya terungkap berkat pemeriksaan “profiling” yang menggunakan alat deteksi narkoba bantuan Pemerintah Australia. Pelaku menempuh perjalanan dari Kuala Lumpur, Malaysia dengan pesawat Air Asia bernomor penerbangan Q27616.

Satu Tewas Tiga Luka SIBUHUAN (Waspada): Kecelakaan lalu lintas di Sigalagala, Sibuhuan Kecamatan Barumun sering terjadi. Kali ini sepeda motor jenis Honda Exotic BM 6230 DS bertubrukan dengan sepeda motor Supra X 125 BB 4737 KB. Satu orang tewas dan tiga mengalami luka-luka. Menurut keterangan yang dihimpun Waspada, Jumat (21/ 5) sekira pukul 18:00, terjadi kecelakaan yang menelan korban jiwa di Sigala gala, sekira tiga kilometer dari Pasar Sibuhuan arah Sosa. Kasat Lantas Polres Tapsel, AKP J Tarigan melalui Ka Pos Lantas Sibuhuan, membenarkan kecelakaan lalu lintas yang menewaskan pengendara sepeda motor Honda Exotic BM 6230 DS Iskan Rambe, 18, dengan sepeda Honda Supra X 125 BB 4737 KB di Sigala-Gala Sibuhuan, Kecamatan Barumun, Jumat (21/56) sekitar pukul 17:30. (a32)


Mantan Presiden RI ke-3, BJ Habibie mendampingi saat-saat terakhir kepergian istrinya Hasri Ainun Habibie Besari di Rumah Sakit Ludwig-Maximilians-Universitat, Klinikum Grohadern, Muenchen, Jerman, Sabtu (22/5) kemarin. Almarhumah meninggal pada usia 72 tahun, rencana. jenazah tiba di Indonesia pada Rabu (26/5) mendatang.

Presiden: Ainun Memang Layak Dimakamkan Di Taman Makam Pahlawan Pesan Ainun: Saya Titip Bapak JAKARTA (Waspada): Presiden Susilo Bambang Yudhoyono (SBY) menegaskan bahwa almarhumah Hasri Ainun Habibie memang pantas dimakamkan di Taman Makam Pahlawan Kalibata Jakarta, bukan hanya karena dia istri mantan presiden BJ Habibie tapi juga karena jasanya. “Pak SBY berkata bahwa Ibu Ainun Habibie berhak mendapat perlakuan hak seperti ini (dimakamkan di TMP Kalibata, Jakarta, red)bukan sekedar sebagai istri Pak Habibie tapi juga karena jasa-jasanya,” kata juru bicara keluarga BJ Habibie, Achmad Watik Pratiknya kepada pers di Jakarta, Minggu (23/5).

Lanjut ke hal A2 kol 1

Humas Tapteng Imbau Instansi Waspadai LSM Gadungan P A N D A N , Ta p t e n g (Waspada): Terkait penangkapan 8 oknum LSM gadungan dengan sebutan lembaga Reclassering Indonesia Komisariat Wilayah Sumatra Utara (Komwilsu) yang beralamat di

Pembangunan Padanglawas Dan Pembohongan Publik KABUPATEN Padanglawas, pemekaran Kabupaten Tapanuli Selatan lahir sesuai Undang-undang No: 38 tahun 2007, lahir dan terbentuk dengan penuh perjuangan serta proses panjang yang diawali sejak tahun tahun 1992, namun hingga saat ini masih jauh dari keinginan dan harapan masyarakat. Pembangunan Padanglawas di era Pejabat Bupati Soripada Harahap berjalan sesuai kemampuan dengan keterbatasan, karena masih memiliki ketergantungan dengan

Watik Pratiknya mengatakan Presiden Yudhoyono secara langsung menyampaikan duka cita kepada Habibie melalui sambungan telefon internasional atas wafatnya Hasri Ainun Habibie. “Tadi malam, Pak SBY menghubungi Pak Habibie yang sampai saat ini masih di rumah sakit. Pak SBY menyampaikan duka cita atas nama pribadi, keluarga, pemerintah, dan atas nama seluruh bangsa Indonesia,” kata Watik Pratiknya di kediaman keluarga Habibie di Jalan Patra Kuningan Jakarta Selatan.

induknya, Tapanuli Selatan. Berbagai elemen masyarakat Kabupaten Padanglawas, baik masyarakat biasa, mahasiswa hingga kalangan legislatif belakangan, mengkritik keras kebijakan pemerintah daerah, bahkan diduga kuat telah terjadi korupsi dan penyalahgunaan, hal ini tentu akan memberi pengaruh terhadap pembangunan daerah.

Lanjut ke hal A2 kol 2

Jalan Djamin Gintings Medan oleh Polsek Barus. Baru-baru ini Humas Pemkab Tapteng mengimbau kepada seluruh instansi jajaran Pemkab Tapteng untuk mewaspadai LSM gadungan yang ingin memeras. Kabag Humas Pemkab Tapteng Drs Surya Darma kepada wartawan di ruang kerjanya di Pandan akhir pekan lalu mengatakan, aktivitas LSM gadungan telah meresahkan PNS di instansi jajaran Pemkab Tapteng, sehingga instansi harus mewaspadai LSM gadungan yang masih banyak berkeliaraan di Tapteng. “Oleh karena itu, kami mengimbau kepada seluruh instansi di jajaran Pemkab Tapteng untuk tetap mewaspadai LSM gadungan yang selama ini melakukan peme-

rasan dengan kedok melakukan sosial control terhadap penyelewengan dana APBD, APBN, DAK, DAU dan BOS yang ujung-ujungnya meminta sejumlah uang kepada kepala instansi yang didatangi,” katanya. Dikatakan, apabila kedepannya ada LSM gadungan yang mendatangi instansi di Lanjut ke hal A2 kol 4

Serampang - Lanjutkan ..... - He.... he....he....

Berita Utama

A2 Presiden: Ainun ....

Presiden juga menyampaikan bahwa ia secara pribadi dan seluruh jajaran pemerintah merasa kehilangan sosok Ainun Habibie yang bukan sekadar mantan ibu negara tetapi juga sosok yang memiliki rekam jejak berjasa besar kepada masyarakat. Menurut Presiden seperti yang disampaikan Watik, Ibu Ainun banyak berjasa kepada masyarakat melalui lembaga, organisasi sosial baik berbentuk beasiswa, donasi, maupun yayasan lain. “Pak Habibie pada kesempatan yang sama menyampaikan terima kasih atas perhatian dan mengingatkan kembali kepada Presiden bahwa surat yang disampaikannya sempat membuat Ibu Ainun merasa terharu saat dibacakan di telinganya,” katanya. B.J. Habibie menyampaikan terima kasih atas nama pribadi, almarhumah, maupun keluarga karena perhatian Presiden dan Pemerintah. Mantan presiden itu seperti yang disampaikan kepada Watik mengungkapkan rasa terima kasihnya atas perhatian pemerintah termasuk dalam

Anas Disambut ....

Urbaningrum memperoleh 252 suara dan Marzuki Alie 218 suara. Tiba-tiba sejumlah peserta mendatangi Anas untuk memberikan ucapan selamat. Sejumlah wartawan juga merangsek mendekati Anas. Puluhan petugas keamanan juga masuk sehingga suasana makin riuh. De n g a n b e g i t u , h a s i l sementara pemilihan Ketua Umum Demokrat itu akan menetapkan Anas Urbaningrum menjadi Ketua Umum Demokrat berikutnya, menggantikan Hadi Utomo. Kemenangan Anas ini menimbulkan kegembiraan luar biasa bagi para pendukungnya di arena kongres. Atmosfir kegembiraan tak terbendung saat suara Anas melewati setengah dari total suara. Penghitungan suara putaran kedua berlangsung sangat sengit dan menegangkan. Di awal penghitungan putaran kedua ini, Marzuki Alie sempat memimpin. Perolehan suara Marzuki Alie memimpin sampai titik angka 117 suara. Setelahnya, Anas kembali memutar balik keadaan dan memimpin hingga posisi 51 persen lebih.

Bupati Madina: ....

harus didukung bersama karena akan dapat melepaskan Madina dari ketertinggalan sehingga apa yang menjadi visi daerah itu dapat terwujud apalagi sekarang sudah lebih maju dari kabupaten lain di Sumut. “Pembangunan semacam ini harus didukung bersama baik pembangunan jalan, MCK, air bersih, saluran dan irigasi agar masyarakat Madina terlepas dari ketertinggalan,” ucapnya. Diungkapkan, program itu mulai dilaksanakan pada saat negara kita mengalami krisis moneter tahun 1997/1998 yang lalu. Pada mulanya program ini diluncurkan untuk mengembalikan kepercayaan masyarakat terhadap pemerintah, namun setelah dilaksanakan ternyata hasilnya sangat menggembirakan, sehingga pemerintah melanjutkannya program ini dengan nama program nasional pemberdayaan masyarakat (PNPM) mandiri pedesaan. Untuk itu, harapkan Tau-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ........, Mg1+. 2, Rh3, Mh1+. 3. MxM, BxM+mat.

Jawaban TTS: TTS Topik








Jawaban Sudoku:

1 6 4 2 3 5 8 7 9

9 7 3 8 1 6 2 5 4

8 5 2 4 7 9 1 3 6

2 9 1 5 6 7 3 4 8

3 8 6 1 4 2 7 9 5

7 4 5 3 9 8 6 1 2

6 1 8 7 5 4 9 2 3

5 2 7 9 8 3 4 6 1

4 3 9 6 2 1 5 8 7

menangani persoalan transportasi pemulangan jenazah dari Jerman ke Indonesia hingga memakamkan jenazah di Taman Makam Pahlawan (TMP) Kalibata. Ia mengatakan, pemerintah telah mencadangkan dua tempat di TMP Kalibata untuk Ainun dan Habibie mengingat keduanya sudah bertekad untuk tidak terpisahkan sampai akhir hayat. “Pada saatnya nanti, Pak Habibie juga akan dimakamkan disana,” katanya. Sejak masuk ke rumah sakit pada 24 Maret 2010, Habibie selalu mendampingi Ainun dan tidak pernah keluar dari rumah sakit. Watik yang juga Direktur Eksekutif Habibie Center itu mengatakan, sampai dimakamkam nanti Habibie tidak ingin berpisah dengan Ainun dan meminta agar selalu satu mobil dengan jenazah sampai peristirahatannya yang terakhir. Hasri Ainun Habibie meninggal pada Sabtu (22/5) pukul 17:30 waktu Munich atau 22:30 WIB. Hasri Ainun Habibie lahir di Semarang pada 11 Agustus

1937 semasa hidupnya aktif di bidang sosial kemasyarakat. Ia aktif di beberapa yayasan yang didirikan keluarga. Menjelang wafatnya, Ainun sedang aktif memperjuangkan adanya fatwa yang menganjurkan donor mata melalui yayasan Bank Mata Indonesia. Saya Titip Bapak Mantan ibu negara, almarhumah Hasri Ainun Habibie sempat menyampaikan pesan kepada keponakannya, Adrie Subono, sebelum meninggal. “Saya titip Bapak,” bisik Ainun. “Dia selalu pesan kepada saya begini ’Saya titip Bapak’,” kata promotor musik terkemuka Adrie Subono di kediaman keluarga Habibie di Jalan Patra Kuningan XIII, Jakarta Selatan, Minggu (23/5). Adrie adalah keponakan BJ Habibie. Ia mengaku memiliki kedekatan yang sangat intens dengan keluarga Habibie, khususnya BJ Habibie. Ia pernah diasuh keluarga Ainun dan Habibie selama delapan tahun ketika tinggal di Jerman. Sebelum Habibie menjabat sebagai Presiden, Adrie selalu menemani Habibie ke mana

pun beliau pergi. “Saya selalu menemani Bapak untuk shalat Jumat, makan siang, atau bepergian. Sekarang setelah ibu tidak ada, pesan ‘titip Bapak’ itu seperti amanah yang harus saya jaga,” katanya. Ia mengatakan, Bapak dan Ibu Habibie selama ini tidak pernah terpisahkan satu sama lain. “Mereka tidak pernah berpisah, di mana ada Bapak, di situ ada Ibu. Sekarang setelah ibu tidak ada, saya khawatir dengan Bapak,” katanya. Adrie mengaku terakhir bertemu dengan Hasri Ainun Habibie sekitar dua bulan lalu sebelum berangkat ke Jerman. Di kediaman keluarga Habibie, Jalan Patra Kuningan XIII, Jakarta Selatan, sudah banyak pelayat datang. Keluarga telah mendirikan tenda untuk mempersiapkan kedatangan pelayat yang lebih banyak. Sejumlah kerabat dan beberapa anak dari pondok pesantren Alawiyah hadir untuk melakukan doa bersama. Pembacaan Al Quran akan terus-menerus dilakukan secara bergantian dan akan dilakukan pengajian malam. (ant/kps)

Anas saat ini tercatat sebagai Ketua Dewan Pimpinan Pusat Partai Demokrat. Pria kelahiran Blitar, Jawa Timur, 15 Juli 1969 ini terpilih menjadi anggota DPR periode 2009– 2014 dari daerah pemilihan Jawa Timur VI. Anas juga Ketua Fraksi dari Partai Demokrat di DPR RI. Pada putaran pertama, Anas memperoleh suara terbanyak meski bersaing ketat dengan Marzuki. Meski tidak sampai 50 persen plus satu, Anas berhasil menangguk dukungan terbanyak dengan 236 suara, sementara Marzuki 209 Suara. Satu kandidat lainnya, Andi Mallarangeng, harus mengakui keunggulan dua pesaingnya dengan hanya mendapatkan 82 suara. Adapun dua suara terhitung tidak sah. Sebelum perhitungan suara putaran kedua, Andi Mallarangeng sempat menggelar rapat tertutup dan memutuskan untuk mengalihkan dukungan ke Marzuki Ali. Bahkan keduanya masuk ruang kongres bersama. Andi disebut menawarkan diri menjadi Sekjen jika Marzuki Ali terpilih. Kubu kandidat Ketua Umum Partai Demokrat Anas

Urbaningrum menawarkan posisi Sekretaris Jenderal (Sekjen) bagi putra kedua Susilo Bambang Yudhoyono, Edhie Baskoro, jika ia memenangi kursi Demokrat Satu. “Kita akan mengusung Ibas (Edhie Baskoro) sebagai Sekjen. Itu sudah kita sampaikan namun beliau belum menyanggupi,” kata pendukung Anas yang juga Wakil Ketua Umum Partai Demokrat Ahmad Mubarok. Hal itu disampaikan Mubarok setelah hasil proses pemilihan suara terbanyak putaran pertama untuk ketua umum dimenangkan oleh Anas dengan 236 (44,6 persen) diikuti Marzuki Alie 209 suara (39,5 persen) dan Andi Malarangeng 82 suara atau 15,5 persen. Tempat Terhormat Anas Urbaningrum janji akan menempatkan saingannya dalam bursa ketua umum Partai Demokrat, Marzuki Alie dan Andi Mallarangeng, di tempat terhormat. “Dari musayawarah di Tim Anas, kami mengusulkan agar Pak Marzuki ditempatkan sebagai Wakil Ketua Dewan Pembina dan Andi sebagai Sekretaris Dewan Pembina,” kata anggota tim pemenangan

Anas Urbaningrum, Angelina Sondakh, di lokasi Kongres II. (kps/ant)

fik, partisipasi masyarakat bergotong royong dalam memanfaatkan dana yang tersedia agar kebutuhan masyarakat pedesaan yang sangat mendesak dapat dipenuhi sehingga kesejahteraan masyarakat miskin khususnya dan umumnya masyarakat Madina dapat meningkat. Bupati Amru Daulay kemudian mengingatkan agar semua potensi lokal dilibatkan agar progran PNPM menjadi gerkan bersama.”Saya minta kepada kepala desa dan camat untuk tetap mensukseskan program ini melalui pengawasan yang baik,dengan demikian program ini kan mencapai sasaran yang diharapkan. Kalau PNPM Mandir i dapat kita laksanakan secara baik di Madina,Insya Allah, kita bisa mengurangi kemiskinan. Mari kita sukseskan bersama agar ke depan masyakarat di daerah makin mandiri. Mandiri dalam arti rakyat makin memiliki kecukupan pangan,sandang dan papan,” pintanya. Kepala Badan Pemberdayaan Masyarakat Madina Awaluddin Nasution ditemui

secara terpisah mengatakan,anggaran PNPM-MP yang bakal diterima masyarakat Madina pada tahun 2010 terus meningkat.Kalau pada tahun 2009 hanya Rp 36 miliar, pada tahun ini direncanakan menjadi Rp 48,5 miliar. Awaluddin menjelaskan, pada tahun 2007 Madina mendapatkan dana PNPM sebanyak Rp 5,5 miliar dan dana itu dibagikan kepada masyarakat 33 desa di 6 kecamatan. Pada tahun 2008 kabupaten tersebut mendapatkan dana PNPM sebanyak Rp 10,408 miliar yang dibagikan kepada 50 desa di 7 kecamatan. Kemudian pada tahun 2009 lanjut Awaluddin Nasution,Kabupaten Mandailing Natal mener ima dana PNPNM-MP sebesar Rp 36 miliar yang dibagikan kepada 185 desa di 23 kecamatan.” Dana PNPM tahun 2010 yang akan diterima sebesar Rp 48,5 miliar akan dialokasikan untuk mengoptimalisasi 185 desa di 23 kecamatan se-Madina dan diyakini bisa mengoptimalisasi desa-desa yang selama ini belum mendapatkan dana PNPM,” ungkapnya. (a24)

Pembangunan ....

lagi memperhatikan kualitas. Hal ini pernah diungkapkan bupati pada suatu pertemuan, pelaksanaan proyek fisik di Palas 80 persen tidak berkualitas. Sekarang telah memasuki triwulan kedua, APBD Padanglawas juga telah disyahkan DPRD di Januari, tetapi sampai saat ini masih belum jelas pelaksanaannya. Belum lagi di Dinas PU Pertambangan dan Energi Palas sebagai tenaga teknis telah tercium indikasi korupsi. Belum lagi proses lelang dan pelaksanaan pembangunan kawasan perkantoran Pemerintah Kabupaten Padanglawas yang dimulti yearskan dengan anggaran Rp216 miliar diduga kuat penuh rekayasa dan mengangkangi aturan dan peraturan perundang-undangan yang berlaku. Kebijakan Pemerintah Kabupaten Padanglawas melalui Kepala Dinas PU Pertambangan dan Energi dalam proses pelaksanaan pembangunan fisik di Padanglawas yang tidak sesuai prosedur itu. Tidak heran menumbulkan perang dingin antara eksekutif dan lembaga legislatif. Bahkan belakangan ini mencuat pula dugaan korupsi di lingkungan Pemerintahan Kabupaten Padanglawas. Hal

Sejak kepemimpinan Bupati Padanglawas defenitif pasangan Basyrah Lubis dan Wakil Bupati H Ali Sutan Harahap dilantik 9 Februari 2009 oleh Gubernur Sumater Utara, H Syamsul Arifin, SE, harapan masyarakat akan terjadi perubahan dan percepatan pembangunan di Padanglawas secepatnya. Di awal kepemimpinan Bupati dan Wakil Bupati defenitif berjalan baik dan harmonis, sekalipun dengan keterbatasan. Bahkan beberapa bulan kemudian anggaran pendapatan dan Belanja Daerah (APBD) Kabupaten Padanglawas TA 2009 disahkan dan disetujui DPRD, malah tergolong lebih awal mendapat persetujuan Gubernur Sumatera Utara. Memasuki bulan Oktober pelaksanaan proyek fisik TA 2009 belum terlaksana, sedang jadwal pelaksanaan semakin singkat. Hal itu terjadi menyusul mutasi Kepala Dinas PU Pertambangan dan Energi Kabupaten Padanglawas. sehingga proses pelelangan tender proyek Tahun Anggaran 2009 tertunda-tunda. Menyusul kondisi itu, pelaksanaan proyek fisik TA 2009 terkesan mendesak dan tidak

SBY T etap Tetap Ketua Dewan Pembina

BANDUNG (Antara): Partai Demokrat dalam kongres II di Padalarang Bandung, Jawa Barat, Minggu pagi secara aklamasi kembali menetapkan Susilo Bambang Yudhoyono sebagai Ketua Dewan Pembina periode 2010-2015. Pimpinan sidang paripurna kongres EE Mangindaan membacakan keputusan Kongres nomor 5/2010 yang memutuskan dan menetapkan kembali SBY sebagai ketua dewan pembina partai berkuasa itu. Ketua Dewan Pembina lanjutnya juga diberi wewenang dan mandat penuh menyusun komposisi personalia Dewan Pembina masa bhakti lima tahun. Penyampaian keputusan mengenai pejabat Ketua Dewan Pembina Partai Demokrat ini merupakan agenda pertama Kongres II Partai Demokrat yang berlangsung sejak Jumat (21/5) lalu.

Humas Tapteng ....

jajaran Pemkab Tapteng yang didatangi diharapkan untuk segera melaporkan kepada Humas Pemkab Tapteng dan pihak Kepolisian agar dapat segera di proses. “Dalam menghadapi LSM, instansi di jajaran Pemkab Tapteng harus teliti menerima oknum-oknum yang mengaku LSM yang ingin melakukan social control. Karena belakangan ini banyak LSM gadungan yang hanya mengandalkan ID Card serta melakukan sosial kontrol dengan tujuan memeras instansi yang didatangi dan apabila ada gerak-gerak mencurigakan yang menjurus pemerasan harap langsung dilaporkan ke Polsek terdekat,” tukasnya. Dia juga mengucapkan terima kasih kepada pihak kepolisian yang telah tanggap menindak lanjuti serta menangkap oknum-oknum yang mengaku LSM yang telah melakukan pemerasan terhadap kepala sekolah di Barus. (a18) ini telah disampaikan ke kejaksaan tinggi Sumatera Utara, baik melalui aksi mahasiswa maupun laporan tertulis dari masyarakat. Inilah mungkin hasil pembangunan Kabupaten Padanglawas sejak tahun 2009 hingga saat ini. Padahal tujuan pemekaran tidak lain adalah untuk percepatan pembangunan dan peningkatan pelayanan publik, bukan untuk kepentingan kelompok atau golongan tertentu. Untuk menjalankan roda pemerintahan dan pembangunan daerah tentu tidak akan mungkin hanya dilakukan bupati dan wakil bupati, untuk itu sangat dibutuhkan menciptakan pemerintahan harmonis. Belum Terlaksana Sejak disahkannya APBD Palas TA 2010 hingga saat ini rencana penerapan PP 41 dan Perda Palas menyangkut susunan struktur pemerintahan masih belum terealisasi. Pelantikan pimpinan Satuan Ke r j a Pe ra n g k a t Da e ra h (SKPD) sebagai penanggungjawab pengguna anggaran di masing-masing satuan kerja belum terlaksana. Akibat kondisi ini kinerja dan pelayanan SKPD di lingkungan Pemerintahan Kabu-

WASPADA Senin 24 Mei 2010

Kecamanan Terhadap Pemukulan Wartawan Waspada Terus Mengalir Pelaku Tebar Ancaman Di Paluta

nsi anggota DPRD Paluta terhadap wartawan. Katanya, perbuatan melawan hukum berupa menghalang-halangi wartawan dalam tugas jurnalistik, merupakan satu perbutan melawan hukum sebagaiman diatur dalam UU No.40 tahun 1999 tentang pers. “Saya menyesalkan sikap AH sebagai anggota DPRD Paluta yang menganiaya wartawan saat melakukan tugas jurnalistik. Ancaman hukuman bagi tindakan seperti itu, sesuai UU tentang Pers dipenjara 2 tahun dan denda Rp 500 juta. Pihak kepolisian diminta tegas dan independen dalam menangani kasus ini,” pintanya. Anggota DPRD Sumut, Mulkan Ritonga, juga menyesalkan sikap seorang anggota DPRD yang tidak elegan dan melakukan pelanggaran serta pengangkangan UU No.40 tahun 1999 tentang pers. ‘Secara pribadi dan lembaga, saya menyesalkan sikap seperti itu,” ucapnya. Patentengan Sementara informasi diperoleh dari sejumlah sumber di Paluta menyebutkan, D selaku oknum pelaku pemukulan terhadap wartawan Waspada, Sori Parlah Harahap, bebas berkeliaran dan malah patentengan. Menurut pengakuan sejumlah sumber, dia melah mengintimidasi dan mengancam wartawan lainnya di Paluta. “Sudah kau lihat yang kulakuan kepada Sori Parlah, apa kau mau seperti itu, tunggu giliranmu,” ancamnya kepada sejumlah wartawan sebagaimana dituturkan sumber yang turut diintimidasi dan takut disebut identitasnya. Hal ini juga mendapat kecaman dari mahasiswa, mereka meminta pihak kepolisian agar segera menangkap dan menahan oknum tersebut. Karena jika masih dibiarkan terus berkeliaran, akan melakukan intimidasi dan tindakan semenamena terhadap orang lain. “Kepada Polres Tapsel yang menangani kasus penganiayaan dan pemukulan wartawan Waspada ini, diminta tegas dalam penerapan hukum sesuai UU No.40 tahun 1999 tentang Pers dan bukan KUH Pidana saja,” pinta mahasiswa. Kecaman juga datang dari Koordinator DPD Gerakan Indonesia Bersatu (GIB) Wilayah

Tabagsel, Drs Aliuddin Harahap, yang mendesak Kapolres Tapanuli Selatan (Tapsel) AKBP Subandriya, SH.MH, segera menyurati Gubsu hingga Mendagri. Itu dijelaskannya kepada Waspada di Padangsidimpuan, Jumat (21/5). Tujuannya, untuk mempercepat proses pemeriksan sesuai hukum terhadap oknum anggota DPRD Paluta, AH. Ia sangat menyayangkan sikap seorang oknum anggota DPRD, yang begitu lantang melakukan aksi penganiayaan di hadapan pihak kepolisian. “Perbuatannya itu secara tidak langsung telah mencoreng, dan tidak lagi menghargai pihak kepolisian yang sedang bertugas,” ucapnya. Praktisi hukum juga meminta aparat hukum harus menuntaskan persoalan dugaan kasus CPNS Gate tahun 2009 di Kabupaten Padanglawas Utara yang sudah berlangsung lama. Tujuannya untuk menghindari terjadinya hal-hal lebih lebih fatal yang tidak diinginkan, jika berlama-lama, kasus itu sangat berpotensi mengakibatkan terjadinya konflik di tengah-tenghah masyarakat. Hal itu ditegaskan praktisi sekaligus pengacara senior asal Kota Medan, Hamdani Harahap, SH, saat dikonfirmasi Waspada via seluler, Jumat (21/ 5), terkait aksi penganiayaan yang dilakukan oknum anggota DPRD Paluta dari Partai Patriot, AH, dan D yang melakukan pemukulan terhadap wartawan Waspada di Paluta. Arjuman Membantah Sementara itu dalam surat klarifikasinya yang diterima Waspada, Jumat (21/5) sore, terkait kasus pemukulan itu, anggota DPRD Paluta H Arjuman Harahap membantah telah memukul wartawan Waspada Sori Parlah Harahap saat berlangsungnya demo, Kamis (20/5). “Dengan ini saya tidak ada melakukan pemukulan atau penganiayaan terhadap Sdr Sori Parlah Harahap. Masalah yang pemukulan itu yang bernisial D, saya tidak tahu kalau ada pemukulan,” katanya. Menurutnya, ini semua terjadi hanya kesalahpahaman saja, karena hubungannya dengan Sori Parlah Harahap selama ini berjalan dengan baik dan tidak ada masalah apapun (a20/csh)

P.SIDIMPUAN (Waspada): Segenap elemen mahasiswa di Tapanuli Bagian Selatan (Tabagsel), Jumat (21/5), mendesak pihak kepolisian untuk segera menangkap oknum anggota DPRD Padanglawas Utara, AH, pelaku penganiyaan, dan seorang temannya, D, pelaku pemukulan terhadap wartawan Waspada, Sori Parlah Harahap. Mereka mendesak Polres Tapanuli Selatan yang menaungi Polsek Padangbolak untuk tidak membiarkan kedua oknum tersebut berkeliaran. Karena dianggap bisa mengulangi sikap arogansi dan premanismenya terhadap orang lain. Elemen mahasiswa yang menyatakan desakan itu, Ketua MPM STKIP, Tongku P Hasibuan, Ketua Umum HMI cabang Padangsidimpuan, Anra Yoparisa, Ketua PMII cabang Padangsidimpuan-Tapsel, Ibrahim Syah, Ketua PC IMM Padangsidimpuan-Tapsel, Rudimansyah, Ketua AMPERA, Parningotan Aritonang. Ketua GEMMA Nusantara, Muhammad Sukur Nasution, Ketua PKM, M Syarif Hasibuan, Ketua AMPS, Irfan Ansari Nasution, Gema Pelita, M Al Hasan Nasution. Ketua AMB, Baginda Siregar, Wakil Ketua BEM UMTS, M Soleh Harahap, Ketua PC IPNU Padangsidimpuan, M Nizan Nasution. Bila dibiarkan, menurut mahasiswa, kejadian ini akan menjadi awal keterpurukan demokrasi dan pengekangan terhadap pers di Indonesia. Karenanya tindaklanjut dari pihak kepolisian berupa penangkapan pelaku sangat diharapkan. Kepada pihak legislatif, terkhusus pada Badan Kehormatan Dewan (BKD) juga diminta segera menindak oknum anggota DPRD itu. Hal ini sangat perlu untuk ditindaklanjuti dengan sesegera mungkin agar demokrasi dan kebebasan pers tidak terkangkangi dengan semena-mena. “Pelaku penganiayaan dan pemukulan wartawan Waspada ini harus ditindak tegas. Hukum harus ditegakkan dan jangan sampai gara-gara insiden ini harga diri pihak kepolisian dan DPRD jatuh, kata Parningotan Aritonang. Mahasiswa se Tabagsel benar-benar kecewa terhadap tindakan oknum anggota DPRD Paluta, Arjuman Harahap, yang telah mengedepankan arogansi dalam mengakomodir aspirasi disampaikan kawan-kawan Gema Paluta. Seharusnya, dalam menyahuti aspirasi pengunjukrasa ini dia harus mengedepankan sikaf elegan, professional, arif dan bijaksana. “Penganiayaan yang dilakukannya terhadap wartawan yang edang bertugas di lapangan, merupakan tindakan yang tidak dapat ditolelir secara hukum. Oknum DPRD tersebut telahmelanggar hukum dan etika sebagai wakil rakyat,” kata

M Sukur. Mahasiswa menuntut pihak kepolisian agar menegakkan hukum dan memberi tidnakan tegas terhadap AH dan Dselaku penganiaya dan pemukul wartawan. BK DPRD Paluta juga harus arif dan bijaksana dalam menyelesaikan hal ini, tanpa pandang buku siapapun AH. Mahasiswa sangat khawatir apabila kedua oknum masih dibiarkan berkeliaran di luar. “Mau dikemanakan negara ini apabila tindakan seorang anggota DPRD lebih mengutamakan arogansi dan premanisme dalam menyahuti aspirasi masyarakat dan semena-mena menghalangi tugas jurnalistik yang dilinsungi UU No.40 tahun 1999,” ujar M Soleh. Untuk itu segenap elemen mahasiswa di Tabagsel meminta kepada pihak kepolisian menindak tegas AH dan D. Kemudian secara politis, diminta kepada BK DPRD Paluta segera menindak tegas oknum anggoat DPRD yang melakukan penganiyaan terhadap wartawan dan arogan dalam menyikapi aspirasi masyarakat. Meminta Ketua DPRD Paluta segera membuat rekomendasi kepada partai oknum yang bersangkutan, karena telah melanggar tata tertib dewan. Dimintakan kepada Partai Patriot sebagai partai oknum anggota DPRD Paluta untuk melakukan tindakan tegas sesuai AD/ART partai itu. “Tugas DPRD adalah mengawasi, merencanakan, dan menetapkan anggaran serta peraturan daerah. Bukan menunjukkan arogansinya saat menerima aspirasi masyarakat, dan bukan menganiaya wartawan yang sedang meliput aksi,” ujar Tongku. Tongku berharap, oknum DPRD Paluta dan temannya yang memukul wartawan, D, seharusnya menyadari apa yang sudah mereka perbuat. Bukan malah patentengan dan bangga atas sikap arogansinya itu. “Diharap pihak kepolisian agar kiranya kasus ini ditindaklanjuti dengan cepat, sebagaimana tugas dan fungsinya selaku pelindung, pengayom, dan pelayan masyarakat,’ harap Tongku. Secara terpisah, Ahmad Kamil Lubis yang merupakan mantan aktifis PMII dan kini Sekretaris KNPI Kota Medan, juga menyesalkan sikap aroga-

NU Sibolga ....

RAWAN KECELAKAAN: Jembatan tua yang menghubungkan Kelurahan Hutaimbaru dengan Sabungan menjadi tempat yang sangat rawan terjadinya kecelakaan. Bagian kiri dan kanannya sudah longsor, sehingga jalan menyempit dan sangat membutuhkan perbaikan, Minggu (23/5).

Ranting NU se-Kota Sibolga, serta lima badan Otonom NU, yakni Muslimat NU, Gerakan Pemuda Ansor, Fatayat NU, IPNU, dan IPPNU, akan dihadiri Ketua PW NU Sumatera Utara, H. Asyari Tambunan. Dengan tema konferensi Meningkatkan khidmah Nahdliyah untuk Sibolga yang lebih bermartabat. (a34) paten Padanglawas tidak maksimal, dan terkesan setengah hati. Karena itu keharmonisan di lingkungan SKPD pun ikut terusik, bahkan terjadi pengkotak-kotakan. Keadaan ini terjadi menyusul pengangkatan pejabat dan eselon di lingkungan Pemkab Padanglawas sebelumnya yang tidak proporsional. Masyarakat Padanglawas sekarang semakin jeli dan bisa melihat sendiri kondisi daerah Padanglawas saat ini. Termasuk bagaimana kondisi pembangunan daerah Padanglawas, maupun harmonisasi di lingkungan pemerintahan. Namun masyarakat sangat berharap agar Pemerintahan Kabupaten Padanglawas ke depan berjalan dengan baik sesuai aturan, peraturan perundang-undangan yang berlaku. Masyarakat tentu tidak menginginkan pembangunan daerah Kabupaten Padanglawas diwarnai dengan pembohongan terhadap publik. Bagaimanapun kita tidak menginginkan gejolak yang terjadi di lingkungan Pemerintahan Kabupaten Padanglawas harus diselesaikan melalui pengajuan hak angket ataupun lewat ranah hukum melalui keputusan pengadilan. (a32)

Waspada/Sukri Falah Harahap

5 Rumah ....

terkejut ada kobaran api di bagian atas dari dapur rumah, diduga akibat hubungan arus pendek listrik. Korban Sarah Nasution, 75, Goloman Nasution, 35, mengalami kerugian sekira Rp40 juta, Sumadin Daulay, 52, empat orang anak mengalami kerugian sekira Rp50 juta, Muhammad Yusuf Daulay, 30, mengalami kerugian sekira Rp20 juta. Menurut keterangan Suherman, 38 tetangga korban, kepada Waspada di sekitar lokasi, api begitu cepat membesar dan menjalar, sehingga membuat rumah tiga pintu semi permanent yang berukuran 20 meter x 12 meter ludes terbakar dan rata dengan tanah sekira 30 menit kemudian. Sekalipun ramai warga yang memberi pertolongan hanya dua sepeda motor yang terselamatkan, satu unit sepeda motor, genset, chainsaw dan sejumlah perabotan rumah tangga habis terbakar, hanya tinggal pakaian di badan. Akibat sulitnya air, hanya memanfaatkan sumur warga di sekitar lokasi kebakaran, sehingga sulit memadamkan kobaran api, setelah rumah rata dengan tanah sekira pukul 05:30 api berangsur padam. Kapolres Tapsel AKBP Subandrya melalui Kapolsek Sosa AKP M. Basyir didampingi Kanit Reskrim Iptu Agus M. Butar butar, saat dihubungi membenarkan kejadian kejadian kebakaran itu, diperkirakan kerugian ratusan juta ru-

piah. Semua barang perabotan rumah tangga habis terbakar dan tidak terselamatkan, kebakaran diduga akibat hubungan arus pendek listrik. Sementara Kepala Ranting PLN Sibuhuan, Ir Fauzan ketika dihubungi Waspada terkait kemungkinan penyebab kebakaran akibat hubungan arus pendek listrik, menduga hal itu bisa saja terjadi karena instalasi di dalam rumah tidak sesuai standar. Karena PLN sendiri sudah cukup membuat pengamanan hingga ke rumah pelangan. Sementara Idham Hasibuan dan H Syahwil Nasution anggota DPRD Padanglawas asal kecamatan Hutaraja Tinggi secara terpisah kepada Waspada, melihat setiap kali terjadi kebakaran di Padanglawas tidak tertolong akibat tidak adanya kendaraan pemadam kebakaran. Mereka berharap kepada Pemerintah Kabupaten Padanglawas segera menyediakan mobil pemadam kebakaran. Dua Rumah Di Lumbanjulu Dua rumah warga juga terbakar di pinggir Jalan Lintas Sumatera Desa Lumbanjulu, Kec. Lumbanjulu, Kab.Tobasa, Jumat malam (21/5) sekira pukul 21:30. Rumah milik Opung Bintang Sirait dan Maruasa Sirait hangus terbakar dan empat unit rumah terpaksa dirusak untuk mencegah kobaran api lebih meluas. Informasi yang dihimpun Waspada menyebutkan, malam itu warga tiba-tiba melihat api dari salah satu rumah pen-

duduk secara spontan warga berteriak kebakaran dan beramai-ramai ke lokasi kejadian untuk membantu menyelamatkan harta benda para korban. Sebagian warga berupaya memadamkan api yang begitu cepat membesar. Tidak berapa lama mobil pemadam kebakaran dari PT TPL Porsea yang berjarak 25 kilometer dari lokasi kejadian tiba di lokasi kejadian untuk memadamkan api dengan dibantu masyarakat dan aparat polsek setempat. Api dapat dikuasai sekitar pukul 23:00 dan akibat lokasi kebakaran persis di tepi Jalinsum membuat arus kendaraan dari Parapat ke Balige macet total selama terjadinya kebakaran. Arus lalulintas kembali normal setelah api dapat dipadamkan. PT TPL Serahkan Bantuan Sementara itu, Bagian Media Relation PT. TPL Porsea Ir Fadmin Malau menyerahkan bantuan spontan untuk musibah kebakaran merupakan kepedulian sosial perusahaan secara spontan kepada masyarakat sekitar dan sebagai tanda kebersamaan perusahaan dengan masyarakat. Di lokasi kebakaran, bantuan yang diberikan berupa sembako (beras, gula, kopi dan mi instan) yang diserahkan Manajer Humas TPL Porsea, Ir Tagor Manik kepada para korban kebakaran disaksikan Camat Lumbanjulu Oloan Pane, Danramil Lumbanjulu Kapten SY Purba dan Kapolsek Lumbanjulu AKP GR Purba, kata Fadmin. (a32/a33)

Berita Utama

A2 sungai atau lahan-lahan yang tidak dimanfaatkan dengan tanaman penghijauan yang juga punya nilai ekonomis bagi masyarakat. H Amri Tambunan mengatakan, wilayah Kabupaten Deliserdang yang cukup luas banyak memiliki lahan kritis serta memiliki banyak sungai, dan tentu saja bantaran sungai-sungai (jalur hijau-red) tersebut bisa ditanami dengan tanaman penghijauan. Seperti bantaran Sungai Ular yang panjangnnya mencapai 30 Km dari Kecamatan Galang hingga Kecamatan Pantailabu. Bantaran sungai ini bisa ditanami dengan tanaman bambu dengan melibatkan warga masyarakat. ‘’ Jika hal ini bisa dilaksanakan, kita telah membantu mengurangi pemanasan global yang saat ini telah menjadi ancaman bagi kehidupan manusia,’’ katanya. ‘’ Hal ini harus segera dilaksanakan,’’ perintah Bupati. Secara terpisah, Kepala Dinas Kehutanan, Kepala Dinas Cipta Karya, Kepala Dinas Pendidikan,Pemuda dan Olahraga kepada Waspada mengatakan, mereka menyambut baik instruksi Bupati H Amri Tambunan yang punya ide cukup bagus dalam mengantisipasi pemanasan global dengan melakukan penghijauan di lahanlahan kritis, terutama bantaran-bantaran sungai. (m06)

Data Paspor ...

katanya. Masalah rekrutmen TKI di dalam negeri makin parah setelah dua institusi, yakni Kementerian Tenaga Kerja dan Transmigrasi dengan BNP2TKI saling adu kekuatan dan bersaing terkait kewenangan atas TKI. “Dualisme institusi ini harus diselesaikan, berikan sanksi keras bagi PJTKI dan oknum Imigrasi yang manipulasi data paspor TKI, dan sistem pelatihan ini harus segera diselesaikan, jika pelayanan dan perlindungan pekerja migran mau bagus,” kata Musni Umar.

paspor. “Biasanya manipulasi dimulai dengan pembuatan KTP dengan data palsu,” katanya. Masalah rekrutmen TKI dan TKW di dalam negeri adalah sumber masalah pekerja migran Indonesia di luar negeri. Di antaranya yang banyak terjadi adalah manipulasi data paspor dan pelatihan. “Jika mereka mengalami nasib buruk di tempat bekerja, kita segera marah dan menuding, tetapi penyebab dan akar masalah di dalam negeri tidak diselesaikan dengan baik,”

Ditanduk Tembus ... Julio yang tak berdaya lalu diayun-ayunkan bak mainan, sebelum dilemparkan ke tanah. Penonton pun menjerit histeris, dan berfikir Julio pasti mati. Para matador lain segera terjun ke arena untuk mengalihkan perhatian banteng dan berusaha menyelamatkan Julio. Julio sempat berdiri, sebelum akhirnya terhuyung dan jatuh pingsan berlumuran darah. Petugas Medis segera memberi pertolongan, Julio langsung dilarikan ke rumah sakit. Saat itu juga, Julio menjalani operasi darurat selama satu jam di Pusat Medis Las Ventas, sebelum dipindahkan ke Rumah Sakit di Madrid. Di Madrid, dokter segera melaksanakan tracheotomy darurat dan berusaha keras untuk membangun kembali rahangnya, lidah dan langitlangit mulut dalam operasi besar yang berlangsung selama enam jam. “Ia cukup lama berada di ICU rumah sakit. Kesadarannya mulai pulih dan tanda-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ........, Mg1+. 2, Rh3, Mh1+. 3. MxM, BxM+mat.

Jawaban TTS: TTS Topik








6 1 8 7 5 4 9 2 3

4 3 9 6 2 1 5 8 7


Jawaban Sudoku:

1 6 4 2 3 5 8 7 9

9 7 3 8 1 6 2 5 4

8 5 2 4 7 9 1 3 6

2 9 1 5 6 7 3 4 8

3 8 6 1 4 2 7 9 5

7 4 5 3 9 8 6 1 2

5 2 7 9 8 3 4 6 1

tanda vital lainnya stabil,” kata juru bicara rumah sakit. Ayahnya, yang juga bernama Julio Aparicio mengatakan, tidak ditemukan komplikasi selama operasi. “Ini merupakan kecelakaan yang fatal. Hampir seluruh mulutnya hancur. Terlalu dini untuk bicara tentang restorasi, kita harus menunggu dan melihat,” katanya. Julio Aparicio, dari Sevilla ini memang berasal dari keluarga matador terkenal. Di Spanyol, pertarungan matador dengan banteng merupakan tontonan populer. Apalagi, yang tampil matador terkenal seperti Julio. Dipastikan sekitar 25.000 tempat duduk akan terisi, serta televisi akan melakukan siaran langsung, jika dia yang tampil. (kps)

Kereta Api ... Hujan lebat menyebabkan terjadi longsor yang mengubur rel kereta api dan kereta api terjungkal saat menubruk tumpukan tanah dan reruntuhan, kata CCTV. Kira-kira 2.000 regu pertolongan, termasuk pemadam kebakaran, polisi dan tentara, menemukan 10 mayat dan mengeluarkan 53 orang lainnya yang terperangkap di dalam gerbong yang tertimbun tanah, kata Xinhua. Regu pertolongan menyelamatkan 280 lainnya sampai pukul 09:00 pagi. Mereka juga memperingatkan bahwa longsor masih mengancam. Para wartawan Xinhua di lokasi kejadian melaporkan, lokomotif bersama delapan gerbong dari kereta api yang menarik 17 gerbong itu, terjungkal dan terbalik di kawasan pegunungan. Regu penyelamat menggunakan alat berat untuk membuka jalan menuju gerbong yang terbalik. Tayangan dari CCTV menunjukkan alat berat memindahkan gerbong-gerbong yang menjadi puing itu di luar rel. Satu penyelidikan sedang dilakukan, dengan Gubernur Jiangxi Wu Xinxiong yang tiba di lokasi kejadian bertindak sebagai pimpinan operasi. Presiden Hu Jintao mendesak pihak berwenang kereta api untuk membuka kembali jalur tersebut secepatnya. Hujan lebat dan badai menghantam kawasan itu dalam beberapa hari terakhir dan dam-dam lokal terpaksa melepaskan air yang permukaannya dengan cepat naik. Daerah rendah dan kawasan penduduk mengalami banjir akibat hujan lebat itu, kata Xinhua. (m07)

Senin 24 Mei 2010

Tertangkap Selingkuh, Anggota DPRK Aceh Timur Kritis Dihajar Warga

Bupati DS Instruksikan Dinas Terkait Hijaukan Lahan Kritis DELISERDANG (Waspada): Bupati H Amri Tambunan menginstruksikan kepada dinas terkait di jajaran Pemkab Deliserdang untuk menghijaukan lahan-lahan kritis terutama jalur hijau atau bantaran sungai di kabupaten tersebut dengan tanaman penyangga untuk mengantisipasi pemanasan global. Hal itu diungkapkan Bupati Deliserdang H Amri Tambunan di hadapan Kepala Dinas Kehutanan, Kepala Dinas Cipta Karya dan Kepala Dinas Pendidikan, Pemuda dan Olahraga Kabupaten Deliserdang usai acara Gerakan Siswa Menanam, diprakarsai Muspika Kecamatan Tanjungmorawa dan Kepala Cabang Dinas Pendidikan di lapangan Desa Bangunrejo Tanjungmorawa, Sabtu(22/5) . Menurut H Amri Tambunan, instansi terkait seperti Dinas Cipta Karya, Dinas Kehutanan, Bapedalda, Dinas Kelautan harus pro-aktif dalam membenahi lingkungan dalam rangka mengantisipasi pemanasan global (global warning) yang saat ini sedang menjadi isu internasional.Tujuannya untuk menyelamatkan bumi dari kehancuran akibat pemanasan global. Oleh karena itu, lanjut H Amri Tambunan, dinas terkait harus menghijaukan lahanlahan kritis, seperti bantaran



TANDATANGANI LETTER OF INTENT: Asisten Pemerintahan Setdako Medan Drs. Daudta P. Sinurat MM (duduk, kanan) dan Wakil Walikota Bidang Budget Keuangan Ekonomi dan Kegiatan Usaha Kasimir Stoychov (duduk, kiri) menandatangani letter of intent di Kantor Walikota Burgas, Bulgaria, 12 Mei lalu, disaksikan Ka Biro Otonomi Daerah Sekda Provsu Drs. Bukit Tambunan MAP, Kadisperindag Provsu Drs. H Hasbi Nasution, Staf Ahli Gubsu Ir. Hj. R. Sabrina Msi (paling kiri), Kabag Kerjasama Setdako Medan Drs Rivai Nasution MM (kedua dari kanan) dan Sekretaris Eksekutif Asosiasi Kota Bersadudara Medan Drs Djauzi Ilmi SH. MM.

Medan Tandatangani Berbagai Kerjasama Dengan Burgas MEDAN (Waspada): Medan adalah kota terbesar ketiga Indonesia dan dikenal juga memiliki berbagai potensi penting. Begitu juga Burgas, kota terbesar kedua di Bulgaria. Melihat potensi tersebut, kedua kota menjalin kerjasama di berbagai bidang, demikian Drs. Rivai Nasution MM, Kabag Kerjasama Setdako Medan Minggu (23/5). Penjalinan kerjasama kedua kota diawali kunjungan delegasi Pemerintah Kota Medan, diwakili Asisten Pemerintahan Setdako Medan Drs Daudta P Sinurat MM, Kabag Kerjasama Setdako Medan Drs Rivai Nasution MM dan Sekretaris Eksekutif Asosiasi Kota Bersadudara Medan Drs Djauzi Ilmi SH MM ke Kota Burgas 10-17 Mei 2010. Dalam kunjungan resmi itu dilakukan penandatanganan pernyataan kehendak (letter of intent) antara kedua kota oleh Wakil Walikota Bidang Budget Keuangan Ekonomi dan Kegiatan Usaha Mr Kasimir Stoychov mewakili Walikota Burgas dan Daudta P Sinurat mewakili Walikota Medan, 12 Mei 2010. Penandatanganan letter of intent (LoI) disaksikan Sekda Kota Burgas Mr Bozhidar Kanchev, Ka Biro Otonomi Daerah Sekda Provsu Drs Bukit Tambunan MAP, Kadisperindag Provsu Drs. H. Hasbi Nasution, Staf Ahli Gubsu Ir. Hj. R. Sabrina Msi, Rivai Nasution, Djauzi Ilmi dan Sekretaris III Sosbud

Kedubes RI di Bulgaria Aditya Timoranto. Pernyataan kehendak itu sebagai langkah awal bagi dilakukan penandatangan MoU (Mutual of Understanding) bagi kerjasama antara kedua kota yang diharapkan dapat dilakukan pada tahun ini pasca terpilihnya Walikota/ Wakil Walikota Medan periode 2010-2015. Daudta P. Sinurat mengatakan kepada pers di Medan, Sabtu (22/5), penandatanganan letter of intent sebagai langkah awal terjalinnya kerjasama antara Kota Medan dan Burgas yang sama-sama memiliki potensi. Dia berharap dengan adanya MoU nantinya dapat dikembangkan hubungan bilateral Republik Bulgaria dan RI, khususnya Kota Medan dan Burgas, di bidang perdagangan, budaya, pendidikan, olahraga dan pemuda. Terlebih kedua kota samasama memiliki pelabuhan, sehingga sangat memungkinkan dijalin kerjasama perdagangan antara kedua kota, kata Daudta P Sinurat. “Selambatnya, diharapkan kalau bisa pada akhir tahun ini juga agar segala rencana pengembangan kerjasama kedua kota dapat segera direalisasikan,” ujar Rivai menjawab pertanyaan wartawan tentang hasil kunjungan ke Bulgaria itu. Sambut Baik Dubes RI untuk Republik Bulgaria Immanuel Inkiriwang menyambut baik penanda-

tanganan letter of intent antara Kota Burgas dan Medan. Menurutnya, realisasi penandatanganan kerjasama tersebut merupakan proses kerjasama yang sangat cepat yang pernah difasilitasi Kedubes RI di Sofia. Dia berharap Walikota Medan terpilih nantinya dapat segera menindaklanjuti letter of intent hingga terealisasi penandatanganan MoU. Burgas ibukota Provinsi Bourgas merupakan kota terbesar kedua di Bulgaria. Letak kota ini sangat strategis sekitar 389 km dari ibukota negara, Sofia. Pendapatan perkapita kota berpenduduk 229.250 jiwa (Juli 2007) ini 40 persen lebih tinggi dari rata-rata wilayah negara bagian lainnya di Bulgaria, negara yang akan bergabung dengan Uni Eropa dengan mata uang Leva (1 US$= 1,3 Leva). Sementara itu, Kota Medan berpenduduk sekira 2 juta jiwa merupakan kota terbesar ketiga di Indonesia setelah Jakarta dan Surabaya. Kota ini memiliki pelabuhan internasional Belawan dan Bandara Internasional Polonia. Kota ini telah menjalin hubungan kerjasama lewat Sister City (Kota Kembar) dengan Pulau Pinang Malaysia (1984), Ichikawa Jepang (1989), Gwangju Korea Selatan (1997), Chengdu, China (2002) dan satu Kota Persahabatan (friedship city) yaitu Bandar Raya Ipoh, Malaysia (2009). (m07)

Anas Ketum PD ...

han, setelah kericuhan ketiganya duduk berdampingan. Kurang Intensif Sebelumnya, Andi mengakui dirinya kurang intensif mendekati pengurus cabang dan pimpinan daerah sehingga perolehan suaranya pada putarannya paling kecil, yakni 82 (16 persen). Kepada pers seusai pemungutan suara, Andi mengatakan dirinya lama menjadi juru bicara presiden sehingga tidak cukup waktu mendekati pengurus daerah. Dia menyatakan calon lain, seperti Marzuki yang lima tahun menjadi Sekjen PD dan Anas yang menjadi pengurus partai memiliki waktu yang cukup mendatangi daerah. Andi, kini menjadi Menteri Pemuda dan Olahraga mengucapkan selamat kepada para ketua terpilih sekaligus memberi apresiasi kepada peserta kongres yang sudah menunjukkan kepada masyarakat bagaimana demokrasi berproses di tubuh partai pemenang Pemilu 2009 itu. Konsentrasi di Kabinet Andi Mallarangeng pada kesempatan itu mengaku belum memikirkan posisi dalam kepengurusan baru DPP Partai Demokrat (PD). Untuk sementara dirinya tetap fokus kepada tugas di kabinet. “ Saya konsentrasi di kementerian,” kata Andi di sela putaran II pemilihan Ketum DPP Partai Demokrat periode 2010-2015. Sementara itu, di kubu Anas sebelumnya muncul optimisme akan meraih 270 suara, lebih dari 50 persen plus

1, sehingga pemungut suara cukup satu putaran. Juru Bicara Tim Anas, Ruhut Sitompul, kepada pers mengatakan, Sabtu (22/5) malam semua pendukung Anas berkumpul di sebuah hotel dan tidur bersama di lobi. Kuda Hitam Di luar dugaan Marzuki, si kuda hitam, mendapat peroleh suara di luar perkiraan banyak pihak. Uji coba peroleh suara melalui usulan pemilihan ketua umum yang dipercepat agaknya melambungkan citranya. Dia mengalahkan Andi yang semula dijagokan dan memiliki baliho serta spanduk dukungan di mana-mana. Marzuki memperoleh 209 suara pada putaran pertama dan 246 suara pada putaran kedua. Artinya, terjadi perpindahan suara Andi ke Anas yang sangat siginifikan. Sebelumnya, Ahmad Mubarok, Ketua Tim Pemenang Anas, mengatakan posisi Sekjen Partai Demokrat akan diberikan kepada Edhie Baskoro (Ibas), meski tawaran itu belum dibicarakan secara serius dengan Anas. Sejumlah pengamat menilai, kekalahan Andi karena SBY tidak memberi isyarat mendukung Andi pada saat pidato pembukaan Kongres. SBY justru mengingatkan agar tidak melakukan politik uang. Sikap netral SBY menghidupkan demokrasi di kongres partai pemenang Pemilu 2009 itu, meskipun kubu yang didukung oleh anaknya kalah telak. (m06/Ant/dtc)

pemerintah. “Sudah diketahui letaknya nanti di Taman Makam Kalibata,” ujar Direktur Habibie Center Ahmad Watik Pratiknya dalam jumpa pers di kediaman Habibie, Jl Patra Kuningan XIII, Jakarta Selatan, Sabtu (22/5). Keputusan ini berdasarkan pertemuan antara pihak keluarga dengan pemerintah yang diwakili oleh Wapres Boediono dan Mensos. Jenazah Ainun sendiri hingga saat ini masih berada di RS Munich, Jerman. Menurut Pratikno, ada beberapa proses yang harus dilalui sebelum jenazah diperbolehkan dibawa pulang. Sekitar dua hingga em-

pat jam, jenazah Ainun akan didiamkan terlebih dahulu di sebuah tempat khusus. Setelah itu, jenazah Ainun akan dimandikan. “Kemudian akan disalatkan di Masjid,” tandasnya. Pemegang 2 Bintang Jasa Menurut Direktur Habibie Center, Ahmad Watik Pratiknya, Ainun Habibie pernah menerima dua bintang jasa. Pertama, bintang republik Indonesia kelas dua karena pernah menjabat sebagai ibu negara dan bintang mahaputra adi pradana.“Atas alasan itulah, ibu dimakamkan di Kalibata,” katanya. Rencananya, pemakaman akan digelar pada hari Rabu tanggal 26 Mei 2010. (kps)

Kericuhan terjadi saat wartawan dan para pendukung mencoba mendekati Anas untuk menyalaminya. Namun, puluhan petugas keamanan langsung membentuk barikade di dekat Anas duduk. Melihat hal itu, panitia segera menghentikan sementara proses pemungutan suara. Bahkan pimpinan sidang EE Mangindaan sempat memperingatkan para pendukung. “Kalau belum tertib saya belum akan mulai. Duduk dulu.Duduk,” kata Mangindaan. Para peserta kembali duduk di tempat semula. Sementara itu, Andi Mallarangeng yang semula duduk berjau-

Anas Rangkul ... Sementara itu, Marzuki Alie mengucapkan selamat kepada Anas atas terpilihnya menjadi ketua umum. Ketua DPR tersebut berharap Anas mampu bekerjasama dengan dirinya selama memimpin PD. “Selamat kepada Anas Urbaningrum karena telah memenangkan kontestansi ini,” kata Marzuki. Sedangkan Andi Mallarangeng yang dikalahkan pada putaran pertama juga tidak lupa menyampaikan ungkapan selamat kepada Anas. “Saya berikan selamat. Saya yakin bung Anas mampu membawa Partai Demokrat ke depan,” katanyanya. “Namanya demokrasi. Siapa pun boleh beri dukungan,” tambah Andi. (dtc)

Ainun Habibie, ... keluarga. Contoh dari keluarga yang sakinah, mawadah, dan warohmah,” katanya. Hasri Ainun Habibie wafat pada Sabtu (22/5) setelah dirawat selama sebulan lebih di sebuah rumah sakit di Munich, Jerman. Menurut rencana, jenazah almarhumah baru akan dibawa kembali ke Tanah Air paling cepat pada hari Selasa (25/5). Dimakamkan di TM Kalibata Ibu Hasri Ainun Habibie rencananya akan dimakamkan di Taman Makam Pahlawan Kalibata, Jakarta Selatan. Posisi pemakaman sendiri juga sudah dipersiapkan oleh

LANGSA (Waspada): Seorang anggota Dewan Perwakilan Rakyat Kabupaten (DPRK) dari Kabupaten Aceh Timur, MY, 32, kritis dihajar warga karena berusaha melarikan diri saat tertangkap basah diduga sedang selingkuh (bermesum) di salah satu rumah warga di Dusun Firdaus Desa Sungai Pauh, Langsa Barat, Minggu (23/5) dini hari. Saat ini, korban dalam keadaan koma dirawat di di Rumah Sakit Umum Daerah (RSUD) Langsa. Sementara pasangan mesumnya, San, 25, warga Desa PB.Bromo, Langsa Barat, diamankan aparat Polres Langsa, bersama satu pasangan mesum lainnya yang tertangkap bersamaan. Pasangan yang ditangkap bersamaan dengan MY, berinisial Sai, 33, penduduk Gampong Matang Seulimeng, Langsa Barat dengan pasangannya Wul, 25, warga Kecamatan Julok, Aceh Timur. Kepala Desa Sungai Pauh, Langsa Barat, Bahrum Nazar kepada wartawan menerangkan, peristiwa itu terjadi Ming-

gu (23/5) dini hari sekira pukul 04.00, berawal saat warga menggerebek sebuah rumah karena curiga dengan keberadaan dua pasangan bukan muhrim berada di rumah salah satu warga setempat hingga menjelang pagi. Saat digerebek, warga mendapati dua pasangan non muhrim itu berada di dalam dua kamar berbeda dalam rumah tersebut. “Saat warga menggerebek, kedua pasangan itu dalam keadaan berpakaian lengkap, tapi saat diperiksa dalam kamar yang dihuni anggota dewan Aceh Timur itu bersama pasangannya warga menemukan kondom yang telah dipakai dan di dalamnya berisi sperma,” sebut Bahrum seraya menambahkan warga tahu MY adalah anggota dewan Aceh Timur berdasarkan pengakuannya saat digerebek. Dijelaskannya, saat penggerebekan, warga menemukan MY bersama pasangannya keluar kamar, sementara pasangan bukan muhrim lainnya bersembunyi dalam kamar lainnya. Pada awalnya MY ber-

Kemenhub Akan ...

Padahal, penerbangan haji dimulai pada Oktober 2010, sehingga kalau Batavia atau Lion dipaksakan ikut menerbangan haji, dampaknya cukup besar. “Mudah-mudahan, tahun depan bisa digelar ‘tender’nya,” katanya. Dia setuju menekan lagi ongkos naik haji pada tahun ini dengan cara memotong tarif penerbangan, yang saat ini menyumbang 52,7 persen dari ongkos naik haji.

waktu sampai satu tahun sejak ditetapkan, jadi tidak mungkin dengan waktu sesingkat ini. “Kami sudah minta Kemenhub menentukan spesifikasi pesawat dan tarif penerbangannya,” kata Slamet. Slamet setuju dengan penilaian Kemenhub bahwa mas-kapai swasta, yang ingin mengikuti “tender”, belum bisa menyiapkan pesawat dalam waktu dekat.

Ibu Tiga Anak ... serangga, juga gagal kare-na diketahui keluarga dan ce-pat mendapat pertolongan. Aryadi ipar korban mengatakan, korban diduga mengidap penyakit jiwa dan sudah berulangkali dibawa berobat, namun tak kunjung sembuh. Bahkan sudah pernah dibawa berobat ke ahli kejiwaan. “Sejak sepeninggal ibunya beberapa tahun lalu, pikirannya terganggu. Sejak itulah ia sering pergi berjalan kemana dia mau,” ucap tetangga kor-

Sri Mulyani: Saya ... ”Saya boleh menangis sekarang karena bukan menteri keuangan lagi. Kalau menteri keuangan nangis, rupiah akan guncang....” Ia menangis, entah karena perpisahan itu; entah menangisi Indonesia, negeri yang sangat ia cintai. Namun, ia mengaku menangis karena lega dan bersyukur bisa menyelesaikan tugas dan menyerahkan Kementerian Keuangan yang kondisinya relatif baik dan kuat kepada pejabat baru yang kompeten dan punya komitmen kuat melanjutkan upaya yang sudah ia rintis. Ia juga ditangisi banyak pegawai Kementerian Keuangan yang merasa kehilangan Ibu Menteri yang mampu berpikir out of the box dan berani mendobrak feodalisme birokrasi. Hari itu, ia menerima 1.000 kuntum bunga dan imbauan, ”Ibu pulang ya... 2014....” Di tengah suara-suara keras di ruang publik yang memojokkan, banyak yang menangis diam-diam, menyaksikan ia menjadi bulan-bulanan media dan arogansi para politisi, serta kerasnya perjuangan mempertahankan prinsip dan etika yang ia kukuhi. Seperti yang ia ungkapkan saat memberikan kuliah umum tentang Etika dan Kebijakan Publik di Jakarta, Kamis (20/5), ”Saya berhasil karena tidak didikte oleh siapa pun, termasuk oleh orang yang mengingininya. Selama saya tidak mengingkari nurani saya dan masih menjaga martabat serta harga diri saya, maka di situlah saya menang....” Bagaimana prinsip dan etika hidup itu terbangun? Sejak kecil, dari keluarga. Dengan orangtua, khususnya Ibu, hubungan kami sangat dekat. Bapak dan Ibu selalu menceritakan segala sesuatu tentang kehidupan sehari-hari, kalau ada peristiwa, orang bersikap begini, begitu, selalu mendiskusikannya dengan kita semua. Itu dilihat dari perspektif pedagogi maupun dari sisi sikap hidup. Semua selalu ada urusannya dengan nilainilai atau etika. Mungkin karena latar belakang pendidikan beliau memang guru, jadi setiap hari dijadikan pelajaran untuk anak-anaknya. Tak pernah selesai Sri Mulyani tetap optimistis di tengah situasi yang hanya menyisakan sedikit ruang untuk optimisme. Dalam kuliah umum tentang Etika dan Kebijakan Publik di Jakarta, ia mengungkapkan, ”Hanya sebagian kecil saja yang rakus. Namun, sebagian besar adalah orang baik dan terhormat, yang

usaha mengibuli warga dengan mengaku pasangannya itu adalah istrinya yang baru dinikahi secara siri. “Namun, setelah didesak dia mengaku kalau mereka belum menikah,” ungkap Bahrum. Setelah warga mendengar pengakuan MY yang berbelitbelit, mereka menjadi geram, namun bisa diatasi. Tetapi, beberapa menit setelah petugas Polres Langsa tiba di lokasi, dan bersama warga hendak menggerebek pasangan lainnya yang masih bersembunyi di salah satu kamar rumah itu, tiba-tiba MY berusaha melarikan diri lewat pintu belakang. Warga spontan mengejar dan langsung melampiaskan kemarahan dengan memukul MY hingga tidak berdaya. Kapolres Langsa AKBP. Yosi Muhamartha melalui Kasat Reskrim AKP Galih Indragiri, SIK kepada wartawan membenarkan penangkapan anggota DPRK Aceh Timur bersama rekan dan pasangan bukan muhrimnya oleh warga di Dusun Firdaus. (b22)

Kotak Hitam Air India Ditemukan

ban. Sedangkan suaminya sehari-harinya bekerja di bengkel di depan rumah. Petugas identifikasi Polresta Tebingtinggi dan Polsek Rambutan yang mendapat laporan segera turun lokasi dan melakukan olah tkp. Sejumlah barang bukti seperti tali nilon yang digunakan korban diamankan petugas. Kapolsek Rambutan AKP M. Simarmata dikonfirmasi membenarkan korban tewas bunuh diri. Tetapi jenazah korban tidak divisum karena tidak mendapat izin keluarga. (a09)

MANGALORE, India (AP): Para penyelidik yang sedang berusaha mencari penyebab terjadinya bencana penerbangan terburuk di India dalam kurun waktu lebih dari satu dasawarsa telah menemukan rekaman suara cockpit dan data penerbangan Minggu (23/5) dari reruntuhan pesawat Air India. Pesawat Boeing 737-800 itu tergelincir dari landasan pacu di pegunungan di selatan India Sabtu dan jatuh ke satu jurang, yang menewaskan 158 orang. Hanya delapan orang yang selamat, kebanyakan dari korban melompat dari reruntuhan pesawat sesaat sebelum terbakar. Kantor berita Press Trust of India melaporkan bahwa kotak hitam pesawat ditemukan oleh para penyelidik yang mengangkatnya dari reruntuhan pesawat. (m07)

bertanggung jawab dan dengan genuine mencintai republik ini. Kecintaan ini akan menjaga etika kita saat bertindak.” Di situ ia dengan terbuka mengungkapkan, ”Di dalam sistem politik yang tidak memungkinkan etika politik dimunculkan, orang seperti saya tidak mungkin eksis.” Mempertahankan prinsip dan etika, dan tegas bersikap ”tidak mau” melakukan halhal yang berpunggungan dengan suara hati bukan hal ringan di tengah konflik antarkepentingan. ”Ada perasaan bergelora, resah, dan keresahan itu memuncak saat banyak orang baik merasa frustrasi dan banyak orang yang dipaksa untuk berkompromi. Untuk memutuskan saya tinggal atau pergi adalah dilema; dengan pergi bisa memberi yang lebih baik atau dengan pergi kemungkinan dipengaruhi menjadi lebih kecil.” Anda sudah melakukan reformasi birokrasi selama lima tahun. Sudah tuntas? Membangun Indonesia tak akan ada selesainya. Ibu saya bilang, membangun anak saja seperti membangun can-di, menaruh bata tiap hari, mu-lai dari interaksi pagi. Selama menjalankan tugas, saya mendapat kesempatan besar melakukan sesuatu yang fundamental. Kalau bisa memberi inspirasi pada yang lain, di level yang signifikan, sehingga terus berjalan. Saya lebih percaya pada sistem daripada individual meski sistem terdiri dari individu-individu. Pemimpin memang akan sangat berpengaruh terutama pada saat menunjukkan sikapnya. Tetapi saya lebih menekankan, sistem yang harus dikedepankan. Orang bisa tiba-tiba pergi, tetapi sistem harus tetap jalan. Apa filosofi Anda menghadapi proses panjang? Waktu saya capai dan malas menulis skripsi, almarhum Mbah Putri saya bilang, ‘Wis ta, Ndhuk (ndhuk adalah istilah Jawa untuk anak, keponakan, cucu kesayangan), dilakoni. Sehari selembar, lama-lama juga selesai’. Ini mengajarkan ketekunan, persistensi, ada unsur endurance (keuletan), tawakal. Begitu seharusnya kita bekerja. Menjawab kritik Sri Mulyani menyadari, banyaknya kritik muncul dari kekecewaan. ”Negeri ini kaya akan sumber daya alam,” ujarnya. ”Di pertambangan, Anda tinggal datang, keruk, jual, tidak menyejahterakan. Kontraknya tertutup dalam rezim represif. Sekarang, kontrak itu harus dilihat lagi, prosesnya harus genuine, terbuka, bisa di-

cek berapa banyak yang dikeruk, berapa besar yang dijual, berapa harga jualnya sehingga kita bisa memperkirakan penerimaan dan pajaknya.” Pajak adalah salah satu sarana menyejahterakan rakyat. Pemerintah harus melakukan intervensi di bidang pendidikan, kesehatan, dan pelayanan sosial secara umum. Untuk itu, dibutuhkan birokrasi yang bersih dan efektif. Kalau ada kasus, itu adalah koreksi agar tahu sistemnya masih ada yang lemah. Reformasi tak bisa berjalan hanya di satu bidang dan sektor. Ini memberi tekanan untuk tak menghentikan reformasi. ”Yang bisa mengimbangi pasar adalah pemerintahan yang bersih dan kredibel. Pemerintah yang buruk, mendompleng pasar dan memeras rakyat,” sambung dia. ”Kalau pemerintah berusaha mengubah sistem, ini bukan soal liberal atau bukan. Salah satu pertimbangannya, mungkin, birokrasinya belum siap, atau lemah, atau korupsi. Di sisi lain, rakyat harus sejahtera. Bagaimana bisa sejahtera kalau masih korupsi?” Jadi, apa ideologi Anda? Pemerintahan yang bersih dikombinasikan dengan demokrasi. Itulah yang bisa menggunakan sisi baik mekanisme pasar dan mengoreksi sisi buruknya. Saya tidak pidato, tetapi saya bekerja. Maka, setiap orang yang mengkritik saya neolib, saya akan tanya apa yang sudah dia lakukan agar debat kita lebih berbobot. Pernah ibu saya bertanya, ”Kamu itu kerjanya apa, Ndhuk?” Ibu bilang, apa dampak yang saya kerjakan. ‘Saya sudah jadi profesor, kok gajinya seperti ini, lha di TV ada kuis yang hadiahnya sampai miliaran.’ Begitu kata ibu saya. Sekarang, ketika gaji profesor sudah dinaikkan, bapak dan ibu saya sudah tidak ada. Anda akhirnya juga bicara terbuka soal perkawinan kepentingan. Sebenarnya itu adalah concern kita bersama. Di masa lalu maupun sekarang, banyak pejabat maupun petinggi partai adalah bekas pengusaha. Mereka tak mengenal yang namanya conflict of interest dalam pembuatan keputusan publik. Saya beberapa kali minta hal ini diatur, tetapi sampai hari ini tampaknya rancangan undang-undang mengenai hal itu masih belum jelas. Ini adalah tantangan kredibilitas kebijakan. Tampaknya masih akan lama ya? Iya, karena tekanan uang dalam politik begitu nyata.... (kps)


WASPADA Senin 24 Mei 2010


Penembakan Di Papua Berulang

Tiga Aparat Terluka JAYAPURA (Antara): Penembakan oleh orang tidak bertanggungjawab kembali terjadi di Papua, menyebabkan dua aparat TNI serta seorang polisi terluka dan sekarang menjalani perawatan intensif di Jayapura. Penembakan diduga dilakukan Organisasi Papua Merdeka (OPM) itu terjadi di kawasan Yambi, Kabupaten Puncak Jaya.

Dua anggota TNI dari Yon 753, Komandan Pleton di Pos Yambi Letda Inf Agung dan Pratu Efriyan, serta seroang anggota Polres Mulia, Bripda Saumileka, ditembak di dua lokasi berbeda. Kapolres Puncak Jaya AKBP Alek Korwa ketika dihubungi Antara Minggu (23/5) pagi dari Jayapura membenarkan mengenai insiden itu. Dua anggota TNI dari Yon 753 itu terkena tembakan saat kelompok

bersenjata yang diduga OPM menembaki pos Yambi, Jumat Malam (21/5) sekitar pukul 20.00 WIT. Ketika polisi bersama aparat TNI hendak mengevakuasi dua anggota Yon 753 tersebut pada Sabtu (22/5), terjadilah kontak senjata hingga Bripda Saumileka tertembak di 2 kilometer sebelum Pos Yambi. Ketiga korban dievakuasi ke Jayapura menggunakan angkutan udara

dari Trigana Air. Di Jayapura, seorang polisi yang terluka dirawat di RS Bhayangkara, sedangan dua anggota TNI Yon 753 dirawat di RST Marthen Indey. Ribuan Rumah Di Gorontalo Terendam Sementara ribuan rumah di kota Gorontalo teredam banjir setinggi setengah hingga satu meter sejak Minggu pagi, setelah hujan deras turun dalam beberapa hari terakhir. Data dari Posko Penanggulangan Bencana Kota Gorontalo hingga pukul 12:00 WITA, menunjukkan terdapat 2.147 rumah yang terendam dengan jumlah korban banjir 9.055 jiwa. Sementara, jumlah korban banjir yang mengungsi sebanyak 118 KK atau sekitar 436 jiwa, dengan 15 titik lokasi pengungsian. Wilayah yang terendam

banjir ada empat kecamatan di antaranya, kota Selatan yakni Kelurahan Limba U.II, Biawu, Tenda dan Siendeng. Di Kecamatan Kota Timur terdapat empat kelurahan yang mengalami banjir, Kota Utara 6 kelurahan dan Kota Barat dua kelurahan. Warga yang mengungsi berharap pemerintah segera menanggulangi banjir tersebut dan mendistribusikan bantuan. “Kami butuh makanan yang siap dimakan dan air minum,” ujar Hadijah, salah seorang pengungsi. Warga memprediksi ketinggian air akan terus bertambah, karena debit air di Sungai Bulango dan Bone makin bertambah dan meluap ke rumah warga. Meski demikian, hingga berita ini diturunkan banjir belum merendam pusat pertokoan yang juga rawan banjir.

Ada Tekanan Politik Kasus Sisminbakum Waspada/Hasriwal AS

Para deklarator usai mendeklerasikan Retreat Club di Marlion Park, Singapura City sebagai pebisnis, Minggu (23/5).

Tokoh Muda Sumut Deklarasikan Retreat Club Di Singapura SINGAPURA (Waspada): Pengusaha dan tokoh muda asal Sumatera Utara mendeklarasikan Retreat Club di Marlion Park, Singapura City, Minggu (23/5), guna mempersatukan kekuatan di bidang bisnis dari profesi masing-masing. Deklarasi Retreat Club oleh 11 pemuda, tokoh dan pengusaha asal Sumut itu untuk mengembangkan bisnis dari masing-masing anggota yang tergabung dalam Retreat Club, memiliki tiga wilayah kota yakni, Jakarta, Medan dan Batam. Chairman Retreat Club, Ikhwan R Nasution yang menjadi insvirator Retreat Club mengatakan, saatnya pemuda Indonesia mengembangkan profesi masing-masing menjadi bisnis. “Bisnis yang dikembang Retreat Club sama sekali bukan mengejar harta kekayaan, melainkan mengembangkan profesi dari masing-masing anggota yang tergabung di Retreat Club menjadi bisnis yang bermanfaat bagi orang banyak,” kata dia, usai mendeklarasikan Retreat Club di Singapura. Menurut alumni Institut

Teknologi Medan (ITM) itu, Retreat Club memiliki 11 owner sekaligus anggota, merupakan putra-putri Sumut yang berprofesi mulai dari pengusaha, kontraktor, bankir, markater, pengajar, peneliti sampai bidang jurnalis. Ikhwan menjelaskan, langkah pemanasan pengembangan dan gerak dari Retreat Club berawal dari komunikasi rekanrekan yang tersebar di tiga kota, kemudian mengkonkritkan untuk mengembangkan bisnis dari masing-masing profesi yang tengah digeluti ke 11 anggota. “Kami berkumpul di Batam yang memiliki potensial perbisnisan di Indonesia,” katanya. Selanjutnya, atas kesepakatan bersama, Retreat Club di deklarasikan di negera Singapura. “Dekler di Singapura dilakukan dengan harapan bisnis yang akan dikembangkan melaju pesat, seperti Singapura yang menjadi negara global bisnis terbesar di Asia, bahkan dunia,” kata Ikhwan. Ke-11 anggota ini, Ikhwan R Nasution (merangkap Chair-

Pilihan Sri Mulyani Jalan Terbaik J A K A RTA ( Wa s p a d a ) : Mundurnya Sri Mulyani Indrawati dari Menteri Keuangan (Menkeu), dan memilih menjadi Direktur Pelaksana Grup Bank Dunia murni usaha dari Sri Mulyani sendiri. Usaha itu dilakukan Sri Mulyani, karena tidak ada yang melindungi dirinya dari tekanan politik yang bertubi-tubi pascarekomendasi DPR RI akan hasil pansus kasus Bank Century. “Dia (Sri Mulyani ) kecewa,” kata pengamat politik dan ekonomi Sanggam Hutapea (foto) kepada Waspada, kemarin. Disamping itu, sikap teguh dan tegar Sri Mulyani dalam mengambil keputusan, membuat sebagian orang tidak nyaman dengan keberadaannya sebagai Menkeu. “Dia bagi sebagian orang mejadi duri dalam daging.” Menurut Sanggam, apa yang diungkapkan Sri Mulyani pada kuliah umum bertajuk Kebijakan Publik dan Etika Publik di Hotel Ritz Carlton, Selasa lalu, merupakan ungkapan yang tulus dan itu kebenarannya. Sri Mulyani sangat sedih, sebab dia merasa sudah melakukan yang terbaik bagi bangsa, tetapi terbeban resiko politik yang cukup berat tanpa ada yang menopangnya, termasuk bosnya. Menghadapi tekan berat dan tidak ada yang melindungi, dia mencari jalan keluar sendiri dengan menerima posisi salah satu Direktur Pelaksana Bank Dunia. “Bagi Bank Dunia, Sri Mulyani bukan orang asing, sebab dia pernah menjabat di IMF dan dia sangat dikenal di level dunia.” Sanggam juga yakin mundurnya Sri Mulyani dari jabatan Menteri Keuangan kental kompromi politik. Keberangkatan dia ke Washington, AS, menurut Sanggam, merupakan jalan terbaik,

sehingga terlepas dari tekanan politik, dimana dia terindikasi jadi target, bukan Boediono. “Saya pikir proses politik yang sedemikian rupa hanya menjadikan Sri Mulyani jadi target,” tandas Sanggam Sementara, Ketua Fraksi MPR dari Partai Gerakan Indonesia Raya (Gerindra), Martin Hutabarat menilai kemenangan Sri Mulyani karena dia berhasil menjaga dan memelihara hati nuraninya. “Dia tak tergerus oleh konflik kepentingan selama menjadi Menkeu,” tegasnya.(aya)

man), Sri Keumala, Ida Flora Agustini Siregar, Hafni Zulaika Lubis, Khalijah, Zulhendri Atasmi, Zulham Arif, Tengku M Nur, Budia Adi Dharma Siregar, Hasriwal Hasibuan dan Syafruddin. Kumpulan sumber daya manusia dari semua profesi ini untuk mengembangkan potensi masing-masing menjadi bisnis. “Ini murni bisnis, tidak menyinggung atau memasuki wilayah seperti LSM atau partai politik. Ini bisnis pencapaian kehidupan yang berguna pada orang lain dalam menggerakan perekonomian dalam bisnis masing-masing perorangan yang masuk dalam Retreat Club,” kata dia.(j02)

JAKARTA (Antara): Anggota Komisi III DPR Desmond J Mahesa melihat adanya tekanan politik dalam penanganan kasus Sistem Administrasi Badan Hukum Kementerian Hukum dan HAM (Sisminbakum). Menurut Desmond di Jakarta, Minggu (23/5), pihaknya mencurigai ada satu kekuatan besar yang mengintervensi proses penanganan hukum kasus Sisminbakum itu. “Ini sudah tidak murni hukum lagi, ada satu kekuatan besar yang berada di belakang Hartono Tanoesoedibyo, sehingga mampu mangkir selama lima kali di persidangan,” ujar anggota Fraksi Gerindra itu. Pihaknya juga merasa aneh dengan niat JPU yang hanya akan membacakan Berita Acara Pemeriksaan (BAP) pengusaha itu di muka persidangan. “BAP itu pastinya berisi hal-hal yang meringankan dan menguntungkan kedudukan Hartono. Bagaimana kejaksaan dapat bersikap seperti itu ? Seharusnya JPU tegas dan memanggil paksa Hartono,” tegas Desmond. Apalagi dalam berkas dakwaan tersangka sebelumnya, nama Hartono disebut-sebut

terlibat dalam kasus yang merugikan negara ratusan miliar rupiah itu. Sebelumnya Jaksa Agung Muda Tindak Pidana Khusus (Jampidsus) Kejagung Marwan Effendy mengakui menghadapi banyak kendala dalam penanganan kasus dugaan korupsi pengadaan. Sisminbakum di Kementerian Hukum dan HAM. Force Majeur Marwan Effendy mengungkapkan kasus korupsi yang melibatkan pengusaha Hartono Tanoesoedibyo itu belum dapat dituntaskan karena ada faktor force majeur (keadaan memaksa yang membuat kejaksaan tidak mampu menuntaskan kasus). “Ya, ada (kasus) yang tidak bisa dijangkau kita, karena force majeur, seperti Hartono Tanoesoedibyo, Gubernur Bengkulu Agusrin Najamudin. Itu di luar kemampuan kita,” kata Marwan. Kejaksaan sebelumnya telah menetapkan status tersangka kepada Dirjen AHU Kementerian Hukum dan HAM Syamsudin Manan Sinaga dan dua mantan Dirjen AHU sebelumnya, Zulkarnain Yunus dan Romli Atmasasmita sebagai tersangka.


ANTRI OBAT: Sejumlah warga Desa Mnelete, Soe, Nusa Tenggara Timur, Minggu (23/5), antri untuk mendapatkan obat ketika digelar pengobatan gratis oleh Posko Jenggala. Pengobatan itu disambut antusias warga masyarakat yang memang membutuhkan pengobatan.

Menkum HAM

Pengurus PPRN Sah Di Bawah Kepemimpinan Amelia A Yani MEDAN (Waspada): Kementerian Hukum dan HAM RI (Direktorat Jenderal Administrasi Hukum Umum) mengeluarkan penegasan terkait kepengurusan DPP PPRN (Partai Peduli Rakyat Nasional) yang sah. Penegasan itu dikeluarkan melalui surat No: AHU.4.AH.11.01-10 tertanggal 12 Mei 2010 ditandatangani Plh Direktur Tata Negara, Tehna Bana Sitepu a/n Dirjen Administrasi Hukum Umum. Dalam surat ditembuskan kepada Ketua KPU Pusat dan Dirjen Administrasi Hukum Umum (sebagai laporan), ditegaskan bahwa kepengurusan DPP PPRN yang sah di bawah kepemimpinan Amelia A Yani. “Kami tegaskan bahwa kepengurusan DPP PPRN yang terdaftar di Kementerian Hukum dan HAM adalah DPP PPRN sesuai Keputusan Menteri Hukum dan HAM No. M.HH19.AH.11.01 tahun 2008 tentang pengesahan PPRN sebagai

badan hukum, dengan ketua umum Amelia A Yani,” sebut petikan surat penegasan itu. Penegasan itu dikeluarkan untuk menjawab surat mengatasnamakan pengurus DPP PPRN, yang mempertanyakan kepengurusan DPP PPRN yang sah. Ultimatum Menindaklanjuti penegasan Kementerian Hukum dan HAM itu, serta mencermati masih adanya oknum-oknum tertentu yang masih mengklaim sebagai pengurus DPP PPRN di luar dari pengesahan itu, maka Ketua Umum DPP PPRN Amelia A Yani mengeluarkan ultimatum kepada beberapa oknum tertentu, terkait penggunaan kop surat, stempel, bendera dan atribut lainnya atas nama PPRN. Dalam surat No: 277/A.1/ DPP-PPRN/2010 ditandatangani Amelia A Yani, disebutkan beberapa oknum antara lain, Sabar Ganda L Sitorus, Ricky Sitorus, Nelson Sitorus,

Yansen Sitorus, Suryani Siahaan, Sarminanto, Rauchin, Khamelin Hadisudiarto, Madrofi SIS dan Negeri Sirait. “Nama-nama itu tidak berhak mempergunakan atau mengatasnamakan PPRN, baik menggunakan kop surat, stempel dan bendera. Apabila di kemudian hari menggunakan atribut itu, maka saya akan mengambil langkah hukum,” kata dia, dalam surat yang ditembuskan ke Depkum HAM, KPU Pusat, KPUD provinsi/kabupaten/kota se-Indonesia dan DPW/DPD PPRN se-Indonesia. Sementara Ketua DPW PPRN Sumut, Jumongkas Hutagaol mengatakan, dengan penegasan Depkum HAM dan ultimatumKetuaUmumDPPPPRN, maka diharapkan seluruh kader partai semakin tahu kondisi sebenarnya, dan tentunya bisa menambah soliditas ke depan. Supaya ke depan, kader-kader PPRN lebih selektif menerima informasi, termasuk dari media massa.(m11)


WASPADA Senin 24 Mei 2010


SSB Portis DS Kampiun Waspada Super Seri Festival MEDAN (Waspada): Sekolah Sepakbola (SSB) Portis Deli Serdang menjuarai Turnamen Waspada Super Seri Festival (WSSF) Seri I U12 di Lapangan Jl Air Bersih Medan, Minggu (23/5).


Tri Kusharjanto/Vita Marissa masih terlalu tangguh bagi lawan-lawannya di ajang Djarum Sirkuit Nasional Bulutangkis Regional I di Jakarta, Minggu (23/5).

Tri Kus/Vita Masih Mampu Djarum Sirkuit Nasional Bulutangkis Regional I JAKARTA (Waspada): Final nomor ganda dewasa campuran di turnamen akbar Djarum Sirkuit Nasional (Djarum Sirnas) Bulutangkis Regional I di Jakarta menampilkan Tri Kusharjanto/Vita Marissa sebagai peraih podium tertinggi, Minggu (23/5). Kedua atlet yang sudah tidak asing lagi bagi pecinta bulutangkis tanah air ini, berhasil menjadi yang terbaik setelah menumbangkan pasangan Rendra Wijaya/Lita Nurlita. Trikus/Vita terlihat masih terlalu tangguh untuk bisa diimbangi lawannya ini. Seranganserangan yang dilancarkan oleh Rendra/Lita mentah dan selalu berhasil dikembalikan Trikus maupunVita. Beberapa kali poin yang diraih lawannya tersebut merupakan buah dari unforced error yang dilakukan Trikus/Vita.

“Kami sudah berusaha menampilkan yang terbaik yang kami miliki, namun memang kualitas dan teknik permainan mereka jauh diatas kami,” papar Lita menanggapi kekalahannya. Trikus/Vita hanya membutuhkan waktu tak lebih dari 30 menit untuk menghentikan perlawanan Rendra/Lita, tercatat pula, pasangan Trikus/Vita menorehkan prestasi gemilang dengan tidak kehilangan satu set pun sepanjang kejuaraan yang mempersembahkan hadiah total Rp200 juta ini. Trikus/Vita terus mendominasi sepanjang pertandingan, di set pertama mereka berada di atas angin dan meninggalkan perolehan angka lawannya jauh 20-15, sebelum akhirnya mereka menutup set kedua dengan 2117 saat Lita gagal menuntaskan bola tanggung di depan net.

Memasuki set kedua, permainan tak berbeda jauh, meskipun Trikus/Vita sempat tertinggal 1-5 di awal pertandingan, tetapi mereka berhasil mengunci pasangan asal PB Djarum/PB SGS Elektrik tersebut di angka 6 dan berbalik unggul 11-8 di jeda interval. Setelah jeda, perolehan Trikus/Vita semakin tak terkejar. Perbedaan jam terbang, membuat pasangan yang lebih senior ini akhirnya menutup set kedua 21-14. Vita yang memang bermain tanpa beban dan target mengomentari kemenangannya ini dengan berkelakar “iseng-iseng berhadiah karena saya bermain untuk bersenangsenang”. Dengan menduduki podium pertama ini, Trikus/Vita berhak atas hadiah uang tunai sebesar Rp13,2 juta. (m33)

Tim asuhan pelatih Edy Septiono tampil juara setelah memenangi adu tendangan penalti atas SSB PTP Wilayah I 3-2. Duel yang berlangung 2x15 menit itu berjalan ketat. Portis mencetak gol lebih dahulu di paruh babak pertama lewat tendangan bebas M Ridho. Keunggulan 1-0 Portis dapat disamakan anak-anak PTP jelang lima menit pertandingan berakhir. Skor 1-1 bertahan hingga wasit meniup peluit panjang dan dilanjutkan dengan adu tendangan penalti. Abdul Hakim, Budi KS dan M Ridho yang menjadi eksekutor penalti SSB Portis menjalankan tugas mereka dengan baik. Sedangkan kekalahan yang diderita PTP diakibatkan setelah Aji Satria Bagus gagal mencetak gol usai tendangannya melenceng di sisi kiri gawang Portis.

Waspada/Surya Efendi

Para pemain perlawakilan tim-tim juara Waspada Super Seri Festival (WSSF) Seri I U-12 diabadikan bersama Ketua Umum PSMS Medan Dzulmi Eldin, Ketua Umum SSB Patriot Drs Hendra DS, Ketua Umum KONI Medan Drs Zulhifzi Lubis, Redaktur Olahraga Waspada Jonny Ramadhan Silalahi, Camat Medan Kota dan Ketua Panpel Heri Dodi Saptono, Minggu (23/5). Pelatih SSB Portis Edy Septiono didampingi Manajer Legirin SPd ditemui mengaku puas dengan penampilan tim asuhannya. “Anak-anak bermain bagus sepanjang permainan. Ini merupakan gelar juara kedua yang kita raih dari turnamen yang diadakan SSB Patriot setelah pada 2008 juga tam-

pil juara,” jelas Edy. Sebelumnya, perebutan posisi ketiga antara SSB Tunas Remaja dan Generasi Medan dimenangkan Tunas Remaja juga lewat adul tendangan penalti 3-1. Turnamen yang diadakan SSB Patriot dan didukung Harian Waspada dan Suzuki itu ditutup resmi Ketua

SABANG (Waspada): Skuad Rajawali FC tampil sebagai juara turnamen sepakbola Dandim Sabang Cup 2010 setelah di final berhasil mematahkan perlawanan Muda Sebaya 3-1 barubaru ini. Dalam pertandingan yang turut disaksikan Dandim 0112/ Sabang Letkol Inf Joko Sudiono MA, kedua tim bertarung ketat. Rajawali yang tampil dengan duet striker Abdullah-Irhamuddin unggul lebih dulu di pertengahan babak pertama. Abdullah pun menjadi pe-

nyumbang gol pertama bagi Rajawali FC tersebut. Tertinggal satu angka membuat tim asuhan Azni SH gencar mengusung serangan balik ke wilayah pertahanan lawan. Trio motor serangan Muda Sebaya, yakni Darmansyah, Azwar dan Ricky, pun berkali-kali mengusik barisan pertahanan Rajawali. Kerja keras Muda Sebaya akhirnya terbayar 10 menit jelang bubaran babak pertama. Tendangan A Razi dari jarak 25 meter berhasil menembus gawang Rajawali yang dikawal

Andi. Memasuki babak kedua, Rajawali pun menambah pundi gol lewat sumbangan Zulfaladeni dan Ismail. Atas kemenangan itu, Rajawali menyabet hadiah uang pembinaan Rp10 juta plus piala bergilir yang diserahkan Dandim Joko Sudiono. Selaku runner-up, Muda Sebaya mendapatkan uang pembinaan Rp7,5 juta. Peringkat ketiga dan keempat yang ditempati Gempor dan PS Pasiran masingmasing men-dapat Rp5 juta dan Rp2,5 juta. (b29)

Kejurnas Turing GT Radial Seri 2


Bulutangkis Medan Sapu Bersih

turnamen bagi pesepakbola usia dini,” katanya. Turut hadir dalam acara penutupan kemarin di antaranya Ketua KONI Medan Drs H Zulhifzi Lubis, Ketua Umum SSB Patriot Drs Hendra DS, Camat Medan Kota, perwakilan dari PSSI Medan dan undangan lainnya. (m42)

Rajawali FC Jawara Dandim Cup

Alvin Menyodok Posisi Kedua

Atlet-atlet Medan memegang piagam juara cabang bulutangkisi Porwildasu 2010 Wilayah II usai pertandingan di Stabat, Langkat, Sabtu (22/5).

Umum PSMS Medan Drs Dzulmi Eldin. “Kompetisi merupakan bagian penting dari pembinaan sepakbola usia dini. Untuk itu diharapkan kepada pihak lain untuk ikut memperbanyak kompetisi dan kita menyatakan apresiasi kepada SSB Patriot yang sangat sering menggelar

SENTUL (Waspada): Acungan jempol patut diacungkan kepada juara nasional tiga kali beruntun, Alvin Bahar usai menuntaskan Seri 2 Kejurnas Turing GT Radial Car Championship (GTRCC), di Sirkuit Sentul, Bogor, Minggu (23/5). Meski di seri pertama terlempar dari posisi podium, Alvin yang disokong tim Honda Fastron Racing Team ini mencuat dengan meraih posisi runnerup. Sejak latihan awal, Alvin memang sudah begitu percaya diri akan meraih podium. Apalagi settingan mobil yang dipercayai sudah begitu mumpuni untuk balapan seri kedua ini. Dukungan ban GT Radial Champiro SX1 pun sangat

membantu sehingga Alvin pun merasa yakin bisa finis di podium. Prediksi pembalap pabrikan Honda ini sama sekali tak meleset. Meski start dari posisi kelima, Alvin akhirnya bisa mencuat sampai ke posisi kedua setelah Rama Danindro dari tim Honda Jakarta Center meraih gelar juara. Meski finish kedua, Alvin sesungguhnya mengaku kecewa karena ia merasa diuntungkan dengan problem yang dialami Sunny TS dan Roy Haryanto. Padahal Alvin sendiri sangat menginginkan bisa bersaing ketat sepanjang 18 lap dengan para pembalap papan atas

seperti Rama, Sunny, Roy dan Imin Brata yang meraih posisi tertinggi di kualifikasi sehari sebelumnya. Sayang, Sunny mengalami overheat dan mobil Roy hancur sebelum balapan sehingga ia tak tampil. Dengan begitu, Alvin hanya bersaing ketat dengan Rama dan Imin. Dia pun berharap di seri berikut bisa kembali bersaing dengan semua pembalap papan atas sehingga membuat persiangan di lintasan jadi lebih menarik. Tapi, Alvin merasa mencuat di posisi kedua ini sebagai kebangkitan bagi dirinya setelah di seri sebelumnya hanya bisa menempati posisi keenam. (m33/ini)

Waspada/Surya Efendi

Ketua Umum PSMS Medan Drs Dzulmi Eldin menyerahkan trofi kepada kapten tim SSB Portis Deli Serdang selaku juara Waspada Super Seri Festival Seri I U-12 , Minggu (23/5).

Patriot Pantonlabu Kian Bertuah BANDA ACEH (Waspada): SSB Patriot Pantonlabu kian bertuah dalam Piala Danone 2010 wilayah Aceh. Pada Minggu (23/5), tim asal ujung timur Aceh Utara itu sukses mengungguli tiga lawan berturut-turut di Stadion Harapan Bangsa, Lhong Raya, Banda Aceh. Manajer SSB Patriot Pantonlabu, Rabu Juli, yang menghubungi Waspada menyebutkan, timnya menang WO atas SSB Malahayati karena lawan tidak hadir. Dalam pertandingan selanjutnya, tim asuhan H Januari ini mengulang sukses dengan mengalahkan SSB Karya Muda Dewantara 3-1. “Setelah itu, kita kembali berlaga melawan SSB Elang Biru Langsa dan berhasil menang 1-0. Keberhasilan ini tidak terlepas dari kekompakan dan semangat tinggi dari anak-anak serta dukungan doa dari masyarakat, khususnya masyarakat Pantonlabu,” tandas Juli. (cmus)

Porwildasu Wilayah I 2010 MEDAN (Waspada): Kontingen Medan melakukan sapu bersih di cabang bulutangkis Pekan Olahraga Wilayah Sumatera Utara (Porwildasu) 2010 Wilayah I, setelah memenangi semua nomor final yang dipertandingkan pada hari terakhir di GOR Serba Guna Stabat, Langkat, Sabtu (22/5). Dalam final tersebut, Medan merebut lima nomor perorangan yang dipertandingkan. Sukses ini melengkapi hasil di hari pertama di mana Medan sudah menjadi juara di nomor beregu putra dan putri. Dari cabang bulutangkis, Medan total mampu meraih tu-

juh gelar juara dan lima runner-up disusul Langkat yang menempati tempat kedua. Peringkat ketiga diduduki Serdang Bedagai (Sergai) dengan satu posisi runner-up. Untuk Porda Sumut 2010 mendatang, setiap pemenang dan runnerup berhak mendapat tempat. Pemenang tunggal putra dipegang Lucas Alexander (Medan). Tempat kedua ditempati Hendi Boy (Medan) dan juara ketiga bersama diraih M Iqbal (Langkat) dan EkiWardana (Sergai). Tunggal putri masing-masing diraih Arindasari (Medan), Ayudesi (Medan), Sari (Langkat) dan Damayanti (Sergai).

Problem Catur Hitam melangkah, mematikan lawannya dalam tiga langkah.

Jawaban di halaman A2.

Untuk ganda putra, predikat juara diraih pasangan Medan Lucas/Tobias, runner-up menjadi milik Teguh/Reza (Medan), sedangkan Ari/Putra (Langkat) dan EkiWardana/Cahyo (Sergai) menjadi juara III bersama. Di ganda putri, pemenangnya disandang Arindasari/Muzelin (Medan) disusul Khoirunnisa/Ayu Desi (Medan) serta juara III bersama diisi Sari/Nova (Langkat)danYusnita/Desi(Langkat). Untuk ganda campuran, pasangan Medan Teguh/Cindy menjadi peserta terbaik diikuti Tobias/Muzelin (Me-dan), M Iqbal/Yusnita (Langkat) dan Johanes/Damayanti (Sergai). (h09)



Penampilan para pembalap di kelas Honda Jazz Speed Challenge saat tampil pada Indonesian Series of Motorsport Round 2 di Sentul Internasional Sirkuit, Minggu (23/5).

UMUM Mendatar

1. Judul lagu ciptaan alm Gesang, sungai besar di pulau Jawa. 7. Berkeliling. 9. Nama pencipta lagu keroncong yang meninggal baru-baru ini. 10. Kabupaten di pantai timur Sumut. 11. Kecuali; Lain daripada. 12. Salah satu marga batak. 13. Surat tanda bukti yang disahkan pejabat resmi menurut peraturan berlaku, misalnya untuk hak kepemilikan tanah atau kelahiran. 14. Tameng. 15. Batu permata nilam. 16. Tepat. 17. Singkatan Menteri Pemuda dan Olahraga. 18. Sembap karena gemuk. 20. Kawasan khusus disediakan untuk kapal pesiar. 21. Pejabat pengadilan bagian administrasi pengadilan, membuat berita acara persidangan. 22. Nenek. 23. Aliran politik ekonomi ditandai dengan segi positif ekonomi pasar bebas, disertai dengan

usaha menekan campur tangan pemerintah dan konsentrasi kekuasaan swasta terhadap perekonomian.


1. Kata tanya untuk menanyakan cara dsbnya. 2. Paham atau ajaran untuk mencintai bangsa dan negara sendiri. 3. ______ Rudolf _______, pencipta lagu Indonesia Raya. 4. Paham atau ajaran kenegaraan dan ekonomi yang berusaha supaya harta benda, industri dan perusahaan menjadi milik negara. 5. Tidak (Jawa). 6. J u d u l l a g u k e b a n g s a a n Indonesia. 8. Bentur. 13. Kata populer di luarnegeri untuk pelabuhan udara. 18. Kawan. 19. Mesin penggerak. 20. Akhlak, susila, budi pekerti. 21. Tonggak batu sebagai tanda jarak. 22. Satu hambatan listrik sebagai tatanan antara dua ujung yang dilalui arus listrik.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu pertimbangan dan logika. Jawaban di halaman A2 kolom 1.

6 7 4 2


5 7

2 7


1 7 8 8

9 5

6 8 9

6 7

3 5

2 6

6 4 8 1



WASPADA Senin 24 Mei 2010

Akhir Sempurna Mourinho MADRID (Waspada): Jose Mourinho semakin memantapkan julukan yang dipilihnya sendiri, The Special One, setelah sukses membawa Inter Milan merebut trofi Liga Champions di Santiago Bernabeu, Minggu (23/5) dinihari WIB.

Menghadapi wakil Jerman, Bayern Munchen, Mourinho pun bertemu dengan mentornya semasa di Barcelona, Louis van Gaal. Di awal pertandingan, Munchen tampak menguasai keadaan dengan mendominasi penguasaan bola, sementara Inter terlihat gugup menangani kelincahan Arjen Robben cs. Namun ternyata Inter tidak sepenuhnya bertahan. Mereka melakukannya untuk menyamarkan serangan balik mematikan yang mereka tunjukkan pada gol pertama Diego Milito di pertengahan babak pertama. Tiga menit menjelang jeda, kerja sama Milito dan Wesley Sneijder kembali merobek barisan sentral pertahanan “FC Hollywood”. Untung Bayern punya kiper setangguh Hans Joerg Butt yang berhasil menahan tendangan Sneijder di tepi kotak penalti. Bayern membuat kejutan di detik-detik awal babak kedua. Berhasil menikam ke jantung pertahanan lawan, Thomas Mueller melepas tembakan keras namun bidikannya masih membentur kaki Julio Cesar. Menit-menit selanjutnya didominasi oleh serangan Bayern. Di menit ke-62, sepakan

Mueller mengenai kepala Esteban Cambiasso di depan gawang. Tak lama kemudian, tendangan roket Arjen Robben ditepis Cesar. Kondisi ini dimanfaatkan Inter untuk menjebak lawan. Di menit ke-71, Samuel Eto’o berhasil merebut bola dan langsung memberikannya kepada Milito. Setelah mengelabui Daniel van Buyten, ia mengirimkan bola ke pojok kanan gawang Bayern. Keberhasilan Inter menjuarai Liga Champions musim ini juga mengangkat perolehan gelar tim Italia. Dengan 12 gelar, Italia kini berbagi tempat dengan Spanyol sebagai kolektor gelar terbanyak. Titel ini merupakan trofi ketiga yang berhasil diraih La Beneamata setelah sebelumnya mereka dapatakan di musim 1963-1964 dan 1964-1965 ketika kejuaraan masih bernama European Cup. Negeri Pisa dan Negeri Matador kini berbagi tempat pertama untuk urusan raihan trofi terbanyak di European Cup/ Liga Champions. Selain Nerazzuri, trofi untuk Italia disumbangkan oleh AC Milan (tujuh gelar) dan Juventus (dua gelar).

1955–56 1956–57 1957–58 1958–59 1959–60 1960–61 1961–62 1962–63 1963–64 1964–65 1965–66 1966–67 1967–68 1968–69 1969–70 1970–71 1971–72 1972–73 1973–74 1974–75 1975–76 1976–77 1977–78 1978–79 1979–80 1980–81 1981–82 1982–83 1983–84 1984–85 1985–86 1986–87 1987–88 1988–89 1989–90 1990–91 1991–92 1992–93 1993–94 1994–95 1995–96 1996–97 1997–98 1998–99 1999–00 2000–01 2001–02 2002–03 2003–04 2004–05 2005–06 2006–07 2007–08 2008–09 2009-10

Real Madrid Real Madrid Real Madrid Real Madrid Real Madrid Benfica Benfica AC Milan Inter Milan Inter Milan Real Madrid Glasgow Celtic Man United AC Milan Feyenoord Ajax Ajax Ajax Bayern Munich Bayern Munich Bayern Munich Liverpool Liverpool Nottingham Forest Nottingham Forest Liverpool Aston Villa Hamburg Liverpool Juventus Steaua Bucarest Porto PSV Eindhoven AC Milan AC Milan Red Star Belgrade Barcelona Marseille AC Milan Ajax Juventus Borussia Dortmund Real Madrid Man United Real Madrid Bayern Munich Real Madrid AC Milan Porto Liverpool Barcelona AC Milan Man United Barcelona Inter Milan

Kapten Inter Milan, Javier Zanetti, didampingi rekan-rekan lainnya mengangkat trofi jawara Liga Champions 2010 di Santiago Bernabeu, Madrid, Minggu (23/5) dinihari WIB.

Tugas Mourinho Di Inter Selesai MADRID (Waspada): Pelatih Inter Milan Jose Mourinho mengatakan, tugasnya di Giuseppe Meazza sudah selesai. Ia mengaku siap memburu rekor baru, yaitu menjuarai Liga Champions bersama tim yang lain. Mourinho menangani Inter pada 2008. Ia dibebani target membawa Inter menjuarai Liga Champions. Target itu tercapai pada 2009-2010 usai menjadi raja Eropa setelah mengalahkan Bayern Munchen, Minggu (23/ 5) dinihari WIB. Ini merupakan


Pelatih Inter Milan Jose Mourinho (kanan) sudah siap meninggalkan Kota Milan untuk merasakan nuansa baru di Madrid.

Pahlawan Tanpa Sepatu Emas MADRID (Waspada): Dalam tiga musim terakhir, top skor Liga Champions selalu berasal dari tim yang jadi juara. Musim ini, Diego Milito (foto) melakukannya bersama Inter Milan meski tak harus mengakhirinya dengan sepatu emas. Tren unik itu dimulai pada musim 2006/2007 ketika AC Milan merebut titel Liga Champions ketujuhnya usai mengalahkan Liverpool 2-1 di final.

Saat itu, Kaka jadi top skor dengan 10 gol sekaligus pemain terbaik. Meski begitu, Kaka tak mencetak gol di partai puncak. Setahun sesudahnya, giliran Cristiano Ronaldo yang membawa Manchester United menjadi jawara usai menundukkan Chelsea lewat adu penalti. Satu golnya di final membuat koleksi golnya jadi delapan gol serta menobatkannya sebagai top

skor. CR7 (kini CR9) pun tampil sebagai pemain terbaik. Barcelona, musim lalu jadi jawara usai mengatasi MU 2-0, juga menampilkan pemainnya di daftar teratas pencetak gol yaitu Lionel Messi dengan sembilan gol. Messi pun turut mendonasi satu gol di final dan jadi pemain terbaik. Musim ini, Milito mematahkan catatan itu. Striker asal Argentina itu tak perlu jadi top skor

untuk membawa Inter juara. Dua golnya melawan Bayern Munich di final sudah cukup membawa trofi ketiga sepanjang 102 tahun sejarah Il Biscione. Dengan total enam gol, Milito harus puas berada di bawah Ivica Olic (Bayern Munich) yang mencetak tujuh gol dan Messi yang kembali jadi top skor dengan torehan delapan gol. (m33/bb)


gelar ketiga bagi Inter pada musim tersebut setelah SerieA dan Piala Italia. Bagi Mourinho, trofi Liga Champions ini merupakan yang kedua dalam kariernya. Sebelumnya, ia menjuarainya bersama FC Porto pada 2004. Pencapaian itu menjadikan Mourinho sebagai pelatih ketiga yang menjuarai Liga Champions bersama dua klub berbeda setelah Ernst Happel (Feyenoord

1970 dan Hamburg 1983) dan Ottmar Hitzfeld (Borussia Dortmund 1997 dan Bayern Muenchen 2001). “Saya merasakan kesedihan besar dan mungkin akan pergi. Namun, dalam kehidupan profesional saya, saya mencoba menjadi sedingin mungkin untuk menentukan apa yang akan saya lakukan berikutnya,” ungkap Mourinho. “Saya melakukan apa yang

harus saya lakukan. Tugas saya sudah selesai. Saya masuk sejarah klub dan Inter tak akan pernah menjadi sama seperti sebelum ini. Saya tak mau bicara lebih banyak karena akan menangis dan mengubah pikiran.Yang pasti, peluang saya pergi lebih besar ketimbang bertahan,” jelas Mourinho. “Saya adalah salah satu dari sedikit pelatih yang pernah memenangi Liga Champions

bersama dua klub berbeda. Sekarang, saya ingin menjadi yang pertama menjuarainya bersama tiga klub,” tambah The Special One. Spekulasi soal kepergian Mourinho sudah muncul sebelum final Liga Champions ini dan Real Madrid adalah klub yang disebut-sebut oleh media Spanyol dan Italia sebagai klub Mourinho musim depan. (m33/ini)


WASPADA Senin 24 Mei 2010



Diego Maradona dan Lionel Messi (kanan)

Messi Baik-baik Saja PENYERANG tim nasional Argentina, Lionel Messi mengatakan, bahwa lututnya hanya cedera ringan. Dia pun optimistis bahwa cedera tersebut tak akan menghalanginya bermain pada Piala Dunia 2010 Afrika Selatan. Sebagai informasi, Messi mengalami cedera dalam sesi latihan Argentina pada Sabtu (22/ 5) lalu. Mengacu hasil pemeriksaan, Messi hanya mengalami lecet. “Itu hanya lecet,” kata Messi, Minggu (23/5). Rekan Messi, Juan Sebastian Veron, juga mengatakan hal senada. Menurutnya, Messi tidak mengalami masalah yang mengkhawatirkan. “Messi baik-baik saja. Itu hanya benturan

ringan,” ujar Veron. Timnas Argentina menjalani sesi latihan di Pusat Sepak Bola Nasional di Ezeiza. Dalam sesi latihan itu, hanya penyerang Inter Milan, Diego Milito, Walter Samuel dan pemain Bayern Muenchen, Martin Demichelis, yang absen untuk membela klub masing-masing pada final Liga Champions, Minggu (23/5). Sesi latihan ini digelar sebagai bagian dari persiapan menghadapi Piala Dunia 2010 Afrika Selatan. Selain itu, timnas Argentina juga akan melakoni partai ujicoba melawan timnas Kanada pada Senin (24/5).

Sakit Usus Gagalkan Diarra FEDERASI Sepakbola Perancis (FFF) mengumumkan gelandang tim nasional Perancis, Lassana Diarra (foto), mengalami masalah usus sehingga pelatih Raymond Domenech mencoretnya dari daftar skuad yang bakal tampil di Afrika Selatan pada Piala Dunia 2010 nanti. Domenech sudah mengumumkan 23 pemain yang bakal bermain di Afrika Selatan dan Diarra adalah salah satunya. Namun, dalam sesi latihan sejak Jumat (21/45) lalu, Domenech pun mencoretnya dan belum mencari pengganti. “Mengenai sakit ususnya, hal pemeriksaan menunjukkan bukti penyakit tak terduga yang mengharuskannya beristirahat dalam periode tak tertentu. Sebagai konsekuensinya, Diarra akan absen kehilangan Piala Dunia 2010 Afrika Selatan,” demikian keterangan FFF. Sementara itu, Presiden FFF Jean-Pierre Escalettes menilai absennya Diarra merupakan kerugian besar bagi Perancis. Menurutnya,


Menanti Tarian Tango Milito Diarra memiliki kematangan mental yang akan membantu perjuangan Perancis. “Ia seharusnya berperan penting bagi tim karena kekuatan mentalnya. Ini dramatis karena dia harus kehilangan Piala Dunia,” ungkap Escalettes.

Verbeek Pamit Pada Australia

BEBERAPA hari lagi, tim nasional Australia akan bertolak ke Afrika Selatan sebelum Piala Dunia dimulai medio Juni nanti. Karena takkan

kembali lagi, pelatih Pim Verbeek (foto) pun berpamitan pada negara tersebut. Pria Belanda berusia 54 tahun itu telah memutuskan akan mempurnakan tugasnya sebagai arsitek Australia selepas Piala Dunia tahun ini. Setelah itu, ia meneruskan karirnya di tempat lain sebagai pelatih tim muda Maroko. Pada Senin (24/5) ini,Verbeek akan memimpin pasukannya berujicoba melawan Selandia Baru yang juga partai terakhirnya di kandang sendiri sebelum berangkat ke Afsel, dua hari kemudian. Verbeek menukangi Tim Cahill dkk sejak 2007, setelah satu tahun membesut timnas Korea Selatan. Sebelum menjadi pelatih kepala Korea, ia pernah menjadi asisten Guus Hiddink di Piala Dunia 2002 dan Dick Advocaat di Piala Dunia 2006. Bersama Socceroos, ia terlibat dalam 27 pertandingan dengan hasil 15 kali menang, delapan seri, dan empat kali kalah. Di bawah kendali dirinya Australia akan tampil di Piala Dunia 2010 dan telah lolos ke putaran final Piala Asia 2011.

MADRID (Waspada): Umurnya sudah kepala tiga, tapi Diego Milito (foto) baru tampil 24 kali untuk timnas negaranya, Argentina. Dengan kehebatannya di musim ini, dia dipastikan membuat pusing Diego Maradona. Boleh dibilang Milito adalah pemain terbaik dalam sorotan di hari penutupan semua kompetisi klub Eropa musim ini selesai, yang ditandai dengan final Liga Champions di Santiago Bernabeu, Madrid, Minggu (23/5) dinihari WIB. Dalam laga melawan Bayern Muenchen, ia memborong semua gol kemenangan Inter Milan (2-0) untuk membawa klub Italia itu menjadi yang terbaik di Eropa. Itu melengkapi dua

gelar yang sebelumnya telah masuk lemari trofi La Beneamata: Coppa Italia dan Seri A. Milito menjadi top skor timnya di Liga Italia dengan 22 gol, menjadi penentu kemenangan di final Coppa dan giornata pamungkas. Total ia mendulang 30 gol di semua kompetisi. Hampir dipastikan, mantan pemain Genoa dan Real Zaragoza itu bakal menjadi pemain terbaik Inter musim ini. Dibawa ke level interna-

sional, Milito sedang menanti kesempatan besar bermain di Piala Dunia 2010, turnamen yang belum pernah ia ikuti. Ia sempat masuk nominasi tim empat tahun lalu, tapi akhirnya tidak berhasil menembus skuad Jose


David Beckham (kiri) berbincang-bincang dengan prajurit Marinir Ben McBean (kanan) yang menggunakan lengan palsu.

Munich-Ribery Berlanjut

kembali ke penampilan terbaik saya secepatnya,” terang Gerrard yang mengaku tengah berada dalam kondisi baik-baik saja.

Lloris Keluhkan Bola PD

KIPER Perancis, Hugo Lloris (foto), mempertanyakan bola yang akan dipakai di Piala Dunia 2010 dengan mengindikasikan mustahil bagi kiper memprediksikan ke mana arah bola. Kiper Olympique Lyonnais ini menuai reputasinya sebagai salah satu kiper terbaik di Eropa musim lalu, namun khawatir dirinya akan terlihat amatir di Afrika Selatan, karena bola baru yang akan digunakannya nantri. “Bola ini musibah. Kami menggunakannya

di ajang Copa Prancis musim dingin. Kami harus terbiasa dengan itu,” ujarnya seperti dilansir dari L’Equipe yang disitat dari, Minggu (23/5). “Semua kiper akan berada dalam tekanan. Kami satu sama lain berbagi kegilaan. Pada kenyataannya, saya tidak meminta saya sendiri menjawab pertanyaan ini. Saya hanya tahu, dengan bola seperti ini, mereka bisa mencetak gol dari manapun,” aku Lloris. “Apa yang aneh dari bola-bola ini, ketika mereka berada di udara mungkin sangat bagus tidak pernah jatuh atau mereka bergerak dengan sangat cepat. Kiper harus siaga setiap saat, terus menganalisa. Posisi ini dibutuhkan, tapi kami akan dituntut untuk berkonsentrasi lebih,” tegasnya. Menurut Lloris, dibandingkan di era 90an, bola-bola ini sangat berat dan kiper bisa menepisnya. Lloris baru sembilan kali membela Perancis, tapi berharap bisa mendapatkan kesempatan untuk menambah jumlah caps di Afrika Selatan nanti. (m33/berbagai sumber)

bersama Manchester City. Ia menjadi pemain terproduktif keempat di Liga Inggris musim ini dengan 23 gol. “Diego takkan mendapatkan (tempatnya) dengan mudah,” ujar Tevez suatu ketika mengomentari ketatnya persaingan di lini depan tim Tango untuk Piala Dunia 2010. Maka Maradona-lah yang akan memutuskan, siapa di antara keempat pemain tersebut yang bakal menjadi starter utama di Afrika Selatan, meskipun dia juga masih punya Sergio Aguero dan striker gaek Martin Palermo. Tim Tango akan mengawali Piala Dunia melawan Nigeria pada 12 Juni atau hari ketika Milito tepat berusia 31 tahun. (m33/ini/ap)

Beckham Terjun Ke Medan Perang

Gerrard Lupakan Liverpool Demi PD STEVEN Gerrard (foto) mengakui jika musim ini adalah musim terburuknya bersama Liverpool, namun yakin penampilannya tidak akan ikut melorot pada Piala Dunia di Afrika Selatan nanti. “Ini adalah musim yang buruk, secara pribadi maupun tim, karena kami tampil di bawah ekspektasi. Kami tidak bisa meraih target yang kami pasang di awal musim,” jelas sang gelandang berujar seperti dikutip Sky Sports, Minggu (23/5). “Sangat sulit untuk menerima kenyataan itu. Tetapi kini kami berkumpul untuk Inggris, dan kami harus mengesampingkan dulu masalah klub. Fokus utama saya adalah ‘apakah saya bisa tampil dengan baik di Piala Dunia, untuk diri saya sendiri dan juga timnas Inggris?” lanjutnya. Namun di samping keterpurukan timnya musim ini, Gerrard masih bisa melihat sisi positif menjelang akhir musim. “Salah satu hal positif adalah penampilan saya mulai kembali seperti yang saya inginkan. Saya telah mengalami naik-turun sepanjang musim ini. Beberapa kali cedera, dan berjuang

Pekerman. Kakak bek Barcelona Gabriel Milito itu mulai mengenakan seragam Albiceleste di tahun 2003, tapi hingga kini keberadaannya terbatas. Ia baru main 21 kali dan mendulang empat gol dan itupun kebanyakan sebagai pemain pengganti. Dengan kecemerlangannya musim ini, pelatih Maradona memiliki banyak penyerang top yang produktif. Lionel Messi si pemain terbaik dunia dari klub Barcelona, menjadi top skorer Liga Spanyol dengan 34 gol. Striker Real Madrid Gonzalo Higuain juga tengah dalam performa hot dengan torehan 27 gol di La Liga. Pemain depan berkelas lain, Carlos Tevez, juga tampil brilian

MUNICH, Jerman (Waspada): Tim-tim yang menginginkan playmaker Bayern Munich, Franck Ribery (foto) harus gigit jari. Pasalnya, pemain asal Perancis itu baru saja memperpanjang kontraknya bersama The Bavarians. Dalam situs remi Munich, Minggu (23/5), disebutkan durasi kontrak Ribery diperpanjang hingga 2015. Pernyataan ini disampaikan langsung oleh Reuters Pimpinan Bayern Munich, Karl-Heinz Rummenigge. “Kami sangat puas kami bisa meraih kesepakatan perpanjangan kontrak dengan salah satu pemain terbaik dunia,” kata Rummenigge kepada Ribery selama ini menjadi incaran klub-klub besar Eropa seperti Chelsea dan Manchester United, Barcelona, Real Madrid dan Inter Milan.Beberapa klub bahkan bersedia memboyongnya dengan bandrol 65 juta euro atau setara dengan Rp763 miliar. (m33/ap)

KABUL (Waspada): Gelandang Inggris, David Beckham, mengunjungi markas tentara Inggris di sebuah wilayah paling berbahaya di Afganistan, Provinsi Helmand. Beckham mengaku sangat terhormat bisa bertemu dengan orang-orang yang sangat berani itu. “Orang-orang ini adalah yang paling berani dari yang pernah kutemui dan sungguh aku merasa terhormat berada di sini,” ungkap Beckham, Minggu (23/5). “Ini sangat menakutkan, sa-

ngat menakutkan. Anda merasakannya. Baru kemarin sepasukan tentara tewas. Anda merasakannya dan Anda merasakan tekanan di sini,” papar Becks. “Aku mewakili negara dalam banyak kesempatan di lapangan. Namun, apa yang dilakukan orang-orang ini untuk mewakili negaranya sangat luar biasa,” terang mantan kapten Three Lions yang bakal absen pada Piala Dunia 2010 Afrika Selatan karena cedera tendon achilles ini. (m33/sun)

Maicon Bakal Ikuti Mou MADRID (Waspada): Defender Inter Milan, Douglas Maicon (foto), akan mengikuti Jose Mourinho jika dia pindah ke Real Madrid. Namun, itu hanya terjadi jikaPresidenInterMilanMassimo Moratti melepaskannya. “Kami berharap yang terbaik buat Mourinho karena dia memang berhak atas itu. Aku tetap berada di Inter karena

masih terikat kontrak. Tapi, jika sang pelatih memintaku pergi ke Madrid, aku akan siap mengikutinya. Tapi, itu harus dengan persetujuan presiden klub,” kata Maicon. Pemain asal Brazil itu tampil bagus sepanjang musim ini. Dia juga berperan besar membawa Inter meraih treble, juara Coppa Italia, Liga Serie-A dan Liga

Champions. “Kami sadar telah membuat sejarah. Kami juga sudah membicarakan hal ini saat pertemuan membahas taktik sebelum pertandingan. Kami saling berbicara. Jika memenangkan Liga Champions, maka nama kami akan selalu tertulis di sejarah. Ini perasaan yang luar biasa,” tambahnya. (m33/ini)

Madrid Siap Pecat Pellegrini MADRID (Waspada): Presiden Real Madrid, Florentino Perez, tengah menyelesaikan urusannya dengan pelatih asal Chile, Manuel Pellegrini, sebelum merekrut Jose Mourinho musim depan. Agen Manuel Pellegrini akan terbang ke Madrid, Senin (24/5) ini, untuk menyelesaikan negosiasi pemenuhan klausul kontrak dengan Perez yang ingin memecat sang pelatih untuk memberi tempat bagi Jose Mourinho. Mourinho sendiri, yang sukses mempersembahkan gelar Liga Champions, bagi Inter Milan, kepada RAI TV terang-terangan mengatakan ingin meraih tiga gelar Liga Champions dengan tiga tim berbeda dan Madrid memiliki peluang terbesar. Pellegrini gagal menghadirkan satu pun gelar, meski Florentino Perez telah mengucurkan dana sekitar Rp3,2 triliun, termasuk untuk mendatangkan Ricardo Kaka dan Cristiano Ronaldo. (m33/ini)


Douglas Maicon bersikeras mengikuti langkah Jose Mourinho jika hengkang ke Madrid.


WASPADA, Senin 24 Mei 2010



WASPADA Senin 24 Mei 2010

Koruptor Religius Oleh Suhrawardi K Lubis Uang hasil korupsi digunakan untuk keperluan ibadah. Sesungguhnya sang koruptor telah melakukan penghinaan dan penistaan terhadap kemuliaan ajaran agama yang dianutnya


Contagion Effect Krisis Yunani


erhatian dunia kini tertuju ke zona Eropa. Semua mata mengarah ke sana dan tidak menafikan akan ada krisis lanjutan. Zona Eropa atau negara-negara yang tergabung dalam Uni Eropa kini diterpa krisis yang maha berat. Selain tumpukan utang, Salah satu penyebab krisis yang membelitYunani adalah defisit.Yunani adalah salah satu negara Eropa dengan defisit tertinggi. Meski demikian, negara tersebut berjanji akan mencicil utangnya agar jumlahnya terus berkurang hingga tiga tahun mendatang. Pada akhir tahun lalu,Yunani telah berencana memotong jumlah defisit yang sebelumnya mencapai 12,7 persen dari GDP hingga hanya 2,8 persen. Menyusul kekhawatiran bilaYunani tidak akan mampu memenuhi janji itu, pemimpin Uni Eropa pada awal pekan ini memintaYunani untuk memotong jumlah pembelanjaan dan upah pekerja di sektor publik. Bila tidak, Yunani harus siap menerima sanksi. Dalam analisisnya Economist menjabarkan jauh ini Portugal, Irlandia dan Spanyol, serta sejumlah negara berdefisit tinggi di zona Euro, dianggap berada di jajaran korban berikutnya. Di negara-negara superkaya, “yield” obligasi pemerintah itu tergolong stabil dan jauh di bawah rata-rata obligasi bertenor jangka panjang. Biaya penjaminan surat utang negara yang gagal bayar, telah naik tajam di 47 dari 50 negara di mana instrumen utang jenis ini digunakan. Selisih (spread) swap surat utang negara yang gagal bayar milik Dubai saja melesat ke tingkat tertingginya, tepat setahun terakhir di pekan ini, di tengah keprihatinan terhadap mengetatnya syarat-syarat restrukturisasi utang oleh konglomerasi yang dikuasai negara itu. Kepercayaan yang tiba-tiba hilang terhadap semua surat utang negara, terutama obligasi Treasury milik Amerika, yang menjadi benchmark (patokan) dunia untuk aset bebas risiko, akan menciptakan malapetaka di negara yang masih rentan dan perlu lebih pulih lagi ini. Pemerintah Yunani memang mengambil langkah-langkah termasuk pembekuan gaji, Intisari pengurangandanapensiun,dankenaikanpajak. Pemerintah ingin melakukan pemotongan Hingga saat ini Indo- anggaran senilai 38 miliar dollar AS dalam tiga tahun ke depan. nesia memang belum Cara ini, dalam kacamata pemerintah bisa menghadapi dampak. mengurangi defisitYunani menjadi kurang dari 3 persen dari Produk Domestik Bruto (PDB) Tetapi sesuai penuturan sebelumakhir2014.SaatinidefisitYunanibernilai persen dari PDB. Sri Mulyani kita akan lihat 13,6Bagaimana efek yang mungkin terjadi ke di 2011 Indonesia(contagioneffect)?SebenarnyaYunani itu terlalu jauh dari Indonesia. Negara ini setidaknya sudah berpengalaman melewati krisis finansial global 2008 yang dipicu kebangkrutan di Amerika. Kemudian gagal bayar dalam jumlah besar yang terjadi di Dubai. Kini krisisYunani telah menyeret euro ke level terendah. Di dalam negeri sebenarnya sudah dilakukan berbagai persiapan. Mantan Menteri Keuangan Sri Mulyani mengatakan: “Kalau dilihat resiko 2011, maka dua faktor dari sisi ekonomi akan menciptakan dinamika yangharusdikelolaresikonya.KrisisYunanijugaakanmenjadifaktoryangakanmenyebabkan dinamika resiko yang dipersepsikan menular, sehingga dikhawatirkan penarikan likuiditas akan berpengaruh pada ekonomi nasional.” Pernyataan Gubernur Bank Sentral Eropa Jean-Claude Trichet yang berpendapat bahwaYunani harus bisa menyelesaikan masalahnya sendiri tanpa ada perlakuan khusus dinilai sebagai penerapan standar ganda oleh Eropa yang membedakan kelompok negara besar dan kelompok negara kecil. Permasalahan ini membuat spekulan mempunyai opini bahwa Yunani tidak ada harapan dan membuat mereka memilih untuk melepas euro. Menurut catatan, nilai tukar euro telah merosot lebih dari 8 persen terhadap dolar AS sejak 25 November 2009 atau sejak Yunani terlilit masalah defisit dan utang. Saran kepada Yunani untuk memperketat anggaran adalah menuju kegagalan. Hal ini dikarenakan belum pulihnya perekonomian dunia mengisyaratkan stimulus masih diperlukan untuk mendorong perekonomian. Dan ini merupakan ujian bagi 16 negara yang pada 11 tahun lalu menyatakan kesatuan moneter mereka, tambahnya. Keputusan untuk membiarkan krisis Yunani tanpa bantuan, yang menurut penilaiannya bahwa rasio utang Yunani tidak lebih tinggi dari Jerman.Sejauh ini, defisit anggaran Yunani telah mengguncang nilai euro dan sebagian pasar finansial intenasional. Banyak kekhawatiran negara itu akan menjadi anggota pertama UE yang gagal bayar utang. KerugianYunani ini bukan tak mungkin menyebar ke kawasan lain karena eksposur perbankan Eropa. Berdasarkan data Bank of International Settlement, eksposur perbankan Jerman terhadap Yunani mencapai 43,2 miliar dolar AS dan Perancis sejumlah 75,5 miliar dolar AS. Krisis bujet ini telah menjadi ujian untuk perekonomian dan hubungan politik blok tersebut. Negara-negara kuat berada dalam dilema. Di sisi lain, bantuan untuk Yunani secara politis tidak populer. Namun Jerman dan Perancis tak bisa membiarkan krisis menyebar ke ekonomi Eropa Selatan seperti Spanyol dan Italia, yang merupakan mitra dagang utama. Hingga saat ini Indonesia memang belum menghadapi dampak. Tetapi sesuai penuturan Sri Mulyani kita akan lihat di 2011. Kalau bisa dilalui maka selamat lagilah ekonomi negara ini.*

Hubungi kami KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN  Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817.  Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385  Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109  Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm


erita korupsi sudah menjadi menu kesukaan media seharihari, baik media lokal, regional maupun nasional. Mulai dari surat kabar (harian maupun mingguan), majalah mingguan maupun bulanan, radio lokal maupun nasional, televisi daerah maupun nasional begitu juga internet. Semua aktif menyajikan berita tentang korupsi ini. Pokoknya tiada hari tanpa berita korupsi. Berita korupsi yang disajikan sangat beragam. Ada kelas ringan yang hanya puluhan ribu sampai dengan ratusan ribu rupiah, ada kelas menengah yang bernilai jutaan sampai puluhan juta dan ada pula kelas berat alis jumbo yang bernilai ratusan juta sampai puluhan miliar, bahkan ratusan miliar rupiah. Media juga memberitakan pelaku korupsi ada pengusaha, ada pula birokrat. Tempat korupsinya pun beragam, ada yang di jalan raya, di sekolah di kampus. Kalau dilihat pula dari tingkatan pekerjaannya, pelaku korupsi itu ada yang pegawai biasa dan ada yang pejabat. Pegawai, mulai dari pegawai kelurahan, pegawai kecamatan, pegawai dinas, pegawai kantor bupati, pegawai kantor walikota, pegawai di gubernuran bahkan pegawai di kementerian. Sedangkan pejabat negara, ada di bidang eksekutif seperti kepala dinas, bupati, walikota, gubernur, menteri, mantan menteri menjadi tersangka korupsi. Selain itu ada juga legislatif, seperti DPRD kabupaten dan kota, DPRD provinsi dan adapula DPR-RI. Tak ketinggalan juga diberitakan, bahwa aparat penegak hukum pun ikut juga berkorupsi-ria. Mulai dari kepolisian ketika melakukan penyidikan, kejaksaan ketika menyusun dan melakukan penuntutan. Malah hakim-pun ikut korupsi ketika menyidangkan dan me-

mutus perkara di depan persidangan. Demikian juga petugas Lembaga Pemasyarakatan (LP) pada saat hukuman dijalankan. Media juga memberitakan, bahwa pelaku korupsi itu mulai dari yang bergaji rendahan sampai dengan yang memperoleh remunerasi yang lumayan besar, seperti Gayus Tambunan di Direktorat Jendral Pajak dan Hakim Muh-tadi Asnun yang mengadili Gayus di Pengadilan Negeri Tangerang. Namun, dari semua berita korupsi itu ada satu hal yang membuat hati bertambah miris dan gundah gulana. Yaitu berita yang menginformasikan bahwa uang yang dikorupsi para koruptor itu dipergunakan untuk kepentingan yang sifatnya religius atau agamais, misalnya digunakan untuk melakukan perjalanan ibadah. Seperti hakim dan penyidik kasus Gayus Tambunan yang menggunakan uang sogokan yang diberikan Gayus Tambunan untuk biaya perjalanan melaksanakan ibadah umrah ke tanah suci Makkah. Sedangkan dalam kasus pemilihan Miranda Goeltom menjadi salah seorang petinggi di Bank Indonesia, ada terdakwa yang anggota/mantan anggota DPR yang mengemukakan sebagian uang sogokan yang diterimanya dipergunakan membantu biaya perjalanan

rombongan peziarah ke Israel. Hal sejenis dengan itu, di Bali pernah terjadi anggota DPRD menggunakan APBD untuk kepentingan biaya perjalanan ziarah Tirtayatra ke India dan banyak lagi kasuskasus lainnya yang menggunakan uang korupsi untuk kepentingan yang bersifat religius. Bahkan ada juga yang mempergunakan untuk pembangunan rumah ibadah. Seperti yang dilakukan pelaku Mafia Pajak di Surabaya. Diduga ia menggunakan uang yang diperoleh dari mafia pajak untuk melakukan amal sosial, bahkan di lingkungan tempat tinggalnya dikenal sangat dermawan. Bahkan ia menjadi donatur pembangunan masjid di lingkungan tempat tinggalnya hingga bernilai puluhan juta rupiah. Kenapa semua ini harus terjadi? Kenapa koruptor religius? Kenapa harus membawa persoalan keagamaan pada perbuatan korupsi? Entahlah. Semua ini terjadi mungkin sebagai upaya pembersihan diri. Karena ada pemahaman, bahwa dosa perbuatan korupsi itu dapat dibersihkan dengan melakukan ziarah suci, atau mungkin juga untuk mengelabui orang-orang di sekitarnya bahwa dia seorang yang alim, bahwa dia seorang yang religius dan taat dalam menjalan suruhan agama. Padahal dengan adanya pemberitaan bahwa uang korupsi itu digunakannya untuk keperluan yang religius, sesungguhnya sang koruptor telah melakukan penghinaan dan penistaan terhadap kemuliaan ajaran agama yang dianutnya. Kenapa? Sebab orang yang taat kepada ajaran agama mestinya dapat mengendalikan diri untuk tidak berprilaku senista korupsi. Sekarang dia korupsi, tapi besok lusa dia religius atau dia hari ini religius tapi besok korupsi. atau di mana sajapun dan kapan saja ia akan korupsi. Begitu pula koruptor yang rajin

memberikan sumbangan dan bantuan, apalagi untuk kepentingan rumah ibadah. Mungkin menurut pemahaman agamanya, setiap orang yang membelanjakan hartanya untuk kebaikan di jalan Allah (tak peduli asal hartanya dari mana) adalah seperti sebuah biji yang tumbuh menjadi tujuh tangkai, tiap tangkai tumbuh seratus. Artinya kalau dia korupsi seratus juta, cukup disumbangkan satu juta, karena dipergunakan untuk kebaikan, yang satu juta akan tumbuh menjadi tujuh juta dan kemudian akan tumbuh pula menjadi tujuh ratus juta. Dengan demikian tujuh ratus juta dikurangi seratus juta dari sudut hitung-hitungan matematiknya masih tersisa keuntungan sang koruptor sebesar enam ratus juta lagi. Hebatkan? Dengan perhitungan seperti itu sang koruptor mengejar akhirat dengan korupsi. Sehingga tiada hari tanpa korupsi. Sudah sepatutnya koruptor religius itu menjadi bahan pertimbangan khusus bagi hakim yang akan menjatuhkan vonis (tentunya hakim yang tidak korup). Untuk menjaga kehormatan agama dan kehormatan umat yang mengamalkan agama dengan tulus lahir dan bathin, “koruptor religius” harus dihukum lebih berat, bahkan boleh juga dipertimbangkan hukuman mati. Sikap sok alim koruptor itu harus menjadi alasan pemberat jangan malah sebaliknya menjadi alasan yang meringankan. Kenapa “koruptor religius” yang menjadikan uang korupsinya untuk biaya ibadah dan bantuan rumah ibadah hukumannya harus diperberat? Karena sang koruptor telah melakukan rangkaian kesalahan yang beruntun. Mulai dari melakukan kesalahan korupsi yang telah menyengsarakan masyarakat banyak, melecehkan kehormatan agama yang dianutnya, mempermalukan kehormatan umat yang mengamalkan agama dengan tulus serta mempermalukan umat pemeluk agama yang dianutnya. Karena itu wajar kalau koruptor religius ini mendapat hukuman yang lebih berat tinimbang koruptor non religius. Penulis adalah Bendahara PW Muhammadiyah SU & Dosen UMSU

Mewaspadai Gempa Besar Sumatera Oleh M. Anwar Siregar Daerah paling kritis gempa dalam 5-10 tahun ke depan adalah Nias (P.Tello/Pulau-pulau Batu),Sumatera Barat, Bengkulu dan Simeulue serta gempa Selat Sunda


ebagian besar wilayah Indonesia semakin terancam bencana, apalagi kondisi batuan lempeng bumi Indonesia belum juga pulih dari efek tumbukan antar lempeng-lempeng raksasa. Terjadi lagi bencana gempa di Bengkulu, Sumatera Barat, dan Aceh (Simeulue dan Meulaboh 2010) serta gempa-gempa di Perairan Ternate dalam rentang satu bulan beruntun dengan kekuatan 7 skala richter. Siklus gempa begitu cepat berubah disebabkan efek energi keseimbangan bumi atau dikenal sebagai teori relaksasi bumi. Ini masih meneruskan responsibilitas ke berbagai penjuru permukaan bumi dan adalah merupakan sifat alamiah bumi bahwa bumi membutuhkan keseimbangan dan keselarasan. Daerah kritis gempa Di bawah ini terdapat beberapa daerah kritis gempa yang posisi koordinat pulau-pulaunya telah mengalami pergeseran sejauh 15-30 meter. Ini ditujukan oleh pengangkatan batimetri atau perubahan topografi lepas pantai yang terangkat setinggi 1-2 meter ke permukaan dapat menguncang dunia dalam ratusan kilometer dalam rentan 10 tahun dari tahun ini. Daerah tersebut yaitu 1. Pantai Barat Sumatera (Aceh, Simeulue, Nias, Mentawai, Enggano, Selat Sunda). Dari kompleksitas pergerakan lempeng di wilayah samudera Indonesia telah membentuk zona daerah seismik gap laut sebelah barat Pulau Sumatera menjadi tujuh zona subduksi. Zona subduksi itu merupakan pertemuan lempeng benua Eurasia dengan Indo-Australia. Lempeng benua Indo-Australia bergerak ke barat menghunjam lempeng Eurasia. Gempa terjadi karena ada bagian lempeng yang patah. Pusat gempa Desember 2004 (Aceh-Andaman), Maret 2005 (Nias-Simeulue) serta 2010 (Sinabang-Simeulue-Meulaboh) berada di segmen patahan yang berbeda. Pusat gempa Desember 2004, menurut penelitian Kerry Sieh, terletak di zona patahan dua, sedangkan gempa Maret di zona patahan tiga. Pada bulan Desember 2004 lalu beberapa segmen pecah bersamaan. Itulah yang menimbulkan tsunami. Penelitian Sieh mengungkapkan ada korelasi antara subduksi patahan dan sesar geser.

Akumulasi dari subduksi lempeng itu menghasilkan energi besar di sepanjang pantai barat, sehingga gempa-gempa maut masih berlangsung di wilayah Pantai Barat Sumatera dalam periodesasi yang sangat singkat dengan kekuatan diatas 7.0 SR. Bukti kasus kejadian ini adalah gempa Sinabang dan gempa Meulaboh. Pergerakan sesar geser rata-rata 15 milimeter hingga 30 meter per tahun. Pusat gempa Sinabang dan Meulaboh masih ada korelasi dengan pusat gempa Maret 2005 yang mengalami pemecahan lempengan sejauh 300 kilometer akibat ada pembebanan energi pecahan lempengan Burma pada kejadian gempa 2004 ke blok lempengan Nias-Simeulue. Zona subduksi patahan di lautan Pantai Barat diperkirakan sebagai pusat ”tarian gempa kolosal” bagi dunia dalam 10 tahun mendatang. Terdapat lebih dari tiga zona subduksi yang akan memberikan penghancuran ketataruangan bagi kota-kota besar di Barat Sumatera yang tidak dan belum membangun tata ruang kota berketahanan bencana yaitu pusat subduksi antara Kepulauan Enggano dengan Mentawai, Subduksi antara Nias-Simeulue dan Subduksi antara Aceh-Andaman dan Ujung Sumatera dengan Selat Sunda lalu menerus ke selatan Jawa. 2. Daratan Patahan Besar Sumatera. Gempa bumi terjadi di daratan patahan besar Sumatera diawali dengan akumulasi tegangan dan tekanan di sekitar batas lempeng, yang menjadi pusat konsentrasi dari akumulasi tegangan (stress) dan regangan (strainght). Akibatnya bisa sampai jauh beberapa ratus kilometer dari batas lempeng karena ada pelimpahan stress di kerak bumi, sehingga ada daerah aktif gempa di luar daerah pertemuan lempeng. Kasus sesar Sumatera umpamanya adalah sesar yang dibentuk oleh pelimpahan stress tabrakan lempeng IndoAustralia dengan Eurasia dengan sudut tabrakan miring terhadap garis batas, sehingga menyebabkan ada tekanan yang mendorong daerah Sumatra ke arah Utara. Dorongan ke utara ini tidak bisa diserap semua oleh zona subduksi di Kep.Mentawai, tapi harus ditanggung oleh sebuah jalur patahan besar di sepanjang Pegunungan Bukit Barisan Sumatera yang disebut Patahan (besar)

Sumatera. Kemiringan ini menyebabkan timbulnya konsentrasi kekuatan gempa di sesar Sumatera dan merupakan pusat-pusat gempa di daratan Sumatera. Pusat kekuatan gempa di daratan Sumatera terbagi 20 segment atau ruas patahan mulai dari ruas Aceh, Seulimeum, Tripa, Renun, Toru, Angkola, Asik, Barumun, Sumpur, Sumani, Sianok, Suliti, Siulak, Dikit, Ketaun, Musi, Manna, Kumering, Semangko dan Sunda. Panjang tiap ruas berbeda dari 35 km hingga 220 km Mewaspadai gempa besar Gempa bumi adalah proses alam yang berulang-ulang. Daerah yang pernah mengalami gempa diwaktu lampau pasti akan mengalami gempa lagi di waktu mendatang. Daerah beberapa subduksi samudera yang menahan beban energi kritis siklus gempa dalam kondisi matang di Pantai Barat Sumatera jika mengacu pada masa rentan pelepasan energi seimisitas dalam periode waktu tahunan, puluhan dan ratusan tahun, antara lain : Dalam hitungan 100-200 tahun yaitu gempa Mentawai, 1883, perkiraan periodik pelepasan tahun 2033 diatas 9.0 Skala Richter, Enggano (1905, kekuatan 8.0 SR) Gempa Aceh-Andaman (2004, kekuatan 9.1 SR). Periode waktu 50-80 tahun yaitu gempa P. Tello (1935. 7,7 SR), gempa Nias-Simeulue 2005. Dalam periode waktu 10-50 tahun adalah gempa di Bengkulu 2000, 2007, Simeulue 2002, 2010. Gempa Bengkulu-Sumatera Barat 2008, 2009. Daerah paling kritis gempa dalam 5-10 tahun ke depan adalah Nias (P. Tello/Pulau-pulau Batu), Sumatera Barat, Bengkulu dan Simeulue serta gempa Selat Sunda. Daerah di Patahan Besar Sumatera yang dapat menimbulkan bencana gempa besar di masa mendatang tercatat antara lain jika mengacu pada siklus tahunan, puluhan hingga ratusan tahun yaitu : Dalam hitungan periode waktu 80-200 tahun yaitu gempa Sorik Merapi (1892, kekuatan 7.7 Skala Richter). Gempa Kerinci (1909. kekuatan 7,6 SR), gempa Danau Toba (1916 dan 1921, kekuatan 6,8 SR). Periode 50-80 tahun yaitu gempa Bukit Tinggi (1926, kekuatan 6,7 SR dan 1943. 7,3 SR), gempa Liwa (1933. Kekuatan 7,5 SR dan 1994. 7,0 SR). Gempa Tapteng (1934. 8.0 SR). Gempa Sipirok (1936. 6,8 SR). Gempa Karo (1936. 7,2 SR). Gempa dengan siklus 10-50 tahun yaitu gempa Tarutung (1987. 6,8 SR), Gempa Muara Sipongi (2005. 5,6 SR). Gempa Kutacane (1975. 6,7 SR). Kesimpulan daerah kritis gempa didaratan terdapat di segment patahan Sumatera Utara, Aceh Tenggara, Aceh Besar, Padang, Jambi dan Lampung.

Penataan ruang gempa Daerah di Sumatera yang memasuki periode pelepasan energi gempa sebaiknya telah mempersiapkan penataan ruang lingkungan geologi yang baru berketahanan bencana dengan berkonsentrasi penuh dalam pengembangan pemanfaatan lahan secara tegas. Dan 10 kota besar seperti Sibolga, Padang, Liwa, Lampung, serta Bengkulu yang berpeluang mengalami kehancuran akibat penumbukan vertikal lempeng di samudera yang menghasilkan tsunami dan di antara tsunami akan mengguncang dunia sejauh lebih 1000 km yaitu tsunami antara Pulau EngganoSelat Sunda dan antara Mentawai dengan Kepulauan Nias-Simeulue dengan efek pemicu penjalaran tetap berpusat di patahan Mentawai. Perencanaan penataan ruang geologi yang berbasis mitigasi berketahanan gempa yang perlu diperhatikan. Kondisi

(Bersambung ke hal C7)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Gubsu: Izin tak diperlukan, bubarlah republik ini - Percumalah ada awak, kalau dilangkahi, he...he...he * Jalan tak seimbang dengan jumlah kendaraan - Betul sekali! * Pemuda harus menjadi pelaku perubahan - Tapi jangan pula jadi korban perubahan


D Wak


Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Plt. Redaktur Opini: Dedi Sahputra. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba, H. Halim Hasan, Diurna Wantana (Sumatera Utara), T. Donny Paridi (Aceh), Armansyah Thahir (Aceh, Otomotif), Austin Antariksa (Olahraga, Kreasi), Syafriwani Harahap (Luar Negeri, Popular, Pariwisata), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Anum Purba (Keluarga)), Hj. Ayu Kesumaningtyas (Kesehatan). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: H. Subagio PN (Medan), Zultamsir (Sumut), Aji Wahyudi (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Handaya Wirayuga, Hajrul Azhari, Syahrial Siregar, Khairil Umri (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid (Banda Aceh), Iskandarsyah (Aceh Besar), Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin, Zainuddin Abdullah, Maimun (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Musyawir (Lhoksukon), Muhammad H. Ishak (Idi), HAR Djuli, Amiruddin (Bireuen), Bahtiar Gayo, Irwandi (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar, Irham Hakim (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Muhammad Rapyan (Sinabang).

 Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Medan Metropolitan

WASPADA Senin 24 Mei 2010

Guru Dilapor Ke Poldasu

Kantor Pengadilan Agama Dibobol Maling MEDAN (Waspada): Kantor Pengadilan Agama (PA) Kelas I A di Jalan SM Raja, Kel. Timbang Deli, Kec. Medan Amplas, dibobol maling, Sabtu (22/5) dinihari. Dari kantor tersebut, pelaku membawa kabur 3 unit laptop, yakni dua diantaranya merupakan laptop milik pemerintah dan satu laptop lainnya milik pegawai serta uang tunai Rp800 ribu yang berada di ruang bendahara. Peristiwa itu pertama kali diketahui oleh Suheri, penjaga malam yang bertugas. Oleh Suheri, aksi kejahatan itu dilaporkan kepada Sahlan Hasibuan, pegawai Kantor PA Kelas I A Medan yang pertama kali tiba di lokasi. Mendengar pengakuan Suheri, lalu keduanya melaporkan kejadian itu kepada Ketua Pengadilan Agama Kelas I Medan. Selanjutnya, siang harinya sekitar pukul 12:00, pencurian itu dilaporkan Ketua PA Medan ke Mapolsekta Patumbak. Kapolsekta Patumbak, AKP Wahyuddin, ketika dikonfirmasi wartawan melalui telepon selulernya, Minggu (23/5) siang, membenarkan kejadian itu. “Tersangka diduga satu orang masuk ke ruangan ketua PA melalui jendela. Disana, pelaku tidak berhasil menemukan barang-barang berharga, setelah mengobrak-abrik ruangan. Lalu, pelaku masuk ke ruangan bendahara melalui pintunya, dan mengambil 3 unit laptop serta uang tunai Rp800 ribu,” terang Wahyuddin. Menurutnya, baru satu orang saksi yang diperiksa yaitu Suheri. “Sedangkan karyawan CCTV nya akan kita panggil dan kita minta data rekaman CCTV, karena disana ada CCTV, tapi kita belum tau apakah berfungsi atau tidak,” ujar Wahyuddin sembari menuturkan bahwa kasusnya masih diselidiki. (m39)

Pencuri Kabel Indosat Diciduk MEDAN (Waspada): Seorang residivis pencurian kabel telepon kembali mengulangi perbuatannya mencuri kabel milik Indosat diciduk petugas Polsekta Pancurbatu, Sabtu (22/5). Tersangka SS, 48, warga Dusun I Desa Tanjung Anom, Kec. Pancurbatu, ditangkap ketika berada di pangkalan Angkot 46 Desa Tanjung Anom, sekira pukul 23.00 WIB. Buru bangunan tersebut dijbeloskan ke tahanan karena mencuri 1kg kabel milik Indosat dari salah satu rumah warga yang terletak di Jalan Rakyat Dusun I Desa Tanjung Anom. Informasi yang diperoleh wartawan menyebutkan, Kamis (20/5) siang, Muklis Ashari, warga Gang Genteng, Kel. Delitua, mengetahui kalau kabel Indosat yang selama ini disimpannya di satu rumah di Jalan Rakyat Desa Tanjung Anom, sudah tidak ada lagi. Kemudian dia melaporkannya Polsekta Pancurbatu. Petugas Polsekta Pancurbatu yang menerima laporan segera melakukan penyelidikan dan meringkus tersangka. Saat diperiksa, tersangka SS mengakui perbuatannya telah mencuri kabel milik Indosat dari tempat penyimpanan di salah satu gudang. Sebanyak 1 kg kabel disikatnya dengan cara mengguntingnya terlebih dahulu. Selanjutnya dijualnya kepada tukang botot seharga Rp65.000. Tersangka juga mengakui kalau pencurian dilakukannya untuk yang kedua kalinya. Pada tahun 2007 tersangka pernah mendekam di penjara dalam kasus yang sama . Kapolsekta Pancurbatu, AKP Jhon S Purba, SH saat dikonfirmasi, Minggu (23/5) sore, membenarkan adanya penangkapan terhadap tersangka dalam kasus pencurian kabel milik Indosat. “Akibat perbuatannya itu, tersangka dijerat dengan pasal 363 KUHP tentang pencurian dengan pemberatan,” ujarnya. (cat)

Berbuat Mesum Dalam Toilet Palladium Diamankan MEDAN (Waspada): Satpam PT ASA Karya Perkasa bersama karyawan PT BIN mengamankan sepasang pria dan wanita diduga berbuat mesum di toilet wanita Palladium Plaza Jalan Raden Saleh Medan, Sabtu (22/5) siang. Keterangan Waspada peroleh di lapangan, terungkapnya kasus itu pukul 12:30, berawal karyawati PT Bersih Indah Karya bagian clening service sedang bekerja sebagaimana biasanya. Ketika hendak membersihkan toilet wanita di lantai I terlihat sepatu pria di dalam ruang toilet. Merasa curiga, karyawati itu membuka pintu toilet dan mendapati sepasang insan berlainan jenis diduga berbuat mesum. Satpam PT ASA Karya Kencana mendapat laporan segera mengamankan Fnd, 40, (resleting celana terbuka) penduduk Jalan Masjid dan wanita Up berusia sekitar 24 tahun, ke pos satpam di basement Palladium. Chief Satpam PT ASA Karya Kencana, Bona R kepada Waspada mengatakan, pasangan yang berlainan jenis itu sudah diambil keterangannya. “Setelah mereka membuat surat pernyataan, lalu dipulangkan,” kata Bona. (m31)

Waspada/Surya Efendi

TAMAN BERINGIN: Dua pasang muda-mudi melepas lelah dari panasnya matahari sembari duduk di Taman Beringin depan Gubernuran Jl. Jend Sudriman Medan, Minggu (23/5). Taman Beringin ini semakin sunyi dikarenakan jembatan sungai Babura di dekat taman tersebut sedang diperbaiki dan ditutup bagi kendaraan. Beberapa tokoh masyarakat mengharapkan taman ini tidak disalahgunakan.

Peningkatan Isu Begu Ganjang Berbahaya MEDAN (Waspada): Pelaksana Harian (Lakhar) Bidang Humas Polda Sumut AKBP MP Nainggolan menegaskan, rendahnya pemahaman agama membuat isu pemeliharaan begu ganjang atau santet di Sumut kian meningkat. “Akibatnya, korban meninggal sia-sia pada 2010 ini juga mengalami kenaikan dibanding 2009 lalu,” katanya, Rabu (19/5). Karena itu, lanjutnya, selain polisi, juga sangat diharapkan peran tokoh agama untuk memberikan sosialisasi tentang pemahaman isu begu ganjang kepada masyarakat. Sebab, jika tidak, dikhawatirkan kondisi ini akan memperburuk stabilitas keamanan di Sumut. “Sosialisasi yang dilakukan pihak kepolisian akan percuma jika tidak dibantu oleh peran tokoh agama,” katanya. Menurut Nainggolan, sepanjang 2009 telah terjadi dua

kasus isu begu ganjang di Kabupaten Simalungun dan Tapanuli Tengah (Tapteng). Di Simalungun, tercatat dua korban luka akibat isu begu ganjang. Rumah korban dibakar oleh massa dan penyidik kepolisian menetapkan 28 orang tersangka. Sedangkan di Tapteng, dua orang korban tewas akibat dianiaya massa , sementara kediaman korban dibakar. Dalam peristiwa ini, polisi menetapkan 45 orang tersangka. “Kedua kasus tersebut sudah dimajukan sampai ke pengadilan,” jelasnya. Peningkatan isu begu ganjang tercatat hingga Mei 2010. Ada empat kasus telah terjadi di jajaran Polda Sumut. Kondisi

miris terhadap pemahaman agama itu lebih banyak terjadi di wilayah Tapanuli Utara. Menurut Nainggolan, sekitar Maret lalu telah terjadi isu begu ganjang di Siborong-borong, Taput, dengan seorang korban luka berat dan polisi menetapkan tujuh orang tersangka. Kemudian Sabtu (15/5) terjadi pembantaian sadis oleh massa terhadap keluarga Bilson Simare-mare dan istrinya Riama br Rajagukguk serta anak mereka, Lauren Simare-mare, gara-gara isu menyesatkan. Ketiganya tewas dalam kondisi mengenaskan. Sementara menantu Bilson Simare-mare, Tiurma br Nainggolan, mengalami luka serius akibat terkena senjata tajam di tubuhnya. Dalam kasus ini, polisi masih menetapkan 42 orang tersangka dengan 13 orang daftar pencarian orang (DPO), termasuk dukun penyebar isu begu

ganjang tersebut. “Masih dicari dan dikembangkan,” ujar Nainggolan. Selasa (18/5) sebanyak 16 warga diamankan pihak Polres Taput karena membakar kediaman Paris Manalu di Desa Hutauruk, Kecamatan Sipoholon, Taput, dipicu isu begu ganjang. “Dalam peristiwa ini, sebanyak empat orang mengalami luka ringan dan polisi telah menetapkan 15 orang tersangka dengan DPO tiga orang,” ujarnya. Ditambahkannya, sebelum peristiwa di Taput itu, kasus isu begu ganja juga terjadi di wilayah hukum Polres Asahan, tepatnya di kecamatan Air Batu. Seorang gadis cilik menjual berbagai macam jenis dan bentuk kalung yang dikatakan mampu mengusir begu ganjang.Wanita cilik itu sempat diamankan namunsetelahitudipulangkankarena tidak terbukti melanggar pidana. Dalam kasus ini, polisi juga menemukan korban jiwa. (m39)

Waspada/Ismanto Ismail

LIHAT RANMOR: Petugas Polsekta Medan Sunggal menggiring tersangka FA melihat sepeda motor yang dicurinya, Kamis (20/5).

MEDAN (Waspada): Memberi keterangan palsu kepada pihak Kecamatan Tanjung Morawa untuk mendapat pinjaman dari Bank Sumut, seorang PNS guru SD Negeri 101894 dilaporkan mantan suaminya ke Poldasu, Kamis (20/5). Tumpak Parulian Sirait, 45, warga Jalan Gereja, Dusun XII, Desa Limau Manis, Kecamatan Tanjung Morawa, Deliserdang kepada wartawan mengatakan, R br N, 40, PNS guru SD Negeri 101894 Desa Bangun Sari, Deliserdang pada 12 Agustus 2008 telah mengaku sebagai seorang janda untuk mendapatkan kartu keluarga (KK) baru, sebagai kelengkapan persyaratan untuk meminjam uang puluhan juta ke Bank Sumut. “Keterangan palsu itu dibuatnya untuk mengurus KK baru guna mendapatkan pinjaman dari Bank Sumut,” ujarnya. Padahal, menurut Sirait, status mereka saat itu masih suami istri karena gugatan cerai yang diajukannya pada 2006 lalu belum memperoleh putusan hukum tetap dari Mahkamah Agung (MA). Sirait mengajukan kasasi atas putusan cerai dari Pengadilan Tinggi Medan Nomor 230/PDT/2007/PT-MDN. Putusan resmi mereka bercerai baru dikeluarkan pada 26 April 2010 lalu. Kata Sirait, keterangan palsu tersebut diberikan R br N kepada Kaur Pemerintahan Kecamatan Tanjung Morawa, Amru pada 2008 lalu. “Karena keterangan palsu itulah, makanya orang kecamatan mengeluarkan KK yang baru,” katanya. Setelah memperoleh KK baru dengan menyertakan (mendaftarkan) dua nama dari lima anak mereka, selanjutnya boru Nababan memperoleh pinjaman awal dari Bank Sumut sebesar Rp 15 juta. Pinjaman itu terus bertambah hingga pada 2 Februari 2010 mencapai Rp 57 juta. Hal itu membuat Sirait geram, karena R br N kerap bercerita kepada orang lain, mantan suaminya tidak pernah memberinya nafkah. “Sebetulnya saya nggak mau mengadu, tapi karena dia arogan dan ingin merebut anak-anak kami, makanya saya ke sini (Mapolda Sumut),” kata Sirait. Hingga kemarin petang, Sirait ditemani Kaur Pemerintahan Amru masih dimintai keterangan oleh penyidik di gedung Sentra Pelayanan Kepolisian (SPK) Terpadu Polda Sumut. Selingkuh Menurut Sirait, gugatan cerai itu diajukannya karena pernah mendapati R br N berselingkuh dengan tetangga mereka, pria beristri. Namun, kasus perselingkuhan pada 2006 yang telah dilaporkan ke Polres Deliserdang dengan bukti lapor No Pol. LP/ 576/VIII/2006, SPK tertanggal 24 Agustus 2008 hingga kemarin tak kunjung tuntas. Sirait menduga sebelum pernah mendapati R br N bersama pria lain di rumah mereka saat dirinya tidak ada, mantan istrinya itu sudah sering memasukkan pria ke kediamannya. Dugaan itu diperkuat dengan pemberitahuan yang disampaikan anak mereka yang mengaku melihat seorang pria masuk dan bercengkrama dengan boru Nababan. “Ini semua gara-gara perselingkuhan mantan istri saya itu, makanya saya mengajukan gugatan cerai,” katanya.(m39)

Puluhan Penumpang Sriwijaya Air Tertunda Berangkat MEDAN (Waspada) : Puluhan penumpang pesawat Sriwijaya Air dengan nomor penerbangan SJ-941 Medan tujuan Pekan BaruJakarta tertunda berangkat akibat mengalami gangguan teknik, di Bandara Polonia, Jumat (21/5).Para penumpangnya yang seyogianya diberangkatkan pukul 16.00 terpaksa tertunda lebih dari 1 jam menunggu perbaikan kerusakan pada pesawat itu. Pantauan di Bandara Polonia, kru pesawat terdiri dari pilot dan co-pilot serta pramugari yang sudah naik ke pesawat untuk mempersiapkan penerbangan terlihat turun kembali ke terminal keberangkatan dalam negeri.Masalahnya, gangguan teknik terdapat di bagian sayap kiri pesawat harus diperbaiki lebih dulu. Sedangkan para penumpang saat itu belum dipanggil naik atau boarding ke pesawat. Bahrum Sinaga selaku Komandan Posko Sekurity PT Angkasa Pura II yang dihubungi wartawan saat memantau kerusakan itu mengatakan, penerbangan Sriwijaya Air yang tertunda berangkat itu menurut jadwal terbang ke Pekan Baru pukul 16.00, hanya mengalami keterlambatan lebih dari satu jam. Puluhan penumpang terpaksa menunggu di ruang tunggu dengan raut wajah kecewa. Beberapa penumpang eksekutif di antaranya pejabat yang menunggu di ruang tunggu eksekutif JW Lounge pun mengaku kecewa, pihak maskapai penerbangan itu tidak mengumumkan alasan penundaan dan gangguan teknis yang terjadi di pesawat. Menurut informasi yang diperoleh, dari salah seorang penumpang yang kebetulan menghubungi petugas Sriwijaya Air menyebutkan, gangguan teknis itu terdapat pada selang hidraulik menghubung sayap kiri pesawat yang tidak berfungsi secara normal.Untuk mengatasi gangguan itu, pihak Sriwijaya Air mencoba mendatangkan material yang akan diganti dari Jakarta. (m32)

Jadwal Penerbangan Di Bandara Polonia

Pencuri Sepeda Motor Dipukuli Massa MEDAN (Waspada): Seorang residivis yang baru beberapa bulan bebas menjalani hukuman, babak belur dipukuli massa karena membawa lari sepeda motor Nuritduansyah, 18, di di Jalan Binjai simpang Diski, Kec. Sunggal, Kab. Deli Serdang, Kamis (20/5). Tersangka FA, penduduk Dusun I, Desa Pantegeni, Stabat, Kab. Langkat, kemudian diboyong ke Mapolsekta Medan Sunggal, sedangkan temannya Sofyan, 26, penduduk kawasan Titi Bobrok Jalan Setiabudi, masih dalam pengejaran. Kapolsekta Medan Sunggal, AKP Faisal F Napitupulu, SH,SIK didampingi Kanit Reskrim Iptu Anthoni Simamora, SH kepada Waspada menuturkan, tersangka FA bersama temannya Sofyan sebelumnya dengan mengendarai sepeda motor Suzuki Satria FU mencari sasaran sepeda motor hendak dicuri. Setiba di Jalan Binjai simpang Diski, mereka melihat sepeda motor Yamaha Zupiter MX BK 2501 AAJ warna merah yang parkir depan warnet kawasan tersebut. Kemudian FA turun dari bocengan sepeda motor yang dikemudikan temannya. Dia lalu mengambil sepeda motor korban dengan menggunakan kunci palsu. Korban Nuritdiansyah, warga Asrama Pondam kawasan Diski, melihat sepeda motornya diambil tersangka langsung melakukan pengejaran dan berhasil menarik bagian belakang kendaraannya sehingga tersangka terjatuh. Massa yang berada di lokasi langsung meringkus dan memukuli tersangka hingga babak belur. Tersangka akhirnya diselamatkan dari amukan warga setelah petugas Reskrim Polsekta Medan Sunggal datang ke lokasi. Tersangka FA kepada Waspada mengakui sudah dua kali ditangkap Polsekta Medan Sunggal dalam kasus pencurian sepeda motor. Pertama ditangkap pada Oktober 2009 di kawasan Ringroard, dua bulan ditahan di Polsekta Medan Sunggal dan dua bulan berada di Rutan Tanjung Gusta. (m31)



Pasangan walikota-wakil walikota Medan Rahudman Harahap-Dzulmi Eldin, didampingi tim suksesnya, turut mengucapkan ikrar bersama ratusan relawan yang tergabung dalam Rahudman Comunitas Center (RCC), di Melinium Plaza, Sabtu (22/5).

RCC All Out Menangkan Rahudman-Eldin MEDAN (Waspada): Rahudman Communitas Center (RCC) bersumpah akan memenangkan pasangan calon walikota Rahudman HarahapDzulmi Eldin. Mereka juga akan mengajak masyarakat untuk menggunakan hak pilihnya pada 15 Juni nanti. 570 orang yang tergabung dalam RCC, Sabtu (22/5), berkumpul di Melinium Plaza, mengucapkan ikrar. RCC merupakan wadah tempat berkumpulnya para relawan yang pada Pilkada Medan, berjuang untuk memenangkan pasangan Rahudman-Eldin. Dipimpin Direktur Eksekutif RCC Sugito, para relawan mengucapkan ikrar yang isinya, mereka bersumpah akan bekerja sekuat tenaga untuk memenangkan pasangan Rahudman-Eldin. Mereka ikhlas menerima ganjaran dari tuhan kalau ada maksud tidak baik dalam melaksanakan perjuangan. Rahudman Harahap dan Dzulmi Eldin, yang hadir pada acara ikrar tersebut, menyatakan rasa terimakasihnya atas kesepakatan yang dilakukan

hari itu. Kata Rahudman, sejak Pilkada putaran pertama, para relawan telah menunjukkan kesolidannya, sehingga dia dengan pasangannya menduduki posisi pertama dalam penghitungan suara. Rasa kebersamaan Sementara itu, Wakil Ketua Partai Golkar Sumut Rajamin Sirait, mengaku bangga dengan semangat para relawan untuk memenangkan Rahudman-Eldin. Menurutnya RCC telah menunjukkan rasa kebersamaan yang tinggi dalam berjuang. ‘’Saya senang, karena kita semua merasa sama. Tidak ada yang merasa paling berjasa, selain rasa kebersamaan,’’ katanya. Ikrar yang diucapkan para relawan, menurut Rajamin, bukan sekadar slogan kosong, tapi merupakan kekuatan besar untuk mewujudkan citacita menjadikan RahudmanEldin, sebagai walikota dan walikota Medan 2010-1015. Ingat, katanya, bahwa iblis tidak pernah takut dengan orang yang rajin berdoa. Tapi iblis takut pada orang yang bersepakat. Karena dengan

kesepakatan, apapun bisa dilakukan. ‘’Dan hari ini, RCC telah bersepakat untuk memenangkan RahudmanEldin. Saya yakin, itu akan terwujud,’’tambahnya. Rajamin Sirait, juga menyebutkan kalau dengan ikrar yang diucapkan hari itu membuktikan kalau sebenarnya bukan Rahudman-Eldin, yang mencari dukungan untuk menjadi walikota. Tapi, masyarakatlah yang memerlukan keduanya, menjadi walikota Medan. ‘’Karena memang timbalah yang mencari sumur. Bukan sumur yang mencari timba.’’ Pasangan Rahudman Harahap-Dzulmi Eldin, menurut Rajamin Sirait, juga tidak perlu mengumbar janji seperti pasangan calon walikota lainnya. Karena pasangan ini sudah merupakan janji. Yaitu pasangan [bekulit] hitam dan [berkulit] putih. Artinya, pasangan Rahudman-Eldin, adalah pasangan hitam di atas putih. Hitam-putih, menurut Rajamin, adalah merupakan pasangan yang manis. Karena

bila putih-putih, hasilnya pucat, sedangkan bila hitamhitam, menjadi seram. ‘’Jadi pasangan Rahudman-Eldin lah yang paling ideal,’’ tambahnya. Sedangkan Ketua Tim Pemenangan Rahudman-Eldin, M.Syaf Lubis, juga mengucapkan rasa syukurnya atas kesepakatan yang telah diambil hari itu. Artinya mayoritas masyarakat menginginkan Rahudman-Eldin, menjadi walikota dan wakil walikota. Disebutkan Syaf Lubis, sebagai orang timur, kita wajib menghormati tamu. Tapi kita tidak akan mau kalau tamu itu sampai menjadi penguasa di rumah kita. ‘’Kita harus tolak itu,’’ katanya. Masyarakat Medan, menurut Syaf, harus menjadi pemilik rumah kos. Bukan sebagai anak kos. Karenanya, masyarakat Medan akan bertanggungjawab terhadap apapun yang terjadi pada kota ini. ‘’Kalau jadi anak kos, tidak punya tanggungjawab apa-apa. Begitu rumah kosnya terbakar, dia tinggal angkat kopor dan pergi,’’ kata Syaf Lubis. (m17)

No. Penerbangan Ke Flight


Tiba Dari



GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-146

06.25 09.05 10.55 12.25 13.45 15.45 17.10 18.10 19.10 14.45

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-148 GA-188 GA-190 GA-192 GA-196 GA-147

06.10 08.00 09:30 10.50 11.50 12.50 14.10 16.15 19.35 18.10

AIR ASIA 1 Kuala Lumpur AK- 937 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 457 4 Kuala Lumpur AK-939 5 Penang QZ-8074 6 Jakarta QZ-7497 7 Jakarta QZ-7503 8 Jakarta QZ-7505 9 Phuket (3,5,7) FD-3991

08.50 09.40 18.00 20.10 16.05 12.20 13.30 18.40 17.45

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Jakarta Jakarta Jakarta Phuket (3,5,7)

AK-936 QZ-8055 AK-456 AK-938 QZ-8075 QZ-7496 QZ-7502 QZ-7504 FD-3990

08.25 11.55 17.40 19.40 18.05 19.15 13.05 15.40 17.15






LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Batam/S.baya 13 Banda Aceh 14 Penang 15 Penang

06.30 09.00 10.00 11.00 12.00 13.45 15.35 17.05 18.35 21.15 22.25 12.55 19.35 09.10 12.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Batam/S.baya Banda Aceh Penang Penang

JT-380 JT-398 JT-394 JT-302 JT-398 JT-382 JT-384 JT-396 JT-306 JT-386 JT-308 JT-971 JT-397 JT- 8289 JT-8287

08.20 09.20 10.20 11.20 10.45 13.05 14.55 16.25 19.35 21.35 23.20 12.20 08.20 11.35 15.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.25

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 14.45

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

08.30 20.45

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

07.50 20.00

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Batam

7P-592 7P-598 7P-594 7P-596 7P-568

10.10 12.50 15.50 19.10 13.00

Jakarta Jakarta Jakarta Jakarta Batam

7P-591 7P-597 7P-593 7P-595 7P-567

09.35 12.15 15.15 18.25 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-017 SJ-035 SJ-041 SJ-010 SJ-102 SJ-021

10.20 15.30 19.10 15.05 15.20 11.30 07.20 16.00

Jakarta Jakarta Jakarta Jakarta Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-014 SJ-034 SJ-140 SJ-140 SJ-103 SJ-020

11.50 18.35 20.15 14.30 15.25 14.20 09.35 14.45

JT- 381 JT- 397 JT- 301 JT- 395 JT- 303 JT- 399 JT- 383 JT- 385 JT- 387 JT- 305 JT-309 JT-972 JT-396 JT-8288 JT-8286

Medan Metropolitan


WASPADA Senin 24 Mei 2010

Pembangunan Gedung Baru DPRDSU Terindikasi Sarat Penyimpangan Habiskan Dana APBD Rp171 M MEDAN (Waspada): Pembangunan gedung baru DPRD Sumut sudah mulai rampung. Namun, proses pembangunan gedung yang menelan biaya Anggaran Pendapatan Belanja Daerah Sumatera Utara (APBD) Sumut mencapai Rp171 miliar tersebut, terindikasi sarat penyimpangan. Anggota Komisi D dari Fraksi Demokrat DPRD Sumut, Tunggul Siagian kepada wartawan, Sabtu (22/5) mengatakan, pihaknya sudah mencium ‘aroma’ tak sedap terkait pembangunan gedung rakyat Sumut tersebut. Karena pengawas pembangunan berasal dari satu perusahaan dengan pelaksanak pembangunan. “Dalam UU sudah jelas dikatakan, pelaksana proyek tidak diperbolehkan satu perusahaan dengan konsultan pengawas. Maksud dari UU itu, untuk mengoptimalkan pengawasan dan mencegah penyimpangan dalam pelaksanaannya,” terang Tunggul. Seperti diketahui, pelaksana pembangunan yakni PT Jaya Konstruksi serta pengawas PT Arkon, berasal dari perusahaan yang sama. “Mana mungkin

secara tupoksi, PT Arkon selaku pengawas dapat melaksanakan fungsinya kepada PT Jaya Konstruksi sebagai pelaksana pembangunan. Karena memang perusahaannya sama,” jelasnya. Untuk itu, Tunggul meminta, Dinas Tata Ruang dan Pemukiman (Tarukim) Pemprovsu agar segera mengevaluasi kinerja kedua perusahaan tersebut. Selain itu, kata Tunggul, melihat kualitas pembangunan gedung, ternyata hasilnya dinilai tidak sebanding dengan dana yang mencapai Rp171 miliar. “Kalau cuma seperti itu, saya kira perusahaan lokal Sumut juga bisa menjadi pelaksananya,” katanya. Menurutnya, sangat disayangkan pelaksana proyek yang ditunjuk ternyata PT Jaya Konstruksi yang notabene sebagian sahamnya berasal dari Pemprov

KNPI Medan Timur Peringati Harkitnas MEDAN (Waspada): Pimpinan Kecamatan (PK) Komite Nasional Pemuda Indonesia (KNPI) Medan Timur menggelar silaturahmi dengan legiun veteran dalam rangka memperingati 102 tahun Hari Kebangkitan Nasional (Harkitnas) di Jalan Ampera I, Kamis (20/5). Silaturahmi digelar secara sederhana ini dihadiri sejumlah pembina PK KNPI Medan Timur antara lain, Kapolsek Medan Timur AKP YS Nasution, Dan Ramil, mantan Pj Walikota Medan, Drs Afifuddin Lubis, MSi. Ketua PK KNPI Medan Timur, Amri Tasman, SH mengatakan, silaturahmi dengan legiun veteran dalam rangkaian untuk membina silaturahmi pemuda dengan para pejuang yang telah merebut kemerdekaan. Sebagai pemuda, kata Amri Tasman, warisan dan cita-cita para pejuang akan diwujudkan dengan membangun kebersamaan dengan semangat persatuan dan kesatuan demi kemajuan bangsa dan negara. “KNPI sebagai wadah organisasi kepemudaan khususnya di Kecamatan Medan Timur akan menjadikan kegiatan ini aktivitas rutin,” katanya. Sebagai bentuk penghargaan, PK KNPI Medan Timur memberikan bingkisan dan asuransi kecelakaan kepada setiap legiun veteran yang ada di kecamatan Medan Timur. Mewakili para pejuang,Yunus mengaku terharu dengan adanya silaturahmi yang digelar PK KNPI Kecamatan Medan Timur. Menurutnya, sebagai pejuang yang merasakan betapa pahitnya merebut dan mempertahankan kemerdekaan di zaman penjajahan Belanda, Jepang saat ini berharap agar generasi penerus bangsa mau meneruskan semangat patriotisme. Kapolsek Medan Timur sebagai pembina, mengatakan, sangat senang dan bangga bisa berbicara di hadapan pejuang yang tergabung dalam legiun veteran. Menurutnya, sebagai generasi penerus yang bisa dilakukan membangun bangsa yakni berkarya di bidang masing-masing. “Saya bangga, pemuda-pemuda di Kecamatan Medan Timur bahu membahu dalam mewujudkan keamanan dan ketertiban di masyarakat. Ini juga upaya mengisi kemerdekaan,” katanya. (m36)

Diapari Siregar Pimpin Kembali KBPPP Sumut MEDAN (Waspada): Dengan memperoleh 16 suara Ir Diapari Siregar kembali terpilih dan memimpin Dewan Pimpinan Daerah (DPD) Keluarga Besar Putera Putri Polri (KBPPP) Sumut periode 2010-2014, setelah secara meyakinkan berhasil merebut suara terbanyak dan menyisihkan kandidat lainnya Dra Hj Yulheni (7 suara). Pemilihan Ketua DPD KBPPP Sumut periode 2010-2014 itu berlangsung demokratis di Aula Tribata Diklat SPN Sampali Medan, Sabtu (22/5). Musda-II yang dijadwalkan berlangsung dua hari secara maraton berhasil dituntaskan selama sehari penuh, dibuka oleh Kapoldasu diwakili Wakapolda Brigjen Pol. Drs Safaruddin, MSi, dihadiri Sekjen DPP KBPPP Agenanda Djatmiko, MBA mewakili Ketua Umum, Anna Setot, para dewan penasehat, serta 22 utusan Resort dari kab/ kota di Sumut. Diapari yang telah memimpin KBPPP Sumut periode sebelumnya di sesi agenda pemilihan langsung dicalonkan kembali sebagai ketua. Sidang dipimpin presidium Drs Syaiful Syafri berhasil menuntaskan agenda pemilihan dengan lancar. Sekjen KBPPP Pusat Agenanda Djatmiko, MBA didampingi Kabag Bina Mitra Poldasu yang juga sebagai Pembina Harian KBPP Sumut Kombes Pol Suwarno usai pembacaan SK langsung melantik dan mengukuhkan Ir Diapari Siregar sebagai Ketua DPD KBPPP Sumut periode 2010-2014, ditandai dengan penyerahan pataka dan penyematan pin. Kabag Bina Mitra Poldasu selaku Pembina Harian KBPPP Sumut Kombes Pol Suwarno dalam amanatnya menyaatakan PR baru bagi ketua terpilih dan jajaran pengurus KBPPP Sumut nantinya membantu tugas-tugas pokok Polri di bidang Polmas, Linmas, Siskamling maupun Swakarsa harus betul-betul disiapkan untuk menggalang potensi masyarakat yang andal. “Karenanya, KBPPP sebagai partnership Polri akan berperan aktif dalam menciptakan keamanan masyarakat menuju “toto tentrem dan raharjo,” ujar Suwarno. Ketua terpilih Ir Diapari Siregar menyatakan ucapan terima kasih kepada berbagai pihak yang telah berpartisipasi dalam penyelenggaraan Musda II yang berlangsung lancar dan sukses. “Kami segera akan menyusun kepengurusan DPD KBPPP Sumut dalam waktu sepuluh hari ke depan, sekaligus persiapan untuk menghadapi Musyawarah Nasional (Munas) KBPPP di Semarang dalam waktu dekat ini,’’ ujarnya.(m03)


Sekjen DPP KBPPP Agenanda Djatmiko, MBA didampingi Kabag Bina Mitra Poldasu Kombes Pol Suwarno menyerahkan pataka kepada Ketua KBPPP Sumut Ir Diapari Siregar saat pelantikan dan pengukuhan.

DKI Jakarta. Seharusnya, karena menggunakan APBD Sumut, pengerjaan proyek tersebut diserahkan kepada perusahaan lokal. “Untuk ke depan, ini akan menjadi perhatian bagi DPRD Sumut. Karena kalau ada proyek pembangunan yang menggunakan APBD Sumut dalam jumlah besar, sebaiknya diserahkan kepada perusahaan lokal. Karena kinerja perusahaan dari luar juga ternyata biasa saja,” katanya.

Di sisi lain, Tunggul juga merasa prihatin, karena pelaksana proyek tidak memberikan sentuhan beraroma Sumut dalam mendekorasi gedung DPRD itu. Padahal, menurutnya, nuansa Sumut harus melekat dan menjadi ciri khas gedung tersebut. “Gedung DPRD Sumut yang baru, harusnya berornamen khas Sumut. Ornamen itu menyatakan identitas daerah kita,” ucapnya. Sedangkan Anggota Komisi D dari Fraksi Golkar DPRD Su-

mut, Biller Pasaribu, menyoroti tentang perlunya pembangunan limbah berskala besar. Itu diperlukan, katanya, mengingat banyaknya rakyat yang tentunya akan datang ke gedung tersebut. Jangan sampai, lanjutnya, limbah akan menjadi masalah baru setelah pembangunan gedung itu rampung. “Kita tidak ingin setelah pelaksana proyek pergi, muncul masalah terkait limbah di gedung dewan tersebut,” kata Biller. (h11)

Pemugaran Jembatan Sudirman Kacaukan Lalu Lintas Perubahan Arus Lalu Lintas Harus Dilakukan M E D A N ( Wa s p a d a ) : Pemerintah Provinsi (Pemprov) Sumatera Utara dan Pemerintah Kota (Pemko) Medan diminta untuk melakukan perubahan arus lalu lintas di Medan. Hal itu penting sebagai ekses dari penutupan Jalan Sudirman yang mengakibatkan kemacetan parah di beberapa ruas jalan. Pantauan Waspada, Jumat (21/5), akibat penutupan yang disebabkan pemugaran jembatan di Jalan Sudirman itu, telah membawa efek negatif terhadap lalu lintas di kota ini. Beberapa arus lalu lintas di ruas jalan yang selama ini tergolong lancar, kini dipenuhi oleh kendaraan yang bergerak merayap. Jalan Mongonsidi misalnya. Ruas jalan yang selama ini cukup lancar, sejak penutupan Jalan Sudirman telah menjadi sumber kemacetan. Tidak saja karena sempitnya ruas jalan yang dibagi dua dengan lebar hanya 3 meter di masing-masing ruas, tapi juga karena meningkatnya volume kendaraan melalui jalan tersebut. “Ya, selama ini di sini jarang sekali macet, bahkan hampir tidak pernah. Tapi sekarang, mulai pagi kemacetan sudah terjadi. Paling parah dari pukul 16.00 sampai pukul 18.00 sore,” jelas Roy, salah seorang warga Jalan Mongonsidi. Petugas kepolisian yang berjaga di sana memang telah mengambil inisatif mengurangi kemacetan. Salah satunya dengan melakukan sistem buka tutup pembatas jalan. Pada jam sibuk, petugas polisi menutup pembatas jalan agar kendaraan yang datang dari arah berlawanan tidak masuk ke ruas jalan di sebelahnya, sehingga memperlambat arus kendaraan yang berada di jalur tersebut. Pengendara, baru bisa memutar arus di bundaran Jalan Juanda. Namun, itu pun tidak begitu banyak membantu.

Kemacetan panjang mulai terasa sejak simpang Avros hingga ke persimpangan Jalan Pattimura. Kondisi serupa jelas juga berekses ke Jalan Pattimura hingga Jalan Jamin Ginting. Kemacetan panjang kini menjadi langganan biasa di kedua ruas jalan tersebut, apalagi di persimpangan lima antara Jalan Iskandar Muda dan JalanWahid Hasyim. Kesemrautan akan semakin parah saat listrik padam dan traffict light tidak berfungsi. Tingginya volume kendaraan yang melalui ruas-ruas jalan tersebut diperkirakan karena ditutupnya Jalan Sudirman. Sebab, kendaraan ‘dipaksa’ melalui ruas jalan itu untuk menuju ke berbagai kawasan. “Terpaksa lewat dari Jalan Mongonsidi kalau mau ke kampus (USU Padang Bulan). Dari mana lagi? Jalan Sudirman ditutup,” tukas Syafii Nasution, mahasiswa Fakultas Sastra USU yang berdomisili di Jalan Pancing. Sejatinya, tidak saja jalan yang menuju Padang Bulan yang macet, kondisi setali tiga uang pun terjadi di beberapa ruas jalan ke arah Jalan Gatot Subroto. Kemacetan yang kerap terjadi di Jalan Gajah Mada hingga Jalan S Parman, semakin parah setelah ditutupnya Jalan Sudirman. Padahal, sebagaimana di Jalan Mongonsidi, di beberapa persimpangan polisi terlihat berjaga-jaga dan memasang pembatas jalan. Kondisi itu bisa terjadi, menurut Rafriandi Nasution, SE, MT, pengamat tata kota, disebabkan karena Pemprov dan Pemko tidak mempunyai persiapan yang matang saat memutuskan menutup Jalan Sudirman untuk merenovasi jembatan. “Seharusnya, sebelum ditutup Pemprov bekerjasama dengan Pemko Medan mela-

kukan tata ulang arus lalu lintas di beberapa ruas jalan. Sehingga, tidak terjadi penumpukan volume kendaraan di suatu jalan,” jelas alumnus pascasarjana Fakultas Teknik USU ini. Dia menjelaskan, salah satu perubahan arus yang bisa dilakukan adalah dengan membagi dua Jalan Zainul Arifin yang selama ini hanya satu jalur. Ini penting dilakukan agar arus kendaraan yang menuju ke kawasan Jalan Kejaksaan dan Jalan S Parman, tidak hanya bisa dari Jalan Gajah Mada. “Kalau Jalan Zainul Arifin, tepatrnya di kawasan Kampung Madras itu dibagi dua, pengendara tidak tertumpuk di Jalan Gajah Mada,” tukasnya. Hal yang sama juga bisa dilakukan di Jalan Gatot Subroto, antara Simpang Majestik hingga persimpangan Jalan Iskandar Muda yang selama ini satu arus. Dengan demikian, arus kendaraan dari kawasan pusat kota menuju Padang Bulan tidak semata harus melalui Jalan Mongonsidi. “Pembagian dua arus Jalan Gatot Subroto akan bisa menjadi salah satu jalan alternatif menuju ke Jalan Iskandar Muda hingga kawasan Padang Bulan. Jadi, kendaraan tidak tertumpuk di Jalan Mongonsidi,” bebernya. Karena itu, lanjut Rafriandi, Pemprov Sumut harus segera mengambil langkah tersebut dengan mengajak duduk pihak Dinas Perhubungan Pemko Medan. Sebab, jika itu tidak dilakukan, maka bisa menimbulkan kerugian secara immateril bagi warga Medan, mengingat penutupan Jalan Sudirman diperkirakan berlangsung hingga September 2010 mendatang. “Tentu tidak sedikit kerugian yang diderita masyarakat akibat kemacetan. Ini harusnya menjadi perhatian pemerintah agar memikirkan bagaimana supaya kemacetan itu bisa diminimalisir,” tandasnya (crl)

Fakta Nusantara Dituding Lakukan Pembohongan Publik MEDAN (Waspada): Forum Aspirasi Karyawan dan Pensiunan Perkebunan Nusantara II (Fakta Nusantara) dipimpin Indro Suhito, SH, Ir. Riswan Hutabarat dan Afan Rahbi Sinulingga,ST dituding melakukan pembohongan publik, menghasut dan memprovokasi karyawan PTPN II saat melakukan unjuk rasa di DPRD Sumut 6 Mei lalu. Hal itu dikatakan Kuasa Khusus Serikat Pekerja Perkebunan PTPNusantara-II (SPBUN PTPN II), Serikat Pekerja Merdeka PTPNusantara-II (SPM PTPN II), Koordinator SPBUN PTPN II KSO LNK dan Forum SPM PTPN II KSO LNK, Benny Parlaungan Rambe, SH dan Robinson Silalahi, SH dari kantor Benny Parlaungan Rambe, SH & Rekan selaku kuasa hukum Fakta Nusantara, kemarin. “Kami beri waktu 3 X 24 jam sejak pemberitaan ini diekspos ke media kepada Indro Suhito, RiswanHutabaratdanAfanRahbi Sinulingga dkk untuk mengklarifikasi dugaan pembohongan publik dan pencemaran nama baik karyawan khususnya yang tergabung dalam SP-BUN dan SPM PTPN II dan sekaligus melakukan permintaan maaf dengan pemberitaan yang benar di media nasional dan Medan. Jika mereka tidak mengklarifikasi akan lanjutkan secara hukum pidana dan perdata,” tegas Benny Parlaungan Rambe, SH. Menurut Rambe, pihak SPBUN dan SPM PTPN II selaku pemberi kuasa khusus sudah merasa tercemar atas pemberi-

taan di media massa maupun saat unjuk rasa yang dilakukan pihak-pihak yang mengatasnamakan Fakta Nusantara di bawah pimpinan Indro cs. “Klien kami merasa sudah dirugikan karena pihak yang mengaku Fakta Nusantara telah membawa sejumlah karyawan anggota SP-BUN dan SPM tanpa pemberitahuan dan persetujuan kedua serikat pekerja yang sah di PTPN II ini. Bahkan dampak dari itu semua klien kami juga terpaksa harus melakukan klarifikasi atas pemanggilan berbagai pihak karena sejumlah massa yang melakukan aksi berasal dari SP-BUN dan SPM. Mereka telah merugikan moril klien kami, makanya jika ketiga orang yang kami sebutkan di atas tidak mengklarifikasi akan kami lanjutkan ke proses hukum,” tambah Rambe. KSO LNK Salah satu poin yang dianggap pembohongan publik dan meresahkan pihak SP-BUN dan SPM PTPN II, menurut Rambe, disampaikan pihak Fakta Nusantara dalam orasi demo di DPRD Sumut tentang keresahan karyawan PTPN II yang bekerja di Kerja Sama Operasional (KSO) PT Langkat Nusantara Kepong (LNK). “Mereka (Fakta Nusantara– red) sudah membalik fakta dan memberikan informasi bohong.Yang jelas, karyawan yang tergabung dalam Forum SPM dan Koordinator SP-BUN PTPN II KSO LNK tidak resah dan tidak dalam kondisi sengsara. Terbukti para penghasilan karyawan makin meningkat dengan pe-

nambahan pendapatan prestasi diluar upah, bahkan upah mereka sudah diatas UMP tahun berjalan,” katanya. Selain itu, tambahnya, pembohongan publik yang disampaikan pihak yang mengaku Fakta Nusantara yang menyebutkan Perjanjian Kerja Bersama (PKB) bersifat lokal dan salah satu isi dari PKB tersebut mencabut Santunan Hari Tua (SHT ) karyawan PTPN II. “Sebenarnya telah diadakan penandatanganan PKB 20102011 pada 30 April 2010 di Jakarta oleh Direksi PTPN II dan Serikat Pekerja PTPN II disaksikan Dirjen PHI Kementerian tenaga Kerja dan Transmigrasi. Semua isi dari PKB ini adalah untuk melindungi dan meningkatkan kesejahteraan karyawan PTPN II,” katanya. Sebelumnya, sekelompok orang yang mengaku dari Fakta Nusantara di bawah pimpinan Indro Suhito, Riswan Hutabarat dan Afan Rahbi Sinulingga melakukan aksi unjuk rasa di DPRD Sumut ada 6 Mei lalu dengan menyampaikan berbagai hal yang mendiskreditkan PTPN II dan KSO LNK. Aksi tersebut mendapat reaksi keras dari SP-BUN dan SPM PTPN II karena diantara massa yang melakukan aksi unjuk rasa merupakan anggota kedua serikat pekerja tersebut. Pihak SP-BUN dan SPM telah menegaskan pihaknya tidak mentolerir anggotanya yang ikut dalam aksi dan akan melakukan tindakan organisasi berupa pemecatan. (m08)


H Tengku Dzulmi Eldin (kanan) melantik para pengurus LSP Satria Nusantara Sumut periode 2010-2012 di Lapangan Gedung Keuangan Sumut, Minggu (23/5).

Dzulmi Eldin Lantik Pengurus LSP Satria Nusantara MEDAN ( Waspada): H Tengku Dzulmi Eldin yang merupakan calon wakil walikota Medan melantik pengurus Lembaga Seni Pernapasan (LSP) Satr ia Nusantara Sumatera Utara periode 20102012 yang dipimpin Sahabuddin Duha, SE di Lapangan Gedung Keuangan Sumut, Minggu (23/5). Eldin mengatakan, seni pernapasan ini sangat bermanfaat bagi siapa saja yang melakukannya. Secara fisik memang tidak terlihat, tetapi secara kebatinan pernapasan ini sungguh sangat baik dan besar manfaatnya bagi kesehatan pada diri masing-masing. Siapa pun tahu banyak senam pernafasan di Indonesia, tetapi di Medan yang paling populer adalah Seni Pernapasan Satria Nusantara. “Kenapa banyak orang mau ikut dalam kegiatan senam Satria Nusantara ini, tentunya pasti bapak/ibu merasakan besar manfaat yang dirasakan apabila kita mengikuti senam pernapasan ini deng-an baik dan rutin. Kepada pengurus saya ucapkan selamat dan mudah-mudahan ke depan kita bisa mengajak keluarga, saudara, lingkungan kita untuk

mau bersama-sama melakukan pelatihan senam pernafasan ini agar masyarakat bisa merasakan bagaimana hidup sehat khususnya di Kota Medan tercinta ini,” ujarnya. Ketua LSP Satria Nusantara Sumut, Sahabuddin Duha menje-laskan, seni pernapasan Satria Nusantara merupakan salah satu kegiatan untuk membantu program pemerintah dalam menyehat-kan masyarakat dan mengajak masyarakat untuk hidup sehat. Bahkan Satria Nusantara sudah diakui di Departemen Kesehatan malah organisasi kesehatan dunia WHO, bahwa seni pernapasan Satria Nusantara untuk kesehatan dan mampu menyembuhkan berbagai macam penyakit baik medis maupun non medis. “Satria Nusantara dengan tiga inti utama, olah gerak, olah napas dan olah zikir memiliki motto ‘Jagalah Sehatmu Sebelum Datang Sakitmu’ dan Kesehatan adalah harta yang tak ternilai. Dengan olah gerak, olah napas dan olah zikir, kita bisa menjaga kesehatan agar terhindar dari berbagai penyakit baik penyakit medis maupun non medis,” ujarnya. Kegiatan yang berlangsung

sejak pukul 06:00 tersebut diawali dengan gerak jalan santai, kemudian dilanjutkan dengan pelantikan pengurus dan peragaan gerak jurus seni pernapasan Satria Nusan-tara. Pada kesempatan itu, beberapa anggota menceritakan pengalaman tentang manfaat seni pernapasan bagi kesehatan dan menyembuhkan penyakit yang pernah dialaminya. Susunan kepengurusan LSP Satria Nusantara Sumut per iode 2010-2012 yaitu Pelindung Gubernur Sumatera Utara, Pembina: Kadis Pemuda dan Olah Raga Provsu, Anggota DPD RI, Drs. Parlindungan Purba, Drs. Sujamrat Amro (FOMI Sumut), Dewan Penasehat: DR. AM Situmeang, SH, Edi Negara Siahaan, SH, H. Huzaifah, SH, HT Adhan Gusti, SH, Abdurrahman, SH, MHum, Ir. H. S. Sinuhaji dan Drs. Washington Purba. Ketua: Sahabuddin Duha, SE, Wakil Ketua, Ir. H. BE Tanjung, Ir. H. Sugih Arto Yusuf, H . D e w a n Na s u t i o n , H j. Nurjannah. Sekretaris, Ir. H. Sukirdi, Wakil Sekretaris, Hj. Elvina Herawaty, MSc, Tiurma Tambunan, SE. Bendaraha I, H. Sudarto, BSc, Bendahara II, Hj. Iswarni. (m41)

AS Penyumbang Gas Emisi CO2 Terbesar Dunia MEDAN (Waspada): Negara Amerika Serikat ternyata penyumbang emisi gas rumah kaca (Carbon Dioksida/CO2) yang mempengaruhi langsung komposisi atmosfer sehingga terjadinya perubahan iklim dan pemanasan global. Urutan kedua ditempati negara Uni Soviet, disusul Cina, Brazil, India, Jepang, sedangkan Indonesia berada pada urutan ketujuh. Hal tersebut disampaikan Wahyuddin dari Stasiun Klimatologi Sampali Medan bagian Data dan Analisis Prakiraan Cuaca dalam seminar Lingkungan III Lex Natural Fakultas Hukum Universitas Medan Area (UMA), di Aula Kampus I UMA, Jalan Kolam Medan Estate, Kamis (20/5). Wahyuddin menyebutkan, gas emisi C02 sangat mempengaruhi perubahan iklim bumi. Dengan semakin meningkatnya CO2 maka bumi

akan semakin panas. “Aktivitas manusia dalam pembangunan sering menggunakan energi yang bersumber dari fosil dan energi lain yang menghasilkan gas emisi rumah kaca,” ujarnya. Namun Wahyuddin mengakui, perubahan iklim penyebab pemanasan global tidak hanya disebabkan emisi C02 tapi bisa disebabkan penggunaan energi transportasi dan industri serta perambahan hutan. “Untuk dunia penyumbang emisi gas rumah kaca terbesar berasal dari sektor transpotasi dan industri,” ungkap Wahyuddin. Wahyuddin menjelaskan, pada dasarnya pemanasan global bisa dikurangi jika penggunaan fosil dan energi lainnya dikurangi sebanyaknya-banyaknya. Pengurangan tersebut menyebabkan kondisi suhu bumi akan semakin baik atau laju peningkatan perubahan

iklim bisa diperlambat. Sebelumnya Rektor UMA diwakili Wakil Rektor II UMA, Ir. Hj. Siti Mardiana, M.Si ketika membuka seminar tersebut mengatakan, pemanasan global harus segera diantisipasi. Hutan dan lingkungan kita harus tetap dijaga dan dilestarikan. UMA sebagai lembaga pendidikan, katanya, terus berupaya melestarikan lingkungan, bahkan UMA saat ini telah memiliki hutan kampus yang diakui terbaik di Sumatera Utara. Seminar digelar Mahasiswa Fakultas Hukum UMA tersebut juga menampilkan pembicara Kepala Divisi Litigasi LBH Medan, Syah Rijal Munthe, SH dan Ida Marni dari Balai Besar Konservasi Sumber Daya Alam (BBKSDA) Sumut dan menghadirkan puluhan pelajar SMA dan remaja pencinta alam se Kota Medan, sebagai peserta seminar. (m41)

Indonesia Belum Miliki UU Penilaian Aset MEDAN (Waspada): Indonesia hingga kini belum memiliki undang- undang tentang penilaian aset. Para penilai masih mengacu pada Peraturan Menteri Keuangan (PMK) Nomor 125 tahun 2008 tentang pengaturan penilai publik. “Payung hukum tentang penilai aset belum ada. Saat ini masih dalam rancangan yang digodok oleh Menkeu,” ungkap Ketua Umum Masyarakat Profesi Penilai Indonesia (MAPPI) Pusat, Ir Hamid Yusup di sela - sela Pendidikan P1-P2, di Hotel Madani Medan, Jumat (21/5). Dalam Pendidikan P1 - P2 yang berlangsung 17 Mei - 8 Juni 2010 yang diikuti 31 peserta tersebut, Hamid Yusup menjelaskan, belum adanya payung hukum menyebabkan Indonesia ketinggalan dengan negara lain. Padahal tahun 2012 Indonesia sudah harus mengikuti standar internasional tentang penilaian aset. Dalam PMK tahun 2008, pihak yang berhak menilai aset itu, ada dua kelompok yakni penilai property dan penilai bisnis. Penilai property terdiri penilai aset tetap (berwujud) seperti tanah, mesin, mobil dan sebagainya. Sedangkan penilai bisnis, adalah mereka yang menilai objek usaha (tak berwujud)

seperti penilaian saham, kerugian dan sebagainya. Kedua penilai, yang terdiri dari penilai swasta dan penilai pemerintah harus mendapat izin dan diangkat oleh Menteri Keuangan. Idealnya jumlah penilai untuk suatu negara seperti negara maju, sebaiknya 50 penilai/ 1 juta orang, namun saat ini Indonesia masih memiliki rasio 10 orang penilai/1 juta orang. Karena itu, kata Hamid pada tahun 2014, MAPPI akan menyediakan 4 ribu- 5 ribu penilai, agar mampu melayani kebutuhan penilaian terhadap aset pemerintah dan swasta. “Dari 2 ribu jumlah penilai MAPPI, saat ini yang bersertifikat MAPPI (Cert) baru 316 orang,” jelas Hamid Yusup didampingi Ketua dan Sekum MAPPI Sumut - NAD, Ir. Safrida dan Ir. Taslim serta Wakil Ketua, Ir. Irwan Bahri dan Ir. Hilal Rasyad, M.Si. Selenggarakan Kongres Pada kesempatan itu Hamid juga menjelaskan, Indonesia (MAPPI) akan menyelenggarakan “The 25 th Pan Pasifik Congress” di Bali pada 27 - 30 September 2010 mendatang dengan peserta dari berbagai negara di dunia. Terkait dengan kongres tersebut, Hamid mengimbau

kepada pengguna jasa penilain di Indonesia seperti instansi pemerintah dan swasta untuk berpartisipasi karena sangat bermanfaat terkait dengan penilain aset. Sementara itu, Irwan Bahri mengatakan berdasarkan PMK Nomor 01/PMK.01/2010, pengguna jasa profesi penilai publik harus menggunakan penilai publik yakni Kantor Jasa Penilai Publik (KJPP) atau cabang KJPP yang telah memperoleh izin dari Kementerian Keuangan RI. “Sekarang untuk melakukan penilaian aset harus menggunakan KJPP tidak lagi PT (Persero). Untuk Medan saat ini ada 25 KJPP,” jelas Irwan Bahri seraya mengatakan dalam waktu dekat MAPPI Sumut NAD akan menggelar pendidikan penilai ganti rugi. Hilal Rasyad menambahkan, pendidikan P1-P2 yang diikuti 31 orang yang berasal dari 15 KJPP dan satu Perbankan adalah syarat untuk menjadi anggota MAPPI. “Tapi sebelum menjadi anggota MAPPI, mereka yang ikut pendidikan harus lulus ujian pendidikan P1P2,” ungkap Hilal Rasyad didampingi Ketua, Sekretaris dan Bendahara Pelaksana , Dwi Indriati, SE, Suprapto, ST dan Linda Lubis, SH. (m41)

Medan Metropolitan

WASPADA Senin 24 Mei 2010


Transportasi Medan Mengarah Ke Massal MEDAN (Waspada): Sejumlah kota metropolitan di Indonesia termasuk Kota Medan akan diarahkan mengoperasikan transportasi angkutan massal, sebagai upaya mengurangi kemacetan arus lalu lintas. Terkait hal itu, Departemen Pehubungan (Dephub) telah membuat satu studi kelayakan disebut Pustraffic Trantib (pusat traffic transportasi tertib). “Ada 9 koridor dari hasil studi di sejumlah kota besar di Indonesia layak dijadikan jalur bus. Bahkan saat Pj Walikota Medan dijabat Drs. Rahudman Harahap, MM, Pemko Medan dan Departemen Perhubungan telah menandatangani Memo-

randum of Understanding (MoU),” kata Kepala Seksi (Kasi) Darat Dinas Perhubungan Sumatera Utara, Darwin Purba, MT di kantornya, Jumat (21/5), seputar upaya Pemprovsu mengurangi kemacetan arus lalu lintas di kota Medan. Menurut Darwin, pihaknya berharap MoU bisa diimplementasikan, tidak hanya sekadar wacana. “Dengan kondisi jalan macet saat ini terjadi di

sejumlah titik kawasan di Medan, tentu kita semua mengharapkan hal itu bisa diwujudkan,” ujarnya. Upaya pengoperasi-an angkutan massal itu, tambah Darwin, sudah sangat mendesak, mengingat kawasan di Medan saat ini sudah dipenuhi dengan angkutan kota yang sering membuat macet arus lalu lintas. Ditanya tentang banyaknya organisasi pengangkutan di Medan, Purba mengemukakan, semua organisasi atau perusahaan angkutan tersebut sudah memiliki izin masing-masing. Jadi, Dishub Sumut tidak berwenang untuk menertibkannya. Saat ini, katanya, organisasi angkutan di Medan mencapai

dua puluhan. Diharapkan masing-masing pemilik organisasi tersebutbisamenjagadanmenertibkan anggotanya di lapangan. Terkait perbaikan jembatan Sudirman yang berdampak pada kemacetan arus di beberapa lokasi di Medan, menurut Darwin, perbaikan itu pasti telah dilakukan studi kelayakan secara matang. “Ya, kita berharap semua elemen masyarakat dan warga Kota Medan khususnya pengguna jalan bisa menerima dan memahami perbaikan Jembatan Sudirman itu. Secara teknis orang-orang di Dinas Jalan dan Jembatan sudah memikirkan untuk melakukan perbaikan jembatan Sudirman,” ujar Darwin. (m32)

Mahasiswa Jerman Disuguh Tiwul MEDAN (Waspada): 25 Mahasiswa Universitas Fern, Hagen-Jerman mengunjungi Universitas Negeri Medan diundang khusus oleh Pusat Studi Sejarah dan Ilmu-Ilmu Sosial (Pussis) Unimed, kemarin. Ketika berkunjung ke Jurusan Pendidikan Sejarah, mereka disuguhkan masakan khas Sumatera Utara, seperti ubi rebus, jagung rebus, getuk, serabi, tiwul, cenil, pisang rebus dan lain-lain yang tidak ditemukan

dalam masakan Jerman. “Kami berkesan dengan masakan ini,” ujar seorang mahasiswa Jerman itu. Kepala Pussis Ichwan Azhari mengatakan, maksud kedatangan mereka untuk mempererat silaturahim, menjajaki penelitian kerjasama internasional maupun menjajagi pertukaran peneliti antar Universitas Fern dan Unimed. “Dengan demikian, lanjutnya, mahasiswa Jerman patut diterima

Alumnus Gelar Reuni Akbar SMA Negeri 3 Medan MEDAN (Waspada): Alumnus SMA Negeri 3 Medan menggelar pertemuan akbar, 26 Juni 2010. Reuni akbar kedua ini diharapkan diikuti alumni angkatan 1970-an hingga lulusan 2010. “Tak hanya silaturahmi, reuni akbar ini diharapkan membentuk kegiatan positif pada dunia pendidikan dan pengaktifan kembali Ikatan Alumni SMA Negeri 3,” kata Industrial Silaban, koordinator persiapan. Alumnus 1992 itu mengharapkan, reuni kedua setelah 2007 mampu membentuk suatu wadah yang menunjang mutu pendidikan di Kota Medan, khususnya pendidikan di SMA Negeri 3 Jl. Budi Permasyarakatan, berdiri sejak 1954. Juga kegiatan yang positif bagi alumni dan siswa di SMA Negeri 3. Rangkaian kegiatan, lanjut dia, diisi berbagai aktivitas, diantaranya bakti sosial dan bazar. “Bukan hanya sekadar kumpul-kumpul saja,” ungkap Silaban. Untuk informasi kegiatan dan mendaftarkan diri dapat dilakukan di Sekretariat Ikatan Alumni SMA Negeri 3 Medan di SMA NegerI 3, menghubungi 0811643754 (Industrial Silaban) dan 081378075000 (Dharma Syahputra angkatan 1994), juga melalui jaringan sosial, facebook reuni akbar smuntig medan,” kata Silaban. (m11)

dengan baik, terutama dalam meningkatkan mutu penelitianpenelitian antar universitas,” ujarnya. Setiba di Unimed, rombongan dari Jerman dijamu oleh Pussis dan ketua Jurusan Pendidikan Sejarah. Dalam pertemuan itu, peneliti Pussis Erond Damanik menyampaikan profil Fakultas Ilmu Sosial, Pussis dan jurusan Pendidikan sejarah dalam Bahasa Inggris. Sedangkan Ichwan mengarahkan kerangka kerja jangka panjang Pussis dalam Bahasa Jerman. Selain menyantap masakan khas Sumatera Utara, mahasiswa Jerman ketika mengunjungi Jurusan Sejarah, melihat dari dekat kondisi ruangan, fasilitas dan mahasiswa serta kondisi tenaga pengajar di jurusan tersebut. Mereka juga sempat mengunjungi Lembaga Penelitian Unimed yang diterima oleh Eddyanto, sekretaris lembaga itu. Pimpinan rombongan dari Universitas Fern Hagen Jerman, yakni Prof. ReinhardWendt mengemukakan, tujuan kunjungan ini untuk mempererat kerjasama penelitian internasional. Selain itu melihat dari dekat kondisi Sumatera Utara yang banyak ditulis dalam literatur sejarah di Jerman. Sebagai hasil kerjasama, lanjutnya, pihak

Universitas Fern Hagen Jerman akan mengundang dan membiayai penelitian Kepala Pussis Ichwan Azhari untuk melakukan penelitian selama tiga bulan di Jerman, terutama untuk mengupas keberadaan Islam di Sumatera Utara sebelum kedatangan missionaris Jerman. Penelitian itu akan dilaksanakan pada September tahun 2010. Sementara Erond Damanik mengemukakan rombongan dari Jerman tidak saja mengunjungi Pussis tetapi juga meninjau beberapa lokasi perkebunan yang ada di Sumatera Utara, bangunan bersejarah di Kota Medan, mengunjungi Parapat dan Pulau Samosir. Minggu (23/ 5), rombongan berangkat ke Pulau Jawa dan Indonesia Timur lainnya. Erond menambahkan dalam rombongan, di samping mahasiswa dari Universitas Fern Jerman, juga terdapat Irene Girsang, yakni utusan Vereingte Evangelical Mission (VEM) yang menangani bidang perempuan. Dari Irene diketahui arsip tentang Sumatera terutama sejarah, kebudayaan, dan catatancatatan tentang Batak banyak sekali terdapat di Perpustakaan UEM (dahulu RMG) di Wupertal, Jerman. (m15)

Lulusan SMP Mulai Jajaki SMA MEDAN (Waspada): Para lulusan SMP sederajat sudah mulai mencari informasi tentang keberadaan sekolah lanjutan atas yang menurut mereka cocok untuk melanjutkan sekolah. Ada yang melirik sekolah negeri, banyak juga yang memilih sekolah swasta. Infromasi itu terasa sangat penting, guna memastikan apakah mereka bisa diterima di sekolah itu, atau mampukan mereka mengikuti program dan peraturan yang dicanangkan pihak sekolah. Seperti terlihat Jumat (21/5) sejumlah orangtua siswa mendatangi SMA Harapan Jalan Imam Bonjol Medan. Asnida, 44, yang ingin menyekolahkan anaknya di sekolah itu tampaknya harus berpikir keras agar putrinya, Wina, bisa masuk. Pasalnya, pendaftaran sudah dimulai sejak awal

Mei lalu. Sedangkan dia belum mendapatkan infromasi sepenuhnya tentang kreteria penerimaan di sekolah yang disebutsebut bergengsi di Medan ini. “Saya kira seperti sekolah swasta yang lain, bisa mendaftar setelah pengumuman di sekolah negeri selesai. Saya ingin juga dia sekolah negeri, tapi swasta perlu juga untuk cadangan kalau di negeri tidak lulus. Eh, taunya pendaftaran sudah lama. Ini saya masih mau bertanya ke yayasan, masih bisa enggak ya,” kata Asnida. Sementara itu, Kepala Sekolah SMA Sofyan Alwi menyebutkan, masa pendaftaran di sekolah ini sudah dimulai sejak awal Mei lalu. Calon siswa yang berasal dari sekolah lain akan mengikuti testing, nilai yang dicapai harus 7,0. Hal itu utuk menyesuaikan rencana nilai Kriteria Ketuntasan Minimal

(KKM) yang jumlahnya mencapai 7,5. Sedangkan bagi siswa yang berasal dari sekolah tersebut tidak disertakan testing. Tahun ini pihaknya hanya menerima siswa sebanyak 220 siswa baru. Jadi model Di tempat terpisah, sekolah negeri seperti SMAN 3 Medan melalui Wakil Kepala Sekolah Emir Harahap membenarkan orangtua siswa sudah mulai mencari informasi penerimaan siswa baru. Namun, kata dia, belum bisa memberikan informasi penerimaan siswa baru karena petunjuknya belum diterima dari Dinas Pendidikan Kota Medan. Namun, lanjut Emir, saat ini SMAN 3 sudah termasuk sekolah negeri yang ditunjuk sebagai sekolah model. “Sekolah model adalah kelanjutan dari program pemerintah tentang sekolah rintisan

(SSN) yang mendapat bantuan dari dana block grant. Kriteria sekolah model adalah sekolah tersebut memiliki fasilitas laboratorium (Fisika, Kimia, Biologi) dan laboratorium komputer. Disamping itu guru-guru pengajar di sekolah tersebut dinilai memiliki kualitas mengajar yang baik. Hal itu ditandai dengan prestasi belajar dari siswa,serta yang paling penting lagi bahwa sekolah tersebut memiliki karakter kepemimpinan yang kuat serta kemampuan managerial. Dia menambahkan, sekolah model tersebut serta merta dijadikan sekolah Pusat Sumber Belajar (PSB) bagi sekolah yang lain di wilayahnya.“Nah, kenapa SMAN 3 Medan terpilih sebagai sekolah model? Tentunya ini didasarkan kepada keputusan dan penilaian dari Direktorat Dikdasmen (DEPDIKNAS),” ujarnya. (m36)

Mery Kirana Doyan Masakan Mandailing dua hari,” katanya sembari BAGI Mer y Kirana, tersenyum. datang ke kota Medan seKepada Waspada, Mery akan tak lengkap tanpa pun bercerita perjalanan wisata kuliner. Karena itu, karirnya hingga kini menjadi walau baru dua kali mengmodel dan bintang iklan. injak Medan, kesempatan Awalnya, dia masuk ke tersebut betul-betul tak disiadunia modeling lewat suatu siakan bintang iklan Honda ketidaksengajaan ketika Vario ini untuk mencoba masih duduk di bangku SMP. aneka jenis kuliner. Saat itu, anak sulung dari Lantas, dari seluruh dua bersaudara ini diajak makanan khas Medan, apa temannya untuk mengikuti yang paling disukai gadis fashion show di salah satu berkulit putih ini? Ketika hal itu ditanyakan Waspada seSMP di Jakarta. Sejak itulah, dia mulai suai acara pelantikan pengumerasa tertarik dengan rus Persatuan Wartawan dunia modeling. Sayang, Indonesia (PWI) Sumut peWaspada/Surya Efendi minatnya tersebut mendapat riode 2010-2015 di Selecta PINTAR NYANYI: Selain menjadi MC, Mery Kirana ternyata tentangan dari kedua orang Building, Jumat (21/5) malam, Mery dengan cepat juga pintar nyanyi. Mery pada malam pelantikan pengurus PWI tuanya yang menginginkan menyebut masakan dengan Sumut di gedung Selecta, Jumat (21/5) malam, sempat berduet Mery fokus saja ke pendidikannya. “Makanya, karir lauk daun ubi tumbuk dan dengan Kadis Kesehatan Sumut dr Edwin Effendi. saya di modeling sempat terhenti karena orang tua ingin saya ikan sale. “Itu saya rasa enak sekali dan tidak ditemukan di daerah fokus sekolah hingga kuliah. Dan setelah tamat kuliah, baru lain di Indonesia. Pokoknya, maknyus bangetlah,” ujar presenter orang tua mengizinkan saya aktif ke dunia modeling dan iklan,” jelas gadis berambut sebahu yang juga pernah membintangi MNC Music Channel ini. Saat disebut itu merupakan masakan khas Mandailing, iklan Mandiri Fiesta dan Sunsilk ini. Hmmm.. dalam dua kali kunjungannya, lantas bagaimana alumni London School Jakarta ini pun mengaku tak tahu. “Oohh.. itu namanya masakan Mandailing yah? Tak tahu saya, kesannyasoalcowok-cowokdanduniamalamMedan?“Sayabelum mas, tapi yang jelas rasanya punya ciri khas tersendiri,” timpal tahu. Makanya saya ingin coba neh,” katanya sembari tergelak. Hanya, dia mengaku bangga dengan Gubernur Sumatera gadis kelahiran Bandung, 30 Maret 1979 ini. Wajar jika Merry belum tahu banyak soal Sumatera Utara. Utara, Syamsul Arifin, yang menurutnya sangat merakyat. Hal Maklum, dia baru dua kali datang ke Medan. Pertama pada itu dinilainya setelah mendengar Syamsul menyampaikan Februari lalu dalam rangka jalan-jalan, dan kedua saat kata sambutan pada acara pelantikan tersebut. “Orangnya diundang PWI Sumut menjadi master of ceremony (MC) pada lucu dan ngomongnya blak-blakan. Sangat sedikit pejabat acara pelantikan. “Sebenarnya saya ingin sekali jalan-jalan di negeri ini yang bisa seperti itu, tidak birokratis dan tidak ke Berastagi dan Danau Toba, tapi sayangnya saya tidak punya jaim,” tandasnya sembari mengaku cukup senang berfoto waktu banyak di sini. Dalam dua kali ke mari, saya hanya bisa bersama Gubsu. (Rahmad Nur Lubis)

Waspada/David Swayana

Sebagian alumni SMK Eria diabadikan bersama Wakil Koordinator Perguruan Eria Drs. H. Rukzaidan, MM dan sejumlah guru pada acara Reuni Akbar yang berlangsung di aula Perguruan Eria, Minggu (23/5).

Ikatan Alumni SMK Eria Harus Miliki Program Kerja MEDAN (Waspada): Organisasi Ikatan Alumni Sekolah Menengah Kejuruan (SMK) Eria yang telah diprakarsai dan akan dibentuk dalam waktu dekat, kiranya harus memiliki program kerja yang jelas. Demikian ditegaskan Wakil Koordinator Perguruan Eria Drs. H. Rukzaidan, MM dalam sambutannya pada Reuni Akbar SMK Eria di aulaYayasan Pendidikan Ani Idrus (YPAI) Perguruan Eria Medan, Minggu (23/5). Menurut Rukzaidan, program kerja dimaksud harus bersifat realistis dan bermanfaat bagi keluarga besar alumni SMK

Eria. Bahkan, tidak tertutup kemungkinan program kerja dimaksud dapat dirasakan manfaatnya oleh pihak SMK Eria selaku sekolah asal para alumni tersebut. Selain itu, Rukzaidan mengharapkan para alumni SMK Eria dapat memanfaatkan Reuni Akbar ini sebagai momentum untuk lebih meningkatkan silaturahmi. “Jadi, jalinan silaturahmi tersebut harus lebih dipererat baik di antara sesama alumni maupun antara alumni dan SMK Eria,” ujarnya. Sementara itu, Aswin Bancin selaku perwakilan alumni

mengatakan, Reuni Akbar tersebut tidak hanya sekedar bersilaturahmi antara sesama alumni dan antara alumni dengan SMK Eria. Namun, Reuni Akbar tersebut dapat dijadikan momentum untuk pembentukan Ikatan Alumni SMK Eria. “Dengan adanya organisasi Ikatan Alumni SMK Eria, maka jalinan silaturahmi antara sesama alumni menjadi lebih erat. Bahkan, dapat membentuk hubungan kemitraan dengan SMK Eria,” ujar Aswin. Di penghujung acara, Ketua Panitia Reuni Akbar SMK Eria

Jauhar Sabani mengumumkan terbentuknya Tim Formatur untuk memilih dan menyusun kepengurusan Ikatan Alumni SMK Eria. Adapun komposisi Tim Formatur tersebut antara lain, Jauhar Sabani, Budi Ichsan, Dinda Faradilla, Fauziah Hanum, Juli Parla, Kurnia Syahputra, Rahmad Hidayat, Aswin Bancin, David Swayana, Azhari, Anjasmara dan lain-lain. Acara Reuni Akbar yang dihadiri ratusan alumni SMK Eria tersebut diakhiri dengan foto bersama para guru. (m26)

Mahasiswa Akper-Akbid Imelda Jadi Agen Anti Narkoba MEDAN (Waspada): Mahasiswa Akademi Keperawatan (Akper) dan Akademi Kebidanan (Akbid) Yayasan Imelda Medan dinobatkan menjadi agen anti narkoba oleh Badan Narkotika Nasional (BNN). Tujuannya, untuk mendukung program pemberantasan narkoba yangdilaksanakanPolridanBNN. Polri dan BNN menilai mahasiswa khususnya yang berasal dari sekolah kesehatan, merupakan salah satu tolok ukur keberha-silan program agen anti narkoba dan akan

diteruskan hingga ke tingkat masyarakat awam. Demikian dikatakan Kepala Pelaksana Harian BNN Kabupaten Asahan AKBP Zahara didampingi AKBP Mansyur Ginting dan Kompol HM Dalimunthe dari Dit Narkoba Polda Sumut yang mewakili BNN Prov Sumut kepada wartawan, Jumat (21/5), usai menjadi pembicara pada sosialisasi UU No 35 Tahun 2009 di aula RSU Imelda Pekerja Indonesia (RS IPI) Medan. “Seorang tenaga kesehatan

seperti mahasiswa Akper/ Akbid, harus ditempa menjadi seorang agen anti narkoba dalam membantu tugas-tugas Polri maupun BNN. Ini sebagai wujud sosialisasi ketentuan pidana UU Nomor 35 Tahun 2009 tentang Narkotika,” kata Zahara. Dalam sosialisasi ini, lanjut Zahara, pihaknya menyematkan pin BNN kepada beberapa mahasiswa, pihak yayasan dan staf pengajar sebagai agen anti narkoba di lingkungan sekolah kesehatan tersebut. Sementara itu, Sekretaris

Yayasan Imelda Medan Suheri P Gultom mengatakan, kerjasama antara BNN-Polda-Yayasan Imelda Medan merupakan wujud kepedulian yayasan dalam memberantas masalah narkoba. “Pihak yayasan bersikap tegas terhadap mahasiswa yang tersangkut dengan masalah narkoba. Kita akan memberikan sanksi skorsing selama mahasiswa tersebut menjalani pemeriksaan di kepolisian. Jika keterlibatannya terlalu jauh, maka akan kita keluarkan dari sekolah ini,” tegas Gultom.(m26)



WASPADA Senin 24 Mei 2010

Momen Lanjutan Lorenzo LE MANS, Perancis (Waspada): Pembalap Fiat Yamaha, Jorge Lorenzo (foto), melanjutkan momen terbaiknya di ajang balap motor MotoGP setelah memenangkan MotoGP Perancis di Sirkuit Le Mans, Minggu (23/5).


Rajon Rondo tampil memukau bagi Boston Celtics yang kini sudah memimpin 3-0 atas Orlando Magic.

Satu Kaki Celtics Sudah Di Final BOSTON, AS (Waspada): Tampil nyaris tanpa catat sejak menit pertama, Boston Celtics kembali menunjukkan ketangguhannya usai menumbangkan Orlando Magic 94-71 di game ketiga final NBA Wilayah Timur, Minggu (23/5). Usai Celtics mengalahkan Magic di kandangnya pada dua game awal, ternyata Magic belum bisa membalas kekalahannya di kandang Celtics dan harus mengakui kehebatan Ray Allen cs. Pada kuarter pertama, Celtics mampu membuka pertandingan dengan membuat Magic tertegun atas ketertinggalan poin yang cukup jauh, 27-12. Meski di kuarter kedua, Magic mencoba memperkecil ketinggalan, Dwight Howard cs harus gagal hingga akhir yang hanya tertinggal dua poin. Selama pertandingan, Celtics memang memimpin di tiga kuarter dan hanya tertinggal di kuarter keempat 19-24. Hingga laga usai, Celtics memastikan kemenangan ketiga atas Magic, 94-71. Jika pada game keempat, Selasa (25/5), Celtics kembali menang, maka dipastikan skuad Glen Doc Rivers itu untuk kedua kali dalam tiga musim terakhir tampil di babak final wilayah. Kalau lolos, Paul Pierce dan kawan-kawan akan bertemu pemenang final Wilayah Barat antara LA Lakers atau Phoenix Suns. Sementara ini, Lakers tengah unggul 2-0. Sejarah juga mencatat, tidak pernah ada tim yang pada akhirnya kalah setelah memenangi tiga game pertama di babak playoff. Celtics 10 kali membuka partai playoff dengan 30 di mana: empat kali melakukan sapu bersih dan enam kali memenanginya dalam lima game. Trio bintang Celtics, Paul Pierce, Ray Allen dan Garnett tetap bermain inspiratif untuk timnya. Pierce mencetak 15 poin dan sembilan rebound, Allen menambahkan 14 angka dan Garnett mendulang 10 angka dalam waktu 24 menit. Di luar tiga pemain senior itu, Glen “Big Baby� Davis dan Rajon Rondo menampilkan permainan memukai. Kedua pemain yang lahir di tahun 1986 itu, tahun ketika Larry Bird membawa Celtics kali terakhir menjadi juara NBA, bermain penuh energi dan menawan. Davis menjadi top skor tim dengan 17 angka dan Rondo mendonasikan 11 poin 12 assist. Dari kubu Magic, hanya tiga pemain yang mencetak skor dua digit, yakniVince Carter (15), Jameer Nelson (15) dan Mickael Pietrus (12). Dwight Howard tampil melempem dengan hanya menghasilkan tujuh poin dan tujuh rebound. (m33/ap)

Kuznetsova Bangkit, Azarenka Tumbang PARIS (Waspada): Svetlana Kuznetsova bangkit dari awal yang buruk untuk mengawali pertahanan gelarnya di Perancis Terbuka dengan kemenangan 6-3, 6-1 atas petenis Rumania Sorana Cirstea, Minggu (23/5). Unggulan keenam asal Rusia itu kehilangan tiga game pertama sebelum mendapatkan kembali penampilan terbaiknya untuk menyingkirkan petenis peringkat 34 dunia tersebut di lapangan utama. Pada pertandingan lain, petenis Argentina Gisela Dulko menang mudah 6-1, 6-2 atas Victoria Azarenka (foto) asal Belarus. Selain itu, petenis Perancis Aravane Rezai ikut meloloskan diri ke babak kedua usai mengalahkan Heidi El Tabakh (Kanada) 6-1, 6-1. Para unggulan lain yang lolos tanpa hambatan di antaranya adalah Dominika Cibulkova (Slowakia), Maria Kirilenko (Rusia) dan Flavia Pennetta (Italia). Nasib sial justru dialami Maria Jose Martinez (Spanyol) yang tumbang di tangan petenis A. Amanmuradova 2-6, 4-6. Di bagian putra, petenis Swedia Robin Soderling juga melangkah pasti berkat keberhasilannya menuntaskan perlawanan petenis tuan rumah Laurent Recouderc 6-0, 6-2, 6-3. Unggulan kelima tersebut nyaris menang tanpa keringat dikarenakan Recouderc sempat meminta pertolongan medis untuk mengatasi nyeri di tangan kanannya. Petenis Latvia yang tengah naik daun, Ernest Gulbis, kali ini tak berdaya melawan cedera yang menimpanya kala melawan Julien Benneteau (Perancis). Gulbis kalah 4-6, 2-6, 0-1. Unggulan ke-10 Marin Cilic (Kroasia) mendampingi Soderling setelah meng-akhiri kiprah petenis Brazil Ricardo Mello 61, 3-6, 6-3, 6-1. (m33/ap)


Hasil ini merupakan sukses kedua beruntun rider Spanyol ini menjuarai seri balapan, setelah dua pekan sebelumnya merebut kemenangan di Spanyol. Bagi Lorenzo, hasil ini sekaligus memperpanjang gelar di Le Mans, karena tahun lalu juga menjadi kampiun dalam balapan yang diwarnai hujan itu. Lorenzo mengatasi perlawanan rekan setimnya peraih pole position, Valentino Rossi, guna menjuarai MotoGP Perancis dengan waktu 44 menit 29,147 detik selama 28 putaran. Rossi, awalnya sempat memimpin lomba dan bertarung ketat dengan Lorenzo dan Dani Pedrosa di posisi ketiga, namun selepas 10 lap tertinggal jauh dari Lorenzo. Di paruh kedua. Lorenzo sudah tak menemui lagi perlawanan dan melenggang menyentuh garis finish dengan keunggulan 5,6 detik di depan Rossi. Podium ketiga diisi rider Repsol Honda Andrea Dovizioso yang melewati Pedrosa


di lap terakhir. Pedrosa malah hanya finish kelima, karena

dilewati pembalap Ducati asal AS Nicky Hayden.

Hasil MotoGP Perancis Jorge Lorenzo Valentino Rossi Andrea Dovizioso Nicky Hayden Dani Pedrosa Marco Melandri Randy de Puniet Hector Barbera Aleix Espargaro Marco Simoncelli Hiroshi Aoyama Colin Edwards Mika Kallio

(Spanyol/Fiat Yamaha) (Spanyol/Fiat Yamaha) (Italia/Repsol Honda) (AS/Ducati Marlboro) (Spanyol/Repsol Honda) (Italia/Honda Gresini) (Perancis/LCR Honda) (Spanyol/Aspar Ducati) (Spanyol/Pramac Racing (Italia/Honda Gresini) (Jepang/Interwetten Honda) (AS/Yamaha Tech 3) (Finlandia/Pramac Racing)

44:29.114 44:34.786 44:36.986 44:38.46 44:41.727 44:51.032 44:58.402 45:02.242 45:02.607 45:02.919 45:03.46 45:06.237 45:24.175

Andalan Ducati lainnya, Casey Stoner, sempat terlibat duel di awal lomba namun keluar arena karena terjatuh saat balapan memasuki putaran kedua. Kemenangan ini membuat Lorenzo jauh meninggalkan Rossi dengan koleksi 70 poin selepas tiga seri.

Rossi sementara berada di tempat kedua dengan 61 poin dan Dovizioso (42) merebut posisi ketiga sekaligus menggeser Pedrosa. Lewat hasil di Perancis ini, Lorenzo kini mencuat menjadi favorit kuat juara dunia 2010 menggantikan The Doctor. Mantan rider MotoGP, Toni

Elias dari Spanyol menjuarai kelas Moto2 setelah mengatasi tantangan Julian Simone (Perancis). Di kelas 125 cc, gelar juara dibawa pulang pembalap Pol Espargaro yang mencatat kemenangan kedua beruntunnya musim ini. (h09/ap)


WASPADA Senin 24 Maret 2010

Sabam Siagian Bercerita Oleh Rosihan Anwar


ANGGAL 10 Mei 2010 wartawan senior Rosihan Anwar genap berusia 88 tahun alias sebelas windhu. Peristiwa itu di-pesta-in oleh teman-temannya dari dunia jurnalistik bertempat di Hotel Santika Jakarta. Pada kesempatan itu wartawan Kompas Jakob Oetama membuka pertemuan dengan menjelaskan kedudukan Rosihan Anwar dalam sejarah kewartawanan Indonesia. Sabam Siagian Redaktur Senior & Direktur harian The Jakarta Post atas permintaan hadirin memberikan sambutan pula. Pada awal tahun 1950an, demikian kata Sabam, setiap pagi sekitar jam 9 sebuah station wagon harian Pedoman lewat rumah keluarga Pendeta Siagian di daerah Kwitang. Rupanya menjemput salah seorang staf redaksi. Di sebelah supir duduk Rosihan Anwar, pemimpin redaksi Pedoman. Raut mukanya dan pantulan wajahnya cenderung menggambarkan arogansi (kesombongan) seorang intelektual yang tidak menghiraukan lingkungan sekelilingnya. Sore hari mobil Pedoman itu lewat rumah kami mengantar seorang staf redaksi dan tokoh di depan sebelah supir nampak letih, tenggelam dalam dunia pemikirannya. Esok paginya kita bacalah tajuk rencana di harian Pedoman dengan logika yang tersusun rapi, gaya penulisan yang lancar, dibumbui sarkasme. Dan konklusi tajam bagaikan panah yang telak kena sasaran. Emil Salim pada tahun-tahun itu Ketua Dewan Mahasiswa UI sering mencek temanteman dekatnya. “Bung sudah baca tajuk Pedoman tadi pagi. Apa pendapat Bung ?”. Malulah awak kalau belum membacanya. Sosok seorang pemimpin redaksi yang berpandangan luas, agak alof bersikap independen, menulis yang kena sasaran, sosok demikian agaknya direkam radar ingatan saya. Dan ditanam benih cita-cita ingin jadi Pemred. Meskipun baru kemudian melalui jalan berliku dan faktor situasi saya masuki profesi jurnalistik, kata Sabam Siagian. Memang sudah merupakan label (merek, cap) yang melekat pada diri Bung Rosihan sebagai seorang tokoh jurnalistik yang tidak begitu sabar melihat rekan yang setengah jadi bobot intelektualismenya, dan cenderung arogan. Lain sekali, umpamanya, siapa yang pernah mengenal almarhum Mochtar Lubis. Itu saya alami ketika diikutsertakan dalam kelompok redaktur yang meliput kunjungan Jenderal Sumitro, panglima komando pemulihan keamanan dan ketertiban, dan Jaksa Agung Ali Said ke Pulau Buru, kamp tahanan politik (tapol) pada bulan Oktober 1973. Ada Rosihan Anwar dari Pedoman, Mochtar Lubis dari Indonesia Raya, Jakob Oetama dari Kompas, Tengku Hafas dari Nusantara, saya paling junior, baru beberapa bulan di Sinar Harapan. Bung Rosihan sekali-sekali tegur saya meskipun tidak begitu akrab. Nasib saya masih lumayan. Ada rekan dari harian Merdeka yang seperti dicuekin. Mungkin karena dia tahu almarhum Soedjatmoko, teman akrab Bung Rosihan, mengenal saya sejak di Amerika Serikat. Mochtar Lubis yang pernah berkunjung ke New York, setelah koran Indonesia Raya terbit kembali tahun 1967 dan mengajak saya ke restoran, sikapnya segera merangkul. “Back slapping” kata orang Amerika “Bung sudah dapat ampelop ?”. Kalau belum, pakai punya saya” ujar Bung Muchtar sepontan. “Ampelop?”. Sebagai orang masih hijau di dunia kewartawanan Orde Baru, saya terheran-heran. Pada suatu pagi ketika kami sedang duduk-duduk di depan losmen penginapan di pulau Buru kebetulan lewat seorang pria agak kurus, selalu dengan senyum kecil. “Ah, itu orangnya. Kasir Kejaksaan Agung. Minta dari dia” kata Bung Rosihan. Sebagai yang yunior, maka saya uberlah si juru bayar itu. Tidak terbayang bahwa seorang wapemred menguber seorang juru bayar termasuk cakupan kegiatan. Tapi ini Indonesia. Kembali ke Jenderal Sumitro, Januari 1974. Perdana Menteri Tanak dari Jepang datang. Pecahlah huru hara. Peristiwa Malari. Sejumlah koran dibreidel. And Pedoman is no more. Tapi Bung Rosihan tetap menulis.Terus menulis. Ia tetap memantau peristiwa. Memilihmana yang perlu dikomentari. Dan lahirlah tulisannya. Kita dapat bagadang semalam suntuh di sini, bercerita tentang berbagai episode dalam hidup Rosihan Anwar, seperti para nelayan yang suka cerita pengalaman mereka di laut terbuka, sering dilebih-lebihkan. Tapi pertanyaan utama tetap mengiang: Rosihan Anwar, apa sebenarnya inti kepribadiannya? Apa DNA karakternya, meminjam istilah dari biokimia kedokteran ? Sepintas lalu dia dianggap aloof (sikap menyendiri, menjauhkan diri), arogan (congkak), sarkastis (mulut tajam). Terhadap semua label (etiket, nama) itu, yang bersangkutan sendiri seperti tidak keberatan. Mungkin dia berlindung di balik label itu. Menyembunyikan DNAnya. Saya sendiri agaknya baru sadar akan watak sebenarnya Rosihan Anwar akhir-akhir ini, setelah begitu lama mengklaim mengenalnya. Ceritanya begini. Pada hari Idul Fitri tahun lalu saya berkunjung ke Jalan Surabaya 13 untuk ber-lebaran ke keluarga Rosihan Anwar. “Ini Bung tulisan saya tentang Sjahrir. Baru selesai, sudah saya kirim ke redakturnya di Negeri Belanda” kata tuan rumah, demikian Sabam Siagian. (+++)

Dedi Sahputra


Isratine Muammar Al-Gadhafi adalah sebuah anti klimaks. Mungkin ia merasa letih. Isratine, katanya singkat dalam judul buku putihnya. Ini sebuah ide “perdamaian” Palestina-Israel dengan cara menggabungkan kedua bangsa dalam satu negara menjadi Isratine (Israel-Palestine). Tak terdengar lagi sorak garangnya. Serang, hancurkan, usir Israel, sang penjajah di abad moderen. ’’Bawa saja mereka (Israel) ke Alaska...Mereka bisa hidup damai di tempat yang terisolasi seperti itu,” ujar Khadafi lantang suatu waktu melalui video conference yang disampaikannya kepada pelajar Georgetown University awal 2009 lalu. Tapi semangat dan seruan perang itu sudah terdengar lamat-lamat. Kini bahkan jadi sumir. Karena bunyinya sudah berubah menjadi seruan ”berdamai” dengan Yahudi. Kalau Gadhafi itu orang Medan, kira-kira bahasanya begini; ’’Ya uda-la, kalau berantem terus gak siap-siap, jadikan satu negara aja. Kok payah kali.’’ Tidak seperti biasanya, gagasan patriotik mengusir Israel dari tanah jajahan itu selalu sampai melalui pesan komunikasi massa. Tapi kali ini lebih masif. Pake seminar segala, dengan pembicara internasional lagi. Anda bisa memaknainya apa saja, bisa merupakan sosialisasi, sebagai upaya mendapatkan dukungan atas usulan itu, sebuah upaya sistimatis untuk merasionalkan kemenangan Israel atau apa saja. Rasional..? Tentu saja, coba lihat sekarang, betapa jauhnya tanah Palestina itu dijajah, betapa terisolasinya warga Palestina itu dan betapa lemahnya ”lautan” warga Arab di kelilingnya, juga umat Islam pada umumnya. Betapa canggihnya Israel itu. Mereka-lah satu-satunya negara di kawasan Arab yang anteng-anteng aja meski punya cadangan senjata berhulu ledak nuklir. Maka sangat rasional-lah ide menggabungkan kedua negara itu. Yang penting damai, karena cara kekerasan hampir mustahil untuk mengusir Israel. *** Lelaki tua itu menangis sedih. Tatap matanya menerawang jauh juga basah air mata. Di hadapannya jasad seorang remaja yang masih hangat; baru saja tewas dibunuh tentara Israel. Dua anaknya yang lain sudah lebih dulu syahid di tangan bangsa Yahudi itu. Kini semua anaknya sudah tewas. Tapi bukan itu yang disedihkannya. Dengan tubuh yang tua renta, dia tidak sanggup lagi berjihad mengangkat senjata mengusir pasukan zionis. Dan kini, dia tidak lagi

punya anak yang bisa dikirim ke medan jihad menjemput syahidnya. Sungguh ini suatu kepiluan mendalam.. Bagi orang tua ini, penjajahan oleh Bani Israil itu adalah medan jihad. Seperti buah ranum bagi orang shaleh untuk memetik syahid. Bukan tujuan akhir perjuangan yang menjadi bebannya, tapi proses yang dijalaninya itulah yang menjadi tugasnya. Begitulah cara orang beriman melihat berbagai peristiwa di bumi ini. Semuanya bermuara kepada Allah SWT. Ujiannya adalah tsiqoh kepada Allah. Standar berhasil-gagalnya sebuah perjuangan bukan diukur dari tercapai tidaknya sebuah rencana. Tetapi adalah bagaimana untuk tetap istiqomah dalam perjuangan di jalan-Nya. Karena orang beriman tidak disibukkan oleh hasil. Dia menyadari dengan seluruh keyakinannya bahwa hasil usaha bukanlah ranahnya, tetapi domain-nya Tuhan Sang Maha Penentu. Tapi tidak jarang orang lelah dalam perjuangannya, sehingga melupakan kewajiban berusaha yang melekat dalam dirinya. *** Begitulah hidup. Selalu berganti ulasan, wacana dan berbagi duka serta kegembiraan. Kalau ingat Masjidil Haram, hati senang, rindu ingin ke sana. Tapi kalau ingat Masjidil Aqsa yang “digerogoti” terus oleh Israel, hati jadi miris. Subhanallazi asra bi’abdihi laylan minal-masjidil-harami ilal-masjidil-aqsha (Maha Suci Allah, yang telah memperjalankan hamba-Nya pada suatu malam dari Masjidil Haram ke Masjidil Aqsa) (Q.S.17:1). Jadi hidup itu bolak-balik, Masjidil HaramMasjidil Aqsa, senang-sedih, menang-kalah, muda-tua, cantik-jelek dan seterusnya. Semua terjadi dalam kegelapan (di malam hari). Artinya kita tidak tahu apa yang bakal terjadi, semuanya serba gelap. Satu-satunya ukuran yang mungkin adalah, suatu hasil selalu berkorelasi dengan derajat upaya. Jadi kalau Anda giat berusaha Anda bakalan kaya, kalau rajin belajar bakalan pintar dan seterusnya. Anda pasti dibilang tukang ngayal kalau pinginnya jadi bos banyak uang tapi malas berupaya. Pak Belalang. Namun tetap saja, Anda tidak bakal tahu berapa banyak dagangan laku hari ini, berapa sisa uang setelah setoran Angkot lunas, atau siapa yang bakal nelpon ngasih job hari ini. Karena kegelapan itu tanpa batas. Tapi Allah kasih kuncinya, Fa-inna ma’al-’usri yusran, kesulitan itu selalu beriringan dengan kemudahan (Q.S.94:56). Jadi saya rasa cukup jelas bahwa tidak ada alasan untuk merasa letih melawan Israel.


Aceh Kaya Energi, Miskin Listrik ? Oleh Drs Muhammad Syukri M.Pd Di Aceh sumber daya air berlimpah dan pemanfaatan energi air bukanlah teknologi yang sangat rumit


i era moderen saat ini, energi listrik telah menjadi sebuah kebutuhan primer, di samping sembilan bahan pokok lainnya. Kebutuhan energi listrik bukan hanya monopoli masyarakat perkotaan, tetapi kebutuhan hari-hari seluruh masyarakat, termasuk di perdesaan. Sayang, stabilitas arus listrik untuk para konsumen di tanah air belum memuaskan. Di samping voltasenya yang tidak stabil, listrik sering padam. Bagi mereka yang menggantungkan usahanya dari listrik, pemadaman sangat merugikan produktivitas usaha termasuk meluluhlantakkan peralatan elektronik masyarakat. Belum lama ini, sebuah LSM internasional menghimbau masyarakat dunia untuk mematikan lampu selama satu jam pada 27 Maret 2010 sejak pukul 20.30 sampai 21.30. Bagi beberapa kota besar di tanah air, gerakan ini mendapat respon cukup baik, karena kontinuitas energi listriknya sangat optimal alias hampir tidak pernah terjadinya pemadaman. Sebaliknya, gerakan ini terasa kurang relevan dengan kondisi kelistrikan Aceh yang masuk kelas byar-pet. Tanpa kenal waktu, tanpa kenal hari, tiba-tiba lampu bisa padam untuk jangka waktu yang relatif lama. Sebelum gerakan Earth Hour dicanangkan, jutaan masyarakat di Aceh hampir setiap hari ”dimatikan” lampunya oleh sebuah Badan Usaha Milik Negara yang bernama PLN. Inilah sebuah ironi yang dialami negeri kaya energi tetapi miskin listrik. Pada gilirannya, gerakan mematikan lampu selama satu jam (Earth Hour) bukan lagi sebuah kesadaran, melainkan sebuah ketidakberdayaan konsumen energi listrik di Aceh. Kaya sumber energi Saat kita mulai menyadari Aceh termasuk sebuah wilayah kaya sumberdaya energi. Maka ironis manakala rakyatnya tidak memperoleh energi listrik dengan sempurna. Siapapun, bahkan masyarakat dunia mengetahui jika di wilayah Aceh Utara maupun Aceh Timur tersedia cadangan sumber energi berupa gas alam cair dan minyak bumi yang cukup besar. Bahan bakar yang digunakan menggerakkan pembangkit listrik tenaga diesel, sehingga sangat tidak beralasan jika Pembangkit Listrik Tenaga Diesel (PLTD) milik PLN akan kekurangan daya menyuplai energi listrik. Konon lagi, PT. Arun NGL memiliki delapan unit Pembangkit Listrik Tenaga Gas (PLTG), namun yang digunakan untuk operasional BUMN ini hanya enam unit. Dengan demikian, terdapat dua unit PLTG dalam keadaan menganggur. PLTG yang menganggur ini, kata Zulkifli Manajer PT. PLN Aceh, memiliki kapasitas 2 x 20 MW (Serambi Indonesia, 23 Desember 2009). Selain sumberdaya energi yang berasal dari hidrokarbon, di Aceh terdapat sumber energi berupa aliran air yang mengalir melalui beberapa sungai besar. Hulu sungaisungai besar ini umumnya berada di kawasan pedalaman Aceh, seperti Geum-

pang dan Tangse-Pidie, Bener Meriah, Aceh Tengah, Gayo Lues dan Aceh Tenggara. Sungai-sungai besar itu antara lain: Sungai Woyla,Teunom,Tripa, Meureudu, Peusangan, Kluet, Pase, Jambu Aye, Lawe Alas, Peureulak, Simpang Kiri dan Sungai Simpang Kanan. Selain sungai-sungai besar itu, masih terdapat sungai kecil, alur (alue), dan parit-parit berair deras yang cukup potensial membangkitkan energi listrik skala kecil, antara 1 sampai 2,5 KW. Air yang mengalir melalui sungai-sungai tersebut belum sepenuhnya dimanfaatkan untuk sumber energi, paling-paling hanya digunakan untuk pengairan atau sumber air baku. Sebagian besar anugerah AllahYang Maha Pemurah ini mengalir begitu saja ke lautan lepas, menyatu dengan air asin di Samudera Hindia maupun Selat Malaka. Kalau dihitung-hitung sangat banyak s u m b e r e n e rg i yang terbuang percuma dari triliunan liter air yang mengalir ke laut setiap detiknya, karena tidak termanfaatkan. Mencermati fakta ini, sepertinya kita belum mampu melihat air sebagai rahmat yang bisa diolah menjadi nikmat yang berupa sumber energi listrik. Mungkin, dan boleh jadi, karena wilayah Aceh ini terlalu berlimpah rahmat sehingga membuat semua orang bingung untuk mengolah rahmat itu menjadi nikmat. Seperti sebuah kalimat orang bijak: Si Kaya yang tidak mengetahui dirinya kaya. Fakta ini berbeda dengan beberapa negara yang hidup dalam kesulitan, atau daerah lain yang sangat terbatas sumberdayanya. Mereka berupaya memanfaatkan semua potensi sumberdaya dengan sangat maksimal. Misalnya Negara Mesir (Egypt) yang memanfaatkan potensi Sungai Nil dengan maksimal, sehingga denyut perekonomian negeri kinaah ini dapat dikatakan mengalir seiring derasnya air Sungai Nil. Melalui satusatunya sungai yang membelah padang pasir di negara itu, mereka membangun sebuah PLTA di Bendungan Aswan yang berhasil memproduksi listrik dalam kapasitas sangat besar. Dengan energi listrik itu, mereka memasok air minum ke seluruh permukiman melalui pipa-pipa besar yang melintasi padang pasir. Bukan mustahil, jika padang pasir yang gersang itu, kini pelan-pelan telah berubah menjadi permukiman hijau yang asri, seperti Rehab City sekitar 20 KM dari Kairo. Konon, mereka juga telah berhasil mengekspor tenaga listrik ke beberapa negara tetangga yang akhirnya menjadi salah satu sumber devisa. Di sisi lain, melalui energi listrik, pemerintah Mesir berhasil menarik investor membangun

industri di tengah padang gersang. Para investor juga membangun resort di gunung karang Port Sukhna, lalu air bersih dari Sungai Nil dengan energi listrik berhasil disalurkan ke kawasan industri dan resort tersebut. Luar biasanya, pemerintah Mesir mampu memenuhi kebutuhan listrik rakyat selama 24 jam tanpa pernah padam. Ramah lingkungan Mengapa di Aceh, bumi para pahlawan, dan salah satu negeri paling lengkap di dunia, terkesan tidak mampu berbuat apapun untuk memanfaatkan air sebagai sumber energi? Begitu banyak sungai maupun alue dimiliki, baik yang berada di celah bukit dan pegunungan, maupun yang melintasi permukiman penduduk. Terkadang sumberdaya air itu menjadi sebuah ironi, karena dijadikan untuk tempat membuang sampah dan sumber galian golongan C. Begitu besar debit air yang mengalir, sayang hanya dijadikan sebagai lokasi WC cemplung,WC rakit, dan tempat mandi dan cuci. Sangat jelas, jika sumberdaya air itu belum dimanfaatkan untuk menggerakkan turbin atau dinamo yang bisa menghasilkan energi listrik. Air tersebut dibiarkan mengalir menyelusuri badan sungai menuju laut lepas seperti syair lagu Bengawan Solo.....air mengalir sampai jauh, akhirnya ke laut..... Padahal, pemanfaatan energi air sudah dirintis nenek moyang atau endatu kita, antara lain untuk alat penumbuk padi, dan memindahkan air ke areal persawahan. Konon, pada abad ke-2 sebelum Masehi, di Jerman telah dibangun kincir air pertama dengan kapasitas 0,5 tenaga kuda (HP) yang digunakan mengolah hasil pertanian. Contoh-contoh ini memperlihatkan bahwa pemanfaatan energi air bukanlah teknologi yang sangat rumit, dan tidak perlu harus menunggu ahli dari negara lain. Universitas Syiah Kuala sudah memiliki Fakultas Teknik Elektro, di lembaga ini tersedia sumberdaya manusia yang berlebih. Kemudian, di pasar lokal sudah tersedia dinamo, kabel, bahan logam dan alat las yang bisa digunakan untuk membuat kincir air yang lebih tahan lama. Lalu, mengapa potensi-potensi itu belum dimanfaatkan? Sangatlah wajar apabila Prof. Otto Soemarwoto (1991:318) juga mempertanyakannya, ”Perkembangan pemanfaatan energi di Eropa yang telah dimulai sangat awal, menimbulkan pertanyaan mengapa di Indonesia tidak terjadi perkembangan serupa. Curah hujan di Indonesia sangat tinggi dan topografinya bergunung, sehingga potensi energi air sangatlah besar.” Memang, semua sangat menyadari bahwa pemanfaatan energi air melalui sebuah Pembangkit Listrik Tenaga Air (PLTA) memerlukan biaya sangat besar, serta memerlukan pakar di bidangnya.

Syukur alhamdulillah, JBIC telah bersedia mendanai pembangunan PLTA Peusangan 1 dan 2 di Kabupaten Aceh Tengah yang diperkirakan akan operasional tahun 2014 dengan kapasitas 86 MW. Energi yang dihasilkan PLTA ini, menurut Zulkifli Manajer PT PLN Aceh, akan mampu menyuplai listrik ke seluruh Aceh. Sementara Gubernur Irwandi Yusuf (Kantor Berita Antara, 29/3/2010) menyatakan bahwa dua generator PLTG Arun akan beroperasi dalam tahun ini. Walupun pembangkit listrik itu menjanjikan harapan masa depan kelistrikan Aceh, mengapa tidak, pemerintah Aceh bersama konsorsium kabupaten/kota juga perlu mengambil peran mendirikan Perusahaan Listrik Aceh (PLA). Sebuah perusahaan daerah yang berperan membangun dan mengoperasionalkan PLTA, atau Pembangkit Listrik Tenaga Mikro Hidro (PLTMH) di seluruh wilayah Aceh. PLA yang dibantu lulusan Fakultas Teknik Elektro Unsyiah, dengan teknologi biasa dan biaya yang lebih murah, dapat membangun kincir-kincir sederhana untuk masyarakat atau kebutuhan budidaya pertanian, perkebunan, dan reboisasi. Di samping itu, energi listrik dari PLTA danPLTMHtersebutdapatdijualkepadaPLN, sehingga menjadi sebuah sumber pendapatan daerah yang berkelanjutan, baik untuk pendapatan pemerintah Aceh maupun kabupaten/kota sesuai besaran saham yang dimiliki.Soalnya,investasimembangunPLTA atauPLTMHmemilikiprospekdankeuntungan yang lebih realistis daripada investasi di sektor lain. Selain itu, pembangkit listrik yang menggunakan tenaga air ini sangat ramah lingkungan karena tidak meninggalkan residu sisa pembakaran bahan bakar fosil, juga tidak mengubah ekosistim secara total sehingga sejalan dengan visi Aceh Green. Bukankah akhirnya akan menjadi sebuah terobosan pemerintah Aceh di bidang energi? Dalam QS 94:5-6 Allah SWT telah mengingatkan kita: ...karena sesungguhnya sesudah kesulitan itu ada kemudahan; sesungguhnya sesudah kesulitan itu ada kemudahan.... Dalam surat ke-94 (Surat Alam Nasyrah) ini, Allah SWT mengulang dua kali kalimat ”sesudah kesulitan itu ada kemudahan.” Bukankah menandakan kalimat ini begitu penting bagi kita untuk mencapai kemudahan dan keluar dari kesulitan? Dan, dengan sebuah logika sederhana, bahwa kemudahan akan tercapai jika kita mau belajar dari kesulitan. Kemudahan tidak akan datang begitu saja tanpa menemukan sumber kesulitan, dan merumuskan solusinya. Berdasarkan uraian di atas, paling kurang ditemukan salah satu sumber kesulitan yaitu terbatasnya energi listrik yang mampu dipasok oleh PLN. Ilmu pengetahuan menyatakan bahwa energi listrik antara lain dapat diperoleh dengan memanfaatkan aliran air. Solusinya: di kawasan pedalaman Aceh sangat banyak sumberdaya air yang dapat digunakan membangkitkan energi listrik. Kesimpulannya: Aceh sangat kaya akan potensi sumberdaya energi, hanya saja rahmat tersebut belum diubah menjadi nikmat! Penulis adalah Staf Ahli Ekonomi dan Keuangan Pemkab Aceh Tengah, tulisan ini merupakan makalah yang disampaikan pada Seminar Energi Rakorwil Forum Ukhuwah Lembaga Dakwah Teknik (FULDT) di Unsyiah Darussalam, 29 April 2010

SBI,Upaya Meningkatkan Mutu Pendidikan Oleh M.Yusuf Hasibuan

iri pendidikan berkualitas adalah akses informasi elektronik yang mudah diperoleh serta perpustakaan yang lengkap untuk mendukung proses pembelajaran. Dengan ini guru dapat menyajikan informasi dari berbagai sumber pembelajaran untuk kemudian ditransfer kepada murid. Proses pembelajaran lebih banyak menggunakan perangkat teknologi sehingga murid lebih cepat mengetahui perkembangan ilmu pengetahuan. Guru dalam hal ini bukan sebagai satu-satunya penyedia informasi namun hanya bertindak sebagai fasilitator. Buku yang dimiliki siswa pada setiap bidang studi lebih dari satu. Ini memungkinkan para guru maupun murid untuk memilih bahan pembelajaran yang paling tepat. (Stephen P.Heyneman, dikutip dari “Internartional Journal Economics of Education Review”, 2004) Bila ditilik keadaan pendidikan di Indonesia maka kategori pendidikan bermutu seperti yang disebutkan di atas masih jauh dari yang diharapkan. Pendidikan kita masih berada dalam kategori yang sangat memprihatinkan. Padahal harapannya sumber daya manusia Indonesia memiliki kemampuan yang setara dengan negara maju. Sekarang masih banyak sekolah di pedalaman yang memiliki buku-buku keluaran dua puluh tahun lalu. Guru masih sering menyalin buku di papan tulis untuk dihafal siswa.

Hasilnya timbul siswa penghafal tanpa mengetahui makna dari pengetahuan yang diajarkan. Sedangkan di beberapa kota besar justru pendidikan telah berada pada tahap berkualitas. Banyak siswa yang telah mengecam pendidikan dengan menggunakan berbagai metode pembelajaran. Termasuk di dalamnya kemudahan akses terhadap informasi. Buku pembelajaran selalu up to date dan guru memiliki banyak sumber informasi mengenai mata pelajaran yang diasuh. Selanjutnya pengajaran telah menggunakan bahasa asing semenjak pendidikan dasar. Hal ini menunjukkan ketimpangan yang besar dalam pendidikan kita. Satu sisi berada dalam keadaan terbaik sedangkan pada sisi lainnya masih dalam kondisi memperihatinkan. SBI sebuah solusi Pemerintah kabupaten/kota menyelenggarakan paling sedikit satu SD, SMP, SMA, SMK bertaraf internasional dan/ atau memfasilitasi penyelenggaraan paling sedikit satu SD,SMP, SMA, SMK bertaraf internasional yang diselenggarakan masyarakat (Peraturan Pemerintah No.17 Tahun 2010 pasal 143 dan 146). PP No.17 tahun 2010 mendorong setiap kabupaten/kota yang ada di Indonesia untuk menyiapkan sekolah bertaraf internasional (SBI). Niatan baik dari pemerintah harus direspon dengan baik

oleh daerah bila ingin menjadikan pendidikan sebagai prioritas. Sebagaimana diketahui SBI memerlukan pendanaan yang sangat besar untuk menghasilkan mutu pendidikan berkualitas. Maka dari itu anggaran pendidikan sebanyak 20 persen dari APBN yang telah disahkan dapat dipergunakan untuk peningkatan mutu pendidikan. Hal ini sejalan dengan pendapat Heyneman (2001) dalam jurnalnya berjudul The growing for international market for education good and service yang menyatakan bahwa untuk mencapai pendidikan berkualitas D (paling tinggi) diperlukan dana pendidikan 300 kali lipat dibandingkan negara miskin. Pendidikan berkualitas C harus mengeluarkan dana 30 kali lipat dibandingkan dengan negara miskin. Pendidikan berkualitas B harus mengeluarkan dana 3 kali lipat dibandingkan negara miskin. Sedangkan pendidikan berkualitas A ada pada negara miskin. Sayangnya sebagian besar siswa di dunia berada pada level A (paling rendah) dan B. sedangkan level D (Paling tinggi) hanya 6 persen dari total siswa di dunia di mana 2 persennya terdiri dari siswa yang domisilinya di Amerika Serikat. Agar Indonesia dapat mengejar ketinggalannya dalam bidang pendidikan maka perlu pembenahan dalam dunia pendidikan terkait kualitas dan pendanaan. Pemerintah pusat dengan adanya PP No.17 tahun 2010 telah siap untuk memberikan pendanaan pembentukan SBI. Pemerintah juga telah mengeluarkan standar nasional pendidikan (SNP) bagi sekolah yang melakukan aktifitasnya di Indonesia. Ada delapan standar yang harus dipenuhi agar diperoleh pendidikan


membutuhkan lahan yang baru untuk perluasan pengembangan kemudian hari. Periodesasi gempa bagi penataan ruang gempa yaitu terdiri unit-unit dari kesatuan peta-peta kerentanan geologis tinggi yang wajib dimiliki setiap kota di Indonesia sebagai landasan yuridis dalam membangun penataan ruang kota yang baru. Sedangkan dalam penataan ruang lingkungan geologi yang wajib dimasukan

adalah membangun karakter bangunan dan infrastruktur kawasan tahan gempa untuk penempatan alat sistim peringatan dini dan kawasan non bangunan berwawasan ekologi yang berkelanjutan dengan memperhitungkan luas cakupan 30 persen dari luasan suatu kawasan hijau terbuka tiap kecamatan. Penataan kawasan lingkungan geologi tersebut ditetapkan sebagai daerah sempadan daerah aliran sungai

Sebagian besar siswa di dunia berada pada level A (paling rendah) dan B


(Lanjutan dari hal C6) geologinya saat ini adalah periodesasi gempa dan kemampuan daya dukung lingkungan untuk pengembangan strategis baru bagi kawasan kota yang telah mengalami penghancuran. Karena kota yang pernah mengalami penghancuran gempa tsunami masih

bermutu. Standar tersebut meliputi standar isi, standar proses, standar kompetensi lulusan, standar pendidik dan tenaga kependidikan, standar sarana dan prasarana, standar pengelolaan, standar pembiayaan dan standar penilaian. Untuk SBI ada tambahan standar pendidikan internasional yang dikeluarkan oleh negara-negara anggota OECD (Organization for Economic Co-operation and Development) atau negara maju lain. Dengan mengacu pada standar pendidikan internasional harapannya pendidikan di Indonesia akan dapat setara dengan negara maju di masa mendatang.

dibuat kawasan RTBL, kawasan hijau untuk publik,kawasanevakuasibencanasertahutan konservasi atau reservoir air bersih, daerah green belt ataupun sebagai daerah hijau terbatas diwajibkan sebagai kawasan abadi dan zona hijau lahan pertanian abadi untuk sumber-sumber pangan berkelanjutan.

Peran perguruan tinggi Banyak masalah yang terjadi dalam pelaksanaan SBI di Indonesia. Saat ini pengawasan terhadap SBI masih sangat minim sekali. Maka dari itu perlu dilakukan pengawasan yang lebih ekstra supaya pendidikan sesuai dengan standar SNP dan OECD. Minimnya pengajar yang dapat berbahasa inggris masih menjadi kendala padahal salah satu ciri SBI adalah bahasa pengantarnya menggunakan bilingual. Universitas Negeri Medan (Unimed) sebagai tempat memproduksi pengajar di Sumut telah melakukan terobosan untuk mendukungpeningkatanmutuSBI.Berbagai terobosan dilakukan yang goal targetnya adalah untuk meningkatkan mutu pengajar termasuk salah satunya meningkatkan kemampuan berbahasa Inggris mahasiswa. Selain itu Unimed juga telah membuka kelas internasional di Fakultas MIPA. Lulusan dari programinisalahsatunyaadalahmenyiapkan pendidik pada sekolah bertaraf internasional. Penulis adalah Dosen dan Staf Ahli Lembaga Penelitian Unimed

Penulis adalah Geolog, Pemerhati Masalah Lingkungan dan Geosfer


B6 d’Masiv Band Rajai Nominasi AMI Awards Ke-13 MENENTENG singel Jangan Menyerah terinspirasi dari kebesaran jiwa seorang anak penderita Kanker menikmati detik kehidupan sambil menunggu ajal menjemput - d’Masiv merajai nominasi AMI Awards ke-13 diumumkan Yayasan Anugerah Musik Indonesia Jumat petang (21/ 5) di Grand Auditorium Universitas Bunda Mulia, Jakarta Utara.

Band asal Ciledug – Tangerang dipunggawai Rian (vokal), Kiki dan Rama (gitar), Rai (bas) dan Why (drum) ini menyabet empatnominasibidangPop.Yakni terbaik pada kategori Duo, Grup, Lagu, Penata Musik dan Album. Bahkan,melengkapikegemilangan secara grup, Rian d’Masiv juga masuk nominasi kategori Lagu Anak Anak terbaik lewat karyanya bertajuk Bintang Yang Bersinar lantunan para Idola Cilik – 2. Biduanita terbaik AMI 2009, Agnes Monica, membayangi d’Masiv dengan menyabet dua nominasi terbaik dikategori Artis Solo Wanita lewat lagu Teruslah dan Album (Sacredly Agnezious).

Serta mengantar duet pencipta lagu Pay & Dewiq (Teruslah) masuk nominasi LaguTerbaik ajang pesta prestasi insan musik Indonesia yang malam puncaknya digelar di JIETEX Mangga Dua Square, 9 Juni 2010 mendatang dan disiarkan langsung RCTI. Sementara Anang Hermansyah menandai debut ulang totalnyadiindustrimusiknasional lewatalbumSeparuhJiwakuPergi, meraih dua nominasi. Yakni kategori Artis Solo Pria dan Lagu Terbaik. Dua nominasi bidang pop juga diraih Rossa dan penyanyi masa depan Gita Gutawa. Keduanya sama masuk nominasi terbaik kategori Artis SoloWanita

dan Album Terbaik. Untuk menjadi Artis Solo Wanita terbaik AMI tahun ini, Gita Gutawa (lagu Harmony Cinta) dan Rossa (Terlanjur Cinta), bakal bersaing ketat dengan Agnes (Teruslah), Bunga Citra Lestari (Kar’na Kucinta Kau), Krisdayanti (Aku Wanita Biasa) dan Sherina (Cinta Pertama dan Terakhir). Begitu pula Anang Hermansyah. Pelantun tembang Separuh Jiwaku Pergi yang belakangan tengah intim dengan penyanyi Syahriniini,harusbersaingdengan Ari Lasso (lagu Cintailah Aku Sepenuh Hati), Ello (Masih Ada), Iwan Fals (Untukmu Terkasih) danOnce(SimphonyYangIndah).

Pada bidang Rock, kejutan diukir band Blackout. Lewat album perdana bertajuk Goodbye, band pop rock yang digawangi Azizi (vokal), Ega (gitar), Iwan (bas), Sastro (keyboard) dan Rere (drum) ini, masuk nominasi Album Rock terbaik bersama album 36 th (God Bless, Ian Antono/Nagaswara), Anglels & The Outsider (S.I.D, Jan Djuhana & SID/Sony BMG), Ost. Generasi Biru (Slank, Slank Record/Virgo Ramayana), Road to Abbey (JRocks, J-Rock-Pay/Aquarius Musikindo), Suara Jalanan (Boomerang, Log Zhelebour/Logiss Kreasi Murni). “Mencermati band nomina-

WASPADA Senin 24 Mei 2010

Nostalgia Fan Club Ungkapkan Rasa Cinta

tor lain, kami tak terlalu berharap meraih piala AMI. Masuk nominasi saja sudah bagus.Yang pentingkamiyangtengahmenggarap album kedua, pasti lebih terlecut untuk melahirkan karya terbaik. Agar musik Rock kembali jaya diblantikamusiknasional,”papar vokalis Blackout bernama panjang Syaifuddin Zahri Azis ini. Ratna Listy yang sebelumnya belum pernah menjadi nominator AMI, akhirnya masuk nominasi terbaik pada kategori Lagu Berbahasa Daerah Terbaik lewat lagu/album Janur Mlengkung/ Laras Pesisiran. Penyanyi dan pembawa acara televisi ini berpeluang besar meraih AMI Award karena hanya bersaing dengan penyanyi Dadang Anesa, Rini Cholista, Safitri/Tommy dan Wulan. HasillainNominasiAMI2010 :Duo,GrupPopTerbaik:1.d’Masiv (JanganMenyerah,albumSpecial Edition), 2. Geisha (Jika Cinta Dia, album Anugerah Terindah) 3. Gigi (YaYaYa), album Gigi) 4. Nidji (Sang Mantan, album Let’s Play), Pasto ( Tanya Hati, album Kembali), The Dance Company (Papa Rock’N Roll, album Papa Rock’N Roll). Bidang Original SoundTrack Terbaik : 1. Gigi (Sang Pemimpi/ Ost.SangPemimpi),2.LunaMaya feat Dide Hijau Daun (Suara/ Ku b e r h a r a p / O s t J a n d a Kembang), 3. Melly & Amme (Ketika Cinta Bertasbih/Ost.KCB), 4. Slank feat Nirina/Ost. Generasi Biru 5. Ungu (Cinta Gila/Ost.Sang Pemimpi). * (AgusT)

Amputasi Kaki Tak Kurangi Kesaktian Bubi Chen

Bubi Chen/

MAESTRO jazz Bubi Chen tak kehilangan kesaktiannya dalam memainkan musik walaupun aksinya di panggung harus dibantu sang istri, setelah pergelangan kaki kanannya diamputasi. Dalam pergelaran konser mini bertajuk A Wonderfull Jazz Evening with Bubi Chen and The

07.30 OB 08.00 Kecil-Kecil Jadi Manten 09.00 Musik : Dahsyat 11.00 Silet 12.00 Seputar Indonesia 12.30 Sergap 13.00 Sinema Siang 15.00 Kabar Kabari 16.00 Minta Tolong 17.00 Seputar Indonesia 17.30 Launching Album Dunia Idola 18.00 Kemilau Cinta Kamila 20.30 Seindah Senyum Winona 22.00 Ketoprak Canda 00.00 Seputar Indonesia Malam 01.00 Highlights UEFA Champions


Doctors di Hotel Patra Jasa Semarang, Sabtu (22/5) malam, Bubi Chen membuktikan kemampuannya bersama maestro bidang ilmu yang saling berbeda. Bubi Chen berkolaborasi bersama sejumlah dokter menunjukkan kebolehan dalam bermusik. Bubi Chen tampak gagah

07.30 SCTV Musik Inbox 09.30 Halo Selebriti 10.00 SCTV FTV Pagi 12.00 Liputan 6 Siang 12.30 SCTV FTV Siang 14.30 Status Selebritis 15.00 Sinema Sore 17.00 Liputan 6 Petang 17.30 Buku Harian Baim 18.00 Uya Emang Kuya 19.00 Mawar Melati 20.30 Cinta Fitri 21.30 Kesetiaan Cinta 23.00 FTV 01.00 Liputan 6 Malam 01.30 Solusi WK

dalam balutan jas dan topi pet hitam saat naik ke panggung, meski harus menggunakan kursi roda dan selalu didampingi istri tercintanya. Mengiringi permainan piano Bubi Chen, sejumlah dokter dan musisiSemarangtelahsiapdengan posisinya masing-masing, termasuk Prof dr Darmono penggagas konser itu yang kebagian mengawal vokal dan gitar. Dentuman irama tembang Autum Leaf langsung menyeruak mengawali konser tersebut, disusul serentetan tembang berjudul I Have a Dream, Molindo Cafe, dan Get Back. Kepiawaian Bubi Chen dalam memainkan tuts-tuts piano ternyata tak terkikis usia dan keterbatasannya, dan sang maestro jazz itu membuktikannya dengan sempurna. Beberapa kali Bubi Chen memang harus dibantu istrinya agar bisa duduk dengan nyaman, mengingat keterbatasan fisik usai kehilangan kaki kanan akibat

07.00 Disney Club 08.00 Tom & Jerry 09.30 LAyar PAgi 11.00 Sidik 12.00 Cerita Siang 13.30 Cerita Sore Komik Kubuka Kubuku 14.30 Go Show 2 15.00 Tom & Jerry 15.30 Disney Club 16.30 Lintas 5 17.00 Zona Juara 18.00 Gerhana Jadi Dua 19.00 Upin & Ipin 19.30 Kisah Fantasi 21.00 Arisan Dangdut 22.30 Sinema MAlam 01.00 Galaxy

diabetes itu. Beberapa kali pula istrinya terlihat naik ke atas panggung membantu Bubi dan kemudian turun kembali ke bangku penontonhinggamembuatsuasanakonser itu terasa sangat menyentuh. Irama lagu berbagai macam aliran musik, seperti jazz, klasik, pop, keroncong, dan dangdut juga masih sanggup dimainkan Bubi Chen dengan apik dan membuat penonton terkesima. Saat melantunkan irama Kopi Dangdut yang justru dibawakannya tanpa bernuansa dangdut,parapenontonlangsung menyambutnya dengan tepuk tangan panjang tanda apresiasi pada sang maestro. “Saya persembahkan konser ini untuk mereka semua yang telah merawat saya selama berada di rumah sakit,” kata Bubi Chen di sela pementasannya. Penggagas konser mini tersebut Prof dr Darmono mengatakankonsepacaraituadalahpeng-

07.00 Kartun : Pororo 07.30 Kartun :Animal Mechanical 08.30 Espresso 09.30 Sinema Religi 11.30 Topik Siang 12.00 Musik Klik 13.00 Tawa Sutra XL 15.00 All About Asia 16.00 Mantap 17.30 Topik Petang 18.00 Dapet Deh 18.30 Super Family 19.30 Super Deal 2 Milyar 20.30 Tawa Sutra 22.30 Black In News 23.30 Most Shocking 00.00 Topik Malam 00.30 Lensa Olahraga Malam

07.00 Ben 10 08.00 Jiran 09.30 FTV Drama 11.30 Patroli 12.00 Fokus Siang 12.30 Happy Song 14.30 KiSS 15.00 Fokus 15.30 FS My Fair Lady 17.00 Nurhaliza 18.00 Putri Duyung Marina 19.00 Take Celebrity Out 22.00 Sinema Asia 00.00 Fokus Malam 00.30 FS The Sword and The Chess Of Dead

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

gabungan antara seni dan ilmu pengetahuan dalam berkolaborasi bermain musik. Darmono adalahdokteryang merawatBubi ChenselamadiRumahSakitTelogorejo Semarang dan mengakui telahlamamengidolakanmaestro jaz kelahiran Surabaya, 9 Februari 1938 itu. “Merawat orang sakit juga perlu seni agar pasien optimistis. Dokter tidak boleh hanya mengandalkan otak, namun juga perasaan, sehingga art dan science harus seiring,” katanya. Konser yang digagas Darmono itu hanya bagian kecil dari rangkaian acara Pertemuan Ilmiah Tahunan Endokrinologi Jawa Tengah dan DI Yogyakarta pada 21-23 Mei di Semarang. Darmono juga mengakui permainan musik yang tidak berjalan seimbang mengingat kepiawaian Bubi yang tidak tertandingi, tetapi konser itu lebih sebagai bentuk keakraban, bukan semata-mata pertunjukan.(ant)

07.05BedahEditorialMedia Indonesia 08.00 Healthy Life 09.05 Indonesia This Morning 09.30 Market Review 10.05 The Interview 10.30 Metro Xin Wen 11.05 Showbiz Cinema 11.30 Megapolitan 12.05 Metro Siang 13.05 Zero to Hero 14.30 Metro Sore 15.05 Bisnis Hari Ini 15.30 Public Corner 16.05 Discover Indonesia 19.05 Suara Anda 20.30 Newsmakers 21.05 Top Nine News 21.30 Prime Interview 22.05 Economic Challenge 23.05 Metro Realitas 23.30 Metro Sports 01.05 Oprah Winfrey

Malam ini Senin 24 Mei 2010 mulai pukul 20.00 bertempat di Ball Room Hotel Grand Aston Medan, sederetan artis papan atas Indonesia akan mengungkapkan ‘Rasa Cinta’ lewat tembang-tembang nostalgia yang pernah hits di masanya. Sederetan artis seperti Memes, Nourma Yunita, Cristine Panjaitan, serta Mawi Purba bersama Rythm King, akan menembangkan sederetan lagu nostalgia penuh rasa cinta dalam acara yang dikemas apik Nostalgia Fans Club. Seperti diungkapkan Ketua penyelenggara, Vonny Lidia, kepada wartawan di Medan, Nostalgia Fans Club kembali hadir dengan lagu-lagu kenangan penuh pesona dan keindahan dengan menampilkan artis-artis papan atas Indonesia. “Acara ini sengaja kami kemas dari anda untuk anda, dan menjadi hiburan sangat digemari masyarakat,” Ujar Vonny Lidia didampingi wakil Ketua Nelson Matondang, Sekretaris Horas P Aritonang SE, Usron

Putra, Muhammad Irfan PRD, Syafruddin Razali dan Kordinator acara Utha Likumahuwa. Menurut Vonny, acara nostalgia ‘Rasa Cinta’ di Medan ini akan menjadi memori yang indah dalam kehidupan. Masyarakat diajak untuk kembali menelusuri masa lalu yang penuh kenangan dengan tembangtembang penuh rasa cinta. “Kami akan menghadirkan lagu-lagu sangat populer dan terkenang sepanjang masa, serta memiliki nilai-nilai seni dan budaya telah me-warnai perjalanan musik Indonesia,” ujar Vonny. Ditambahkan Nelson, Nostalgia Fans Club juga akan menghadirkan bintang tamu seperti, Rinto Harahap, Cindy Claudia Harahap. Sebagai pembawa acara adalah Sys NS. Nostalgia Fans Club akan terus menguman-dangkan bait-bait keindahan dan kata cinta di telinga masyarakat. “Keindahan hanya ada di dalam hati yang damai.(rel/m09)

Telkomsel Edukasi Pembuatan Film Untuk Pelajar Aktor film Ayat-Ayat Cinta Fedi Nuril bersama sutradara Affandi Abdul Rachman (Pencarian Terakhir, melakukan edukasi tentang pembuatan film dihadapan siswa SMUN 1 Medan Sabtu (22/5) sore. Acara tersebut diaadakan sebagai bentuk apresiasi dan memberikan nilai tambah bagi pelanggan Telkomsel, khusunya bagi sekolah tergabung dalam Telkomsel School Community (TSC), digelar kegiatan Sinemania Edumovie merupakan ajang edukasi pembuatan film diikuti lebih dari 250 pelajar di Medan. Kegiatan Sinema Edumovie merupakan EDUKASI PELAJAR : Telkomsel menggelar kegiatan Sinemania pelatihan How to make a Edumovie merupakan ajang edukasi pembuatan film untuk pelajar movie melalui sharing di Medan telah bergabung di Telkomsel School Community. Dalam session dan talkshow gambar terlihat sutradara Affandi Abdul Rachman dan pemain tentang behind the scene film, Fedi Nuril saat memberikan pengarahannya dihadapan pembuatan sebuah film. para peserta Menurut Manager Branch Telkomsel Medan, Kurnia nonton bareng, out bond, dan kegiatan Hadhi, Program ini merupakan ajang hiburan juga tetap berbasis edukasi pencerahan dan penambah wawasan bagi lainnya. para member Telkomsel School CommuSekolah yang ingin bergabung ke nity tentang proses pembuatan film, dalam Telkomsel School Community dapat sekaligus sarana gathering bagi para menghubungi kantor GraPARI Telkomsel member School Community. terdekat. Sementara untuk menjadi anggota Telkomsel School Community komunitas, pelanggan Kartu As dan merupakan komunitas sekolah pertama simPATI dapat melakukan registrasi dengan dan terbesar di Indonesia yang kini cara mengirimkan SMS, ketik SEKOLAH memiliki 6,6 juta anggota dari sekitar 7.000 <spasi><School ID>, contoh: SEKOLAH sekolah di seluruh Indonesia. Program 1235456789, lalu kirim ke 4545 (gratis). dihadirkan bagi para anggota komunitas Para anggota komunitas dapat berfokus pada kegiatan berkonsep edukasi menikmati tarif nelpon dan SMS murah, untuk meningkatkan kualitas prestasi siswa serta tarif internetan hanya Rp 1/KB. tanpa melupakan sisi entertainment. Anggota komunitas juga dapat menikmati Selain edukasi, apresiasi lain yang paket hemat layanan mobile broadband dapat dinikmati untuk sekolah telah Telkomsel Flash sebesar 35 MB hanya bergabung dalam Telkomsel School dengan harga Rp 10.000, aktiv selama 30 Community, antara lain dapat mengikuti hari.(m09) Try Out Gratis, menyaksikan konser musik,

07.30 Suami-Suami Takut Istri 08.30 Angels Diary 09.00 Dering’s 11.00 Insert 12.00 Jelang Siang 12.30 Reportase Siang 13.00 Bingkai Berita 13.30 Online 15.00 Missing Lyrics 16.00 Kejar Tayang 16.30 Orang Ketiga Series 17.00 Reportase 17.30 Insert Sore 19.00 Gong Show 20.30 Realigi 21.30 Bioskop Trans TV 00.00 Bioskop Trans TV 01.00 Reportase

06.30 Apa Kabar Indonesia 10.00 Nuansa 1000 Pulau 10.30 Backpacker 11.00 Kabar ++ 12.00 Kabar Siang 13.00 Kabar Keadilan 13.30 Expose 15.00 Kabar 15 15.30 Kabar Pasar 16.00 Menyingkap Tabir 16.30 Fakta & Data 17.00 Kabar Hari Ini 17.30 Kabar Petang 19.30 Di Balik Langit Berita 21.00 Apa Kabar Indonesia Malam 22.30 Highlight Proliga 23.00 Auto Expert 23.30 Kabar Arena

07.00 Spongebob 08.00 Eyeshield 09.00 Monchows 09.45 Obsesi 10.30 Bukan Sinetron 11.30 Pengakuan Terlarang 12.00 Bukan Abdel & Temon 13.00 Global Siang 13.30 Awas Ada Sule 14.30 Amel Cemal Cemil 15.30 MTV Studio 16.30 Berita Global 18.00 Naruto 19.00 3 Mas Ketir 20.00 Big Movies 22.00 Big Movies 00.00 Global Malam 00.30 FIFA World Cup 01.30 MTV Insomnia

07.30 I Gosip 08.00 DUAAR 09.00 Dorce 10.30 60 Minutes 11.30 Redaksi Siang 12.00 I Gosip Siang 12.30 Bocah Petualang 13.00 Laptop Si Unyil 13.30 Jalan Sesama 15.30 Asal Usul Fauna 16.00 Jejak Petualang 17.00 I Gosip News 17.30 Scary Job 18.00 On The Spot 19.00 OKB 20.00 Opera Van Java 21.00 Mariam Mikrolet 22.00 Bukan Empat Mata 23.30 Berburu 00.30 Sport 7 Malam


WASPADA Senin, 24 Mei 2010


Luar Negeri



Senin 24 Mei 2010

Tabrakan Truk Dan Bus, 32 Tewas Orang Di China

Abbas Serukan Rakyat Palestina Agar Boikot Produk Israel

BEIJING, China (AP): Satu tabrakan laga kambing antara truk dan bus di bagian timurlaut China menewaskan 32 orang dan mencederai 24 lainnya Minggu (23/5) pagi. Kecelakaan itu terjadi di jalan raya yang tengah dilakukan perbaikan di Fuxin, Provinsi Liaoning, kata kantor berita Xinhua. Truk itu melintasi sisi jalan yang salah ketika akhirnya menabrak bus tersebut, sehingga menyebabkan kebakaran, kata seorang pejabat dari Provinsi Liaoning. Tiga orang yang berada di atas truk tewas di tempat, dan 29 penumpang bus juga tewas. Sementara 24 penumpang lainnya yang menderita cedera dirawat di rumahsakit, tiga di antaranya dalam kondisi kritis. Kecelakaan itu terjadi pada pukul 3 dini hari, ketika bus tersebut dalam perjalanan dari kota Tianjin dekat Beijing menuju Harbin, ibukota Provinsi Helongjiang. Penyebab kecelakaan sedang diselidiki.(m18)

Pembocor Nuklir Masuk Penjara Lagi JERUSALEM (AP): Seorang warga Israel yang membocorkan tentang persenjataan nuklir Israel dan dihukum 18 tahun penjara karena tindakannya membocorkan rahasia itu kembali masuk penjara. Mordechai Vanunu diseret ke penjara Minggu (23/5) karena melanggar syarat dari pembebasannya 2004 lalu, di mana di dalamnya termasuk larangan bertemu dengan warga asing. Pengacaranya mengatakanVanunu punya pacar warga Norwegia. Petugas penjara mengatakan dia harus menjalani hukuman tiga bulan penjara. Vanunu sebelumnya bertugas sebagai teknisi di satu reaktor nuklir. Dia membocorkan semua informasi penting dan gambar dari reaktor nuklir tersebut kepada Sunday Times of London pada tahun 1986. Para pakar asing mengulas keterangannya menyimpulkan bahwa Israel memiliki senjata nuklir. Agen intelijen Israel menculiknya di Roma dan membawanya ke Israel untuk diadili. Israel tidak pernah mengakui atau membantah bahwa mereka memiliki senjata nuklir.(m18)

14 Warga Sipil Tewas Dalam Serangan Shebab MOGADISHU, Somalia (Antara/AFP): Pemberontak Shebab Somalia yang diilhami Al Qaida menyerang istana kepresidenan di Mogadishu, memicu pertempuran yang menewaskan sedikitnya 14 warga sipil, kata para pejabat dan saksimata Minggu (23/5). Pasukan pemerintah didukung tentara Uni Afrika menangkis dan membalas serangan pemberontak, yang menyerang kompleks kepresidenan. Peristiwa itu terjadi pada saat Presiden Sharif Sheikh Ahmed sedang menghadiri konferensi diTurki. Para pejuang Shebab melancarkan serangan besar mereka di Shibis utara dan Bondhere yang terletak di tepi laut ibu kota Sabtu malam. Setelah tenang sejenak, pertemuan dilanjutkan hingga terbit fajar Minggu. “Jumlah penduduk sipil yang tewas dalam pertempuran semalam mencapai 11, dan mungkin bisa lebih banyak lagi, karena kelompok garis keras menggunakan mortir untuk menyerang beberapa posisi di Mogadishu selatan pagi ini,” kata Mohamed Ali Idle, seorang pejabat keamanan Somalia kepada AFP. Sedikitnya tiga warga sipil lain juga tewas dan 25 terluka akibat baku tembak mortir di wilayah selatan Wolwadag dan Laut Hitam, dan Ali Muse, kata kepala layanan ambulan Mogadishu kepada AFP.

Wanita Mata-mata Korut Ditangkap Di Seoul SEOUL, Korea Selatan (Antara/AFP): Pihak yang berwenang di Korea Selatan menahan seorang wanita mata-mata Korea Utara yang berpura-pura menjadi pengungsi, dalam rangka mendapatkan informasi mengenai sistem subway (kereta bawah tanah) Seoul, kata laporan berita Minggu (23/5). Informasi itu akan digunakan untuk serangan-serangan teroris, kata kantor berita Korea Selatan (Korsel) Yonhap, mengutip Badan Intelijen Nasional dan para jaksa di Seoul.Wanita berumur 36 tahun yang bernama keluarga Kim, memasuki Korsel melalui China dan Laos pada September 2009, menyaru sebagai seorang pembelot Korea Utara (Korut), menurut Yonhap. Kim mendapatkan informasi rahasia, termasuk catatan kontak darurat kepada staf subway Seoul, dari mantan pekerja subway berumur 52 tahun bernama Oh dan membawanya ke Pyongyang, katanya. Oh yang bertemu dengan Kim secara online dan kemudian menjadi pacarnya, juga ditahan karena membocorkan dokumen rahasia, kata laporan itu menambahkan. Kim adalah pemilik sebuah toko kosmetik dan biro perjalanan di provinsi Hunan, China, mengamankan data pribadinya pada pariwisata Korsel untuk beberapa tahun sebelum menyelinap ke Korsel sebagai pengungsi, ujarnya. Badan Intelijen Nasional menolak memberikan komentar, dan para pejabat di kantor kejaksaan Seoul yang menangani kasus itu juga tak bisa segera dihubungi. Hubungan lintas-batas kedua negara memburuk setelah kapal perang Korsel, Cheonan, berbobot 1.200 ton tenggelam, yang menurut Seoul ditorpedo oleh kapal selam Korsel di dekat perbatasan laut yang mereka sengketakan. Kedua Korea secara teknis masih dalam status perang sejak konflik 1950-1953 diakhiri dengan gencatan senjata yang rentan.

The Associoated Press


Para petugas kepolisian Pakistan berdiri berjaga-jaga ketika para pendukung Islami Jamiat Tulba mengadakan rapat umum di Karachi, Pakistan, Sabtu (22/5) untuk mengutuk satu halaman di Facebook yang mendorong pengguna halaman itu untuk membuat lukisan Nabi Muhammad SAW. Pakistan telah melarang Facebook dan YouTube, namun mengatakan hanya pemerintah yang akan memulihkan kembali kedua halaman di dunia maya itu.

Taliban Di Afghanistan Serang Pangkalan NATO KABUL, Afghanistan (AP): Taliban Minggu (23/5) mengaku bertanggungjawab atas serangan terhadap pangkalan terbesar NATO di bagian selatan Afghanistan di mana kelompok pemberontak menembakkan roket, mortir dan senjata otomatis dalam usaha mereka menggempur Pangkalan Udara Kandahar. Serangan tersebut merupakan kedua kalinya terjadi atas instalasi militer minggu ini. Beberapa tentara koalisi dan karyawan sipil cedera dalam serangan Sabtu malam itu, namun tidak ada laporan tentang korban tewas, kata para pejabat. Artileri dan tembakan dari senapang mesin terdengar bergema di pangkalan itu, sekitar 500 km di sebelah baratdaya Kabul, beberapa jam setelah serangan itu dilancarkan, demikian laporan kantor berita Kanada

dari Kandahar. Pasukan militant menembakkan roket dan mortir sekitar pukul 8.00 malam dan mencoba menorobos bagian utara pangkalan itu namun tidak berhasil, kata para pejabat. Satu roket menghantam satu blok di mana terdapat jajaran toko di mana para tentara NATO berkumpul di malam hari untuk berbincang-bincang. Ceceran darah terlihat di jalan di luar restoran T.G.I. Friday pada Minggu pagi, kata Maura Axelrod, wartawan HDNet yang be-

BANGKOK, Thailand (Antara/AFP): Perdana Menteri Thailand AbhisitVejjajiva Minggu (23/5) mengatakan, negaranya sudah tenang dan kembali normal, dan bahwa sekolah-sekolah, jalan-jalan serta badanbadan pemerintah akan berkegiatan kembali Senin. “Segala sesuatunya telah tenang dan kembali seperti sediakala,” kata PM Abhisit dalam pidato rutin di televisi Minggu. Abhisit mengatakan bahwa pemerintah kota sedang membersihkan kawasan unjukrasa di wilayah niaga terkenal Bangkok itu, yang secara paksa dibersihkan pekan lalu setelah enam pekan diduduki oleh para pemrotes. “Lalu lintas dan apapun akan

kembali normal besok. Kantorkantor pemerintah dan sekolahsekolah akan dibuka kembali,” katanya, merujuk pada tindakantindakan yang diberlakukan agar warga sipil menjauh dari jalanjalan itu, pada saat tentara terlibat bentrokan dengan pemrotes Baju Merah. Tentara mencari bahanbahan peledak sementara itu para petugas pemadam kebakaran sibuk menyiram bara toko-toko mewah yang dibakar di pusat Bangkok, Sabtu. Sementara ibu kota berusaha membersihkan kepingankepingan setelah kerusuhan politik terburuk di dalam sejarah modern Thailand, Abhisit menandaskan pentingnya rekonsiliasi dalam pidato Jumat. Na-

Hubungan Brazil Dan Iran terlihat unsur positif hubungan dengan Iran. Hak-hak azasi manusia dan demokrasi tidak ada di Iran. Pemilihan presiden yang dilaksanakan tahun lalu dianggap tidak bersih, penahanan para penentang Ahmadinejad bahkan ada yang terbunuh. Membangun hubungan diplomatik dan ekonomi bukan merupakan prioritas bagi Brazil. Artinya, secara geopolitik dan ekonomi Iran bukanlah mitra dagang utama bagi Brazil. Berkunjung dan mengikat perjanjian dengan Iran ditengarai hanyalah untuk kepentingan pribadi sang presiden. Tahun 2011 Lula akan mengakhiri jabatan kepresidenannya. Ia ingin dinominasikan dalam posisi tinggi di lingkungan PBB atau FAO. Para pengamat Brazil beranggapan bahwa Lula ingin menjadi Sekretaris Jenderal PBB. Oleh karena itu jalan terbaik baginya untuk mencapai citacitanya di dunia internasional yaitu memanfaatkan kebijakan luar negeri Brazil bagi kepentingan pribadinya. Pendekatan yang dilakukan Lula pada Iran sebagai pintu masuk bagi duku-

nada. Hari berikutnya, puluhan militan Taliban menyerang pangkalan militer AS di Bagram, menewaskan seorang kontraktor warga Amerika dalam pertempuran yang berlangsung delapan jam itu. Sabtu malam, sedikitnya lima roket menghantam pangkalan Kandahar dalam serangan awal, kata Komodor Amanda Peterseim, seorang jubir pasukan NATO di pangkalan itu.Tidak ada laporan korban tewas dan Peter-seim tidak mengetahui secara jelas jumlah korban yang cedera. “Alarm bergaung selama beberapa jam, namun tidak ada pemberontak yang berhasil menyusup ke pangkalan,” kata NATO dalam pernyataan. Dikatakan ‘sejumlah personil militer dan sipil cedera dan ‘mendapatkan perawatan medis. Tidak ada korban tewas.”(m18)

PM Abhisit: Thailand Kembali ‘Tenang Dan Normal’

Gema Internasional

KUNJUNGAN Presiden Brazil Luiz Inacio Lula da Silva ke Iran pertengahan Mei lalu dalam hubungan persahabatan dan pergaulan internasional adalah hal yang biasa, dipandang sebagai kunjungan balasan terhadap presiden Iran Ahmadinejad yang datang ke Brazil bulan November tahun lalu. PresidenLulayangmenganut paham sosialis independen, dia suka berbicara terang-terangan dan menjaga jarak dengan Amerika Serikat. Lula berpendapat bahwa Iran berhak mengembangkan energi nuklir untuk perdamaian. Dia ingin masyarakat internasional menghindari sanksi baru terhadap Iran. Seyogyanya PBB lebih dahulu melakukan pembicaraan kembali yang lebih intens dengan Iran untuk mencari solusi yang terbaik. Kunjungan presiden Lula ke Iran telah menimbulkan perdebatan yang hangat di Brazil. Ada yang berpendapat tidak ada manfaatnya melakukan perjanjian dengan Iran mengingat Brazil secara politik.Mereka memandang Iran yang selalu bersikap high profile manner. Tidak

rada di dalam pangkalan itu. Jubir Taliban Qari Yousef Ahmadi mengatakan kepada AP bahwa pasukannya menyerang pangkalan itu dari dua sisi dan menembakkan lebih 15 roket. Serangan tersebut merupakan serangan ketiga terhadap pasukan NATO di Afghanistan dalam waktu enam hari. Serangan itu dilancarkan setelah Taliban mengumumkan rencana penyerangan terhadap pasukan NATO dan pasukan pemerintah Afghanistan – reaksi mereka terhadap janji pemerintah Obama untuk memberangus Taliban dari pertahanan mereka di Provinsi Kandahar. Selasa lalu, seorang pembom bunuhdiri Taliban menyerang konvoi NATO di ibukota, menewaskan 18 orang, termasuk lima warga Amerika dan seorang tentara NATO warga Ka-

ngan dari dunia Arab atau negara-negara lain yang bersahabat dengan Iran. Langkah yang dilakukan oleh presiden Lula dengan mengikat perjanjian dengan Iran, kemungkinan sekali akan terjadi ketegangan antara Iran dengan komunitas internasional semakin meningkat dan sanksi baru bagi Iran tak mungkin terhindarkan apalagi China berada pula di belakang dukungan sanksi baru terhadap Iran. Di pihak lain, yang mendukung kunjungan Lula ke Teheran berpendapat bahwa saatnya pula Brazil ikut terjun aktif dalam kancah internasional menyangkut isu-isu tertentu yang berpengaruh secara global. Dengan demikian Brazil membuka jalan mengambil peran diplomasi yang intensif. Dunia tak begitu berminat dengan nuklirisasi Iran, tetapi juga tidak membuat komunitas internasional menjadi lebih buruk karena konflik yang mengarah pada instabilitas di wilayah Timur Tengah. Memang diakui sanksi di mana saja tak terlaksana dengan baik. Ambillah contoh

seperti Kuba dan Korea Utara. Sanksi hanya lebih banyak bersifat provokatif yang mendapat reaksi keras dari rakyat. Berangkat dari dasar pikiran ini, diyakini semua usahausaha yang dilakukan Brazil dengan Iran dapat dibenarkan. Amerika Serikat telah mengenyampingkan kemungkinan melakukan negosiasi yang positif dengan Iran karena AS telah bersikap memberikan sanksi. Sedangkan Russia dan China tak berpihak,namuntakdapatmenghindardaritekanan-tekananyang dilakukan AS. Sedangkan Sekjen PBB bahkan tak memiliki daya melakukan negosiasi. Dari peluang-peluang yang tersedia, masih ada ruang bagi Brazil untuk melaksanakan kemampuan diplomasinya meskipun bagi yang pesimistis lebih menyukai selalu bersembunyi di bawah “skirt” AS. Dengan alasan ini, Brazil bersiap-siap untuk menyelamatkan prinsipnya: “mutlak menentang penggunaan senjata nuklir dalam peperangan, namun bersedia melaksanakan keputusan sanksi apabila disahkan oleh PBB.” (Kosky)

mun dalam pidatonya itu, Abhisit tidak menawarkan penyelenggaraan pemilu dini, yang menjadi tuntutan utama para pemrotes yang menggelar unjukrasa di Bangkok selama dua bulan, sampai tentara membubarkan mereka dalam pekan ini. Para pemrotes “Baju Merah” yang menimbulkan kerusu-han di Bangkok sebagian besar datang dari daerah perdesaan dan masyarakat miskin kota. Mereka, yang cenderung setia kepada mantan perdana menteri Thaksin Shinawatra yang digulingkan dan kini hidup di pengasingan, menginginkan

pemilu baru, dan menuding elit kota yang menguasai semua kekuasaan dan mengabaikan pada kemakmuran negara. “Mari yakinlah kembali bahwa pemerintah akan memenuhi tantangan-tantangan itu, dan mengatasi kesulitan-kesulitan ini melalui lima-butir rencana rekonsiliasi yang telah saya umumkan sebelumnya,” kata Abhisit dalam pidato televisi. Rencana itu, pertama kali diumumkan pada 3 Mei, menawarkan reformasi politik, keadilan sosial dan penyelidikan terhadap kekerasan politik.

RAMALLAH, Tepi Barat (Antara/Reuters): Presiden Mahmoud Abbas, meminta rakyat Palestina agar memboikot semua barang yang berasal dari wilayah pemukiman Israel. Pemimpin Palestina berusia 75 tahun itu meminta rakyatnya berhenti membeli semua barang yang diproduksi di daerahdaerah pemukiman Israel di Tepi Barat. Mahmoud Abbas sendiri menepis tuduhan Israel bahwa kampanye anti-produk itu merupakan bentuk kebencian terhadap negara Zionis Israel. Dia menyambut para pegiat Palestina yang menyebarkan brosur-brosur berisi daftar berbagai produk Israel yang dilarang diperjual-belikan di pasar-pasar Palestina. Terrmasuk dalam daftar produk tersebut adalah furnitur, minuman anggur, dan minuman ringan. “Saya mengimbau seluruh rakyat Palestina untuk melakukan hal yang sama dan memboikot produk-produk ini,” kata Abbas dalam pidatonya yang untuk pertama kali mendukung kampanye pemboikotan itu. Gerakan ini juga disuarakan Perdana Menteri Salam Fayyad. Abbas bahkan menempelkan sebuah stiker bertuliskan “bebas barang-barang buatan wilayah pemukiman (Israel)” di pintu rumahnya. “Kami tidak memancing melawan Israel. Kami tidak ingin memboikot barang-barang dari Israel,” katanya. Abbas berupaya membedakan antara produk buatan Israel dan produk yang dibuat di daerah-daerah pemukiman Israel yang dibangun di atas tanah rakyat Palestina. Para konsumen dan ekonomi Palestina justru terkait dengan dan bergantung pada pasokan barang dari Israel. Menteri Keuangan Israel Yuval Steinitz, Jumat, mengatakan, pemboikotan produk negaranya itu melemahkan upaya Amerika Serikat (AS) memajukan proses perdamaian Palestina-Israel. “Ini bukan cara yang tepat untuk mendekati perundingan,” katanya dalam siaran TV Channel 1. Barang-barang yang diproduksi di wilayah pemukiman Yahudi itu biasanya diproduksi bersama dengan pabrik-pabrik di Israel, katanya. Bagi Palestina, upaya pemboikotan itu diharapkan melemahkan viabilitas ekonomi di kantong-kantong Yahudi. Rakyat Palestina juga berharap gerakan mereka akan diikuti negara-negara anggota Uni Eropa. Negara-negara Uni Eropa itu diharapkan melarang perdagangan dengan perusahaan-perusahaan yang beroperasi di wilayah-wilayah pemukiman Yahudi yang dibangun di atas tanah rakyat Palestina. Di berbagai wilayah pemukiman Tepi Barat dan Yerusalem Timur itu, terdapat sekitar setengah juta warga Yahudi Israel. Mereka hidup bersama tiga juta warga Palestina.

Iran Ancam Tinggalkan ‘Deklarasi Teheran’ TEHERAN, Iran (Antara/AFP): Iran mengancam keluar dari kesepakatan soal bahan bakar nuklir yang dicapai dengan bantuan Brazil dan Turki pekan ini jika negara-negara besar tidak sepenuhnya mau menerima isi kesepakatan tersebut. “Parlemen mendukung Deklarasi Teheran (tentang kesepakatan bahan bakar nuklir) secara penuh. Kalau mereka mempertimbangkannya secara parsial, parlemen tidak akan menerimanya,” kata Ketua Parlemen Iran Ali Larijani, Sabtu (22/5). Seperti dikutip Kantor Berita IRNA, Larijani mengatakan, jika negaranegara besar punya tuntutan ekstra dan berniat curang, kondisi demikian tidak cocok dengan Deklarasi Teheran. Pekan ini, Brazil dan Turki berhasil membantu tercapainya kesepakatan berkaitan dengan penyelesaian program nuklir Iran. Kesepakatan tentang pengiriman separuh bahan uranium yang sudah mendapatkan pengayaan rendah untuk ditukarkan dengan bahan bakar reaktor nuklir ini merupakan pengakuan terhadap hak Iran melakukan pengayaan uranium untuk tujuan damai. Namun Dewan Keamanan PBB telah meminta Iran menghentikan pengayaan uranium dalam lima resolusinya. Sebaliknya, negara-negara besar yang dipimpin Amerika Serikat (AS) justru terus berupaya menggolkan sanksi-sanksi baru terhadap Iran. Larijani menegaskan bahwa kesepakatan itu berisi sejumlah hal dipandang Iran sebagai tawaran kepadanya dan pihak lain. Sebelumnya, Wakil Ketua Parlemen Iran Mohammad Reza Bahonar mengingatkan bahwa Teheran akan keluar dari kesepakatan itu jika DK PBB menjatuhkan sanksi-sanksi baru berkaitan dengan langkah Iran melanjutkan pengayaan uranium. Iran menolak tuduhan bahwa dia berupaya membangun senjata nuklir melalui pengayaan uranium. Sebaliknya, sebagai penandatangan Perjanjian Non-Proliferasi Nuklir, Iran berhak melakukan pengayaan uranium untuk menghasilkan bahan bakar nuklir. Februari lalu, langkah Iran menaikkan pengayaan uraniumnya hingga 20 persen yang sebenarnya masih jauh di bawah kemampuan membuat bom nuklir telah menimbulkan keprihatinan sejumlah negara. Selasa lalu, AS menyerahkan naskah resolusi PBB yang meminta pengawasan ketat internasional atas bank, perkapalan, dan bisnis Iran yang bisa saja berhubungan dengan kegiatan nuklir negara itu. Berkaitan dengan persetujuan Iran membarter uranium yang sudah mendapat pengayaan rendah untuk bahan bakar nuklirnya itu, Sekjen PBB Ban Ki-moon menyebutnya sebagai sebuah perkembangan positif. Namun persetujuan Iran itu perlu diikuti dengan kesepakatan yang lebih luas dengan masyarakat internasional, katanya. Sekjen PBB mengimbau Teheran yang sudah menandatangani kesepakatan penukaran nuklir dengan Brazil dan Turki itu agar memenuhi resolusi DK-PBB. Iran juga diminta bekerja sama secara penuh dengan Badan Energi Atom Internasional (IAEA).

WASPADA Senin 24 Mei 2010

Miliki SS Dan Ganja Diringkus PEMATANGSIANTAR (Waspada): Dua pria NM, 27, warga Kampung Tempel, Kel.Kerasaan, Kec. Pematang Bandar, Kab.Simalungun dan DMS, 28, warga Kampung Lanbau, Kel. Bandar Mariah, Kec.Pematang Bandar, Simalungun memiliki shabu-shabu (SS) dan ganja hingga diringkus pihak Polres Simalungun. Keterangan dihimpun menyebutkan, NM diringkus Polres Simalungun di depan rumah makan Fatimah, Kamis (20/5) pukul 13:30. Sedang DMS diringkus pihak Polres Simalungun di Kampung Lanbau, Kelurahan Bandar Mariah, Kec.Pematang Bandar, Simalungun pada hari yang sama pukul 14:30. NM diringkus sesudah mendapat informasi dari masyarakat yang menyebutkan NM membawa SS di depan rumah makan Fatimah. Informasi itu segera ditindaklanjuti dan meringkus NM. Saat diringkus, ditemukan SS seberat 0,2 gram dan satu bungkus kecil ganja seberat lebih kurang 0,1 gram. Ketika dilakukan pengembangan, NM mengaku SS itu diperolehnya dari DMS hingga personil Polres Simalungun melakukan pengejaran terhadap DMS. Ketika DMS ditemukan, personil Polres Simalungun segera meringkus DMS dan saat digeledah ditemukan dua bungkus kecil SS 0,2 gram. NM dan DMS selanjutnya diboyong bersama barang bukti ke Sat Narkoba Polres Simalungun dan ditahan. Kapolres Simalungun AKBP Rudi Hartono SH, SIK saat dikonfirmasi melalui Pahumas Kompol Ramli Sirait dan Kasat Narkoba Nelson Situmorang, SH di Mapolres, Jumat (21/5) menyebutkan, DMS merupakan residivis kasus narkotika dan baru satu bulan keluar dari penjara.(a14)

Sumatera Utara BPK Fokuskan Pemeriksaan Anggaran DPRD Samosir TA 2009 SAMOSIR ( Waspada) : Selama kurun waktu 2 bulan yang dimulai April 2010, BPK RI Wilayah Medan melakukan audit keuangan Pemkab Samosir TA 2009 yang dipusatkan di Ruang Rapat Inspektorat Kab. Samosir. Saat hendak ditemui Waspada di Kantor Inspektorat pekan lalu, pihak BPK tidak berada di lokasi, namun Kepala Inspektorat Kabupaten Samosir Tombor Simbolon,SH menyebutkan, BPK lagi melakukan pemeriksaan ke lapangan. Ketua Tim pemeriksa BPK di Samosir Wowo, Kamis (20/ 5) menyebutkan, pemeriksaan keuangan di Samosir cukup luas hingga mencapai 65 SKPD termasuk Sekretariat DPRD Kab. Samosir.

Dipastikan, pihak BPK akan memfokuskan pemeriksaan secara intensif terkait penggunaan anggaran di Sekretariat DPRD Samosir TA 2009 akhir Mei atau awal. BPK perlu melakukan pemeriksaan secara intensif terkait penggunaan anggaran Setwan Samosir TA 2009 di antaranya rapat koordinasi dan konsultasi keluar daerah Rp1.241.250.000, rapat koordinasi dalam daerah Rp 566.650.000, penyediaan jasa pemeliharaan kesehatan DPRD Rp 560.250.000, rapat paripurna Rp232.000.000, kegiatan reses Rp.413.475.000, Penunjang Pansus pansus DPRD Rp203. 700.000, publikasi kegiatan DPRD Rp95.000.000. Ketua DPP Aurel Citra Independen Silverius N, SH yang

diwakili Ketua DPD ACI Samosir, Kamis (20/5) menyebutkan, terkait temuan BPK No.7/S/ XVIII.MDN/8/2008 tanggal 11 Agustus 2008 terkait dana TKI, pihak BPK sudah mengingatkan Bupati Samosir agar dana dikembalikan ke Kas Negara. Sekretaris Dewan Kab. Samosir Mangihut Sinaga saat dihubungi Waspada, Kamis (20/ 5) tidak bersedia menjawab. (c10)


DPRDSU Sesalkan PTPN IV Soal Konversi Perkebunan Teh Simalungun Jadi Sawit MEDAN (Waspada): Sejumlah anggota DPRD Sumut menyesalkantindakanPTPNIVyang melakukan konversi (perubahan) tanaman teh menjadi tanaman kelapa sawit di Bah Butong wilayah Kabupaten Simalungun. Karena konversi tersebut akan berdampak langsung menimbulkan banjir. Hal tersebut diungkapkan anggota Komisi C DPRD Sumut EfendiNapitupuludanIrwansyah Damanik yang merupakan anggota dewan dari dapil Pematangsiantar dan Simalungun kepada wartawan,Selasa(18/5)diMedan. Efendi menyatakan, seharusnyaPTPNIVsebagaisalahsatu BUMN tidak senantiasa ber-

orientasi kepada keuntungan dari perusahaan saja. Tapi ada halhalyangharusdipertahankandari perkebunan teh tersebut. Apalagi, kata Efendi, kondisi alam kebun di Simalungun (daerah Marjanji dan Raya), mendukung untuk perkebunan teh, serta sudah menjadi ciri khas potensiyangdimilikiSimalungun. Bahkan kualitas teh BahbutongSimalungun termasuk terbaik di dunia. â&#x20AC;&#x153;Meski kebun teh itu dinilai tidak menguntungkan, tapi ada nilaikeuntungannya,karenatanaman teh ternyata bisa menahan erosi dan banjir.Tapi dengan merubah tanaman teh jadi sawit dapat merubah iklim dan kondisi

lahan akan smakin gersang,â&#x20AC;? ujar Irwansyah. Irwansyah Damanik mencontohkan sejumlah daerah yang sudah mengalami banjir akibat dampak dari konversi tanaman teh menjadi tanaman sawit. SepertiTanah Jawa, Jawa MarajaBah Jambi yang langsung menerimadampakakibatperubahan tanaman tersebut. Sebab, ungkap Irwansyah, tanaman kelapa sawit per pohon butuh air 25.000 liter air. Bahkan kalau usia tanah sudah ditanami sawitselama75tahun,makaakan meninggalkanbakteriyangmembahayakan terhadap kualitas tanah tersebut dan hal ini berdampak sangat fatal terhadap tanah Simalungun. (h11)

B10 PDAM Tirta Malem Karo Sesuaikan Tarif Air KABANJAHE (Waspada): Berdasarkan hasil rapat dewan direksi dengan forum pelanggan dan Badan Pengawas, Perusahaan Daerah Air Minum (PDAM) Tirta Malem Kabupaten Karo, yang dituangkan dalam SK Bupati Karo Nomor 690/114/PDAM/2010, terhitung mulai 1 Juni 2010 akan melakukan penyesuaian tarif air minum dari Rp 700, per m3 menjadi Rp 1.250 per m3 (per 1.000 liter) kepada setiap pelanggan. Hal ini dikatakan Direktur Utama PDAM Tirta Malem Drs Antoni Sembiring melalui Direktur Umum Esra Tarigan, ST didampingi Drs Syamsudin P Sinurat kepada wartawan, Kamis (20/5). Menurut Antony Sembiring, dinaikkannya tarif air minum ini kepada pelanggan di seluruh Karo, karena sejak 2003 sampai sekarang PDAM Tirta Malem belum pernah melakukan penyesuaian tarif terhadap pelanggannya. Selain, akibat kenaikan tarif dasar listrik PLN, dan bertambahnya biaya operasional serta naiknnya gaji pegawai PDAM Tirta Malem, penyesuaian tarif air minum harus dilakukan, karena sifatnya sangat mendesak, disamping naiknya harga-harga barang dan inflasi. Oleh karena itu, kata Dirum Esra Ginting, PDAM Tirta Malem Kabupaten Karo menganggap perlu melakukan penyesuaian tariff. Menanggapi kenaikan tari air minum di Karo, Wakil Ketua DPRD Karo Ferianta Purba SE ditemui secara terpisah mengatakan, sepanjang tidak bertentangan dengan peraturan dan perundangundangan, hal itu tidak menjadi masalah. “Namun yang terpenting kalau tarif sudah naik, hendaknya pihak PDAM Tirta Malem harus juga meningkatkan pelayanannya terhadap pelanggan, karena kita tau sendiri khusus di kota Kabanjahe kebutuhan air bersih cukup tinggi,” ujarnya. (c06)

Sumatera Utara Pengelolaan Perkebunan Di Labusel Demi Tersedianya Lapangan Pekerjaan KOTAPINANG(Waspada): Posisi topografis Labuhanbatu Selatan, ibukota Kotapinang persimpangan yang menghubungkan daerah di sebelah selatan Tapanuli dengan sebelah utara Labuhanbatu, Asahan dan Riau merupakan potensi yang menjadikan Labusel sebagai kawasan Industri dan perdagangan. Oleh sebab itu Labusel harus membuka diri bagi investor yang ingin menanamkan modal dan pemerintah setempat akan mengupayakan jaminan berusaha. “Labusel harus bisa menarik para investor dari luar untuk membantu membangun Labusel,” ungkap Drs Evendi Ritonga kepadaWaspadabeberapawaktu lalu. Disisi lain, luas wilayah perkebunan kelapa sawit dan karet sangatmendukungmewujudkan Labusel sebagai kawasan industri baik berupa pengolahan bahan baku menjadi bahan mentah dan

bahan setengah jadi maupun produkjadi.Asupan-asupanyang mendukung perwujudan senantiasa dilakukan seperti perbaikan sarana infrastruktur pendukung seperti jalan dan jembatan. “Pemkab seharusnya memberikan jaminan berusaha bagi setiap investor yang ingin menanamkan modal di Labusel,” jelasnya. Menurutnya,dalamperspektif pembangunan seluruh daya dan upaya yang dilakukan terhadap pembangunan itu untuk kesejahteraan rakyat. Oleh sebab itu, Pemkab Labusel harus memperhatikan aspek-aspek tersebut sehingga pembangunan dapat dirasakan manfaatnya oleh masyarakat. “Seharusnya pemerintah menjadi guru terhadap aspek pembangunan masyarakat bukan menjadi murid,” ucapnya. Dia mengartikan pemerintah bertindak sebagai guru bertindak yang mengarahkan murid dalam

hal ini masyarakat dalam upaya melakukan pembangunan. Jika sebaliknyayangterjadimakapembangunan banyak yang ditolak masyarakat karena pembangunan yang dilaksanakan tidak menyentuh sama sekali bagi masyarakat. “Pemerintah yang mengajak para investor dan mengarahkannya pada masyarakat karena keberadaan investor akan membantuketersediaanlapangankerja bagimasyarakatLabusel,”tegasnya. Halinilahyangmengoptimalkan pembangunan secara langsung kepada masyarakat agar masyarakattidakmenolaksemua program-program pembangunanyangdisusunolehpemerintah daerah. Dia juga menjelaskan berdasarkan data BPS Kab. Labuhanbatu 2008 produksi kelapa sawit tahun 2008 menunjukkan luas lahan 342Ha dengan produksi tandan buah segar (TBS) 5,2 juta

ton. Jumlah ini diikuti oleh pertumbuhan pabrik Pengolahan KelapaSawit(PKS)42unitdengan total produksi 5,2 ton. Sedangkan perkebunan karet dengan total areal mencapai 88ribu hektar dan produksi 88 ribu ton yang didukung oleh pabrik pengolahan karet sebanyak 8 unit. ”Labusel sangat potensial dikembangkan sebagai kawasan industri khususnya industri pengolahan kelapa sawit dan karet karena kedua komoditas ini merupakan sektor unggulan Labusel,” lanjutnya. Industri pengolahan kelapa sawit dan karet serta industri lain telah menyerap sekira 24 ribu angkatan kerja yang tersedia di Labusel sehingga berdampak pada menurunnya angka pengangguran. ”Ini semua harus dilakukan bersama masyarakat danpemerintahuntukmewujudkan Labusel bermartabat dan sejahtera,” tutupnya. (rel/c05)

WASPADA Senin 24 Mei 2010

ASTTI Sumut Dan Gapensi Karo Gelar Pelatihan Tenaga Kerja 2010 KABANJAHE (Waspada) : ASTTI (Asosiasi Tenaga Teknik Indonesia) cabang Sumut bekerja sama dengan Gapensi Karo, Selasa (18/5) mengadakan pelatihan tenaga kerja kepada 159 peserta yang dilaksanakan aula Universitas Quality Karo . Pelatihan tenaga kerja yang kedua kali ini dilaksanakan di Karo selain diikuti 100 peserta dari luar daerah juga diikuti 59 peserta dari PUD Karo berlangsung selama sehari ini bertujuan sebagai syarat penting untuk dapat mengikuti tender, demi membangun lebih baik dan yang paling utama bertanggungjawab dengan tugas yang dilakukan pemenang tender yang ada di Tanah Karo. Dalam pelatihan tenaga kerja yang diketuai panitia B Ginting merespon dari segi sosial ke depan demi menunjang tingkat krebilitas tenaga kerja di dalam menambah kualitas di Tanah Karo sendiri ini. (a17)

Panwas Pangururan Tidak Pandang Bulu SAMOSIR (Waspada) : Dalam menjalankan tugas pengawasan pelaksanaan Pemilukada di Kab. Samosir 2010 untuk wilayah Kec. Pangururan sebagai barometer Samosir, Panwas Pangururan di bawah kepemimpinan Pardamean Naibaho tidak pandang bulu dan sapu bersih setiap pelanggaran yang terjadi. Hal ini ditegaskan Ketua Panwas Pemilukada Kec. Pangururan Pardamean Naibaho menjawab Waspada, Kamis (20/5) di kantornya. Sejak awal April, tepatnya tahapan kampanye, Panwas Pangururan menemukan dua pelanggaran di antaranya pemasangan baliho yang tidak sesuai aturan di mana pemasangan baliho beserta stiker persis berada di Pagar Sekolah SMUN 1 di Pintu Sona dan sudah dilaporkan ke KPU Samosir. Dan bila ditemukan money politik dan pemberian lainnya, Panwas Pangururan tidak segan-segan menyeret ke tindak pidana. (c10)

Sumatera Utara Lahan Gerhan Di TNGL Digarap WASPADA Senin 24 Mei 2010

BESITANG (Waspada): Program gerakan hutan dan lahan (gerhan) tahun 2008 di kawasan Balai Besar TNGL Resort Sekoci, Kec. Besitang, yang menghabiskan dana miliaran rupiah terancam sia-sia karena tidak adanya perawatan yang berkelanjutan. Selain mencuatnya dugaan kolusi, korupsi dan nepotisme (KKN) dalam proses pelaksa-

Penipuan Jual Beli Tanah, Korban Rugi Rp50 Juta P. SIANTAR (Waspada): Sa, 65, warga Jalan Ragi Idup, Nagori Pematang Simalungun, Siantar, didugamenipuseseorang sebesar Rp 50 juta dalam penjanjian jual beli tanah dan rumah. Korban, Bambang Cahyono, 48, warga Jalan Bawal, Pajak Baru, Belawan, Kota Medan dalam pengaduannya di Polres Simalungun,Kamis(20/5)menyebutkan, Sa diduga melakukan penipuan terhadapnya di rumah Sa di Jalan Ragi Idup, Nagori Pematang Simalungun, Rabu (5/5) pukul 20:00. Penipuan itu dilakukan Sa dengan mendatangi korban ke rumahnya pada November 2009 dan membujuk korban agar membeli tanah dan rumah miliknya di Jalan Ragi Idup, Nagori Pematang Simalungun dengan perjanjian tiga kali bayar. Korban saat itu setuju membeli tanah dan rumah Sa sesuai dengan perjanjian dan memberikan uang panjar Rp 50 juta. Pada saat korban hendak melunasi sisa pembayaran kepada Sa, Rabu (5/ 5), ternyata Sa sudah sudah menjual tanah dan rumah miliknya kepada orang lain. â&#x20AC;&#x153;Korban mencoba meminta tanggungjawab Sa atas perjanjian mereka, namun Sa tidak memperdulikannya hingga korban yang merasa keberatan akibat dirugikan mencapai Rp 50 juta akhirnya memutuskan mengadukan Sa ke Polres Simalungun denganmenyertakanbarangbukti satulembarkwitansitandaterima uang Rp 50 juta,â&#x20AC;? sebut Kapolres Simalungun AKBP Rudi Hartono, SH, SIK, Jumat (21/5).(a14)

naan program pada waktu, kini areal itu terancam dirambah sekelompok warga. Sesuai catatan Waspada, pihak TNGL bersama Polres Langkat tahun 2006/2007 melaksanakan Operasi Hutan Lestari (OHL) dan mengeksekusi rumah serta memusnahkan ratusan hektar tanaman kelapa sawit. Setahun pasca OHL, kawasan hutan yang telah kritis tersebut ditanami beberapa jenis pohon lewat program Gerhan. Ironisnya, setelah penanaman, nyaris tidak ada perawatan, bahkan sekelompok penggarap kembali mencoba masuk untuk bercocok tanam.

Warga lokal ketika itu mengancam, jika pemerintah tidak merelokasi para pengungsi yang telah merambah kawasan hutan sejak tahun 1999, maka mereka akan masuk menggarap. Warga kecewa, karena tidak ada kepastian dan ketegasan dari pemerintah terkait rencaba relokasi pengungsil. Mereka kecewa sekaligus cemburu melihat keberadaan para pengungsi yang terkesan dibiarkan merambah hutan. Dipicu rasa kecemburuan sosial inilah, sekelompok warga nekad berspekluasi menggarap kawasan hutan di kawasan Towe r d a n Ba ra k In d u k .

Sebagian dari perambah telah melakukan penanaman pohon rambung. Ka. SPTN VI BB TNGL, Subhan, S. Hut, dikonfirmasi Waspada, Minggu (23/5) petang mengatakan, mengatasi aksi perambahan akan semakin sulit jika para pengungsi tidak segera direlokasi. Ia sendiri mengaku tidak mengetahui kapan pengungsi dapat direlokasi. Saat ini, lanjutnya, untuk menekan laju aksi perambahan, pihaknya berupaya melakukan pendekatan kepada warga lokal Ia memperkirakan, aksi perambahan terhitung dari awal 2010 mencapai 200 hektare. (a02)


Sumatera Utara

WASPADA Senin 24 Mei 2010

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:23 12:37 12:24 12:31 12:31 12:27 12:24 12:20 12:26

‘Ashar 15:47 15:59 15:47 15:54 15:54 15:51 15:47 15:43 15:50

Magrib 18:33 18:49 18:33 18:43 18:41 18:34 18:33 18:28 18:36



Shubuh Syuruq


19:45 20:02 19:46 19:56 19:54 19:46 19:45 19:41 19:48

04:43 04:53 04:43 04:48 04:48 04:50 04:44 04:40 04:46

04:53 05:03 04:53 04:58 04:58 05:00 04:54 04:50 04:56

Langsa 12:26 L.Seumawe 12:29 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:33 P.Sidimpuan12:21 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19

06:12 06:23 06:13 06:17 06:18 06:19 06:13 06:09 06:15

Zhuhur ‘Ashar 15:49 15:52 15:46 15:45 15:56 15:44 15:45 15:45 15:42




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:36 18:41 18:32 18:31 18:43 18:27 18:30 18:29 18:26

19:49 19:54 19:44 19:44 19:56 19:39 19:43 19:42 19:38

04:44 04:46 04:42 04:41 04:52 04:44 04:42 04:43 04:40

04:54 04:56 04:52 04:51 05:02 04:54 04:52 04:53 04:50

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:36 12:23 12:23 12:24 12:34 12:27 12:24 12:31 12:19 12:29

18:49 18:30 18:29 18:32 18:46 18:34 18:33 18:41 18:27 18:38

20:02 19:42 19:42 19:45 19:59 19:47 19:46 19:54 19:40 19:51

04:52 04:45 04:45 04:45 04:50 04:48 04:43 04:48 04:39 04:49

05:02 04:55 04:55 04:55 05:00 04:58 04:53 04:58 04:49 05:59

Tarutung 12:22 T.Tinggi 12:21 Panyabungan 12:20 Teluk Dalam12:27 Salak 12:25 Limapuluh 12:20 Parapat 12:22 GunungTua 12:19 Sibuhuan 12:19 Lhoksukon 12:29

06:13 06:16 06:11 06:10 06:21 06:13 06:11 06:12 06:09

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

Ratusan Pohon Jati Di Areal PTPN IV Adolina Diperjual Belikan PANTAI CERMIN (Waspada): Penebangan pohon jati yang berjajar rapi di tepi jalan Perbaungan menuju Pantai Cermin, tepatnya di Desa Ujung Rambung dan Celawan dipertanyakan. Sebab selama ini pohon itu diketahui milik PTPN IV Kebun Adolina. Hasil penelusuran Waspada, proyek kayu jati yang bernilai ratusan juta rupiah diduga sudah direkayasa sejak awal sampai kepada proses pembagian hasil untuk pihak yang terlibat. Karena 116 pohon kayu jati yang telah berusia 20 tahun lebih dan berdiameter 50 cm itu, hanya dibayarkan Rp 2.251.750 kepada kas Pemerintah Kabupaten Serdang Bedagai melalui Dinas Kehutanan dan Perkebunan (Dishutbun). Menurut Kepala Desa Ujung Rambung Sunaryo,40, saat ditemui dirumahnya, Jumat (21/5) mengatakan, awalnya pihak PTPN IV Kebun Adolina melalui suratnya nomor 85/HGU/BPN/94 ditanda tangani Manejer unit bernama H A. Syarifuddin Lubis selaku pemilik pohon dan lahan menyurati agar Pemerintah Desa Ujung Rambung dan Celawan mengajukan permohonan penebangan dan penertiban pohon jati karena berpotensi tumbang dan mencelakai orang. Kemudian setelah tiga kali kedua perangkat desa itu bermusyawarah bersama Muspika Pantai Cermin, kedua desa membalas surat yang dilayangkan Kebun Adolina sebelumnya. Permohonan kedua desa sebagai formalitas untuk melegalisasi penertiban pohon. Intinya Kebun Adolina menyerahkan asetnya dan desa mewakili Pemkab Sergai bertanggungjawab untuk melaksanakannya. “Pertemuan yang ketiga kalinya di kantor Camat Pantai Cermin, pembelinya sudah ada, namun nilai kontraknya kami tidak diberitahu. Hanya saja Desa Ujung Rambung dan Celawan menerima dana sebanyak Rp 20 juta melalui rekening,” ujar Sunaryo. Dikatakan, meskipun uang sudah diterimanya melalui rekening namun belum ada mengambil atau menggunakannya. Sunaryo dan perangkat desanya berencana akan membeli lahan untuk pembangunan Pos Kesehatan Desa (Poskesdes) dengan uang penjualan kayu jati itu. Kepala Seksi Penertiban Peredaran Hasil Hutan dan Pelaporan Dishutbun Sergai, Kamaluzzaman SP mengatakan, mereka bisa mengeluarkan Surat Keterangan Hasil hutan (SKHH), setelah pemilik kayu mengajukan permohonan untuk ditebang dan pengangkutan dibuktikan dokumen dan persyaratan yang telah ditetapkan . “Kami hanya menerima pembayaran SKHH dan itu dibayarkan ke kas Pemkab Sergai, meski demikian sebelumnya kita juga telah meninjau kelokasi untuk meneliti asal usul kayu,” kata Kamal. Disebutkan, Dishutbun Sergai dalam meneliti asal usul kayu jati telah menunjuk seorang pejabat pembuat Surat Keterangan Asal Usul (SKAU) kayu dalam hal ini diwakili Sutikno Kepala Desa Petuaran Hilir, Kecamatan Pegajahan. (a07)

Bank Sumut Sei Rampah Buka Peluang Usaha Para Ibu SEI RAMPAH (Waspada): PT Bank Sumut Cabang Sei Rampah membuka peluang usaha bagi para ibu ibu di Kab.Serdang Bedagai. Hal itu sesuai dengan program Kredit Peduli Usaha Mikro Sumut Sejahtera (KPUMSS) yang telah diluncurkan sejak November 2009 hingga bulan Mei 2010 ini. Demikian disampaikan Pimpinan Cabang PT Bank Sumut Sei Rampah,T Ade Maulanza di Sei Rampah, Sabtu (22/5) sore. Menurutnya, PT Bank Sumut Cabang Sei Rampah telah menggulirkan dana pinjaman tanpa jaminan sebesar Rp.725 juta kepada 19 kelompok Kredit Peduli Usaha Mikro Sumut Sejahtera (KPUMSS) khususnya kepada perempuan yang mempunyai usaha kecil yang produktif di Kab.Serdang Bedagai. Dikatakan T Ade Maulanza, pinjaman khusus untuk kaum hawa ini disalurkan ke setiap tiap kelompok dengan catatan syaratnya setiap kelompok harus menimal mempunyai 20 hingga 30 orang yang terdiri dari ketua, sekretaris dan bendahara. Apabila pinjaman ini berjalan dengan lancar sesuai aturan yang diberlakukan PT Bank Sumut, maka PT Bank Sumut akan memberikan pinjaman yang lebih besar lagi secara bertahap kepada masing-masing kelompok dari penjaman minimal pertama sebesar Rp500.000 hingga pinjaman maximal Rp5.000.000 per anggota tanpa jaminan. Program KPUMSS ini adalah gagasan dari Direktur Utama PT Bank Sumut yaitu H Gus Irawan Pasaribu, SE.AK.MM yang diluncurkan untuk membantu dan mendukung program pemerintah guna meningkatkan taraf kehidupan masyarakat pra sejahtera khsusnya diperuntukan bagi kaum hawa. Sementara itu dijelaskan, suku bunga pinjaman tanpa jaminan ini juga sangat ringan dan untuk pengembalian pinjaman itu dilakukan setiap minggunya yang masing-masing kelompok berkumpul di rumah salah seorang anggota kelompok, yang pengutipan ansurannya dikutip petugas lapangan 2 orang Account Officer (AO) dari PT.Bank Sumut Cabang Sei Rampah. Sedangkan syarat pinjaman KPUMSS harus beranggotakan 20-30 orang dan melampirkan fotokopy KTP suami dan istri,kartu keluarga dan pas foto asli. Hingga saat ini tingkat kredit macet KPUMSS di Kab.Serdang Bedagai sebesar 0 persen, kata T.Ade Maulanza. (a07)

Pembuat Dodol Edarkan Shabu Diringkus PERBAUNGAN(Waspada): AS alias Jipo,23, warga Dusun III Desa Bengkel, Kec. Perbaungan, Kab.Serdang Bedagai diringkus Sat Narkoba Polres Sergai dari kediamannya, Sabtu (22/5) malam sekira pukul 22:30 karena terbukti memiliki dua paket sabhu senilai Rp.200 ribu. Menurut pemuda yang sehari harinya bekerja sebagai pembuat dodol itu di sela sela pemeriksaan petugas, Minggu (23/5), kegiatan mengedarkan narkotika jenis sabhu itu dilakukannya telah berlangsung sebulan lebih dengan omzet keuntungan Rp 1,5 juta. “Dalam satu gram sabu yang dibeli dengan harga Rp 1,2 juta, dibuat menjadi paket kecil sebanyak 30 paket dengan harga eceran Rp 100 ribu,’’ katanya. Tersangka menyebutkan, barang haram itu diperolehnya dari seorang yang bernama Rijal warga Pasar VIII Tembung, Percut Sei Tuan, Deliserdang. Kasat Narkoba Iptu Irsol ketika dikonfirmasi Minggu menyatakan tersangka masih dalam proses pemeriksaan. (a07)

Gudang Penampungan CPO Ilegal Merajalela PERBAUNGAN (Waspada): Sejak dua bulan terakhir ini gudang penampungan CPO yang terletak ditepi Jalinsum MedanTebingtinggi, tepatnya di Desa Sei Buluh, Kec.Perbaungan, Kab. Serdang Bedagai atau persis di simpang Jalan Sampurno merajalela. Pantauan Waspada, Kamis (20/5) saat melintas di lokasi gudang CPO itu hampir ratusan mobil tangki yang membawa CPO setiap harinya singgah untuk kencing. Di pintu masuk gudang dikawal oknum aparat. Kalau ada orang yang dicurigai lalu oknum aparat dan sipil itu mendatangi untuk memberikan uang minyak. Menurut sumber sistem permainan sopir bisa menjual minyak CPO, tetapi pemilik minyak tidak rugi karena kerani timbang di PKS sudah main dengan pengemudi truk tanki. Misalnya muatan truk 15.000 liter, petugas timbangan melebihinya ataupun minyak yang sudah dijual ditambah dengan air,sehingga CPO yang dibawa tidak nampak berkurang. (a07)


15:59 15:46 15:46 15:48 15:57 15:50 15:47 15:54 15:42 15:52

06:22 06:14 06:14 06:14 06:20 06:17 06:12 06:18 06:09 06:18

Zhuhur ‘Ashar 15:46 15:45 15:43 15:50 15:48 15:44 15:46 15:43 15:43 15:52




Shubuh Syuruq

18:29 18:30 18:25 18:32 18:32 18:29 18:30 18:26 18:25 18:40

19:42 19:43 19:37 19:44 19:45 19:42 19:43 19:38 19:37 19:53

04:44 04:41 04:43 04:51 04:46 04:40 04:43 04:42 04:42 04:46

04:54 04:51 04:53 05:01 04:56 04:50 04:53 04:52 04:52 04:56

06:13 06:10 06:12 06:20 06:15 06:09 06:12 06:11 06:11 06:15

Dua Terdakwa Korupsi Di Binjai Dituntut 54 Bulan Penjara BINJAI (Waspada): Dua terdakwa korupsi di Pemko Binjai dituntut 54 bulan penjara ditambah denda Rp100 juta dan mengganti kerugian Rp. 434.525.300. Jaksa Penuntut Umum Rinaldi Umar ketika membacakan tuntutan, Jumat (21/5) di PN Binjai dengan majelis hakim dipimpin Saut M Pasaribu, kedua terdakwa R selaku Penjabat Pembuat Komitmen (PPK) dan SP selaku pengusaha yang me-

menangkan dua proyek PDAM Tirtasari Binjai 2006 terbukti merugikan Negara Rp540 juta, sesuai perhitungan BPKP serta keterangan dari 25 saksi. R selaku Penjabat Pembuat Komitmen (PPK) dipersalahkan melakukan penyusunan HPS dengan mark up dan tidak sesuai dengan Keppres 80/2003. Seharusnya HPS dibuat oleh panitia lelang. R, oleh JPU Rinaldi Umar disebutkan terbuktu bersalah dengan melanggar pasal 3 ayat 1 dari UU No.31 tahun 1999 yo UU No:20 tahun 2001 yo pasal 65 yo pasal 55 ayat 1 KHU Pidana sehinggadituntut24bulanpenjara

potong masa tahanan dan denda Rp50 juta subsider tiga bulan kurungan. Pengusaha SP sebagai pekerja dengan menggunakan dua perusahaan milik orang lain CV Mencirim Jaya dengan Direktur UK yang juga ikut sebagai terdakwa dan sudah dituntut 24 bulan penjara. Kemudian CV Rizki Syahpura milik Sofyan Pardede yang dikuasai, tidak mengerjakan proyekdanmenyerahkankepada karyawan PDAM Tirtasari Binjai Sugeng. JPU Rinaldi Umar menilai SP melakukan penyalahgunaan dengan mencari keuntungan

pribadi dan orang lain.dan terbukti melanggar pasal 3 jo 18 UU No.31 tahun 1999 yo UU No.20 tahun 2001 jo pasal 65 jo pasal 55 ayat 1 KUH Pidana dituntut 30bulanpenjaraditambahdenda Rp50 juta dengan subsider tiga bulan kurangan serta mengganti kerugian negara Rp. 434.525.300 dalamtemposatubulan.Jikamasa tempo satu bulan tidak dibayar harta terdakwa SP bisa dirampas. Apabila harta terdakwa tidak mencukupi hukuman ditambah 10 bulan masa tahanan. Kedua terdakwa R dan SP ,usai pembacaan tuntutan, Jumat

(21/5)mengakuituntutankepada merekasangatberat.Sepertidiakui R di persidangan,tidak ada tersangka SP maupun UK menyebutkan ia menerima uang. R mengakuimelakukantugassesuai prosedur. Jika dipersalahkan menaikkan harga perhitungan sendiri (HPS) yang seharusnya dikerjakan panitia lelang, R membenarkan dan kesalahan itu tidak sendiri. Jika HPS tidak dikerjakanakibatpanitialelangtidak mampu, pekerjaan itu juga brordinasi dengan Kepala Dinas Praswil (kini Dinas PU). Dengan persetujuan Kepala Dinas R me-

ngerjakan HPS dan mengikuti perintahKadisPraswildalamHPS harus disisipkan setoran untuk Walikota Binjai 15 persen. Sebagai bawahan tidak mungkin melanggar perintah atasan,dan mau tidak mau HPS dipertinggi untuk bisa menyisihkan dana untuk walikota Binjai 15 persen. Penasehat hukum R dan SP, Betman akan melakukan pembelaan 31 mei 2010 dan secara khusus R juga akan membacakan pembelaan ,sebab R menilai hukuman kepadanya tidak pantas. (a03)

Hasil Inventarisasi PLN Binjai Temukan Penyelewengan Materil BINJAI (Waspada): Kerusakan jaringan dan trafo di wilayah PLN Cabang Binjai seperti terbakarnya trafo di Jalan Semarang Kamismalam(20/5)mengakibatkanaliranlistrikpadamdaripukul 23:00 sampai Jumat (21/5) pukul 11:30. Ternyata trafo yang diperbaiki kembali mengalami kerusakan Sabtu malam ( 22/5) juga mengakibatkan aliran listrik kerumah pelanggan padam sekira lima jam, akibat materil PLN banyak diselewengkan. Menurut petugas,trafoyangdigantijugabarang bekas, sebab yang baru tidak ada. Terjadinya pemasangan materil bekas yang hanya dicat oleh PLN Cabang Binjai disebabkan adanya penyelewengan sisa materil. Hasil inventarisasi dilakukan Desember 2009 untuk materil sampai Juni 2007, PLN Cabang Binjai dirugikan sampai Rp117.479.344. Penyelewengan itu diduga dilakukan mantan kepala gudang. Data daftar sisa materil yang bermasalah yang dibuat 4 Januari 2010 ditandatangani Manajer Cab.Binjai Ir Pintor Rumapea, Asisten Manajer SDM dan ADM Muslim, yang diperiksa SPV Tan

Emmy Sinaga dan SPV Logistik BinsarTambunan (tidak menandatangani). Hasil inventarisasi dibuat Asisten OfficerADM Logistik Karna.S ditemukan penyelewengan . Materil Wichgear dan jaringan yaitu Cross Am Steel UNP 10 x 200 mm Hotpid 18 buah bernilai Rp3.861.000. Rack CT sebanyak satu buah nilai Rp1.705.000. Bidang Swischgear dan jaringan yaitu barang relay skunder sebanyak empat buah dengan harga Rp67.320.000. Materil Transformator terdiri CT 60/5 Amp 220volt sebanyak 15 buah total harga Rp1.458.195. CT 200/SA.TR , tiga buah bernilai Rp511.500. CT 250 SATR sebanayak lima buah bernilai Rp1.160.500. CT 300/SATR tidak ditemukan tujuh buah seharga Rp1.624.700 dan CT.TM 200/400/ 5A 20KV Indoor sebanyak tiga buah dengan nilai Rp1.165.746. Materil kabel juga diselewengkan jenis kabel NYFGBY 4x 120 mm sebanyak tiga unit bernilai Rp1.848.000. Kabel TIC 3 x 35 +1x25 mm 2 dan kabel TIC 3 x 50 +1 x 35 mm 2tidakditerakannilaikerugiannya. Alat ukur dan pembatas de-

ngan jenis KWH Mtr 1Phs 5/20A, 220V + MCB 4A lima unit dengan nilai Rp942.975. KWH Mtr 1 Phs 5/20 A 220V + MCB 6A sebanyak 80 unit yang dinilai seharga Rp15.087.600. KWH Mtr 1Phs 20/ 60 A 220V sebanyak empat buah harga Rp451.000.KWH Mtr 3 Phs 5/20 A 220/380V ST dua unit nilainya Rp115.128. MCCB 3 x 40 Amp juga dua buah bernilai Rp1.990.000 dan MCCB 3x300 Amp hanya satu unit seharga Rp3.168.000. Kemudian kabel Clamp On Power Hitester 380 volt digital dua unit senilai Rp15. 070.000. Total kerugian Rp.117. 479.344. PenyelewenganmaterialPLN Cabang Binjai ketika ingin dikonfirmasi di gudang induk PasarVTandem, ternyata petugas mempersilakankekantorcabang, sedangkan kantor cabang PLN Binjai, Sabtu (22/5) tutup. Namun data hasil inventarisasi yang merugikan Negara ditandatangani Manajer PLN Cabang Binjai dan Asman SDM/ ADM serta petugas pemeriksa Emmy Sinaga. Hanya SPV Logistik Binsar A Tambunan tidak menandatangani hasil inventarisasi. (a03)

Lawatan Sejarah Tiga Daerah Berakhir Di Langkat STABAT (Waspada) : Lawatan sejarah di Kota Medan, Deli Serdang dan Kab. Langkat berakhir di Pendopo rumah dinas Bupati Langkat di Stabat dalam acara penutupan, Jumat (21/5) malam. Kegiatan tahunan itu diselenggarakan Balai Pelestarian Sejarah dan Nilai Tradisional (BPSNT) Banda Aceh bekerjasama dengan Pemkab Langkat. Kepala BPSNT Banda Aceh, Djuniat, S.Sos melalui Irini Dwi Wanti selaku kordinator, lawatan ke tempat bersejarah bertujuan membangkitkan kesadaran sejarah dan menyamakan

persepsi di kalangan siswa/siswi Aceh maupun Sumut , dari keragaman budaya menjadi semangat persatuan. Selain itu membuka cakrawala kepada generasi muda tentang budaya dan simpul-simpul yang merajut keberagaman. Lawatan sejarah 2010 itu bertemakan Merajut Simpul Keindonesiaan Pada Masyarakat Multikultur di Tanah Deli, berlangsung 18 – 22 Mei. Peserta terdiri dari siswa Kota Banda Aceh, Kab. Aceh Jaya, Aceh Barat, pelajar Kab. Langkat, Deliserdang, Medan dan Simalungun. Mereka mengunjungi

tempat-tempat bersejarah di daerah itu sekaligus menampilkan beragam atraksi kesenian. Dijelaskan Kakan Pariwisata dan Kebudayaan Kab. Langkat, Hj. Punama Dewi Tarigan, dengan kegiatan itu siswa tidak hanya diberikan pelajaran sejarah di sekolah, tetapi melihat secara langsung tempat-tempat bersejarah dan memahami makna yang terkandung disetiap kunjungan. Sementara lawatan sejarah tingkat nasional ke VIII akan dilaksanakan di Kalimantan Selatan Oktober mendatang. (a38)

Waspada/Andi Nasution

TERIMA POHON PENGHIJAUAN: Bupati Deliserdang Drs H Amri Tambunan menerima secara simbolis pohon penghijauan dalam peringatan Hari Kebangkitan Nasional (Harkitnas) di Lapangan Bola Desa Bangun Rejo, Dusun II, Kec. Tanjungmorawa, Kab. Deliserdang. Sabtu (22/5).

T. Morawa Gelar Bakti Sosial Dan Peduli Lingkungan TANJUNGMORAWA(Waspada):Memperingati Hari Kebangkitan Nasional (Harkitnas) 2010 Kecamatan Tanjungmorawa menggelar berbagai acara di Lapangan Bola, Desa Bangun Rejo, Dusun II, Kec. Tanjungmorawa, Kab. Deliserdang. Sabtu (22/5). Acara yang berlangsung meriah itu yakni gerak jalan santai yang diikuti sekitar 1.500 orang dari berbagai elemen, bakti sosial seperti donor darah, penanaman pohon penghijauan dan lucky draw dengan berbagai hadiah seperti TV, kulkas, DVD, kipas angin, dispenser, setrika, blender dan lainnya. Selain itu juga diberikan secara simbolis kepada Bupati Deliserdang Drs H Amri Tambunan serta rombonganbukuSKUdenganjudulBekalPembina Dalam Pengujian Pramuka Penggalang dan pohon penghijauan. Bupati Deliserdang Drs H Amri Tambunan mengatakan, rasa bangga memiliki putra-putri terbaik Deliserdang. Untuk itu jadikanlah hasil perjuangan para pejuang sebagai motivasi untuk lebih memajukan bangsa. “Sebagai bukti kita mengingat hasil perjuangan para pejuang dan rasa syukur kepada Allah SWT serta kontribusi kepada bangsa dan negara maka mari bersama-sama memelihara kekayaan alam bangsa ini,” kata bupati. CamatTanjungmorawa Drs H Hasbi mengatakan, momentum Harkitnas 2010 diharapkan solidaritas atau semangat kebersamaan untuk menyelamatkan bumi yang sudah pada taraf pemana-

san global harus dimulai dari dini. “Kegiatan siswa menanam merupakan ruh dari apresiasi terhadap sekolah yang menjadi proritas Bupati Deliserdang Drs H Amri Tambunan dalam konsep Cerdas dan Gerakan Masyarakat Peduli Pendidikan (GMPP) dan diharapkan peningkatan kesadaransiswaterhadaplingkungan.Maribersamasama menjaga lingkungan dan tanamkan gerakan menanam,” ujarnya. Kepala Cabang Dinas Pendidikan, Pemuda dan Olahraga Tanjungmorawa Drs M Nurdin, MPd mengatakan, selaku Kacabdis Dikpora yang baru merasa bangga dan memberikan penghargaan yang setinggi-tingginya atas pelaksanaan acara itu terutama kepada Camat, GMPP, tokoh masyarakat, tokoh pemuda, para kepala sekolah dan pengawas serta para guru dan masyarakat yang mendukung acara gerakan siswa menanam dan bakti sosial seperti donor darah. Acara yang dibuka dengan pembacaan doa oleh Hengki Syaputra SPd itu dihadiri Asisten I Drs M Iqbal Nasution, Kepala Dinas Cipta Karya Ir Donald L Tobing, Kepala Dinas Kehutanan Ir Arli, Kepala Dinas Pendidikan, Pemuda dan Olahraga Drs Sofian Marpaung MPd, mantan Kacabdisdikpora Tanjungmorawa Dra Hj Sa’adah Lubis, SPd.MAP, Pengurus ENO Indonesia yang diwakili Ismail, PMI Medan, Lion Club, Muspika, para kepala desa/dusun seTanjungmorawa, para ketua yayasan maupun kepala sekolah serta para guru dan siswa se Kecamatan Tanjungmorawa dan tokoh masyarakat. (csn/a05)

Kesultanan Serdang Amanahkan Khaidar Aswan Pemangku Wajir Negeri Serdang PASCA berpulangnya ke Rahmatullah, alm. OK. H. Habibullah, sebulan yang lalu (Sabtu, 22/5 doa bersama mengenang 40 hari di rumah duka Batangkuis. semoga Allah menempatkan beliau disisiNya), juga mempengaruhi silsilah kerajaan Serdang yang selama ini masih dipegang teguh pihak kesultanan. Kekosongan jabatan sudah barang tentu terjadi, mengingat jabatan almarhum semasa hidupnya adalah sebagai Pemangku AdatWajir Negeri Serdang, yang sudah barang tentu ini akan menjadi perhatian penting bagi pihak Kesultanan Serdang. Tengku Achmad Thala’a sebagai Timbalan Adat Serdang tidak mau berleha-leha dalam menyikapi hal ini. Sabtu (22/ 5) Achmad Thala’a langsung memberikan titah amanah Kerajaan Negeri Serdang. Posisi almarhum OK Habibullah diberikan kepada Datuk Paduka Diraja Batangkuis, OK Khaidar Aswan sebagai Pemangku Adat Wajir Negeri Serdang.

Waspada/Hotma Darwis Pasaribu

SERAHKAN : Timbalan Adat Serdang, Tengku Achmad Thala’a berikan surat Kesultanan Serdang kepada Datuk Mude Paduke Diraja Batangkuis. OK. Khaidar Aswan Pemangku Adat Wajir Negeri Serdang, yang sebelumnya diemban almarhum OK. H. Habibullah. Ada beberapa hal menjadi pertimbangan dalam memberikan perintah kesultanan, terlebih menyikapi penggantian posisi almarhum OK Habibullah. “Banyak yang harus dijaga, terutama dampak sosial yang menjadi pertimbangan,” kata Tngku Achmad Thala’a di Kampoeng Niaga Dirgantara Batangkuis, Sabtu (22/5). “Kita masih menjaga etika

dan sopan santun sebagai tanda adat melayu,” kata Amek sapaan akrab Achmad Thala’a, seraya menyebutan kurang etis rasanya kalau penggantian ini dilakukan secepatnya, sementara keluarga almarhum masih berduka. “Jadi kita tunggu waktu yang tepat, “ kata Amek, waktu yang tepat dimaksudnya tidak lain rentang waktu berpulangnya

ke Rahmatullah almarhum OK Habibullah dan waktu pemberian penggantian posisinya sebagai Pemangku Wajiran Negeri Serdang kepada Datuk Mude Paduka Diraja Batangkuis, OK Khaidar Aswan. “Penggantian merupakan ketentuan yang harus dilakukan pihak Kesultanan Serdang,” jelas Amek, seraya menyebutkan tujuannya tidak lain untuk melestarikan tananan hidup puak Melayu yang masih memegang teguh titah-tatih dan tahta yang ada di Kesultanan Serdang. Amanah Datuk Mude Paduka Diraja Batangkuis, OK Khaidar “Abah Nda” Aswan, seusai menerima surat kesultanan mengatakan, kalau apa yang diberikan Kesultanan Serdang merupakan amanah yang harus diemban untuk melestarikan budaya Melayu, khususnya di Negeri Penjaga Serumpun Batangkuis. Batang Kuis merupakan salahsatu daerah yang masih memegang tatanan budaya melayu. Saat ini di Negeri Penjaga Serumpun Batangkuis masih berdiri kokoh bangunan peninggalan kerajaan Melayu, yaitu Rumah Kedatukan Wajir Serdang, persis di sebelah rumah almarhum OK Habibullah. “Budaya Melayu harus dilestarikan, amanah yang diberikan kepada saya sebagai

Pemangku Adat Wajir Negeri Serdang merupakan keharusan untuk meneruskan apa yang telah dilakukan oleh almarhum OK Habibullah,” cerita Khaidar Aswan, yang secara garis keturunan merupakan tutur cucu dari almarhum OK Habibullah. Disinggung apakah setelah pemberian surat kesultanan ini akan dilaksanakan upacara adat resmi dari Kesultanan dalam pemberian amanat sebagai Pemangku Adat Wajir Negeri Serdang? “Kita akan konsultasikan semuanya kepada pihak Kesultanan dan akan mencari waktu dan momen yang tepat,” kata Khaidar Aswan. Banyak yang sudah dilakukan Khaidar Aswan dalam melestarikan Budaya Melayu di Sumatera Utara, khususnya di Deliserdang yang merupakan domisilinya, tepatnya di Negeri Penjaga Serumpun, Batangkuis, yang selama ini dikenal cikal bakal kota transit menyambut kehadiran Bandara Kualanamu. Wajir dapat diistilahkan sebagai perwakilan atau sejajar dengan jabatan camat kalau di struktur pemerintahan, dimana sangat peran penting dalam menyampaikan titah kesultanan kepada masyarakat, khususnya puak melayu. Khaidar Aswan yang selama ini merupakan sosok yang sangat peduli dengan komunitas

masyarakat melayu, khususnya di daerah pantai Deliserdang, diharapkan mampu mengangkat marwah puak Melayu baik di lingkungan sosial maupun berkiprah dalam pengembangan usaha yang bisa memberikan kemandirian terhadap puak Melayu. “Sekali lagi saya ingatkan, MASMERAH, “ katanya, MAS MERAH (mari senantiasa membaca sejarah), kalau bukan kita siapa lagi yang melestarikan budaya Melayu, terutama dalam menjaga tatanan adat istiadat Melayu yang harus dijunjung tinggi. “Banggalah sebagai orang Melayu,” kata Khaidar Aswan telah menunjukkan bukti kebesaran hatinya sebagai orang Melayu pun terlihat dari tutur sapa di lingkungan keluarganya masih kental bernuansa melayu, baik terhadap anak-anaknya disapa“KakYung, Kak Ngah, Kak Lang dan si bungsu Dek Uda”. “Mari mulai melestarikan budaya Melayu dari lingkungan keluarga kita sendiri, “ kata Datuk Mude Paduka Diraja Batang Kuis, OK Khaidar Aswan, Pemangku Adat Wajir Negeri Serdang. Bak pepatah melayu, “Genggam Bara, Biar sampai menjadi arang, sabar menderita mencapai kejayaan” Hotma Darwis Pasaribu


Sumatera Utara

WASPADA Senin 24 Mei 2010

Dinas Kelautan, Perikanan Dan Peternakan L. Batu Adakan Kontes Ternak Sapi

Bocah Penderita Tumor Asal Batubara Butuh Bantuan

RANTAUPRAPAT (Waspada): Dinas Kelautan, Perikanan dan Peternakan Kabupaten Labuhanbatu akan mengadakan kontes ternak sapi pada 29 Mei mendatang di Lapangan Desa Sidorukun, Kecamatan Pangkatan. Kepala Dinas Kelautan, Perikanan dan Peternakan L.Batu Ir Amir Situmorang melalui Ketua Panitia Pelaksana Raisan, SE, kepada Waspada, Minggu (23/5) di Rantauprapat memaparkan, peserta kontes ternak sapi ini adalah peternak sapi dan penyuluh. Adapun hadiah yang akan diperebutkan terdiri dari, Juara I sebanyak 4 kelompok.kategori, hadiah masing-masing 1 ekor lembu unggul. Juara II dan III juga sebanyak 4 kelompok/kategori, hadiah masing-masing, yakni uang pembinaan. Bagi penyuluh yang ternak binaannya mendapat juara akan diberikan hadiah berupa uang pembinaan dan piagam penghargaan. Bagi camat yang ternak binaannya mendapat juara akan diberikan hadiahberupauangpembinaandanpiagampenghargaandanseluruh peserta yang mengikuti kontes nantinya diberikan piagam penghargaan. Sebelumnya Amir Situmorang menjelaskan, kontes ternak sapi ini bertujuan memberikan stimulans kepada masyarakat L.Batu khususnya para peternak agar lebih giat dalam budidaya ternak sapi sehingga L.Batu ke depan dapat menjadi sentra ternak sapi unggulan. Selain itu, dalam jangka panjang, kegiatan juga bertujuan menciptakan swasembada daging di L.Batu sehingga ke depan daerah kita tidak perlu lagi mendatangkan sapi dari daerah-daerah lain untuk memenuhi konsumsi daging L.Batu. Karenaitu,diamengimbaukepadamasyarakatkhususnyapeternak sapi dan penyuluh agar dapat mengikuti kontes ternak sapi ini dan ke depan mungkin kontes serupa akan dibanjiri hadiah-hadiah yang lebih banyak dan bernilai lebih besar lagi. (a27)

KISARAN (Waspada) : Bocah penderita tumor ganas asal Kabupaten Batubara membutuhkan uluran tangan, terkait bocah ini harus menjalani operasi di rumah sakit Medan, sedangkan orang tuanya tersandung faktor ekonomi. Pasien, Nanang Sudiar,10, putra pertama pasangan Sarwono,34, dan Sriamia,31, warga Dusun XI, Desa Seibalai, Kecamatan Talawi , Kabupaten Batubara, menderita tumor di dalam lambungnya, mengakibatkan tubuh bocah kelas empat SD ini kurus, dan tubuhnya panas dan nyeri di perut, penyakit tersebut telah diderita selama sekitar satu bulan, dan orang tuanya telah berusaha untuk mengobati dengan membawanya ke puskesmas terdekat, dan hingga rumah sakit yang ada di Kisaran hingga Kota Pematangsiantar, akibat keterpurukan ekonomi, anak ini terpaksa dirawat dengan obat seadanya dari mantri kampung. Dikarenakan penyakitnya semakin parah, bocah ini terpaksa di rawat di RSUD Kisaran, Jumat (21/5). “Kami telah berusaha untuk mengobatinya, namun penyakitnya tidak juga sembuh, dan menurut dokter anak ini harus di rujuk ke Medan, agar bisa dilakukan pengobatan yang lebih serius,” ungkap ayah pasien, Sarwono ditemui Waspada. Menurut Sarwono, dia dan keluarganya tidak mampu menanggung perawatan anaknya bila berobat di ke Medan, karena dia hanya seorang yang bekerja serabutan, sementara buah hatinya itu tidak terdaftar peserta Jamkesmas dari pemkab sehingga dia harus menanggung biaya perawatan di rumah sakit. Dengan demikian, katanya,keluargayangtidakmampuinisangatmengharapkanbantuan para dermawan untuk sudi membantu pembiayaan anaknya. “Harta yang ada sudah habis terjual untuk biaya perawatan anaknya, sehingga untuk saat ini kami kehabisan uang, sedangkan obat anaknya harus ditebus,” ujar Sarwo. Dokter Spesialis Anak RSUD Kisaran, dr Alfian Nasution, ditemui Waspada menjelaskan, anak itu menderita tumor di lambungnya, dan mengakibatkan tubuhnya kurus dan kurang gizi, sehingga harus segera dirujuk ke rumah sakit Medan untuk dilakukan operasi, mengingat RSUD Kisaran masih minim sarana dan prasarana. “Anak ini harus segara mendapatkan perawatan di rumah sakit yang lebih lengkap, oleh sebab itu, diharapkan Pemkab Batubara, dapatmemperhatikanwarganyayangmemerlukanbantuan,”jelasnya. (csap)

Penarik Beca Tewas Tubruk Trotoar Jalan TANJUNGBALAI (Waspada) : Penarik beca bermotor ditemukan tewas di Jalan Jendral Sudirman Km 2, Kec Datukbandar, Kota Tanjungbalai, Minggu (23/5) sekira pukul 03:00. Korban, Thamrin Ginting, 27, warga Jalan Akaka Kampung Baru, KelTB Kota III, KecTanjungbalai Utara, diduga tewas akibat menubruk trotoar jalan. Belum diketahui pasti penyebab terjadinya peristiwa itu. “ Laporan warga, ditemukan seorang pria tewas dan becanya terbalik di lokasi kejadian, diduga kejadian itu akibat kecelakaan lalu lintas,” kata Kapolres Tanjungbalai, AKBP Puja Laksana melalui Perwira Humas, AKP Lukman Sirait. Sementara, petugas instalasi jenazah RSUD Tanjungbalai, Ilham, mengatakan, ditemukan luka lecet di bagian dahi, bahu dan dada korban. Mengenai luka berat, menurut Ilham, tidak ditemukan, bahkan kepala korban juga tidak mengalami pembengkakan, apalagi luka. (a37)

Polsek T. Balai Utara Ringkus Pengisap Ganja TANJUNGBALAI (Waspada) : Petugas Kepolisian Sektor Tanjungbalai Utara, meringkus 4 pria diduga mengisap ganja di Gg. Ros, Kel TB Kota IV, Kota Tanjungbalai, Sabtu (22/5) sekira pukul 21:00. Para tersangka, DD, 34, RI, 31, dan Sy alias Boyot, 60, ketiganya warga Gg Ros, Kel TB Kota IV, Kec Tanjungbalai Utara, dan ER, 33, warga Jalan Mawar, Kel TB Kota IV, Kec Tanjungbalai Utara. Keempat tersangka itu diringkus bersama barang bukti 4 puntung rokok yang bercampur daun ganja kering, dan 1 bungkus kecil ganja dikemas dengan kertas rokok. Penangkapan terjadi berkat informasi masyarakat yang menyebutkan, keempat tersangka sedang asyik mengisap rokok bercampur daun ganja kering di rumah Sy alias Boyot. Kapolres Tanjungbalai, AKBP Puja Laksana dikonfirmasi melalui Perwira Humas, AKP Lukman Sirait, membenarkan penangkapan itu. Dan, kata Sirait, para tersangka masih menjalani pemeriksaan intensif. (a37)

Belasan Buruh Pemanen Terancam PHK LIMAPULUH(Waspada):Belasan buruh pemanen kelapa sawit penduduk Aek Kelubi Desa Padang Genting KecTalawi, Kab Batubara terancam di PHK alias tidak dipekerjakan lagi tanpa diketahui alasan maupun kesalahan diperbuat.Mereka berencana akan mendatangi DPRD Batubara meminta perlindungan hukum. ‘’Pemecatan ini sangat membingungkan kami dan dilakukan sepihak tanpa diketahui alasan dan kesalahan diperbuat sehingga pihak kebun tidak membenarkan bekerja,’’sebut Izul, seorang pekerja pemanen kelapa sawit didesa itu kepada Waspada, Minggu (23/ 5). Menurutnya, mereka ada yang sudah bekerja 2 hingga 4 tahun dan tetap status buruh harian lepas (BHL) menerima upah Rp 35.000 per hari dan dibayar dalam setiap minggunya.Terakhir mereka dapat kabar, toke tidak menerima mereka bekerja sehingga tidak diketahui mau bekerja apa lagi untuk memenuhi kebutuhan hidup seharihari. ‘’Ini disampaikan langsung kepercayaan toke di hadapan rekan pekerja lain bahwa kami sudah tidak dipekerjakan lagi,’’ ujarnya. Bahkan di antara pekerja rata-rata sudah berumah tangga yang mempunyai tanggung jawab hidup. Mereka masing-masing, Rusman,Selamet,Wartok, Sarel, Tono, Jaim,Napi, Dolok,Mare-mare, dan Bandi. (a11)


BUTUH BANTUAN: Sarwono, warga Kabupaten Batubara, terlihat sedang membelai anaknya, Nanang Sudiar,10, yang menderita tumor di lambungnya, sedangkan dokter menyarankan untuk dirujuk ke Rumah Sakit Medan untuk mendapatkan perawatan, sementara, orang tuanya tergolong keluarga yang tidak mampu dan tidak tercatat peserta Jamkesmas, sehingga keluarga ini mengharap bantuan dari pemkab, dan orang yang peduli untuk membiayai perabotan anaknya. Foto direkam, Sabtu (22/5).

Bocah Penderita Sindrom Steven Johnson Meninggal KISARAN (Waspada): Bocah penderita tidak cocok mengkonsumsi obat (Sindrom Steven Jonson) meninggal di RSUD Kisaran, Jumat (21/5) sekira pukul 22:00. Muhammad Ridho, usia 11 bulan, putra keenam pasangan Suradi Guna,43, dan Mariati,36, warga Lingkungan XII, Kelurahan Perjuangan, KecamatanTeluknibung, Kota Tanjungbalai, telah menjalaniperawatanselamalima haridiRSUDKisarannamunnyawanya tidak tertolong karena pasien menderita komplikasi penyakit. “Kami telah mengobati korban sesuai dengan penanganan

Sindrom Steven Jhonson, karena kondisi anak terlalu parah, karena menderita komplikasi penyakit, korban meninggal,” ujar dokter Spesialis Anak RSUD Kisaran, dr Alfian Nasution Sp A ditemui Waspada, Sabtu (22/5). Menurut Alfian, penyakit itu merupakan efek samping tidak kecocokan obat, (drug eruption) dan bukan sebuah kesalahan perawatan (human eror) sehingga diperlukan pemahaman masyarakat dalam menggunakan obat, bila menimbulkan efek samping segera hentikan dan hubungi dokter yang bersangkutan. “Bila kita tidak tidak cocok dengansatuobat,segaraberitahu dokter, agar obat itu tidak diberikan ketika kita sakit, dan juga diharapkan dokter mau bertanyakepadapasien,jenisobat

apa yang tidak cocok dengan tubuh pasien,” ujar Alfian. Di tempat terpisah, Dokter Puskesmas Teluknibung, Tanjungbalai, tempat korban berobat, dr Faisal dikonfirmasi Waspada menyatakan, bocah itu menderita Sindrom Steven Jhonson bukan berasal dari obat puskesmas, karena menurutnya, anak itu berobat di puskesmas pada tanggal 4 Mei 2010, dan korban menderita penyakit itu pada 17 Mei, sehingga ada rentang waktu yang lama, dan berdasarkan ilmu tentang Sindrom Steven Johnson, penyakit ini berlangsung cepat, sehingga sedikit sekali kemungkinan anak itu sakit karena obat yang diberikan puskesmas, dan besar kemungkinan dari obat lain yang diberikan dokter atau mantri tertentu yang

diberikan kepada korban saat berobat. “Bila kita menderita Sindrom Steven Johnson, reaksinya cepat, karena penyakit ini akan terasa ketika obat yang diberikan itu dikonsumsi,” ujar Faisal. Oleh sebab itu, katanya, pihaknyamelakukanpeningkatan pelayandanmemberikanpenyuluhankesehatanterhadapmasyarakat, agar penyakit ini tidak ditemui lagi, selain itu diharapkan RSUD Tanjungbalai dapat memenuhi kekurangan dokter spesialis, sehingga bila ada warga yang sakit tidak perlu di rawat ke luar daerah. “Selama ini kami cukup repot karena kekurangan dokter spesialis. Oleh sebab itu kekurangan kepadainstansiterkaitdapatdapat memenuhi kekurangan itu,” ujar Faisal. (csap)

Perusahaan Pencemar Sungai Di Limapuluh Harus Bertanggungjawab LIMAPULUH (Waspada): Pencemaran lingkungan yang diduga akibat pembuangan limbah sebuah perusahaan negara di daerah Gunung Bayu, Simalungun mengakibatkan air sungai menghitam dan berminyak, ribuan ekor ikan mas di kolam milik petani di Kelurahan Limapuluh, Kab. Batubara mati. Oleh petani tambak ikan mas itu kerugian jutaan rupiah yang dialaminya dilaporkan kepada LSM Batubara Hijau. Melalui Batubara hijau peristiwa ini disampaikan kepada Dinas Lingkungan Hidup Batubara, Polsek Limapuluh serta Camat Limapuluh. Dinas Lingkungan Hidup Batubara langsung menurunkan Kasi Pengawasan Syamsul dan seorang stafnya. Pada kolam petani dilakukan pengujian keasaman air dengan menggunakan alat PH meter dan kertas Lak-

mus. Dari pengujian di lapangan indikator keasaman air mencapai 8 sampai 9 dari angka normalnya 7 sampai 7,5. Direktur Eksekutif Batubara Hijau Arsyad Syahuri Nainggolan kepada Waspada, Minggu (23/ 5) tindakan pencemaran yang diduga oleh perusahaan negara itu ditelusuri dari hilir hingga ke hulu, akhirnya kuat dugaan memang berasal dari PTPN IV Gunung Bayu. Batubara Hijau dan Waspada sebelumnya telah bertemu dengan Manajer PTPN IV Gunung Bayu Muklis di rumah dinasnya. Secara gamblang Muklis mengakui adanya peristiwa itu dan berjanji secepatnya menanggulangi kerugian petani. “ Kerugian yang ditimbulkan oleh pencemaran itu tidak saja kepada petani tambak yang ikan masnya ribuan ekor mati di Kelurahan Limapuluh, tetapi

kerugian lingkungan yang terjadi di sepanjang sungai,” tegas Arsyad. Dijelaskan, menurut UU nomor 32 Tahun 2009 tentang perlindungan dan pengelolaan lingkungan hidup pencemaran lingkungan hidup adalah masuk atau dimasukkannya makhluk hidup, zat energi dan atau komponen lain kedalam lingkungan hidup oleh kegiatan manusia sehingga melampaui baku mutu lingkungan hidup yang telah ditetapkan. Dalam pasal 87 butir (1) UU tersebut menegaskan, Setiap penanggung jawab usaha dan / atau kegiatan yang melakukan perbuatan melanggar hukum berupa pencemaran dan atau perusakan lingkungan hidup yang menimbulkan kerugian pada orang lain atau lingkungan hidup, wajib membayar ganti rugi dan

atau melakukan tindakan tertentu. UUinijugapadaBABXVpada pasal 99 (1) jelas Arsyad mengatur tentangketentuanPidana.“Setiap orang yang karena kelalaiannya mengakibatkan dilampauinya baku mutu udara ambien, baku mutu air, baku mutu air laut atau kriteria baku kerusakan lingkungan hidup dipidana dengan pidana penjara paling singkat 1 (satu) tahun dan paling lama tiga tahun dan denda paling sedikit Rp 1 miliar dan paling banyak Rp 3 miliar”. Hingga saat ini menurut Arsyad proses hukum telah berjalan di Polsek Limapuluh, menurut informasi sudah tiga orang warga yang diperiksa penyidik. “ Kita mengharapkan kasus pencemaran ini segera dapat dituntaskansesuaidenganhukum yang berlaku,” pinta Arsyad. (a31)

Temuan Komisi A DPRD Batubara Dilaporkan Ke Menhut RI TANJUNGTIRAM (Waspada):Temuan Komisi A DPRD Batubara ke perusahaan sawit PT SDL di Desa Baganbaru Kec.Tanjungtiram, Batubara,Rabu(19/5)akandilaporkankeMenteriKehutanan(Menhut) RI. “Kami sudah siapkan dokumentasi hasil temuan di lapangan di lokasi kebun sawit milik PT SDL yang saat ini berubah nama PT TS yang dituduh telah merambah hutan dan mengalih fungsikan dari kawasan hutan produksi menjadi tanaman sawit. Dalam waktu dekat kami akan melapor ke Menhut,” jelas Drs Sakroni, Ketua Komisi A DPRD Batubara didampingi Sekretaris Hamonangan Simatupang di kamar kerjanya, Kamis (20/5) Turun ke lapangan, sebut Sakroni sebagai menyahuti pe ngaduan Kelompok Tani Paduan Karya Baganbaru seluas 82 hektar tanah milik warga telah digarap PT SDL tanpa ganti rugi Tentang tuduhan perambahan hutan, apakah hutan produksi atau jalur hijau dilakukan PT SDL (sekarang PT TS) merupakan wewenang Dinas Kehutanan dan Perkebunan Batubara.Kalau dilihat kondisi di lapangan, ratusan hektare sudah ditanami sawit hanya berjarak 30 sampai 50 meter dari bibir pantai Disebutkan, aktivitas PT TS mengelola tanaman sawit dipertanyakan karena diduga tidak memiliki izin dari Menteri Perkebunan dan tidak terdaftar di Dinas Perkebunan Provsu. Karena sertifikat hak milik sudah dipecah-pecah menjadi 378 sertifikat yang setiap 1 orang memiliki 2 hektare. Diduga sebagian nama-nama di sertifikat ‘fiktif’ tidak dikenal bukan warga setempat.Warga juga mengeluhkan Sungai Buaya dan Sungai Nipah ditutup tidak masuk lagi air pasang, sertatemuanlainadajembatanbangunantahun2002sudahdibongkar dan bangunan jalan dana APBD dipasang portal. “ Berdasarkan temuan langsung di lapangan Komisi A DPRD Batubara terdiri dari Sakroni (Ketua),Usman Atim (Wakil Ketua), Hamonangan Simatupang (Sekretaris), anggota Naffiar, Sarianto Damanik, Benny Sius Sianturi, H Sutan Sitompul,Ahmad Mukhtas, Syahril Guci akan disampaikan ke Menhut melanjuti pertemuan Komisi A dengan Menhut di Jakarta sebulan lalu,” terang Sakroni.(a30)

Pemkab L. Batu Biayai 92 Siswa Ikuti Tes Seleksi Masuk UI RANTAUPRAPAT (Waspada): Pemkab Labuhanbatu membiayai 92 orang putra-putri asal L.Batu, baik yang bersekolah di dalam daerah maupun di luar L.Batu dalam mengikuti tes seleksi masuk UniversitasIndonesia(UI)yangdilaksanakandiSMAPlusRantauprapat, Minggu (23/5). Keterangan Kepala Dinas Pendidikan L.Batu Drs Iskandar, MPd melaluiKetuaPanitiaPelaksanaSeleksiKhairulisMPdkepadaWaspada, di sela-sela tes, ke-92 siswa merupakan peringkat sepuluh besar di sekolah masing-masing dan bisa mengikuti tes seleksi setelah sebelumnya melampirkan bukti rapor dari kelas X-XII. Adapun yang ditanggulangi Dinas Pendidikan dalam tes seleksi

Kisaran Pusat Pendidikan Dan Bisnis


DILANTIK: Para penurus IDI Labusel yakni dr H ArisYudhariyansyah, dr HSG Weldy Ritonga dan dr Willi, saat dilantik.

Kepengurusan DPC IDI Labusel Dilantik KOTAPINANG(Waspada):Tenagamediskhususnyadokterumum, specialist dirsakan masih kurang di Kabupaten Labuhanbatu Selatan (Labusel) sebagai kabupaten baru hasil pemekaran dari Kabupaten Labuhanbatu. Eksistensi kepegurusan PC-Ikatan Dokter Indonesia (IDI) Kab. Labusel,bersamaKadisKesehatan,kitaperlubersinergiuntukmerekrut dokterspesialislain. JanganjadikanpelantikanIDIinihanyaseremonial saja, tetapi dibentuknya kepengurusan PC-IDI Labusel untuk mengisi pemekaran dalam hal pendekatan akses kepada masyarakat guna membantu masyarakat Labusel dibidang kesehatan, selain itu guna untuk meningkatkan qualitas tenaga dokter di Kab Labusel. Hal ini dikatakan dr Henry Salim Siregar,Sp.OG, Ketua IDI Sumatera Utara saat melantik kepengurusan PC-IDI Kab.Labusel, Rabu (19/5) di aula kantor Bupati Labusel. Pengurus IDI Labusel yang dilantik terdiri, Ketua dr HSG Weldy Ritonga, Sekretaris dr H Aris Yudhariyansyah dan Bendahara dr Willy dilengkapi dengan sejumlah pengurus lain. Pj.Bupati Labusel Ir Hj R Sabrina, MSi diwakili Sekdakab Drs H Abd.Rajab Pasaribu, MM mengatakan, seluruh masyarakat Kab.Labusel mengharapkan peningkatan kinerja dokter dalam hal pelayanan kesehatan. Menurut Sekdakab, Kab.Labusel belum mempunyai visi dan misi, sektor apa yang diutamakan, karena Labusel belum ada Bupati defenitif. Sekdakab mengharapkan agar Pemilukada di Kab Labusel sudah disepakati bersama direncanakan 29 September 2010 nanti supaya sama kita sukseskan. H SGWeldy Ritonga, yang juga bakal calon wakil Bupati Labusel, sebagai Ketua IDI Labusel mengharapkan kerja sama dengan sesama pengurus baru dilantik serta mengharapkan kepada pengurus wilayah IDI Provsu untuk selalu membimbing IDI Labusel, agar nanti IDI Labusel sebagai kabupaten baru dapat setara dengan IDI Kabupaten lain. (c05)

BERADA di Jalur Lintas Sumatera, dekat dengan pelabuhan Teluk Nibung/ Bagan Asahan dan Kuala Tanjung, serta dikelilingi hinterland yang padat populasi dan potensi, Kota Kisaran strategis sebagai pusat pendidikan dan bisnis. Rektor Universitas Asahan Prof Dr Ir H Darma Bakti, MS menyatakan hal itu saat penanaman pohon mahoni secara simbolis di Kampus UNA Kamis (20/ 5)dalamrangkaHariKebangkitan Nasional, sekaligus menyambut Hari Lingkungan Hidup se Dunia 6 Juni dan rangkaian acara Dies Natalis UNA ke-25 tanggal 17 Juli 2010. Rektor UNA didampingi Purek II Ir Ansoruddin, Purek III Drs Muh.Saleh Malawat, MMA, dan Dekan Fakultas Ekonomi H Abdul Rahman, SE. “Ribuan pohon telah ditanam di beberapa desa lewat Lembaga Penelitian dan Pengabdian Masyarakat UNA, terakhir di Desa Teladan, Kecamatan Tinggi Raja oleh mahasiswa Fakultas Ekonomi, Maret 2010,” jelas Ir Ansoruddin. Darma Bakti mengungkapkan, setidaknya ada lima perguruan tinggi di Kisaran, sekolah dasar dan lanjutan yang merata di semua kecamatan, dikelilingi kabupaten/kota yang padat populasi dan potensi. “Kisaran bisa menjelma menjadi pelayan pendidikan dan bisnis yang prima,” tukas Darma.

Apa yang dikatakan Rektor UNA sangat signifikan dengan realita tidak adanya ikon kota Kisaran.JulukanKotaPerkebunan hanya “memperdalam luka” sebabsistempemerintahanmendorong input utama ke pemerintah pusat. Daerah hanya mendapatbagianPajakBumiBangunan, program CD-CSR hanya bersifat “hore-hore”, sedikit infrastruktur perusahaan perkebunan. Tidakdapatdisangkalkehadiran perusahaan perkebunan dengan jumlah pekerjanya menunjang perekonomian dan perdagangan daerah ini, membuka lapangan kerja, dan penyebaran teknologi. Untuk menunjang keberadaan lima perguruan tinggi di Kisaran bukan hal mudah. Kenyataannya di Dinas Pendidikan Kabupaten Asahan tidak ada Bidang Pendidikan Tinggi. Harus ada terobosan DPRD Asahan dan Pemkab Asahan untuk melahirkan Peraturan Daerah yang bisa menjadi sumber dana penunjang peningkatan lima perguruan tinggi di Kisaran. “Orientasi Universitas Asahan menjadi penyelenggara pendidikan yang murah tetapi berkualitas. Bantuan pemerintah, alumni yang sudah sukses, maupun donasi lainnya sangat diharapkan,” ujar Darma. Universitas Asahan memiliki Fakultas Teknik, Pertanian, Ekonomi, Hukum dan Fakulkas Keguruan Ilmu Pendidikan dengan Program Studi Strata 1 Terakreditasi terdiri Teknik Sipil, Agroekoteknologi, Manajemen, Ekonomi Pembangunan, Ilmu Hukum, sedang proses akreditasi terdiri dari Teknik Informatika/

Perangkat Lunak, Teknik Mesin, Budidaya Perairan, Pendidikan Matematika, Pendidikan Bahasa Inggris, dan Pendidikan Bahasa Indonesia. Dies Natalis UNA ke 25 diisi 26 kegiatan olahraga, sosial, dan peningkatankualitasSDMinternal dan eksternal, termasuk seminar sehari tentang Pendidikan Berkarakter. Fokus Waspada melakukan TeleConfrence Selular Minggu (23/ 5) di Grup Kisaran-Asahan, antara lain General Manager PT Berlian Sistem Informasi Jakarta Ir Nazri E.Lubis, MM. Dia berharap Universitas Asahan bisa lebih fokus menyuplai kebutuhan SDM industri di Asahan dan sekitarnya. “Beberapa perusahaan besar di Asahan masih dominan memakai tenaga staf dan manejerial produk luar Asahan,” tukas putra Kisaran jebolan Teknik Industri USU Medan dan Magister Managemen UGM Yogyakarta ini. Untuklembagakajian,lanjutnya, Pemkab Asahan harus memberi ruang partisipasi kepadaUniversitasAsahan.“Masa saya kuliah dulu banyak proyek kajianBappedaAsahandikerjakan USUdanITB.Berilahkesempatan kepada UNA sebagai penanggungjawab proyek kajian, meskipun UNA bekerjasama dengan USU dan ITB toh akhirnya akan terjadi transfer knowledge. Perlahan UNA pasti bisa jadi mainplayer,” tandasnya. Menurutnya UNA harus mengurai siklus proses industri perkebunan untuk melihat di titik mana jebolan UNA bisa berkontribusi. “Pemeliharaan perkebunan, operasi dan perawatan

pabrik contoh titik yang bisa diisi jebolan UNA,”tambahnya. Selain fokus kepada keilmuannya, UNA harus memantau perkembangan alumninya di sejumlah perusahaan, apakah bisa berkembang, jika tidak bisa dikaji kendalanya apakah faktor bahasa,skill,inovasidankreatifitas untuk perbaikan program kurikulum. “Pada perusahaan besar ada program rekrutmen yang bernama Management Trainee, di mana fresh graduate direkrut untukdididikmenjadipemimpin, setidaknya di Asahan ada quota untuk UNA dan Pemkab Asahan harus membantu lobinya,”ujar Nazri. Sejalan dengan pendapat Nazri, putra Kisaran berdomisili di Jakarta Anhar Darwis SE. Ak, CFE melihat potensi Kabupaten Asahan yang berhubungan langsung dengan Port Klang Malaysia bisa mengembangkan potensi tenaga kerja skill, dari tenaga kerja kelas bawah, menengah sampai atas, di mana Universitas Asahan harusmampumemainkanperan. “Universitas Asahan sebaiknyamengantisipasikemungkinan adanya blok Migas di perairan Asahanyangbelumdibuka,’tukas Anhar. Dengan jumlah dosen berlatar belakang pendidikan S1 (226 orang), S2 (70 orang) dan S3 (7 orang), UNA memiliki fasilitas Pusat Komputer, Perpustakaan, Laboratorium Beton, Mekanika Tanah, Ilmu Ukur Tanah, Fisika Dasar, Agro Biologi, Agro Ekonomi, Agro Bio-OPT, Budidaya Perikanan, Teknologi Kelautan, BudidayaPerairan,danLaboratorium Agro Teknologi, dan Kebun

Waspada/Nurkarim Nehe

TANAM POHON:Rektor Universitas Asahan Prof Dr Ir H Darma Bakti MS didampingi PR II Ir Ansoruddin, PR III Drs.Muh.Saleh Malawat MMA menanam secara simbolis pohon mahoni di Kampus UNA Kamis (20/5) dalam momen Hari Kebangkitan Nasional, rangkaian Dies Natalis ke-25, menyambut Hari Lingkungan Hidup se Dunia. UNA lewat LPPM (Lembaga Penelitian dan Pengabdian Masyarakat) dan praktikum mahasiswa sudah menanam ribuan pohon penghijauan. Contoh. Wacana yang dilontarkan RektorUniversitasAsahanDarma Bakti untuk menjadikan Kisaran sebagai pelayan pendidikan dan bisnis layak dimatangkan eksekutif dan legislatif daerah ini. Moral Untuk eksistensi UNA, birokrat Riau asal desa Sarang Elang, Sungai Kepayang-Asahan Mardhiah Abwar, sangat dibutuhkan menopangSDMmasyarakatAsahan. “Persoalannya UNA harus didesainjadiUniversitasyangtidak meninggalkan nilai moral dalam pendidikannya, tidak hanya mentransfer pengetahuan saja,” pesan Mardhiah Abwar untuk Dies Natalis UNA ke-25. Mardhiah malah memimpikanKotaPendidikandanSantri.

“Bagaimana menyantrikan masyarakat, agar malu meludah di depan publik, malu buang sampah sembarangan, malu menghardik, malu korupsi, malu tidak masuk kantor. Itu hanya didapat pada moral, bukan dari pendidikan pengetahuannya,” tandas Mardhiah. Tetapi Moral tanpa ilmu pengetahuan, lanjutnya, akan menjadi milik pribadi. “Sangat indah bila moral dan ilmu pengetahuan bersanding dalam SDM yang handal,”tambahnya. Ke depan, harap Mardhiah, Pemkab Asahan harus menjadi tenaga pendorong lebih besar bagi UNA untuk menjadi Perguruan Tinggi yang berkualitas dan punya berstandard. Nurkarim Nehe


WASPADA Senin 24 Mei 2010


MTsN Jambo Aye Gelar Gebyar Seni PANTONLABU, Aceh Utara (Waspada): Dalam rangka Ulang Tahun ke- XII, Madsarah Tsanawiyah Negeri (MTsN) Tanah Jambo Aye, Aceh Utara, menggelar Gebyar Seni tingkat SD/MI, meliputi lomba Tarian, MTQ, Shalawat Badar dan cabang Deklamasi. “Perlombaan dibuka Selasa (18/5) pagi dan ditutup secara resmi Kamis (20/5) siang oleh Kakankemag Aceh Utara, Drs H Zulkifli Idris. Gebyar ini diikuti 25 sanggar seni dari 25 SD/ MI asal Kec.Tanah Jambo Aye, Baktiya dan Kec. Seunuddon, Aceh Utara serta Kecamatan Madat, Aceh Timur,”kata Kepala MTsN Tanah Jambo Aye, Drs A Rahman Bitai, Jumat (21/5). A Rahman Bitai merincikan, untuk cabang Deklamasi, Juara I diraih SDN1 Baktiya, Juara II MIN Pantonlabu dan Juara III SDN20 Tanah Jambo Aye. Cabang Tarian, Juara I SDN7 Tanah Jambo Aye, juara II SDN16 Tanah Jambo Aye dan Juara III MIN Pantonlabu. Untuk Cabang MTQ, Juara I SDN5 Tanah Jambo Aye, disusul SDN13 Tanah Jambo Aye dan Juara III SDN20 Tanah Jambo Aye. Cabang Shalawat Badar, juara I diraih SDN20 Tanah Jambo Aye, juara II MIN Seunuddon dan juara III MIN Pantonlabu.(cmus)

Alumni SMA Beureunuen Gelar Pengobatan Gratis BANDA ACEH (Waspada): Alumni Sekolah Menegah Atas (SMA) Negeri 1 Beureunuen, Kab. Pidie, akan melakuan pengobatan gratis kepada masyarakat miskin dan duafa dalam wilayah Kec. Mutiara, Pidie, pada tahun 2010 ini. Kegiatan sosial yang diprakarsai dr Rahman, alumnus 1982, bekerja di sebuah klinik di Medan itu, meliputi penyakit bibir sumbing, tumor, dan penyakit lainnya, dengan tindakan medis dilakukan di Medan Sumatera Utara. Pendataan pasien dilakukan bersamaan dengan peringatan Maulid Nabi Muhammad SAW, Minggu (16/5) lalu di Beureunuen. Terdata 16 pasien dari kalangan masyarakat miskin yang melaporkan diri untuk mendapat pengobatan gratis itu. Nurdin F Joes, salah seorang alumni SMAN 1 Beureunuen merincikan pasien itu terdiri atas 5 orang bibir sumbing/langit langit terbelah, 2 orang tumor rahim, 1 orang tumor payudara, 3 orang kusta, 4 orang tumor pada anggota tubuh lainnya, dan 1 orang tala semia/kelainan darah. “Lima orang penderita pasien bibir sumbing dan dua orang penderita tumor sudah diberangkatkan ke Medan, dan sudah tiba di ibukota Sumatera Utara itu Kamis (20/5) untuk dilakukan tindakan medis di klinik tempat dr Rahman bekerja,” ungkap F. Joes kepada Waspada di Banda Aceh. Kelima penderita bibir sumbing bernama Alif Munandar, M Sultan, Nasrul Akbar, Muttakin, dan Firdaus. Di luar 16 pasien tersebut dimana 2 pasien lainnya dirujuk ke RSUDZA Banda Aceh yang difasilitasi dr Sulaiman Yusuf SpA, yang juga alumnus SMA itu tahun 1982.(b04)

FKIP Nominasi Formasi Mahasiswa Baru Unimus BIREUEN (Waspada): Hingga hari ketiga pendaftaran calon mahasiswa baru Universitas Almuslim Peusangan, Jumat (22/ 5), Fakultas Keguruan dan Ilmu Pendidikan (FKIP) menjadi nominasi dibandingkan dengan fakultas lainnya. Panitia Penerimaan mahasiswa baru Unimus, Drs. Abdul Halim, di kampus mengatakan, jumlah calon mahasiswa yang mendaftar sampai hari ketiga pendaftaran telah mencapai ribuan orang. “Untuk kelas regular 1.862 pendaftar, program studi kebidanan, 154 pendaftar, dan untuk program atensi 98 pendaftar,” ucapnya seraya menyebutkan, dari jumlah pendaftar itu, mayoritas mereka mendaftar di FKIP. Rektor Universitas Almuslim Peusangan, Drs. Amiruddin Idris, SE, M.Si melalui Kabag Humas, Zulkifli, S.Kom menyebutkan, diperkirakan jumlah calon mahasiswa yang mendaftar mencapai sepuluh ribu lebih sampai 31 Juli 2010. Karenanya, dia mengimbau kepada seluruh calon mahasiswa yang telah mendaftarkan diri di Unimus agar tidak terpengaruh dengancalon-caloyangmulaigentanyanmencarimangsanya.(cb03)

Wakil Walikota Kunjungi Korban Kebakaran, Warga Doa Bersama LHOKSEUMAWE (Waspada): Selain mendapatkan kunjungan juga bantuan langsung dari Wakil Walikota Lhokseumawe Suadi Yahya, Jumat (21/5), puluhan masyarakat juga menggelar doa bersama untuk keluarga Nek Kora, korban kebakaran di Gampong Teumpok Teungoh, Kecamatan Banda Sakti. Wakil Walikota Lhokseumawe Suadi Yahya pada Kamis (20/ 5) usai Shalat Ashar atau sekira pukul 17.30 Wib menyempatkan diri mengunjungi para korban kebakaran di Posko Bantuan Musibah di Jalan Angsana Gang Nek Kora. Pada kesempatan itu,WakilWalikota SuadiYahya mengatakan pihaknya berupaya memberikan perhatian semaksimal mungkin untuk menghadapi masa panik pasca musibah, Senin (18/5) malam itu. Ketua Posko Bantuan Musibah Kebakaran Jalan Angsana Zainuddin Abdullah mengatakan, setelah kunjungan Walikota Lhokseumawe Munir Usman kini giliranWakilWalikota Lhokseumawe Suadi Yahya mengunjungi korban kebakaran. Dalam kunjungan tersebut selain memberi bantuan uang tunai yang tidak diketahui jumlahnya, Suadi juga menyerahkan bantuan yang urgen untuk kebutuhan korban kebakaran seperti sembako juga perangkat alat shalat dan mengaji.(b15)

Aceh Timur Peringati Harkitnas IDI (Waspada): Memperhatikan dan merenungkan berbagai hal yang dapat melemahkan bangsa harus dibangun karakter bangsa. Pasalnya, karakter tersebut memiliki urgensi yang luas dan bersifat multi dimensional dan multi aspek. Demikian pidato Menteri Komunikasi dan Informatika, Ir. H. Tifatul Sembiring dibacakan Bupati Tgk. Muslim Hasballah pada Peringatan Hari Kebangkitan Nasional Ke-102 di Halaman Pendopo Idi, Kamis (20/5). Kata dia, multi dimensional karena mencakup dimensidimensi kebangsaan. Sementara multi aspek dikarenakan mencakup potensi-potensi keunggulan bangsa. Sebab itu, lanjut Bupati Muslim Hasballah, pembangunan karakter bangsa setidaknya diarahkan kepada empat tataran besar, diantaranya untuk menjaga jati diri bangsa, untuk menjaga keutuhan NKRI, dan untuk membentuk masyarakat yang berakhlak mulia dan untuk membentuk bangsa yang maju, mandiri dan bermartabat.(cmad)

Ratusan Ha Sawah Dan Tambak Tercemar Limbah BIREUEN (Waspada): Ratusan ha areal persawahan dan tambak di Kecamatan Kuala dilaporkan tercemar limbah Kota Bireuen. Pasalanya, saluran pembuangan limbah kerap meluap menggenangi lahan masyarakat saat musim hujan. Selain itu tumpukan sampah setiap hari bertambah, sehingga mengancam kesehatan ribuan warga dari sejumlah desa di daerah itu. Ketearangan yang dikumpulkan dua hari ini, kegiatan usaha tambak dan pertanian masyarakat di kawasan pesisir ini selalu terganggu, khusunya musim hujan karena limbah kota meluap ke areal sawah dan tambak. Saluran pembuangan yang tersumbat antara lain saluran pembuangan arah timur Kota Bireuen dari jembatan Cureh melintasi Desa Geudong-geudong, Geudong Alue, Lancoklancok, Cot Laga Sawa hingga Cot Batee. Saluran barat yakni Titi Rumbia, Desa Reuleut, Lhok Awe-awe, Krueng Juli Timue dan Krueng Juli Barat berujung di muara kuala Krueng Juli. Geuchik (Kades-red) Krueng Juli Barat, Lukman M Ali yang ditanya terpisah, membenarkan limbah Kota Bireuen mencemari lingkungan warga dan merusak ekosistem serta mengganggu usaha ekonomi masyarakat, khususnya sektor pertanian dan perikanan. Sehingga selalu menimbulkan kerugian besar akibat terkontaminasi limbah.(amh)

Waspada/Rusli Ismail

BERKEMBANG PESAT: Suasana Pasar Pagi Lueng Putu, Kecamatan Bandar Baru, Kabupaten Pidie Jaya, yang sebelumnya hanya ditempati beberapa pedagangnya saja. Kini semakin tumbuh dan berkembang pesat.

Pemkab Bireuen Tak Bayar SPP Dua Tahun

Mahasiswa Korban Konflik Terancam Dikeluarkan BIREUEN (Waspada): Sejumlah mahasiswa korban konflik di Universitas Al-Muslim (Unimus) terancam dikeluarkan pihak akademik perguruan tinggu itu. Pasalnya, biaya kuliah mereka yang ditanggung pihak Pemkab setempat sudah dua tahun tak dibayar, sehingga mereka terancam dikeluarkan. Informasi yang diperoleh Waspada akhir pekan lalu, sejumlah mahsiswa yang sedang menimba ilmu di perguruan tinggi swasta Unimus hampir

dua tahun biaya kuliah mereka tak dibayar Pemkab setempat hampir dua tahun, sehingga mereka terancam dikeluarkan dari kampus kebanggan masyarakat Peusangan itu. Wakil Rektor III Drs. Syarkawi, M.Ed melalui Kabag. Humas Kemahasiswaan Zulkifli, S.Kom yang ditanya Waspada secara terpisah membenarkan para mahasiswa korban konflik tanggungan pihak Pemkab setempat tidak ada jalan lain kecuali mereka diberhentikan se-

mentara, sehingga tunggakan baiya kuliah mereka yang hampir dua tahun kembali dibayar pihak Pemkab. ”Kita sebenarnya tak sampai hati mengeluarkan mereka, namun Unimus hampir dua tahun menanggung beban mereka, sehingga pihak kampus merasa berat, apalagi selama ini pihak Pemkab yang menjadi tanggungan mereka belum melunasi hak mereka sampai sekarang ini,” katanya. Menurut Zulkifli, terancam-

Dialog Budaya Aceh Digelar Di Aceh Tamiang KUALASIMPANG ( Waspada): Dialog Budaya Aceh akan diselenggarakan di Aula Sanggar Kegiatan Belajar ( SKB) Karang Baru, Kab. Aceh Tamiang, selama dua hari yaitu Selasa-Rabu (25-26/5). Kepala Dinas Kebudayaan Pariwisata Pemuda dan Olahraga Kabupaten Aceh Tamiang, Drs. Arisnur kepada Waspada, Minggu (23/5) menyatakan, dialog kebudayaan ini kegiatan lanjutan mengulas berbagai hal soal perkembangan nilai budaya serta cara melestarikannya. Arisnur menerangkan, panitia pelaksana Dialog Kebudayaan Aceh 2010 sesuai Surat Keputusan Kadis Kebudayaan dan Pariwisata Provinsi Aceh terdiri

atas unsur Dinas Kebudayaan dan Pariwisata Aceh serta unsur Dinas Kebudayaan dan Pariwisata Pemuda dan Olahraga Aceh Tamiang. ”Dengan adanya dialog budaya Aceh ini diharapkan mampu mengembalikan semangat masyarakat Aceh sebagai masyarakat yang mempunyai budaya yang tinggi dan Islami serta mampu memproteksi budayanya dari pengaruh-pengaruh budaya luar,” kata Arisnur. Arisnur menegaskan, kemegahan dan ketinggian khasanah kebudayaan Aceh yang Islami merupakan suatu kebanggaan yang diharapkan akan terus terjaga dari pengaruh-peng-

aruh kebudayaan luar. ”Keinginan yang wajar jika kemegahan budaya yang dimiliki masyarakat Aceh itu senantiasa tetap dibina dan dikembangkan,” ujarnya. Peserta yang akan menghadiri acara dialog budaya Aceh ini berasal dari utusan masingmasing kecamatan, diantaranya tokoh adat, Imeum Mukim, Majelis Adat Aceh ( MAA), tokoh pemuda, PKK dan dari instansi terkait lainnya. Selain itu ada juga narasumber dari Disbudparpora, Ketua Majelis Permusyawaratan Ulama, Ketua Majelis Pendidikan, Dinas Syariat Islam Kab. Aceh Tamiang dan Kadis Budpar Provinsi Aceh.(b24)

nya dikeluarkan sejumlah mahasiswa korban konflik bukan karena pihaknya tak peduli kepada mereka, namun kalau sudah hampir mencapai dua tahun tak bayar SPP pihak kampus juga berat menanggung beban mereka. ”Karena universitas tak sanggup lagi menanggungbebandanSPP,tahuninikita tidak akan menerima lagi titipan mahasiswa korban konflik dari Pemkab Bireuen,” tegasnya. Ke Jakarta Pada kesempatan itu, Zulkif-

li mengatakan, 210 berkas behasiswa mahasiswa Unimus calon penerima beasiswa Dikti tahun ini telah dikirim ke Jakarta melalui Kopertis Wilayah I Sumut Aceh di Medan. Berkas beasiswa yang dikirim itu adalah berkas beasiswa jenis BBM lama (105 berkas), BBM Baru (25 Berkas), PPA Lama (75 berkas) dan PPA baru (7 berkas). ”Setelah diproses di Jakarta, para mahasiswa akan mendapat dana beasiswa masing-masing untuk jenis BBM

dan PPA Baru sejumlah 1 Juta Rupiah dan BBM dan PPA Lama akan mendapatkan dana 3 Juta Rupiah yang diberikan untuk 3 tahap,” jelas Zulkifli.S.Kom Rektor Universitas Almuslim Drs. H. Amiruddin Idris, SE, M.SI secara terpisah menyatakan jumlah penerima beasiswa Universitas Almulsim setiap tahun terus bertambah, namun pihaknya terus berusaha mencari sumber lain agar dapat membantu mahasiswa kurang mampu.(amh)

Kadis Perindustrian Koperasi Dan UKM Diperiksa Kejari BLANGKEJEREN (Waspada): Mesin ketel di Kecamatan Tripe Jaya tidak berfungsi, Kejaksaan negeri Gayo Lues memeriksa Kadis Perindustrian Koperasi dan UKM, Drs. Nya’Mat, untuk dimintai keterangan. Sumber mengatakan, kemarin, mesin ketel sebanyak sepuluh unit dengan anggaran Rp1 miliar dari dana Otsus 2008, selain tidak berfungsi diduga tidak didukung dokumen lelang yang lengkap. Dikatakan, setelah dua kali diperiksa, Kadis tidak pernah lagidatangmemenuhiundangan lisan Kejari, dengan alasan sakit. Jika ketel itu tidak difungsikan tidak tertutup kemungkinan terancam menjadi mesin tua. “Kalau jadi mesin tua, oto-

matis ada yang salah dari perencanaan awal yang menyebabkan terjadinya indikasi pemborosan keuangan negara. Di luar indikasi dokumen kontrak yang tidak sesuai peraturan.” Kajari Gayo Lues, H. Basrulnas, SH, melalui Kasi Pidsus Roy Ryadi, SH yang ditemui Waspada, Rabu (19/5) di ruang kerjanya, membenarkan perihal pemanggilan Kadis Perindustrian Koperasi dan UKM tersebut. “Drs. Nya’ Mat kita periksa berdasarkan informasi masyarakat yang mengatakan mesin ketel di Kecamatan Tripe Jaya yang di beli 2008 lalu tidak berfungsi. Dari pemeriksaan terakhir , dia berjanji menyerahkan dokumen soal ketel termasuk dokumen lelang. Namun unda-

ngan lisan berikutnya tidak dipenuhi Drs. Nya’ Mat,” katanya. Saat dikonfirmasi di ruangannya, Drs. Nya’Mat menjelaskan tidak berfungsinya mesin ketel itu karena arus listrik untuk mengoperasikan mesin tidak mencukupi. Sementara dari perencanaan awal, ketel yang seharusnya untuk industri ditulis untuk rumah tangga. Soal dokumen yang diminta Kajari, Drs. Nya’ Mat mengatakan yang mengetahui soal dokumen mantan Kabid atau PPTK, Ali Perdana.“Beliau pindah tugas ke Aceh Singkil,” jelasnya. Soal tidak ketidakhadirannya, karena undangan lisan itu tidak pernah sampai kepadanya. “Saya tidak pernah tidak hadir jika diminta soal masalah itu.”(cb01)

Mengapa Lahan Sawah Disulap Jadi Kebun Kopi? ACEH Tengah tanah surganya Aceh. Namun sayang penduduk di sana setiap tahunnya harus mendatangkan beras dari luar, demi mengisi perut. Jumlahnya juga terbilang banyak, mencapai 13.159,544 ton pertahun. Ternyata lahan yang subur di sana tidak menjamin warganya mendapatkan beras. Mengapa bisa demikian? Alam Gayo yang berbukit dan lembah, ternyata tidak selama menjamin tersedianya beras. Tekstur tanah dan tofograpi ini menjadikan lahan subur itu lebih dominan untuk perkebunan dan pertanian selain padi. Dari luas wilayah 4.314,39 kilometer bujur sangkar lahan persawahan di sana hanya 7. 514 hektar. Produksinya juga belum banyak, hanya 25.547,6 ton dalam setahun. Sementara rakyat di pegunungan itu setiap tahunnya membutuhkan 28. 488,104 ton beras. Selain minimnya lahan persawahan, seiring dengan dinamika, muncul problem baru di sana. Banyak sawah beralih fungsi, bukan hanya untuk perumahan dan perkantoran, namun banyak yang disulap petani menjadi lahan perkebunan. Mengapa para petani mengambil inisiatif merubah tanah bersawahan menjadi kebun. Menurut beberapa petani yang dijumpai Waspada secara terpisah mengatakan, tingginya hasil kopi dihitung secara total pertahunnya, jika dibanding dengan hasil tanaman padi. “Biasanya dalam 1 hektar lahan dapat ditanam seribu batang kopi. Perhitungannya,

bila dalam 1 batang kopi mampu menghasilkan 1 kaleng gelondongan( biji kopi yang belum dibuang kulitnya), namun setelah digiling kulit luarnya, menghasilkan 4 bambu gabah (biji kopi yang telah dibuang kulit merah),” jelasnya seorang petani kopi di Kecamata Bintang. “Otomatis, jika 4 bambu gabah kopi itu setelah dikeringkan, bisa menghasilkan 2 kilogram kopi. Sementara harga biji kopi kering saat ini mencapai Rp 25 ribu rupiah perkilogramnya, berarti dalam satu tahun kita dapat mengantongi sekitar Rp50 ribu pendapatan brutto perbatang kopi,” rincinya. Jika dijumlahkan Rp 50 ribu dikalikan seribu batang kopi dalam satu hektar lahan, maka penghasilan petani kopi mencapai Rp 50 juta pertahun. Pendapatan brutto itu setelah dichek dengan pengeluaran yang mencapai 40 persen, maka nilai netto petani mencapai Rp 30 juta. Sementara seorang petani yang menanam padi di Bintang, dimana sawahnya mampu menghasilkan 4 kunce dalam setahun. Untuk mendapatkan 4 kunce , dia membutuhkan bibit mencapai 4 kaleng. Dalam 1 kaleng, jika panen maksimal tanpa ada hama, akan menghadilkan 1 kunce. Ukuran 1 kunce setara 50 kaleng gabah padi. “Biasanya kami panen 200 kaleng padi pertahun atau 4 kunce, namun bila kita jadikan beras setelah prosesing, jumlahnya diperkirakan hanya mencapai 80 kaleng. Hanya 20 kaleng beras saja yang kami dapat dalam satu kunce gabah padi, ka-

rena terjadi penyusutan sekitar 30 kaleng setelah terbuangnya gabah,” jelas petani itu. Ukuran 1 kaleng padi bila dihitung dengan gram mencapai 16 kilogram. Dalam 1 hektar menghasilkan 80 kaleng beras atau seberat 1.280 kilogram. Pendapatan 1, 3 ton itu dengan klasifikasi beras lokal yang berkualitas, dengan masa tanam setahun sekali. Namun dari data Dinas Pertanian Tanaman Pangan Aceh Tengah, disebutkan hasil padi dalam 1 hektar mencapai 3,4 ton dalamsetahun.Angkaitubertolak belakang dengan hasil yang didapati petani sawah di sana. Pihak pertanian di sana menargetkan ke depan penghasilan beras di sana mencapai 5 ton dalam setiap hektar pertahun dengan sistem tanam, setahun dua kali. Namun perbedaan jumlah angka yang didapat itu berimbas kepada petani sawah. “Hasil yang didapat dalam 1 hektar sulit mencapai 5 kunce (100 kaleng beras atau 1,6 ton beras). Saya belum pernah dengar beras lokal dapat menghasilkan 3,4 ton dalam setahun,” sebut Aman Qurnia seorang petani sawah di Kala Segi, Bintang. Nilai yang didapat petani sawah dalam setahun hanya Rp 10 juta. Itu juga masih bruto, belum dihitung pengeluaran yang cukup besar. Petani sawah hanya mendapat 40 persen dari hasil sawahnya atau senilai Rp 4 juta dalam setahun. Melihat perkembangan itu tidak dapat ditahan, bila petani sawah banyak yang mengalihkan areal persawahannya

menjadi kebun kopi. Kalkulasi perhitungannya sudah jelas, pendapatan kopi lebih besar bila dibandingkan sawah. Otomatis hasil padi di Aceh Tengah mengalami penurunan. Menurut Kadis Pertanian Tanaman Pangan Aceh Tengah, Ir.Nasiruddin Sk,MM, melalui Stafnya Rusli Sp.MM, menjelaskan, jumlah penduduk di negeri “Malem Dewa” 195. 124 jiwa . Dalam setiap hari perorang membutuhkan 0,4 kg beras. Dalam setahun perjiwa membutuhkan 146 kg beras. “ Aceh Tengah membutuhkan 28. 488,104 ton beras dalam setahun. Sementara produksi hanya 25.547,6 ton, dari hasil sawah 7. 514 hektar. Dengan demikian Aceh Tengah kekurangan 15. 328,56 ton beras setiap tahunnya,” sebut Rusli menjawab Waspada. Menurutnya, salah satu penyebab masih belum maksimal hasil beras di kota wisata itu, selain keberadaan sawah yang mulai menciut, karena beralih fungsi jadi ladang tanaman kopi. Namun disebabkan juga sebagian sawah itu telah ditumbuhi gedung perkantoran, rumah warga dan pembangun jalan beraspal. “Itu telah menjadi panggilan zaman. Penduduk setiap hari terus bertambah. Dengan bertambahnya jumlah jiwa kebutuhan akan sandang pangan tentunya akan meningkat. Jadi bila sawah yang letaknya berada dilokasi perkotaan, seperti Kecamatan Kebayakan, Bebesen dan Pegasing, pastinya secara otomatis jumlah lahan

persawahan akan berkurang keberadaaanya, karena dimanfaatkan untuk berbagai kepentingan lain,” jelas Rusli. Secara bersamaan, Fathan, staf lainnya di Distan, menjelaskan untuk mengatasi menciutnya sawah yang diperkirakan mencapai 400- 600 hektar, pihak Pertanian telah mengupayakan pembukaan lahan sawah baru di beberapa kecamatan. Seperti Linge, Bintang, Celala, dan Kecamatan Ketol. “ Di sana telah ditanami jenis bibit unggul dan hasilnya lumayan, mencapai 3,4 ton perhektar. Dengan sistem tanam 2 kali setahun.Yang akan datang melalui berbagai penyuluhan serta tehnis mengolah sawah, diharapkan ke petani mampu menghasilkan 5,0 ton beras perhektar. Bila itu tercapai kebu-

tuhan warga akan beras akan terpenuhi tanpa harus dipasok,” urai Fathan. Namun katanya, sampai saat ini untuk tercapainya target tersebut, Aceh Tengah masih membutuhkan lahan yang akan dijadikan sawah seluas 6. 451 hektar. ” Untuk menjadikan persawahan baru itu membutuhkan waktu dan proses. Kita akan terus berupaya, hasil beras dari lahan sawah yang ada saat ini mampu mengurangi besarnya pasokan beras dari luar daerah,” sebutnya. Namun bila dihitung secara ekonomi, waktu dan tenaga, perbandingan hasil sawah dan kopi jauh berbeda. Maka tidaklah heran bila lahan sawah di sana banyak yang beralih fungsi menjadi kebun kopi. Irwandi/ Bahtiar Gayo


Sebagian sawah yang beralih fungsi menjadi lahan di Aceh Tengah, foto diambil baru-baru ini.



WASPADA Senin 24 Mei 2010

Rekanan Harus Lunasi Retribusi Galian C

Bus Kurnia Kembali Beroperasi Di Pantai Barat Selatan BANDA ACEH (Waspada): Bus Antar Kota Antar Provinsi (AKAP) Fa.Kurnia yang pernah jaya di era 90-an, kini kembali beroperasi di wilayah pantai barat selatan dengan mengambil trayek perdana Meulaboh-Medan, Sumatera Utara. Bus Kurnia satu group dengan KAP (Kurnia, Anugrah dan Pusaka), ini dikenal kesohornya sejak lama dan kehadirannya ditunggu-tunggu masyarakat di kawasan itu. Di samping berfasilitas wah, busnya juga memiliki 32 tempat duduk (seat). Pemilik loket CV. Bintang Lestari Tour, Hendri Putra.S, yang ditemui di komplek terminal Blangpidie, kemarin mengaku sejak dua pekan lalu sebanyak empat unit bus kurnia kelas eksekutif sudah beroperasi kembali. Untuk wilayah pantai barat selatan, katanya, tahap awal ini hanya mengambil satu trip per hari dengan empat unit bus secara bergantian. “Kini harapan masyarakat tercapai sudahdengankembaliberoperasinyabusini,”ungkapHendri. Saat ini pihaknya mengambil tarif Rp120.000 untuk Abdya-Medan. Tarif ini katanya jauh lebih murah dibandingkan dengan mobil rental lainnya semisal minibus L.300 yang memungut ongkos Rp140.000, sedangkan travel jenis kijang senilai Rp150.000. “Saya optimis bus Kurnia kembali disukai masyarakat karena selain berfasilitas mewah ongkosnya juga murah,” imbuhnya.(b07)

Pembangunan Terminal Baru Bus Bireuen Belum Jelas BIREUEN (Waspada): Sejumlah awak dan agen bus di Kota Bireuen mempertanyakan kejelasan pembangunan terminal bus antar kota yang belum ada tanda-tanda pelaksanaannya menyusul digusurnya kawasan terminal bus lama untuk pembangunan BPD Aceh Cabang Bireuen. Pasalnya, pekerja bus ini mengaku sering mendapat teguran dari petugas lalu lintas baik polisi atau Dinas Perhubungan karena bus ukuran sedang dan minibus diparkir di sisi dan badan jalan lintas Negara sehingga mengganggu kelancaran arus lalu lintas dan terkesan semrawut. “Kami menilai masih banyak juga supir dan agen yang mau mengikuti aturan dan menjaga ketertiban, tetapi bagaimana lagi, pasca penggusuran kawasan terminal beberapa waktu lalu, sampai sekarang belum ada lokasi atau terminal pengganti, katanya segera dibangun,” kata seorang agen bus, Rusli Jumat (21/5). Sementara itu, Sekretaris Daerah Kabupaten Bireuen, Nasrullah Muhammad mengatakan, pembangunan terminal bus antar kota dengan sumber dana dari tingkat Provinsi Aceh, Pemkab Bireuen dalam hal ini hanya menyediakan tanah lokasi pembangunan. (cb03)

Jembatan Mon Kelayu Rusak Parah KUTA BLANG, Bireuen (Waspada): Masyarakat Desa Mon Kelayu, Kecamatan Gandapura, Kabupaten Bireuen selama ini resah. Pasalnya, kondisi jembatan di ruas jalan utama desa kawasan tambak lantai dan pondasi sudah rusak parah. Untuk mencegah terjadinya korban jiwa, warga setempat sudah menambal lantai jembatan dengan batang kelapa. Kades Mon Keulayu Muzakir H Hamid kepada Waspada Sabtu (22/5) mengatakan, kerusakan lantai dan pondasi jembatan Mon Keulayu sejak tahun 2004 sudah diusulkan perbaikan ke tingkat kabupaten, namun hingga kini belum ada realisasinya. Mulyadi, 29, warga desa setempat mengatakan, lantai dan pondasi jembatan beton berukuran 4x3 meter itu sudah patah sejak beberapa tahun lalu, meskipun sudah berulang kali diusulkan untuk mendapat perbaikan hingga kini belum ada perbaikan. Dikatakan, jembatan jalan utama Desa Mon Kelayu dapat menghubungi beberapa desa lainnya; Samuti Aman, Samuti Rayek, Samuti Pante dan Meunasah Rayek, tembus ke Simpang Pulo Awe, Kecamatan Kuta Blang.(b16)

Dua Maling Ditangkap SIGLI (Waspada): Polisi dan warga Desa Pineung, Kec. Mutiara, Kab. Pidie, Sabtu (22/5) sekira pukul 22:00 berhasil menangkap dua maling itik yang selama ini meresahakan warga setempat. Kedua maling itu MY, 32, warga Desa Ceurucok, Kec. Simpang Tiga, Kab. Pidie dan SR, 19, warga Desa Dayah Langgien, Kec. Bandar Baru, Kab. Pidie Jaya. Keduanya nyaris dibal-bal warga bila tidak segera diamankan polisi. Bersama kedua tersangka polisi dan warga berhasil mengamankan barang bukti berupa empat ekor itik dan satu unit sepeda motor jenis bebek. Kedua tersangka maling itik itu diancam lima tahun kurungan penjara. Beberapa warga Desa Pineung mengaku sejak beberapa bulan terakhir ini banyak ternak unggas milik penduduk setempat hilang pada malam hari. Sehingga belakangan ini warga mengintai aksi pencurian tersebut. Kapolsek Mutiara Iptu Jamaluddin melalui Kanit Reskrim Bripka Yuswar, SE kepada Waspada kemarin membenarkan pihaknya telah menangkap dua tersangka pencurian itik bersama empat ekor bebek warna putih. “Kini kedua tersangka bersama barang bukti telah kita amankan di Mapolsek Mutiara untuk dilakukan pengembangan,” kata Yuswar.(b20)

Waspada/Muhammad Riza

MALIK ITIK: Dua maling itek beulati (itik-red) diapit Kanit Reskrim Polsek Mutiara Bripka Yuswar, SE memegang barang bukti itik, Minggu (23/5).

Ketibaan (flight, asal, waktu):

Garuda Indonesia GA 146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 398 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

AK 305 Kuala Lumpur *


Keberangkatan (flight, tujuan, waktu):

15:45 GA 147 Medan/Jakarta


11:15 JT 397 Medan/Jakarta 16:00 JT 307 Jakarta 19:50 JT 399 Medan/Jakarta

07:20 11:55 16:35

12:50 SJ011 Medan/Jakarta


12:20 AK 306 Kuala Lumpur *


FY 3401 Penang 13:50 FY 3400 Penang * Setiap Senin, Rabu, Jumat dan Sabtu.


SIGLI(Waspada): Pemkab Pidie bertekad meningkatkan Pendapatan Asli Daerah (PAD) melalui sektor retribusi penambangan galian C. Maka dari itu, rekanan yang mengerjakan proyek sumber dana dari APBA dan APBN diwajibkan melunasi retribusi galian C. “Khusus proyek yang bersumber dari APBA dan APBN yang dikerjakan pihak rekanan. Kita telah menyurati Provinsi dan KPN agar setiap rekanan yang bersangkutan harus memlunasi retribusi galian C sebagai kelengkapan administrasi pengamprahan anggaran,” kata Kepala Dinas Penglola Keuangan dan Kekayaan Daerah (DPKKD) Pidie, Amiruddin, SE kepada Waspada, Jum’at (21/5). Disebutkannya pendapatan di sektor retribusi galian C kali ini diakuinya terus mengalami kenaikan setiap tahunnya. Pada tahun 2008 pedapatan asli daerah dari galian C yang ditargetkan senilai Rp15 miliar mampu mencapai target 89 persen, sedangkan pada tahun 2009 dari target Rp17 miliar mencapai 97 persen. Untuk mengejar target Pandapatan Asli Daerah (PAD) di sektor retribusi galian C, Pemkab Pidie bentuk tim peninjau yang akan turun langsung ke lokasi Juni nanti, guna menindaklanjuti target PAD senilai Rp26 miliar tahun 2010 ini. Dilihat dari tingkatan yang dicapai, Pemkab Pidie terus berupaya mencapai target dimaksud. Semisal proyek yang didanai provinsi dan APBN diwajibkan membayar retribusi galian C.(b20) Waspada/Muhammad Riza

GALIAN C: Aktivitas galian C di beberapa daerah di Kabupaten Pidie berdampak buruk bagi lingkungan. Bila tidak segera dihentikan dikhawatirkan bencana alam akan mengancam daerah tersebut.

Dublin Port Gagal Investasi Di Sabang SABANG (Waspada): Perusahaan asing dari Irlandia Dublin Port yang bergerak di bidang pengelolaan pelabuhan, rencananya akan berinvestasi di Pelabuhan Sabang, namun sudah mengurungkan niatnya, meskipun sudah banyak menurunkan biaya operasional selama membuka perwakilannya di Sabang. Plt. Kepala BPKS, Ir. Nasruddin Daud ketika dihubungi Waspada via ponselnya mengatakan, perusahaan Dublin Port Irlandia yang membuka kantor perwakilan di Jakarta sekarang ini sudah terjadi pergantian pimpinan dan rencana pembangunan Pelabuhan Sabang sebagai pelabuhan peti kemas menjadi batal. Salah seorang perwakilan Dublin Port yang ditempatkan di Sabang sudah kembali ke Jakarta dan menyatakan perusahaannya sudah membatalkan berinventasi di Kawasan Sabang. Kepala Unit Usaha Pelabuhan BPKS Agus Salim SE MSi juga mengatakan, ka-

bar ini pukulan pahit bagi Sabang, harapan semula agar Dublin Port Company dapat segera berinvestasi di Sabang sudah dipastikan tidak terwujud sebagaimana yang diharapkan, pihak Dublin Port sendiri sudah menyampaikan secara resmi tidak jadi berinvestasi di Sabang. Dijelaskan, pernyataan gagalnya Dublin Port itu keputusan final dari pihak manajemen Dublin Port yang berbasis di Irlandia dan diteruskan kepada anak perusahaan Dublin yang ada di Indonesia. Dari keputusan dan kesepakatan itu kata Agus, sudah tertuang dalam surat resmi yang dilayangkan pihak Duplin Port tertanggal 17 April 2010 kepada Pemerintah Aceh dan BPKS yang langsung disampaikan melalui perwakilan Dublin di Aceh Mr Kan Wehlen. “Dalam surat itu, Dublin Port menyatakan permohonan maaf kepada kita karena tidak jadi meneruskan rencana kerjasama investasi di kawasan pelabuhan bebas Sabang,” jelas Agus dengan nada kecewa yang menyatakan alasan Dublin Port membatalkan investasi itu tidak dijelaskan

dalam surat tersebut. “Kita juga heran, pihak Dublin Port tidak ada menjelaskan dalam surat apa alasan mereka tidak jadi beriventasi, bahkan secara formal utusan Dublin Port Mr Kan Wehlen secara lisan sudah menyampaikan kepada kita, tapi alasan kenapa mereka tidak jadi berinventasi juga tidak dijelaskan,” terangnya. Padahal lanjut dia, pihak Dublin Port sendiri selama membentuk perencanaan dan menyusun program kerjasama dengan BPKS dilaporkan sudah menghabiskan dana operasional senilai Rp15 miliar. Seperti diketahui, bebagai persiapan dan perencanaan sebenarnya sudah menuai kesepakatan final karena sebelumnya pihak Dublin Port melalui anak perusahaan di Indonesia sudah merencanakan pada tahun ini akan memperbaikisejumlahgudangpenumpukan kontainer di pelabuhan BPKS. Bahkan harapan dan penantian Dublin untuk action pertengahan bulan ini hanya tinggal kenangan, seiring batalnya pihak Dublin Port untuk berinvestasi.(b29)

Puluhan Ha Sawah Merekah ALUE IE PUTEH, Aceh Utara (Waspada): Sedikitnya 50 hektar (Ha) tanaman padi berusia sekitar 20 hari pasca tanam, di Desa Alue Buya dan sebahagian Desa Matang Cut serta Matang Raya Timu, Kecamatan Baktiya, Aceh Utara, kini terancam mati akibat kekeringan. Bahkan, sebagian hamparan sawah di ketiga desa itu kini sudah merekah. “Sejak awal musim tanam kali ini, kami belum kebagian air irigasi. Saat persemaian bibit, kebetulan ada air hujan. Namun setelah siap tanam, pertumbuhan padi tidak normal lantaran intensitas hujan berangsur kurang dan air irigasipun tidak sampai ke kawasan ini,” kata Tgk Ajuran, Kejruen atau Petugas Penjaga Pintu Air (P3A) Desa Alue Buya kepada Waspada, Selasa (18/5). Menurut Tgk Ajuran, distribusi air dari saluran induk Irigasi Langkahan ke kawasan Desa Alue Buya dan Desa Matang Cut, terhambat karena saluran sekunder dari Darul Aman Seunuddon (BPL 18) hingga ke Desa Alue Buya (BDA2) terlalu sempit dan lebih dangkal daripada saluran hulu, sehingga aliran air tidak lancar. Demi mengairi sawah, sambung Ajuran, pihaknya bersama masyarakat pernah beberapa kali bergotongroyong mengeruk saluran tersebut dengan menggunakan cangkul dan sekrup. Setelah dikeruk, aliran air sempat normal sekitar dua hari, tapi selanjutnya aliran air kembali tersendat karena material tanggul yang dibangun dari tanah pasir tergerus air dan kembali menyumbat saluran. “Saluran irigasi sepanjang 1200 meter ini pernah direhab Juni 2009. Dananya disebut-sebut mencapai Rp 750 juta dari APBK Aceh Utara Tahun Anggaran (TA) 2008. Entah atas izin siapa, rekanan menggunakan tanah pasir yang dikeruk


MEREKAH: Puluhan hektar sawah siap tanam di Desa Alue Buya dan sebahagian Desa Matang Cut serta Matang Raya Timu, Kecamatan Baktiya, Aceh Utara, merekah akibat kekeringan. Aliran air irigasi Langkahan tidak sampai ke kawasan itu karena saluran irigasi sekunder menyempit dan dangkal. di kawasan sekitar untuk menambah ketinggian tanggul. Buntutnya, tanggul tidak kokoh dan mudah runtuh, lebih-lebih saat musim hujan. Seharusnya, rekanan menggunakan tanah liat atau tanah gunung,” imbuh Tgk Ajuran didampingi warga Desa Alue Buya lainnya Tgk Zulkifli. Tgk Ajuran juga mengaku sudah berulang kali mengeluhkan soal tidak adanya air di sawah Alue Buya dan sekitarnya kepada Petugas Pintu Air (PPA). Bahkan, PPA berjanji akan segera mencari solusinya.Tetapi kenyataan yang terjadi, air dalam saluran tidak cukup untuk membasuh muka dan sawah warga pun tetap kering kerontang. Secara terpisah PPA Baktiya, Ismail

alias Mae Matang Jeulikat ketika dikonfirmasi via telefon, kemarin, membenarkan aliran air irigasi tidak sampai ke Desa Alue Buya, Desa Matang Cut dan sebagian sawah di Desa Matang Raya Timu. Namun Ismail membantah hal itu akibat saluran sekunder dari BPL 18- BDA 2, direhab asal jadi. “Aliran air tersendat karena saluran sudah dipenuhi endapan lumpur, bukan karena tersumbat pasir material tanggul. Dan ini tidak saja terjadi di BPL 18-BDA2, tapi juga di saluran lainnya. Bila kurang yakin, silakan cek langsung ke lapangan. Saya juga minta pejabat terkait segera ke lokasi. Sebab sebagai petugas lapangan saya sudah kewalahan menghadapii situasi ini,” tandas Ismail.(cmus)

Sisa Dana Otsus Dan Migas Tak Jelas Di Pidie SIGLI (Waspada): Keberadaan sisa dana Otonomi Khusus (Otsus), Minyak Dan Gas (Migas) tahun 2009 untuk Kabupaten Pidie ditengarai tidak jelas. Disebut-sebut sisa dana tersebut mengendap di Provinsi Aceh. Sekretaris Bappeda, Kabupaten Pidie Muhammad Adam, saat ditanya Waspada, Jumat (21/5) tentang kebaradaan sisa dana Otsus dan Migas tahun 2009 tidak dapat menjelaskan dengan alasan dirinya tidak mengantongi data. Bahkan untuk memperjelas tentang keberadaan sisa dana itu pihaknya telah beberapa kali melakukan koordinasi dengan pihak Provinsi Aceh. Tetapi dirinya tidak memperoleh jawaban pasti. “Sisa dana Otsus dan Migas sampai saat ini masih berada di provinsi. Kami tidak mengetahui jumlahnya secara rinci. Apakah masih ada atau tidak,” sebut Muhammad Adam. Menurut dia, meskipun proyek pembangunan yang menggunakan dana Otsus dan Migas itu proses tendernya dilakukan Pidie, tetapi pengelolaannya dilakukan Pemerintah Provinsi Aceh. Elsesnya, pihaknya sulit mengetahui sisa keberadaan dana tersebut. Muhammad Adam menuturkan, tahun 2009 Pemkab Pidie memperleh dana senilai Rp111.940.000.000 bersumber dari Otsus dan Migas. Danadana itu dianggarkan untuk bidang pembangunan dan pemeliharaan infrastruktur dari dari dana tambahan hasil Migas senilai Rp2.482.600.000 dan Otsus Rp62.198.420.000. Bidang pemberdayaan ekonomi rakyat dan pengentasan kemiskinan dana yang bersumber dari Migas senilai Rp4.062.500.000 dan Otsus Rp3.175.000.000. Sedangkan bidang pendidikan, kesehatan, pelaksanaan keistimewaan dan sosial budaya sumber dana dari Migas senilai Rp12.064.900.000 dan Otsus senilai Rp27.956.580.000. “Rincian angka total sumber dana dari Migas tahun 2009 Pidie senilai Rp18.610.000.000 dan Otsus senilai Rp93.330.000.000. Kalau ditanya sisanya saya tidak tahu. Sebab dana ini dikelola langsung Pemprov Aceh,” katanya. Dia memperkirakan sisa dana itu telah ‘hangus’ karena proyek dari sumber dana tidak selesai dikerjakan. Maklum, batas waktu yang ditentukan sangat mepet. Sedangkan untuk tahun 2010 dana yang bersumber dari Otsus dan Migas senilai Rp120.104.014.326. (b20)

BPM Gelar Lomba Inovasi TTG Terbarukan Se-Aceh BANDA ACEH (Waspada): Badan Pemberdayaan Masyarakat (BPM) Aceh menggelar lomba inovasi alat teknologi tepat guna (TTG) terbarukan se-Aceh II dengan total hadiah Rp.105 juta. Dan kepada Juara I akan diikutsertakan pada Gelar TTG Nasional XII bulan September 2010 di Yogjakarta. Kepala BPM Aceh, Drs. H. M. Ali Basyah, MM dalam pernyataanya, Jumat (21/5) di Banda Aceh, menyebutkan kegiatan lomba inovasi TTG dilaksanakan dengan tujuan mempercepat pemulihan ekonomi, meningkatkan dan mengembangkan kegiatan usaha ekonomi produktif masyarakat. “Juga memperluas lapangan kerja dan usaha serta meningkatkan produktivitas dan mutu produksi,” kata Ali Basyah. Selain itu, tambahnya, menunjang pengembangan wilayah melalui penemuan TTG berbasis potensi daerah menuju keunggulan kompetitif dalam persaingan lokal, regional dan global. Dikatakannya, TTG adalah teknologi yang sesuai dengan kebutuhan masyarakat dan dapat menjawab permasalahan masyarakat serta tidak merusak lingkungan. TTG ini juga dapat dimanfaatkan oleh masyarakat secara mudah serta menghasilkan nilai tambah dari aspek ekonomi dan lingkungan hidup. Peserta dapat mengirim atau mengantar dokumen usulan TTG yang akan diperlombakan kepada Panitia Penyelenggara Lomba Inovasi Alat TTG Terbarukan se-Aceh II BPM Aceh, cq Bidang Pengembangan Teknologi Perdesaan, Jl. Tgk Syeh Mudawali No.E-19, Banda Aceh. (b04)

Tepas Bambu Bireuen Diminati Warga Malaysia BIREUEN (Waspada): Tepas bambu hasil kerajinan tangan warga Desa Buket Teukuh dan Blang Reuling, Kecamatan Kota Juang, saat ini diminati warga negeri jiran Malaysia. Namun, warga atau perajinnya belum memenuhi pertmintaan karena terkendala dana memproduksinya. Demikian Nurleli, seorang perajin tepas bambu di Desa Buket Teukueh baru-baru ini. “Saya diberitahu tetangga yang berobat ke Rumahsakit Lam Wah Ie Pulau Penang Malaysia bahwa ada lima keluarga yang meminta untuk dibawakan tikar anyaman bambu yang kami rajut atau produksi, namun kami belum mampu memenuhi permintaan itu, selain barangnya tak mencukupi juga tidak memiliki modal usaha memproduksi dalam jumlah banyak sesuai permintaan,” katanya akhir pekan lalu. Geuchik (kepala desa) Blang Reuling, M. Nasir Adam yang ditanya secara terpisah membenarkan informasi tepas made in warganya diminta warga Malaysia. “Warga saya menganyam tikar dan merajut tepas itu pekerjaan membantu suaminya,” katanya. Menurut M. Nasir, hingga kini mereka belum pernah mendapatkan bantuan baik dari dinas terkait maupun NGO. “Saya sendiri mengharapkan ada kepedulian pemerintah kepada warga kami yang memproduksi tepas bambu ini,” harapnya.(amh)

Giliran Pegawai Sekdakab Bireuen Kumpul Uang Bayar Tunggakan Listrik BIREUEN (Waspada): Aksi solidaritas kumpul koin yang digelar aliansi masyarakat sipil Bireuen, kabarnya diikuti para pegawai di Setdakab Bireuen. Namun, aksi mereka bukan untuk mendukung aksi yang digelar aliansi masyakat sipil itu, namun untuk membantu Pemkab Bireuen untuk melunasi tunggakan rekening listrik yang disebut-sebut selama 11 bulan mencapai Rp9,214 miliar lebih. Informasi yang diperoleh Waspada kemarin, setelah sejumlah LSM mengelar aksi kumpul koin dipusat kota, sejak Senin (17/5) pagi. Sementara, sejumlah pegawai Sekdakab Bireuen usai apel sore, atas dasar solidaritas berinisiatif membantu Pemkab dengan cara mengumpulkan duit pecahan seribu dari pegawai di kantor pemerintahan itu. ”Pengutipan sumbangan mereka lakukan bukan untuk menjatuhkan harkat dan martabat Pemkab Bireuen, tapi sebatas wujud rasa solidaritas para pega-

wai di sekdakab ini,” kata Adli seorang pegawai Sekdakab Bireuen. Menurutnya, inisiatif pengumpulan uang membantu pemkab setempat membayar tunggakan rekening listrik itu, karena selain Pemkab Bireuen sedang krisis dana, juga yang paling dikhawatirkan adalah bila tunggakan listrik tersebut belum dilunasi tentunya suplai arus listrik terancam diputuskan sementara waktu. “Nah, kalau sempat listrik diputuskan, imbasnya pelaksanaan tugas menjadi tidak optimal,” ujarnya, seraya mengatakan, setelah koin terkumpul sampai satu karung 50 kilogram, baru diserahkan kepada Bupati dan Ketua DPRK Bireuen. Sementara itu, Manager PT PLN Ranting Bireuen Ridwan Adam, yang dikonfirmasi wartawan secara terpisah kemarin mengatakan, tunggakan tekening listrik Pemkab Bireuen sejak

Juli 2009 hingga Mei 2010 atau sekitar 11 bulan sebesar Rp 9,214.125.460 miliar. Tunggakan itu adalah, untuk Penerangan Jalan Umum (PJU) tunggakan Rp 6.938.917.640 miliar. Tunggakan rekening listrik khusus Kota Bireuen baik lampu jalan dan perkantoran Rp miliar. ”Dengan tidak menguranggi rasa hormat, sampai batas pembayaran setiap tanggal 20 belum dilunasi, suplai arus listrik dibeberapa perkantoran, akan diputuskan sementara,” tegasnya. Menurut Ridwan Adam, sebagai upaya menarik tunggakan tersebut, PLN ranting Bireuen selama ini sudah berupaya melakukan penagihan secara persuasif tapi sudah 11 bulan belum terlunasi. Bahkan permasalahan ini menjadi perhatian Gubernur Aceh melalui surat ditandatangani Wakil Gubernur Muhammad Nazar.(amh)

Waspada/Abdul Mukthi Hasan

TEPAS BAMBU BUKET TEUKUEH : Seorang pedagang tepas bambu yang diproduksi warga Buket Teukueh, Kota Juang, Bireuen, belum lama ini menggelar dagangannya di pasar Gandapura, pada hari pekan (Selasared). Tepas bambu hasil kerajinan warga Buket Teukueh itu telah terkenal sejak lama, bahkan telah dipasarkan kemana-mana di Aceh, termasuk yang dipesan khusus.


WASPADA Senin 24 Mei 2010

C5 Ternak Berkeliaran Di Perkantoran

Chikungunya Dapat Kembali Ancam Warga Agara KUTACANE (Waspada): Serangan chikungunya kembali terdengar di Aceh Tenggara (Agara). Hal ini disinyalir akibat masih kurangnya pemahaman yang disampaikan kepada masyarakat untuk mengantisipasi penyakit tersebut. Anil Huda, ST, Direktur Satyiapila kepada Waspada, Kamis (20/5) mengatakan, serangan chikungunya pertama kali ‘merambah’ ke Agara sekitar Mei dan Juni 2009. Terdeteksinya berawal dari sidak Bupati H. Hasanuddin B, dan Kadiskes Agara Dr. Ramulia S.POg, di Kecamatan Lawe Sigala-gala. Saat itu Kadiskes mengatakan, salah satu penyebab chikungunya karena adanya sampah coklat yang dibuang tergenang air. Namun saat ini, indikasi terjadinya serangan chikungunya di Agara sudah muncul kembali. “Ada kami pantau pasien yang berobat di tempat praktek dokter dan RSU Kutacane,” kata Anil Huda. Munculnya chikungunya ini

BLANGKEJEREN ( Waspada): Belum ditentukannya soal qanun penertiban hewan ternak oleh DPRK, beberapa pemilik ternak membiarkan ternak mereka berkeliaran di pekarangan kantor. Buktinya, Kamis pagi (20/5) belasan ternak berkeliaran di halaman kantor Mahkamah Syariah Gayo Lues. Bebasnya ternak berkeliaran, membuat jalan menuju kantor terhalang. Bahkan pegawai yang hendak ke kantor harus menunggu lama agar bisa sampai ke kantor. Salah seorang warga yang hedak menuju kantor mahkamah syariah meminta Pemkab dan DPRK menindaklanjuti hal itu. Pasalnya, selain mengganggu lalu lintas, ternak acap merusak kebun warga.(cb01)

disinyalir karena tidak adanya tindaklanjut penanganan yang dilakukan pihak berkompeten, kata dia. Direktur RSU Sahuddin, Dr. Buhari, Spog membenarkan hasil yang disampaikan Satyiapila kepada Waspada. Buhari SPOG tidak membantah hal ini bakal menjadi ancaman, namun dikatakan saat ini kasus chikungunya masih belum tahap mengkhawatirkan. Dr. Buhari mengatakan, chikungunya bisa dicegah. Upaya pencegahan hampir mirip pencegahan epidemic serangan nyamuk demam berdarah. Dengan melakukan pengurasan genangan air, menimbun sampah. “Ya tiga M itu lah yang perlu dilakukan secara disiplin,” kata dia. Ditambahkan, terkait sampah coklat yang terbuang, Dr. Buhari mengatakan, sebaiknya sampah kulit coklat dibakar agar tidak ada tempat nyamuk bersarang dan berkembang biak.(b28)

Tak Tahan Hirup Debu, Warga Blokade Jalan Negara KUTABINJEI, Aceh Timur (Waspada): Tak tahan terus-terusan menghirup debu, warga memblokade proyek pengaspalan jalan negara di kawasan Desa Julok Tunong Kecamatan Julok, Aceh Timur, Jumat (21/5).Warga meletakkan ban bekas di badan jalan. “Kepulan debu sangat banyak. Rekanan hanya menyiram jalan dua kali sehari. Alhasil, warga yang tinggal sekitar proyek mesti mandi debu dan tidak bisa beraktifitas secara normal. Saya sendiri, yang sehari-hari membuka bengkel mobil di pinggiran jalan ini terpaksa mogok kerja,” kata Mastura, 50, warga Julok Tunong, Jumat (21/05). “Debu tak hanya beterbangan siang hari.

Malam pun debu menyusup hingga ke kamar. Ini sangat mengganggu dan meresahkan, terutama warga yang tinggal dekat proyek. Karenanya, warga terpaksa meletakkan ban bekas di badan jalan, supaya kenderaan yang lalulalang melambat dan debu yang beterbangan pun berkurang,” imbuhnya. Secara terpisah, pihak rekanan proyek, Amiruddin, saat dikonfirmasi via telefon memastikan pihaknya selama ini rutin menyiram jalan. Hanya saja, karena suhu beberapa hari ini sangat panas, badan jalan cepat kering. “Harapan kami, masyarakat bisa memaklumi dan bersabar karena jalan ini masih tahap pengerasan,” tandas Amiruddin.(cmad)

Kas Kosong, SMA Unggul Terancam Tutup IDI RAYEUK, Aceh Timur (Waspada): Garagara usulan anggaran biaya operasional tidak tertampung dalam APBK 2010, SMA Unggul Aceh Timur di Kecamatan Birem Bayeun terancam tutup. Kas sekolah dilaporkan kosong total. “Kami benar-benar kehabisan biaya operasional. Jangankan untuk kebutuhan lain, untuk bayar rekening listrik sekolah saja susah,” keluh Kepala SMA unggul Birem Bayeuen, Drs. Muhammad Thaib, Jumat (21/5). Thaib menyesalkan sikap pemerintah yang tidak memasukkan biaya operasional SMA Unggul Aceh Timur dalam APBK tahun ini. Apalagi, selama ini sekolah tersebut telah banyak memberi kontribusi positif, khususnya mengharumkan nama Aceh Timur melalui beragam prestasi. “Contoh nyata, kelulusan UN siswa kita tahun ini mencapai 100 persen dan 60 persen siswa di antaranya mendapat undangan dari sejumlah uiversitas terkemuka di Indonesia,

termasuk Fakultas Kedokteran Unsyiah, Sekolah Teknik Telkom Bandung dan USU Sumatera Utara,” kata Thaib. Selain itu, dalam ajang olimpiade ilmu pengetahuan tingkat kabupaten baru-baru ini, SMA unggul Aceh Timur memenangi 6 mata pelajaran dari 8 bidang studi yang dipertandingkan dan keenam siswa pemenang akan mewakili Aceh Timur untuk olimpiade tingkat Provinsi Aceh. “Di samping itu, 30 persen siswa kita juga akan mewakili Aceh Timur untuk olimpiade olah raga tingkat nasional. Dengan segudang prestasi sangat ironis jika dana operasional sekolah malah tidak dianggarkan dalam APBK,” tandas Thaib. Secara terpisah, Kepala Dinas Pendapatan dan Pengelolaan Keuangan Daerah (DPPKD) Aceh Timur, Drs. Daifuddin, saat dikonfirmasi berjanji mengusulkan anggaran operasional untuk SMA Unggul Birem Bayeun, pada perobahan anggaran Juni mendatang.(cmus)

Dukungan JR-UUPA Mengalir BANDA ACEH (Waspada): Setelah JRUUPA resmi didaftar ke Mahkamah Konstitusi (MK) di Jakarta, Kamis (20/5), dukungan terhadap gugatan pengujian terhadap pasal 256 UUPA tentang Pembatasan Calon Independen, terus mengalir. Tidak hanya dari kalangan ulama dan intelektual, namun sejumlah elemen sipil masyarakat Aceh, juga mendukung melalui media masa. “Kita mendukung sepenuhnya JR-UUPA yang telah digagas dan kini resmi didaftar di MK,” ujar Tgk. H. M. Iqbal, B.Th, MA, Jumat (21/5) di Banda Aceh. Iqbal memahami, hanya melalui JR-UUPA akan terjadi kesusaian pasal-pasal dalam UUPA dengan Undang-Undang Dasar (UUD) 1945. “Selaku masyarakat bawah hanya menginginkan demokrasi di Aceh benar-benar terlaksana sesuai UU,” katanya. Muliadi, politisi asal Aceh Timur secara terpisah mengomentari, dalam JR-UUPA yang sedang digagas Masyarakat Sipil Aceh (MSA) di Jakarta, dipastikan terjadi pro-kontra di Aceh.


> Kirim foto dari kamera handphone ke 08192

Namun dia menilai itu positif dalam ajang politik menuju demokrasi seluas-luasnya di Provinsi Aceh. Muliadi yang juga anggota DPRK Aceh Timur periode 2009-2014 menambahkan, dalam Judicial Review Undang-Undang Pemerintah Aceh (UUPA) nantinya diharap tidak hanya pasal 256 UUPA yang diujikan, namun 19 pasal lainnya harus di Judicial Review (JR) juga, sehingga benar-benar sesuai UUD 1945. Menurut Muliadi, jika Mahkamah Konstitusi (MK) mengabulkan JR-UUPA, maka demokrasi di Aceh akan memihak kepada masyarakat sipil di luar Partai Lokal (Parlok) dan Partai Nasional (Parnas). “Jalur Calon Independen dalam Pilkada nanti sebagaimana di daerah lain sangat diidamkan masyarakat di Aceh,” ujarnya. Sementara anggota DPR asal Aceh, Tgk. Abdurrahman BTM, saat dimintai keterangannya mengatakan, pihaknya di senayan tetap memperjuangkan aspirasi masyarakat Aceh.(cmad)

11 01 47


Aksi Penjualan Tanah Menggila KUALASIMPANG (Waspada): Aksi penjualan ratusan hektar tanah negara diduga dilakukan sindikat mafia mengatasnamakan masyarakat dan kelompok tani, kian menggila di Kecamatan Tenggulun, Kabupaten Aceh Tamiang. Direktur Eksekutif Lembaga Advokasi Hutan Lestari (LembAHtari), Sayed Zainal, M, SH menyatakan kepada Waspada, kemarin, LembAHtari prihatin atas terjadinya indikasi itu. “Ternyata sampai April 2010, kawasan KEL yang bersebelahan dengan tapal batas Taman Nasional Gunung Leuser (TNGL) Tenggulun terus dirambah, bahkan dikapling untuk diperjualbelikan dari luasan 50 ha mencapai 300 ha, mengatasnamakan masyarakat dan kelompok tani dengan harga Rp5 juta–Rp6 juta /hektar,” ungkap Sayed Zainal. Sayed menerangkan, sejak Maret sampai 12 Mei 2010 LembAHtari melakukan pantauan langsung di lapangan dengan menentukan titik kordinat lokasi

yang ditambah untuk perkebunan sawit dan lokasi yang akan dijualbelikan. Seperti temuan di lapangan berdasarkan titik koordinat N 04°, 02’, 16.23 E. 98°, 00’,. 26.2" N. 08°, 02’. 42.3" E. 92°. 02’. 42.8". (Peta topografi Tenggulun Skala 1.50.000). Uniknya lokasi yang dirambah dan dikapling terletak dalam kawasan penyanggah TNGL merupakan kawasan KEL secara administarsi desa/kecamatan merupakan Dusun Adil Makmur Desa Tenggulun, bersebelahan dengan lokasi HGU PT. Sisiro yang merupakan koridor (lintasan gajah). “Berkaitan temuan suratsurat, ada keanehan lokasi itu diatasnamakan Kelompok Tani SM Besitang diketuai Sup, penduduk Langkat Tamiang beranggotakan 80 orang termasuk datuk penghulu Tenggulun dan beberapa tokoh masyarakat Tenggulun,” ungkap Sayed. LembAhtari mengungkapkan, modus operandinya, 4 November 2009 dan 21 Oktober 2009 Datuk Penghulu Tenggulun membuat surat keterangan, berkaitan pengurusan surat tanah diserahkan kepada Kelompok Tani SM. Sedangkan di sisi lain Datuk Penghulu Tenggulun

menyatakan, dalam surat keterangan itu akan mengurus pelepasan hutan kepada Dishutbun Aceh Tamiang. Sayed menerangkan, pada 27 Maret 2007 Sup Ketua Kelompok Tani SM juga menyerahkan kuasa di bawah tangan kepada dua tokoh masyarakat Tenggulun berinitial MA dan JUM untuk mengurus surat menyurat. Ada indikasi kuat lain kelompok tani dan Datok Penghulu Tenggulun telah menerima uang panjar Rp100 juta untuk mengurus akte camat. LembAHtari mengimbau Pemkab Aceh Tamiang dan Muspida Kec. Tenggulun serta Dishutbun Aceh Tamiang mengamankan pembukaan lahan secara liar dan rencana jual beli lahan oleh orang-orang tak bertanggungjawab. “Sebab selama ini masalah-masalah kejahatan lingkungan yang berkaitan tanah dan perkebunan terus dikibarkan tanpa ada tindakan hukum dan pengawasan,” sebut Sayed. LembAHtari juga meminta agar Kepala Balai TNGL mengamankan serta mengambil tindakan kawasan penyangga TNGL di wilayah Tenggulun yang merupakan wilayah kon-

Penanaman Pakan Ternak

Hari Kebangkitan Nasional dimanfaatkan oleh kaum muda untuk unjuk rasa sebagai bentuk protes terhadap situasi sosial di negeri ini. Tampak pada gambar yang diabadikan Kamis (20/5), kaum muda unjuk rasa di Bundaran Simpang Lima Kota Banda Aceh. Kiriman Safirul Akram, Banda Aceh, 0813602401xx

servasi yang perlu diselamatkan mengingat kawasan itu koridor gajah yang terus terancam. Camat Tenggulun, Rafe’ie SE ketika dikonfirmasi Waspada, Kamis (20/5) membenarkan ada oknum-oknum yang ingin menjual tanah negara yaitu kelompok Sup Cs. “Kalau soal ada orang yang sudah mengambil uang panjar senilai Rp100 juta dari Sup untuk mengurus surat akta camat, hal

itu bukan urusan saya sebagai camat, tetapi kalau tentang Datuk Tenggulun yang menerbitkan surat tanah pernah saya panggil agar menarik kembali dan membatalkan surat-surat yang menyangkut tanah negara yang diperjualbelikan itu,” kata Rafe’ie. Rafe’ie juga menegaskan tidak akan membuat surat akte tanah yang diminta kelompok Sup Cs.(b24)

H Amir Dan Arifin Mukim Terpilih Tanjung Mas Dan Punaga RIMO, Aceh Singkil (Waspada): H. Amirudin Manik dan Arifin terpilih sebagai mukim Tanjung mas dan Punaga Kecamatan Gunung Meriah, Aceh Singkil melalui pemilihan mukim (Pilkim), Kamis (20/5) di Rimo dan Gunung Lagan. Pada Pilkim Tanjung Mas di Gedung Pertemuan Rimo, H. Amirudin Manik menjadi Kepala Mukim Tanjung Mas dengan 46 suara, sementara H. Manjek Pohan mendapat 36 suara. Pilkim Tanjung Mas memperebutkan 100 suara oleh tiga kandidat calon, suara yang diperebutkan itu merupakan suara perwakilan dari 19 kampung (desa), di mana setiap Kampung diberi Lima hak suara sementara Lima suara jatah pengurus kemukiman. Punaga Usai Pilkim Tanjung Mas, panitia Pilkim melanjutkan kegiatan serupa untuk Pilkim Punaga yang dilaksanakan di gedung SDN Tanah Merah, Kampung Seping Baru, dimenangkan Arifin dengan 14 suara dari 35 suara yang diperebutkan. Ketua Panitia Drs. Jihan Pahmi Sanif, Jumat (21/5) menyebutkan, Pillkim untuk dua wilayah tersebut berjalan aman dan lancar. “Pemilihan mukim berjalan aman dan lancar,” kata Sanif yang juga Kasi PMD Setcam Gunung Meriah.(b30)

Ratusan Juta Diduga Bermasalah

Hujan Tak Urungkan Semangat Harkitnas

BLANGKEJEREN (Waspada): Penanaman pakan hewan ternak jenis rumput gajah yang bersumber dari dana otsus 2010 senilai Rp165 juta lebih, diduga bermasalah. Pasalnya, dari sepuluh hektar lahan yang direncanakan baru ditanam seluas 4 hektar. Sumber Waspada yang enggan dituliskan identitasnya menjelaskan, dari dana senilai Rp165 juta lebih itu, untuk perhektarnya dialokasikan senilai Rp23 juta. Dari dana senilai Rp23 juta itu, sudah termasuk biaya pagar, upah tanam, dan pupuk serta bibit. “Namun rekanan baru sekadar menanam bibit seluas empat hektar dan upah bibit tampaknya tidak diberikan rekanan. Bibit itupun diduga tak sesuai kebutuhan dalam hektarnya yakni, sekitar sepuluh ribu stek (bibit) dalam satu hektar,” katanya pekan lalu. Ditambahkannya, selain kekurangan stek dalam hektarnya, di duga penanaman stek itu tidak dibarengi dengan pemupukan dan pagar sebagaimana yang tercantum dalam kontrak. “Kalau pun dipupuk, kemungkinan tidak merata. Soal pagar tampaknya tidak ada,” katanya

SUBULUSSALAM (Waspada): Hujan yang menyelimuti Kota Subulussalam, Jumat (21/5) tidak menyurutkan semangat para Pegawai Negeri Sipil (PNS) dan sejumlah siswa setempat mengikuti upacara Peringatan Hari Kebangkitan Nasional (Harkitnas) yang dilaksanakan di halaman Setdako Subulussalam. Walikota Subulussalam, Merah Sakti selaku pembina upacara yang dihadiriWakilWalikota H. Affan Alfian Bintang, unsur Muspida plus, jajaran Kepala SKPK setempat dan sejumlah undangan mengingatkan segenap jajarannya dan para generasi muda agar jangan sampai kehilangan arah dan pedoman dalam mengisi kemerdekaan, seperti dengan senantiasa menjalin persatuan dan kesatuan. Melalui momen Harkitnas, Sakti mengajak semua elemen masyarakat, terutama mereka yang berperan dalam pemerintahan untuk tidak melupakan sejarah, bagaimana besarnya tantangan dan halangan dalam mewujudkan Indonesia merdeka. Satu hal yang tak kalah pentingnya dalam mewujdukan Subulussalam yang lebih baik, Sakti memastikan perlunya KIS (Koordinasi, Integarsi dan Sinkronisasi) antara para pimpinan SKPD dan jajarannya. (b33)

menduga. Anehnya lagi kata sumber, bibit rumput gajah yang disebut-sebut dibeli rekanan dari Aceh Tengah, tenyata dibeli dari lahan milik Ibnu Hafit yang terletak di Desa Tetingi, Kecamatan Blang Pegayon, Gayo Lues. Kepala Bidang Peternakan dan Perikanan, drh. Ibnu Hafit yang ditemui Waspada, Jumat (21/5) menjelaskan, lahan pakan ternak itu bukan sepuluh hektar melainkan tujuh hektar. “Belum ditanamnya sisa lahan seluas tiga hektar lagi karena masih menunggu datangnya curah hujan. Pasalnya, jika penanaman bibit dilakukan saat kemarau kemungkinan bibit itu akan mati,” katanya. Disebutkannya pihaknya sama sekali tidak berniat untuk tidak menanam sisa itu. “Selain itu anggaran untuk kegiatan itu belum turun dan sekarang penanaman masih memakai dana rekanan sendiri,” katanya seraya menjelaskan pekerjaan itu belum selesai tenggang waktunya. Hafit juga mengatakan, ketiga hektar lahan yang belum ditanami itu meliputi lahan milik Jhon, seluas satu hektar berlokasi di jalan Kutacane-

Blangkejeren. Udin, lokasi di Desa Tetingi dan Abdi di Desa Umelah, kecamatan sama. “Sedangkan empat hektar lahan yang telah ditanami meliputi lahan Ramli Syarif, seluas 1,3 hektar di Blang Tenggulun, Sukri, 1,5 hektar di Blang Sere, Kec. Kuta Panjang dan lahan Abu, seluas 1,2 hektar di Desa Tamak Kolak, Kecamatan Blang Pegayon,” katanya memaparkan. Di samping itu ungkap Hafit, soal upah tanam dan pagar sepenuhnya tanggung jawab rekanan. “Kita tidak mau tahu soal upah tanam dan pagar serta pupuk yang jelas saat seratus persen semuanya ada,” katanya. Soal bibit rumput gajah yang sempat disebut-sebut diambil dari lahan Ibnu Hafit, hal itu dibantah Ibnu Hafit. “Bibitnya langsung dibeli rekanan dari Aceh Tengah usai pengu m u m a n t e n d e r l a l u ,” ungkapnya. Terakhir Hafit mengatakan, rekanan penanaman pakan ternak itu CV. P berkantor di Desa Kampung Jawa, Kecamatan Blangkejeren. Sayang, pimpinan perusahaan itu, menurut Ibnu Hafit sedang di Banda Aceh.(cb01)

Pemprov Diminta Tanggulangi Ekses Gelombang Pasang


DIHALANG TERNAK: Gerombolan ternak memenuhi jalan menuju kantor Mahkamah Syariah Gayo Lues. Terlihat mobil dinas Kepala Mahkamah Syariah dihalangi ternak saat memasuki halaman kantor.

TAPAKTUAN (Waspada): Sejumlah anggota DPRK Aceh Selatan minta Provinsi Aceh menanggulangi ekses bencana gelombang yang melanda daerah penghasil pala tersebut. “Selain memberi bantuan para korban yang terpaksa harus mengungsi guna menyelamatkan diri, kita juga minta penanganan jangka panjang melalui pembangunan tanggul laut di sejumlah titik rawan,” kata Azmir,SH kepada Waspada yang menghubungi di Tapaktuan, Jumat (21/5). Wakil Ketua Komisi D itu mengataku prihatin terha-

dap nasib para korban bencana gelombang pasang, sebagaimana dialami ratusan masyarakat Gampong Ujung Mangki Kecamatan Bakongan dan warga Gampong Ujung Karang Kecamatan Sawang. Karenanya Azmir meminta Dinas PU Cipta Karya Provinsi Aceh tanggap dan peduli terhadap nasib para korban, mengingat pihak kabupaten tidak mampu menanganinya, selain memberi bantuan masa panik. “APBK kita yang sangat terbatas tidak mampu menangani ekses gelombang pasang yang melan-

da sepanjang pantai, dari Labuhanhaji Barat sampai ke Trumon,” kata anggota dewan dari Labuhanhaji Barat itu. Sementara Bupati Aceh Selatan melalui Asisten Ekonomi dan Pembangunan H. Tanius MN, SE, MM mengakui pihaknya telah melaporkan bencana itu ke provinsi sekaligus minta penanganan. “Kita harapkan selain membangun tanggul pengaman pantai dan memperbaiki bangunan rumah warga yang rusak, juga minta bantuan masa panik secara kemanusiaan,” katanya.(b19)

Satpol PP Dan WH Diminta Lebih Profesional SUBULUSSALAM (Waspada): Segenap anggota dan personil Satuan Polisi Pamong Praja dan Wilayatul Hisbah (Satpol PP dan WH) diminta mampu bekerja lebih maksimal dan profesional tanpa mengabaikan nilai-nilai agama dan budaya daerah. Hal lain, harus mematuhi rambu-rambu yang ada dan tidak ke luar dari tugas dan wewenang yang diemban. Demikian antara lain amanah Wakil Walikota Subulussalam H. Affan Alfian Bintang saat membuka Pelatihan dan Pendidikan (Diklat) Satpol PP dan WH Angkatan II, Jumat (21/5) di Mapolsek Simpang Kiri, Subulussalam. Affan pun memastikan kalau tugas dan kewenangan para personil Satpol PP danWH punya batasan-batasan yang harus dipatuhi dan tidak mengabaikan, apalagi melanggar norma-norma yang ada sehingga kehadirannya di masyarakat tidak justru menjadi persoalan. Pembukaan Diklat yang berlangsung selama 3 hari di Mapolsek Simpang Kiri yang diikuti 38 peserta itu, dihadiri Kabag Bina Mitra Polres Aceh Singkil, AKP Baik Tarigan, Pabung Polres, Pabung Kodim 0109, Muspika Simpang Kiri dan undangan lainnya. (b33)

Bupati Lepas Peserta PSG SMKN 2 BLANGKEJEREN (Waspada): SMK Negeri 2 Blangkejeren membidangi Bisnis Manajemen tahun ini melepas peserta Pendidikan System Ganda (PSG) 108 siswa disebar ke berbagai kantor baik negeri maupun swasta di wilayah Kab. Gayo Lues. PSG ini suatu keharusan bagi Sekolah Menengah Kejuruan (SMK), kata Kepala Sekolah Drs. Hasan Basri pada pelepasan PSG pada 6 Mei lalu, di lapangan SMK Negeri 2 Blangkejeren, Kab. Gayo Lues, Provinsi Aceh. Dalam acara ini, Kepala Dinas Pendidikan Pemuda dan Olahraga Kabupaten Gayo Lues, Drs. H. Syamsul Bahri mengatakan, pihaknya dapat memaklumi sesuatu jika kita punya ilmu.Tanpa ilmu kita tidak mengetahui tentang sesuatu. Oleh sebab itu, para siswa harus belajar keras agar dapat ilmu dan dengan ilmu itu akan terangkat harkat dan martabat kita sebagai manusia.(rel/m27)

C6 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca

Bursa Automotive

5 CM 6 CM

Rp. 65.000 Rp. 78.000

- Grand Escudo XL7 Hitam 03 Rp. 105Jt - KIA Carens II Hitam ‘05 Rp. 97Jt Hub. 0816 3113 953

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

SUZUKI BERHADIAH HP NOKIA (061) 77612356 Carry PU...DP 12,5 Jt Ang. 2.7x3 thn & 2.2 x 4 thn APV Arena..DP 16Jt Ang. 4.4x3 thn. & 3.7 x 4 thn. Splash...DP 27 Jt Ang. 4.5 x 3 thn. & 3,8 x 4 thn New SX4 DP 30 Jt ang. 6.2 x 3 Thn. & 5.2x4 thn.

DAIHATSU Rocky Independen BK, STNK Panjang, warna hijau metalik, Siap pakai. Harga Rp. 85 Jt/Nego. Hub. 0812 6497 032 Maaf TP.

SUZUKI APV Tipe X Hitam Th. 2006. Mulus. Hrg. : 98Jt. Nego. Hub. 0813 7550 1012

DAIHATSU Feroza ‘94, W. Hitam. Sangat mulus. Ban 31. Baru. H. 49Jt. Hub. 061-3031 3617

SUZUKI Karimun G X Thn 2000 W. Hijau Metalic, BK Mdn, Komplit, AC, Tape, PR, BR, CL, Remote, Mulus, Orisinal luar dalam B.U Hub HP. 0812.6085.8594, Mdn


Xenia Li..........................DP Mulai 12 Jt-an Terios TS Extra ................DP Mulai 13 Jt-an Gran Max Pick Up...........DP Mulai 5 Jt-an Hub. Josua Pane. 061-77004944 / 0812 6311 0820

TOYOTA Kijang Super Standard 93, BK Medan, warna merah, AC, RT, BR, VR. Kondisi siap pakai. Harga Nego. Hub. 0852 61311 904

PROMO DAIHATSU HADIAH & DISKON Xenia DP 11 Jt-an, Angs. 2,9 Jt Terios DP 13 Jt-an, Angs. 4 Jt-an Luxio DP 12 Jt-an, Angs. 3,9 Jt Gran Max. Pick Up & MB DP 5 Jt-an, Angs. 2,5Jt. Hub. Ger y 0813 76941988 / 77722561

AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. DP + Bunga Ringan. Hub. 0813 7512 7297 - (061) 7795 1428


: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


DAIHATSU BARU READY STOCK: Luxio, Terios Matic, GranMax, Minibus. Proses cepat & mudah. Hub. 0812 6504 2255 / 0617630 - 4788 (AGUSTINA) # ASTRA DAIHATSU BARU # * Xenia DP: 10 Jt Terios DP: 13Jt * Pick - Up DP: 5 Jt Luxio DP : 9 Jt Proses Cepat. Data dijemput + Hadiah Hub: Kalpin 0852 7041 9000

D A I H AT S U R o c k y T h n . 9 7 Independen Wrn. Hitam metalic. Hrg. 85Jt. Nego. Hub. 0852 6140 8206

DAIHATSU Taft Badak Pick Up 1983 Dijual. AC Dingin, Siap pakai. Hub. 0813 9734 3498 - 7700 1497

DAIHATSU Feroza Th. ‘94. Wrn. Hi Metalik. AC, BR, CL, PS, PW, VR, Tape. Hub. 0852 6189 4858. Bagi yang Serius. DAIHATSU Espass Pick Up Thn 2003 W. Hitam, Mobil original, Siap pakai Hub. 0819.886.560 DAIHATSU Xenia Li Thn 2006 Warna Hitam, 1 Nama, Pajak baru perpanjang Tipe Li, Paling lengkap (Sporty) masih orisinal mulus sehat Hub. 0812.6470.4359

HYUNDAI Verna Thn. 02/03. Coklat Met. BK Baru, Kain Ulos + Matahari Baru Rp. 68 Jt. Hub. 77863981 HYUNDAI Accent GLS 1997. Ungu metalik. Siap pakai. Hub. 0813 7644 6612 ISUZU New Panther Pick Up ‘04, PS, BK Mdn. Tgn-1, mulus, DP 15 Jt, Angs: 2,37Jt Isuzu Panther Hi-Sporty ‘97. Green Army, AC DB, PW, CL, RPM, DP 19Jt. Hub. 76700 976

ISUZU Panther Hi Grade Thn ‘96 W. Hijau Gelap Pajak Full 1 Thn, Mobil mulus, Siap pakai 0819.886.560 MAZDA Vantrend Thn. 95. Hijau met. PS, PW, AC, TP, VR, Asli Medan. Mulus, siap pakai. H. 25Jt/Nego Tempat. 0812 602 5621 TP


L300. Angs. 3Jt-an. Pajero Sport (Ready Stock). T120 SS, Cold Diesel 110 PS, 125 PS, Triton. Serius Hub. (061) 76728071 / 0812 653 3319 NISSAN SENTRA ‘93 Over Kredit, A/T. Abu2 metalik. Mulus, AC, PS, PW, VR (matik masalah), Balik DP 7 Jt (Nego). Sisa 22 x 1,1Jt. Hub. 061-7776 9000 DEALER RESMI SUZUKI MOBIL Carry PU 1.5 DP Hanya Rp. 5 Jt-an APV Arena DP Hanya Rp. 7 Jt-an

NB: Proses Mudah & Cepat Data Dijemput Hub. 0812 654 0809 / (061) 77722121


TOYOTA Kijang LGX 2,0 Silver ‘02/’03, BK Mdn, Mulus, AC DB, VR 15, BR Maxxis, PW, CL, DP 30Jt Angs. 3,89Jt. Hub. 76700976 TOYOTA Innova E Bensin Thn. 2006. AC, DVD + TV, VR 16, {S, PW, CL, EM. Jok kulit, Silver Plat BB. Rp. 140Jt. Hub. 0812 6594 2789 TOYOTA Kijang Capsul Model LGX New Bensin 1,8 Th.2003. Silver met, Mulus, orisinil, VR, BR, PS, PW, CL, E. Miror. RTP, AC Double, Hrg. 133Jt. Nego. Hub. 061-6967 9753

TOYOTA Kijang Commando Thn ‘90 AC, Tape, Vlag Racing, BK Sampai tahun depan, Hrg Rp. 45 Jt, W. Biru Langit Hub. 0813.7041.9990

TOYOTA Corolla GL Thn ‘84 Biru Metalic, AC, Tape, VR 14, Jok klt, Ban baru/ 21,5 Jt 0852.6125.5154




- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954 BUTUH DANA BUTUH DANA

7 CM 8 CM

Rp. 91.000 Rp. 104.000

9 CM Rp. 126.000 10 CM Rp. 140.000



1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633






SEWA FLOOR STANDING HUB: 3 Pk Jln. Sutomo No. 139 C. & 5 Pk


TEL. 061-7347810 - 7360741 TEL. 77982281 medan INSTALASI & PEMASANGAN SERVICE, REPARASI AC - KULKAS


AC 1 pk, 1,5 pk, 2 pk=1,3Jt s/d = 1,9Jt, AC Window 700rb, AC Air cooler=1,2Jt. Kulkas 1 pt=450rb s/d=900rb, 2 pt=650rb s/d=1,3Jt, K. Mini=500rbK. 2 pt Jumbo=2Jt, M. Cuci 2 tb=600rb, 1 tb=900rb s/d = 1,4Jt. V. Cliner = 900rb. Genset 9000 Wt=6,5Jt 7000Wt=4,5Jt, Alat Pemotong Kayu. Hub. SENANG HATI : 4517509 - 77073637 Jl. Sekip 67 A (Bisa T.T. Baru/Bekas)



DIJUAL SERVER PULSA (Perangkat Komplet) Sofware VRE dan FM NEGO, Berminat? Call: 0813 70444 544 (no SMS) Ingin Promosikan Produk Anda



Media yang Tepat untuk Iklan Anda





11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000




Hub. SUMATERA JAYA Jl. Gatot Subroto No. 401 dkt simp Barat Tel. 0812 6413 9993

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 Siap Ketempat


10 SET AMD ATLON X2 Hanya 27.000.000,-

(Ram 1gb, Casing USB, Hd 160gb, Key, Mou, Headset, 17” SAMSUNG) (Skat, Instalasi Jaringan, Games Online - Offline, Billing, Switch Hub) (BARU GARANSI FULL 1 THN)



ADHIKA COMP. M. Idris 23, 4150371 - 77426432



Tumpat Sedot



Jl. Gatot Subroto Medan Ada Garansi Jl. Brayan Medan

8442246 08126427 1725 Ada Garansi ADI 8442271 0813 7035 7291




Jl. Setia Budi




Tanpa jahitan, Tdk berdarah Lgsg pakai celana Ditangani dokter ahli sunat Hub. 0813.7002.4756 Sudah Terbukti !!


Bila Anda ingin perkasa jangan salah masuk. Disini tempatnya, carilah yang benar-benar asli. Perwira yang sempurnya ya disini tempatnya yang lebih joss. Bergaransi seuur hidup tanpa efek samping. Pastikan anda menjadi laki-laki yang luar biasa.. Kalau anda penasaran, ikut terapi ini berlaku untuk semua Agama, ras dll. Legenda pengobatan Mak erot sudah tidak diragukan lagi, ribuan, pasien bahkan sampai kemancanegara dari keluhan laki-laki seperti gangguan ereksi, peyakit kelamin secara medis susah disembuhkan Terapi Mak Erot ini mengutamakan ramuan. Doa-doa, pemijatan dan minyak poles. Tanpa bahan kimia dan tanpa perbedaan, tanpa efek samping. Jangan biarkan masalah anda berlarut-larut. Bagi wanita yang ingin punya keturunan, mau memperkencang dan memperbesar payudara, disinilah tempatnya Menangani Keluhan Pria & Wanita

KHUSUS WANITA KHUSUS PRIA - Ingin punya keturunan - Ejakulasi dini - Memperkencang dan memperbesar payudara - Impotensi - Mengembalikan keperawanan - Memperbesar, panjang - Mengobati keputihan - Keras, tahan lama HP. 0812.4038.333 Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 Jl. Laksana No. 55j Masuk dari Jl. Amaliun YUKI SImpang Raya Medan (Praktek Tetap









(Untuk reumatik & asam urat)


Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

Hub. 0812 6446 8869





WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 081361718158, 0813 6230 2458 NARO SERVICE Jl. Sisingamangaraja

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll


ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

Dpt Diperoleh di Sumatera - Aceh Hub: (061) 7365429 - 7362887



Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

Jaminkan BPKB Anda untuk Biaya Anak Sekolah. Dapatkan SUBSIDI SPP sampai dengan Rp. 1 Juta *. Hanya untuk Mei - Juni 2010. Hub. ADIRA FINANCE Komp. Graha Niaga Jl. Bambu II Simp. Glugur. Telp. 0813 7022 0404 / 061-76220211


Bersedia dipanggil



Umroh bayar Rp. 4.000.000,- Langsung berangkat, Sisanya cicil 12 - 24 Bln Segera Mendaftar ke: Jl. Dr. Mansyur No. 9B (sebelah Cikal USU), Medan Telp. (061) 8222800 (Hunting), (061) 77477888

Hub. Mbak Tari (061) 9167.1526

PT. SINAR MAS MULTIFINANCE. Jaminan Khusus BPKB Sepeda Motor Bunga 1,5 %, Discon, 1x cicilan Hub. 0813 6101 7444.

DANA EXPRESS SHM, SK Camat 1 Hari Clear 061-7685 4885, 0812 6095 5531 (Anwar)

IZIN DEPAG NO. D/416 TAHUN 2008 09H Umroh Ziarah 19/ 21 Jun 12H Umroh Plus Turky 25 Jun 12H Umroh Plus Cairo & Alexandria 29 Jun 16H Umroh Plus Al Aqsho 19 Jul 11H Umroh Ramadhan Awal 12 Agt 14H Umroh R. Lailatul Qadar 25 Agt 30H Umroh Ramadhan 12 Agt


10 SET INTEL PIV DUO CORE 1,8GHZ Hanya 27.000.000,-


GELORA INDAH Tour & Travel




Orang Bijak akan memilih penyelenggara Umroh yang Berizin






JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP: (061) 457.6116 - 7731.3385 HP. 0813.6137.2321 - 0812.6566.6807

SERVICE GAS Kompor + W. Heater GAS Hub. AHOK 77770544


Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput


Sahabat Anda Menuju Baitullah

CUCI AC Rp. 20.000 AC Baru 100% 1 Pk Rp. 2.190.000 Menerima Bongkar - Pasang, Isi Obat, Tukar Tambah






Senin, 24 Mei 2010

Pasang Iklan “WASPADA”

Mengatasi Penyakit & Problem antara lain: ˆ Kelainan sex, bysex (homo/ lesbi) ˆ Gangguan jiwa/ mental, kegelisahan, gila ˆ Kurang percaya diri, stres berat Buka setiap hari jam 08.00 s/d 21.00 WIB ˆ Dendam, marah, cemas, dll hari libur tetap buka

Penyakit yang dapat disembuhkan secara langsung ditempat seperti: Lumpuh/ struk (komplikasi) bisa kembali normal, gondok, liver, amandel, hernia, ginjal, rematik, tumor, impoten, diabetes, spilis, singa, dll


ˆKENALILAH HATI NURANI (fitroh dirimu) karena disitulah kunci kebahagiaan, ketentraman, kesuksesan yang hakiki, abadi dan pasti PRAKTEK: Jl. SM. Raja, samping UISU masuk Jl. Sempurna, 300m No. 49 Medan HP. 0812.682.77999

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

Telp: 061 - 4576602 Way of Life

Cash Back

8 Juta

Hadiah GPS + K. FILM V. KOOL D/P 6 Jutaan



Hubungi Dealer



JL. JEND. G. SUBROTO 18-20 Depan Air Mancur Petisah Tel. 4522619 - 4146757 MEDAN



Gelar terapi alat vital paling spektakuler langsung besar dan panjang di tempat no suntik/ silicon, terapi aman tanpa efek samping, asli tradisional, bebas pantangan, untuk semua usia, ras dan agama. Cukup satu kali pengobatan khasiatnya luar biasa dijamin...!!! Puas, paten dan permanen untuk selamanya Terapinya aman serta bebas pantangan, metode terapi dan teknik dasar pengurutan untuk membetulkan simpul syaraf kejantanannya disempurnakan dengan sarana supra natural/ do’a, yang sudah di pandukan melalui ramuan khusus untuk menambah keperkasaan dan juga ukuran yang diinginkan. Cukup satu kali pengobatan khasiatnya luar biasa. Dijamin joss!!! Dan keahliannya luar biasa... Langsung besar dan panjang ditempat, disesuaikan dengan ukuran yang di inginkan: panjang 15 cm diameter 3 cm, panjang 17 cm diameternya 4 cm, panjang 20 cm diameternya 5,5 cm. Sanggup melakukan hubungan secara berulang-ulang tanpa obat kuat/ doping, dijamin faten..!!!


(Bukan memberi janji tapi memberi bukti)

A. PENGOBATAN MEDIS DAN NON MEDIS B. TASBIH AL KHAROMAH, BATU MERAH DELIMA, Al-Qur’an Stambul, susuk kantil, susuk rembulan, susuk nur insan, pasang susuk, pagar goib, masalah asmara, putar giling, keris semar mesem, kapsul kecantikan kekebalan, pesugihan halal, terawangan, gendam, istri cantik, khodam pendamping, suami kaya, rogosukmo, pelarisan usaha, kepangkatan, pegangan bisnis, ajimat anti tuyul, ajimat politik, ajimat atlet, pelet, putar giling, panglimunan, keartisan, sedulur papat dll problem Alamat: Perumahan Griya Mora Indah Blok C/ 105 Tanjung Morawa (masuk dari Gg. Lokasi dekat Klenteng China) Telp (061) 6962.7396 BERGARANSI 0813.6116.4240 SAMPAI 0813.9779.6600 (No SMS) BERHASIL Buka: Jam 13.00-21.00 WIB RIBUAN ORANG TELAH TERBUKTI

* PONDOK NUR AGUNG * Akte Notaris No. 07/NA/2009

Anda telah minta bantuan& belajar kemanamana tetapi blm berhasil dan merasa puas !!! I. PENGOBATAN MEDIS & NON MEDIS II. Pelarisan usaha, psg susuk, gendam, pesugihan, jin, pendamping, kekebalan, dll III.PROGRAM SERTIFIKASI PENGHUSADA: Kami akan membukakan kekuatan bathin & hijab mata bathin anda secara seketika, sehingga anda memiliki kemampuan supranatural yang sangat mengagumkan dapat menembus dimensi astral, khodam dan malaikat, meminjam kesaktian, memiliki kesehatan tubuh & kelancaran usaha, dapat melakukan pengobatan medis & non medis, dsb (berijazah Sertifikat) IV. PROGRAM MASTER PENGHUSADA: Gemblengan khusus bagi anda yg ingin terjun kemasyarakat menjadi seorang supranatural yg handal dan mempunyai sertifikasi supranatural tingkat nasional, anda dijamin menguasai berbagai Ilmu Supranatural dan dapat menurunkan keilmuannya kepada orang lain secara profesional (berijazah Sertifikat) Hub. PAK RANDI (TOKOH SPRITUALIS YG BERPENGALAMAN) Serta SPRITUALIS INDONESIA AWARD 2008 Alamat: Perumahan Cendana Asri Blok AC/ 06 Tj. Morawa Telp. (061) 7778.9233 - 0813.6118.8416 0813.8811.0705 (No SMS)

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap Sabtu Malam Pkl. 22.30 Wib (Live)

Call Center: 0818 090 73481 Menyembuhkan impotent, lemah syahwat, kencing manis, raja singa, loyo, ejakulasi dini, cepat keluar, siplis, lemah syahwat, dll, dijamin normal kembali !!! batas usia 80 thn. Terapi alat vital Bapak Haryono sudah puluhan tahun menangani keluhan pria, terapinya nyata, hasilnya luar biasa, tidak disuntik/ silicon aman tanpa efek samping, beliau pakar kenjantanan asli asal Banten. Yang paling pertama menemukan cara terapi tradisional dan hasil ditempat. Ilmunya sudah dipatenkan. Menangani bekas suntik, silicon, ingin cepat dapat keturunan, sperma encer adn menangani yang gagal dari tempat lain. ditangni secara tuntas untuk penanganan serahkan pada ahlinya bergaransi dan sudah teruji dan terbukti Khusus Umum, menangani masalah seperti menaklukkan hati melalui senyuman dan kerlingan, membuat orang yg diinginkan simpatik dan jatuh hati, membuka aura pesona kecantikan/ ketampanan anda, juga masalah rumah tangga lainnya, cepat dapat jodoh PIL/ WIL, mengembalikan keharmonisan suami istri Alamat Praktek tetap: Jl. SM. Raja/ Yuki Simp. Raya masuk Jl. Amaliun Gg. Kesatuan No. 4 HP. 0813.7660.6663 NB. MOBIL BISA MASUK/ GARASI PAKEM. B-346/DSP.5/11/2008


Atasi gangguan, Psikosomatis, Lelah, letih, lesu, hilang asa (sakit fisik lain), bukan krn virus, bakteri & kuman Hub. 0852.7550.5381




Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke


Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I

Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai

SPECIALIST MATA TANPA OPERASI Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll

Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web: ffaridar aridar aridara

Ekonomi & Bisnis

WASPADA Senin, 24 Mei 2010

Simpanan Masyarakat Di Bank Turun Rp1,46 Triliun Sebulan JAKARTA (Waspada): Dana simpanan nasabah di bank umum berkurang Rp 1,46 triliun pada bulan April 2010. Jika per 30 Maret 2010 simpanan nasabah mencapai Rp2.000,62 triliun, maka April 2010 angkanya turun 0,07 persen menjadi Rp 1.999,16 triliun.

Penurunan total simpanan ini terjadi karena penurunan pada giro sebesar Rp7,93 triliun dan simpanan lainnya sebesar Rp1,90 triliun atau total penurunannya sebesar Rp9,83 triliun. Meskipun terjadi kenaikan pada tabungan sebesar Rp4,65 triliun dan deposito sebesar Rp3,72 triliun atau total kenaikannya sebesar Rp8,37 Triliun. Menurut data Lembaga Penjamin Simpanan (LPS) dikutip detikFinance, Minggu (23/ 05), dari total dana simpanan

di bank umum hingga April 2010 jumlah simpanan dijamin oleh LPS mengalami penurunan sebesar Rp3,1 Triliun, yaitu dari Rp1.246,3 triliun pada bulan Maret 2010 menjadi Rp1.243,2 triliun pada bulan April 2010. Jumlah simpanan dijamin oleh LPS tersebut meliputi 62,19 persen dari total simpanan pada seluruh bank umum. Simpanan dijamin tersebut terdiri dari seluruh simpanan nasabah untuk segmen Rp 0 s.d Rp 2 miliar dan seluruh bagian

dijamin (Rp2 miliar) dari simpanan nasabah untuk segmen diatas Rp 2 miliar. Sedangkan jumlah rekening seluruh simpanannya dijamin oleh LPS (Rp 0-Rp 2 miliar) mengalami kenaikan sebesar 731.134 rekening, yaitu dari 90.015.293 rekening pada Maret 2010 menjadi 90.746.427 rekening pada bulan April 2010. Jumlah rekening tersebut meliputi 99,90 persen dari total rekening pada seluruh bank umum.(dtc)

DPR: UU JPSK Dan UU OJK Harus Dibahas Bersamaan JAKARTA (Waspada): Dewan Perwakilan Rakyat (DPR) mendesak pembahasan mengenai Undang-Undang Jaring Pengaman Sistem Keuangan (UU JPSK) dan UndangUndang Otoritas Jasa Keuangan (UU OJK) dilakukan secara bersamaan. DPR menilai kedua UU tersebut sama pentingnya untuk segera disahkan. “Undang-undang tersebut kan masuk ke DPR atas inisiatif pemerintah, nah sampai sekarang belum ada masuk. Pemerintah seharusnya mengajukan RUU JPSK dan RUU OJK secara bersamaan kepada DPR untuk

segera dibahas,” ujar Anggota Komisi XI DPR RI Arif Budimanta ketika berbincang dengan detikFinance di Jakarta, Minggu (23/05). Arif menuturkan, kedua UU tersebut fungsinya memang sangat penting serta terkait satu sama lain. Jika JPSK sebagai payung hukum serta antisipasi terhadap krisis sewaktu-waktu dapat terjadi. Arif juga mengatakan OJK juga sangat penting agar nantinya ada sebuah lembaga pengawas seluruh jasa keuangan. “Agar tidak lagi ada perdebatan seperti Kasus Bank Cen-




tury atau seperti krisis 2008 kemarin, maka kedua UU harus segera dibahas. Jadi intinya secara simultan dilakukannya berbarengan satu sama lain,” tegasnya. Karena, lanjut Arif, Kasus Bank Century terjadi akibat lemahnya pengawasan Bank Indonesia (BI) akibatnya harus dilakukan bailout (penyelamatan) sebesar Rp 6,7 triliun. “Maka dari itu, OJK nantinya mencabut fungsi pengawasan yang ada di BI sedangkan JPSK merupakan protokol krisis sewaktu-waktu dapat terjadi di Indonesia. Jadi ada langkahlangkah apa saja yang tertuang

dalam undang-undang jika nantinya krisis melanda,” paparnya. Selain itu, Arif menegaskan jika krisis terjadi di Eropa dapat sewaktu-waktu berdampak kepada Indonesia. “S e k a r a n g k i t a t i d a k memiliki protokol, bisa-bisa nanti tidak ada yang berani mengambil kebijakan jika tidak ada UU-nya,” tambahnya. Ia juga mengatakan, pembahasan UU JPSK maupun UU OJK menjadi pekerjaan rumah atau “PR” yang harus diselesaikan bagi Menteri Keuangan terpilih pengganti Sri Mulyani yaitu Agus Martowardoyo.(dtc)


Sharing And Cooking Tupperware Asik Bersama Yati Pesek MEDAN (Waspada): Ratusan ibu rumah tangga di Medan asyik bersama artis komedi Yati Pesek dalam talk show acara sharing and cooking Tupperware dipandu Shanaz Haque berlangsung di Atrium Plaza Medan Fair, Minggu (23/5). Dalam road show sharing and cooking di kota besar se Indonesia diantaranya Medan, Bandung, Pekanbaru, Surabaya, Balikpapan, Yogyakarta, Lamp u n g , Ja k a r t a t e r s e b u t Tupperware berbagi inspirasi dengan ratusan ibu rumah tangga di Medan. Talk show berlangsung kocak bersama seniman ketoprak Yati Pesek yang sering tampil dalam berbagai acara komedi di televisi tersebut juga disiarkan secara live oleh radio dalam acara yang dikemas dalam Tupperware she can on radio. Menurut Jesica Carla dari PT Fortune Indonesia Tbk atas nama Tupperware Indonesia acara tersebut dalam rangka berbagi inspirasi bersama wanita Medan yang disiarkan radio dalam talk show Tupperware she can on radio. Disamping talkshow acara juga dirangkai dengan demo masak cooking with lifestyle serta lomba menghias makanan serba ikan yang diikuti para ibu rumah tangga yang datang ditemani keluarga dan teman-


Artis Shanaz Haque pemandu acara bersama Yati Pesek berbagi inspirasi dengan wanita Medan di Atrium Plaza Medan Fair. temannya, ujarnya. Talk showYati Pesek sebagai wanita inspiratif she can on radio dipandu Shanaz Haque berlangsung sejak pukul 11 hingga 12, sementara itu cooking with life style yang dipandu koki masak Rudy Choiruddin diramaikan bintang tamu Ulfa Dwiyanti, sebutnya. Dengan kantor di Amerika Serikat, produk untuk memenuhi kebutuhan ibu dalam

melayani keluarga tersebut telah hadir di 120 negara dengan jumlah sales force 1,9 juta dengan jumlah penjualan 1,8 miliar dolar AS. Selama hampir 15 tahun, Tupperware telah membantu banyak wanita dari semua kalangan di negeri ini untuk memperkaya kehidupannya dan menghargai usaha mereka dengan potensi yang tidak terbatas untuk tumbuh sebagai

wanita mandiri. Sementara itu dalam demo masakyang dipandu koki ternama Rudy Choiruddin dan Ulfa Dwiyanti tersebut kian memeriahkan suasana dan bertambah hangat, tidak hanya para ibu yang menjadi peserta seirus mengikuti, acara tersebut juga menjadi perhatian ribuan pengunjung Plaza Medan Fair. (m40)


Pedoman tata cara membaca Al Qur’an dengan baik dan benar Untuk anak-anak dan dewasa.





Menerima Mahasiswa/i Baru T.A. 2010/ 2011



Terakreditasi BAN PT. dan DEPKES Izin No. 191/D/0/2002 Jl. Gaperta Ujung No. 58 Telp. 0811.649.533 - 0811.600.285 0812.6335.972 - (061) 846.9815 NB. Disediakan Akomodasi dan Penginapan bagi Mahasiswa dari luar kota


AKBID KHOLISATURRAHMI - BINJAI Terakreditasi BAN PT dan DEPKES Izin No. 50/D/0/2002 Jl. Samanhudi Pasar III Binjai Telp. (061) 882.3834 0813.6176.4117 0811.649.533 - 0811.600.285 NB: Disediakan Akomodasi dan Penginapan Bagi Mahasiswa dari luar kota



IZIN NO. 85/D/O/2006 Jl. Letda Sujono No. 241 Medan Telp. (061) 735.1236 (061) 7750.9333 0811.649.533 - 0811.600.285

NB: Disediakan Akomodasi dan Penginapan Bagi Mahasiswa dari luar kota






JL.DR.TD.PARDEDE/JL.MATARAM NO. 21 MEDAN (SAMPING PARDEDE HALL) TELP : 061 – 4152844 HP : 081263990442 – 081361781005

2. KLINIK SPESIALIS RSU HERNA MEDAN JL.MOJOPAHIT NO.118.A MEDAN TELP : 061 – 4510766 HP : 081263990442 – 081361781005 TANGGAL TESTING : GEL I : 07 JULI 2010 GEL II : 03 AGUSTUS 2010




1. Kesehatan Masyarakat (SKM) Angkatan XI 2. Keperawatan (SKp) Angkatan X

B. Diploma-III (D-III) 1. 2. 3. 4.

Akademi Keperawatan (AKPER) Angkatan XIX Akademi Kebidanan (AKBID) Angkatan XV Akademi Analis Kesehatan (AAK) Angkatan XIX Akademi Analisa Farmasi & Makanan Angkatan XVII (AKAFARMA)

C. Menerima Lulusan:

1. D-III Kesehatan 2. SMU/ SMA/ SPK/ MAN/ SMK Semua jurusan

D. Ujian masuk: 7 Juli 2010 Informasi selanjutnya & pendaftaran

KAMPUS PENDIDIKAN SARI MUTIARA Jalan Kapten Muslim No. 79 Medan Telp. (061) 8476769 – 8452687 HP. 081362092650

Pendaftaran dimulai dari sekarang s/d Agustus 2010

Informasi/ pendaftaran:

1. Kampus A Jl. H. Adam Malik No. 140-142 Telp. (061) 661.4941 2. Kampus B Jl. H. Sutan Oloan No. 1 Pondok Surya Telp. 846.4282 08.00-15.30 Wib Setiap hari kerja CP: 0812.6445.0973 - 0852.9725.2579 0813.6220.5812


24 - 30 MEI


LT. 8x24m, KT 3, KM 2, Ruang Tamu panjang, Jl. Karya Sehati Gg. Sehati 4 Medan Johor Hub. 0812.6542.2876




Kuliah SENIN s/d SABTU

Informasi Pembaca Bursa Property





LOWONGAN KERJA LOWONGAN KERJA Wanita (Gadis/ Janda) Menjadi - Prwt anak (gaji 600 Rb - 1 Jt) - Prwt org tua (Gaji 650 - 1,2 Jt) Bersih/ ditambah uang kerajinan/ bln Hub. “Cahaya” (061) 453.1124/ 0852.7552.3457 Jl. Ayahanda 73C Medan


Membutuhkan TK. Jahit Hub. (061) 847.5648 0811.659.235 !! BUTUH CEPAT !!! Butuh P/W untuk ditempatkan dikantor. Syarat: Bawa surat lamaran. Penghasilan : Min : 2 jutaan / bulan. INFO : IBU NAIRA (081260347392 / 081375038423). Alamat kantor : Jln Gatot Subroto No. 29 – 30 Plataran Komplek Carefour Parkir belakang – Medan Fair. Terbuka bagi Mahasiswa/I – Ada shiff


Diutamakan yang belum Berkeluarga JAMINAN 40 RIBU Hubungi ANUGRAH PANGKAS Jln Setia Budi Simpang Sei Serayu No. 91 HP : 08137644423

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik


: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual, LT. 15x42: ±634m², SHM di Jl. Garu III No. 54 Medan, Rp. 850 Jt/nego Hub. Ibu Evi HP. 0811.653.404, TP


Jl. Ngastino No. 13 Samping Purwo dan Surat SHM dan IMB, Bertingkat dijual atau tukar tambah Ruko, Harga Rp. 350 Jt Peminat hub Putra 0813.7650.7393 Atau 414.8989


Jl. Gambir Pasar 8 No. 89 Tembung, LT. 12x50, LB. 11x21, KT 5, KM 4, Full keramik Hubungi HP. 0878.6804.4075 DI JUAL RUMAH BARU KONDISI 80 % B.U

UB. 6 x 15. UT. L. 12 P. 12 Lokasi Psr 1 Tj. Sari Ring Road Gg. Dahlia / Nusa Indah Depan Perum. Asoka - Harga 300 Jt

Hub : 081396466152


& lsg dislrkan mjd Guru PG/TK Hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 7623.5314 - 9158.3487 - 4533.875 - 456.9269 Jl. Karya Wisata No. 23A Johor Tp. 786.1690 Medan

Jl. STM Gg. Rahmat No. 5 (depan Mesjid Salman) Uk. 22x19m² 4 Kamar dan 2 Kamar mandi Sertifikat Hak Milik Hub. 0813.9658.4007 0812.7620.021 Tanpa perantara



DICARI SGR Lls SLTA/ sdrj Unt diddk

Di T. Tinggi, membutuhkan: - Mekanik Listrik 3 phase, Mengerti elektromotor - Mekanik las yang biasa kerja di Pabrik, pengalaman min. 5 tahun di bidangnya Disediakan tempat tinggal Hub HP. 0813.7003.7456


Kami Perusahaan Angkatan Darat, membutuhkan tenaga kerja untuk ditempatkan sebagai : 1. MANDOR LAPANGAN 2. SUPERVISOR 3. OPERATOR TELEPON Dengan syarat : 1. Laki - laki usia min 25 tahun ( 1 , 2 ) 2. Wanita usia min 23 tahun ( 3 ) 3. Berpengalaman kerja min 1 tahun ( 3 ) 4. Berpengalaman kerja min 2 tahun ( 1, 2 ) 5. Pendidikan Min SMU / Sederajat ( 1,2,3 ) 6. Teliti, loyal, jujur dan bertanggung jawab ( 1,2,3 ) 7. Dapat bekerja lembur ( 1 , 2 ) 8. Mampu bekerjasama dengan team (1,2,3) 9. Berdomisili disekitar Pulo Brayan s/d Belawan ( 1,2,3 ) 10. Mempunyai kenderaan sendiri ( 1 ,2 ) Surat Lamaran Kerja ditujukan ke: Jl. Mesjid No. 139 , Selambat-lambatnya 2 minggu setelah iklan ini terbit.

Jl. Samanhudi Binjai Pasar V Pinggir Jalan Besar, SIAP HUNI Dengan Harga Rp. 55 Jt, DP Rp. 6 Jt Cicilan Rp. 286.000/bulan KPR BTN Belum termasuk biaya pengurusan SHM Hub. (061) 7744.5855 0812.6075.455 (061) 7665.9000 0812.6432.9000 0813.6199.3443 0813.6239.2579 0812.6579.9000

DP 12 Jt, Angs: 900 Rb-an, Kolam renang, Angkot ±2 Km RS, Pasar tradisional, 3 Km tol Bandar Selamat Hub. 0813.6240.7444 (Lia), Dptkan Disc. Khusus RUMAH Dijual Type 100 dgn luas Tanah ±550m² Jl. Roso - Mariendal I (Psr. V), Dalam Complex (Ex. Kantor pemasaran), Ada gudang kecil, Cocok buat kantor, Sertifikat Hak Milik Hub. 0812.6585.0320 (TP)


Jl. Sei Besitang/ 18 M. Baru, Ruko Jl. Abdullah Lbs (Belakang SIS), H. Nego, KPR Call: (061) 7728.7459 - 0819.827.459


Di Jl. Restu Gg. Bersama No. 4, Uk. 8,5x24, 3 KT, 2 KM, RT, RK, Bbs banjir, Harga nego Hub. 081396479480


Jl. STM/ Suka Jaya No. 8, Sertifikat Hak Milik, Luas Tanah 975m Hub. 0812.605.1602 DIJUAL RUMAH CEPAT HARGA NEGO

Jl. Bunga Asoka/ Jl. Bunga Balddu I No. 10 Blok XIII (lurusan Puskesmas) Asam Kumbang Medan LT. 10x15: 150m, LB. 7,5x12: 90m Fas. PAM, PLN, dan Telp, Status tanah Sertifikat SHM Hub Telp. 8216362 – HP. 0813 6155 6695


KELUARGA, PRIA/ WANITA, MUSLIM, GEDUNG BARU: Fasilitas OK (Air, Listrik), Aman, bersih Alamat: Jl. Kapt. Muslim Gg. Jawa No. 50 B Sei Sikambing C II Medan Telp. (061) 845.8935 HP. 0812.6588.5188




(W/P) Wanita penampilan menarik, KTP, Pria, SIM A, KK, Foto color, Sp. Motor, KTP, Data kirim ke: Jl. Rantang 20s Telp. 7718.8317




TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - 1 Set Sofa Kain/ Kulit Rp. 1 Jt-an Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188




Sebuah Group Usaha yang sudah Go Public. Yang siap membina Anda Tuk Bisa menjadi Wira Usaha. Hanya dengan modal Usaha 600 Ribu. Dapatkan Info Lengkapnya: Senin - Jumat - Sesi I Pkl. 10.00 WIB - Sesi II Pkl 14.00 WIB Gedung RELIANCE, Lt. Dasar Jl. T. Amir Hamzah 9 E Hub. BISNIS CONSULTAN TONNY, SE. (DNTY)

Spring Bed 6 kaki 2 lapis Rp. 1.100.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun Hub Telp. (061) 661.6802 - 661.8116 - 7653 2188

Harga Ter Murah

Anda Butuh Perabot Jepara Asli?


Model Terbaru


PELUANG BISNIS 1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro Rp. 22 Jt s/d 38Jt 2. Air Pegunungan 6700 s/d 7000 Liter Rp. 230.000 / Tangki Menyediakan Mesin RO dan Yamaha Hubungi:

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243




Menujual/ Menerima Tempahan & Reperasi Ukuran Jepara, Kursi, Lemari, Alat-alat pengantin Jl. Denai no. 205 HP. 0852.9708.6572 Cabang Tj. Morawa - L. Pakam Km. 18,5 No. 40 Telp. (061) 9123.5306 Medan


PECI MAHKOTA MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Depan Gg. Sadu Medan

Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 6532 9000 - 0812 600 5410


LT. 14,5x70m, LB. 8,5x16m, 2 Pintu 1 Lantai, SHM Jl. Proklamasi depan SMA Negeri, 100m dr Rmh Dinas Bupati Langkat, Lokasi strategis untuk segala usaha (muka belakang jalan) Hub. 0852.7503.6101 (Khusus Muslim, Hrg 1M nego)



PELUANG USAHA Dicari Agen/ Reseller Welcome:


Tasbi I Blok ii/ 7, Fas. 3 KT/ 2 KM, AC, Full furniture Hub. 0812.6501.4878 7763.8670

- Jual Alarm Kereta @75 Rb, Qty. 30 = @45 Rb Lengkap dgn cara pemasangannya, cocok untuk semua type sepeda motor, berfungsi jika kunci dirusak/ bobol, baik pakai kunci T, duplikat ataupun kunci asli maka suara klakson akan berbunyi dan mesin tidak dapat hidup Bergaransi 1 tahun - Alarm pintu antimaling @30 Rb, Qty 100 = @ 19 Rb, Incl. battery, Pemasangan sangat mudah, tidak perlu instalasi, cara kerja jika pintu dirusak atau dibuka akan berbunyi sangat keras, ada saklar on/ of aktifkan dan matikan alarm - Korek mancis antik bentuk sepatu, dadu, granat, peluru, pisau, battery, monyet, pepsi, dll, Hrg mulai @30 - 50 Rb, Reseller hrg nego





Jln. Suka Sabar / Kolam Sertifikat Hak Milik (SHM) Ukuran 6 x 14 m, Harga 35 Jt + Surat Hub : 08126434985





Hubungi Melawati Jl. Pahlawan No. 7 Tg. Morawa Medan (Sumut) Telp. (061) 7947.7364, 0812.654.8425 0813.6229.7935, 0819.601.5795 DICARI YANG MAU MEMBUKA COUNTER, MENCARI MEMBER / ANGGOTA SELURUH INDONESIA.





AYO SEGERA GABUNG ! Raih Bonus uang, perjalanan wisata, mobil, rumah. Produk lengkap, baju, tas, sepatu, accesories, cocok ware, kopi,dll

Uk. 423,60m² (17,65x24mtr), Tinggi, Tanah keras, Siap bangun, Harga nego, Lokasi di Jl. Bunga Wijaya Kusuma IV (Pasar IV) belakang Villa Pesona 3, Tanjung Sari Medan Hub. 0816.306.451 - (0761) 482.6922 / 0815.3370.2435, TP

A.5 x 15 Rp 8 Jt. 9 x 15 Rp 15 Jt, ML B. 6 x 16 Rp 10 Jt. 7 x 16 Rp 12 Jt, KS C.6 x 15 Rp 55 Jt. 8 x 25 Rp 45 Jt, JR di pinggir jalan Hub : 4570929, Mdn. Mitra 2,5 %

Hubungi: ZidaneComputer Telp (061) 7621.2092/ 0813.6194.5061


Tel: 4525462 - Fax. 4151359


Pasang Iklan

“WASPADA” Telp: 061 - 4576602

Ekonomi & Bisnis


Pengamat & Praktisi Manajemen

Inspirasi Bisnis

Cahyo Pramono

Spiritual Bisnis UANG itu penting tetapi bukan segalanya. Dengan uang kita bisa membeli jam tetapi bukan waktu. Dengan uang kita bisa membeli buku bukan pengetahuan. Dengan uang kita bisa membeli darah, dokter dan obat tetapi bukan membeli nyawa. Dengan uang kita bisa membeli posisi tetapi bukan kehormatan. Dengan uang kita bisa mebeli rumah tetapi bukan kehidupan. Dengan uang kita bisa membeli tempat tidur tetapi bukan tidurnya itu sendiri. Dengan uang kita bisa membali sex tetapi bukan cinta. Benar bahwa kemiskinan adalah kejahatan yang sebenarbenarnya. Benar bahwa kemiskinan adalah pintu terdekat dengan dosa. Benar bahwa kemiskinan dekat dengan penderitaan keduniaan. Jadi, sangat benar jika orang berusaha untuk menyelamatkan dirinya dari kemiskinan dengan jalan bisnis. Benar bahwa mendapatkan kekayaan adalah cita-cita yang terpuji dan perlu dukungan. Tetapi sangat benar bahwa uang tidak tidak selamanya membawa pemiliknya memasuki dunia kebahagiaan sejati. Pembaca yang budiman, beberapa waktu terakhir ini saya bertemu dengan banyak pengusaha sukses yang gundah-gulana, mendapati hidupnya yang penuh rutinitas dan melelahkan tanpa isi/makna. Di kala lain, saya sering mengatakan bahwa bisnis adalah salah satu pintu terdekat untuk menggapai ridho Tuhan. Bagi anda yang baru memulai bisnis, anggaplah ini ide-ide dari pengalaman beberapa pendahulu yang saya pikir cukup berharga untuk dipertimbangkan menjadi referensi. Saya meyakini bahwa akhir perjalanan kita adalah sebuah kebahagiaan sejati. Akhir perjalanan kita adalah bersama sang Khalik yang suatu saat akan kita sapa dengan kata “kekasih”. Jadi sangat positif jika ujung jalan itu kita capai dengan proses yang benar dalam arah yang lurus. Demikian selayaknya kita memanfaatkan jalur bisnis untuk menjadi kendaraan mencapai tujuan itu. Saya mendapati 3 tahap hubungan yang paling utama dalam mencapai spiritualitas bisnis. Yaitu kemampuan mengelola hubungan internal, interpersonal dan spiritual. Mari kita bahas satu-persatu. Hubungan Internal Ini menyangkut diri sendiri. Apapun yang terjadi diluar diri, tidaklah menjadi lebih begitu strategis dibandingkan dengan harmonisasi diri. Kualitas diri adalah pondasi pertama dari konstruksi ini. Pembaca yang budiman, setelah saya amati, mengatur dan mengelola orang lain sangatlah gampang jika kita sanggup mengatur dan mengelola diri sendiri. Dan yakinlah semua kebahagiaan dan sukses ada bersemayam dalam diri kita. Tak usah dicari kemana-mana, tidak di gunung tinggi, tidak dilembah, tidak di air terjun yang tinggi, tidak juga di dasar lautan luas. Untuk sukses lahir dan batin dalam berbisnis, saya mencatat 3 hal penting yang harus dikembangkan dalam hubungan internal ini, jauh hari sejak memulai bisnis apapun.Yang pertama adalah SABAR. Sukses dan kaya hanya dimiliki oleh orang-orang sabar. Yang sanggup menjaga diri untuk tidak berlebihan, untuk bersaja, untuk kuat menunggu momen dan tangguh menjalani semua proses pembelajaran dengan segala potensi-potensi kegagalan. Hampir tidak ada pengusaha yang begitu mulai bisni langsung sukses dan selalu berjalan mulus. Semua dijalani dengan

proses yang benar-benar menuntut kesabaran. Sabar yang unggul biasanya terjadi karena adanya kesadaran bahha Tuhan akan membantu orang-orang yang berjuang dengan sungguhsungguh. Yang kedua adalah BERSYUKUR. Membatasi diri untuk tidak berlebihan akan menjadikan rasa cukup. Rasa cukup yang benar akan mengundang rasa puas. Rasa puas yang benar akan mengajarkan rasa bahagia dan terimakasih. Yang pasti, janji Tuhan sangat jelas bahwa Ia akan menambahkan berkah bagi orang-orang yang tahu bersyukur. Mati-matian mencari uang tanpa mempertimbangkan keseimbangan justru mengarahkan pelakunya menjadi budak. Bukan tuan yang bisa mengatur uang, tetapi orang yang diperbudak uang. Yang ketiga adalah KESEDERHANAAN. Semua orang-orang pintar dari abad pertama adanya kehidupan di bumi ini selalu menciptakan yang komplikasi dan sulit menjadi sederhana dan mudah. Kesederhanaan menempatkan patron-patron yang pas dan tidak berlebihan. Hidup bersahaja akan mengantarkan diri kepada kejayaan. Ingat sekadar gengsi, tiada akan membawa kebaikan. Gensi tidak akan mengantarkan anak-anak kita sekolah ke jenjang yang tinggi. Gensi tidak akan menjadikan kita kenyang. Hubungan Interpersonal Ada tiga pilar utama untuk sukses berhubungan dengan orang lain yang akan berbuah keindahan dan harmoni, yaitu; kasih sayang, memberi dan memaafkan. Benar bahwa uang tiada kenal kawan atau saudara, kita harus benar-benar serius menanganinya. Tetapi rejeki jelas urusan Tuhan. Dan rejeki itu datang melalui orang-orang yang ada disekitar kita. Berhubungan dengan orang lain, pantasnya dilandasi oleh kesadaran penuh kasih sayang. Singkirkan rasa iri dengki dan curiga yang menyesatkan. Bahkan jika kita dirampok atau tertipu sekalipun, hilangkan rasa khawatir itu. Karena Tuhan pasti sedang berbicara dengan bahasanya dan pasti Dia akan menolong kita selanjutnya. Kasih sayang intinya hanya memberi dan memaafkan. Mulailah dengan memberi, karena dengan memberi, kita akan berpotensi menerima. Mulailah dengan melayani, karena sesudahnya kita akan dilayani. Orang-orang jahat yang mengganggu bisnis kita bukanlah datang begitu saja. Mereka telah diatur oleh Tuhan untuk memperkuat kita. Ada rahasi yang kadang kita tidak paham, bahwa Tuhan menghendaki kita untuk naik kelas ketingkatan spiritual yang lebih tinggi. Hubungan Spiritual Nah, semua tahapan diatas adalah sebuah rangkaian pondasi dan tubuh sebuah bangunan diri untuk mencapai tingkat ketuhanan. Dalam tahapan ini saya meyakini hanya ada satu kata kunci, yaitu MENYERAH. Menyerah bukanlah kalah. Menyerah adalah laku sengaja dengan kesadaran tinggi untuk percaya.Ya, percaya bahwa Tuhan tidak pernah tidur dan tidak pernah ingkar janji, sejauh kita masih berpegangan dan tetap digandengNya. Mungkin perjalanan hidup kita akan melewati jurang terjal, badai yang menghancurkan, atau kering yang menyengsarakan, tetaplah percaya dan serahkan saja tangan kita untuk tetap dalam gandenganNya. Pasti kebahagiaan sejati akan mejadi milik kita. Konsultasi & Pelatihan;

Sulaman Bordir Medan Jangan Tiru Motif Daerah Lain MEDAN (Waspada): Untuk memperkuat ekonomi keluarga serta meningkatkan potensi daerah dalam memaksimal peluang pasar cukup potensial di Medan, motif dan gaya sulaman bordir dihasilkan jangan meniru daerah lain. Hal tersebut dikatakan Kepala Dinas Perdagangan dan Industri (Disperindag) Medan Drs HT Basyrul Kamali MM, Sabtu (22/5), dalam tinjauannya kepada 35 ibu rumah tangga mendapat pelatihan sulaman bordir di Kelurahan Helvetia Timur. Menurutnya, Medan sebagai salah satu pangsa pasar terbesar untuk produk sulaman bordir harus menjadi tuan di daerahnya sendiri, sehingga imej masyarakat yang menganggap kualitas daerah luar bisa bergeser ke hasil karya pelaku usaha lokal. “Untuk itu perajin sulaman


Kadisperindag Medan Drs HT Basyrul Kamali MM menyerahkan bantuan lima unit mesin jahit pada peserta pelatihan secara simbolis. bordir di Medan diimbau tidak lagi meniru motif dan gaya sulaman daerah lain seperti Bukittinggi, Palembang, Jambi dan daerah lainnya agar produk lokal memiliki kualitas dan gaya tersendiri yang dilirik oleh

pasar,” ujarnya. Produk lokal saat ini telah menciptakan desain dan gaya sendiri diantaranya perajin batik di kecamatan Medan Tembung, para perajin tersebut telah membuat berbagai corak dan

Pelindo I Bangun Fasilitas Pelabuhan Belawan Rp11 Miliar MEDAN (Waspada): Pelabuhan Belawan merupakan pintu gerbang pengekspor terbesar komoditi non migas kini semakin dibenahi dengan melakukan pembangunan sejumlah fasilitas bernilai Rp11 miliar. Pembangunan pelabuhan terbesar di luar Pulau Jawa ini dilaksanakan PT Pelabuhan Indonesia I (Pelindo) sebagai BUMN pengelola pelabuhan umum di 4 Provinsi di Sumater, jelas General Manager Pelabuhan Belawan Ir Syahputra Sembiring MSM, melalui Humas Swandi Hutasoit, Jumat (21/5). Program ini dirancang seiring dengan meningkatnya arus bongkar muat barang di daerah ini, sehingga Pelindo I berupaya meningkatkan pelayanan kepada pengguna jasa melakukan aktivitasnya di Pelabuhan Belawan, jelas Swandi. Investasi infrastruktur dilaksanakan Pelindo I untuk Cabang Belawan diantaranya membangun fasilitas lapangan parkir truk angkutan, rehab lapangan penumpukan peti kemas dan pembangunan lapangan penumpukan peti kemas serta fasilitas gedung berupa alat pendingin ruangan (air condition/AC) di Terminal Penumpang Domestik Pelabuhan

Belawan. General Manager Pelindo I Cabang Belawan, jelas Swandi juga menegaskan pembangunan fasilitas ini untuk mengantisipasi meningkatnya aktivitas bongkar muat peti kemas merupakan ekspansi sistem pengapalan barang saat ini. Pelabuhan Belawan dahulunya mendominasi bongkar muat cargo kini berangsur angsur mulai melengkapi fasilitas ini dengan merehab lapangan penumpukan peti kemas di area 301-302. Pembangunan ini sendiri berbiaya Rp 4,4 miliar. Selain itu, jelasnya, Pelabuhan Belawan, tahun ini juga akan melakukan pematangan lahan di samping PT Pusri Pelabuhan Belawan untuk dijadikan lapangan penumpukan peti kemas dengan biaya sebesar Rp 2,076 miliar. Membangun fasilitas di pelabuhan tidak terlepas dengan membanguan sarana lalu lintas karena kelancaran arus lalu lintas sangat mendukung lancarnya arus bongkar muat barang. Menyadari pentingnya sarana ini Pelabuhan Belawan akan memperbaiki lahan parkir dengan melakukan pengerasan lahan menggunakan coneblock di samping Badan Pendidikan

dan Latihan (BPL) Pelindo I Jalan Raya Pelabuhan. Lapangan parkir truk ini bernilai Rp 3,7 miliar. Selain membangun fasiltas B/M barang, Pelindo I Cabang Belawan juga meningkatkan pelayanan bagi masyarakat yang akan menggunakan angkutan kapal dengan melengkapi sarana pendingin di ruanga tunggu penumpang (terminal penumpang). Sarana pendingin (AC) ini juga akan menyerap anggaran sebesar Rp867 juta.(m35)

motif ciri khas Medan atau daerah lain di Sumatera Utara, tuturnya. Dalam kesempatan itu Basyrul mengatakan untuk mengasah keterampilan ibu rumah tangga dan mengembangkan kemampuan menghasilkan karya cipta yang memiliki nilai jual, Pemko Medan giat mengadakan pelatihan. Diantaranya seanyak 35 ibu rumah tangga di Kelurahan Helvetia Timur, Kecamatan Medan Helvetia dilatih keahlian menjahit sulaman bordir selama 20 hari di aula kelurahan tersebut, tuturnya. Untuk mendukung pelatihan, Pemko Medan melalui Disperindag menyerahkan lima unit mesin jahit sebagai hibah yang diharapkan dapat digunakan secara terus menerus oleh para ibu rumah tangga setempat untuk mengasaha keterampilan. Disamping itu, para peserta pelatihan juga diberikan bantuan peralatan pelatihan seperti kain, benang, dan fasi-litas penunjang lainnya dibim-bing oleh seorang instruktur berpengalaman termasuk pengetahuan tentang motif sulaman. Disamping instruktur, pelatihan juga diawasi langsung oleh Lurah Helvetia Timur Zul Fahri Ahmadi selama 20 hari berlangsungnya pelatihan itu. Menurut Zul Fahri, kelurahan yang dipimpinnya saat ini menyandang predikat terbaik 10 program PKK percontohan tingkat kota Medan, saat ini para kader dan ibu rumah tangga sedang menghadapi monitoring tim PKK propinsi, ujarnya.(m40)

Telkomsel Gandeng GSTar MEDAN (Waspada): Telkomsel menggandeng GStar Mobile Phones dalam program bundling simPATI dilanjutkan dengan pameran seri Qwerty Phone terbarunya seri Q83 – Qwerty Trackpad di atrium Sun Plaza Medan Sabtu (22/5). Sesuai dengan Tagline-nya, keunggulan seri terbaru Q83 adalah bentuk qwerty, dual on GSM, serta dilengkapi juga dengan fitur masa kini seperti Facebook, E-buddy, Twitter disamping tambahan fitur-fitur Telkomsel seperti Chat dan Flash.

Kartu Perdana Simpati mempunyai begitu banyak nilai seperti bonus 100 sms ke seluruh operator, nelpon dengan telpon Mania, bonus content, serta lainnya. Telkomsel akan memberikan tambahan nilai khusus berupa data 3MB/bulan selama 6 bulan, dengan syarat harus melakukan isi ulang pulsa sebesar Rp30,000 akumulasi. GStar telah di kenal pasar handphone sebagai produk kuat , bandel dan tahan banting, serta memiliki dukungan service centre.(m09)

WASPADA Senin 24 Mei 2010

Asahan III Untuk Masyarakat Sumut MEDAN (Waspada) : Direktur Utama PT PLN (Persero) Dahlan Iskan merasa kaget ketika mendengar salah satu penyebab mengapa Gubernur Sumatera Utara tidak mengeluarkan izin lokasi untuk PLTA Asahan III kepada PLN. Padahal dari awal pihaknya telah menyatakan bahwasanya listrik dari Asahan III akan sepenuhnya untuk masyarakat Sumatera Utara. Dan permasalahan saham antara PT PLN, Pemprovsu, dan pemkab/ pemko akan dibahas setelah duduk bersama. “Saya kaget ketika mendengar kabar salah satu penyebab mengapa Gubernur Sumatera Utara tidak mengeluarkan izin lokasi karena khawatir listrik Asahan III nanti akan diberikan kepada Inalum,” ujar Dirut PT PLN, Dahlan Iskan via telefon

selularnya di Jakarta, Minggu (23/5). Hal ini, lanjutnya, tidak benar. Isyu murahan dan mungkin sengaja diada-adakan untuk membelokkan izin tersebut kepada pihak lain bukan kepada PT PLN. “Isyu kekhawatiran seperti itu saya dengar saat berada di Medan pekan lalu, beberapa anggota DPR Komisi VII dan juga berbagai pihak yang berbicara kepada saya menanyakan kebenaran isyu tersebut,” ujarnya. Namun, terang Dahlan Iskan, dirinya belum pernah mendengar langsung kekhawatiran tersebut dari Gubernur Sumatera Utara tersebut. “Sekali lagi saya tegaskan listrik dari Asahan III akan sepenuhnya untuk masyarakat Sumut. Tidak ada deal sama sekali dengan Inalum dan pernyataan ini akan saya pertanggungjawabkan dunia akherat,” lanjutnya. Dahlan Iskan berharap, dengan pernyataan resmi ini mudah-mudahan Gubsu sudah bisa jelas dan memproses izin

lokasi untuk PLN sudah diajukan sejak 2004 lalu dan telah diulang sebanyak dua belas kali. Dirinya mengakui, proyek ini didanai dari pinjaman Jepang (JICA) sekitar 250 juta Dolar AS dengan bunga sekitar 0,75 persen per tahun dengan syarat yang sangat bagus pula. Dimana selama sepuluh tahun pertama tidak perlu mencicil dan membayar bunga, dan pengembalian pinjaman selama 40 tahun. “Uangnya sudah siap sejak empat tahun lalu. Sangat sayang kalau fasilitas seperti ini tidak digunakan. Dan jika hal ini dikhawatirkan oleh Gubsu sepertinya tidak menjadi alasan karena syarat antara JICA dan PLN tidak ada syarat mengikat dengan pemberian listrik kepada mereka,” ujarnya. Selain itu, lanjutnya, tidak ada keharusan kontraktor mengerjakan nanti harus dari Jepang, bisa saja dari negara manapun penting bisa menang tender internasional. “Yang mengadakan tender pun dari PT PLN bukan dari Jepang. Saya harap dengan penegasan ini

persoalannya menjadi jernih dan Asahan III bisa segera dilaksanakan,” ujarnya. Dalam waktu dekat sekitar satu minggu PLN Pusat juga telah mengeluarkan SK pengangkatan orang akan menjadi pimpinan proyek PLTA Asahan III beserta jajaran di bawahnya. “Tentunya adalah mereka putra Sumut yang kini menjadi pejabat PLN yang sudah berpengalaman mengerjakan PLTA khususnya Asahan II,” tandasnya. Selain itu, mereka juga pernah ikut mengerjakan PLTA Renun dimana tingkat kesulitan lebih tinggi dibanding dengan Asahan III, karena PLTA Renun harus membuat terowongan dibawah gunung batu sejauh total sekitar 25 km sedangkan Asahan III hanya 8 km. “Beliau ini adalah Ikuten Sinulingga yang sekarang menjadi GM Pembangkitan Sumbagut dan saya harap dan cita-citaka Asahan III ini akan menjadi kebanggaan Sumut dengan yang mengerjakannya adalah putra-putra terbaik Sumut,” lanjut Dahlan Iskan kembali. (m38)

YLKI: Kenaikan Elpiji Dan TDL Pukul Daya Beli Masyarakat J A K A RTA ( Wa s p a d a ) : Yayasan Lembaga Konsumen Indonesia (YLKI) mengkhawatirkan kenaikan elpiji non subsidi dan tarif dasar listrik (TDL) dilakukan secara bersamaan akan memukul daya beli masyarakat. “TDL, tarif tol, elpiji dan kereta api ekonomi antar kota, semuanya akan dinaikkan tahun ini. Kalau semuanya serentak dinaikkan, maka itu akan pukul daya beli konsumen secara keseluruhan,” ujar pengurus harian YLKI, Tulus Abadi saat dihubungi detikFinance, Minggu (23/5). Meskipun kenaikan elpiji non subsidi adalah termasuk aksi korporasi, namun Agus berharap agar pemerintah hatihati dalam menyetujui kenaikan

elpiji non subsidi sebesar Rp 1.000 per kilogram (Kg) yang diusulkan PT Pe rtamina (Persero) tersebut. Pemerintah harus memperhitungkan dengan matang terkait waktu kenaikan harga elpiji itu. “Masyarakat digencar dengan berbagai kenaikan harga tanpa adanya kenaikan pendapatan mereka, itu sama saja melumpuhkan daya beli mereka. Jadi waktu kenaikannya harus diperhitungkan secara matang. Jangan sampai serentak” ungkapnya. Selain berdampak pada daya beli konsumen, Ia juga memperkirakan kenaikan harga elpiji justru akan membuat bengkak subsidi elpiji dalam APBN. Menurut Tulus, kenaikan

ini akan membuat para pemakai elpiji non subsidi akan bermigrasi menggunakan elpiji 3 Kg yang harganya lebih murah karena masih disubsidi. “Sekarang saja 10 persen pengguna elpiji 12 Kg sudah beralih menggunakan elpiji 3 Kg,” jelasnya. Pada kesempatan sama, ia juga meminta agar formulasi harga elpiji non subsidi tersebut diaudit oleh Badan Pemeriksa Keuangan (BPK) agar penetapan harganya bisa lebih tranparan. “Selama ini, kan Pertamina tentukan itu semua. Jadi formulasi harganya harus diaudit oleh lembaga independen seperti BPK,” tergasnya. Seperti diketahui, Pertamina berencana untuk menaik-

kan harga elpiji ukuran 12 kg sebesar RP 1.000 per kg pada tahun ini. Kenaikan tersebut diusulkan karena saat ini BUMN Migas tersebut mengaku harus nombok sekitar Rp 2.658 per kg dari setiap elpiji non subsidi yang dijualnya kepada masyarakat. Sementara konsumsi elpiji non subsidi pada tahun ini diperkirakan mencapai 1,2 juta metric ton (MT). Elpiji non subsidi terdiri dari elpiji ukuran 12 kg, 50 kg, dan elpiji curah atau bulk. Direktur Utama Pertamina, Karen Agustiawan memperkirakan kerugian akan dialami perseroan dari penjualan elpiji non subsidi tahun ini sekitar Rp 2,7 triliun jika harga elpiji jenis tersebut tidak dinaikkan.(dtc)

Dampak Krisis Eropa Tak Separah Krisis 2008 JAKARTA (Waspada): Krisis yang masih mengkhawatirkan di Eropa, khususnya wilayah Selatan Eropa, tidak akan membawa penurunan tajam terhadap ekonomi Indonesia di tahun 2010 ini. Pasalnya, negara-negara seperi Yunani, Spanyol, Portugal, dan Irlandia, bukan pelaku utama penggerak ekonomi Eropa. Demikian disampaikan Pengamat Ekonomi dari Standard Charted Bank, Fauzi Ichsan dalam perbincangan dalam IDX Investor Club di Hotel Nikko, Jalan MH Thamrin, Jakarta, Sabtu (22/5). “Krisis Eropa tidak akan separah krisis global tahun 2008. Prospek pasar saham menjadi menarik karena valuasinya jadi murah, walaupun investor

masih menunggu,” ujar Ichsan. Ia menambahkan, negaranegara Eropa juga sedang berkonsolidasi untuk bekerjasama guna menyelamatkan ekonomi mereka. Khususnya pemulihan di sumber krisis, khususnya negara di Eropa Selatan. Meskipun ada kekhawatiran dari pelaku pasar dunia pada pekan ini, krisis akan terus berlanjut. Bahkan investor memutuskan menarik dananya dari bursa-bursa di Asia termasuk Indonesia. Kabar negara Eropa lain akan mengikuti langkah Jerman, melarang perdagangan naked short selling atas surat utang 16 negara, diperkirakan juga memicu aksi jual di Eropa kemudian diikuti di bursa Wallstreet.

“Memang di Eropa yang paling penting adalah Jerman, Perancis dan negara-negara Skandinavia. Misalkan, pagipagi Jerman mau out dari pemulihan euro, bagaimana. Bisa saja Bank Of Eropa menyelamatkan, dengan mencetak uang baru. Namun akibatnya nilai mata uang pasti akan menurun. Bahkan akan terus berlanjut, dan diprediksi euro menjadi 11,5 euro per dollar AS,” papar Ichsan. Pada perdagangan akhir pekan ini, bursa Eropa sudah terkoreksi meskipun tidak terlalu dalam. Laju aksi jual di Eropa telah mengendur, pun demikian di kawasan Asia. Bahkan bursa Shanghai telah masuk ke teritori positif. Pada perdagangan pekan

depan, indeks-indeks bursa global diperkirakan mulai rebound lantaran koreksi tajam selama pekan ini telah membuat harga-harga saham terlalu murah. Investor diprediksi memang tengah menunggu titik terendah dari sentimen negatif Eropa untuk kemudian melakukan aksi beli massif. “Dengan rentannya pemulihan ekonomi AS dan eropa, suku bunga global diperkirakan akan tetap rendah di tahun ini. Namun selama adanya ketidakpastian di saham, investor sementara memarkir dana di pasar uang, walaupun bunganya rendah,” imbuhnya. “Pemulihan ekonomi global, laba perusahaan dan perbankan diperkirakan naik, usai krisis Euro berakhir.” tukas Ichsan. (dtc)

KP2T T.Tinggi Reformasi Birokrasi KESAN berbeda ketika memasuki Kantor Perizinan Terpadu (KP2T) Kota Tebingtinggi. Tidak tampak seperti instansi pemerintah lajimnya, para pegawai berseragam batik layaknya karyawan di instansi swasta. Sistem layanan cepat, mudah, dan transparan menjadi komitmen bagi pegawai dan stafnya. Hal itu ditandai dengan pemberian cap tandatanganan dari seluruh staf dan pegawai yang terpajang di dinding ruangan kantor sebagai komitmen untuk memberikan pelayanan terbaik. Masalah administrasi yang biasa berbelit-belit termasuk dalam hal perizinan, kini menjadi satu tempat dalam kantor layanan samsat terpadu. Setiap masyarakat berurusan mendapat layanan prima dibantu sarana dan prasarana sistem komputerisasi. Proses perizinan sebelumnya terdapat di sejumlah dinas seperti dinas koperasi dan UMKM Perindokop menangani perijinan SIUP-TDP, SIUP Gudang. Dinas PU menangani perijinan SIMB, Dinas Kesehatan menangani semua izin bagian kesehatan, Dinas Perkonomian menangani izin HO, izin alkohol dan Dinas Perhubungan yang menangani izin mendirikan perusahaan angkutan, dan pendaftaran kenderaan

Waspada/Muhammad Idris

MENINJAU: Tim Kementerian Pemberdayaan Aparatur Negera (PAN) dan Birokrasi RI saat meninjau sistem pelayanan di Kantor Perizinan Terpadu (KP2T) Kota Tebingtinggi didampingi Kepala KP2T, Erwin Suheri Damanik, S.Sos. MSP. bermotor. Hal ini memakan waktu cukup panjang dan biaya tidak jelas, karena banyak meja dan instansi yang dilalui. Pelayanan buruk berbiaya tinggi pula. Setelah KP2T Tebingtinggi berdiri beberapa tahun lalu, seluruh jenis perijinan menjadi satu tempat. Warga yang membutuhkan langsung mengajukan permohonan ke loket informasi, kemudian pemeriksaan berkas, selanjutnya dilakukan

peninjauan lapangan (survey),setelah itu percetakan sertifikat. Proses pelayanan mulai dari tahap permohonan sampai penerbitan dokumen telah terjadi pemangkasan tahapan dan prosedur, serta efisiensi biaya. Dalam hal terjadi telah reformasi birokrasi. Berdasarkan grafik penerimaan retribusi sebelum dan sesudah adanya KP2T Tebingtinggi Agusturs 2018 hingga

Desember 2009 terjadi peningkatan retribusi, paling menonjol di bidang ekonomi dan pekerjaan umum. Rekapitulasi jumlah IMB tahun 2008 sebanyak 72 IMB sedangkan tahun 2009 jauh meningkat mencapai 321 IMB. Te r k a i t k e b e r h a s i l a n reformasi birokrasi dalam hal perizinan ini, KP2 T Tebingtinggi telah ditinjau Tim Kementerian Pemberdayaan Aparatur Negera (PAN) dan Birokrasi RI , Kamis (8/5) lalu. Kepala KP2T Kota Tebingtinggi, Erwin Suheri Damanik, S.Sos.MSP. kepada Waspada, baru-baru ini mengatakan, sistem pelayanan terpadu dalam satu tempat tidak hanya meningkatkan retribusi daerah tetapi juga meningkat keinginan masyarakat mengurus perizinan. Pelayanan yang diberikan, tambahnya, dilengkapi sarana seperti sistem informasi perizinan, menindaklanjuti proses dengan sistem komputerisasi, tersedia monitor touchscreen diberikan kepada pelaku usaha untuk mendapatkan informasi terkait dengan persyaratan izin dan biaya. KP2T Tebingtinggi ini, tambahnya, didirikan atas prakarsa Walikota Sistem dan prasana yang ada saat ini menurut, merupakan terbaik di Sumut. ● Muhammad Idris

Waspada, Senin 24 Mei 2010  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you