Page 1

Harga Eceran Rp2.500,-

Demi Kebenaran Dan Keadilan


Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

SENIN, Pahing, 13 Januari 2014/11 Rabiul Awal 1435 H

No: 24459 Tahun Ke-68

Terbit 24 Halaman

Waspada/David Swayana

Waspada/David Swayana

WARGA mengevakuasi isi rumah setelah rumahnya ambruk dihantam hujan lumpur, Sabtu (11/1) subuh.

KONDISI jalan di Desa Kebayaken berlumpur setelah terjadi hujan lumpur, Sabtu (11/1) subuh.

Pemerintah Pusat Bantu Pemkab Tangani Sinabung

Hujan Lumpur Jadi Momok Baru

KABANJAHE (Waspada): Pemerintah pusat melalui Kementerian Koordinator Bidang Kesejahteraan Rakyat (Kemenkokesra) dan Badan Nasional Penanggulangan Bencana (BNPB) akan membantu Pemkab Karo untuk menangani bencana erupsi Gunung Sinabung. “Bantuan dari pusat akan datang dan sekarang masih di perjalanan. Artinya, kebutuhan kami belum terganggu,” ujar Komandan Tanggap Darurat Gunung Sinabung, Saberina Br Tarigan, kepada Waspada di Poskonya, Minggu (12/1). Plt Asisten II Pemkab Karo ini menyebutkan, hasil pertemuannya dengan Kemenkokesra dan BNPB di Jakarta, Pemkab Karo tidak sendiri. Pemerintah pusat akan memback-up selama berlansungnya penanganan erupsi Gunung Sinabung. “Mereka berpesan agar memberikan hal-hal yang terbaik ke masyarakat. Anak-anak harus sekolah. Pengungsi tidak boleh tidak makan dan harus memiliki tempat tinggal. Semua harus ditangani,” katanya. Lanjut ke hal A2 kol. 1

ERUPSI Gunung Sinabung makin dahsyat, dan membuat m a s y a ra k a t Ta n a h K a r o semakin khawatir. Hujan debu disusul hujan lumpur semakin mencekam. Bahkan sejumlah perkampungan di kaki gunung luluh lantak. Kini, warga bukan saja mengalami kesulitan ekonomi karena semua tanaman mereka hancur, melainkan rumah-rumah mereka ikut porak-poranda tertimbun hujan lumpur yang keluar dari mulut gunung tersebut. Saat Tim Waspada meninjau perkembangan Gunung Sinabung,Sabtu (11/1), tampak dua desa seperti Desa Sigaranggarang dan Desa Kutarayat luluh lantak dihantam hujan lumpur. Kejadian baru itu menjadi momok bagi warga yang berada di kaki gunung tersebut. Jalan yang menuju tempat wisata Lau Kawar dipenuhi lumpur setebal 10 centimeter. Akibatnya semua kendaraan kesulitan untuk melintas. Sejumlah warga yang selama ini belum mengungsi, KUBAH Masjid Nur Hidayah ambruk setelah dihantam hujan lumpur, Sabtu (11/1) subuh. Foto-foto lainnya lihat di halaman A2.

Waspada/David Swayana

Lanjut ke hal A2 kol. 3

Hujan Lumpur Siram 7 Desa Masjid, Gereja Dan Puluhan Rumah Di Kaki Gunung Sinabung Ambruk TANAH KARO (Waspada): Erupsi Gunung Sinabung makin dahsyat. Sabtu(11/1) subuh hujan lumpur melanda tujuh desa di Kec. Namanteran. Yakni Desa Sigarang garang, Kutarayat, Kuta Gugung, Kebayaken, Sukanalu, Bekerah dan Simacem. Distanbun Kab Karo Agustoni Tarigan SP didampingi Kabid Perencanaan Jamson Sagala SP yang saat itu berada di Kec. Namanteran mengatakan, terdapat tujuh komoditi tanaman yang dianggap fuso, yakni tanaman pangan 1,636,62 Ha, holtikultura 6.085,37 Ha, buah 1,034,92 Ha dan perkebunan 2,857,48 Ha dengan total keseluruhan mencapai 10,779,49 Ha. ‘’Kita segera melaporkan permasalahan ini ke Kemen-


PARA pemrotes anti-pemerintah bersantai tengah hari di bawah naungan payung pantai pada saat mereka ikut ambil bagian dalam rapat umum di Monumen Demokrasi di Bangkok, Thailand, Minggu (12/1).

itu. Namun pihak KPK ternyata tidak memberikan izin. Keluarga pun mengeluh. Wakil Ketua KPK, Bambang Widjojanto memberikan penjelasan terkait hal itu. Menurutnya, tidak ada perbedaan atau diskriminasi bagi setiap tahanan KPK. “Semua orang diperlakukan sama di KPK,” kata Bambang Minggu (12/11).

BANGKOK, Thailand (AP): Para penduduk Bangkok, ibukota Thailand yang padat menghadapi suasana lalulintas kacau dan paling buruk dan tidak pernah terjadi sebelumnya, dengan para pemrotes anti-pemerintah berencana untuk menduduki sejumlah persimpangan besar Senin (13/1).

Lanjut ke hal A2 kol. 3

Lanjut ke hal A2 kol. 5

Lanjut ke hal A2 kol. 5

Al Bayan

Hari Ini Pemrotes Duduki Jalanan Bangkok

Wagubsu Ir HT Erry Nuradi MSi:

Tahun Gajah Oleh Tgk. H. Ameer Hamzah Tidakkah engkau perhatikan, bagaimana Tuhanmu telah bertindak terhadap tentara bergajah. Bukankah Dia telah menjadikan tipudaya mereka sia-sia? Dan Dia mengirim kepada mereka burung Ababil.Yang melempari mereka dengan sijjil sehingga mereka dijadikannya sebagai daun kayu yang dimakan ulat.(QS. Alfiil). SETIAP Rabiul Awal datang, kita teringat Tahun Gajah. Tahun kelahiran Nabi Muhammad SAW. Muhammad lahir delapan bulan setelah gajah-gajah dari Sana’a (Yaman) diarak ke Mekkah untuk meruntuhkan Ka’bah. Gajah-gajah itu dikendarai oleh Panglima Abrahah dan tenteranya. Niat jahat Abrahah kandas ketika mereka sampai di Masy’aril Haram dekat Muzdalifah sebab tentara dari langit “burung Ababil” membombardir mereka.

Lanjut ke hal A2 kol. 2 Waspada Daily

Konvensi Capres Demokrat Di Istana Maimon 21-23 Januari MEDAN (Waspada): Tim Komite Konvensi Calon Presiden (Capres) Partai Demokrat akan menggelar ‘debat bernegara’ yang diikuti oleh 11 peserta konvensi, pada 21 dan 23 Januari 2014 di Istana Maimon, Medan. Debat ini merupakan salah satu rangkaian proses penjaringan Capres yang akan diusung Partai Demokrat pada Pemilu Presiden 2014. Anggota Komite Konvensi, DR. Hinca IP Panjaitan menyampaikan hal itu dalam keterangan persnya kepada wartawan, Minggu (12/1) sore di Medan. Hinca didampingi komite konvensi lainnya, Putu Suasta dan Budi Utomo, serta Ketua DPD Partai Demokrat Sumut, HT Milwan, dan pengurus H. Farianda Putra Sinik, SE, T. Dirkansyah, Sopar Siburian, Ti Aisyah Ritonga, Enda Mora Lubis, dan Zulkifli. Hinja memamparkan, komite pada 15 September 1013 telah menetapkan 11 peserta konvensi, yakni Ali Maskur Musa (pimpinan BPK, Jakarta), Anis Bawedan (Rektor Universitas Paramadina, Jakarta), Dahlan Iskan (Menteri BUMN), Dino Patijala (Dubes RI untuk AS), Irman Gusman

KPK Tepis Kekhawatiran Keluarga Anas Akan Diracun JAKARTA (Waspada): Pihak keluarga mengkhawatirkan keamanan dan keselamatan Anas Urbaningrum selama berada di Rumah Tahanan (Rutan) Komisi Pemberantasan Korupsi (KPK). Oleh karena itu, mereka melarang Anas mengonsumsi makanan dan minuman dari KPK. Sebaliknya, mereka menyuplai makanan dan konsumsi sendiri bagi mantan Ketua Umum Partai Demokrat

terian Pertanian,’’ katanya. PantauanWaspada di lapangan, akibat erupsi yang sangat dahsyat sejumlah desa yang berada di kaki Gunung Sinabung luluh lantak. Rumah dan tempat beribadah seperti gereja, masjid ambruk akibat tebalnya abu vulkanik bersamaan dengan hujan. Bahkan di lokasi itu tampak ada mobil dan kereta tidak terselamatkan akibat tebalnya lumpur di jalan desa tersebut. Lanjut ke hal A2 kol. 1


Waspada/Rudi Arman

KAPOLRESTA Medan Kombes Pol Nico Afinta Karokaro, SIK, SH, MH (dua kiri) melihat Kasat Reserse Narkoba Kompol Dony Alexander (tiga kanan) memegang bahan pembuatan ekstasi disaksikan dua tersangka saat ekspos di Polresta Medan, Minggu (12/1) sore. Terlihat juga Wakasat AKP Viktor Ziliwu (kiri) dan Kanit Idik II AKP Azuar (kanan).

Banjir Landa Pabrik Ekstasi Jl. PWS Sejumlah Produksi 250 Butir Sehari MEDAN (Waspada): Ka- N a r k o b a K o m p o l D o n y Lokasi Jakarta polresta Medan Kombes Pol Alexander saat ekspos tiga JAKARTA (Antara): Hujan deras sejak Minggu (12/1) pagi hingga sore menyebabkan banjir di sejumlah lokasi di Jakarta. TMC Polda Metrojaya menginformasikan banjir menggenangi Jl. Arteri Km 26 yang mengakibatkan kemacetan di Jalan Tol Jor Km 28 dari arah Cilandak, Jakarta Selatan. Lanjut ke hal A2 kol. 5

Nico Afinta Karokaro, SIK, SH, MH menjelaskan, pabrik pembuatan ekstasi dan sabu di Jl. PWS Medan memproduksi 200 hingga 250 butir pil ekstasi dalam sehari. “ Selain diedarkan di Medan, ekstasi ini diedarkan tersangka hingga Pekanbaru Provinsi Riau dengan harga jual Rp100 ribu per butir,” kata Nico didampingi Kasat Res

Plt Wali Kota Medan Dzulmi Eldin

“Waspada Sumber Ide Dan Gagasan Cerdas Bagi Saya”

“Waspada Sebagai Kontrol Pembangunan Kota Medan”

WAKIL GUBERNUR Sumatera Utara Ir HT Erry Nuradi, MSi memberikan apresiasi kepada Harian Waspada yang telah menjalankan fungsinya sebagai media massa, yakni sebagai media informasi, pendidikan, hiburan, dan sebagai media kontrol sosial sesuai Pasal 33 UU Nomor 40 Tahun 1999 tentang pers. Apresiasi itu disampaikan Erry, menanggapi sepak terjang Harian Waspada yang memperingati HUT ke-67 pada 11 Januari 2014. Sebagai salah satu media massa tertua dan terbaik di Medan, Erry menilai Waspada telah sukses menjalankan fungsinya sebagai saluran dan jendela informasi bagi masyarakat.Tidak hanya di Provinsi Sumatera Utara, Aceh, tetapi juga secara nasional. Waspada juga berperan menjalankan fungsinya sebagai sarana pendidikan massa (mass communication) demi mencerdaskan

PLT WALI KOTA MEDAN Drs HT Dzulmi Eldin, MSi mengatakan, Harian Waspada sebagai kontrol dalam pembangunan kota ini. Untuk itu, dia berharap kepada Waspada agar tetap membuat kritikan yang sifatnya membangun. “Yang pertama, saya ucapkan selamat ulang tahun ke-67 kepada Harian Waspada semoga tetap eksis dan mampu menjadi tonggak dalam pembangunan Kota Medan. Semoga di tahun ini Harian Waspada selaku salah satu harian yang sudah sangat lama berkiprah sebagai mitra pemerintah Kota Medan,” kata Eldin, Minggu (12/1). Dikatakan Eldin, Harian Waspada diharapkan terus menghadirkan bacaan atau tulisan yang dapat mencerdaskan masyarakat Sumatera Utara khususnya Kota Medan, utamanya dalam membuat berita-berita yang sifatnya membangun. Menjalankan tugas jurnalistik dengan baik.

Lanjut ke hal A2 kol. 7

Lanjut ke hal A2 kol. 5

penggerebekan narkoba, Minggu (12/1) sore. Dijelaskan Nico, dalam penggerebekan pabrik ektasi Rabu (8/1), polisi menangkap dua tersangka, JK alias Ajon dan Her alias Apin dengan barang bukti 350 butir ekstasi, 3 bungkus plastik tepung warna putih seberat 2,52 gram,

Lanjut ke hal A2 kol. 3

Ada-ada Saja Makan Rumput ANEH tapi nyata, begitulah yang diinstruksikan seorang pemuka agama ini kepada jemaatnya. Di Afrika Selatan, sekitar utara Pretoria, seorang pastor membuat seruan kontroversial. Ia menyuruh jemaat gereja memakan rumput dengan dalih agar bisa “lebih dekat dengan Tuhan”.

Lanjut ke hal A2 kol. 2

Serampang - Ditunggu hujan emas - He...he...he...

Berita Utama


“Waspada” Sebagai....

Waspada/David Swayana

Salah satu rumah warga ambruk setelah dihantam hujan lumpur, Sabtu (11/1) subuh. Selain rumah, masjid dan gereja juga ambruk terlihat warga menyelamatkan barang-barangnya.

Hujan Lumpur Siram ....

Hujan Lumpur Jadi ...

Seperti di Desa Sigarang-Garang dan Desa Kutarayat tampak Masjid Nurhasanah dan Gereja Masehi Persekutuan Damai ambruk akibat terjangan abu tebal yang turun bersamaan dengan hujan. Ketebalan lumpur yang berada di atas atap rumah warga diperkirakan 3 centimeter. Sehingga tiang penyangga tidak mampu menahannya. Bahkan, seluruh tanaman hancur.Rata dengan tanah. Jalan juga dipenuhi dengan lumpur setebal 10 centimeter sehingga kendaraan susah untuk melintas di jalan tersebut. Kondisi jalan sangat licin akibat ketebalan lumpur. Irmawati warga Desa Kutarayat mengatakan, kejadian yang sangat dahsyat itu mulai Sabtu (11/1) sekitar pukul 05:00. Saat itu diawali turunnya hujan gerimis. Warga yang belum mengungsi tidak menduga hal itu terjadi. “Kami warga yang bertahan di desa ini. Kami belum pindah ke pengungsian. Tadi pagi kami sudah mendengar ada suara keras dari Sinabung,tapi kami pikir tidak ada apa-apa. Setelah suara itu , turun hujan gerimis dan lama-lama makin deras bercampur abu,” ujarnya. Ditambahkannya, peristiwa itu baru kali ini terjadi. Sebelumnya sudah terjadi abu vulkanik,namun tidak setebal kali ini. “Baru kali inilah kejadian yang paling mengerikan. Kalau sebelumnya juga ada abu vulkanik tapi tidak setebal hari ini. Kalau ini sudah sangat mengancam keselamatan. Makanya terpaksa kami mengungsi hari ini. Kami takut terjadi lagi yang lebih dahsyat lagi,” katanya saat mengevakuasi barang-barang keluar dari rumah tersebut. Hal yang sama dikatakan Tarigan warga Desa Sigaranggarang yang saat itu sedang membersihkan atap rumahnya akibat lumpur Gunung Sinabung. Dia mengatakan, peristiwa itu terjadi saat dia tertidur lelap. Tiba-tiba mendengar suara hujan turun,namun suaranya berbeda dengan suara hujan biasa. “Tadi pagi kejadiannya, saat kami masih tertidur. Tiba-tiba hujannya deras bercampur abu, makanya seperti ini. Tapi masih untung tidak bercampur batu-batuan. Tapi baru kali ini paling dahsyat abunya,” katanya. Kadistanbun Kab Karo Agustoni Tarigan SP didampingi Kabid Perencanaan Jamson Sagala yang saat itu berada di lokasi mengaku pihaknyayangmenadapatlaporantetanghujanlumpuryangmelanda di kecamatan itu langsung melakukan pengambilan sampel tanah dan tanaman yang di terjang lumpur setebal 15 Cm itu. Pihaknya akan membuat laporan bencana yang melanda hampir sebagian Kab. Karo ke Kementerian dan Presiden. (m50/c10/a36)

hari itu tampak sibuk mengevakuasi barang-barang.Ada yang menggunakan mobil angkutan dan ada yang menggunakan kereta. Hujan lumpur tersebut baru terjadi, meskipun erupsi Gunung Sinabung sudah beberapa bulan lamanya. Ada beberapa desa yang berada di kaki gunung, namun tidak semuanya disiram hujan lumpur. Dari kejadian tersebut menandakan kondisi Gunung Sinabung semakin mengkhawatirkan. Seperti di Desa Sigaranggarang dan Desa Kutarayat, tampak Masjid Nurhasanah dan Gereja Masehi Persekutuan Damai ambruk akibat terjangan abu tebal yang turun bersamaan dengan hujan lumpur. Ketebalan lumpur yang berada di atas atap rumah warga diperkirakan tiga centimeter. Sehingga tiang penyangga tidak mampu menahannya. Irmawati warga Desa Kutarayat mengatakan, peristiwa yang sangat dahsyat tersebut terjadi, Sabtu (11/1), sekitar pukul 05:00. Saat itu diawali dengan turunnya hujan gerimis.Warga yang belum mengungsi ini tidak menduga hal itu bakal terjadi. “Kami warga yang bertahan di desa ini. Kami belum pindah ke pengungsian. Tadi pagi kami sudah mendengar ada suara keras dari Sinabung,tapi kami pikir tidak ada apa-apa. Setelah suara itu, turun hujan gerimis dan lama-lama makin deras bercampur abu,” ujarnya. Katanya, hal itu baru kali ini terjadi. Sebelumnya hanya abu vulkanik,namun tidak setebal kali ini. “Baru kali inilah kejadian yang paling mengerikan. Kalau sebelumnya juga ada abu vulkanik tapi tidak setebal hari ini. Kalau ini sudah sangat mengancam keselamatan. Makanya kami mengungsi hari ini karena takut terjadi lagi yang lebih dahsyat,” katanya saat mengevakuasi barangbarangnya keluar dari rumah. Dengan mata berkaca-kaca, Irmawati mengatakan, kondisi yang dialaminya saat ini bukan saja kesulitan mencari nafkah,melainkan rumah tempat tinggalnya juga telah rata dengan tanah akibat hujan lumpur yang disemburkan Gunung Sinabung. “Kemana lagi kami pergi, apakah kami selamanya tinggal di pengungsian? Kalau nantinya gunung itu sudah aman,tapi kami tetap tidak aman karena rumah pun sudah hancur dihantam lumpur,” katanya. Demikian juga dikatakan Tarigan warga Desa Sigaranggarang yang saat itu sedang membersihkan atap rumahnya akibat lumpur Sinabung. “Tadi pagi kejadiannya,saat kami masih tertidur. Tibatiba hujannya deras bercampur abu,makanya seperti ini. Tapi masih untung tidak bercampur batu-batuan. Tapi baru kali ini paling dahsyat abunya,” katanya. Dikatakannya, pada malam itu juga erupsi sangat besar, namun tidak disertai dengan hujan. Sehingga warga masih bertahan karena erupsi tidak mengarah ke kampung tersebut. Namun, di pagi hari turun hujan gerimis dan lama kelamaan suara hujan semakin kencang bercampur abu. “Waktu hujan itu saya keluar dan mencoba menampung hujan dengan ember. Dari situ tampak jelas ternyata abu yang terbang bersamaan dengan hujan sehingga menjadi lumpur,” katanya. (m50/a36)

Pemerintah Pusat .... Sebelumnya, logistik makanan di posko utama yang digunakan untuk menampung bantuan sebelum disalurkan ke posko pengungsian mengalami krisis. Dalam beberapa hari terakhir, posko yang ditangani Pemkab Karo ini tidak melakukan aktivitas masak memasak untuk kebutuhan para relawan dan sejumlah petugas yang berada di sana. Namun, Saberina mem-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur:

bantah jika itu disebabkan oleh krisis logistik di posko tersebut. Menurutnya, dapur umum yang dalambeberapahariterakhirtidak beraktivitas karena petugasnya yang enggan untuk memasak. “Itu hanya karena orang ini yang malas masak. Waktu ditelponadamasalahdisini,sayalangsung bilang beli saja,” kata Saberina dan menambahkan, badan jalan penghubung yang sempat menutup akses menuju Sinabung juga sudah dibersihkan. Dia juga membantah adanya rumah permanen milik warga yang rubuh lantaran terkena erupsi gunung. “Rumah yang rubuh itu rumah yang seperti di ladang, beratap tepas. Nanti kita akan perbaiki itu. Tapi, yang runtuhbukanrumahyangditinggali warga,” ujarnya. (a36)

Ada-ada Saja....

1. ....., Kd4+. 2. Bd2, MxB+. 3. Ra3, Mb2+. 4. Rxa4, Gc6+mat. (Jika 2. Ra3, Md6+. 3. Rxa4, Gc6+mat). Jawaban TTS: TTS


Dilansir dari Mirror online, Minggu (12/1), pria bernama Lesego Daniel sebelumnya juga dilaporkan pernah menendang dan menginjak jemaatnya dalam sebuah upacara keagamaan. Meski begitu, praktek tak lazim dan kontroversial yang ia lakukan selalu dibela oleh para pengikutnya. “Ya, kami makan rumput dan kami bangga akan hal itu. Dengan kekuatan Tuhan kita bisa melakukan apa saja,” kata Rosemary Phetha, 21, seorang mahasiswi hukum yang menjadi pengikutnya. Ada pula pengakuan lain yang menyebut bahwa setelah merumput, seseorang menjadi lebih baik setelah terkena serangan stroke. Namun, ribuan pengguna jejaring sosial mengkritik aksi berlebihan dari sang pastor, dan menyebut seruannya sebagai hal “gila”. Seorang pengguna Facebook bernama Melvin Jeddy Bowtie menulis: “Saya telah melihat banyak hal gila tapi yang satu ini jelas tidak lucu. Pria ini telah mengubah manusia menjadi kambing!(mr/rzl)

Albayan.... Jawaban Sudoku:

3 1 7 9 2 8 6 4 5

8 4 6 5 3 1 2 9 7

9 5 2 4 6 7 8 1 3

7 8 1 3 5 2 4 6 9

6 2 4 7 1 9 5 3 8

5 3 9 6 8 4 7 2 1

1 6 3 8 4 5 9 7 2

4 9 5 2 7 3 1 8 6

2 7 8 1 9 6 3 5 4

Sebagian besar tentara dan gajah-gajah itu tewas di sana, sebagian kecil berhasil melarikan diri sampai di San’a Yaman. Panglima Abrahah termasuk yang selamat sampai di istananya, tetapi tidak lama kemudian dia pun tewas karena luka-luka yang sangat serius. Kulitnya hangus, dagingnya bolong-bolong dan gatal. Alquran menggambarkan kulit mereka “seperti daun kayu yang dimakan ulat” (QS. Alfiil:5). Syeikh Dr. Muhammad AlGazali, ulama penulis Sirah dari

Pabrik Ekstasi ...

Bambang menepis kekhawatiran keluarga bahwa akan terjadi sesuatu yang buruk terhadap Anas. Dia menuturkan ada belasan tersangka di Rutan KPK dan selama ini, mereka tidak apa-apa. “Insya Allah baik-baik saja. Tidak ada yang kelaparan, tidak ada yang keracunan,” ujarnya. Bahkan, lanjutnya, kalau sakit, mereka juga ada dokternya. “KPK memperlakukan siapapun dia, tahanannya KPK sama semua, sehingga dianjurkan untuk tidak membuat eksklusifisme yang seolah istimewa dari tahanan lainnya,” tegasnya. Bambang meminta para keluarga tahanan, khususnya Anas, untuk bersabar dan tawakal. “Jangan membuat ‘sesuatu’ yang sesungguhnya bukan kehendak dari tersangka yang kini sebagian haknya dibatasi sesuai undang-undang,” ucapnya. (vvn)

nggrebek lokasi home industry pembuatan ekstasi dan sabu di Jl. PWS No 15 B, Kel. Sei Pu-tih Timur 2, Medan Petisah. Dari dalam rumah berlantai 3 tersebut, polisi mengamankan dua tersangka, Rabu (8/1) sore. Dari pengembangan, polisi menggerebek rumah bandar sabu di Jl. Soekarno Hatta Binjai, dari lokasi polisi menyita barang bukti sabu seberat 300 gr dan seorang tersangka pengedar bernama Ham. Sedangkan Dony Alexander menjelaskan, dari 9 orang yang diamankan dalam penggrebekan narkoba dikawasan Jl. Letda Sujono Gang Pancasila Tembung, polisi menetap 2 orang sebagai tersangka. Tujuh orang lagi dipulangkan setelah diperiksa sebagai saksi.Dua orang yang dijadikan tersangka yakni Ir dan DK. Satuan Reserse Narkoba Polresta Medan menetapkan 5 orang menjadi tersangka dari 13 orang yang diamankan saat dilakukan penggrebekan narkoba dikawasan Kampung Kubur Jl. Zainul Arifin Medan, Senin (6/1). Ke lima orang yang ditetapkan sebagai tersangka dalam penggrebekan ini adalah, AK, Iq, AG, Ri dan OCG. “Mereka ini terdiri dari bandar, penyedia tempat dan bong alat isap sabu dan pemakai,” jelasnya. Kawasan Kampung Kubur digetrebek Senin (6/1) sore. Dalam penggrebekan ini petugas 13 orang yang berada didalam sebuah rumah dan menyita barang bukti 14,32 gr sabu, 15 bong, 10 buah mancis, 1 buah timbangan elektrik, 126 buah pipet kaca, satu handpone dan uang Rp1,4 juta. (m39)

Mesir mengatakan; gajah-gajah itu sebenarnya telah member isyarat bahwa mereka tidak mau berjalankeMekkah,misalnyamereka selalu berputar ke belakang, namun para serdadu Abrahah tetap mencambuk gajah-gajahnya supaya berjalan ke Mekkah. Ketika gajah-gajah itu berada di Masy’aril Haram, gajah sudah mulai mengamuk, tidak mau lagi berjalan mendkati Ka’bah. Sebenarnya Abrahah hanya seorang Gubernur Yaman yang ditempatkan oleh Raja Ethiopia di sana. Yaman zaman itu dalam jajahan Ethiopia. Abrahah ingin

menghancurkan Ka’bah karena cemburu, iri dan dengki melihat kemuliaan Mekkah. Di sana ada rumah suci yang sangat dibanggakan bangsa Arab. Tiap tahun mereka berziarah ke Ka’bah baik dari Timur, Utara, dan Barat. Abrahah juga telah membuat rumah suci tandingan di San’a, tetapi tidak ada yang datang. Dalam pikiran Abrahah, Ka’bah di Mekkah harus dihancurkan supaya para penziarah beralih ke San’a. Ternyata Ka’bah bukan rumahbiasa,ia“BaitAllah”yangsuci. BukanKa’bahhancurtetapipasukan Abrahah yang hancur binasa.

1 kg tepung warna putih, 1 buah pipet kaca berisi sisa sabu seberat 0,65 gram, 2 pipet kaca berisi tepung seberat 2,19 gram .Juga 600 gram tepung warna putih, 5 botol tepung warna seberat 550 gram, 1 buah bong, 2 buah mancis, 1 timbangan elektrik, 1 set blender merkYuragi, 1 hp, dan 1 kotak karton berisi satu bola pijar dan kabelnya. “Omzet pabrik ekstasi dan sabu ini ratusan juta rupiah, dan telah beroperasi tiga bulan,” jelas Nico. Diketahui sebelumnya, Sat Narkoba Polresta Medan me-

KPK Tepis ...

“Kita sangat berharap supaya Waspada dapat meningkatkan peranan pers dalam pembangunan yang berdasarkan Pancasila. Pers yang sehat adalah pers yang bebas dan bertanggungjawab yaitu menjalankan fungsinya menyebarkan informasi yang objektif dan edukatif. Menyalurkan aspirasi rakyat dan memperluas komunikasi,” ujarnya. Menurut Eldin,dalam hal ini perlu dikembangkan interaksi positif antara pers, pemerintah dan masyarakat. “Untuk itu selamat kepada Harian Waspada telah mampu memainkan peranannya dengan baik, dan tentunya kita berharap Waspada menjadi motor penggerak jurnalisme pembangunan di Kota Medan. Kemitraan ini tentunya dapat mendukung pembangunan sepenuhnya. Karena media massa dalam hal ini Waspada dapat menjadi jembatan antara pemerintahan, stakeholder, dan masyarakat. Dengan sinergitas yang baik, saya yakin kita mampu mewujudkan Kota Medan yang berdaya saing, nyaman, peduli dan sejahtera yang berujung pada kesejahteraan masyarakat secara menyeluruh dan merata,” katanya. Mantan Sekda ini sekali lagi mengucapkan selamat Hari UlangTahun (HUT) ke-67 Harian Waspada. Semoga menjadi lebih eksis di hati pembaca. Semoga dapat terus meningkatkan kualitas melalui berita-berita pembangunan serta membawa aspirasi masyarakat Kota Medan sesuai denganmottonya“Demikebenaran dan keadilan”. “Saya yakin kalau Waspada akan tetap menjadi motor pembangunan kota ini. Waspada bukan saja hanya

untuk bacaan,melainkan sebagai pengantarilmubagimasyarakat,” katanya. Eldin mengatakan, memasuki usia ke 67, Waspada semakin eksis, sebagai jendela informasi masyarakat dan pemerintah. Waspada diharapkan dapat memberi kontribusi dalam membangun sikap kritis serta turut menjaga dan menciptakan kedamaian dan keharmonisan di Sumut. “Kita mengakui sejarah panjang perjalanan Waspada terpaut erat dengan sejarah bangsa. Pemberitaan yang disajikan Waspada sejak berdiri hingga kini merupakan catatan sejarah yang sangat berharga bagi bangsa dan negara. Membaca Waspada dari hari ke hari, hingga detik ini, saya berkesimpulan bahwa sejarah juga telah terselamatkan sebab setiap pemberitaan yang tersaji dalam penerbitan Waspada selalu memuat peristiwa besar dalam sejarah bangsa, termasuk perjalanan Kota Medan,” ujarnya. Untuk itu, Eldin memberikan apresiasi kepada para penerus perjuanganWaspada hingga saat ini, yang dengan semangat, motivasi, dan dedikasi yang tinggi tetap komit menjaga eksistensi dan garis perjuangan Waspada hingga hari ini. “Semoga jajaran direksi Harian Waspada tetap komit menjadikannya sebagai roda pembangunan kota yang kita cintai ini. Waspada harus ikut mendorong langkah-langkah pemerintah dalam membangun perkembangan kota ini. Saya juga tidak lupa mendoakan para pemimpin HarianWaspada supaya tetap sehat dalam memimpin media yang kita cintai ini,” demikian Eldin. (m50)

Banjir Landa ... Selain itu, banjir sekitar 30 cm juga menggenangi Jalan Karang Tengah, Lebak Bulus, Jakarta Selatan dan bantaran Kali Ciliwung, Kampung Pulo, Jakarta Timur. Tinggi Air Sungai Terus Naik Hingga Minggu pukul 20:10 WIB tinggi muka air sungai di Jakarta terus bergerak naik, ungkap Pusat Data Informasi dan Humas Badan Nasional Penanggulangan Bencana (BNPB). “Pantauan Pusat Pengendalian dan Operasi atau Pusdalops BPBD DKI Jakarta, debit Sungai Ciliwung di Depok dan Manggarai posisi siaga II. Begitu pula di Karet juga siaga II,” kata Kepala Pusat Data Informasi dan Humas Badan Nasional Penanggulangan Bencana (BNPB) Sutopo Purwo Nugroho.

Hari Ini Pemrotes Duduki ... Aksi itu mereka lakukan dalam apa yang dianggapnya sebagai satu usaha untuk melumpuhkan Bangkok. Ada kekhawatiran bahwa kerusuhan kemungkinan terjadi yang memicu satu kudeta militer. Para pemrotes berusaha memaksa PM sementara Yingluck Shinawatra untuk mengundurkan diri dan pemerintahannya digantikan oleh satu pemerintahan sementara nonpemilihan guna melaksanakan pembaruan yang mereka katakan diperlukan untuk menghentikan korupsi dan politik uang. Mereka ingin menjegal pemilihan umum dini yang diserukan Yingluck pada 2 Februari. (m10)

Konvensi Capres .... (Ketua DPD RI), Marzuki Alie (Ketua DPR RI), Pramono Edhie Wibowo (mantan KSAD), EndriartonoSutarto(mantanPanglima TNI), Gita Wirawan (Menteri Perindustrian dan Perdagangan), Haryono Isman (mantan Menpora), dan Sinyo H Sarundajang (Gubernur Sulawesi Barat). Dijelaskan Hinca, kesebelas peserta konvensi ini telah melakukanbeberapatahapanproses penjaringan, di mana pada 15 September – 31 Desember 2013 melakukan sosialisasi ke tengah masyarakat. Kemudian 6-9 Januari 2014 melakukan jumpa media (pemimpin redaksi) guna memaparkan hasil ‘blusukan’ (sosisialisasi) mereka, terutama menyangkut permasalahan di tengah masyarakat. Selanjutnya pada 21 Januari – 2 April 2014, kesebelas peserta konvensi itu akan melakukan debat terbuka, yang kami namakan dengan ‘debat bernegara’, yang akan dilangsungkan di 12 kota di Indonesia. Dan untuk pertama kali (21 Januari), debat ini dilaksanakan di Medan, dan Palembang, secara bersamaan. “Jadi,hariinikeberadaankami diMedanadalahuntukpersiapan komitekonvensimenyelenggarakan debat tersebut. Makanya hari ini kami bersama-sama Ketua

DPD Partai Demokrat Sumut, rapat kordinasi untuk acara debat tersebut,” tegas Hinca yang juga Ketua Divisi Komunikasi Publik DPP Partai Demokrat. Debat ini, lanjut Hinca, sebagai salah satu upaya Partai Demokrat demokratisasi yang baik, untuk melahirkan pemimpin bangsa, dengan memberikan kesempatan kepada anak bangsa ikut konvensi.“Sehingga diharapkan dapat menaikkan elektabilitas capres dan Partai Demokrat. Kami ingin melebihi target yang diperoleh Demokrat pada pemilu sebelumnya,” tegasnya. Yangmenarik,ungkapHinca, materi debat adalah tema-tema yangmenonjoldidaerahbersangkutan, seperti krisis energi dan tanah. “Jadi prinsipnya adalah kalau di Sumut adalah persoalan ekonomi Indonesia yang terjadi di Sumut. Debat ini juga akan dihadiri seluruh gubernur dan kepala daerah di Sumut, serta kalangan akademi dan tokoh masyarakat di Sumut,” ujarnya. Panitia sengaja memilih Istana Maimon sebagai tempat dilangsungkannya‘debat bernegara’ tersebut, dengan harapan agar kearifan dan kebijaksanaan Sultan Deli dapat ‘menular’ kepada peserta konvensi. “Sehingga Capres yang lahir dari konvensi ini memiliki jiwa

WASPADA Senin 13 Januari 2014

“Waspada” Sumber Ide ... masyarakat pembaca melalui pemberitaannya. Bahkan, katanya, Waspada berperan memberikan pemahaman, pengetahuan dan wawasan kepada masyarakat. Selain itu, sebut Erry, Waspada tetap eksis menjalankan fungsi menghibur masyarakat pembaca dengan rubrik cerita pendek, cerita bersambung, pojok ataupun karikatur yang mengandung makna khusus atas keadaan terkini. ‘’ Bahkan untuk mengantisipasi kejenuhan akibat berita berat (hard news), Harian Waspada menyediakan halaman pendidikan khusus bagi anak-anak pada edisi terbitan Minggu seperti belajar menggambar, ayo mewarnai dan lainnya,’’ kata Erry dan menambahkan, Waspada cukup berperan memajukan dunia olahraga denganhalamankhususolahraga dan memberitakan perkembangan olahraga di tanah air. “Harian Waspada menurut saya merupakan media untuk segala golongan masyarakat tanpa membedakan status sosial, pendidikan dan usia, termasuk bagi anak-anak. Saya yakin, konsep penerbitan seperti ini akan tetap bertahan di tengahtengah menjamurnya media online saat ini,” kata Erry Nuradi. Menurut Erry Nuradi, Waspada tergolong media yang tegas dalam menjalankan fungsinya sebagai media sosial kontrol. Namun, hal yang membanggakan, Waspada tetap santun dalam menyampaikan kritik, baik kepada Pemerintah Provinsi Sumut maupun kepada Pemerintah Kabupaten/Kota. ‘’ Dalam menjalankan sosial kontrol, Waspada tetap mengedepankan makna demokrasi dengan mengedepankan unsur keikutsertaan masyarakat dalam pemerintahan (social participation), pertanggungjawaban pemerintah terhadap rakyat (social responsibility), dukungan rakyat terhadap pemerintah (social support), dan kontrol masyarakat terhadap tindakantindakan atau kinerja pemerintah (social control), ‘’ kata Erry. Erry menilai Waspada sukses sebagai lembaga ekonomi yang dapat memanfaatkan keadaan di sekitarnya sebagai nilai jual sehingga pers sebagai lembaga sosial dapat memperoleh keuntungan maksimal dari hasil produksinya untuk tetap terbit. “Saya yakin, pendiri Harian Waspada, Bapak H Mohd Said (almarhum) dan Ibu Hj Ani Idrus(almarhumah) jauh hari telah menanamkan semangat luar biasa kepada penerusnya hingga Waspada tetap berkembang di segala musim mengikuti

perkembangan zaman dan teknologi informasi hingga saat ini,” jelas Erry Nuradi. Secara gamblang Erry menegaskan, peran yang tidak kalah penting dan layak mendapat apresiasi adalah Waspada mampu menciptakan suasana aman dan kondusif di Provinsi Sumut lewat pemberitaannya yang menyejukkan. “Waspada bukan tergolong media yang suka mengadu domba demi tujuan tertentu, tidak menimbulkan pertentangan dan menyinggung unsur SARA hingga mengakibatkan konflik antarsuku dan agama, atau golongan satu dengan golongan lain. Peran ini sangat mendukung dalam upaya pembangunan di Sumatera Utara,” ujar Erry Nuradi. Menurutnya, sejak berdiri dan terbit 11 Januari 1947 hingga saat ini, Waspada terus berkiprah memberikan dukungan kepada Pemerintah Provinsi Sumut dalam menjalankan roda pembangunan dan pemerintahan, meski tidak jarang dukungan tersebut dituangkan dalam bentuk kritik yang tajam dan pedas. ‘’ Semua itu bertujuan mengingatkan pemegang kebijakan dalam menjalankan tugas pokok dan fungsinya (tupoksi) sebagai aparatur sipil negara (ASN) dan abdi negara,’’ katanya. Secara pribadi, Erry berterimakasih mendapat kritikan disertai solusi karena kritik yang disalurkan melalui Waspada mengingatkan dia akan tupoksi sebagai Wagubsu. ‘’ Keberhasilan Sumatera Utara menjadi provinsi yang sejahtera dan berdaya saing adalah tanggungjawab kita bersama,” imbuh Erry Nuradi. Di penghujung perbincangan, Erry Nuradi berharap Waspada tetap menjalankan fungsi dan perannya sebagai media massa yang lebih mengutamakan kepentingan masyarakat luas dan tetap eksis dalam mendukung pembangunan provinsi ini dan terus menggali informasi yang mengandung ide dan gagasan dari seluruh lapisan masyarakat, terkait dengan program pembangunan di Sumut. “Saya ingin berbagi rahasia, bahwa media massa adalah sumber ide dan gagasan bagi saya dalam menjalankan roda pemerintahan saat menjabat bupati dua priode di Kabupaten Serdang Bedagai. Jadi wajar saja jika media massa yangkayamemuatidedan gagasan cerdas, mendapat tempat di hati saya dan beritanya menjadi menu sarapan pagi saya, seperti Waspada,” demikian Erry Nuradi.(m46)

kepemimpinan Sultan Deli,” kata Caleg DPR RI 2014-2019 Partai Demokrat Nomor Urut 2 Dapil Sumut III (Tanjungbalai, Asahan, Batubara, P. Siantar, Simalungun, Karo, Dairi, Pakpak Bharat, Langkat dan Binjai). Hasil Survei Ia mengungkapkan, untuk tahapan konvensi selanjutnya atau untuk menetapkan satu dari 11pesertakonvensiyangnantinya diusung sebagai Capres Partai Demokrat, akan dilakukan survei oleh3lembagasurveiindependen dan profesional. “Partai dan Pak SBY sama sekali tak punya kekuasaan menentukan satu dari 11 peserta konvensi capres tersebut,” tandasnya. Survei itu, imbuh Hinca, akan dilaksanakan dua kali. Dimana pada pertengahan Januari ini akan diumumkan hasil survey pertama, yang hanya untuk menyusun peringkat, sehingga jadi masukan bagi peserta konvensi untuk berupaya mendongkrak elektabilitasnya, sebelum dilakukan penetapan caprespadaMei2014mendatang. “Hasil survey pertama tentunya bisa menjadi acuan bagi peserta konvensi,” katanya. Anggota Komite Konvensi lainnya, Putu Suasna, menambahkan, untuk menjaga kredibilitas hasil survey tersebut,

pihaknya melibatkan tiga ahli yang akan mengawasi dan mengauditketigalembagasurvey itu,yakniProf.ThamrinTamagola, Dr. Almuktabar, dan Dr. Andrinof Chaniago. “Jadi konvensi ini sebuah peradaban demokrasi yang baik, sehingga potensi yang ada kita konsolidasikan, baik dari pusat hingga ke bawah,” tegasnya. Sementara itu, Ketua DPD Partai Demokrat Sumut, Ht. Milwan,menegaskan-selakutuanrumah, pihaknya siap mendukung dan mensukseskan acara ‘debat bernegara’ tersebut. “Dan ini jelas sebuah kehormatan dan kebanggaan bagi pengurus DPD Demokrat Sumut dan seluruh kader, dengan dipilihnya Medan sebagai salah satu tempat acara debat tersebut,” ujar Milwan yang juga caleg DPRD Sumut 20142019 Partai Demokrat Nomor Urut 1 Dapil SumutVI (Labuhanbatu, Labuhanbatu Utara dan Labuhanbatu Selatan). Ia mengimbau kepada masyarakat agar dapat menghadiri debat ini, sehingga kita tahu untuk menggunakan hak suara kita pada Pemilu Presiden 2014. “Dan bagi segenap pengurus dan kader Partai Demokrat di Sumut, tentunya sebuah kewajiban untuk menghadiri acara terebut,” katanya. (m30)

Medan Metropolitan

WASPADA Senin 13 Januari 2014


Kejahatan Modus Baru

Ngaku Polisi Gerebek Rumah Warga MEDAN (Waspada): Kejahatan dengan modus baru terjadi di Kota Medan. Dua pria mengaku polisi dari Polresta Medan menggerebek rumah di Jln. Teratai Raya Perumnas Helvetia, Kec. Medan Helvetia, Minggu (12/1) dinihari.

Gaet Investor, Kadin Harus Tingkatkan Kerjasama Dengan Konsul MEDAN (Waspada) : Untuk meningkatkan investasi, pengurus Kadin Medan diminta harus meningkatkan kerjasama dengan sejumlah Konsul negara sahabat. “Kepercayaan itu sangat penting, selama ini hubungan kerjasama dengan jajaran Konsul negara asing yang ada di Medan cukup baik,” kata Ir Ru d i Zu l h a m Ha s i b u a n , menjawab wartawan di Medan, Sabtu (11/1). Rudi menjelaskan hal itu dalam kaitan Musyawarah Kota (Mukota) IV Kamar Dagang dan Industri (Kadin) Medan yang akan dilaksanakan pada Rabu 15 Januari 2014 di Hotel Polonia Medan. “Kepercayaan investor terhadap kalangan dunia usaha di kota Medan cukup baik dan siapapun Ketua Kadin Kota Medan ke depan harus siap menjemput bola,” ujar Rudi Zulham, yang disebut-sebut kalangan unsur panitia, salah seorang kandidat Ketua Kadin Medan pada Mukota IV. Hadir pada kesempatan rapat unsur panitia pelaksana antara lain Putrama Alkhairi, Ir

Rudi Zulham Hasibuan, Sulaji, Drs Imam Herianto, H Erwin Yoesran, Hasbi Jalil, Mhd Tahir Siregar, M Nasir Wahab dan sejumlah panitia lainnya. Panitia meyakini Mukota IV Kadin Medan akan lebih ramai, pelaku ekonomi dari BUMN, BUMD dan koperasi diundang pada acara tersebut. Kata dia, Kadin mitra kerja pemerintah dan dilindungi undang-undang, harus meningkat peran untuk memberdayakan dunia usaha, sejalan dengan tema “Memperkuat peran dunia usaha yang berdaya saing untuk kemajuan Kota Medan.” Sementara itu, Sulaji, salah seorang panitia menyebutkan, semua persiapan sudah mantap termasuk akomodasi, konsumsi, dan undangan kalangan pejabat maupun dunia usaha. Menjawab kandidat Ketua Kadin Medan ke depan, Ketua panitia pelaksana Imam Herianto menegaskan, belum membicarakan calon ketua. Seperti pembicaraan sebelumnya sudah muncul beberapa kandidat diyakini mampu memajukan dunia usaha kedepan. (m32)

Jamaah Ihya Ulumiddin Tolak Dikatakan Sesat MEDAN (Waspada): Jamaah pondok pengajian Ihya Ulumiddin di Jln. Karya Bakti, Medan Johor, menyesalkan aksi demonstrasi dilakukan tiga organisasi Islam pada Jumat (10/1). Para jamaah berasal dari seluruh daerah di Indonesia dan Asia itu menegaskan, bahwa pondok pengajian pimpinan DR Syekh Achmad Arifin tidak pernah mengajarkan kesesatan. Khalifah Syamsuddin didampingi Khalifah Rudi dan Ustad Syaifuddin serta jamaah lainnya kepada wartawan, Minggu (12/1) mengatakan, fatwa MUI Sumut nomor 03/KF/ MUI-SU/IX/2013 menyatakan pengajian sesat tidak sesuai kriteria penerbitan fatwa yang dituangkan dalam AD/ART MUI. “Fatwa MUI keluar hanya karena keterangan sepihak, yakni mantan murid di pondok pengajian. Saudara-saudara kami tergabung dalam Forum Umat Islam (FUI), Lembaga Umat Islam (LUI) dan Mujahiddin terpancing sehingga melakuan aksi. Padahal 27 Desember 2013 kami sudah duduk bersama dengan ketua FUI, dan menjelaskan perihal itu,” kata dia. Mereka mengatakan, siap

diproses sesuai hukum jika bersalah, dan berharap kepada masyarakat tidak terpancing isu tidak jelas. “Pondok pengajian sudah ada sejak lama, bahkan sejak Indonesia belum merdeka,” kata Khalifah Syamsuddin. Dia menyebutkan, jika mantan murid pondok pengajian itu menyatakan guru besar mereka berbuat zinah, itu tidak benar. “Wanita-wanita yang disebut menjadi korban zinah telah membantah dan melaporkan yang bersangkutan ke pihak berwajib atas pencemaran nama baik sesuai dengan nomor laporan polisi STTLP/1772/K/ VII/2013 Resta Medan,” ujarnya. Seorang jamaah Rico SH Purba, menyayangkan kejadian itu. Rico yang telah mualaf dan mengenal agama Islam di pondok pengajian itu menepis kabar beredar jika di pondok pengajian itu ada kuburan massal dan tertutup untuk masyarakat umum. “Saya mualaf dan memeluk agama Islam disini, bukan setahun atau dua tahun tetapi sudah lebih lima tahun, tidak ada yang namanya ajaran sesat, kuburan massal dan tertutup. Boleh dilihat,” tuturnya. (m27)

Dari rumah tersebut, kedua pelaku mengambil sepedamotor RX King BK 6748 HR, uang tunai Rp1,3 juta, dan sejumlah KTP. Pemilik rumah Siti Aisah Nasution, 48, kepada wartawan mengatakan, setelah mengambil sepedamotor, uang, dan KTP, dirinya disarankan kedua pelaku untuk menjemput barang bukti itu di Polresta Medan. Tapi setelah ke Polresta Medan, sepedamotor tidak ditemukannya begitu juga dengan kedua pelaku yang ngaku polisi itu. “Sudah saya lihat tidak ada sepedamotor, begitu juga dengan polisi itu,” ujar Siti Aisah saat dijumpai di Polresta Medan, Minggu (12/1) sore. Kata dia, penggerebekan itu dilakukan karena adanya informasi di rumah korban ada permainan judi kartu joker. Tapi

setelah digerebek, justru di dalam rumah tersebut tidak ada ditemukan aktifitas perjudian seperti informasi itu. Karena tidak menemukan permainan judi, kedua pelaku ngaku polisi yang datang dengan mobil sedan berwarna biru itu menyita barang bukti. Seluruh penghuni rumah berjumlah 11 orang yang sedang tertidur dibangunkan dan menyita KTP masing-masing. “Mereka masuk mendobrak pintu depan dan menunjukkan kartu tanda anggota polisi dari Polresta Medan, langsung memeriksa isi rumah. Mereka bilang ada bong, padahal kami tidak ada pemakai sabu, boleh periksa urine. Mereka minta uang damai Rp10 juta tapi uang saya tidak ada, disitulah dia mengambil barang-barang itu,” kata korban yang bekerja seba-

gai penarik betor itu. Siti menjelaskan, dirinya sangat mengingat betul ciri-ciri kedua pelaku yang ngaku polisi itu. “Satu pendek, satu lagi tinggi wajahnya bendol-bendol, saya tanda sama mereka,” sebutnya. Kapolresta Medan Kombes Pol Nico Afinta Karokaro SIK, SH, MH, yang dikonfirmasi mengatakan, korban sebaiknya membuat laporan resmi atas kejadian ini. Sedangkan kebenaran tentang perjudian itu akan tetap diproses. “Korban harus membuat laporan, kalau tentang judinya bila terbukti akan tetap diproses,” katanya. Kapolresta menyarankan kepada masyarakat harus lebih waspada dengan peristiwa seperti ini. Pasalnya, banyak orang yang tidak bertanggungjawab memanfaatkan situasi dengan mengaku sebagai polisi. (m39)


KETUA Yayasan Politeknik Unggul LP3M Medan H Muhammad Nasir Mahmud SE, MBA, MSi, para staf dan mahasiswa foto bersama usai melakukan kegiatan wisata rohani (wisroh) di Ponpes Al Munjiri.

Pulmed Ciptakan Generasi Unggul MEDAN (Waspada): Mahasiswa Politeknik Unggul LP3M Medan (Pulmed) mengisi hari libur panjang mengadakan wisata rohani (wisroh) melakukani’tikafsebagaibentukpelatihanimplementasi ESQ agama Islam bagi para mahasiswa dan staf Pulmed, di Ponpes Al Munjiri, baru-baru ini. Banyak pelajaran yang bisa diambil para peserta dari kegiatan ini, di antaranya memahami dan mempraktikkan adab keseharian Rasullah SAW dan meningkatkan spirit rohani dan ketaqwaan menumbuhkan jiwa sosial di tengahtengah masyarakat. Ketua Yayasan Politeknik Unggul LP3M Medan H Muhammad Nasir Mahmud SE, MBA,

MSi, yang ikut serta dalam training tersebut menjelaskan, kegiatan ini adalah wujud nyata dari Tri Darma Perguruan Tinggi yaitu pengabdian masyarakat, yang menjadikan mahasiswa yang beriman, berahlak, dan beramal sholeh. Kegiatan tersebut juga dihadiri Direktur Pulmed, para pembantu direktur dan staf, serta didukung oleh pemuka masyarakat serta ulama setempat. Didalam kegiatan ini mahasiswa diajak untuk saling memupuk nilai kebersamaan serta persaudaraan dan memperbaiki diri untuk menjadi insan yang tidak hanya unggul dari IPTEK (Ilmu pengetahuan dan teknologi) tetapi juga IMTAQ (Iman dan taqwa). (cwan)


Medan Metropolitan

WASPADA Senin 13 Januari 2014

Waspada/David Swayana

ALIRAN lahar dari puncak Gunung Sinabung semakin meluas memasuki kawasan Desa Bekerah, Sabtu (11/1).

Waspada/David Swayana

ALIRAN lahar dari puncak Gunung Sinabung semakin meluas memasuki kawasan Desa Suka Meriah, Sabtu (11/1).

Catatan Perjalanan Tim Waspada

Dihadang Lahar Dingin Di Lereng Sinabung TANAH KARO (Waspada): Sejak Kamis (9/1) pagi, puncak Gunung Sinabung tertutup kabut tebal. Erupsi dan semburan awan panas tidak bisa dilihat dengan jelas. Apalagi saat itu hujan mengguyur wilayah Kabupaten Karo termasuk kawasan Gunung Sinabung. TimWaspada yang turun ke lapangan, mengalami kesulitan untuk mengabadikan erupsi gunung berapi aktif tersebut dari jarak aman yang telah ditetapkan Kantor Pusat Vulkanologi Mitigasi Bencana dan Geologi. Alhasil, tim Waspada nekad bergerak maju. Awalnya tim

Waspada singgah di Desa Perteguhan, Kecamatan Simpang Empat. Dari desa itu terlihat lereng Gunung Sinabung dan aliran lahar dinginnya. Namun belum terlihat puncak gunung tersebut. Kemudian tim Waspada bergerak maju ke Desa Berastepu, Kecamatan Simpang Empat. Lagi-lagi, puncak Gunung Sinabung tidak terlihat jelas karena tertutup kabut. Hanya areal pertanian yang diselimuti debu vulkanik terlihat jelas. Lalu, tim Waspada kembali bergerak dengan menempuh waktu perjalanan hampir setengah jam dan tiba di Desa Sukanalu, Kecamatan Naman-

teran. Dari desa ini, terlihat jelas lereng Gunung Sinabung sudah semakin dekat. Sayangnya, puncak gunung masih belum terlihat jelas. Sementara, sebagian besar penduduk di Desa Sukanalu sudah tidak menghuni rumahnya lagi. Mereka menempati lokasi pengungsian di Kabanjahe sejak dua bulan lalu. Saat berhenti sejenak di desa ini, tim Waspada berpapasan dengan seorang pengendara sepedamotor yang mengaku bermarga Sembiring. Tim Waspada mencoba menanyakan lokasi Gunung Sinabung dan tempat yang aman

untuk melihat erupsi. Di luar dugaan, ternyata Sembiring meminta tim Waspada agar berbalik arah. Sebab, Desa Sukanalu sudah termasuk kawasan yang tidak aman dan berada dalam radius 3 km di kaki Gunung Sinabung. “Ula nari kena kujadah, bahaya kari. Aliran lahar enggo nutupi dalan si tembus ku Desa Sukameriah. (Artinya, jangan lagi kalian kesitu, nanti bahaya kalian. Aliran lahar Sinabung sudah menutupi jalan yang menghubungkan desa ini dengan Desa Sukameriah,” kata Sembiring. Namun tim Waspada memilih tetap melanjutkan perja-

lanan hingga ke desa berikutnya. Dan tibalah di Desa Bekerah yang sudah tidak berpenghuni. Suasana terasa sangat mencekam karena desa tersebut sudah diselimuti debu vulkanik yang cukup tebal. Setelah bergerak maju melewati desa itu, tim Waspada mendapati hamparan tanaman pertanian milik warga yang telah layu dan gosong. Diduga tanaman ini rusak akibat awan panas yang meluncur dari puncak Gunung Sinabung. Meski sudah beberapa ratus meter meninggalkan Desa Bekerah, namun tidak ada satu orang pun warga yang berpapasan dengan tim Waspada.

Setelah melewati tanjakan dan tikungan, tiba-tiba timWaspada dikejutkan dengan luncuran lahar dingin disertai material vulkanik dan batang pepohonan dari arah Gunung Sinabung. Lahar dingin setebal satu meter itu menutupi badan jalan. Spontan salah seorang anggota tim Waspada berteriak. “Berhenti!! Kita sudah memasuki jalur lintasan lahar dan awan panas. Segera ambil foto secepatnya, lalu kita balik.” Baru berkisar satu menit mengambil foto luncuran lahar dingin, tiba-tiba terdengar dentuman menggelegar dan sangat keras dari arah puncak Gunung Sinabung.

Karena khawatir ada luncuran awan panas dan lava pijar, tim Waspada berlari ke arah mobil. Sialnya, tidak ada tanah kosong untuk memutar arah. Akibatnya, mobil dipacu mundur dengan kecepatan tinggi hingga memasuki Desa Bekerah. Selanjutnya, tim Waspada menyambangi Kantor Pusat Vulkanologi Mitigasi Bencana dan Geologi di Jln. Kiras Bangun, Desa Ndokum Siroga, Kecamatan Simpang Empat, Kab. Karo. Dari instansi ini, diperoleh informasi bahwa Desa Bekerah sudah masuk dalam zona berbahaya. Sebab, kawasan itu sangat berpotensi dilanda awan panas, lontaran batu, guguran lava

pijar, gas beracun dan hujan debu yang sangat tebal. Lokasi tersebut masuk dalam kawasan lereng Gunung Sinabung. Sebelumnya, Kepala Kantor PusatVulkanologi Mitigasi Bencana dan Geologi Armen Putra mengatakan, jarak aman bagi masyarakat umum untuk menyaksikan erupsi Gunung Sinabung yakni dalam radius di atas 5 kilometer. “Beginilah jadinya gara-gara ingin melihat puncak Sinabung di tengah kabut. Puncaknya tidak terlihat, malah mobil kita dihadang lahar dingin,” ujar anggota tim Waspada lainnya dengan nada cemas. (m50/m25/c10)

Dua Pencuri Sepedamotor Diringkus MEDAN (Waspada): Dua pencuri sepedamotor diringkus petugas Reskrim Polsek Medan Area, Minggu (12/1). Kedua tersangka HS, 18, warga Jln. MentengVII Gang Ria, Kel. Menteng, Kec. Medan Denai, dan PJ, 16, warga Jln. Pasar Merah Gang Benteng, Kel. Binjai, Medan Denai, melakukan pencurian sepedamotor di Jln. Menteng Raya, Kec. Medan Denai, Sabtu (11/1) siang. Sedangkan pemilik sepedamotor M Andre Lubis ,18, warga Jln. AR Hakim Gang Kolam Ujung, Kel. Tegal Sari II, Kec. Medan Area, membuat laporan pengaduan ke Polsek Medan Area. Informasi yang diperoleh di kepolisian, kedua tersangka mencuri sepedamotor tersebut dari lokasi parkiran di Jln. Menteng Raya, tepatnya di dekat

jembatan Sungai Denai. Sebelumnya, tersangka PJ yang merupakan teman sekolah korban meminjam sepedamotor korban di sekolah dengan alasan untuk membeli jajanan. Namun, tersangka PJ diamdiam menduplikat kunci sepedamotor itu, setelah itu mengembalikan kendaraan korban berikut kunci kontaknya. Keesokan harinya, PJ mengajak korban utuk bertemu di jembatan Sungai Denai. Ketika berada di lokasi tempat mereka bertemu, PJ megajak korban ke suatu tempat yang berjarak 10 meter untuk membeli rokok dengan rmaksud agar Andre menjauh dari sepedamotornya. Sementara tersangka HS yang saat itu di lokasi dengan memegang kunci duplikat, langsung mencuri sepedamotor

korban. Tersangka PJ melihat temannya berhasil mencuri sepedamotor korban langsung permisi meninggalkan korban. Tak jauh dari lokasi, ternyata korban melihat sepedamotornya dibawa HS dan diboncengan PJ. Korban kemudian pulang ke rumah dan melaporkannya ke orangtuanya. Keesokan harinya, salah seorang keluarga korban yang bertugas di kepolisian melakukan pencarian terhadap kedua tersangka. Kedua tersangka ditangkap dari rumahnya masing-masing. Setelah itu, diboyong ke Polsek Medan Area untuk proses lebih lanjut. Sedangkan sepedamotor korban telah dijual kedua tersangka kepada berinisial Co di Tembung. Terpisah, Kapolsek Medan

Area Kompol Rama S Putra ketika dikonfirmasi membenarkan adanya dua tersangka curanmor yang diamankan. “Dari hasil pemeriksaan, kedua tersangka mengaku tidak bekerja berdua. Saat ini kita masih melakukan pengembangan, untuk mengejar 3 tersangka lagi, yang identitasnya sudah kita kantongi, serta seorang penadah sepedamotor,” sebut Rama. Penumpang Betor Sementara itu, tas berisikan uang dan surat berharga milik penumpang becak bermotor (betor) Liny Zeinna Nasution alias Liny, 37, PNS, dirampok dua pelaku mengendarai sepedamotor di Jln. Gajah Mada Medan, Minggu (12/1) sore. Saksi mata kepada Waspada mengatakan, peristiwa itu terjadi pukul 15:30, saat korban Liny,

penduduk Jln. Umar, Kel. Glugur Darat I, Kec. Medan Timur, bersama ibu dan anaknya naik betor hendak menuju ke Jln. Dr Mansyur Medan. Ketika melintas di Jln. Gajah Mada,betoryangditumpangkorban mengalami kerusakan. Kemudian korban bersama ibu dan anaknya turun dari betor tersebut lalu memanggil betor lainnya. Namun, saat hendak naik betor lainnya, tas milik korban dirampok dua pelaku mengendarai sepedamotor. Akibat kejadian itu, korban mengalami kerugian tas warna coklat kotakkotak berisikan dompet warna hitam, uang Rp250.000, kartu ATM Bank BSM, BRI, BCA, SIM A dan C, KTP dan STNK sepedamotor BK 5254 XJ. Selanjutnya korban membuat pengaduan ke Polsek Medan Baru. (h04/m36)

Rektor USU Pada Dies Natalis FH Ke-60

BOPTN USU Rp10,5 M Harus Dikembalikan MEDAN (Waspada): Rektor USU Prof Syahril Pasaribu berharap dosen USU ramai-ramai meningkatkan penelitian, karena tahun 2013 penelitian yang dilakukan dosen USU diperkirakan tidak sampai 100. Sementara di ITB, penelitian dosennya sekitar 1.000 per tahun. “Saya sedih biaya operasional (BO-PTN) USU 2013 sekitar Rp10,5 miliar dikembalikan karena tidak terserap. Saya minta tolong ke semua fakultas agar semuanya terlibat dalam penelitian,” kata Prof Syahril Pasaribu dalam sambutannya pada peringatan Dies Natalis Fakultas Hukum (FH)USUke60,diruangPeradilan Semu FH USU, Sabtu (11/1). Peringatan Dies Natalis yang berlangsung sederhana didahului laporan Ketua panitia Dr OK Saidin SH, MHum, dan sambutan Dekan FH USU Prof Runtung Sitepu, Gubsu Gatot Pujo Nugroho diwakili Sekda Nurdin

Lubis SH, MM. Orasi ilmiah oleh Prof Dr Mariam Darus SH, dan pemberian penghargaan serta cenderahati kepada mantan dekan FH USU serta yang berjasa demi kemajuan FH USU. Dikatakan rektor, banyak kemajuan dicapai FH USU. Ke depan kita harus bisa membuat yang terbaik sehingga bisa dicontoh orang lain sebagai perguruan tinggi negeri badan hukum (PTN BH). “Akreditasi kita seharusnya A dan selain itu ada akreditasi secara internasional. Seperti IPB Bogor, saat saya menghadiri Dies Natalisnya mereka itu mempunyai akreditasi dari Jepang dan Amerika,” sebutnya. Rektor juga minta dosen yang masih S1 harus disekolahkan lagi, sehinga mahasiswa S1 dididik oleh S2. “Dirgahayu FH USU ke 60, semoga tambah sukses dan jaya serta semakin banyak penelitiannya,” tutur rektor.

Sementara Gubsu diwakili Nurdin Lubis mengharapkan, FH USU terus mampu menyumbangkan pemikiran serta alumni yang berkualitas demi kemajuan bangsa. Melalui tri dharma perguruan tinggi ikut berperan membantu tegaknya supremasi hukum di negara kita khususnya di Sumut. Peringatan ini menjadi momentum untuk evaluasi, demi menghadapi tantangan masa datang. Terutama untuk penegakan supremasi hukum karena hasil-hasil yang kita capai belum optimal. Alumni FH USU diharapkan mampu menyadarkan masyarakat dalam penegakan hukum karena sangat penting jadi pedoman kehidupan. Dekan FH USU Prof Runtung Sitepu mengatakan, FH USU merupakan fakultas nomor dua tertua di USU didirikan 12 Januari 1954. Dalam usianya yang ke 60 tahun telah mengala-

mi perkembangan yang cukup pesat berkat kerja keras dan kebersamaan pimpinan, civitas akademika, dan alumni. Jumlah mahasiswa saat ini tercatat 3.469 orang, dan yang menerima bea siswa 239 (9,95 persen) dengan total jumlah beasiswa yang diterima selama 2013 Rp1,1 miliar lebih. Kata Runtung, dalam berbagai kompetisi baik tingkat USU maupun di kancah nasional tim FH USU senantiasa diperhitungkan sebagai lawan tangguh oleh universitas lain. Banyak kejuaraan yang diraih mahasiswa FH USU. Jumlah alumni 11.292 dan jumlah dosen 119 orang, kiranya tahun 2014 ada tambahan dosen minimal 5 orang dalam upaya mencapai ratio dosen dan mahasiswa yang ideal. Dies Natalis yang dihadiri panitia antara lain Prof Budiman Ginting, M Husni, Dr Abdul Hakim Siagian SH, Dr Pendastaren

Tarigan, dan yang lainnya dirangkai dengan peresmian ruang koleksi buku-buku sumbangan Prof AP Parlindungan. Pada peringatan Dies itu diserahkan cenderamata kepada mantan Dekan FH USU Prof Mr T Dzulkarnain, Prof Ani Abbas Manoppo, Prof Mahadi, Hatunggal Siregar SH, Prof OK Madjloes, Prof Dr Bachtiar Agus Salim, Amru Daulay SH, Prof M Abduh, Prof Sanwani Nasution, OK Chairuddin, Prof Rehngena Purba, Prof Hasnil Basri. Sementara itu, Prof Dr Mariam Darus dalam orasi ilmiahnya dengan thema “Perkembangan prinsip itikad baik sebagai azas umum di dalam hukum Indonesia” mengatakan, lulusan FHUSUharusbersihdarigodaangodaanmateridanharusmampu merebut jadi pimpinan berbagai bidang. Dulu sampai tahun 80an,FHUSUterkenaldengantujuh pedang samurai. (m49)

Waspada/Amir Syarifuddin

PENGURUS Dharma Wanita Sumut foto bersama pengungsi Gunung Sinabung di halaman Masjid Istihrar, Kabanjahe.

Dharma Wanita Sumut Kunjungi Pengungsi Sinabung MEDAN (Waspada): DhamaWanita Provinsi Sumatera Utara mengunjungi pengungsi korban erupsi Gunung Sinabung, di Masjid Itihrar dan GBKP Kabanjahe, Jumat (10/1). Dewan Penasehat Dharma Wanita Sumut Sutias Handayani Gatot Pujo Nugroho memborong kerajinan karya pengungsi untuk memotivasi mereka. Ratusan pengungsi di Masjid Itihrar dan GBKP tampak sumringah, saat rombongan ibu-ibu Dharma Wanita tiba di lokasi pengungsian. Sutias yang didampingi Ketua DharmaWanita Provinsi Sumatera Utara Doharni Nurdin Lubis terus menyemangati para pengungsi agar tegar dan sabar menghadapi bencana.“Meski bencana belum ada tanda-tanda pasti kapan berakhir, tapi saya harap warga tetap semangat,” kata Sutias. Menurutnya, masyarakat Indonesia bisa mengambil contoh dan hikmah dari para warga korban bencana erupsi Sinabung. Meski kondisi sulit dan tinggal di pengungsian dalam waktu panjang, namun warga Tanah Karo tetap tegar menjalankan kegiatan sehari-hari, mulai berladang hingga menyekolahkan anak-anak mereka. Hikmah lain, pasca letusan Gunung Sinabung, menurut Sutias, bumiTanah Karo akan semakin subur karena abu dan material vulkanik sangat kaya zat-zat yang berguna bagi lahan pertanian. Sutias dan Doharni menambahkan, selama di pengungsian warga bisa menambah ilmu membuat kerajinan yang dilaksanakan para volunter. Seperti membuat kerajinan tikar plastik,

anyaman hingga berbagai aksesoris rumah tangga. “Dengan ketrampilan para ibu-ibu bisa menambah ilmu dan penghasilan bila ketrampilan diolah dan dimanfaat setelah pasca bencana,” sebutnya. Hal senada juga disampaikan Ketua Dharma Wanita Provsu Ny Doharni Nurdin Lubis. Dia mengatakan, kedatangan ibu-ibu DharmaWanita sebagai bentuk kepedulian dan dukungan kepada warga Tanah Karo agar tetap semangat. “Kami datang karena terpanggil akan korban erupsi Sinabung yang harus tinggal di pengungsian dengan kondisi segala keterbatasan, mulai dari tidur dan makan,” ujarnya. Pendeta Rosmalia boru Barus yang menerima rombangan Dharma Wanita di GBKP memberi aspriasi besar, karena kehadiran Dharma Wanita mampu memotivasi dan menghibur para korban erupsi Gunung Sinabung. “Saya mewakili pengungsi sangat senang dan kami tidak pernah membeda-bedakan unsur mana saja yang datang dan memberi bantuan,” sebutnya. Selain itu, bekal ilmu keterampilan sudah tentu akan bermanfaat untuk korban, mengingat kondisi lahan pertanian belum bisa digarap. Dengan hasil kerajinan ini warga bisa menopang biaya hidup selama kondisi belum normal. Pada kunjungan ini Sutias langsung memborong hasil kerajinan para pengungsi sebesar Rp10 juta. Sementara Dharma Wanita Sumut menyerahkan berbagai bantuan mulai dari peralatan mandi, paket keperluan wanita hingga makanan Balita. (m28)

Medan Metropolitan

WASPADA Senin 13 Januari 2014


Mahasiswa Penerima Beasiswa Prestasi Dompet Dhuafa Waspada MEDAN (Waspada): Panitia Seleksi Dompet Dhuafa mengumumkan 35 nama mahasiswa/i penerima Beasiswa Prestasi Angkatan XXII Tahun 2014 dari Dompet Dhuafa Waspada dan LAZ PT Bank Sumut, Sabtu (11/1). Dari USU: Sutan Tarmizi Lubis,Wisnu Tribowo, Lingga Rahmad, Ananda J Pranata, Shelly Maharani, dan Khairani Nasution. Unimed: Eva Susanti Br Ginting, Nanda Putri Hamid Damanik, Nurul Awaliyah, dan Apritivani Maduwu. IAIN Sumut: Sri Rahmadani, Putri Ayu Azra’i, Tri Agustini, Siti Rahmayati,Yeni Rahmadani Purba,Wina Asry, Lenny Marlina Rambe, Adilla Putri, Fadilatul Rahmah, Hafiz Yanuariza, dan M Syafri Sirait. UMN Al-Washliyah: Rukia Safitri Nasution. Dari Univa: Rita Junija dan Abdul Rahman. STT Harapan: Rama Prameswara Ritonga. UMSU: Cyntia HadiyantiTarigan,Yusniar, Dianto, dan Maulana Satrya Sinaga. STIK-P: Maya Safitri, Kartika Ayu, M May Fazri. Universitas Asahan: M Apriansyah Hasibuan. STAI TJ: M Yusuf. STIT AR: Wahyuniva. Sebelumnya, panitia seleksi mengadakan seleksi tahap II berupa wawancara langsung di Kantor Dompet Dhuafa Waspada Sumatera Utara Jln. Setia Budi No. 115 Medan yakni pada tanggal 4 Januari 2014 untuk gelombang 1 dan 10 Januari 2014 untuk gelombang II yang diikuti 104 orang mahasiswa dengan tiga orang tidak hadir, maka sesuai pemberitahuan sebelumnya dianggap mengundurkan diri. Bagi penerima beasiswa diharapkan hadir pada acara Silaturahmi Penyerahan Beasiswa Perdana di kantor Dompet DhuafaWaspada Sumut Jln. Setia Budi No. 115 Medan, pada Sabtu, 1 Februari 2014 pukul 13:30 WIB–selesai. (cwan)

Plt Bupati Madina Diminta Fasilitasi Penyelesaian Lahan KP USU MEDAN (Waspadfa): Komisi A DPRD Sumut berharap Pelaksana Tugas (Plt) Bupati Madina segera dapat memfasilitasi penyelesaian permasalahan pencabutan izin lokasi lahan perkebunan sawit Koperasi Pengembangan Universitas Sumatera Utara (KP USU) di Madina oleh pemkab setempat. “Kitamasihtetapmengusahakanpenyelesaianpersoalaninikepada Plt Bupati Madina Dahlan Hasan Nasution,” kata anggota Komisi A DPRD Sumut Ahmad Ikhyar Hasibuan di Medan, Jumat (10/1). Menurut Ikhyar, Komisi A yang membidangi pertanahan belum mengambil sikap mengenai permasalahan dicabutnya izin lokasi usaha perkebunan kelapa sawit Koperasi Pengembangan Universitas Sumatera Utara (KP USU) di Madina, oleh pemkab setempat. Ikhyar mengatakan, hingga saat ini yang telah dilakukan komisi adalah mengirimkan hasil rapat Komisi A dengan KP USU dan Badan Pertanahan Nasional (BPN) Sumut kepada Pelaksana Tugas (Plt) Bupati Madina agar permasalahan itu segera ditindaklanjuti. Lewat surat tersebut, kata dia, Komisi A mendesak agar Plt Bupati Madina segera memfasilitasi penyelesaian antara KP USU dengan Pemkab Madina yang mencabut izin lokasi KP USU. Menyinggung adanya pernyataan yang menyebutkan Komisi A DPRD Sumut sudah melakukan kunjungan ke lokasi, Ikhyar mengatakan, sampai hari ini Komisi A belum melakukan kunjungan kerja ke lokasi. “Tidak benar itu, kita belum pernah melakukan kunjungan lapangan,” sebutnya. Menurut dia, kunjungan kerja yang dijadwalkan beberapa waktu lalu itu dibatalkan karena bupati sedang berada di Jakarta. Ketika itu yang ada hanya Sekretaris Daerah Pemkab Madina, yang tentunya tidak bisa menjawab permasalahan. Sebagaimana diketahui, permasalahan antara KP USU dengan Pemkab Madina mencuat karena Bupati Madina non aktif Hidayat Batubara mencabut izin lokasi lahan perkebunan sawit KP USU di Madina seluas 10.000 hektar tanpa alasan yang jelas. Padahal, di lahan tersebut, KP USU sudah melakukan land clearing seluas 2.000 hektar dan telah melakukan penanaman seluas 800 hektar yang saat ini sudah berbuah pasir. Hanya KP USU Di lokasi terpisah, tokoh masyarakat Mandailing Natal (Madina) Muis Pulungan menegaskan, masyarakat Kec. Muara Batang Gadis hanya tahu kalau lahan tersebut milik KP USU. Selama ini masyarakat Madina telah lama mengetahui kehadiran KP USU dalam pengelolaan perkebunan sawit di Kecamatan Muara Batang Gadis. “Kami hanya tahu KP USU yang mengelolanya. Tidak ada yang lain,” tuturnya. (h02)

BkkbN Sumut Serahkan Bantuan Pada Pengungsi Sinabung MEDAN (Waspada): Badan Kependudukan dan Keluarga Berencana (BkkbN) Sumut kembali menyerahkan bantuan kepada pengungsi Gunung Sinabung di Desa Sempajaya, Kec. Berastagi, Kab. Karo, Jumat (10/1) sore. Bantuan berupa beras, ikan kaleng, vitamin, payung BkkbN, dan lainnya langsung diserahkan Sekretaris BkkbN Sumut Datang Sembiring bersama Ketua Komisi E DPRD Sumut Brilian Moktar. Datang Sembiring mengatakan, BkkbN Sumut sudah dua kali memberikan bantuan kepada para pengungsi sejak terjadinya erupsi 2013 lalu. “Pengungsi di Desa Sempajaya ini adalah penduduk Desa Naman, Kec. Namanteran, yang berada lima kilometer dari kaki gunung. Desa itu merupakan asal usul orangtua saya, jadi seluruh pengungsi disini adalah keluarga. Jadi saya merasa segan kalau ke kampung itu tidak memberikan sesuatu,” katanya. Untukitu,dirinyabersamaKasiAdvokasidanKomunikasiInformasi dan Edukasi (KIE) Anthony mengajak mitra BkkbN Sumut untuk membantuparapengungsi.“Kamiberusahamengumpulkanbantuan semampu kami. Ini adalah bantuan kedua,” ujarnya. Selain itu, kata dia, pihaknya juga tetap mensosialisasikan keluarga berencana melalui payung-payung yang menuliskan dua anak cukup. “Namanya BkkbN kemana pun kamu tidak boleh lupa mensosialisasikan program kami. Jangan karena sedang berduka, program berencananya lupa. Harapan kita dengan bantuan makanan dan payung BkkbN bisa mengingatkan kembali keluarga berencana untuk keluarga yang sejahtera,” sebutnya. Sementara itu, Komisi E DPRD Sumut dari Fraksi PDI-P Brilian Moktar mengapresiasi pemberian bantuan dari BkkbN Sumut ini. “Kami juga selalu diingatkan ketua dan Ketua Umum PDIP Ibu Megawati bahwa jangan ada pengungsi yang kelaparan, yang sakit tidak diobati, anak-anak yang tidak belajar,” tuturnya. Dia mengingatkan masyarakat Karo untuk tidak lupa berKB, karena negara kita sudah cukup berat mendanai masyarakat yang sudah cukup banyak. “Meskipun situasi begini harus tetap ingat ber KB, karena negara kita ini sudah cukup berat mendanai rakyat yang sudah hampir 240 juta jiwa,” katanya. Brilian meminta Pemda dan Pemerintah Pusat untuk mencari lahan 10 ribu hektar agar 5 ribu KK yang tinggalnya hanya 5 km dari Gunung Sinabung direlokasi di suatu tempat. “Saya yakin ada belasan triliun anggaran bencana alam pusat yang bisa kita gunakan untuk bangun 5 ribu rumah sederhana. Dan sisa lahan 8 ribu hektar lagi, dibagi satu keluarga satu hektar mereka kembali bertani. Jika tidak, mereka akan sedih ketika melihat tanaman mereka rusak. Itu sudah habis kan uang dan kesedihan yang tidak ada nilainya,” ujarnya. Sedangkan Kepala Desa Sempajaya Bantu Purba mengucapkan terimakasih kepada BkkbN Sumut yang memberi perhatian kepada para pengungsi. “Pengungsi disini ada sekitar 485 KK yang berasal dari Desa Naman Kecamatan Namanteran,” katanya. Hadir juga pengurus PDI-P Sumut saat memberikan bantuan. (h02)


SEKRETARIS BkkbN Sumut Datang Sembiring (dua kiri) bersama Ketua Komisi E DPRD Sumut Brilian Moktar (kiri) saat menyerahkan bantuan kepada pengungsi Gunung Sinabung di Desa Sempajaya, Kec. Berastagi, Kab. Karo.

Selama 2013, Sumut Ciptakan 187.966 Wirausaha Baru MEDAN (Waspada): Pertumbuhan wirausaha baru khusus sektor usaha mikro kecil menengah (UMKM) di Sumatera Utara sepanjang 2013 mencapai 6,53 persen. Di tengah tekanan ekonomi dunia dan regional yang cenderung lesu, di Sumatera Utara masih mampu memunculkan 187.966 pelaku UMKM yang mampu menyerap 274.812 tenaga kerja. Hal itu dikatakan Kepala Dinas Koperasi dan UKM Pemprov Sumatera Utara Drs Masri MSi, Minggu (12/01). “UMKM masih menjadi andalan dalam mengurangi angka pengangguran dan jumlah penduduk miskin serta menopang pertumbuhan ekonomi,” katanya.

Dijelaskannya, telah terjadi pertambahan jumlah wirausaha mikro kecil menengah di Sumatera Utara dari 2.877.765 pelaku usaha pada 2012, bertambah menjadi 3.065.731 usaha pada 2013 atau tumbuh 6,53%. Keberadaan UMKM tersebut telah berhasil menyerap 4.676.143 tenaga kerja pada tahun 2012 dan meningkat 5,88% pada 2013 menjadi 4.950.955 tenaga kerja. Kepada wartawan, Masri menjelaskan, sektor UMKM strategis bagi perekonomian baik nasional maupun daerah. Karena itu mendorong munculnya pelaku usaha baru menjadi salah satu program strategis pemerintah. Salah satu kendala yang dialami para pelaku usaha adalah minimnya permodalan khu-

susnya banyak pelaku UMKM yang tidak mampu mengakses permodalan perbankan. Karena itu, melalui kegiatan pendampingan, pihaknya terus mendorong UMKM agar mampu menjangkau permodalan perbankan. Pada 2013 UMKM di Sumatera Utara mampu menyerap dana perbankan sebesar Rp37,5 triliun. Selain pendampingan yang diselenggarakan, adanya peraturan Bank Indonesia (BI) yang mewajibkan bank menyalurkan kredit kepada UKM menjadi pendorong terjangkaunya permodalan perbankan. Salah satu upaya menambah wirausaha baru adalah dengan menubuhkan jiwa wirausaha dari kalangan mahasiswa. Pada 2013, sebanyak 52 pelaku usaha dari kalangan mahasiswa

mendapat bantuan dari Kementerian Koperasi dan UKM RI dengan dana sebesar Rp250. 000.000. “Dari 52 wirausaha baru ini diharapkan menjadi pelopor lahirnya wirausaha-wirausaha baru dari kalangan mahasiswa lainnya,” kata Masri. Hal ini, kata dia, sejalan dengan upaya dan kerjasama Dinas Koperasi dan UKM Provinsi Sumatera Utara dengan Universitas Sumatera Utara dan KopertisWilayah I Sumut–Aceh. Sementara itu, Masri memaparkan perkembangan koperasi sepanjang periode 2012– 2013 yang secara kelembagaan mengalami perkembangan yang cukup baik. Perkembangan jumlah koperasi di Sumut periode 2012–2013 mengalami peningkatan sebanyak 518 unit atau 4,61 persen. (m28)

Dugaan Korupsi Pembebasan Lahan

Mantan GM PLN Sumut Bisa Tersangka MEDAN (Waspada): Mantan General Manager (GM) PT PLN Persero I Wilayah Sumbagut Bintatar Hutabarat akan diperiksa kembali atas kasus dugaan korupsi pembebasan lahan di Kab. Toba Samosir untuk pembangunan base camp menuju proyek PLTA Asahan III. Sebelumnya, dia sudah diperiksa sebagai saksi. “Setelah pemeriksaan kemarin, yang bersangkutan akan diperiksa kembali. PenyidikTipikor Poldasu masih membutuhkan keterangannya, termasuk mencari alat bukti lain,” kata Direktur Dit Reskrimsus Poldasu Kombes Pol. Dono Indarto melalui Kanit III Tipikor Poldasu Kompol Ramlan kepadaWaspada, Minggu (12/1). Pemeriksaan terhadap mantan GM PT PLN itu terkait masalah pengelolaan anggaran proyek. “Yang punya anggaran itu PLN, mereka juga yang me-

ngelola dan saat itu yang bersangkutan menjabat GM, maka itu dia diperiksa,” sebutnya. Selain Bintatar Hutabarat, tiga pejabat PLN lainnya juga sudah diperiksa sebagai saksi, di antaranya bendahara. “Apakah nanti di antara mereka ada yang dijadikan sebagai tersangka, kita tunggu hasil penyelidikan,” ujar Ramlan menyebutkan korupsi tidak bisa dilakukan seorang diri. Kata dia, Bupati Tobasa Kasmin Simanjuntak sudah ditetapkan sebagai tersangka kasus itu setelah ditemukan aliran dana sebesar Rp3,5 miliar dari proyek tersebut yang masuk ke rekening pribadinya. Sementara nilai anggaran untuk pelepasan lahan sebesar Rp17,3 miliar.“Logikanya tidak mungkin bupati melakukan korupsi kalau tidak ada anggaran, sementara anggarannya dari PLN,” sebut Ramlan ditanya kemungkinan Binta-

Polisi Buron Empat Perampok MEDAN (Waspada): Empat tersangka perampokan yang menyebabkan tewasnya Ng Tje Sun, 49, di Jln. Kakap simpang Jln. Sampali, Kel. Pandau Hulu, Kec. Medan Area, masih terus diburon. Polisi telah memeriksa kamera CCTV milik warga di sekitar lokasi kejadian. Kapolresta Medan Kombes Nico Afinta, Minggu (12/1) mengatakan, peristiwa tersebut masih menjadi pekerjaan rumah bagi kepolisian untuk mengungkapnya. Dugaan sementara, kejadian sadis ini adalah perampokan murni. “Petugas masih melakukan penyelidikan sekaligus memburon pelakunya. Dugaan sementara, kasus ini perampokan murni karena sepedamotor korban hilang dibawa kabur para pelaku,” ujar Nico, di Mapolresta

Medan. Namun, kata dia, tidak tertutup kemungkinan ada motif lain dibalik peristiwa sadis ini. “Kita tunggulah sampai pelakunya tertangkap. Saat ini, tim kita masih melakukan penyelidikan untuk mengungkap kasus ini,” sebutnya. Dijelaskan Kapolresta, ada beberapa rekaman kamera CCTV milik warga setempat yang telah diperiksa dan semoga bisa menjadi petunjuk untuk mengungkap kasus tersebut. Sebagaimana diberitakan sebelumnya, korban Ng Tje Sun, 49, warga Jln. AH Hakim tewas ditikam perampok saat hendak mengantar putrinya ke sekolah, Sabtu (11/1) sekira pukul 07:00 ,di Jln. Kakap simpang Jln Sampali, Kel. Pandau Hulu, Medan Area.(h04)

tar Hutabarat dijadikan tersangka kasus itu. Menurut dia, penyidik masih memerlukan banyak keterangan saksi lain dan alat bukti. Ramlan mengatakan, Bupati Tobasa belum diperiksa untuk kasus yang melibatkan PLN. “Nanti setelah bupati diperiksa dan ada tambahan barang bukti akan diketahui apa status mantan GM PLN itu,” tuturnya. Tandatangani Cek Sementara itu, Bintatar Hutabarat di tempat terpisah membantah menerima uang hasilkorupsiproyekpembebasan lahan di Tobasa.“Satu perak pun sayatidakterima,”katadiakepada wartawan, Minggu (11/1). Dia mengakui pada 2010 PLN mengeluarkan anggaran sebesar Rp17,3 miliar untuk pembebasan 9 Ha lahan di Dusun Batumamak, Desa Meranti

Utara, Kec. Pintu Pohan, Tobasa yang akan digunakan sebagai akses ke proyek PLTA Asahan III. Tetapi sebelum anggaran itu turun, tim apresial telah mensurvei harga tanah dan menetapkan Rp50 ribu per meter. “Ini yang kita ajukan ke pusat dan direspon, kemudian kita memberikan cek senilai Rp17,3 miliar kepada Pemkab Tobasa untuk pembebasan lahan, dan pihak Pemkab yang mencairkan. Saya hanya menandatangi cek saja. Selesai tugas,” kata dia. Namun, pemilik lahan sebelumnya melapor ke LSM karena mengetahui harga tanah dijual Rp50 ribu/meter, sementara dia menjual jauh di bawah itu.“Inilah yang kemudian menjadi persoalan, soal siapa yang bermain dalam harga jual tanah saya tidak tahu,” ujar Bintatar.(m27)


GUBSU H Gatot Pujo Nugro foto bersama pengurus Gerakan Pemuda AlWashliyah pada acara resepsi Hari Jadi Ke-73, di Medan.

73 Tahun GP Al Washliyah

Gubsu: Jaga Kewibawaan Umat MEDAN (Waspada): Gerakan Pemuda (GP) Al-Washliyah memperingati Hari Jadinya Ke 73 dihadiri Gubsu H Gatot Pujo Nugroho dan sejumlah anggota DPRD Sumut di antaranya Ketua Komisi C H Isma Padli Arya Pulungan SAg, SH, MH, dan Sekretaris Sonny Firdaus SH, di Aula Kampus AlWashliyah Jln. SM Raja Medan, Sabtu (11/1). Acara HUT dirangkai dalam berbagai kegiatan termasuk menyerahkan beasiswa kepada anak-anak panti asuhan. Gubsu H Gatot Pujo Nugroho dalam sambutannya menyampaikan beberapa pesan penting terutama proses suksesi dan kaderisasi ormas harus ditata dengan baik, agar GPA bukan sekadar tempat kumpul belaka, melainkan sarana kaderisasi untuk melahirkan pemimpin masa depan di berbagai bidang. Kata Gatot, GPA hendaknya mendesain alur kaderisasi ormas dengan baik, agar dapat menghasilkan sosok pemimpin bangsa yang matang baik intelektualitas, keislaman maupun moralitasnya. Gubsu mengharapkan kader GPA dapat menjadi negarawan bukan sekadar politisi saja. Karena negarawan akan selalu berpikir untuk melahirkan generasi yang lebih baik. “Bahwa persaingan di era global adalah persaingan ide atau gagasan, karena itu kader GPA harus melahirkan ide kreatif yang orisinil dan berbuah dari Islam,” kata Gatot. Sebelumnya, Ketua Pengurus Wilayah GPA Sumut H Isma Padli Arya Pulungan yang juga Ketua Komisi C DPRD Sumut dalam sambutannya meminta seluruh kader untuk menyusun gerakan, melakukan evaluasi program dalam refleksi hari jadi yang ke 73 tahun. Dia berharap agar melalui kesatuan hati, GPA dapat menempatkan kader-kadernya di semua lini untuk dapat mewarnai bangsa ini. “Kita berharap agar tidak sampai terwarnai oleh carut marut dan situasi tidak baik yang dihadapi bangsa sekarang ini,” tutur Isma. Untuk itu, PW GPA Sumut akan segera memperkuat dan merapatkan barisan seluruh jajaran kepengurusan di tingkat kabupaten dan kota, guna menggenapi visi dan misi GPA dalam upaya mengantarkan kader terbaiknya dalam berbagai jabatan strategis dan kekuasaan. “Semuanya itu adalah untuk kepentingan masyarakat, Islam dan Al-Washliyah sendiri,” sebutnya. Resepsi yang berlangsung sederhana namun penuh keakraban itu, turut dihadiri oleh Ketua Pimpinan Pusat GPA Wizdan Fauran Lubis, Pimpinan Wilayah Al-Washliyah Sumut H Hasbullah Hadi, Senior GPA H Hardy Mulyono, Ansoruddin Amir,Yulizar Parlabutan Lubis, anggota DPRD Sumut Sonny Firdaus SH, Pengurus Daerah GPA Medan, Deli Serdang, Tebing Tinggi dan Sibolga, serta Sekretaris PW GPA Sumut Azrai Harahap, Bendahara Gunarto Azis, dan Rektor UMN Al-Washliyah, serta Rektor Universitas Al-Washliyah.(m22)

Dirgahayu 67 WASPADA


WASPADA Senin 13 Januari 2014




Beserta Seluruh Staf dan Jajarannya



Seluruh Karyawan/Kepala Madrasah

Jajaran Kantor Kemenag Aceh Timur Mengucapkan:


Semoga Waspada tetap jaya dan semakin profesional. Ttd;

Drs. M. Ali M, MM

Abd. Ryasad, ST

Kepala Dinas PU

Kabid Bina Marga & Cipta Karya

“Semoga Waspada Tetap Jaya dan Terus Menjadi Media Pembela Kebenaran dan Keadilan” Ttd.

“Semoga Waspada Tetap Jaya dan Terus Menjadi Media yang membantu Ummat Islam” Ttd.


Drs. Tgk. H. Faisal Hasan



Keluarga Besar


Waspada/Riswan Rika


PENGGIAT SSB Ikka Juliani Bachtar bersama tim Disparpora Binjai diabadikan bersama, Minggu (12/1).

Disparpora Binjai Pertahankan Gelar Liga Grassroot Kreasi U-12

“Semoga Harian Waspada tetap jaya dan semakin profesional melaksanakan fungsinya sebagai media yang menyajikan berita faktual, terdepan dan berimbang”

BINJAI (Waspada): SSB Disparpora Binjai bertahan sebagai juara Liga Grassroot Kreasia U-12 wilayah Sumut yang dipusatkan di Stadion Binjai, Minggu (12/1). SSB Disparpora Binjai meraih nilai penuh dengan dua kemenangan hasil mengalahkan Porsabi 2-1 dan Albatros 5-0. Ikka Juliana, aktif membina SSB di Binjai, berharap LGK wilayah Sumut hendaknya dijuarai SSB Kota Binjai. Ikka pun memminta pelatih Disparpora mewaspadai tim lain yang juga punya peluang juara. SSB Disparpora, dengan nilai 16, masih dibayangi SSB Karisma Medan (14) dan Agas Binjai (13). Pada Minggu (12/1), Karisma tersandung oleh Rajawali yang memaksa hasil imbang 1-1. Sebelumnya, Karisma menang atas GMK 3-1. Hasil lainnya, Bintang Utara Medan bermain imbang 22 dengan HP Maju, Agas mengalahkan Albatros 4-0, Rajawali dikalahkan Sahata 0-2, Tandem Putra menaklukkan Bintang Utara 5-1. Selanjutnya, Agas mengalahkan Porsabi 2-0, GMK mengungguli Sahata 3-0, dan Tandem Putra mencukur HPM 6-0. (a04)


Tgk. H. Rahwadi AR, ST Kepala Dinas

Pimpinan dan Anggota


Klasemen LGK Kreasia Wil Sumut: Disparpora Karisma Agas GMK Tandem Putra Porsabi Rajawali Albatros Sahata HP Maju Bintang Utara

6 6 6 6 6 6 6 6 6 6 6

5 4 4 3 3 2 2 1 1 0 0

1 2 1 2 1 2 2 1 1 2 1

0 0 1 1 2 2 2 4 4 4 5

33-4 16 19-4 14 27-3 13 20-9 11 15-21 10 18-13 8 17-14 8 10-19 4 3-21 4 6-33 2 6-31 1

12 Klub Batubara Ramaikan Turnamen Sepakbola Inalum 2014

“Semoga Harian Waspada tetap jaya dan semakin profesional melaksanakan fungsinya sebagai media yang menyajikan berita faktual, terdepan dan berimbang” Ttd,

TANJUNGGADING (Waspada): Sekira 12 klub sepakbola di Kab Batubara diundang PT Inalum turut merayakan HUT PT Inalum ke-38 dalam turnamen memperebutkan piala Inalum pada 28 Januari-25 Februari 2014. Panitia pelaksana, Junaidi, mengungkapkan technical meeting dan penandatanganan kesepakatan fair play dilaksanakan di Gedung MPH Tanjunggading, Minggu (12/1). Dikatakan, tahun ini Piala Inalum mendengar aspirasi dari kalangan pecinta sepakbola, yang menginginkan pesertanya dari klub daerah. “Tahun-tahun sebelumnya, setiap turnamen yang kita adakan diisi klub yang termasuk dalam divisi. Atas saran dari teman-teman dari klub dan demi pembinaan sepakbola di Batubara, kita berterimakasih kepada mereka,” kata Junaidi. Acara sosialisasi aturan bermain sepakbola yang dipimpin oleh pelatih wasit senior Ngadiman Asri. Ngadiman berharap peserta meminimalisir sanksi dan mengejar prestasi. Untuk itu, semua pihak harus mengaplikasikan peraturan yang berlaku. “Dalam permainan sepakbola sudah ada aturan-aturan yang telah baku, pemain, pelatih, wasit bahkan penonton wajib memahami aturan ini agar pertandingan berlangsung fair play,” kata Ngadiman. (c05)

Darwin Syamsul Mundur MEDAN (Waspada): Ketua Pengprov PSSI Sumut, HM Darwin Syamsul, menyatakan mundur dari jabatannya. Meski masa periode kerjanya masih menyisakan satu tahun, surat pengunduran diri tersebut dikirim ke PSSI per 10 Januari 2014. “Demi kepentingan dan kemajuan sepakbola Sumut, saya memilih mundur saja,” kata Darwin menambahkan perubahan statuta Asosiasi PSSI provinsi seluruh Indonesia tahun 2014 juga menjadi alasan dirinya mundur, Minggu (12/1). Menurutnya, dalam surat yang dikirimkan PSSI perihal perubahan status asosiasi PSSI provinsi seluruh Indonesia, poin keempat menjadi sesuatu hal yang ganjil. “Kepengurusan yang habis masa bakti tahun 2013 wajib menggelar Musdalub mencari ketum baru. Tapi kepengurusan saya baru akan berakhir tahun 2015, kenapa juga wajib menggelar Musdalub?” tanya Darwin mengaku legowo tarik diri dan menyatakan tetap mendukung sepakbola Sumut. “Siapapun nantinya yang terpilih menjadi Ketua Aosiasi Sepakbola Sumut, harapan saya bisa membawa sepakbola Sumut lebih baik,” tambah Darwin. Musdalub PSSI Sumut akan diikuti 63 suara yang terdiri atas 33 Pengcab dan 30 klub Divisi III. Darwin berharap sepakbola Sumut dan Indonesia maju dengan tidak mencampuradukkan sepakbola dengan kepentingan politik. (m42)

Pasang Iklan Telp. 4528431 HP. 081370328259 Email:

M. Nasir, SH Ketua

Drs. Rusman Alian

Elizar Lizam, SE.Ak

Wakil Ketua

Wakil Ketua

Salman, SH Sekwan

Pemerintah Kabupaten Aceh Tamiang Mengucapkan:

“Semoga waspada tetap jaya dan terus berpihak membela Kebenaran demi Keadilan” Tertanda,

H. Hamdan Sati, ST

Drs. Iskandar Zulkarnain, M.AP

(Bupati Aceh Tamiang)

(Wakil Bupati Aceh Tamiang)

Razuardi, MT (Sekdakab Aceh Tamiang)

WASPADA Senin 13 Januari 2014

Dirgahayu 67 WASPADA




“Semoga Harian Waspada tetap jaya dan semakin profesional melaksanakan fungsinya sebagai media yang menyajikan berita faktual, terdepan dan berimbang” Ttd,

Zulkifli H. Adam


Wali Kota

Wakil Wali Kota

Sofyan Adam, SH Sekdako

Keluarga Besar






Masha Sudah Siap MELBOURNE, Australia (Waspada): Usai kembali dari cedera bahu yang dialaminya, Maria Sharapova (foto) mengaku siap untuk kembali bertanding. Bahkan, jelang Australia Terbuka di mana ajang grand slam pertama tiap tahun akan digelar, disambut antusias oleh petenis jelita asal Rusia itu. Diketahui, akibat cedera bahu yang diderita Sharapova, petenis berusia 26 tahun itu harus absen selama empat bulan lamanya. Kali ini, Sharapova akan berusaha mengulangi kesuksesannya saat meraih empat gelar grand slam. Sharapova juga sudah membuktikan bahwa dirinya masih bisa bersaing dengan petenis nomor wahid dunia. Saat turnamen Brisbane International, Sharapova harus mengakui keunggulan Serena Williams di final. “Saya senang bisa tampil di grand slam. Saya senang untuk mendapatkan kembali bentuk permainan terbaik saya mulai dari ajang ini,”ungkap Sharapova, Minggu (12/1). “Anda jelas harus menurunkan harapan Anda dan mungkin harus bersikap realistis tentang pertandingan-pertandingan awal yang akan dijalani. Anda harus terus bekerja keras selama turnamen berlangsung,” papar Masha, sapaan akrabnya. (m33/ap)

“Semoga Harian Waspada tetap jaya dan semakin profesional melaksanakan fungsinya sebagai media yang menyajikan berita faktual, terdepan dan berimbang” Ttd,

Drh. Muzakkir

Ir. Muhammad

Kepala Dinas




Ir. Jufri Hasanuddin, MM

Yusrizal Razali


Wakil Bupati

Drs. Ramli Bahar Sekdakab


DPRK ACEH TIMUR Mengucapkan:


Prima Diminta Profesional

Semoga Waspada tetap jaya dan semakin profesional.

JAKARTA (Waspada): Wakil Ketua Komisi X DPR-RI, Utut Adianto, menegaskan dukungannya terhadap keinginan Menpora RI, Roy Suryo, mempertahankan Program Indonesia Emas (Prima) dalam upaya mempersiapkan atlet yang akan tampil pada multi event SEA Games, Asian Games, dan Olimpiade. Namun demikian, Wakil Ketua Umum PB Percasi bergelar Grand Master ini meminta agar Prima ditangani tenaga profesional, sehingga dalam menjalankan fungsinya bisa sesuai harapan. Terutama dalam meningkatkan prestasi atlet nasional di level internasional. “Saya setuju Prima tetap dilanjutkan. Tapi, Prima yang lahir dari Keputusan Presiden (Keppres) wajib ditangani tenaga profesional,” kata Utut, Minggu (12/1). Menurutnya, kedudukan Prima sangat penting apalagi tugasnya mengangkat prestasi olahraga Indonesia. Karena itulah, sangat masuk akal apabila pemerintah dalam hal ini Kemenpora RI tetap melanjutkan program ini. “Program yang ditangani tenaga profesional saja belum tentu bisa terwujud. Apa jadinya jika Prima ditangani bukan tenaga profesional,” kritik Utut menambahkan. Selain ditangani tenaga profesional, Utut juga setuju jika fungsi Prima dikembalikan seperti saat Program Atlet Andalan (PAL) yang ditangani Achmad Sucipto. “Saya setuju fungsi Prima yang menggantikan posisi PAL yang dilahirkan pada era Menpora Adhyaksa Dault memiliki otoritas penuh dalam menjalankan program percepatan prestasi atlet,” tandas Utut. (yuslan)

“Semoga Harian Waspada tetap jaya dan semakin profesional melaksanakan fungsinya sebagai media yang menyajikan berita faktual, terdepan dan berimbang”




si pertandingan sepakbola di Manyak Payed. “Banyak pemain berbakat sepakbola di Manyak Payed ini. Bahkan Ismed Sofyan yang sempat menjadi pemain nasional itu juga berasal dari Kota Tualang Cut, Manyak Payed,” ungkap Papai. Papai menerangkan turna-


Hasballah Bin M. Thaib

Syahrul Bin Syamaun



Bupati Aceh Timur

Wakil Bupati Aceh Timur

Wakil Ketua II

Wakil Ketua I

M. Ihksan Ahyat SSTP, M.AP


Sekda Aceh Timur





8 Tim Ikut Turnamen Manyak Payed KUALASIMPANG ( Waspada): Delapan kesebelasan akan mengikuti turnamen sepakbola se-Kecamatan Manyak Payed, Kab Aceh Tamiang, pada 13-20 Januari ini di Lapangan Kota Tualang Cut. Turnamen tersebut dibuka oleh anggota DPRD Aceh, Drs H Jamaluddin T Muku, Minggu (12/1). Didampingi anggota DPRK Aceh Tamiang, H Syaiful Sofyan, Jamaluddin membuka turnamen berhadiah total Rp4 juta tersebut. Jamaluddin menyatakan turnamen sepakbola se Kecamatan Manyak Payed sangat positif untuk memberikan kesempatan bagi generasi muda yang punya bakat dan kemampuan bermain sepakbola. “Kejuaraan sepakbola seperti ini di masa mendatang akan terus dilaksanakan dengan jumlah peserta yang lebih banyak dan hadiah ditingkatkan,” ujar Jamaluddin. Ketua Panitia Pelaksana, Papai, menjelaskan turnamen diselenggarakan bekerjasama dengan anggota dewan dengan tujuan sarana hiburan sekaligus meningkatkan frekuen-

“Semoga Harian Waspada tetap jaya dan semakin profesional melaksanakan fungsinya sebagai media yang menyajikan berita faktual, terdepan dan berimbang”


“Semoga waspada tetap jaya dan terus berpihak membela Kebenaran demi Keadilan”

“Semoga Harian Waspada tetap jaya dan eksis dalam memberitakan pendidikan”



men menggunakan sistem gugur. Kedelapan tim peserta terdiri atas PSM, GLMEX, Remaja S, Persiga, Marabunta, SPAS, P

Ir. Mahyiddin


Kepala Dinas PU Aceh Timur


Ketenggar, dan Lueng Manyo. Pada Senin (13/1) ini, PSM akan berhadapan dengan GLMEX Gelanggang Merak. (b23)



Keluarga Besar



Semoga Waspada tetap jaya dan semakin profesional. Ttd;



Kadis Kesehatan Aceh Timur

Sekretaris Dinkes Aceh Timur

FAISAL S.Kep Koordinator Kepala Puskesmas Aceh Timur

“Semoga Harian Waspada tetap jaya dan semakin profesional melaksanakan fungsinya sebagai media yang menyajikan berita faktual, terdepan dan berimbang”

S A F WAN Kepala Dinas

Dirgahayu 67 WASPADA


WASPADA Senin 13 Januari 2014




Semoga Waspada tetap jaya dan semakin profesional. Ttd;


Pak Said Dan Bunda Ani Idrus Penuhi Kriteria Pahlawan Nasional MEDAN (Waspada): Tokoh pers H Mohammad Said dan Hj Ani Idrus banyak berjasa bagi masyarakat, bangsa dan negara, sehingga memenuhi kriteria persyaratan untuk diangkat menjadi pahlawan nasional. Menurut Ustadz Drs H Amhar Nasution MA (foto) kepada Waspada, kemarin, untuk bisa menjadi pahlawan nasional haruslah memenuhi syarat, di mana ketokohan dan pengabdiannya benar-benar terbukti. “Pak Said merupakan tokoh pers tiga zaman dan sejarahwan luar biasa. Banyak karyanya untuk negeri ini, khususnya di Sumut, di zaman kemerdekaan, orde lama hingga orde baru, seperti bukubukunya yang fenomenal. Buku sejarah Aceh Sepanjang Abad, Koeli Kontrak, Sisingamangara dan lainnya, sangat luar biasa karena didasari dari penggalian bahan sampai ke negeri Belanda,” ujar Amhar. Sedangkan Bunda Hj Ani Idrus merupakan wartawati empat zaman yang sampai akhir hayatnya terus berkecimpung dalam dunia pers. Sangat jarang wartawan wanita di masa lalu, apalagi mencari yang benar-benar vokal dalam menyuarakan kepentingan masyarakat dan rakyat kecil. Bunda Ani Idrus, merupakan tokoh pers daerah yang menonjol sampai level nasional, kata Amhar yang sangat mendukung pengangkatan Moh Said dan Ani Idrus sebagai pahlawan nasional, sebagaimana dikatakan Prof Usman Pelly dalam seminar the Big Thinkers, melacak pemikiran dua tokoh dimaksud. Terkait HUT Ke-67 Waspada, dosen STIKP yang juga mengajar di pasca sarjana UMSU menyatakan, STIKP bisa hadir hingga saat ini berkat kegigihan Bunda Ani Idrus, begitu juga dengan sekolahsekolah lainnya, seperti Eria dan HarianWaspada merupakan warisan yang tak ternilai harganya karena visi dan misinya sangat idealis dalam mencerdaskan masyarakat. Sebagai ulama dan pendakwah Amhar menilai,Waspada banyak memuat artikel keagamaan sehingga bisa menjadi media buat para intelektual Islam untuk mencurahkan ide dan gagasannya. Begitu juga dengan rubrik-rubrik lainnya, semuanya sangat baik dan memenuhi harapan umat Islam. “Apalagi di era globalisasi dan derasnya arus transformasi linier masyarakat Islam di Sumut, sudah dilanda degradasi moral karena pengaruh infiltrasi, sekularisasi dan lebih parah terjadi pendiskreditan keyakinan akaidah Islam,” katanya. Lihat saja generasi muda Islam kita dewasa ini sudah berpindah kiblat ke kafe-kafe, diskotik, karaoke serta warnet karena euphoria. Orangtua bahkan sudah tidak mampu menasihati anak-anaknya. Padahal dalam Quran disebutkan, ‘’Wahai orang beriman peliharalahdirimudenganimandanwarisanimanpadaanak-anakmu agar mereka tidak terjun ke api neraka.“Di sinilahWaspada berperan menjalankan fungsi pers, informasinya sangat mendidik,’’ tutur Amhar Nasution.(m03)


Semoga waspada tetap jaya dan terus berpihak membela Kebenaran demi Keadilan Ttd,

Ir. Maringan Situmorang Direktur

Keluarga Besar

SMK Negeri 1 Percut Sei Tuan Mengucapkan:

Keluarga Besar

SMA Unggulan CT Foundation Jln. Veteran Pasar VII Manunggal, Kecamatan Labuhan Deli


Kapolri Batal Ke Sumut MEDAN (Waspada): Kapolri Jenderal Sutarman batal melakukankunjungannyakeSumatera Utara, guna melihat persiapan PoldaSumutdalampengamanan pemilihan umum (Pemilu) 2014. Dalam jadwal kerja Kapolri, direncanakan akan tiba di Sumut pada15Januari,kemudianmemberikan arahan kepada seluruh personel Poldasu dalam rangka kesiapan teknis pengamanan Pemiu.Kapolridirencanakandua hari berada di Sumut, untuk selanjutnya mengunjungi Polda lainnya. Namun, kata Kabid Humas Poldasu Kombes Pol. Heru Prakoso, kedatangan Kapolri diundur. “Bukan dibatalkan, tetapi diundur karena beliau ada rapat di Jakarta pada tanggal yang sama,” katanya kepada Waspada, Minggu (12/1). Hanya saja, Heru tidak dapat memastikan jadwal kedatangan Kapolri ke Sumut. Dia mengatakan, dalam jadwalnya kemarin, Kapolri akan ke Poldasu dan selanjutnya melakukan kunjungan kerjanya ke Polres dan Polsek sebagai rangkaian persiapan pengamanan Pemilu. Sebelum ke Poldasu, Kapolri terlebih dahulu berkunjung Ke Polda Aceh. “Rencananyabeliaumemang akan memberikan arahan dan melihat persiapan anggota. Kunjungan ini sekaligus kunjungan kerja memperkenalkan diri kepada personel, begitu juga anggota perlu mengenal dekat kepada pimpinannya, namun diundur,” sebut Heru.

Sebelumnya Kapolri Sutarman telah mengundang seluruh Kapolda di Indonesia melakukan rapat internal terkait persiapan pengamanan Pemilu di Jakarta. Kapolri juga memperkenalkan Posko Mantap Brata di Polda Metro Jaya sebagai percontohan untuk Polda-Polda lain. Mantap Brata merupakan sandiuntukoperasipengamanan pesta demokrasi 2014. (m27)

Semoga Harian Waspada menjadi media yang terdepan, aktual, terpercaya, dan semakin professional dalam menyajikan berita yang seimbang sesuai dengan motto “Demi Kebenaran dan Keadilan.”

Semoga Harian Waspada menjadi media yang terdepan, aktual, terpercaya, dan semakin profesional dalam menyajikan berita yang seimbang sesuai dengan Motto “Demi Kebenaran dan Keadilan.”




Daulat Siregar, M.Pd.,M.Si


Kepala Sekolah

Luar Negeri

WASPADA Senin 13 Januari 2014

9 Hari Bentrok Antar Pemberontak

Hampir 700 Orang Tewas Di Syria BEIRUT, Lebanon (AP):Para aktivis mengatakan hampir 700 orang tewas dalam bentrokan antar pemberontak di beberapa bagian yang dikuasai oposisi di Syria Utara selama sembilan hari. Bentrokan antara Negara Islam Irak dan Levant yang bergabung dengan kelompok Islam lainnya dengan faksi pemberontak yang lebih moderat merupakan kerusuhan paling serius di dalam oposisi bersenjata sejak meletusnya konflik Syria. Observatorium HAM Syria yang berpangkalan di Inggris mengatakan Minggu (12/1) bahwa sekurang-kurangnya 697 orang tewas sejak bentrokan sesama pemberontak meletus 3 Januari lalu. Angka kematian itu mencakup 351 pejuang dari kelompok Islamis dan brigade oposisi garis keras, 246 lainnya dari Negara Islam dan 100 warga sipil. Gempuran pasukan Syria Sementara itu Observato-

rium juga mengatakan Minggu, pasukan pemerintah menggempur posisi pasukan pemberontak yang mengakibatkan lebih dari 20 orang tewas di pusat kota Homs. Menurut Observatorium bahwa jumlah korban diperkirakan akan meningkat karena puluhan orang lainnya cedera dan kebanyakanberadadalamkondisi parah akibat gempuran ke kawasan yang diduduki pemberontak di Waer, di Homs. Observatorium mengatakan gempuran itu terjadi Sabtu. Kelompok aktivis yang tergabung dalam Local Coordination Committees, juga menyiarkan informasi yang sama. Pasukan yang loyal pada Presiden Syria Bashar Assad telah

Bom Mobil Bunuh 13 Warga Sipil Baghdad BAGHDAD, Irak (AP): Dua ledakan bom mobil terpisah yang terjadi Minggu (12/1) yang ditujukan pada kendaraan umum di Baghdad, menewaskan sekurang-kurangnya 13 warga sipil, kata sejumlah pejabat. Ledakan itu terjadi di tengah kebuntuan antara pasukan Irak dan militan yang ada hubungan dengan al Qaida di barat ibukota Baghdad.Ledakan terjadi sehari setelah seorang pejabat senior Amerika menyelesaikan kunjungan tiga harinya ke Irak untuk menemui para pemimpin tinggi politik guna membahas krisis keamanan di provinsi Anbar di barat yang didominasi oleh Sunni. Ledakan maut itu terjadi di satu stasiun bus yang padat di Baghdad Pusat ketika satu mobil bermuatan bahan peledak meledak di luar stasiun tersebut di kawasan Alawi, yang menewaskan sekurangkurangnyasembilanorangdanmencederai16lainnya,demikianmenurut petugas kepolisian. Ribuan orang menggunakan stasiun bus tersebut setiapharinyaataumelintasikawasanitu.Kamismalam,seorangpelaku bom bunuhdiri meledakkan dirinya di antara sekelompok rekrutan pasukan keamanan, yang menewaskan hampir 24 orang. Bom mobil lainnya yang diparkir di sekitar stasiun itu yang ditujukanbagikumpulanbusdantaksidikawasanHurriyah,Baghdad, yang menewaskan empat warga sipil dan mencederai 12 lainnya, kata polisi yang sama. Rusuh 2 Minggu, 60 tewas Seorang pejabat Irak mengatakan pertempuran antara pasukan keamanan dan militan yang ada hubungan dengan al Qaida di provinsiAnbaryangdidominasiwargaSunnimenewaskansekurangkurangnya 60 orang selama dua minggu terakhir. Kepala Direktorat Kesehatan Anbar, Khudeir Shalal mengatakan Sabtu bahwa 43 orang tewas di kota Ramadi dan 17 lainnya tewas diFallujahsejakmeletusnyakerusuhandiprovinsibarattersebutsetelah penangkapan28Desemberlaluatasseoranganggotaparlemenwarga Sunni yang dihadapkan pada tuduhan terorisme dan pembongkaran satu perkemahan protes anti-pemerintah Sunni di Ramadi. Shalal mengatakan sebanyak 297 orang juga cedera di kedua kota tersebut ketika pihak keamanan melakukan pembersihan. (m10)

Pejuang Taliban Serbu Bus Polisi, 6 Orang Cedera KABUL, Afghanistan (AP): Seorang pelaku serangan bom bunuhdiri Taliban menyerang satu bus yang membawa sejumlah warga yang direkrut polisi di Kabul Timur Minggu (12/1), yang mencederai sekurang-kurangnya enam polisi. Tiga warga sipil juga mengalami cedera ringan dalam serangan itu, kata Kepala Polisi Kabul Jend. Mohammad Zahir Zahir. Penyerang menghantam bus tersebut sekitar pukul 03:30 sore (sekitar pukul 18:00WIB). Jurubicara kepolisian Hashmat Stanekzai mengatakanpenyerangyangtewasdalamdalamusahanya,mengendarai sepedamotor yang sarat membawa bahan peledak dan ditujukan pada satu bus dari pusat latihan polisi Kabul. Taliban menyatakan bertanggungjawab atas serangan tersebut dalam satu pernyataan yang dikirimkan ke media. Secara terpisah Minggu,seorangjurubicaraTalibanmembantahbahwaperundingan rahasia telah dilakukan antara kelompok pemberontak Muslim dan para wakil pemerintah Afghanistan. Dalam satu pernyataan, jurubicaraTaliban Zabihullah Mujahid mengatakan ada kontak antara kedua belah pihak dan dia menolak satulaporanyangdisiarkanTheAssociatedPressyangkatanya,sekurangkurangnya dua menteri pemerintah Presiden Hamid Karzai barubaru ini mengadakan perundingan di Uni Emirat Arab.(m10)

Kematian Sharon, Kemenangan Palestina RAMALLAH, Tepi Barat (Waspada): Kematian mantan PM Israel Ariel Sharon disambut gembira warga Palestina. Kematian Sharon dianggap sebagai simbol kemenangan Palestina. Sharon memang sosok yang dibenci di Palestina. Dia dianggap bertanggung jawab atas kekejaman terhadap warga Palestina termasuk pembantaian pengungsi Palestina di wilayah Sabra dan Shatila pada 1982. “KematianSharonmerupakanbuktibahwapadaakhirnyakemenangan akan diraih Palestina,” ujar tokoh Fatah, Tawfik Tirawi, seperti dikutipWashingtonPost,Minggu(12/1).“Diainginmembunuhsemua warga Palestina. Dia ingin menghapus Palestina dari peta dunia.Tapi pada akhirnya, dia meninggal dan Palestina tetap ada,” lanjut Tirawi. Kecaman terhadap Sharon tidak hanya datang dari Palestina. LSM HAM, Human RightsWatch, juga memberi penyataan serupa meresponskematianSharin.“Sangatdisayangkandiasudahmeninggal sebelum dibawa ke pengadilan internasional atas pembantaian di Sabra dan Shatila,” sebut pernyataan dari Human RightsWatch. Dipuji Barat Pada saat rakyat Palestina merayakan kematian mantan PM Sharon, akibat stroke Sabtu sore, para pemimpin dari negara sekutu Israeljustrumemujikepemimpinannya.Merekabahkanmenyatakan rasa kehilangan dan duka mendalam atas meninggalnya mantan Jenderal yang kerap dijuluki “Buldozer” tersebut. Menurut Fox News, pernyataan duka datang antara lain dari negara sekutu terdekat Israel, Amerika Serikat, Barack Obama. Dalam pernyataan resminya, Obama mengirim ucapan duka atas nama keluarga dan rakyat AS. SementaraMenteriLuarNegeriAS,JohnKerry,menyebutperjalanan hidup Sharon juga menjadi jalan hidup bagi Israel. Kerry mengatakan SharonselalumemperjuangkanmimpibagirakyatIsrael.Walauterkadang dalam mewujukan mimpinya, lanjut Kerry, Sharon siap mengambil risiko dengan menempuh sikap yang berseberangan dengan AS. MayatSharondimakamkanSeninpetangdikawasanpeternakannya diIsraelSelatansetelahupacaraperingatanharisebelumnyadiparlemen, kataradiomiliter.Menurutlaporanitu,petimatiSharonakanditempatkan di parlemen Jerusalem, Minggu untuk memungkinkan masyarakat melakukan penghormatan terakhir mereka. Proses Senin akan dimulai dengan sebuah upacara diYerusalem Knesset, atau parlemen, pada pukul 07.30 GMT, kata laporan itu.Wakil Presiden AS Joe Biden akan memimpin delegasi AS ke misa memorial, dan para pemimpin dunia lainnya diharapkan untuk hadir.(bbc/ rtr/m10)

memperluas serangan udara mereka pada kawasan yang dikuasai pemberontak dalam beberapa minggu terakhir, yang ditujukan pada kawasan penduduk yang dikuasai pemberontak dan banyak warga sipil yang tewas. PemberontakSyrianjugamenargetkan kawasan yang dikuasai para loyalis Assad dengan tembakan mortir yang membabibuta. Minggu, media pemerintah Syria mengatakan mortir yang ditembakkan pemberontak itu menewaskan dua warga sipil di Zahra, kota yang dikuasai para loyalis Assad. Sehari sebelumnya, 40 gerilyawan tewas Sabtu oleh tentara Syria di Provinsi Aleppo, bagian utara negeri itu, kata kantor berita

resmi Syria, SANA. Lebih dari 40 gerilyawan, kebanyakan warganegaraasing,tewasdalam‘operasi khusus’ yang dilancarkan oleh pasukan reguler Syria di Desa Retyan di pinggiran utara Aleppo, kata SANA. Gerilyawan itu telah kehilangan momentum belum lama ini, saat mereka dilanda pertempurandidalamkelompokmereka antara gerilyawan yang memperlihatkan diri sebagai “moderat” dan anggota Negara Islam Irak dan Levant (ISIL). Observatorium yang berpangkalan di Inggris mengatakan pertempuran yang terjadi di dalam gerakan oposisi Syria telah menewaskan 500 orang. Pertempuran meletus Jumat lalu antarkelompok gerilyawan dan apa

yang menamakan diri ISIL, kata Observatorium tersebut. Ditambahkannya, jumlah korban jiwa meliputi 85 warga sipil, 240 gerilyawan dari berbagai grup dan 157 petempur ISIL, demikian laporan Xinhua. Beberapa batalion belum lama ini telah berpaling melawan ISIL, yang baru-baru ini memproklamasikan berdirinya ‘Keamiran Islam’ di Provinsi Fallujah, Irak. Banyak pengamat percaya banyak kelompok gerilyawan berpaling melawan ISIL karena banyak wilayah Irak yang telah dikuasainya di Syria Utara. Selain itu mereka ingin mencitrakan diri denganbaikdanmemperlihatkan mereka“moderat” sebelum Konferensi Perdamaian Jenewa II mengenai krisis Syria.(m10)

Hasina Dilantik Untuk Ketiga Kalinya Jadi PM Bangladesh DHAKA, Bangladesh (AP): SheikhHasinatelahdilantikMinggu (12/1) untuk kedua kalinya berturut-turut sebagai PM Bangladesh dan secara keseluruhannya dia telah menduduki jabatan tersebut tiga kali. Kemenangan terakhir diperolehnya dalam pemilihan yang paling rusuh dalam sejarah negara itu. Hasina diambil sumpahnya seminggu setelah partainya Liga Awami memenangkan satu pemilihan yang ditandai dengan bentrok di jalanan, rendahnya jumlah pemilih dalam pemilihan yang diboikot oposisi yang membuathasilnyamutlakkepartainya. Presiden Abdul Hamid juga telahmelantik29menteriKabinet dan 19 wakil menteri. Pemilihan itu merupakan yang paling maut sejak masa ke-

merdekaan Bangladesh tahun 1971, ketika satu persekutuan oposisi yang dipimpin mantan PM Khaleda Zia, musuh bebuyutan Hasina, berusaha untuk menjungkalkan pemilihan dengan mengimbau dilakukannya pemogokan dan blokade selama beberapa minggu. Sekurang-kurangnya 18 orang tewas pada hari pemilihan yang kacau itu dan lebih dari 100 tempat pemungutan suara dibakar. Sejak Februari lalu, sekurangkurangnya300orangtewasdalam kerusuhan politik. Zia, pemimpin Partai Nasional Bangladesh yang oposisi atau BNP, telah absen pada upacara pelantikan itu di Istana KepresidenandiDhaka.Banyakdiplomat Barat menghadiri upacara tersebut meski ada imbauan dari PBB,

AS dan Uni Eropa agar dilakukan pemilihan yang diikuti semua lapisan. Boikot pemilihan oleh partai Zia berarti pemerintahan baru Hasina tidak akan menghadapi oposisi kuat di Parlemen. BNP bertekad untuk melanjutkan usahanya untuk memaksa Hasina mengundurkan diri dan mengizinkan pemerintah sementara untuk mengawasi pemilihan umum yang baru dengan keikutsertaan oposisi. Setelah pelantikannya, Hasina, yang juga pernah menduduki jabatan PM dari 1996-2001, mengatakan dia akan bekerjasama untukmempertahankandemokrasi dan tidak akan ragu-ragu untuk mengambil langkah keras jika konsensus telah tercapai.(m10)


Ratusan Bangunan Kuno Hangus Terbakar Di Shangri-La, China BEIJING, China (AP): Satu kebakaran yang terjadi selama hampir 10 jam mulai dari Jumat sampaiSabtu(11/1)pagitelahmeluluhlantakkansatukotakunoTibet di China Baratdaya yang populer dengankawasanwisatanya.Kebakaran itu memusnahkan ratusan gedung-gedung karena mobil pemadamkebakarantidakberdaya menghadapikobaranapi,jalanan di kota tersebut sempit, demikian menurut media dan saksimata. Belum ada laporan tentang korban, dan sebab kebakaran itu juga masih belum diketahui. Media pemerintah, yang mengacu padapenguasalokal,mengatakan kebakaran itu dimulai di satu wisma tamu dan dinyatakan sebagai satu kecelakaan. Kebakaranmulaiterjadipada pukul 01:27 dinihari di kota kuno Tibet, Dukezong, yang berusia lebih dari 1.000 tahun dan dikenal dengan jalan-jalan berbatu yang telah diawetkan, struktur kuno dan budaya Tibet. Ini adalah bagian dari pemandangan ShangriLa di Deqen prefektur. Kota tersebut sebelumnya bernama Gyaitang Zong, namun pada tahun 2001 berganti nama menjadi Shangri-La, karena dengan pergantian dengan nama yang sedikit keren itu akan menarikbagiwisatawan.Sepertiratusan kotadankabupatenChina,Shangri-La direnovasi dan diganti dari nama lamanya, Dukezong, yang

mengubahnyamenjadidayatarik wisata yang penuh dengan tokotoko dan wisma tamu. Foto dan rekaman video menunjukkan Dukezong, di mana ratusan gedung rumah dilalap apisehinggamengubahlangitmalammerah. Ribuanorangdilaporkan telah berupaya memadamkan api yang menyebar cepat karena sebagian besar bangunan terbuatdarikayu.Dukezong,yang didirikan lebih dari seribu tahun yang lalu, telah menjadi tujuan wisata yang populer. Wilayah ini belakangan berganti nama menjadi Shangri-la, sebuah nama yang dilekatkan denganmitostanahHimalayaseperti terekam dalam novel karya James Hilton yang terbit pada 1933. Sejauh ini belum diketahui penyebab awal dari kebakaran, walaupun situs pemerintah pro-

vinsi mengatakan, api berawal dari sebuah tempat penginapan. Dia Yu, seorang warga, mengatakan dia terbangun di tengah malam, setelah mendengar ledakandanmenemukanapimelalap kawasan lama kota itu. “Kebakaran itu sangatlah besar. Angin bertiup sangat kencang dan udara kering. Saya takut karena rumah tidak begitu jauh dari kawasan kota lama,” katanya. Menurutnya, petugas pemadam kebakaran telah berada di lokasi kebakaran, tapi mereka sulit untuk menjangkau lokasi kebakaran karena jalan-jalannya yang sempit. Lebih dari 2.000 petugas pemadamkebakaran,tentara,polisi, dan para relawan telah berusaha memadamkan api, kata pejabat pemerintah daerah ShangriLa.(m10)

5 Orang Tewas Akibat Helikopter Jatuh Di Kolombia BOGOTA, Kolombia (AP): Tentara Kolombia mengatakan satu helikopter swasta yang digunakan untuk satu misi militer jatuh di baratlaut negeri itu, yang menewaskan seluruh penumpang dan awak yang ada di dalamnya, yang berjumlah lima orang. Jend. Leonardo Pinto mengatakan Sabtu (11/1) bahwa dua tentara, seorangpetugaskepolisian,seorangpendetamiliterdanpilothelikopter tewas dalam kecelakaan tersebut yang terjadi di daerah pedalaman Anori,kira-kira300kmbaratlautBogota.PesawatituadalahmilikSociedad Aeronautica Santander SA yang dinyatakan hilang sejak Kamis lalu. Pinto tidak mengatakan apa penyebab kecelakaan tersebut. (m10)


A10 2100

Minggu, 12 Januari Getafe v Vallecano


MADRID (Waspada): Atletico Madrid dan Barcelona sama-sama senang bermain 0-0 di Stadion Vecente Calderon, Sabtu (Minggu WIB), sehingga keduanya tetap setara di puncak klasemen La Liga Primera.

Sabtu, 11 Januari Ath Bilbao v Almeria Celta Vigo v Valencia Atl Madrid v Barcelona Elche v Sevilla

Senin 13 Januari 2014

Atletico, Barca Senang Imbang

Senin, 13 Januari Villarreal v Sociedad


6-1 2-1 0-0 1-1

Jumat, 10 Januari Granada v Valladolid

Bermain sama-sama terbuka, El Barca langsung menggempur pertahanan El Atleti. Menit 18 Pedro Rodriguez berkesempatan melayangkan tembakan keras ke gawang tuan rumah, namun kiper Thibout Courtois mampu menghadang bola dengan bagus. “Barcelona belakangan banyak mencetak gol. Jika kami membiarkan mereka memperoleh peluang, maka mereka bisa melukai kami. Kami juga memiliki kesempatan, saya senang hasilnya imbang,” jelas Diego Simeone, entrenador


Klasemen La Liga Barcelona 19 16 Atl Madrid 19 16 Real Madrid18 14 Bilbao 19 11 Sociedad 18 9 Villarreal 18 9 Sevilla 19 8 Valencia 19 7 Granada 19 7 Getafe 19 7 Espanyol 18 6 Malaga 18 5 Levante 18 5 Celta Vigo 19 5 Almeria 19 5 Elche 19 4 Osasuna 18 5 Valladolid 19 3 Vallecano 19 5 Real Betis 18 2

2 2 2 3 5 4 6 2 2 2 4 5 5 4 4 6 3 7 1 5

1 1 2 5 4 5 5 10 10 10 8 8 8 10 10 9 10 9 13 11

53-12 50 47-11 50 52-21 44 32-24 36 35-23 32 32-20 31 36-30 30 26-31 23 19-25 23 20-31 23 22-24 22 19-23 20 17-27 20 23-31 19 21-38 19 17-28 18 15-28 18 21-33 16 19-45 16 15-36 11

Gol Pertama MU Bunuh Angsa Putih LONDON ( Waspada): Manchester United menghentikan tragedi tiga kekalahan beruntunnya, Sabtu (Minggu WIB), saat menggunduli tamunya Swansea City 2-0 pada matchday 21 Liga Premier. Kemenangan di Stadion Old Trafford itu sekaligus pembalasan dendam The Red Devils terhadap Si Angsa Putih, yang menyingkirkan mereka dari Piala FA akhir pekan lalu. Menurut Michael Laudrup, manajer The Swans, gol pertama MU yang dicetak Antonio Valencia (foto) menit 47, yang telah membunuh perlawanan pasukannya. Setelah gol itu, United memang lebih percaya diri dalam menekan lawannya. “Mereka mencetak gol setelah sembilan puluh detik berjalannya babak kedua. Sangat

menyenangkan bisa mencetak gol seperti itu, mereka menciptakan gol di saat momen yang tepat,” tutur Laudrup lewat Sky Sports, Minggu (12/1). “Kami menguasai babak pertama dan kami tahu United sudah mengalami kekalahan tiga kali beruntun. Itu membuat mereka gugup, mereka tidak menciptakan peluang membahayakan, namun di babak kedua mereka mencetak gol cepat,” tambah legenda Denmark tersebut. Kekalahan dari Tottenham Hotspur, Swansea dan Sunderland, membuat Setan Merah MU beresiko menelan empat kekalahan beruntun untuk pertama kalinya sejak 1961. Namun anak asuh David Moyes mampu memupusnya dengan menjinakkan Angsa Putih.

Nowitzki Belum Habis DALLAS, AS (Waspada): Kendati sudah berusia 35 tahun, Dirk Nowitzki (foto) tampil gemilang ketika mengantarkan Dallas Mavericks menang atas New Orleans Pelicans dalam lanjutan kompetisi NBA, Minggu (12/1). Nowitzki menjadi pencetak angka terbanyak dan membantu Mavs meraih kemenangan 110-107 di American Airlines Center, Dallas. Mavs dimotori Nowitzki yang total mencetak 40 angka. Monta Ellis juga tampil prima dengan sumbangan 26 poin dan Jose Calderon menambahkan 17 angka bagi Dallas. Di kubu Pelicans, Anthony David mengemas 28 poin 14 rebound, tapi gagal menyelamatkan timnya dari kekalahan. ‘Awalnya kami bermain buruk, tapi setelah turun minum, kami berhasil bangkit dan selanjutnya irama permainan berpihak kepada tim. Tiba-tiba saja, seluruh pemain jadi percaya diri, sehingga saya pun termotivasi bermain allout,’’ ungkap Nowitzki. “Luar biasa! Saya telah lama berada di liga ini dan jarang menyaksikan aksi heroik dari Nowitzki. Benar-benar sebuah berkah bagi kami memi-

cil sebesar 400 juta euro dengan Barcelona. Kami telah berjuang dan bertarung, itu bagus,” jelasnya. “Dengan kerja keras, tim kami seperti rela menyerahkan nyawa di setiap laga, sehingga kami memiliki kesempatan menang dari pertandingan ke pertandingan lain,” tambah Simeone, mantan gelandang Atletico dan Lazio asal Argentina. “Atletico tampil sangat bagus, mereka tim yang kompak. Kami mendominasi laga, tapi kami kesulitan mencari peluang. Itu pertandingan yang sangat intens,” ucap Xavi Hernandez, playmaker Barca. “Atletico sangat kuat dan Real Madrid selalu ada. Tapi kami akan berjuang untuk memperebutkan gelar juara,” pungkas Xavi. (m15/ant/rtr/mrc/as)

PSG Paham Ajaccio Memang Sulit

BOMBER Barcelona Lionel Messi bermain imbang dengan striker Atletico David Villa di Stadion Vicente Calderon, Madrid, Minggu (12/1) dinihari WIB. -AP-


Atletico, Minggu (12/1). “Hasil imbang sudah cukup. Kami sebenarnya tidak terlalu senang dengan hasil ini, namun secara keseluruhan tim sudah bermain sangat baik,” timpal pelatih Barca Gerardo ‘Tata’ Martino. “Kami menampilkan permainan solid, terutama dalam bertahan. Namun lini serang bermain kurang bagus,” tambah suksesor Tito Vilanova asal Argentina itu kepada Marca. Setelah kegagalan serangan Pedro, El Catalan kembali menciptakan peluang me-

nit 37, namun bola tendangan bek Gerard Pique lagi-lagi bisa ditangkap Courtis. Di awal kedua, Tata memasukkan Lionel Messi untuk mempertajam serangan dengan menarik Andres Iniesta. Tata kembali melakukan pergantian pemain, memasukkan Neymar da Silva dan menarik Alexis Sanchez menit 67, tapi El Blaugrana tetap tak mampu memecah kebuntuan. Los Rojiblancos pun demikian. Beberapa serangan yang bermuara kepada Arda Turan, Diego Costa, David Villa dan Gabriel Fernandez, semuanya gagal menembus gawang kiper Victor Valdes. Menurut Diego Simeone, ada perbedaan tak terlalu besar antara timnya dengan sang juara bertahan. “Kami menghormati Barca, perbedaan ke-


liki seorang pemain sekaliber sepertinya,” puji Ellis.’ Di Chesapeake Energy Arena, Oklahoma City Thunder bangkit setelah sebelumnya dikalahkan Utah Jazz dan Denver Nuggets. Melawan Milwaukee Bucks, Kevin Durant cs menang 101-85. Durant juga menjadi bintang untuk Thunder dengan mencetak 33 poin 10 rebound. Serge Ibaka dan Jeremy Lamb sama-sama menyumbangkan 17 poin, sementara Thabo Sefolosha menambah 14 angka. (m33/ap)

Hasil Minggu (12/1) Toronto Raptors v Brooklyn Nets Houston Rocket v Washington Wizards Detroit Pistons v Phoenix Suns New York Knicks v Philadelphia 76ers Chicago Bulls v Charlotte Bobcats Oklahoma City Thunder v Milwaukee Bucks Dallas Mavericks v New Orleans Pelicans Denver Nuggets v Orlando Magic Portland T’blazers v Boston Celtics

96-80 114-107 110-108 102-92 103-97 101-85 110-107 120-94 112-104

Blatter Promosi Brazil 2014 ZURICH, Swiss (Waspada): Presiden FIFA Sepp Blatter promosi bahwa Piala Dunia 2014 akan menjadi yang terbaik meskipun persiapannya mengalami kemunduran. “Kendati banyak dikritik, itu akan menjadi Piala Dunia terbaik yang pernah ada,” kampanye Blatter, seperti dikutip dari ESPN, Minggu (12/1). “Irama sepakbola saat ini berbeda, kompetisinya juga berbeda. Saat ini ada 32 tim, sementara (Piala Dunia 1950 di Brazil) hanya 16 tim,” papar pria 77 tahun tersebut. Persiapan gelaran Brazil 2014 diganggu banyak persoalan, di antaranya kasus kematian pekerja konstruksi. Namun tuan rumah Brazil sudah menyatakan segala persiapan akan rampung pada 1 Juni. Blatter yakin, turnamen itu akan diingat sebagai yang terbaik dalam sejarah sepakbola dunia. “Kami memiliki kompetisi seperti ini di Italia (tahun 1990). Tuan rumah belum selesai memasang kursi sehari sebelum pertandingan pertama, tetapi di sini kita akan siap,” promosi Blatter. “Saya yakin bulan Maret semua stadion akan selesai dan kita memiliki cukup waktu untuk melakukan gladi bersih. Saya yakin kesiapan stadion akan memenuhi harapan penonton dan pemain,” katanya lagi. (m15/ant/espn)

MU 2 39% 16 5 3 2 9 1 0 0

Swansea 0 Skor Akhir Penguasaan Bola 61% 13 Tembakan Total 2 Tembakan Tepat 5 Tembakan Pojok 3 Penyelamatan 10 Pelanggaran 0 Offsides 2 Kartu Kuning 0 Kartu Merah *Sumber ESPN

Gol Valencia disusul gol Danny Welbeck menit 59, melengkapi kebangkitan United. Winger remaja Adnan Januzaj menjadi katalis bagi kemenangan ini. Januzaj bahkan nyaris membuka gol pertama MU menit 11 melalui tendangan bebas yang membentur mistar gawang. Januzaj kemudian mengirim umpan silang, yang gagal dituntaskan Shinji Kagawa. Bintang belia berusia 18 tahun itu juga menjadi kreator bagi gol Welbeck. Dia mengirim umpan kepada Patrice Evra, yang tembakannya dibelokkan ke gawang tim tamu oleh Welbeck. “Kami bermain bagus, memulai duel dengan baik.Kami membatasi peluang mereka dan kami benar-benar pantas mendapatkan kemenangan ini,” klaim Moyes melalui Soccerway. “Kami memainkan Januzaj lebih melebar dan saya pikir dia bekerja dengan lebih baik, karena sangat mengubah gaya bermain kami. Dia sangat layak menjadi starter dalam laga ini,” pungkas Moyes. (m15/ant/sky/sw)

P A R I S (Waspada): Paris Saint Germain gagal menampilkan permainan terbaiknya pada laga perdana 2014 di Ligue 1 Prancis, Sabtu (Minggu WIB), namun masih mampu mengatasi Ajaccio 2-1. “Kami memiliki sedikit waktu istirahat, itu membuat badan serta kepala para pemain menjauh sedikit dari beberapa hal,” papar pelatih PSG Laurent Blanc, sebagai diberitakan AFP, Minggu (12/1). Kubu Les Parisiens paham, klub Korsika itu memang selalu menjadi lawan sulit. Ajaccio malah unggul lebih dahulu di Stade Francois-Coty melalui gol Eduardo ketika laga baru berlangsung enam menit. Striker Argentina Ezequiel Lavezzi menyamakan kedudukan untuk tim tamu sebelum turun minum. Gelandang Prancis Blaise Matuidi menanduk bola yang menjadi penentu kemenangan Les Parisiens

Klasemen Ligue 1


BLAISE Matuidi dan Ezequiel Lavezzi berbagi gol ke gawang Ajaccio. menit 4. Itu bukan penampilan klasik dari pasukan Blanc, namun mereka sekarang unggul lima angka di puncak klasemen atas AS Monaco, yang sebelumnya bermain 1-1 di markas Montpellier. “Kami tahu ini akan menjadi duel sulit. Kami perlu berada di puncak permainan pada 20 menit pertama, tapi kami tidak melakukannya. Kami

Paris SG 20 14 5 1 46-14 AS Monaco 20 12 6 2 32-14 Lille 19 12 4 3 22- 8 Etienne 20 10 4 6 28-20 Bordeaux 20 8 7 5 27-22 Marseille 19 8 5 6 27-20 Nantes 19 9 2 8 23-17 St Reims 19 7 8 4 23-21 Lyon 20 7 7 6 30-27 Toulouse 20 7 7 6 21-24 Lorient 19 8 3 8 26-26 Guingamp 20 6 7 7 19-19 Bastia 20 6 6 8 23-29 Nice 20 7 3 10 18-25 Rennes 20 5 7 8 22-24 Evian 19 5 5 9 19-32 Montpellier 20 2 12 6 19-25 Valencs 20 4 5 11 20-30 Sochaux 20 2 5 13 15-41 Ajaccio 20 1 6 13 14-36

47 42 40 34 31 29 29 29 28 28 27 25 24 24 22 20 18 17 11 9

mematikan tombol dan kemasukan gol,” sentil Blanc. “Hal itu mereka maksimalkan. Namun kami mampu menyamakan kedudukan, dan pada babak kedua kami punya banyak peluang untuk memenangi partai ini,” katanya menambahkan. Ajaccio telah membangun reputasi terhadap PSG dalam beberapa waktu terakhir. Mereka bahkan mampu mena-

han imbang Cris cs pada tiga pertemuan sebelumnya. “Tapi Paris berada di sini untuk mengambilnya malam ini. Ini benar-benar membuat frustrasi, ketika kami tidak mendapat penghargaan atas usaha-usaha kami,” sesal pelatih Ajaccio Christian Bracconi. (m15/ant/afp/uefa)

Stamford Bridge. Dia pun berandil besar atas sukses Blues meraih tiga gelar Premiershir, empat Piala FA, satu trofi Liga Europa dan satu Liga Champions. Cech sendiri tidak mau euforia, karena selalu mengutamakan kesuksesan tim. “Yang terpenting kami bisa tetap terus menang dan meraih trofi.

Kami ingin memenangi Liga Premier,” ucapnya kepada BTSport. “Kami berharap clean sheets akan membantu kami meraih target kami. Paling membanggakan dari cleans sheets kali ini adalah kami bisa memenangi laga penting,” beber kiper berumur 31 tahun tersebut.(m15/vvn/rtr/bts)

Rekor Clean Sheat Cech LONDON (Waspada): Kemenangan 2-0 Chelsea di markas Hull City pada matchday 21 Liga Premier, memiliki arti penting bagi Petr Cech. Tentu saja, sebab kiper Ceko itu mencetak rekor 209 laga clean sheets (tidak kebobolan) bersama Chelsea. Suami Martina Cochova (foto) itu mematahkan rekor legenda Chelsea Peter Bonneti, yang memerlukan 20 tahun berkostum Biru (19591979) untuk mencetak rekor tersebut. Cech melakukannya di musim kesepuluh bersama The Blues. “Sekarang dia berhasil memecahkan rekor legenda Peter Bonetti. Saya pikir tahun depan dia akan memecahkan rekor di Premier League,” jelas Jose Mourinho, manajer London Blues, Minggu (12/1).

Hull 0 44% 10 2 1 3 12 2 2 0

Chelsea 2 Skor Akhir Penguasaan Bola 59% 14 Tembakan Total 5 Tembakan Tepat 7 Tembakan Pojok 2 Penyelamatan 7 Pelanggaran 0 Offsides 1 Kartu Kuning 0 Kartu Merah *Sumber ESPN

“Dia selalu bermain dalam performa terbaik sejak 2004, clean sheets demi clean sheets,” tambah Mo u r i n h o, y a n g sangat puas sebab Chelsea mampu menggeser Arsenal dari puncak klasemen. Dalam satu dekade terakhir, sosok Cech memang tidak tergantikan sebagai penjaga gawang utama skuad



WASPADA Senin 13 Januari 2014


Giliran Chamberlain LONDON ( Waspada): Setelah Lukas Podolski, giliran Alex Oxlade-Chamberlain yang bakal kembali main pasca pulih dari cedera yang dideritanya sejak lima bulan silam. Chamberlain (foto kiri) pun potensial diturunkan manajer Arsene Wenger (foto kanan), saat Meriam London menjajal Aston Villa pada matchday 21 Liga Premier dinihari WIB nanti di Villa Park. Winger berumur 20 tahun itu tampil 45 saat tim Arsenal U21 melawan Fulham pekan lalu. “Kami membutuhkan setiap pemain, terutama Alex. Kejutan besar ketika dia harus absen usai laga kontra Aston Villa,” beber bek sentral Per Mertesacker melalui Arsenal Player, Minggu (12/1). The Ox mengalami pada awal musim ini, saat The Gunners dipecundangi The Villans 1-3 di Emirates Stadium, Agustus silam. Dia justru pulih untuk kembali menghadapi Villa di Birmingham. “Sejak pertandingan itu, kami bermain bagus sebagai tim, tapi kami tetap membutuhkannya. Sebab dia selalu menjadi pembeda dengan kecepatan, passing, dan tentu finishing yang dimilikinya. Jadi kami senang dia kembali,” klaim Mertesacker. “Sulit dipercaya karena dia (Chamberlain) terakhir bermain di laga pembuka musim melawan Aston Villa, kini dia kembali dan siap diturunkan melawan Villa lagi,” timpal Arsene Wenger. “Dia absen selama lima bulan, kini dia sudah bugar dan itu berarti memberikan kami tambahan tenaga yang luar biasa,” tambah mantan pelatih AS Monaco itu lewat Mirror. Pria Prancis berusia 64 tahun dijuluki The Professor itu menggambarkan The Ox sebagai pemain bertipe versatile alias dapat bermain di sejumlah posisi. Kemampuannya tentu sangat bermanfaat bagi The Gunners, yang sedang dilanda krisis cedera di garis serang. Striker Olivier Giroud, Nicklas Bendtner dan Theo Walcott, dipastikan absen di Villa Park, sedangkan kondisi Mesut Ozil masih meragukan. Menurut Wenger, Chamberlain berpotensi menjadi

Getty Images

bintang besar, seperti halnya kapten Liverpool Steven Gerrard. “Dia memiliki kualitas bagus mendistribusikan bola dan melakukan penetrasi secara individu. Sangat mirip dengan Steven Gerrard,” puji Wenger. “Saat ini dia masih dalam tahap pengembangan. Sangat baik baginya bermain di sejumlah sisi, kiri, kanan, ataupun tengah. Namun setelah mencapai usia 23 atau 24 tahun, dia akan menemukan posisi terbaiknya,” papar The Professor. Dia juga memuji Lukas Podolksi, yang bakal menjadi penyerang tengah Gunners di markas Villa. “Pasti, dia salah satu finisher terbaik yang pernah saya lihat. Saat dia sudah siap secara fisik, maka dia pasti memberikan bantuan yang banyak bagi Arsenal,” ujar Wenger. “Bila ada seorang yang ingin saya lihat melakukan tembakan di depan gawang, dialah Podolski. Dia bisa memainkan peran sentral saat dia benar-benar fit,” pungkasnya. (m15/goal/mrr/rtr)

Waspada/Arianda Tanjung

PEMAIN AIS Medan merayakan keberhasilannya menjadi juara MISC untuk kedua kalinya di Lapangan The Kop Futsal Jl Krakatau, Medan, Minggu (12/1).

AIS Jawara MISC Lagi MEDAN (Waspada): Untuk kedua kalinya, Arsenal Indonesia Suporter (AIS) Medan berhasil menjuarai Medan International Suporter Club (MISC) di Lapangan The Kop Futsal, Jl Krakatau, Medan, Minggu (12/1).

Waspada/Muhammad Hanafiah

KORWIL IMI Kabupaten Aceh Tamiang, Elpian Raden, dan pengurus Atakamo serta aparat Polres Aceh Tamiang diabadikan bersama seusai peserta Rally Wisata memasuki finish di pintu gerbang Kompleks Kantor Bupati Aceh Tamiang, Minggu (12/1).

Reli Wisata Atakamo KUALASIMPANG ( Waspada): Aceh Tamiang Komunitas Mobil atau biasa dikenal Atakamo menggelar kegiatan bakti sosial dan reli wisata di Kabupaten Aceh Tamiang, 11-12 Januari. Ketua Pelaksana Kegiatan, Hari Muliadi, menjelaskan Atakamo melaksanakan kegiatan reli wisata dan bakti sosial dengan memberikan santunan kepada anak yatim piatu Panti Asuhan Al-Hakim Paya Kulbi, Karang Baru. “Organisasi kami ini juga punya kepedulian di bidang sosial,” ujar Hari didampingi Wakil Ketua Atakamo, Bripka Devinon Purba, Minggu (12/1). Reli wisata, sebut Hari, menempuh rute dari Karang Baru, lalu memutar tugu Opak menuju Rantau, terus ke Kota Kualasimpang dan kembali lagi ke halaman kantor Bupati Aceh Tamiang. Peserta reli dilepas Ketua DPRK Aceh Tamiang, Ir Rusman, didampingi Ketua Korwil IMI Kab Aceh Tamiang, Elpian Raden, Kasat Lantas Polres Aceh Tamiang, AKP M Dahlan, dan lainnya. Menurut Hari, reli wisata diikuti 55 peserta yang hadir bersama mobilnya. Setelah seluruh peserta masuk garis finish, peserta pun diajak rileks sejenak sembari minum bareng di kafe. (b23)

Problem Catur Jawaban di halaman A2. 8















seperti tahun lalu dengan mengandalkan bola-bola cepat, baik saat bertahan maupun menyerang. Hal itu terbukti dari 17 laga yang dimainkan, kami mampu memenangkan 15 pertandingan dan hanya kalah dua kali,” katanya kepada Waspada. Dikatakan, aroma persaingan dalam kompetisi ini sangat terasa terbukti setiap minggunya permainan semakin memanas namun tetap mengandalkan sportivitas. “Bahkan pemain AIS Anggi juga berhasil menjadi top skor dengan torehan 25 gol. Menurut saya, turnamen yang digelar tiap minggu ini sangat baik karena tujuannya sebagai rangka silaturahim antar-suporter klub yang berdomisili di Medan,” tambah Pupu. (cat)

Persiraja Selection Bungkam Marabunta KUALASIMPANG (Waspada): Persiraja Selection Banda Aceh mengalahkan PS Marabunta asal Manyak Payed 2-1 dalam laga persahabatan di Lapangan Kota Tualang Cut, Manyak Payed, Kab Aceh Tamiang, Minggu (12/1). Persiraja Selection yang diperkuat sejumlah mantan pemain Persiraja seperti Reza fahlevi, Azhari, Jessi,Akli, dan pemain Persal Aceh Selatan yakni Nandar, Riski plus mantan pemain PON Aceh maupun Pra Pora Aceh Utara, juga menampilkan anggota DPR Aceh, Jamaluddin T Muku. Pada pertandingan tersebut, Persiraja Selection lebih banyak menguasai bola. Tim tamu unggul terlebih dahulu melalui gol Akli pada menit 15. Di penghujung babak pertama, Akli kembali mencatat namanya di papan skor. Memasuki babak kedua, Marabunta meningkatkan tempo permainannya. Alhasil, menit 60 ditandai gol Rico ke gawang Persiraja. Hingga peluit panjang, skor 2-1 bertahan untuk kemenangan Persiraja Selection. (b23)


Hitam melangkah, mematikan lawannya empat langkah.


Turnamen yang berlangsung selama empat bulan ini diikuti sebanyak 18 fans klub di Kota Medan, di antaranya Manchester City Fans Club In-donesia (MCFCI) Medan, Chelsea Indonesia Suporter Club (CISC) Medan, Indo Man United Medan, Arsenal Indonesia Suporter (AIS) Medan, Inter Club Indonesia (ICI) Medan, Juventus Club Indonesia (JCI) Medan, Romanisti Medan, Indo Barca, dan Madri-dista Medan. Manajer AIS Medan, Pupu didampingi Kapten AIS Yanda, mengatakan keberhasilan AIS mempertahankan gelar juara tidak terlepas dari kerjasama pemain serta latihan rutin yang setiap minggu dilakukan. “Meskipun tahun ini ada perombakan, kami tetap mampu menjaga ritme permainan




1. Pegunungan yang memisahkan benua India dan Dataran Tibet. 5. Kumpul. 8. Pajak; Cukai. 9. Negara tetangga. 10. Bekas. 11. Gunjingan (dari mulut ke mulut). 14. Kerangka unsur kursus pendidikan; Ikhtisar suatu pelajaran. 18. Satu. 20. Selebaran warta singkat secara periodik. 23. Tahun Berdikari (singkatan di era orde lama). 24. Orang yang namanya terlupa atau tidak diketahui. 26. Kehilangan daya ingat, terutama tentang masa lalu. 27. Karangan mutiara; Keselarasan suara. 29. Khayalan. 33. Kentara. 35. Bukan. 36. Negara Arab di Asia Barat Daya. 37. Lutung; Loktong. 39. Anggaran Rumah Tangga. 40. Angkatan Laut. 41. Huruf ke-10 Arab. 42. Tetangga Iran. 43. Merdeka; Orang yang tidak berpartai.

1. Keledai (Arab). 2. Waktu setelah matahari terbenam hingga matahari terbit. 3. Tirai. 4. Kekal. 5. Abdi; Budak. 6. Menantu. 7. Buah yang jadi peribahasa: Seorang makan——, semua kena getahnya. 12. Universitas Sumatera Utara. 13. Ya; Setuju. 14. Tidak secara kebetulan. 15. Sifat laten. 16. Bagaikan. 17. Pojok sentilan di halaman depan Waspada. 19. Huruf ke-12 Arab. 20. Keringkasan bicara (linguistik/logi). 21. Timpa; Limbang. 22. Pohon penangkal harimau, 25. Surat mengundang. 28. Kendara terbang tidak bermesin untuk olahraga terbang layang. 30. Tidak liar. 31. Kelak. 32. Kukuh; Padat. 34. Datuk. 38. Tuang; Sadap; Sumbat untuk menutup lubang dalam tong. 41. Nada ke-2 musik.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, atau di kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan tak sampai lima menit. Jawabannya di halaman A2 kolom 1.

3 8 9 1 4 1 7 4 3 2 3 6 7 2 6 4 4 9 5 7 3

6 1 4 2 2 9 7 4 9 8 6 8 4 7 9 4 5 5 7 3 3 8 5 8 2 6 4 *228


WASPADA Senin, 13 Januari 2014


Vettel Pilih Nomor 1 MELBOURNE, Australia (Waspada): Seperti dilaporkan Crash, Minggu (12/1), FIA telah merilis pebalap yang akan mengikuti kompetisi balap Formula One (F1) musim 2014. Tak hanya itu, nomor yang akan terpampang di mobil tiap pebalap juga dibeberkan. Hal yang menarik dari balapan tahun ini adalah, sesuai aturan teranyar yang disepakati bersama FIA, para pebalap akan menggunakan nomor itu sepanjang kariernya. Namun catatan khusus, jika ada pebalap memakai nomor sama, hak diberikan kepada sang driver yang meraih posisi lebih baik di musim lalu. Meskipun tak ada keharusan, juara bertahan Sebastian Vettel (foto) tetap menggunakan nomor 1 untuk musim depan. Nomor alternatif pun telah dipilih jagoan Red Bull asal Jerman tersebut, yakni nomor 5. Nomor itu dipilih sebagai alternatif andai nantinya Vettel sudah tak lagi menyandang predikat juara. (m33/auto)

Nomor Pebalap F1 Musim 2014 Red Bull Racing: #1 Sebastian Vettel ( Jerman), #3 Daniel Ricciardo (Australia) Mercedes GP: #44 Lewis Hamilton (Inggris), #6 Nico Rosberg ( Jerman) Scuderia Ferrari: #14 Fernando Alonso (Spanyol), #7 Kimi Raikkonen (Finlandia) Lotus: #8 Romain Grosjean (Prancis), #13 Pastor Maldonado ( Venezuela) McLaren: #22 Jenson Button (Inggris), #20 Kevin Magnussen (Denmark) Force India: #27 Nico Hulkenberg ( Jerman), #11 Sergio Perez (Mexico) Sauber: #99 Adrian Sutil ( Jerman), #21 Esteban Gutierrez (Mexico) Toro Rosso: #25 Jean-Eric Vergne (Prancis), #26 Daniil Kvyat (Rusia) Williams: #19 Felipe Massa (Brazil), #77 Valtteri Bottas (Finlandia) Marussia: #17 Jules Bianchi (Prancis), #??? Max Chilton (Inggris)


UNIVERSITAS SUMATERA UTARA Jalan dr T. Mansyur No. 9 kampus USU Medan 20155 Telepon: 061-8211633, 8216575 Fax: 061-8219411, 8211822, 8211766 Laman:


PT PLN (Persero) Wilayah Sumatera Utara

Nomor: 64/UN5.1.R/SDM/2014 Tentang

PENERIMAAN TENAGA KEPENDIDIKAN PEGAWAI UNIVERSITAS SUMATERA UTARA TENAGA PENUNJANG KETERTIBAN DAN KEAMANAN Universitas Sumatera Utara melalui Biro Sumber Daya Manusia (SDM) saat ini membuka peluang untuk mengisi Tenaga Penunjang Ketertiban dan Keamanan 1. Persyaratan Umum: ● Warga Negara Indonesia ● Laki-Laki/Perempuan ● Membuat Surat Pernyataan Tidak pernah diancam/dijatuhi hukuman pidana (Format surat disediakan oleh panitia seleksi) ● Membuat surat pernyataan bebas dari bahan narkotika (Format surat disediakan oleh panitia seleksi) ● Melampirkan Surat Keterangan Berkelakuan Baik (SKBB) yang diterbitkan oleh Kepolisian RI untuk keperluan melamar pekerjaan sebagai Tenaga Kependidikan Pegawai Universitas Sumatera Utara Tenaga Penunjang Ketertiban dan Keamanan ● Melampirkan Surat Keterangan Sehat Jasmani dan Rohani yang diterbitkan oleh Dokter Pemerintah 2. Persyaratan Khusus ● Penidikan Minimal SMA Sederajat ● Berusia Minimal 21 Tahun ● Laki-laki: Tinggi Badan (min) 165 Cm, wanita: Tinggi (min) 160 Cm ● Berpengalaman minimal 3 tahun pada bidang ketertiban dan keamanan (lampirkan bukti pendukung, jika ada) ● Komunikatif, mampu bernegosiasi dan membangun tim kerja ● Memiliki Kecakapan, keahlian dan keterampilan penunjang bidang ketertiban dan keamanan (lampirkan bukti pendukung, jika ada) 3. Berkas Permohonan Permohonan ditujukan kepada Rektor Universitas Sumatera Utara beralamat Jalan Dr Mansur No. 9 kampus USU Medan, Kode Pos 20155 dengan melampirkan a. Surat Lamaran Kerja b . Curriculum Vitae c. Foto Copy Ijazah Terakhir d . Foto Copy Kartu Tanda Penduduk (KTP) e. Pas Foto terbaru 4X6 sebanyak 2 (dua) Lembar f. Surat Keterangan Berkelakuan Baik (SKBB) g . Surat Keterangan Dokter 4. Peyerahan Berkas Permohonan: Permohonan diserahkan kepada Biro Sumber Daya Manusia (SDM) Universitas Sumatera Utara, Gedung Biro Pusat Administrasi, Lantai 2 Jalan Dr Mansur No. 9 Kampus USU, Kode Pos 20155 selambatlambatnya tanggal 18 Januari 2014, pukul 13:00 WIB 5.

Jadwal dan Sistem Seleksi - Jadwal seleksi akan diadakan 20 s/d 30 Januari 2014 - Seleksi dilaksanakan dengan sistem gugur pada setiap tahapan - Tahapan Seleksi terdiri dari: ● Seleksi Berkas ● Ujian Tulis ● Tes Fisik ● Tes Psikotes - Pelamar yang berhak mengikuti tahapan seleksi akan diumumkan pada papan pengumuman Biro Sumber Daya Manusia USU, Laman USU: - Keputusan Panitia Seleksi Bersifat Mutlak dan tidak dapat diganggu-gugat Demikian untuk menjadi perhatian. Medan, 6 Januari 2014

Rektor dto

PEMBERITAHUAN Diberitahukan kepada Seluruh Pelanggan PT PLN (Persero) Wilayah Sumatera Utara, bahwa PT PLN (Persero) Wilayah Sumatera Utara kembali akan memberlakukan Uang Jaminan Langganan (UJL) sesuai dengan Surat Keputusan Direksi No.424.K/DIR/2013 Tanggal 31 Mei 2013 tentang Uang Jaminan Langganan (UJL). Oleh Karena itu, kepada seluruh Pelanggan yang melakukan Penyambungan Baru (PB) dan Perubahan Daya (PD) 01 Januari 2011 sampai dengan 30 Juni 2013, dimana pada periode tersebut tidak dikenakan UJL maka kepada Pelanggan pada periode tersebut akan ditagihkan kembali UJL mulai dari Januari 2014 sampai dengan Desember 2014 dengan cara MENCICIL BERSAMAAN DENGAN REKENING LISTRIK SETIAP BULANNYA. Demikian kami sampaikan terima kasih. Medan, Januari 2014

Prof. Dr. dr. Syahril Pasaribu, DTM&H, MSc, (CTM),Sp.A (K) Nip.195002101978111001 Pembantu Rektor II dto.

Prof Dr. Ir. Armansyah Ginting, M.Eng Nip. 196808071995011001

Manajemen PT PLN (Persero) Wilayah Sumatera Utara

Sumatera Utara

WASPADA Senin 13 Januari 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:35 12:48 12:36 12:43 12:42 12:39 12:36 12:31 12:38 12:38

‘Ashar 15:59 16:11 15:59 16:06 16:05 16:04 16:00 15:55 16:02 16:01

Magrib 18:34 18:44 18:34 18:39 18:39 18:41 18:35 18:31 18:37 18:35



Shubuh Syuruq


19:47 19:57 19:48 19:52 19:53 19:55 19:48 19:44 19:50 19:48

05:05 05:21 05:06 05:16 05:14 05:06 05:05 05:01 05:08 05:09

05:15 05:31 05:16 05:26 05:24 05:16 05:15 05:11 05:18 05:19

L.Seumawe 12:41 L. Pakam 12:34 Sei Rampah12:33 Meulaboh 12:45 P.Sidimpuan12:33 P. Siantar 12:34 Balige 12:34 R. Prapat 12:30 Sabang 12:48 Pandan 12:35

06:35 06:51 06:36 06:45 06:44 06:35 06:35 06:30 06:38 06:39

Zhuhur ‘Ashar 16:04 15:58 15:57 16:08 15:57 15:57 15:58 15:55 16:11 15:59





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:37 18:33 18:32 18:43 18:35 18:33 18:34 18:31 18:43 18:36

19:50 19:46 19:45 19:56 19:48 19:46 19:47 19:45 19:56 19:49

05:14 05:04 05:04 05:16 04:59 05:03 05:02 04:58 05:22 05:02

05:24 05:14 05:14 05:26 05:09 05:13 05:12 05:08 05:32 05:12

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:35 12:36 12:46 12:39 12:36 12:42 12:31 12:41 12:34 12:33

18:36 18:36 18:42 18:39 18:34 18:39 18:30 18:40 18:35 18:32

19:49 19:49 19:55 19:53 19:47 19:53 19:44 19:53 19:48 19:45

05:02 05:05 05:19 05:07 05:06 05:14 05:00 05:11 05:02 05:03

05:12 05:15 05:29 05:17 05:16 05:24 05:10 05:21 05:12 05:13

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:31 12:38 12:36 12:32 12:34 12:31 12:31 12:41 12:35 12:29 12:31

15:56 16:03 16:00 15:56 15:58 15:56 15:55 16:03 15:59 15:54 15:55

18:34 18:42 18:37 18:31 18:34 18:33 18:33 18:37 18:35 18:31 18:31

19:48 19:55 19:50 19:44 19:47 19:46 19:47 19:50 19:49 19:44 19:45

04:57 05:04 05:05 05:02 05:03 04:58 04:57 05:13 05:03 04:57 04:59

05:07 05:14 05:15 05:12 05:13 05:08 05:07 05:23 05:13 05:07 05:09

06:44 06:34 06:33 06:46 06:29 06:32 06:31 06:28 06:52 06:32

15:59 16:00 16:08 16:03 15:59 16:05 15:55 16:05 15:58 15:57

06:32 06:35 06:48 06:36 06:36 06:44 06:30 06:40 06:31 06:33

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:27 06:33 06:35 06:31 06:32 06:28 06:27 06:43 06:32 06:26 06:29

BLH, BHL, WGC Realisasikan Sumut Berhias


KONDISI air di anak sungai Desa Sei. Meran, Kec. Pangkalansusu berwarna hitam pekat diduga akibat terkontaminasi limbah PKS.

Air Sungai Wampu Hitam STABAT (Waspada): Warga kawasanbantaranSungaiWampu resah melihat kondisi air sungai menghitam bagaikan tercemar limbah, sehingga tidak dapat memanfaatkannya untuk mandi mau pun kebutuhan lainnya. Kondisi air sungai yang menghitam pekat tak pernah terjadi sebelumnya, kata beberapa warga yang bermukim di kawasan bantaran sungai Dusun Pantai Luas dan Dusun Ampera Desa Stabatlama Kec. Wampu kepada Waspada, Minggu (12/1). Pengamatan Waspada, kondisi air berubah menjadi hitam pekat sejak sore. Selain di Kec. Wampu, warga lain yang bermukim di kawasan bantaran

sungai pada beberapa dusun di Desa Pantaigemi dan Kel. Stabat Baru yang selama ini memanfaatkan air sungai untuk kebutuhansehari-harisepertimandidan air minum, juga menjadi resah. Berbagai kalangan menduga, tercemarnya air Sungai Wampu kemunmgkinan adanya pabrik di hulu sungai yang membuang limbahlangsungkesungai,bahkan ada yang menyebut kemungkinan akibat erupsi Gunung Sinabung. Sementara itu akibat tercemarnya air SungaiWampu yang biasanya jernih dan menguning sewaktubanjir,belumberdampak terhadap hewan sungai seperti ikan. “Belum ada ikan yang mati

terapung,” kata warga. Di Desa Sei Meran Sementara itu, air di aliran anak sungai (paluh) perbatasan antara Desa Sei. Meran, Kec. Pangkalansusu, dengan Lk X Kel. Bukitkubu, Kec. Besitang, juga berwarna hitam pekat, diduga akibatpencemaranlimbahindustri pabrik kelapa sawit PT JBP. Pantaun Waspada di lapangan, sungai yang dahulunya sangatpotensialdanmenjadilapak andalan bagi nelayan karena potensiudanggalahnya,kinitelah ditinggalkan nelayan, karena lingkungan anak sungai sudah tercemar. Sungai ini kondisinya sangat rentan karena sejak lama menjadi

tempatpembuanganlimbahsalah satu Pabrik Kelapa Sawit (PKS). Salah seorang pemuka nelayan yang juga Ketua Kelompok Masyarakat Pengawasan (Pokmaswas) yang dibentuk Dinas Kelautan dan Perikanan Langkat, Bakhtiar Nasution, minta instansi terkait memproses perusahaan yang membuang limbah sembarangan. Nasutionmenekankan kepada pemerintah untuk menindak tegas perusahaan yang merusak lingkungan. “Kita minta aparatur pemerintah dapat menegakkan peraturan perundangan secara konsisten, dengan harapan agar nasib nelayan tradisional dapat dilindungi,” katanya.(a01/a02)

Bupati Deliserdang Drs H. Amri Tambunan:

Pada HUT Ke-67, Waspada Makin Matang Dan Berkualitas Assalamualaikum wr. wb. DALAM suasana penuh kebahagiaan ini, kita semua pantas menyampaikan ucapan syukur kehadirat Allah SWT Tuhan Yang Maha Kuasa, bahwa tanpa terasa, Harian Waspada pada 11 Januari 2014 telah 67 tahun berkiprah sebagai salah satu media pers tertua dan terkemuka di Provinsi Sumatera Utara. “Untuk ini, atas nama pribadi, pemerintah serta mewakili seluruh warga Kabupaten Deliserdang, saya ucapkan Selamat Hari Ulang Tahun kepada Pimpinan dan segenap Pengasuh HarianUmum Waspada, diiringi doa dan harapan semoga tetap eksis dan tampil sebagai salah satu penerbitan pers daerah yang ikut memberi kontribusi besar mengembangkan perjalanan pembangunan pers di tanah air,” kata Bupati Deliserdang, H. Amri Tambunan. Dalamusiake-67HarianWaspadayangdiasuh insan-insan pers berpengalaman dan profesional, keberadaannya diakui semua pihak, karena terbit secara teratur dengan mutu serta tampilan jurnalistik yang semakin matang dan berkualitas, untuk menjalankan fungsinya sebagai penyebar informasi yang cepat, objektif dan edukatif, serta penyaji berita sosial kontrol yang konstruktif, di tengah derasnya tantangan arus kemajuan dan perubahan sekarang ini. Dalamerapembangunanbangsasekarang,persdiakuimenjadi bagian terpenting yang dapat memberi warna tersendiri dalam setiap pengambilan keputusan dan kebijakan publik melalui

pemberitaan sosial kontrol. Dengan kemajuan Teknologi Informasi, pers telah menjadi salah satu kebutuhan masyarakat, karena media ini paling efektif dan tersebar luas. Kesemuanya menunjukkan betapa besar pengaruh pers kepada masyarakat, betapa kuat daya informasi yang dilahirkannya, meski pun pengaruh ini dapat bersifat baik, dan adakalanya dapat pula menjadi sebaliknya. Pada kondisi seperti ini, maka patokanpatokan dasar yang harus tetap digunakan dalam mengembangkan kebebasan pers yang bertanggungjawab, adalah dengan tetap konsekuen memegang teguh Kode Etik Pers yang ada bagi terpeliharanya stabilitas jalannya roda pemerintahan, pembangunan dan kemasyarakatan, bagi upaya percepatan pembangunan, untuk menjawab tuntutanperbaikankehidupanwargayangsemakin tinggi, bahkan cenderung semakin kompleks. “Karenanya kami berharap Waspada tetap konsisten terhadap misiyangdiembanmelaluimottonya,DemiKebenarandanKeadilan, untuk dapat memberi kontribusi yang lebih besar lagi ke depan, dalam mensukseskan upaya percepatan pembangunan daerah khususnyadiKabupatenDeliserdangdanSumateraUtaraumumnya, di samping ikut mencerdaskan kehidupan bangsa sebagaimana amanahyangtertuangpadaPembukaanUUD1945,dengansemangat kebersamaan,Persaudaraandankekeluargaanyangsemakinindah dankokoh.Selamatulangtahun,majuteruspantangmundur.Dirgahayu Harian Umum Waspada …!!!

Bupati Serdang Bedagai, H. Soekirman:

Salam Hangat Dan Kebersamaan DENGAN memanjatkan puji syukur kehadiran Allah SWT atas nama Pemerintah KabupatenSedangBedagai,sayamengucapkan selamat ulang tahun ke-67 Surat Kabar Harian Umum NasionalWaspada, semoga senantiasa dalam lindungan Allah SWT, Amin. Saya mengucapkan terimakasih atas partisipasi dan kontribusi Harian Waspada memberikan informasi secara objektif, aktual, semua berita layak cetak. Hingga memasuki usianyayangke67tahuniniyangsudahmemiliki cukup banyak pengalaman asam dan garam dalam menghadapi berbagai perubahan dan sebagai surat kabar yang selalu konsisten dan tidak berubah, yaitu Menegakan Kebenaran dan Keadilan. Pada kesempatan ini saya ucapkan terimakasihdanpenghargaansetinggi-tingginya kepada Harian Waspada yang telah membantu penyampaian informasi kepada seluruh masyarakat tentang program-program pembangunan Pemerintah Kabupaten Serdai Bedagai, baik yang telah dilaksanakan mau pun yang akan direncanakan. Sehingga dapat mendorong partisipasi masyarakat dalam mewujudkan visi dan misi Kabupaten Serdang Bedagai. Karena itu saya berharap Harian Waspada dapat terus eksis sehingga diakui masyarakat di tengah persaingan industri media cetak yang saat ini begitu ketat, bukanlah sesuatu yang mudah untuk mempertahankan kepercayaan masyarakat terhadap

informasi yang telah diberikan. Dengan momentum ulang tahun Harian Waspada semoga merefleksikan diri ke arah lebih profesional dan taat azas, tak hanya isu tapi juga fakta faktual yang disajikan, sehingga memberi warna tersendiri dalam menghadirkan gambaran realitas bangsa ini. Kepada seluruh jajaran Harian Umum Waspada agar senantiasa dapat terus mengedepankan semangat serta memiliki prinsip loyal, cerdas, cepat dan akurat. Loyaldalamartiloyalitaskepadaperusahaan dan profesi, loyalitas pada perusahaan harus dilakukandenganmenjalankansistemperu-sahaan secara baik. Kalau itu dilakukan berarti mampu memberi kontribusi kepada perusahaan. Sedangkan loyalitas kepada profesi, sebagai wartawan khususnya harus bekerja profesional sesuai kode etik jurnalistik dan peraturan yang berlaku. “Demikian yang dapat saya sampaikan, semoga Harian Waspada dalam pemberitaannya terus memberi ilmu pengetahuan, informasi yang berimbang dan dapat membantu pemerintah daerah untuk mencerdaskan masyarakat Kabupaten Serdang Bedagai. Dan bersama Pemerintah Kabupaten Serdang Bedagai dapat terus menjadi mitra kerja dengan Harian Umum Waspada dalam menyebarluaskan informasi serta tetap diberi kekuatan dalam menjalankan tugas dan pengabdian. Wassalamualaikum WR.WB.”

DELISERDANG (Waspada): Badan Lingkungan Hidup (BLH) Provsu bekerjasama dengan YayasanBumiHijauLestari(BHL) serta Waspada Green Club (WGC) akan membuat kecamatan contoh yang Bersih Hijau Asri Sehat (BERHIAS), di Kec. Sunggal, Sei Semayang, Kab. Deliserdang. Hal itu diketahui pada saat ketiga lembaga ini melakukan acara pengecoran tiang besi tempatsampah,diPondokKecilDesa Sei Semayang, Minggu (12/1). Menurut Kepala Badan Lingkungan Hidup Prov. Sumut, DR. Ir. Hj. Hidayati, M.Sc, permasalahankebersihanmenjadisalah satuhalyangmendapatperhatian khususdariPemerintahSumatera Utara, apalagi saat ini tingkat pencemaran lingkungan semakin tinggi,dimanasalahsatunyadisebabkan tumpukan sampah yang menyebabkan parit dan sungai menjadi tempat pembuangan sampah, sehingga tidak saja menjadipenyebabbanjirtapijuga membuat lingkungan tercemar dan tidak nyaman, kumuh dan kotor serta tidak sehat. Untuk itu Hidayati siap mendukung kegiatan-kegiatan masyarakat terkait penanggulangan lingkungan kebersihan dan penghijauan. Dia berjanji apabila warga Sei Semayang sungguhsungguh ingin memperbaiki lingkungan, dia akan membantu memfasilitasitermasukmenyiapkan sarana prasarana yang dibutuhkan seperti peralatan, sosialisasi serta penyuluhan. Bahkan dirinya akan mengajukan angga-

ran dana. Namun bila ada bantuan dana pemerintah, hendaknya benar-benar dimafaatkan. Dalam kesempatan sama, Camat Sunggal M. Zaki mengharapkan masyarakat sungguhsungguh melaksanakan kegiatan ini. Jangan setengah hati, apalagi ini untuk kebaikan masyarakat itu sendiri. Sebagai camat, dia sangat menginginkan wilayah yang dipimpinnya Bersih Hijau Asri Sehat, bahkan kalau mampu mengelola sampah dengan bijak, dijadikan sumber devisa dan sumberpendapatanwarga,mini-

maldapatdijadikankomposserta bio gas. Sementara Prof. Rauf, tokoh masyarakat setempat yang dikenal sebagai praktisi lingkungan mengatakan dia akan terus melakukan pembinaan terhadap warga, tentu bersama aparat pemerintah. Sedangkan Dewi Budiati dari WGC yang juga dikenal sebagai pemerhati sampah dan penggiat lingkungan, mengharapkan program BERHIAS ini segera terealisasi dan bukan sekedar wacana apalagi hanya sekilas dan

sambil lalu. Dia berjanji ikut memberi sosialisasi dan penyuluhan pada warga cara-cara mudah mengelola sampah baik dengan metode bank sampah, biopori, pupuk komposdankerajinandaurulang sekaligus mengajarkan cara-cara efektif bergotongroyong. Demikian juga denga Ketua Yayasan Bumi Hijau Lestari Parlindungan Purba yang mengatakanakanmengusahakan dilakukanpemeriksaankesehatan donor darah terkait kesehatan masyarakat.(ihn)


KEPALA Badan Lingkungan Provsu Hj. Hidayati didampingi Ketua Yayasan Bumi Hijau Lestari Parlindungan Purba, Ketua Bidang Konservasi Lingkungan Waspada Green Club Prof. Dr. Rauf MP dan Camat Sunggal serta Kepala Dusun beserta warga melakukan pengecoran tiang-tiang besi di sepanjang pinggiran jalan Sei Semayang, Kab. Deliserdang.

Bupati Labuhanbatu Utara:

Waspada Dapat Menjadi Sarana Pembelajaran Menghadapi Pemilu 2014 Assalamualaikum Wr.Wb. SAYA mewakili seluruh masyarakat Kabupaten Labuhanbatu Utara mengucapkan selamat hari jadi Harian Waspada ke 67, semoga terus menjadi salah satu media cetak kebanggaan masyarakat Sumatera Utara. Dengan pengalaman 67 tahun saya yakin dan percaya, Waspada telah menjadi media cetak yang menyampaikan berita secara aktual, berimbang dan dapat dipercaya. Saya juga mengucapkan terimakasih kepada Harian Waspada karena berperan menyampaikan dan menginformasikan perkembangan pembangunan serta kegiatan di Kabupaten labuhanbatuUtara,sehinggamasyarakatluasdapat mengenal dan mengetahui kondisi Kabupaten Labuhanbatu Utara, di mana sekarang ini informasi merupakan sesuatu yang sangat dibutuhkan kita semua.

Di tahun 2014 ini kita akan melaksanakan Pemilu Legislatif dan pemilihan Presiden, saya berharap Harian Waspada dapat menjalankan perannya sebagai salah satu media cetak yang bisa dijadikan referensi masyarakat dalam menghadapi pemilu Legislatif dan pemilihan Presiden. Harian Waspada dapat menyampaikan perkembangan situasi politik di tanah air kepada masyarakat, sehingga dapat menjadi salah satu sarana pembelajaran politik bagi masyarakat dalammenghadapiPemilu2014nantinya.Dengan demikian masyarakat kita dapat menjadi pemilih yang cerdas di mana pemilih yang cerdas akan menghasilkan pemimpin-pemimpin yang cerdas pula, sehingga kita berharap bangsa Indonesia semakin maju dan sejahtera. “Sekali lagi saya ucapkan selamat hari jadi Harian Waspada ke 67.”

Sumatera Utara

B2 WASPADA Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

KOTAPINANG (Waspada): Program Jaminan Kesehatan Nasional (JKN) yang diselenggarakan Badan Penyelenggara Jaminan Sosial (BPJS) Kesehatan masih membingungkan warga di Kab. Labusel. Banyak warga peserta Jamkesmas, Jamkesda, dan PJKMU di daerah ini mengaku kesulitan untuk mendaftarkan diri. Syahman Syarif, warga Lk. Simarkaluang, Kel. Kotapinang, Kec. Kotapinang kepada Waspada, Minggu (12/1) mengatakan, hingga kini dirinya belum dapat mendaftarkan diri sebagai peserta JKN, karena tempat pendaftarannya terlalu jauh yakni di Rantauprapat,Kab.Labuhanbatu. “Kalaupun Askes membuka pendaftaran di RSUD Kotapinang, namun waktu layanannya hanya Senin dan Jumat,” katanya. Parahnya, kata dia, untuk

mendaftarkan diri warga harus membawa syarat lengkap. Sementara, lanjut dia, hingga kini warga tidak mengetahui apa saja syarat-syarat untuk mendaftarkan diri, karena mereka tidak pernah menerima sosialisasi. “Banyakwargamiskinmeninggal dunia karena tidak dapat berobat, sebab mereka nggak dapat mendaftar karena minimnya informasi,” katanya. Dewan Pendiri Ikatan Pemuda Otonom (Ipon) Kab. Labu-

sel, Rizal Sembiring mengatakan, banyak kalangan masyarakat di Kab. Labusel kesulitan untuk berobat akibat program JKN. Menurutnya, sosialisasi JKN belum dimengerti, sehingga program ini tidak memberikan manfaat bagi masyarakat. Karenanya, dia meminta pihak BPJS melakukan sosialisasi secara menyeluruh terkait ketentuan perlindungan dan JKN, agar masyarakat lebih mengetahui ketentuan tentang jaminan kesehatan. “Yang terpenting juga adalah realisasinya dan pelayanannya juga lebih baik sehingga benarbenar dirasakan manfaatnya oleh masyarakat.Saatinibanyakwarga miskin membutuhkan pengobatan, namun tidak belum terdaftar sebagai peserta JKN,” katanya. (c18)

Guru Di Labusel Belum Terima Insentif Gubernur KOTAPINANG (Waspada): Sejumlah guru di Kab. Labusel mengeluhkan belum terealisasinya pembayaran intensif dari Gubernur Sumatera UtaraTahun Anggaran 2013. Namun Kepala Dinas Pendidikan Pemkab Labusel, Zulkifli mengaku, keterlambatan itu disebabkan pihaknya masih mempersiapkan rekening masing-masing guru penerima bantuan. KetuaPersatuanGurusSwasta Indonesia (PGSI) Kab. Labusel, Simson Sibarani kepada Waspada, kemarin (12/1) menuturkan, dalam setahun ini guru di daerah ini belum menerima

insentif dari Gubernur. Padahal, kata dia, mereka telah menandatanganikwitansipenerimaandana itu akhir tahun lalu. “Nggak tahu apapenyebabnya.Paragurusudah mengeluhkepadaPGSI,”katanya. Dijelaskan,besarinsentifyang diterima seorang guru yang telah memiliki Nomor Unik Pendidik Tenaga Kependidikan (NUPTK) yakni Rp60.000/bulan. Pembayaran insentif tersebut kata dia, biasanya dilakukan per-12 bulan atau Rp720.000 per guru penerima. “Namun tidak tahu apa sebabnya dana itu belum terealisasi. Padahal ini sudah tahun 2014,” katanya.

Kepala Dinas Pendidikan, Zulkifli ketika dikonfirmasi via telepon seluler mengaku tidak adamasalahterkaitdanatersebut. Menurutnya, saat ini pihaknya sedangmempersiapkanrekening masing-masing guru penerima, sehingga pembayaran insentif itu nantinya langsung ditransfer melalui rekening. “Penerimaantahunsebelumnya ada masalah karena dilakukan secara manual. Kali ini kita tidak mau lagi, seluruhnya akan ditransfer ke rekening masingmasing guru. Mungkin Senin ini pembayarannya sudah dilakukan,” katanya. (c18)

Hubungi kami Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

IRT Korban Jambret Kalung Emas Lenyap RANTAUPRAPAT (Waspada): Lily, 48, ibu rumah tangga, warga Jalan Bukit Kota Pinang, Kabupaten Labuhanbatu Selatan dijambret di Pasar Gelugur Rantauprapat, Sabtu (11/1) sekitar pukul 09:00. Akibatnya, kalung emas milik Lily senilai Rp4,5 juta lenyap. Informasiyangdihimpundilokasikejadianmenyebutkan,peristiwa tersebut terjadi ketika korban usai berbelanja dan hendak pulang ke rumah anaknya yang ada di Rantauprapat. Saat hendak mencari becak bermotor (Betor), tiba-tiba dua pria tak dikenalnya menghampiri dan langsung menarik kalung milik korban. Mengetahui kalungnya telah dijambret, korban pun langsung menjerit, tetapi pelaku berhasil kabur dengan mengendarai sepedamotor Honda Revo tanpa memakai nomor polisi. Berharap agar pelakunya dapat ditangkap, korban langsung mendatangi Polres Labuhanbatu untuk membuat pengaduan. Sementara seorang Satpam Pasar Gelugur bernama Suswito Pangesti saat ditemui mengatakan, peristiwa itu terjadi saat seluruh Satpam sedang melaksanakan apel pagi. Begitu kami siap, barulah mereka mengetahui ada aksi penjambretan. Kapolres L.Batu AKBP Achmad Fauzi Dalimunthe SIK melalui Kasubag Humas AKP MT Aritonang saat dikonfirmasi membenarkan kejadian tersebut. “Benar, ada warga dijambret di Pasar Gelugur Rantauprapat.” “Kita sudah lakukan olah TKP dan memeriksa kamera CCTV yang ada di Pasar Gelugur. Namun hasilnya pelaku tidak terekam, sebab lokasinya sangat jauh dari kamera CCTV. Walau begitu, kita akan tetap proses laporan korban,” katanya. (a18)

Senin 13 Januari 2014

Pendaftaran JKN Sulitkan Warga

Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Penerbit: PT Penerbitan Harian Waspada


Waspada/Armansyah Abdi

SEORANG PNS Setdakab L.Batu sedang membersihkan halaman di sekitar Mushola Kantor Bupati L.Batu.

Ratusan PNS Setdakab L.Batu Jumat Bersih RANTAUPRAPAT (Waspada): Ratusan Pegawai Negeri Sipil (PNS) dan tenaga honorer di lingkungan Sekdakab Labuhanbatu melaksanakan gotongroyong Jumat Bersih di Komplek Kantor Bupati baru dan kantor bupati sementara, yang dikoordinir Asisten Administrasi UmumHElpinRiswan,SE,Jumat (10/1) pagi. Gotongroyong berjudul

“Gerakan Jumat Bersih” ini merupakan kegiatan yang rutin dilaksanakan para PNS di lingkungan Setdakab L.Batu dalam upaya mendukung program Bupati L.Batu dr H Tigor Panusunan Siregar, SpPD di bidang Kebersihan. Sebelum melaksanakan Jumat Bersih, ratusan PNS dan Tenaga Honorer ini terlebih dahulu mengikuti apel di depan

KantorBupatiBaruyangdipimpin Asisten Administrasi Umum sekaligus memberikan arahan tentang lokasi atau zona pelaksanaan gotongroyong. Para PNS dan Tenaga Honorer yang melaksanakan gotongroyong itu dilengkapi denganberbagaiperalatanseperti cangkul, garpu, sapu lidi, goni tempat sampah dan peralatan lainnya. (a18)

Tidak Ke Laut, Nelayan Menjaring Di Sungai TG TIRAM (Waspada): Mengisi kegiatan tidak melaut sebagian nelayan di pesisir pantai KabBatubaramemilihmenjaring di sungai untuk menutupi kebutuhan sehari-hari. ‘’Ini kerap dilakukan jika tidak turunkelautmenangkapikandan menjaring di sungai,’’ tukas sejumlah nelayan berskala kecil yang bertangkahan di Sungai Batubara Desa Mesjid Lama dan Indrayaman, Kec Talawi kepada Waspada, Minggu (12/1).

Merekamengakubelakangan ini sering tidak ke laut, salah satu faktornya karena cuaca tidak menentu,terkadangmusimangin disertai gelombang tinggi yang mengkhawatirkan. Sehingga, memilih berdiam di rumah sambil menjaring di sungai melakukan penangkapan ikan menggunakan sampan tempel. ‘’Aktivitas ini kami lakukan, setelah air laut pasang dengan menyisir sungai menjaring ikan,’’ tukas Sahar seorang

nelayan. Dari hasil menjaring tersebut mereka dapat menutupi kebutuhan sehari-hari di rumah.Seperti membeli beras maupun minyak goreng untuk keperluan masak. Nelayan memperkirakan kondisi cuaca tersebut berlangsung sampai Februari baru normal kembali. Meskipun cuaca tidak menentusebagianmerekajuganekat mencari nafkah di tengah laut karena desakan ekonomi. (a13)

Waspada/Helmy Has

JALAN desa dekat jalan beton di Guntung Kedai Sianam rusak berlubang berlumpur butuh perbaikan.

Warga Guntung Minta Perbaikan Jalan KEDAI SIANAM, Batubara (Waspada):Warga desa Guntung Kedai Sianam, Kec. Limapuluh mendambakan perbaikan jalan yang rusak berlubang memudahkan mereka berurusan ke kantor Bupati Batubara di Limapuluh. Jalan tersebut satu-satunya akses jalan lintas pantai Limapuluh- Simpang dolok -Kedai Sianam Perupuk-Gambuslaut -Kuala Tanjung. Jalaluddin, 52, warga Limapuluh, Minggu (12/1) mengakui ada pembangunan jalan rabat beton kurang lebih 1.000 meter dana BDB Provsu 2013 Rp1,5 miliar yang ternyata tak tahan lama.

Baru empat bulan, permukaan jalan sudah terkikis/terkelupas batu kerikil bersembulan menimbulkan debu. “Kami sudah puluhan tahun mendambakan sarana jalan Kedai Sianam-Simpangdolok dibangunberkualitastahanlama,tidakasal-asalan,” tukas Jalaluddin. Saat ini kondisi jalan desa memprihatin kan berlubangberlumpur,sulitdilintasikendaraanroda empat keatas bila hujan, truk muatan sawit sering terbenam. Di antara badan jalan yang rusak dekat jalan rabat beton yang butuh perbaikan. (a12)

Pelaksanaan Proyek Jalan RSUD Batubara Diduga Melanggar Kontrak LIMAPULUH(Waspada): PT.API Pemenang tender proyek jalan menuju RSUD Batubara kini menjadi sorotan masyarakat. Meski telah melewati tahun anggaran, proyek dengan biaya Rp,13,6 miliar ini masih tetap dikerjakan, diduga telah terjadi pelanggaran kontrak dalam pekerjaannya. Pantauan Waspada, Minggu (12/1) dalam pelaksanaannyapekerjaanituditemukanberbagai kejanggalan diantaranya pembangunannya menggunakan batu padas, sedangkan di bagian jalan lainnya terlihat batu kali . Pelaksana pekerjaan saat ditemui di lapangan mengaku mereka menggunakan batu padas karena sulit mencari batu kali saat musim hujan. Yang lebih mencurigakan, pada pangkal jalan terlihat pematangan jalan sebelum dicor dipadatkan dengan menimbun sirtu dan basecos, tapi begitu dibagian sepi memasuki daerah perkebunan tidak terlihat lagi pematangan lahan seperti itu. Jalan yang akan dibangun diratakan saja menggunakan greder dan langsung di cor. Menurut informasi yang diterima, pembangunan jalan menuju RSUD ini menelan biaya sebesar Rp13.672.809.000,00 ini dikerjakan oleh CV.API dengan nomor kontrak 01/LP/BDB/ SP/PPK-BB/2013, yang seharusnya telah selesai tahun 2013 . Namun kenyataannya sampai memasuki tahun 2014, pelaksanaan pekerjaan belum selesai dan terus berlanjut. Juru bicara Formitrasu Kamaluddin, kepada

Waspada mengatakan, sesuai Perpres No 54 Tahun 2010 yang diubah dalam Perpres No 70 tahun2012,pasal118ayat(1)menyebutkan,apabila terjadi pelanggaran dan/atau kecurangan dalam proses pengadaan barang/jasa, rekanan dapat dikenakan sanksi administrasi, dituntut ganti rugi dan/atau dilaporkan secara pidana. Sebelumnya, Jumat (10/1), pengecoran jalan hari itu sempat tertunda beberapa saat dan para pekerjapun bubar meninggalkan lokasi. Saat kedatangan sejumlah LSM yang meminta kejelasan dari pihak berkompeten dimana pengerjaan dinilai menyalahi RAB. Proyek tersebut juga tidak diketahui kapan selesainya sebab pada plank proyek tidak tertera volume sertamasadimulaidanselesainya,sehinggaelemen masyarakat menduga proyek bernomor kontrak 01-LP/BDB/SP/PPK/LU/PUP-BB/2013 tersebut juga melanggar undang-undang keterbukaan informasi publik. Dibalik kritik LSM dan sorotan media, situasi itu diduga dimanfaatkan oknum wartawan salah satu media terbitan Medan berinisial JI untuk meraup keuntungan. Pelaksana PT API, akrab dipanggil Adi, didampingi pengawas proyek Usup, kepada sejumlah wartawan di lokasi proyek membenarkan adanya pengkondisian wartawan melalui JI sebesar Rp15 juta. “Itu untuk wartawan Kab. Batubara, bukan untuk sekelompok wartawan”, jelas Usup menyayangkan. (c05)

Dua Janda Infakkan Tanah Untuk Bangun Masjid RANTAUPRAPAT (Waspada): Keteladanan dicontohkan dua orang janda, Butet danTayak.Keduanya,67tahun dan walau hidup serba sederhana, mereka ikhlas menginfakkan tanahnya yang terletak di tepi jalan Lintas Sumatera, Desa Kampung Baru, Kec. BilahBarat,untukpembangunan sebuah masjid. Wakil Bupati Labuhanbatu Suhari Pane SIP menyampaikan itu dalam sambutannya saat peletakan batu pertama pembangunan MasjidMinasSobirindiJalanLintas Sumatera Desa Kampung Baru, tepatnya Dusun Purba Waspada/Ist Tua, Jumat (10/1). DUA janda foto bersama dengan tokoh masyarakat di lokasi Wabup mengatakan, walau kekurangan secara tanah yang diwakafkan untuk pembangunan masjid. ekonomi, kedua ibu tersebut mampu bersikap faatkeutamaansedekah,pertama,menghapusdosa, revolusioner. Keduanya berinfaq di saat mereka kedua,mendapatnaungandiharikiamatdanketiga, tidak punya harta. Hal ini harus menjadi teladan hartayangdiinfakkantidakakanpernahberkurang. bagikitasemuauntukselalumemberikansebagian “Sedekah membawa berkah, mari kita dari harta kita kepada orang yang membutuhkan. budayakan sedekah dan diberikan kepada yang Suhari Pane menambahkan, teladan yang berhak,” pinta Mantan Ketua KPU L.Batu itu. diberikan kedua ibu kiranya memacu semangat Acara tersebut dihadiri Camat Hardianto Ginting, kita untuk terus memberikan sebagian dari harta Kades, BPD, Kades, KUA Bilah Barat H. Sobri kita kepada yang berhak. Dikatakan, ada tiga man- dan para remaja masjid. (a18)

HUT Satpam Ke-33 Di Polres L. Batu

Waspada/Iwan Has

SEORANG nelayan di atas sampan tempel terlihat menjalankan aktivitas menjaring ikan di Sungai Batubara setelah tidak ke laut, karena cuaca tidak menentu musim angin dan gelombang.

RANTAUPRAPAT (Waspada): Kapolres Labuhanbatu AKBP Achmad Fauzi Dalimunthe, SIK menegaskan pada HUT Satuan Pengamanan (Satpam) ke-33, Kamis (9/1) di Rantauprapat, Labuhanbatu mengatakan, Satpam bagian dari Kepolisian. Boleh-boleh menangkap, tapi tidak bisa memeriksa dan pada dasarnya fungsi antara SatpamdenganPolisisamasebagaipetugaspenjaga keamanan. Namun, dalam kenyataannya di tengahtengah masyarakat, kata sejumlah wartawan dan LSM Rantauprapat, seluruh hasil penangkapan Satpam ketika diserahkan ke Polres Labuhanbatu tidak diproses seperti pemeriksaan kasus yang merupakan hasil tangkapan langsung petugas Polres Labuhanbatu. “JangankantangkapanSatpam,yangditangkap petugas TNI saja selalu lamban diproses bahkan tidak diproses oleh Polres Labuhanbatu. Padahal TNI memang resmi aparat negara,” kata sejumlah wartawansaatmengomentaripenegasanKapolres. Masyarakat Labuhanbatu sudah sering melihat dan memperhatikan, hasil tangkapan di luar Polisi terhadap sesuatu tindak pidana,

misalnya pencurian atau penyelewengan lainnya itu selalu tidak begitu diproses oleh Polres Labuhanbatu. Bisa ditolak polisi dengan berbagai alasan. Sementara, Kapolres AKBP Ahmad Fauzi menjelaskan, terkait keluhan sejumlah Satpam yang telah berhasil menangkap pelaku pencurian aset perusahaan namun tetapi tidak ditahan. “Peraturan Mahkamah Agung (PERMA) yang menyatakan bahwa pencurian di bawah Rp2,5 juta merupakan tindak pidana ringan. Jadi itu tipiring, sesuai dengan PERMA, akan tetapi kami akan seminarkan untuk mencari formula yang tepat terkait itu,” kata mantan Kapolres Madina itu berkilah. Selanjutnya, Kapolres meminta kepada sejumlah pimpinan perusahaan agar dapat memperhatikan kesejahteraan Satpam ke depan. “Saya yakin, seluruh Satpam akan bekerja sepenuh hati dan semaksimal mungkin melakukan pengaman aset, untuk itu, saya berharap pihak manajemen juga dapat memberikan perhatian khusus kepada Satpam yang berprestasi, ujar Kapolres. (c07)

Sumatera Utara

WASPADA Senin 13 Januari 2014


Tunggakan Raskin Tabagsel Rp2,1 M P. SIDIMPUAN (Waspada): Realisasi penyaluran beras miskin (Raskin) untuk lima kabupaten/kota di Tabagsel telah 100 persen. Namun, tunggakan raskin mencapai Rp2.119.399.100. Hal itu dikatakan Kepala Kantor Sub Divisi Regional IV Bulog Padangsidimpuan, Maidana Aulia Siregar SH saat menerima audensi pengurus dan anggota Persatuan Wartawan Indonesia

(PWI) Tapanuli Bagian Selatan (Tabagsel), di ruang kerjanya, kemarin. Dalam pertemuan tersebut, Kasubdivreg IV Bulog Padangsidimpuan Maidana Aulia Siregar,

SH didampingi staf. Sedangkan pengurus dan anggota PWI Tabagsel(Tapanulibagianselatan), Hairul Iman Hasibuan (Ketua) beserta pengurus lain. Maidana menjelaskan, total alokasi pagu raskin di Tabagsel yakni Kab. Tapsel, Kota Padangsidimpuan, Madina, Paluta dan Palas 18.589.050 Kg dengan realisasi penyaluran 100 persen, masing-masing Kab. Tapsel pagu raskin 4.493.025 Kg, Kota Padangsidimpuan 1.842.525 Kg, Madina 6.717.600 Kg, Palas 2.802.375 Kg dan Paluta 2.733,525 Kg. Sedangkan total pagu raskin untuk 12 kabupaten/kota di

wilayah kerja Subdivreg IV Bulog Padangsidimpuan sudah termasuk Pulau Nias, Tapteng dan Sibolga keseluruhannya mencapai42.631.845Kg,denganharga per-kilogram raskin Rp1.600. Untuk tahun 2014 alokasi raskin masih sama dengan 2013. Sementara tunggakan raskin di wilayahTabagsel sampai akhir 2013 Rp2.119.399.100 dengan rincian tunggakan Kab. Madina Rp1.415.735.500, yakni pada 2010 Rp127.893.000, 2011 Rp74.555.500,2012Rp176.293.000 dan pada 2013 Rp1.036.994.000. Kab. Tapsel Rp430.780.000, Kota Padangsidimpuan

Rp15.240.000, Paluta Rp183.526.000 dan Palas Rp138.217.600. Tunggakan tagihan Kab. Madina terjadi empat tahun sejak 2010 sampai 2013 dan empat kabupaten/kota lainnya terjadi pada 2013. “Kita masih memberikan toleransi waktu kepada Pemkab dan Pemko untuk melunasi tunggakan tagihan raskin tersebut dan diharapkan daerah yang menunggak secepatnya melunasinya agar SK pagu raskin 2014 dapat segera ditandatangani Gubsu, sehingga penyaluran raskin 2014 tidak terkendala,” katanya. (c13)

Kemenag Tapsel Gelar HAB Ke-68 Di Batangtoru Waspada/Ahmad Cerem Meha

KASUB divreg IV Bulog Padangsidimpuan, Maidana Aulia Siregar, SH menerima cenderamata dari pengurus dan anggota PWI Tabagsel (Tapanuli Bagian Selatan) melalui Hairul Iman Hasibuan (Ketua).

Pemasangan APK Bertambah Ramai BATUBARA (Waspada): Pemasangan alat peraga dan atribut kampanye (APK) pemilu di zona larangan di Kabupaten Batubara semakin ramai. Tidak diketahui pasti mengapa pelaksana kampanye mensepelekan keputusan Bupati Batubara no.266/KPU/2013 tanggal 9 Desember 2013 tentang penetapan kawasan larangan pemasangan AKP termasuk di jalan protokol tertentu. “Sampai, Minggu (12/1) puluhan, AKP masih terpasang di jalan protokol, belum ada tindakan pihak Panitia Pengawas Pemilu (Panwaslu)Kab.Batubara,bukannyaditertibkanmalahanpemasangan AKP tambah ramai,” tukas Khoirudin, tokoh pemuda di Batubara, Minggu (12/1). Menurut dia (Khoirudin), di Talawi, sepanjang jalan protokol (zona larangan) Sei Muka - Pahang, jalan Imam Bonjol LabuhanrukuSimpang Empat, jalan Perintis Kemerdekaan Simpang Empat- Dahari Indah banyak terpasang AKP yang dinilai merusak keindahan lingkungan kawasan setempat. Sama halnya di Tanjungtiram, jalan protokol Jl. Merdeka (Ujungboom-batas Talawi), Jl. Rakyat (Tanjungtiram-Bagandalam) Jl. Limalaras (Limalaras -Pematang Rambai) masih ramai bertebar pemasangan alat peraga kampanye. Menurut sumber, pemasangan AKP di Batubara kurang sosialisasi kepada parpol setempat, ada juga menangkis seakan keputusan Bupati Batubara tentang zona larangan kurang jelas, apakah yang dipasang melintang jalan atau yang di pinggir jalan atau di halaman rumah penduduk. “Yang penting Panwaslu Batubara lebih kreatif memahami tupoksinya untuk mengawal kondusivitas menjelang Pemilu nanti,” ujarnya. (a12)

TAPANULI SELATAN (Waspada): Jajaran Kementerian Agama (Kemenag) Kab.Tapanuli Selatan (Tapsel) menggelar upacara Hari Amal Bakti (HAB) ke-68 Kemenag di Lapangan Sipente Hapesong Baru, Kec. Batangtoru, baru-baru ini. Kegiatan ini diikuti ratusan pegawai dari Kemenag Tapsel, TNI, Polri dan siswa. Turut serta penampilan drum band Madrasah Tsanawiyah Negeri (MTsN) Batangtoru. Di acara ini pidato sambutan Menteri Agama RI melalui Bupati Tapsel H Syahrul M Pasaribu mengatakan, pembangunan kehidupan berbangsa

dan bernegara memiliki dimensi keagamaan, moral dan spiritual yang harus selalu dijaga. “Memperingati ulang tahun kementerian agama bukan sekadar kegiatan rutin organisasi, tetapidijadikanmediaintrospeksi diri, sejauhmana kita melaksanakan tugas pokok dan sejauhmana kita merespon tuntutan dan kebutuhan masyarakat melalui peran yang kita jalankan,” paparnya. Sementara itu, Kepala Kankemenag Tapsel Drs H Amran, menyampaikan terimakasih dan penghargaan yang tinggi atas dukungan lintas sektoral baik

pemerintah maupun masyarakat, termasuk Pemda dan organisasi keagamaan, yang telah mendukung pelaksanaan tugas dan program Kementerian Agama selama ini. “Saya juga memberikan penghargaan atas kerja keras, karya dan dedikasi seluruh jajaran Kemenag Tapsel. Kita semua bekerja dengan visi yang sama. Hanya melalui kerjasama, kekompakan dan kebersamaan kita mampu mencapai kinerja terbaik dalam mewujudkan program strategis Kementerian Agama,” ujarnya, Minggu (12/ 1). (c13)

Waspada/Sy. Nasution

DIRJEN Peternakan dan Kesehatan Hewan Ir.Syukur Irwanto bersama Direktur Perkembangbiakan Ir.Abubakar didamping Kadis Peternakan Tapsel Ir.Hamdan Nasution menuju lokasi peternakan Sipirok.

Dirjen Peternakan Tinjau Peternakan Sapi Di Sipirok SIPIROK(Waspada):DirekturJenderal(Dirjen) Peternakan dan kesehatan hewan dari KementerianPertanianmeninjaulokasi tempatpeternakan sapi di Desa Ramba Siasur, Kec. Sipirok, Kab. Tapanuli Selatan, Sabtu (11/1). Dirjen Peternakan dan Kesehatan Hewan Ir. Syukur Iwantoro, MBA, didampingi Direktur Perkembangbiakan Ir. Abu Bakar, rombongan Kementerian Pertanian, Kadis Perkebunan dan Peternakan Tapsel, Ir. Hamdan Nasution beserta staf dinas peternakan dan Ketua Kelompok Tani Sipirok. Iwantoromengatakan,kegiataninimerupakan program Kementerian Pertanian untuk meninjau langsung lokasi pembibitan dan pengembangan yang ada di daerah-daerah sebagai langkah swasembada daging di Indonesia. “Kita melakukan peninjauan langsung proses perkembangbiakansapididaerah,sebagailangkah upaya pemerintah melaksanakan proses swasembada daging di tahun ini,” kata Syukur. Untuk memenuhi target swasembada daging, Kementerian Pertanian memiliki tiga langkah yakni, kawasan Timur model padang pengembalaan, di Jawa proses penggemukan dan Sumateradilakukanintegrasisapidengantanamansawit. “Langkah yang harus ditempuh untuk memenuhi kebutuhan daging sapi di Indonesia, sesuai program pemerintah yang akan melakukan swasembada daging agar mengurangi impor daging luar,” ujar Iwantoro

Menurut Kadis Peternakan Ir. Hamdan Nasution, sebagai menyahuti program pemerintah itu, Pemkab harus memiliki pengembangbiakan sapi dan kerbau untuk memenuhi program pemerintah dalam swasembada daging Kata Hamdan, target untuk tahun 2014 Dinas Perkebunan dan Peternakan Tapsel yakni akan melahirkan 800 ekor anak sapi dengan proses perkawinan inseminator buatan yakni dengan cara memasukkan sperma sapi jantan ke kelamin sapi betina. Lebih lanjut lagi, program inseminator buatan tersebut sudah dilakukan terhadap 10 ekor sapi betina produktif, dengan jumlah sapi betina yang ada di Tapsel 239 ekor. Berdasarkan informasi, jumlah sapi potong yang ada diTapsel 449 ekor, sedangkan sapi betina produktif 239 ekor dan tersebar di 14 kecamatan di Tapsel. Sebenarnya,jikadibandingkondisipeternakan tahun 80-an, keadaan ini jauh menurun, namun mengingat luasnya areal peternakan yang dijadikan areal perkebunan, hal ini tidak dapat dihindari. Namun, dengan adanya program pemerintah mengadakan integrasi sapi dengan tanaman sawit, peluang Tapanuli Selatan untuk menjadi lumbung ternak, kembali terbuka lebar. Peternakan Ramba Sihasur Kec. Sipirok, jumlah sapi potong 85 ekor terdiri dari 20 ekor sapi jantan,20ekorsapibetinamuda,25ekorsapibetina produktifdewasadan20ekorsapiberumur1sampai 8 bulan dengan luas lahan 4 hektar. (a26)

Plt. Bupati Madina Drs Dahlan Hasan Nasution


BUPATI Tapanuli Selatan sedang membacakan pidato Kementerian Agama RI di apangan Sipente Kec. Batangtoru pada upacara HAB ke-68 Kemenag Tapanuli Selatan.

Wali Kota Tanjungbalai

Waspada Tetap Eksis Di Tengah Persaingan Media WALI KOTA Tanjungbalai, Dr. H. Thamrin Munthe, M.Hum mengatakan, kendati banyak media massa yang muncul, baik cetak mau pun elektronik, namun Harian Waspada tetap eksis di tengah persaingan yang semakin kompetitif, bahkan mampu berada di garis terdepan dalam memberi informasi kepada masyarakat. “Di usianya ke 67, Waspada tetap eksis dan mampu mempertahankan posisinya sebagai media di garis terdepan yang memberi informasi kepada masyarakat,” ujar Thamrin di ruang kerjanya Kamis (9/1). Menurut Thamrin, Waspada bertanggungjawab dalam menyajikan informasi kepada masyarakat. Maksudnya, berita yang terbit tidak menduga-duga apalagi mengada-ada, bahkan tidak pernah mencaplok berita lain. “Berita Waspada aktual, dan kalau kita tidak membaca Waspada hari ini, berarti kita ketinggalan informasi hari ini,” ujar Thamrin. Dosen IAIN Sumut itu juga memuji tim kerja Waspada yang yang memegang teguh kode etik jurnalistik, sehingga informasi yang disajikan berdasarkan fakta atau apa adanya, tidak ditambahi apalagi dikurangi. “Satu berita sepihak, maka media tidak mampu menjembatani kepentingan masyarakat, media seperti itu tidak bertahan lama. Dan sampai hari ini, Waspada tetap komitmen dengan independensinya, sehingga tidak menimbulkan kesenangan sepihak,” kata Thamrin. Mengenai tampilan Waspada, Thamrin juga memberi pujian. Alasannya, kendati sederhana dan tidak mencolok, tapi mampu memenuhi standarisasi tulisan dan informasi. Menurut Thamrin, penyusunan beritanya, terutama di halaman utama mau pun headline halaman lain, mampu menarik perhatian

masyarakat untuk membacanya sampai habis. “Saya belum pernah melihat dan membaca judul berita yang diangkat Waspada menjadi perhatian negatif,” tegas Thamrin. Anak Agen KendatikinimenjabatWaliKotaTanjungbalai,namunH.Thamrin Munthe tidak sungkan-sungkan membeberkan kisah kecilnya sebagai anak agen pertama Harian Waspada di Brastagi. “Ayah saya, MuhammadYamin Munthe (alm), merupakan agen pertama Waspada di Berastagi, makanya saya baca Waspada sejak 1960an,” ujar Thamrin sumringah. Untuk meyakinkan Waspada, suami Dra. Hj. Armaini Jannah itu pun menyebutkan warna tulisan surat kabar yang didirikan H. Muhammad Said dan Hj. Ani Idrus pada 11 Januari 1947.“Warna tulisan Waspada itu, dari hitam diubah menjadi biru dan kini merah,” sebut Thamrin. Sebab itu Thamrin menyatakan, mulai pertama hingga saat ini dia membaca Waspada, beritanya tetapup to date dan bahasanya gampang dicerna. Maka Waspada bukan hanya milik kelompok elit, tapi juga kelompok menengah ke bawah. “Semua merasa memiliki Waspada, dari lapisan atas hingga ke bawah,” tutur Thamrin. SatuhallagiyangmenurutThamrinsangatpositifdariWaspada,yaituinformasinya berbentuk positif dan tidak pernah dikomplain terkait SARA serta mampu mengikuti perkembangan ilmu pengetahuan dan teknologi. Menurut Thamrin, semua ada dan bisa di Waspada, baik kebutuhan politik, ekonomi, pendidikan, seni dan budaya termasuk hubungan adat istiadat. “Dirgahayu Harian Waspada. Teruslah berjaya dan tetap setia sebagai media yang menyuarakan kebenaran dan keadilan serta membela kepentingan masyarakat.”

Secara Nyata Waspada Menyentuh Semua Lapisan Masyarakat PLT. Bupati Madina Drs. Dahlan Hasan Nasution mengatakan, kematangan dan pengalaman yang dimiliki Harian Waspada saat ini sudah dapat diandalkan untuk melakukan tugas jurnalistik. Sebagai koran berpengaruh dan punya segudang pengalaman, Waspada harus terus bertekad lebih eksis dalam menyuarakan pemberitaan demi Kebenaran dan Keadilan sesuai mottonya. “Harian Waspada harus terus meningkatkan fungsi pers ke depan, karena tantangan yang dihadapisemakinberat,sehinggalangkahkedepan juga bisa semakin mendapatkan tempat di hati sanubari masyarakat pembaca setia maupun pembaca baru,” ujar Dahlan Hasan (foto), saat ditemui di Panyabungan, Jumat (10/1). Dahlan didampingi Kabag Humasy dan Protokol Setdakab Madina, Arbiuddin S. Harahap, menyebutkan, dalam perjalanan Harian Waspada selama 67 tahun secara nyata telah menyentuh semualapisanmasyarakat.Haliniditandaidengan konsumen atau pun pembaca Waspada yang semakin meningkat tahun demi tahun. Momentum Hari Jadi ke -67 pada Sabtu 11 Januari 2014, dapat membuat keluarga besar Harian Waspada lebih profesional dan percaya diri dalam menyuarakan informasi sesuai kebutuhan pembacanya. Untuk mencapai cita-cita tersebut tentu dengan cara meningkatkan kualitas berita yang lebihmendalam,kualitascetakanyanglebihtajam, memperluas jaringan pemasaran dan komponen lainnya sehingga saling mendukung dalam satu manajemen yang kuat dan solid. Menurutnya, menapaki eksistensinya, Harian Waspada telah ikut mengambil peran alam mengantarkan bangsa ini dalam berbagai episode kesejahteraan, bahkan Waspada telah berkarya

sejak Indonesia merdeka, masa orde lama hingga era reformasi saat ini. “Masyarakat Kabupaten Mandailing Natal, tentu bangga dengan sejarah panjang yang berhasildilaluitersebut,sehinggamenempatkan Waspada sebagai salah satu surat kabar tertua di Indonesia ,” terangnya. Atas nama Pemerintah Kabupaten Mandailing Natal, Dahlan Hasan Nasution sangat berterima kasih kepada HarianWaspada, karena bagi dirinya Waspada sangat membantu mempublikasikan pembangunan di daerah ini. “Dirgahayu Harian Waspada ke -67, teruslah berjaya dan tetap setia sebagai media yang menyuarakan kebenaran dan keadilan.”

Bupati Tapanuli Selatan

Bupati Labuhanbatu

Usia 67 Tahun, Waspada Sudah Mapan

Waspada Memberi Pengaruh Pemda Dalam Mengambil Keputusan

KAMI melihat Harian Waspada tetap eksis dalam melakukan karya jurnalistik di tengah masyarakat.Denganmenyajikaninformasi-informasi aktual dan akurat, baik sifatnya pendidikan, hiburan, kemasyarakatan mau pun sosial kontrol. Karena itu, mengingat saat ini kita telah berada pada era keterbukan dan kebebasan pers, sudah tentu berbagai karya jurnalistik khususnya media cetak dan elektronik, tumbuh dan berkembang cepat dengan melihat peluang atau segmen pasar masing-masing. Keadaan ini mau tidak mau harus disiasati dengan pertimbangan komprehensif, mengingat adanya persaingan yang cukup ketat, baik cara penyajian, kecepatan, keakuratan data, sistem pemasarannya dan berbagai keunggulan yang harus disajikan ke publik, apabila suatu media akan tetap eksis dan mendapat simpati pelanggan atau calon pelanggan. Pada 11 Januari 2014, usia HarianWaspada genap berkiprah di dunia Jurnalistik selama 67 tahun. Hampir tujuh dasawarsa yang menurut kami, sudah termasuk usia mapan di bidang pengalaman dalam pengelolaan suatu media. Tantangan, hambatan tentu telah banyak dilalui. Ke depan kami menyarankan agar hubungan baik, kerjasama yang telah terbina agar terus dilanjutkan dan ditingkatkan. Karena masyarakat setiaptahuntingkatpendidikannyasudahsemakin baik, ini tentu akan diindikasi dengan semakin kritisnyamasyarakatdalammemilihdanmemilah mana media yang terbaik bagi diri, kelompok mau pun organisasinya. Untuk itu teruslah berkarya dan berkreasi, agar keberadaan harian ini tetap berkembang pada masa-masa datang, serta menyajikan berita yang up to date, kritis dan berimbang, karena bagaimana pun juga,

Assalamualaikum Wr Wb, SERAYA mengucapkan puji syukur kehadirat Allat SWT, Tuhan Yang Maha Esa, saya atas nama pribadi, juga Pemerintah Kabupaten Labuhanbatu dan seluruh masyarakat Labuhanbatu mengucapkan Selamat Ulang Tahun ke-67 kepada Harian Waspada. Semoga di usia yang ke-67 tahun, kita semua diberi kekuatan, kesehatan dam kearifan sehingga Surat Kabar Harian Waspada semakin menunjukkan eksistensinya dengan tetap berpijak pada motto, Demi Kebenaran dan Keadilan. Tanpa terasa, Harian Waspada yang merupakan koran kebanggaan masyarakat Sumatera Utara, hari ini sudah memasuki usia 67 tahun. Waspada salah satu media yang dapat menyampaikan informasi secara jelas dan akurat, sehingga aspirasi masyarakat yang disampaikan melalui tulisan dapat memberi pengaruh kepada kebijakan Pemerintah Daerah dalam mengambil keputusan. Sejak terbit pertama kali 11 Januari 1947, Harian Waspada dikenal sebagai Surat Kabar yang sangat anti terhadap Belanda. Didirikan oleh tokoh pers nasional H. Muhammad Said (alm) dan Hj. Ani Idris (almh),Waspada lahir dengan tujuan awal untuk mengingatkan tokoh-tokoh pergerakan yang ada di Sumatera Utara kala itu, agar mewaspadai keberadaan Belanda di tanah air. Pada momentum Hari Jadi ke-67, Pemerintah Kabupaten Labuhanbatu berterimakasih atas peranan Waspada selama ini, yang telah memberi kontribusi terhadap penyebarluasan informasi berbagai program dan kegiatan pembangunan khususnya dalam tiga tahun (2010-2013) kepemimpinan Bupati-Wakil Bupati Labuhanbatu dr H. Tigor Panusunan Siregar, SpPD-Suhari, SIP. Berbagai program dan kegiatan pembangunan di tengah keterbatasan anggaran Pemkab L. Batu itu, antara lain program pemberian bea siswa terhadap lebih kurang 500 pelajar SMA Labuhanbatu yang berhasil lulus di berbagai Perguruan

Tinggi Negeri (PTN) di seluruh Indonesia pada 2013, dengan besaran bea siswa Rp4 juta - Rp7 juta. Pada tahun 2014 ini, Pemkab L. Batu kembali membuka peluang memberi bea siswa terhadap 1000 pelajar yang mampu menembus PTN. Di samping itu, setiap tahun juga memberi bea siswa bagi mahasiswa yang dinilai berprestasi khususnya mahasiswa dari kalangan keluarga tidak mampu. Selain untuk mengejar kemaslahatan duniawi, Pemkab L. Batu juga berupaya menanamkan spritualitas kepada anak-anak daerah sebagai bekal kehidupan akhirat melalui ‘Program Labuhanbatu Mengaji’, yang telah diterapkan sejak 2013 di 100 masjid. Di bidang ini Pemkab L. Batu memberi honor kepada 100 guru mengaji Rp700.000/orang/bulan di 100 masjid tersebut. Pada tahun 2014 ini, menambah jumlah 100 masjid lagi sehingga ada200masjiddijadikantempatpelaksanaanprogramLabuhanbatu. Tidak untuk umat Islam saja, pada 2014 ini juga melaksanakan program ‘Sekolah Minggu’ bagi umat Kristiani, dengan besaran honor yang sama dengan pengajar pada program Labuhanbatu Mengaji. Di sektor infrastruktur, masyarakat sudah menikmati jalan mulus dan lebar serta jembatan dan parit yang bagus khususnya di Kecamatan Rantau Utara dan Rantau Selatan, yang telah dibangun secara sporadis pada 2013. Padatahun2014ini,sayatelahmencanangkansebagai‘TahunKerja’.Dengandukungan anggaran yang sedikit membaik ketimbang tiga tahun sebelumnya, diharapkan akan lebih banyak lagi berbagai program pembangunan pro rakyat dapat dilaksanakan PemkabL.Batu.Namun,semuaitutetapharusmendapatdukungandarimediamassa khususnya Waspada yang dikenal sebagai Pelita Masyarakat Sumut yang tidak hanya sebataspenyebarinformasikepadakhalayak,tetapijugaikutmengawalpenyelenggaraan pemerintahan dan pembangunan di Kabupaten L. Batu, melalui karya junalistiknya.

peranan Waspada bagi Kabupaten Tapanuli Selatan adalah bagian yang tak terpisahkan dari akselerasi pembangunan di Bumi Tapsel, sebagai bagian dari wilayah Sumatera Utara dan Negara Kesatuan Republik Indonesia (NKRI). Selanjutnya, dalam HUT ke-67 atas nama Pemerintah Kabupaten Tapanuli Selatan, pribadidanrekanseperjuangan,mengucapkan Selamat HUT ke- 67 Harian Waspada, terutama kepada Saudara Pemimpin Umum, Pemimpin Redaksi/Penanggung Jawab,Wakil Pemimpin Umum/Wapemred, Wakil Penanggung Jawab, Redaktur, paraWartawan dan seluruh insan Pers yang ada di lingkungan Harian Waspada, Semoga Tetap Jaya!

Sumatera Utara


WASPADA Senin 13 Januari 2014

Sinabung Sebarkan Aroma Belerang, Warga Sesak Nafas BERASTAGI (Waspada): Aroma belerang berasal dari Gunungapi Sinabung berada di Kec. Namanteran Kab. Karo Sumut sampai ke kota wisata Berastagi. Akibatnya, sejumlah warga sekitar mengalami sesak nafas. Erupsi Gunung Sinabung yang terus terjadi, selain mengeluarkan abu vulkanik, lava pijar, awan panas (wedhus gembel), hujan pasir dan batu kerikil, seka-

rang aroma belerang menyebar sampai Berastagi. “Aroma belerang berasal dari Gunung Sinabung sampai ke Berastagi. Peristiwa tersebut dirasa-

kan warga sekitar sampai saat ini. Setelah tadi malam letusan Sinabung sekira pukul 20:00,” ujar Firman dan Roby kepada Waspada, Sabtu (11/1). Sedangkanjumlahpengungsi dilaporkan bertambah. Bahkan, data diterima Waspada, posko pengungsi juga bertambah menjadi 37 titik dari sebelumnya 32 titik. Sedangkanjumlahpengungsi

mencapai 24.949 jiwa terdiri dari 7.785 kepala keluara (KK) tersebar di 37 titik pengungsian. Lima titik pengungsian baru yaitu Jambur Siabang - abang 1.192 jiwa, terdiri dari 367 KK. Losd Lau Gumba 507 jiwa dari 175 KK., Lapangan Futsal Lau Gumba, 894 jiwa dari 326 KK, GBKP RG Sumbul 311 jiwa dari 100 KK, dan Gereja Adven Sumbul 265 jiwa terdiri dari 78 KK. (c19)

Zona Kampanye Belum Ditetapkan Di Simalungun SIMALUNGUN (Waspada): Komisi Pemilihan Umum (KPU) Kab. Simalungun dan Pemkab Simalungun belum menetapkan zona kampanye. Selain telah melanggar peraturan dan perundang-undangan tentang tahapan pemilu, juga sangat merugikan partai politik dan calon anggota legislatif peserta Pemilu 2014, sehinggapenyelenggaraanpemilu di tanoh Habonaron Do Bona itu rentan digugat. Ketua Panwaslu Kab. Simalungun, Drs Ulamatuah Saragih, mengemukakan hal itu kepada Waspada, Jumat (10/1), di ruang kerjanya. Menurut Ulamatuah, sesuaiketetapandantahapannya, seharusnya pihak KPU Simalungun sudah menetapkan dan mensosialisasikan zona bagi partai politik dan calon anggota legislatif sejak akhir Oktober 2013 lalu, namun hingga kini pihak penyelenggara pemilu belum

menetapkan zona kampanye. “ Disamping telah melanggar peraturan dan perundang-undangan tentang tahapan pemilu, ini juga jelas merugikan partai politik dan para caleg di daerah itu. Sehingga, akibat tidak terpenuhinya tahapan-tahapan sesuai dengan waktunya, maka pemilu di Simalungun sangat rentan digugat para pihak,” terang Ulamatuah. Lebihlanjutdikatakan,menetapkan zona diatur dalam Peraturan KPU Nomor 15 Tahun 2013, sebagai pedoman pelaksanaan kampanye pemasangan baliho atau spanduk partai dan caleg. “Terkait penetapan zona, Panwaslutelahtigakalimenyurati pihak KPU Simalungun, namun hingga sejauh ini belum ada kepastian. Sedangkan, akibat belum ditetapkannya zona kampanye dimaksud, pemasangan

baliho atau spanduk partai maupun caleg dilakukan secara sembrono, tanpa mengindahkan aturan yang ada,” ujar Ulamtuah sembari menambahkan, belum ditetapkannya zona kampanye akibat ketidakmampuan pihak KPU Simalungun melakukan koordinasi dengan Pemkab Simalungun. Adelbert Damanik, salah seorang komisioner KPU Simalungunmembidangidivisihukum membantah tudingan Ketua Panwaslu Simalungun bahwa pihaknya tidak mampu berkoordinasi dengan Pemkab Simalungun. Dia mengatakan, terkait penetapan zona, pihak KPU Simalungun telah lima kali menyurati dan melakukan pertemuan dengan Pemkab Simalungun. Bahkan dua kali di antaranya bertemu dengan bupati. Memang, kata Adelbert, zonakampanyehinggakinibelum


BUPATI Simalungun diwakili Sekdakab Gideon Purba sedang mengambil sumpah para pejabat yang dilantik. ditetapkan. Dalam hal ini bukan berarti KPU Simalungun tidak maksimal. KPU Simalungun sudahlimakalimenyuratibahkan dua kali bertemu bupati, namun zona kampanye belum juga bisa ditetapkan. Pihak penyelenggara pemilu di Simalungun itu juga tidak mau disebut telah melanggar tahapan, karena hingga saat ini KPU Simalungun belum pernahmendapatsuratataurekomendasi tentang pelanggaran pemiludariPanwasluSimalungun sebagai pengawas pemilu di daerah ini. “Yang jelas, KPU hanya mengaturpelaksanaanzonakampanye agar sesuai dan berpedoman kepada Peraturan KPU Nomor15tahun2013.Sedangkan yangpunyawilayahadalahbupati. Kami tidak bisa berbuat apa-apa, karenayangpunyawilayahbelum membuat zona,” tandas Damanik. (a29)

Guru Madrasah Diminta Sukseskan Kurikulum 2013 BERASTAGI (Waspada): Guru madrasah di Kab. Karo dimintamensukseskanpelaksanaan Kurikulum 2013. Salahsatu upaya dilakukan adalah dengan pelaksanaanBimbinganTeknis(Bimtek) kepada kepala madrasah, guru matapelajaran dan guru kelas di seluruh kabupaten/kota di Sumatera Utara. “Kurikulum 2013 ini akan diimplementasikan pada 2014. Saat ini sudah 6.504 guru di Sumatera Utara yang mengikuti bimtekini,”ujarKabidPendidikan Madrasah Kanwil Kementerian Agama Sumut,Tohar Bayoangin, dalam paparannya pada BimbinganTeknisKurikulum2013untuk Guru Madrasah yang diselenggarakanPendidikanIslam(Pendis) Kemenag Kabupaten Karo di Berastagi Cottage, Minggu (12/1). Dikatakan, ada empat elemen perubahan dalam kurikulum 2013, yakni standar kompetensi lulusan, standar isi, standar proses dan standar penilaian. Kemudian, pada setiap jenjang

pendidikan dengan rumusan kompetensi inti yakni penghayatan dan pengamalan agama, sikap, keterampilan dan pengetahuan. “Guru wajib merancang dan mengelola proses pembelajaran aktif yang menyenangkan, yaitu

peserta didik difasilitasi untuk mengamati, menanya, mengolah, menyajikan, menyimpulkan, dan mencipta,” katanya. Kepala Kemenag Kabupaten Karo, Dur Berutu, melalui Kasi Pendis, Karni Harahap menambahkan bahwa pelaksanaan


KABID Pendidikan Madrasah Kanwil Kemenag Sumut Tohar Bayoangin mengalungkan tanda peserta secara simbolis.

Bimtek kurikulum 2013 merupakan acuan salahsatu keberhasilan dalam pendidikan karena kurikulum itu tidak terlepas dari pendidikan. “Dengan adanya kurikulum 2013 yang orientasinya kepada karakter pelajar supaya dapat meningkatkan pelaksana keislaman. Guru madrasah juga selalu senantiasameningkatkankemampuanilmupengetahuan,”katanya. Ketua Panitia Tuah Aman mengatakan,pelaksanaanbimtek tersebutakandilaksanakansesuai panduan yang berlaku, yakni selama 36-38 jam pelajaran dengan dana yang bersumber dari DIPA Kemenag Karo Tahun Anggaran 2013. “Untuk memenuhi jam pelajaran itu, ratusan guru madrasah akan diinapkan di Berastagi Cottage. Kita akan lengkapi akomodasinya. Pembicaranya juga berasal dari Kanwil Kemenag Sumut dan widyasuara Balai Diklat Keagamaan Medan,” tukasnya. (a36)

Mulfachri Harahap Apresiasi PAN DS MEDAN (Waspada): Pengurus Pusat Partai Amanat Nasional (PAN) memberi apresiasi kepada kader PAN Deliserdang. Struktur partai sampai ke tingkat cabang dan ranting memiliki semangat yang tinggi untuk memenangkan Pemilu legislatif 2014. Apresiasi itu disampaikan Ketua DPP PAN Mulfachri Harahap, kepada pengurus DPD dan DPC PAN Deliserdang saat pelaksanaan rapat koordinasi pemenangan PAN di Posko Pemenangan PAN daerah pemilihan(Dapil)Sumut1,diJalanIskandar Muda, Medan, Jumat (10/1). Rapat koordinasi dipimpin Ketua DPD PAN Deliserdang Imran Obos. Hadir sejumlah Pengurus Harian PAN Deliserdang, dan para ketua dan sekretarisDPCPANseDeliserdang.Juga MulfachriHarahap,yangjugacaleg DPR RI dari Dapil Sumut 1. Ketua DPD PAN Deliserdang Imran Obos, usai rapat koordinasi, mengatakan pihaknya bertekad memenangkan Pemilu legislatif 2014. Karenanya dia berusaha menghimpun seluruh kekuatan di internal untuk melakukan kerja-kerja politik. Dia bersyukur, bahwa dalam diri para kader PAN tertanam semangatyangtinggiuntukmengejar target perolehan suara PAN paling tidak 10 persen. Di Deliserdangsendiri,pihaknyamenargetkan ada penambahan kursi di DPRDdarilima,menjadiminimal delapan kursi.

Waspada/Zul Harahap

RAPAT koordinasi pemenangan DPD dan DPC Partai Amanat Nasional (PAN) se Deliserdang di Posko Pemenangan PAN Jalan Iskandar Muda, Medan. Menjawab Waspada, Imran Obos,mengakusangatmenyadari akan rentanya ‘gesekan’ sesama kader dalam hal dukungan kepadacaleg.Itulahyangterusdisiasati PANDeliserdang,agarkadertidak terbelah. ‘’Dan hasilnya, seperti yang didengar tadi. PAN Deliserdangsudahmelakukankebulatan tekad. Untuk DPR RI hanya mendukungMulfachriHarahap.Tidak ada yang lain,’’ katanya. Kata Imran Obos, DPD dan DPC PAN Deliserdang sepakat mendukung Mulfachri, karena berbagaialasan.Yangutama,ada-

Festival Drum Band Pelajar Di P. Brandan Diikuti Dari Aceh BRANDAN(Waspada):FestivaldrumbandantarpelajardiP.Brandan direncanakandibukaBupatiLangkatH.NgogesaSitepu,SHdiLapangan sepakbola Kp. Baru Kec. Babalan Langkat, Rabu (15/1). Demikian disampaikan Panpel Festival drum band TM Syarif kepada Waspada baru baru ini. Dikatakan festival drum band diikuti para pelajar tingkat SD, SMP, SMA juga turut memeriahkan drum band pelajar dari Kualasimpang, Aceh. Panitia memberikan uang pembinaan ditambah piagam penghargaan dan peserta. Sampai saat ini sudah ada yang mendaftar dan pada pembukaan juga akan hadir putri Bupati Langkat Delia Pratiwi Sitepu, Caleg DPR RI dari Partai Golkar. (c01)

lah Mulfachri Harahap, merupakan simbol partai. Saat ini dia adalah Ketua DPP PAN. Positif bagi partai Sementara Ketua DPP PAN Mulfachri Harahap, mengaku bangga melihat kinerja PAN Deliserdang yang begitu baik. Katanya,inimerupakanhalpositifbagi partaidalammenghadapiPemilu tahun ini.

Mulfachri, mengaku telah melihat tren positif kinerja PAN Deliserdang itu dari pelaksanaan Pilkada lalu. Dimana penetapan pasangan Azhari Tambunan – Zainuddin Mars, yang didukung PAN telah menimbulkan rasa percaya diri warga PAN.‘’Artinya, terbukti kalau pilihan PAN mendukung pasangan bupati itu benar,’’ katanya.(m12)

Panwas Binjai Selatan Awasi Verifikasi DPT BINJAI (Waspada): Panwas Kec. Binjai Selatan melakukan kordinasi sekaligus silaturahmi dengan B Kapolsek Binjai Selatan. Ketua Panwas Binjai Selatan Faisal Azmi, SE, menjelaskan, Sabtu (11/1), rapat kodinasi guna mensinkronkan tugas sebagai pengawas pemilu 2014. Faisal Azmi menyebutkan, Panwascam dan PPL telah melakukan pengawasan verifikasi DPT dan NIK invalid, serta mengawasi pembersihan alat peraga kampanye yang menyalahi aturan. Pembersihan dilakukan Satpol PP, setelah adanya rekomendasi Panwaslu Kota Binjai. Faisal mengemukakan, tugas Panwas masih belum maksimal, begitupun proses pengawasan tetap dilakukan dengan kordinasi semua pihak, termasuk Polsek Binjai Selatan, sehingga Pemilu 2014 dapat terlaksa dengan baik dan jurdil. Kapolsek Binjai Selatan, menyatakan siap membantu dan mendukung sepenuhnya pelaksanaan Pemilu Legislatif 2014, sebagai upaya terciptanya Pemilu yang aman dan damai.(a04)

Bupati Simalungun Lantik 102 Pejabat Eselon III Dan IV SIMALUNGUN (Waspada): 102 Pejabat struktural eselon III dan IV termasuk Kepala Unit PelaksanaTekhnis Dinas (UPTD), Kepala Sekolah dan Pengawas Sekolah, dilantik, Jumat (10/1). Pelantikan dipimpin Bupati Simalungun diwakili Sekda GideonPurba,digelardi aulaSMK Pertanian Pamatang Raya. Sebagai saksi dalam pelantikan Eka Hendra SSos (Asisten Pemerintahan dan Kesra) dan Drs Zannas Malau (Asisten Bidang PembangunandanEkonomi)sertarohaniwan Islam, Kristen Protestan dan Katolik. Bupati Simalungun melalui Sekda, Gideon Purba, mengatakan, pengangkatan Pegawai Negeri Sipil (PNS) dalam suatu jabatan dilakukan berdasarkan beberapa kriteris sesuai peraturan dan perundang-undangan berlaku. Selain itu, mutasi jabatan struktural merupakan hal biasa dalam suatu organisasi pemerintahan dengan harapan untuk meningkatkankinerjaPNSdalam memberikan pelayanan kepada masyarakat. Kepada pejabat yang dilantik, diharapkan harus bertanggungjawab atas tugas dan amanah yang diemban. “Oleh sebab itu,

saudara dituntut mampu melaksanakan tugas dengan baik, jujur dan bertanggungjawab, karena dalam melaksanakan tugas, saudara sangat diperlukan kepekaan dan kecermatan dalam memberikanpelayananyangterbaikkepada masyarakat,” tandas Bupati. Disampingitu,kepadacamat diharapkandalammenjalantugas danfungsinyatidakhanyaterpaku kepada tugas-tugas rutin saja, tetapi harus mampu melakukan inovasi dan terobosan yang berarti, memiliki kejelian, melihat peluang-peluang bagaimana melakukan peningkatan PAD serta aspek pembangunanan lainnya dan harus menetap di wilayah tugasnya. Begitu juga halnyadenganparakepalasekolah jugaditututmeningkatkankinerja terutama dalam menciptakan program terbaik untuk kemajuan pendidikan khususnya di Kab. Simalungun. PejabateselonIIIyangdilantik di antaranya Walter Edward MalaluSSossebagaiCamat Dolok Batu Nanggar, Alfretty M Butarbutar sebagai Kepala Bidang (Kabid) Lalulintas dan Angkutan Danau pada Dinas Perhubungan Komunikasi dan Informatika, Arolina Sidauruk SH sebagai

Kabid Sosial Budaya dan SDM di Bappeda, Mhd Rasyid SSosI sebagaiSekretarisCamatGunung Maligas, Mangedar Saragih SP sebagai Kabid Sarana Usaha PerkebunanpadaDinasPerkebunan serta Frensi Inneka Situmorang SH MM sebagai Kabid Bina DemokrasidanPolitikpadaBadan Kesbangpol dan Linmas. Untuk pejabat eselon IV yang dilantik antaralain, Roslina H Sipayung SE sebagai Kasubbid Penguatan Kelembagaan Masyarakat dan Pembangunan Partisipatif di BPMPN, Sahlan Purba sebagai Kasubbag Tata Usaha pada Badan Penanggulangan Bencana Daerah, Rohana Purba sebagai Pengawasan PemerintahanBidangPemerintahanWilayah III di Inspektorat, Rasenni Sipayung SH sebagai Kepala Seksi Peningkatan Peran Perempuan pada Kantor Pemberdayaan Perempuan dan Perlindungan Anak dan Bpyke Adinata Damanik SH sebagai Kepala Seksi Lalulintas dan Angkutan Danau pada Dinas Perhubungan Komunikasi dan Informatika. Kepala UPTD yang dilantik antara lain, Tommi Hutahaean SPd sebagai Kepala UPTD Pendidikan Kecamatan Pamatang

Bandar, Asi Sinaga SPd MSi sebagaiKepalaUPTDKecamatanJawa Maraja Bah Jambi, Abdul Rauf sebagaiKepalaUPTDPendidikan Kecamatan Bosar Maligas, Dra Sumawarni sebagai Kepala UPTD Pendidikan Kecamatan Dolok Panribuan. Kepala Sekolah yangdilantikantaralainDaudRaja Purba SPd sebagai Kepala Sekolah (Kepsek) SMA Negeri 1 Dolok Pardamean, Saor Binitua SihotangSPdsebagaiKepsekSMA Negeri 1 Girsang Sipangan Bolon. Sedangkan Drs Mangapul Siagian sebagai Kepsek SMA Negeri1BosarMaligas,Ramenton Sipayung SPd sebagai Kepsek SMP Negeri 1 Bandar Masilam, Dra Asmin br Ginting sebagai Kepsek SMP Negeri 1 Panei, Drs Maringan Sitio sebagai Kepsek SMP Negeri 1 Dolok Pardamean dan DrsTogi sebagai Kepsek SMP Negeri1TanahJawa,Kencanawati SPd sebagai Kepsek SDN 098033 Perumnas, Emmi Paulina Nababan SPd sebagai Kepsek SDN 091312 Pargampualan, DianasebagaiKepsekSDN091272 Marihat Baris, Abu Asip AmaPd sebagai Kepsek SDN 191515 Buntu Turunan dan Nuriati SPd sebagai Kepsek SDN 091633 Kerasaan. (a29)

H. OK Arya Zulkarnain, SH, MM

Waspada Harian Nasional, Terdepan Menyajikan Berita TIDAK terasa Harian Waspada sebagai media yang terbit berskala nasional dan terdepan dalam menyajikan berita, telah melaksanakanHUTke67pada11Januari2014. Mediayangdidirikantokohpersnasional H. Muhammad Said (alm) dan Hj. Ani Idrus (almh) dalam kiprahnya mulai dari era perjuangan zaman penjajahan sampai sekarang, tetap profesional dan terdepan dalam menyajikan berita bagi kalangan pembaca. Kedua tokoh pers tersebut memiliki banyak karya tulis baik dalam bentuk buku mau pun tulisan di Harian Waspada. ‘’Kita salut dengan tokoh pendiri Harian Waspada dalammemajukanmediamasamelaluikarya dan tulisannya, yang sampai sekarang masih melekat di kalangan pembaca baik intelektual, pejabat dan tokoh masyarakat,” kata Bupati Batubara H. OK Arya Zulkarnain, SH, MM. Pemkab Batubara sangat berkepentingan dengan media masa, khususnya Harian Waspada terutama dalam memberi/ mempublikasikan program-program yang positif dalam kemajuan pembangunan di daerah. Pemberitaan Waspada memberi penerangan, kritikan dan mempunyai ruangan artikel, agama, ekonomi sampai olahraga yang setiap hari dapat dikonsumsi kalangan pembaca untuk dijadikan masukan. Dalam usianya ke 67,Waspada diharap akan lebih memberi kontribusi informasi sebagaimana mottonya, Demi Keadilan dan Kebenaran. Kabupaten Batubara yang merupakan pemekaran dari KabupatenAsahan,kedepanberkiprahmajudengandipusatkannya program pembangunan berskala nasional melalui pengembangan Pelabuhan Hub Internasional Kuala Tanjung-Perupuk oleh

Pemerintah Pusat dengan target sepanjang 21modul.Tahapawaldilaksanakansatumodul pekerjaan dalam Tahun 2014 dengan biaya Rp6,7 miliar. Pembangunan mega proyek ini sebagai salah satu jembatan emas bagi daerah kepemim-pinannyayangterbagidalamtujuh wilayah kecamatan (Sei Balai,Tanjungtiram, Talawi, Lima Puluh, Air Putih, Seisuka dan Medang Deras) ke arah ‘gemilang’ demi mewujudkanvisidanmisiBatubarasejahtera dan Berjaya, di mana nanti berdirinya usaha industri di desa pesisir membuka peluang kerja baru bagi masyarakat dan menjadi pusat pertumbuhan ekonomi di Sumut. Termasuk membenahi infrastruktur jalan darat melalui pembangunan 9 akses jalan dan membuka jalur KA dari Stasiun Bandar Tinggi-Kuala Tanjung tahap awal ditargetkan 22 km, sebagai mendukung kelancaran transportasi angkut barang menujupelabuhanpetikemasHubInternasionalKualaTanjung.Dan dilanjutkan ke Kapal Merah, Kec Tanjungtiram di mana direncanakan sebagai pelabuhan penumpang kapal/ferry. Juga dikembangkan Pelabuhan PT. Inalum, mendukung kawasan ekonomi khusus pasca diambilalihnya perusahaan yang memproduksi Aluminium tersebut oleh Pemerintah Indonesia, sehingga diharapkan daerah dan Provsu dapat memiliki saham sebagaimana harapan. BegitujugaHarianWaspadadalammemberikonstribusimelalui berita yang disajikan, baik dalam peningkatan mutu pendidikan, peningkatanderajatkesehatandanmeningkatkantarafperekonomian. Karena hal itu merupakan konsep dalam upaya untuk pemenuhan kebutuhan hidup dasar yang dibutuhkan masyarakat.

Kasus Pencurian Brankas Masih Kabur STABAT (Waspada): Kasus pembobolan Kredit Plus PT. FinansiaMultiFinandiJalanKHZ. Arifin Stabat Kab. Langkat, yang menggasak brankas berisi uang Rp33.622.000 dan sejumlah barang berharga lainnya, hingga kini masih kabur. Pelaku belum diketahui

identitasnya, bahkan aparat kepolisian belum menemukan titik terang meski brankas bersama isinya telah ditemukan di mobil rental Toyota Avanza BK 1186 JJ, yang ditinggal setelah masuk parit di kawasan Hamparan Perak, Deliserdang. Kapolsek Stabat AKP Naser

yang dikonfirmasi, Minggu (12/ 1) pagi menuturkan kasus tersebut masih dalam penyelidikan. “Belum diketahui siapa yang merental mobil,” katanya. Kapolsekengganberspekulasi karenamasihdalampenyelidikan. Diajugabelumdapatmemastikan mengenai kunci brankas dan

kunci Ruko yang dipegang beberapaorangdaripihakkorban,sebab beberapa saksi terkait masih akan dimintai keterangan lanjutan. Sebagaimanadiketahuidalam kejadian tidak ada pintu Ruko yang dirusak pelaku sebelum membawa kabur brankas 8 Januari lalu. (a03)

Pengedar Sabu Buang Barbut Ke Closet PERBAUNGAN (Waspada): Setelah beberapa lama menjadi target oprasi (TO) Polsek Perbaungan, akhirnyaYD aliasYudis, 38, berhasil diringkus personel Polsek dipimpin Kapolsek AKP Amir Muslim, SH, Jumat (10/1) malam. Sebelum proses penangkapan, tersangka yang merupakan warga Dusun Pisang, Desa Melati

II, Kec. Perbaungan, berupaya menghilangkanbarangbuktisabu yang diperkirakan seberat 4 gram, dengan membuangnya ke lobang closet. Namun berkat kejelian petugas, barang bukti berhasil ditemukan setelah closet dipecahkan. Selanjutnya YD berikut barang bukti diamankan ke Mapolsek Perbaungan.

Setelah menjalani pemeriksaandiPolsek Perbaungan, selanjutnya tersangka diboyong ke Sat Narkoba Polres Serdang Bedagai. Saat ditemui wartawan, Sabtu (11/1) di ruang Satnarkoba, tersangka mengaku menjalankan bisnisharamtersebutkarenatidak memilikipekerjaan.Diajugapernah mendekam setahun di LP Lubuk-

pakam dalam kasus sama. “Sabu tersebut aku beli dari AD warga Tanjungmorawa tiga hari lalu, 4 jie dengan harga Rp4,8 juta,” beber YD. Kasat Narkoba Polres Sergai, AKP Hendra ketika dikonfirmasi Waspada,menyebutkantersangka danbarangbuktitelahdiamankan gunapenyidikanlebihlanjut.(c03)

1 CM Rp. 13.200 1,5 CM Rp. 19.800

2 CM 3 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

DAI H AT SU ZEBRA ESPASS ROLLING DOORS 97 1600 cc. Biru, Body Mulus, Mesin Sehat, Tinggal pakai, Rp. 35Jt, Serius Hub 0813 6269 6789

PROM O A WAL TAH U N DAIHATSU (Xenia, Terios, Granmax Pick Up, Ayla, Dll). DP Murah, Angsuran Ringan, Full Discount, Hub Irnanda 0 8 1 3 2 5 8 0 2 8 9 5

* PAKET HEMAT DAIHATSU * Siap Memberikan Paket Terbaik Untuk Pilihan Keluarga dan Usaha Anda. - NEW TERIOS - NEW AYLA- LUXIO - NEW XENIA - GRAN MAX PU - SIRION Hub : Rahmat / 0812 6267 3416. Solusi Aman dan Terpercaya DAI H AT SU BARU PROM O XENIA DP 23 Jtan Terios DP 29 Jtan Dapatkan Pot Khusus, Info Hub : RIZA 0 8 5 2 7 7 4 7

Pu DP 8 Jtan Ayla DP 20 Jtan Sales 2542


- HABISAN, Dp Murah & Angsuran Ringan. Ready: Xenia, Terios, Ayla, Granmax Pu, Full Diskon + Cash Back + Hadiah. Hub : Syarif ( 0813 9777 3486)

DAIHATSU ESPASS Th 96/97 Rolling Door. W. Merah Metalic, Ac, Vr, Br, Cd, Sangat Mulus, Rp. 36Jt (Nego) 0852 9750 4319

- HONDA JAZZ 04, Hitam - La nc e r 9 7 , Evo 4, Hitam 0 8 1 3 9 6 6 3 8 9 9 2 / Nego # D EA L ER T OYOTA # Tahun Baru & Mobil Baru, Dapatkan Info dan Penawaran Menarik Untuk Toyota Anda. Hub Annuar Damanik 0823 7088 0815

M OBI L DI CARI OVER KREDIT AVANZA/INNOVA/ FORTUNER/YARIS /APV/PAJERO/CRV/JAZZ/ Kontan Pun Ok!. H. IPUL 0812 6038 5555 / 0821 6767 7000 / TELP/SMS TOYOTA KRISTA DIESEL Thn 2003. Silver Met, BK Medan, Mobil Mulus dan Terawat. Hub 0823 6260 7087

DIJUAL MINICAB Thn 82 Mulus Luar Dalam, pajak hidup Hubungi: 081 6330 358, Hrg 8Jt F D



Senin, 13 Januari 2014




Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

Rp. 26.400 Rp. 39.600

4 CM 5 CM

Rp. 52.800 Rp. 71.500

BUTUH DANA SUDAH PUNYA USAHA MASIH BUTUH MODAL Hub. 0853 7372 2365 Proses Cepat G E B YA R DAN A I T U N A I Proses 3 jam Cair, Tanpa Usaha dan Surat Terjamin. Jaminan : SHM, HGB, SK Camat, BPKB Mobil, Truk, Spd Mtr, Mobil yg masih kredit/over leasing/Bantu Pelunasan BPKB. Hub Family Finance SDR Jaya (0813 7044 6668 - 0813 7044 6633 )

BUTUH DANA Proses 1 Hari Cair, Jaminan SHM, SKC, Bergaransi. Hub : 0812 60181864 TERCECER T ERCECER STNK/BPKB - B.9492 SU. A/N : Pieter Kawi. Alamat : Jl. Suka jaya 1 No. 7 RT 6/1 Jakbar. Merk : Mitsubishi

6 CM 7 CM

Rp. 85.800 Rp. 100.100

8 CM Rp. 114.400 9 CM Rp. 138.000



1 (SATU) Buah BPKB No Pol : BK 389 JH Tahun 2003 Toyota Kijang Kristal Atas Nama DJOHAN, No Mesin : 1 RE - 7038458, No Rangka : M HF 11 UF 8130038432, Bagi yang menemukan Harap Hubungi ABDUL AZIZ, HP 0813 7705 4681

TELAH HILANG BPKB Sepeda Motor Suzuki BK 6867 RW a/n. APRIADI. Jl. Bhakti, Dusun III, Desa Sendang Rejo. Kec. Binjai, Kab. Langkat. Hilang disekitar Jalan Tanjung menuju Binjai. Yang Menemukan Hub. David. No. HP. 0 8 1 2 6 0 5 8 0 2 2 1

T ERCECER 1.Akte Pengoperan dan Penyerahan Hak Dengan Ganti Rugi, Tanggal 22 September 1990 No. 122 2.Akte Pengoperan dan Penyerahan Hak Dengan Ganti Rugi, Tanggal 25 Agustus 1990 No. 124.

3 orang Tukang Pangkas yang berpengalaman dan bersedia untuk diuji/disekelsi. Untuk ditempatkan di Baganbatu Riau, Pangkas AC MARIKENA, yang sudah terkenal sejak tujuh tahun yang lalu. Tempat tinggal anggota tersedia dan hasil memuaskan. Berminat Hub. 0821 7049 9207 / 0812 6861 6068

DI CARI SEGERA Perusahaan jasa tenaga pengamanan sedang membutuhkan : Satuan Tenaga Pengamanan (SATPAM) 65 Orang untuk ditempatkan dikota Medan. Syarat : 1. Tinggi min 165 cm 2. Minimal SMA atau Sederajat 3. Jujur, Berwawasan, Mampu bekerjasama dengan TIM 4. Memiliki Ijazah asli 5. Mempersiapkan Pakaian sendiri Kirim Lamaran : PT. N AGA HARI UTAMA Jl. Wahidin No. 81 E/197 (Apotik Jaya Wijaya) atau SMS biodata ke 0 8 1 9 7 2 2 4 4 6 6 (Hanya SMS)

BURSA PERABOT T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun




HP. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

LOWON GAN K ERJ A Taman Penitipan Anak berskala Nasional membutuhkan tenaga pengasuh untuk dikantor Cabang Medan : Pe nga suh Da y Ca re Syarat : - Muslimah berjilbab - Tamatan SMU/Madrasah - Memiliki kompetensi di bidang membaca Alquran, story telling - Menyukai & sayang anak, kreatif, ceria - Jujur, sabar, loyal, mau belajar, ulet, gigih, fleksibel Segera kirimkan lamaran lengkap & pasphoto ke TAM AN PEN I T I PAN AN AK K H ALI FAH DAYCARE & LEARN I N G CEN T RE Cabang Medan Jl. Masdulhak No. 25 Medan 20152 Tlp. 0 8 7 8 6 8 2 2 6 0 8 0 / 0 8 1 2 6 4 8 2 0 3 1 1

Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

DIBUTUHKAN Karyawan / Karyawati Minimarket, persyaratan : - Pendidikan min. SMU / SMK sederajat - Usia maksimal 30 tahun - Belum Menikah - Berpenampilan Menarik - Sehat jasmani dan rohani - Tidak sedang kuliah - Diutamakan yang telah berpengalaman Pelamar datang langsung dengan membawa : - surat lamaran - pas photo - photocopy KTP - photocopy ijasah terakhir - daftar riwayat hidup ke alamat : Ruko Chrysant Park No. 4 dan 5. Jl. STM Ujung, Suka Maju, Medan. Telepon 061-75330248, 0812 6062 2002

Keduanya dibuat dihadapan Drs. Ade Rachman Maksudi, SH pada waktu itu Notaris di Medan

T ERCECER Surat Sertifikat Tanah 1. No. SU/No. Persil. 39. C. 46 /1998- Tgl. 23-2-1998 2. No. SU/No. Persil. 40. C. 46 /1998- Tgl. 23-2-1998 An. Pojok Siregar di Sepanjang Jl. Km 3 Jl. Tigo Linggo menuju Kota Sidikalang Sekitar Tgl 25 November 2013 H I LAN G 1 (SATU) BUKU BPKB Dan STNK Kenderaan Merk Mobil Nissan Xtrail Warna Hitam/2009. An. MELIZA, No Pol : B.8168 MU, No Mesin : MR 20-002485 R dan No Rangka : MHBF-2CG3F9J-001343. Bagi yang menemukan Hub : Bapak ABDUL AZIZ, SE No Handphone 0813 7705 4681, Hilang di Sekitar Jln. Bintang Depan Bengkel Bubut Medan Kota


I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0


12 CM Rp. 198.000 6x6,6 kolom Rp. 132.000


T ERCECER STUK. BK 7487 DJ. No uji : MDN 36026-A. A/N : CV. Mitra. Alamat : Jl. Juanda Baru No. 58 Medan. Merk : Daihatsu

10 CM Rp. 154.000 11 CM Rp. 181.000




PT. HARI REZEKI KITA SEMUA Jl. B. Katamso No.533 (Simp. Jl. Pelangi) Medan Tel. (061) 7878777 - 7878666 Fax. 7863433

BURSA JASA SOLUSI LEGAL Permasalahan / Sengketa, Kredit / Lelang Perbankan Kartu Kredit, Hutang Piutang Bermasalah, Perceraian, Warisan, HAKI, Masalah Hukum Lainnya. Hub 081 2656 7572




1 . K a ba g Adm inist ra si 2 . St a ff Ope ra siona l 3 . Supir Syarat - Pria (1,2,3) - Mempunyai SIM B1, 35-45 tahun (3) - Mempunyai SIM C, 30-50 tahun, Mengetahui Mobil (2) - Minimal Tamat SMA/ Sederajat (1,2,3) - Mengetahui alamat di Medan (2,3) - Berpengalaman, Jujur, Tanggungjawab (1,2,3) Surat lamaran di tujukan ke : CV SUMATERA JAYA ONE JL. G. Krakatau No. 199 B Medan

DI BU T U H K AN - SUPIR (L) 2 ORANG Bs bw matik, SIM A/B1, max 35 thn, tdk merokok - OFFICE GIRL/LOPER (L/P) Min SMP/ SMA, max 23 thn, blm kawin, s. motor & SIM C, tinggal di Medan. - SEKRETARIS REDAKSI DAN LSM 2 ORG Min D3/S1, max 24 thn, s.motor & SIM C, tinggal di Mdn. Kota Mdn Area Lamaran diantar langsung ke : LSM Pe nja ra “U J ” Jl. Ismailiyah No. 17 Komat I Medan

HP. 0813 7035 7291



Informasi Pembaca Bursa Property

Ada Garansi

845.8996 0 8 1 2 .6 3 1 .6 6 3 1 Bergaransi/ Jl.Kpt. Muslim

Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta:


WASPADA Untuk informasi lebih lengkap hub

TEL. (061) 4576602 FAX. (061) 4561347


G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik


MAK EROT YANG TERUJI DAN T ERBU K T I Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia la t vit a lm a ke rot .c om

D I J U A L R U M A H Type Minimalis Di Perum. Garu Mas Jl. Garu 6 No.18 Simp. Marindal Mdn. Type 80/78, Type 75/72 ,Type 68/72, Type 54/78, Type 48/72, Special Promo di awal Jan 2014. Hub 0 8 1 3 6 1 4 2 4 9 7 2

DIJUAL CEPAT 1 Unit Rumah Ukuran 5x12, 1 1/2 LT, SHM. Di Jl. Eka Rasmi Prum Town House No. C3, Harga Rp. 450Jt Bisa Nego. Hub 0822 7317 2488 DIJUAL RUMAH 1 Unit Type 54, Lt, 98, LB 54 dan 3 Unit Type 45, LT . 8 4 , L B 4 5 d i J l . Pembangunan Kompl. Arafah Syariah I. Ds. Bandar Setia, Percut Sei Tuan. Siap huni. Hub. 0852 6115 0907 (Tanpa perantara) * DIJUAL RUMAH, SHM, 6 KT, 3 KM, Di Jln. Gelatik No. 10 Mdn, Harga Rp. 1,5 milyar * MOBIL XENIA 2005, 1000cc, Rp. 82 Juta * Hub Pemilik : 0 8 1 2 6 0 6 4 3 3 9

RUMAH DIJUAL Komp. Millenium Indah No. 4B Jl. Setia Luhur Psr 1 Kel. Dwikora, Luas 72m2, 3 Tingkat, SHM, siap Huni, Harga Rp. 600Jt/Nego. Hub 0853 6000 8824

-Stroke, Kanker, Hepatitis -Diabetes, Prostat, Maag -Rematik, Asam Urat, L. Syawat -Osteoporosis, Radang Sendi -Pengapuran, Sakit Pinggang Saraf Terjepit, dll

DR. SU BA (I N DI A) Jl. Pasundan No. 32-B (Dekat Medan Plaza) Medan Petisah Telp: 061-4550362 HP. 0852 7044 4718 Buka Jam 9.00 - 18.00


Bpk. Umar & Ust. A. Aziz

(Untuk reumatik & asam urat)

MELAYANI BERBAGAI MACAM KELUHAN ANTARA LAIN : * Khusus Pria, Tambah Ukuran - Panjang 13-16-19-22 cm diameter : 3,5, 4-4,5, 5-5,5,5-6 cm - Kuat dan Tahan Lama - Ejakulasi dini, Sphilis/rajasinga mani encer - Lemah Syahwat, diabetes, impoten, dll

* Khusus Wanita - Memperbesar Payudara - Terapi Perawan/Virgin - Kista, Lemah Kandungan - Kanker Payudara - Ingin mempunyai keturunan, dll

* Ingin cepat dapat jodoh, pengasihan & disegani atasan, menyatukan dan memisahkan PIL/WIL, puter giling, juga melayani pasang susuk. Tersedia pegangan untuk dagang, lulus tes, keselamatan, buka tambang, membuka lahan baru, pekerja hiburan, untuk jual beli tanah, rumah, mobil dengan cepat. Pengisian kosmetik, rokok, membuat anda tampil karismatik, cantik dan menarik, tampan, dll. Bergaransi, alami tanpa efek samping, langsung reaksi ditempat. Hasil permanen untuk seumur hidup

Alamat Praktek : Jl. SM Raja No. 134/10 (Depan Taman Makam Pahlawan) Samping Gedung Dakwah Muhammadiyah

HP. 0 8 1 3 8 0 4 2 6 2 5 3 , 0 8 2 1 6 6 5 6 4 5 1 3

Dpt Diperoleh di Sumatera - Aceh

Buku setiap hari jam 08.00 - 22.00 WIB 1 NB : Mobil Bisa Masuk, Rahasia Terjamin. Izin :B-70/DSP.5/II/2007

Hub: (061) 7364920 - 7323590


DIBUTUHKAN SEGERA 1. Kepala Sekolah SMP IT (Sekolah Menengah Pertama Islam Terpadu) 2. Guru SMP IT (Semua Mata Pelajaran) Kualifikasi : - Lulusan S-1 Pendidikan / AKTA IV - Berpengalaman di Bidangnya - Dapat mengoperasionalkan komputer minimal Microsoft Office dan Internet - Kreatif, inovatif, dan mempunyai komitmen pada pekerjaan Lamaran Lengkap di Tujukan ke :

SEKOLAH AL MUSABBIHIN Komp. TASBI Blok C N o. 9 9 M e da n Telp : 061- 8224722; Hp : 081 2645 1903

PERGURUAN ISLAM AS-SYAFI’IYAH INTERNASIONAL MEMBUTUHKAN : 1. GURU BAHASA INDONESIA, BAHASA INGGRIS, SENI BUDAYA 2. KEPALA SEKOLAH DAN GURU TAMAN KANAK - KANAK INTERNASIONAL SYARAT : A. Lulusan S1 / AKTA IV B. Memiliki Laptop C. Mampu Membaca ALQUR’AN D. Mampu Berbahasa Inggris E. Dapat Mengoperasikan Power Point F. Memiliki Kenderaan Sendiri G. Berpenampilan Menarik H. Lamaran ditulisa tangan I. Pengalaman 2 Tahun J. Usia Max 35 Tahun K. Sehat Jasmani dan Rohani L. Pasphoto 3 x 4 = 2 Lembar Kirimkan Lamaran Lengkap Ke Jl. Karya Wisata II No. 1 Medan Johor

Ingin Promosikan Produk Anda Harian

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

D I J U AL 1 Unit Rumah Ukuran Tanah 14,5 x 13 Meter, Luas Bangunan = 130 M2, SHM, Di Jln Garu II-B Gg. Pribadi No. 91 G. Hubungi: SOFYAN HARUN 081 2608 8206



DIJUAL TANAH DI BINJAI Di Dusun IV Desa Sambirejo Kec. Binjai Kab. Langkat, Ukuran Tanah 400 M2, SK Camat, Cocok Untuk Rumah Sewa/Pribadi/ Investasi, Hrg 105Juta/Nego. Peminat Serius Hub HP 0 8 1 2 7 8 5 5 9 2 5 4 (TP) DIJUAL RUMAH CANTIK MURAH B.U P. 15 m, L 6,5 m, KT 3, KM 2, RT 1, Lantai Keramik, Sdh Pagar, Ada Kanopi T. Mobil, siap Huni, Sdh Sertifikat, Harga 230Jt Nego, Alamat Jl. Soekarno Hatta Km 18,5 Binjai, yang berminat aja, TP. Hubungi: HP 0 8 1 2 6 3 4 7 3 8 6 2

DIJUAL RUMAH DAN 6 PINTU Rumah Sewa Di Pekan Hamparan Perak Ds, Luas Tanah 1750 M2 (SHM). Hub 0812 6406 0555

TANAH TAN AH Dijual Murah 150Jt, +/- 800 M2 / 2 Rante / 12 x 67 M, 30 M dari Jalan Aspal Lintas Percut Ke Martubung - Sebelah Masjid Dusun VI Kel. Tanjung Selamat Kec. Percut Sei Tuan. Masuk Dari Pasar I Saentis. Sertifikat Hak Milik (DP). Pemilik Langsung 0813 7710 4418 Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

Media yang Tepat untuk Iklan Anda BURSA



Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA Dibuka sampai pukul 22.00

BURSA ALAT KANTOR PERABOT KANTOR DIJUAL Brankas T 145 cm (9Jt), T 80 cm (5Jt), Cabinet 4 Lc (600), Lemari (1Jt), Fax, Printer LQ 2180 /2170. HP 0 8 5 2 9 6 3 1 1 4 6 4





MENJUAL SEGALA JENIS BIBIT TANAMAN Bibit Gaharu, Kelapa Pandan Wangi Dari Thailand, Mangga Rusia, Jeruk Siam Madu, Manggis, Pala, Cengkeh, Kemiri, Durian, Pokat, Saoh, Jabon, Kecambah Sawit, Karet Sertifikat, Ingul, Vinus, Dll. Partai Kecil & Besar. Hub: Pak Jamal 0813 7091 2113





Faks 061 4510025

Facebook Smswaspada

+628126501779 Jelang pemilu, orang2 politik kalau ngomong sok pinter sok hebat sok merakyat dan mengumbar-janji2 tapi berbau kebohongan & penipuan kepada Rakyat RI! Jangan dipercaya! Mending pilih orang2 baru yg jenius, bersih dan belum pernah keok! +6281396620001 BagaimanajikalahansekitarBandaraKNIAdijadikankotabungaatautamanbunga.Tentu kota Medan sejuk dan tidak sangar. +6281260788151 kepada bapak Bupati Deliserdang .pak coba bapak lihat jalan menuju lapangan tembak brimob sumut di martabe Kec.Pancur batu itu jalan hanya di aspal ujung dan pangkalnya saja di tengah tidak pernah kema aspal bagai jalan penjajahan apa kami warga disitu belum mardeka sehingga jalan kami tidak pernah diaspal? mohon perhatianya pak karna itu jalan alternatip dan bisa mengurangi kemacetan Jalan Jamin ginting km 26 hingga Sp.pos Padang bulan trimks +628126051504 Penderitaan rakyat sdh cukup berat,semua brg pd naik,sepertinya negeri tdk punya pemerintahan,semoga 2014 ini lahir pemimpin yg amanah yg dekat dgn Allah Swt....amiinn +6282167170674 Sungguh SangatTerpuji Sifat Bapak Anas Urbaningrum Mantan Ketua Partai Demokrat Saat Dipanggil Untuk Diperiksa Oleh KPK.Begitulah wajah Pejabat Di Indonesia Sudah Berbuat Salah Pun Masih Ber Anggapan Tidak Dan Enggan Untuk Diperiksa.Kapan Negara Kita Akan Menjadi Maju Disemua Bidang Kalau Kasus Korupsi Saja Pun Takut Berhadapan Dengan Hukum.Sudah Pasti Korupsi Di Indonesia Tidak Akan Habis.Jemput Paksa Saja Pak Anas Urbaningrum Itu Ketua KPK.Jangan Biarkan +6282167170674 Negara Ini Lebih Banyak Manusianya Yang Melakukan Korupsi. +6281361593307 Ada usul.,setiap ujian CPNS,selesai ujian disitu di periksa biar adil dan jelas, tanpa KKN,di setiap lokal ada polisi yg mengawasi.,dan pengawas ujian,di tambah wartawan,tu baru adil....saya dukung presiden yg buat peraturan ini... +6285297814315 Berhati2lah dgn pikiran kita, krn akan menjadi perkataan kita. Berhati2lah dgn perkataan kita, krn akan menjadi perbuatan kita. Berhati2lah dgn tindakkan kita, krn akan menjadi kebiasaan kita. Dan ? Berhati2lah dgn kebiasaan kita, krn akan menjadi karakter kita. Ya Allah, hanya kepada-Mu kami memohon perlindungan dari kesalahan pikiran, perkataan dan perbuatan kami, Bimbinglah kami agar dpt mengikuti segala aturanMu. Aamiin Ya Rabbal’alamiin Wslm +6285277850101 Sport Dokumentary (tinju) di TVONE s/d dini hari membosankan dan menjengkelkan, karena terlalu banyak komentar dan iklan/pesan. Karena jam tayangnya lewat tengah malam dan esoknya hari kerja mohon triknya diperbaiki. Tksih WASPADA. +6285260088842 Keinginan orang/oknum untuk menghapus AGAMA dalam e-KTP membuktikan kwalitas agama/keIMANan orang atau oknum tersebut sangat GALAU, LEMAH dan RUSAK. +6285359230466 Harga gas elpiji 12 kg naik sampe 68 %, luarbiasa zalim pemerintah & pertamina, rakyat yg sudah tak pernah di buat sejahtera, sekarang ditimpa musibah harga elpiji yg naik diluar kemanusiaan, ayo... jangan pilih presiden yg akan dtg & wakil rakyat dari partai yg berkuasa sekarang, pemerintah sekarang sdh jadi pahlawan kesiangan... +6285260088842 Pemberitaan ber-ulang2 dari tahun ketahun oleh WASPADA tentang Jalan Rusak Serbelawan (JRS). Bupati Simalungun tidak bergeming. Kenapa...???. Karena, hatinya sudah MATI. Mungkin dia penganut paham “ANJING MENG-GONGGONG KAFILAH BERLALU”. He...he...he. Horas WASPADA.

Senin 13 Januari 2014

HAI, Pejuang Tak Kenal Lelah

Anas Bicaralah Blak-blakan gustus 2011 Nazaruddin ditangkap di Kolombia. Sejak itu Nazar mengoceh menyebut-nyebut petinggi Partai Demokrat terkait kasus korupsi di berbagai proyek pemerintahan, namun semua yang dituduh mantan bendahara partai berlambang bintang mercy itu hanya tenang-tenang saja. Bahkan Nazaruddin dikecam sebagai orang yang lagi stres, berhalusinasi dll. Namun ocehan Nazar yang terang-terangan menyebut nama Angelina Sondakh, Andi Mallarangeng sampai Anas Urbaningrum, dan sejumlah nama lainnya ternyata membuahkan kenyataan. Terbukti satu per satu orang-orang yang disebutnya sudah ditangkap KPK. Angelina Sondakh sudah divonis penjara, Andi Mallarangeng dalam prosesmenujupersidangan,sedangkanAnasbaruJumatlaluditahanKPKlewatpemanggilan ketiga. Hanya tinggal beberapa nama saja yang belum tersentuh, di antaranya Ibas, putra SBY yang kini menjabat Sekjen DPP Partai Demokrat. Anas begitu resmi menjadi tahanan KPK langsung bernyanyi kecil dengan menyebut sejumlah nama penyidik KPK sesaat sebelum digiring ke mobil tahanan. Diawali dengan ucapan berterima kasih kepada Ketua KPK Abraham Samad yang telah menandatangani surat penahanannya dan juga kepada para penyidik Endang Tarsa, Bambang Sukoco, dan Heri Muryanto. Anas juga mengucapkan terima kasih kepada Ketua Umum Intisari: Partai Demokrat Susilo BambangYudho(SBY). Di atas segalanya saya terima Demokrat kian terpojok yono kasih yang besar kepada Pak SBY. Mudahkalau Anas mau bicara mudahan peristiwa ini punya arti, makna, menjadi hadiah tahun baru 2014. lebih vokal dan blak-blakan danNyanyian Anas pasca ditahan KPK bertujuanmengkritik,tepatnyamenggelitik sebagai whistle blower pihak yang terkait, seakan nama-nama yang disebutnya itu memiliki andil dalam proses dijadikannya ia sebagai tersangka dan kini menghuni rumah tahahan KPK. Walau tanpa bukti KPK diharapkan menindaklanjutinya. Cara Anas menyindir memang berkelas, seakan berterima kasih namun sesungguhnya ingin menyatakan mereka yang disebut terlibat dalam konspirasi politik dalam menjatuhkannya dari kursi Ketua Umum DPP Partai Demokrat dan menjerumuskannya dalam tahanan KPK untuk menghabisi karier politiknya. Kini, posisi Anas sangat sulit. Kelihatan sekali dari wajahnya Anas sangat terpukul. Sebab, dalam sejarah KPK sangat berat untuk orang yang sudah ditahan bisa lolos dari vonis hakim Tipikor. Apalagi trend hukuman yang dijatuhkan kepada terdakwa kasus korupsi cenderung semakin berat. Banyak kasus banding yang mulanya dihukum 2-3 tahun akhirnya menjadi 5-10 tahun penjara, seperti Luthfi Hasan Ishaq, mantan Gubsu Syamsul Arifin, Angelina Sondakh. dll Hemat kita, sejak pelengseran dari kursi Ketua Umum DPP Demokrat setelah dijadikan tersangka oleh KPK, Anas tidak mau blak-blakan membongkar kasus korupsi di lembaga DPR RI, termasuk Demokrat. Padahal, publik hakkul yakin Anas banyak tahu terkait kasus Bank Century dan kasus-kasus lainnya. Apalagi melihat posisi dan kedekatannya dengan keluarga Cikeas semasa menjabat Ketua Fraksi di DPR RI dan Ketua Umum DPP PD. Jadi, reaksi Anas hanya‘’mengancam’’ dengan menyebut sejumlah nama dan kalimat satir berterima kasih belumlah bisa disebut membuka lembaran kedua apalagi lembaran ketiga dan seterusnya. Hal itu sangat disayangnya. Harusnya Anas mau bicara terangterangan kepada media massa sehingga posisinya sebagai tersangka sekaligus pembuka kotak pendora atau menjadi whistle blower. Ini yang ditunggu-tunggu masyarakat. Menjadi tanda tanya mengapa Anas belum juga mau bicara blak-blakan. Padahal, posisinya sudah sangat terzalimi hingga harus ditahan KPK. Padahal, Anas sudah berjanji sesaat setelah lengser dari partai pemenang Pemilu itu tahun lalu untuk membuka lembaran kedua, ketiga dan seterusnya. Harapan publik, Anas menepati janjinya. Bicaralah vokal dan blak-blakan terkait kasus-kasus korupsi yang melibatkan elite politik dan pemerintahan. Koperatiflah dengan KPKdemi kebaikan bangsa dan negara melawan koruptor yang menjadi musuh rakyat dan membuat rakyat miskin karena triliunan rupiah uang rakyat dimakan ‘’tikus-tikus’’ koruptor. Yang pasti, para elite Demokrat sangat khawatir dengan masa depan partainya. Jika Anas bicara blak-blakan maka Demokrat bisa terkubur karena popularitas dan elektabilitas partai semakin hancur. Apalagi kalau lembaran kedua dan seterusnya dari Anas membongkar aib Demokrat. Kalau saja Anas menjadi whistle blower masyarakat akan memberi apresiasi, dan hukumannya pun bisa ringan. Tapi, melihat gelagat Anas yang menyangkal korupsi, korban politik, bahkan bersedia digantung di Monas kalau korupsi satu rupiah saja, lembaran kedua dan seterusnya dari Anas (mungkin) hanya angan-angan belaka.+


Oleh Ahmad Taufan Damanik Pilihan jurnalismenya berbeda jauh dengan jurnalisme kapitalis yang berkembang saat ini:orientasi pasar,pragmatis dan kehilangan misi memajukan kesadaran bangsa


eriode kemunculan tokoh semacam Hajjah Ani Idrus (HAI), seorangperempuanjurnalis-pejuang, jauh dari kaitan model gerakan feminisme yang marak sejak era Orde Baru. Sama halnya dengan tokoh sezamannya semisal SK Trimurti, Toety Azis, Herawati Diah, pisau analisis gender sebagaimana yang sekarang akrab digunakan akademisi dan aktivis perempuan, belumlah mereka kenal. Kesadaran kebangkitan tokoh perempuan masa itu, tentu berkait dengan konteks dinamika yang khas sejalan dengan dialektika persoalan yang mereka hadapi pada masa itu pula. Ada suasana gerakan kebangsaan dan perjuangan kemerdekaan. Ada pula penetrasi modernitasyangmulaitumbuhsejalanpolitik etis kolonial Belanda yang membolehkan kaum bumi putra masuk sekolah Belanda. Adakalanya modernitas berdikotomi dengan nilai kultural lokal, namun tak jarang bisa bersinerji sehingga semakin memperkuat basis nilai aktor yang tumbuh di dalam dialektika kedua nilai tersebut. Dialektika yang rumit ini, bahkan mendorong kesadaran kaum perempuan bangkit dan berdiri sama posisi dengan kaum pria dalam memperjuangkan nasibbangsanya,maupundalamrelasiperempuan - laki-laki. Hanya saja, kebanyakan tokoh perempuan pergerakan masa itu justru meletakkan isukesetaraanposisiperempuan(emansipasi) sebagai bagian integral dari keseluruhan persoalanrakyatdankebangsaanberhadapan dengan struktur penindasan yang lebih besar, yakni penjajahan. Dengan begitu, isu hak perempuan menjadi tak terpisahkan dari isu kebangkitan sosial politik secara umum dan bukan merupakan dua hal yang dikotomistik, sebagaimana adakalanya dilakukan sebagian kalangan feminis dekade sekarang ini. Karena itu, isu hak perempuan bukan sesuatu yang ekslusif dari isu sosial politik lainnya. Pejuangnya pun adalah tokoh yang peduli dan berjuang untuk isu kebangsaan pada umumnya. Sebagai sosok pejuang kebangsaan dan dalam konteks perspektif integralistik itulah mereka mendobrak kelaziman budaya mengenai posisi perempuan di dalam keluarga, masyarakat dan negara. Secara sosiologis mereka tetap merupakan bagian yang kuat dari masyarakat dan nilainilai sosial yang mengikat mereka. Mereka bukan sosok yang mengalienasi diri dari konteks sosial politik yang sedang bergerak pada masa perjuangan mereka. Tulisan ini, akan mencoba melihat sosok HAI, seorang jurnalispejuang yang telah mengabdikan hampir sebagian besar hidupnya untuk kebangkitan bangsanya, dan juga kaumnya: perempuan. Menilik konteks dialektika pergerakan yang melatari kemunculannya, ada baiknya kita pelajari deretan nama tokoh lain yang mengawali pergerakan kaum perempuan di dunia pers-perjuangan Sumatera Utara. Sebutlah kemunculan Perempoean Bergerak yang terbit pertama kalinya 1919 di Medan. Ia didirikan H.Muhammad Taher, Parada Harahap danT.A. Sabariah. Perempoean Bergerak adalah media massa perempuan perta-

ma di Sumut yang melibatkan enam perempuan sebagai pengasuhnya. Slogan majalah ini yaitu “Untuk Menyokong Pergerakan Perempoean”, dicetak oleh N.V. Drukkerij Setia Bangsa, yang juga menerbitkan Benih Merdeka. Para penyunting Perempoean Bergerak terdiri dari Boetet Satidjah, pembantu redaktur adalah Anong S. Hamidah, Ch. Barijah Indra Boengsoe, dan Siti Zahara. Media ini bersama tokoh di da-lamnya, berjuang membangkitkan kesadaran perempuan di tengah penindasan kolonial Hindia Belanda. Tahun 1932, muncul Soeara Iboe, yang diterbitkan organisasi perempuan yang ber-nama sama dengan media ini, yakni Soeara Iboe. Jika Soeara Iboe muncul dari tokoh-tokoh perempuanetnisMandailing,beberapatahun sebelumnya (tahun 1028) sudah muncul pula media Parsaoelian Ni Soripada di Tarutung dari perempuan etnis Toba, yang digagas Puan Siahaan dan Puan ED Nababan. Dari etnis Melayu, muncul majalah Keoetamaan Isteri diluncurkan 2 Oktober 1937 oleh perkumpulan Keoetamaan Isteri. Peluncurannya dihadiri oleh tokoh-tokoh Sumatera Timur, termasuk Paduka Yang Mulia J.M Tengkoe Permaisuri Negeri Deli. Meski pun misinya mendorong kemajuan perempuan, tapi misi besar media ini berkaitan erat pergerakan nasional yang sedang marak di seantero nusantara, termasuk Sumatera Timur. Yang juga menarik adalah media-media ini juga berhasil mengaitkan tokoh-tokoh pejuang perempuan di berbagai daerah di Hindia Belanda. SKTrimurti dan Hajjah Rangkayo Rasuna Said, Fatimah misalnya sering terlibat mengisi kolom di media Keoetaman Istri. Artinya, ada kesamaan kesadaran yang bangkit di berbagai penjuru tanah air, sama dengan bangkitnya gerakan kebangsaan di seanteronusantara.Yangtakkalahpentingnya, pers adalah media bersama memperjuangkan nasib bangsa, termasuk nasib kaum perempuan. Selanjutnya, 18 Mei 1938 muncul pula Menara Poetri yang dibidani Hajjah Rangkayo Rasuna Said dengan missi yang bahkan lebih tajam dari media sebelumnya karena sudah lebih banyak mengutarakan masalah-masalahstrukturaldankebangsaandibandingkan masalah domestik yang melingkupi kaum perempuan. Kemunculan Menara Poetri melengkapi rangkaian sejarah kaum perempuan di Sumut memperjuangkan hak-hak perempuan sekaligus berjuang bersama tokoh bangsa lainnya menuju kemerdekaan dari penindasan penjajahan. Di era yang sama, lahir lagi Boroe Tapanuli, tahun 1940 di Padangsidempuan, dimotori Doemasari Rangkoeti, Roesni Daulay, Dorom Harahap, MarieOentungHarahapdanHalimahLoebis. Sejalankemunculanpejuangperempuan

melalui pendirian media pers, juga muncul sederetan pengarang dan wartawan perempuan yang terlibat dan suka menulis dalam suratkabardanmajalahpadamasapergerakan sekitaran tahun 1930-an antara lain Ommoe Shoebaidah (Pandji Islam), Puan Gumarnia Al Matsir (K.I.), Rangkayo L. Roesli (K.I.), Roswita Cavalinnie (Abad, 20) Siti Norma (Pedoman Masjarakat), Rangkayo Rasoena Said (Menara Poetri dan dll), Rohana Djamil (P.I., editor), Puan Dt Temenggoeng (K.I.), Annie Idroes (Seruan kita), Moenar (Keoetamaan Isteri) Fatimah Das (Keoetamaan Isteri), Herawati Latif (P.I), Siti Awan (K.I.) dan S.K.Trimurti(penulisbebas).Semangattulisanmerekamencerminkansama,kepedulianterhadap nasib bangsa dan karena itu mereka ikut berjuang bersama pejuang kebangsaan lainnya di dalam arus pergerakan kemerdekaan Indonesia. Semangat itu tidak terpisahkan dari kepedulian dan perjuangan mereka untuk kesetaraan hak perempuan. Fenomena umum lainnyaadalahtokohperempuan ini bangkit dari kultur lokal yang kuat, berkembang melalui proses pendidikan relijius yang progresif dari madrasah, surau, yang kemudian dikawinkan dengan semangat modernitasyangdidapatkanmelaluipendidikan sekolah Barat yang tumbuh akibat politik etis.YangberagamaKristenpunmenampilkan kecenderungan sama, mampu memadukan modernitas, adat dan relijiusitas ke dalam pemikiran dan sikap mereka. Tentu ada banyak dialektika dalam proses mengawinkan berbagai latar belakang prinsip nilai berbeda tersebut. Namun nyatanya mereka sanggup menembus batas berbagai perbedaan, dan yang paling penting tak kehilangan identitas asli yang terikat kepada budaya dan agama. Bagi tokoh seperti Rohana Kudus dan Hajjah Rangkayo Rasuna Said – juga Hajjah Ani Idrus - menjadi modern, mandiri, justru meneguhkan jati diri mereka sebagai orang Minang dan Muslimah. Bandingkan dengan kesulitan tokoh-tokoh feminis kita saat ini yang seringkali gamang memadukan berbagai prinsip emansipatoris ala Barat dengan lokalitas dan relijiusitas. Sebagian mereka terpaksa mesti memilih, padahal generasi sebelumnya justru berhasil mengawinkan dimensi rasionalitas dari akar peradaban yang berbeda tersebut. Sosok Hajjah Ani Idrus Dilahirkan di Sawahlunto, 1918, mengenyam Sekolah Dasar di kampung halamannya, kemudian masuk madrasah dan surau. Tahun 1928 ke Medan dan meneruskan pendidikan di sekolah madrasah di Jalan Antara Ujung. Setelah itu masuk Methodist English School, Meisjeskop School, Schakel School, Mulo dan SMA sederajat.Tahun 19621965 menjadi mahasiswa Fakultas Hukum UISU Medan, tahun 1975 sebagai mahasiswa Fisipol UISU, dan mendapatkan gelar DoctorandauntukjurusanilmusosialpolitikUISU. Tahun 1930, pada usia 12 tahun HAI, telah berani mengirimkan tulisannya ke majalah Panji Pustaka Jakarta. Setelah itu, memutuskan berkarir di dunia jurnalistik, yang tak lazim dikerjakan kaum perempuan masa itu. Tahun 1936, beliau bekerja pada Sinar Deli Medan pada majalah Politik Penyedar. Minatnya di bidang politik mendorong menerbitkan majalah Seruan Kita (1938)

yang berisi berita politik bersama H.Moh.Said, yang kemudian menjadi suaminya. Tahun 1947,bersamaH.MohammadSaidmendirian harian Waspa-da. Mengiringi kepeduliannya terhadap isu perempuan, tahun 1949, HAI menerbitkan majalah Dunia Wanita. Ia menjabat Pemim-pin Umum/Pemimpin Redaksi Waspada, Dunia Wanita dan edisi Koran Masuk Desa (KMD, dan Koran Masuk Sekolah) sejak tahun 1969 sampai 1999.Tahun 1988 ia menerima anugerah ‘Satya Penegak Pers Pancasila dari Menteri Penerangan R.I (H. Harmoko), di Jakarta, dimana hanya diberikan pada 12 tokoh pers nasional.Tahun 1990, menerima peng-hargaan Menteri PeneranganR.I.sebagaiwartawanyangmasih aktif mengabdikan diri di atas 70 tahun. Sebagai jurnalis senior, HAI juga ikut mendirikan dan membina organisasi PWI.Tahun 1951 turut mendirikan organisasi PWI. Medan dan menjadi pengurus. Tahun 1953-1963, berturut-turut menjabat sebagai Ketua PWI KringMedan.HAIsangatseriusmeningkatkan kapasitas para pekerja pers. Bersama tokoh pers lainnya, tahun 1959 mendirikan‘Yayasan BalaiWartawan’ Cabang Medan, dan dipilih sebagai ketua, selanjutnya mendirikan‘Yayasan Akademi Pers Indonesia’ (API) dan menjabat wakil ketua. Artinya, HAI juga peduli terhadap peningkatan profesionalitas wartawan. Kerja kerasnya selama 25 tahun bekerja dan mengurusi pers menyebabkan HAI mendapatkan penghargaan dari PWI Cabang Sumut/Medan (tahun 1959). Di internal harian Waspada, HAI mengambilalih kepemimpinan di Harian Waspada Medan tahun 1969 setelah H.Mohammad Said mengundurkan diri. Pada 1979 ia menerima piagam Pembina Penataran Tingkat Nasional dari BP7 Jakarta. Kemudian, tahun 1984, bersamaan Hari Pers NasionalmenjadianggotaKPB(KantorPerwakilan Bersama) di Jakarta dari tujuh Surat kabar terbesar di daerah. Ia banyak melakukan perjalanan jurnalistik ke luar negeri.Tahun 1953 mengunjungi Jepang sebagai wartawan Waspada bersama rombongan misi dagang fact finding RI yang diketuai Dr Sudarsono untuk merundingkan pembayaran Pampasan Perang. Tahun 1954 mengunjungi RRC, tahun 1955 mengunjungi Belanda,Belgia,Perancis,ItaliameliputiperundinganTunku Abdul Rahman dengan Ching Peng, pimpinan Komunis Malaya, di Baling Malaysia.Tahun 1956 mengunjungi Amerika Serikat, Mesir, Turki, Jepang, Hongkong, dan Thailand. Kemudian, tahun 1961 dan 1962 mengunjungi Inggris dan Jerman Barat serta Paris.Tahun 1963 mengikuti rombongan Menteri Luar Negeri Subandrio ke Manila, Filipina dan mengikuti perjalan Presiden RI ke Irian Jaya dalam rangka penyerahan Irian Barat ke pangkuan RI. Selanjutnya, tahun 1976 mengikuti rombongan Adam Malik menghadiri KTT Non-Blok di Srilangka. Ia juga punya banyak pengalaman di bidang politik. Tahun 1934 ia memasuki organisasi ‘Indonesia Muda’, wadah perjuangan pergerakan pemuda sebagai wakil ketua.Tahun 1937 menjadi anggota partai Gerakan Rakyat Indonesia (GERINDO) di Medan. Kemudian1949,menjadianggotaPartaiNasional Indonesia (PNI), beberapa kali menjabat sebagai ketua penerangan, dan pernah menjadi anggota pleno Pusat PNI di Jakarta. Ia juga menghadiri KongresWanita Pertama di Jogya. Lalu, tahun 1950, ia mendirikan FrontWanita Sumatera Utara sebagai ketua. Kemudian menjabat Ketua Keuangan Kongres Rakyat Bersambung ke hal C7

Harmonisasi Dalam Dalihan Na Tolu Oleh Drs Indra Muda Hutasuhut, MAP Apabila masyarakat Sipirok ditanyakan ini sawah siapa? Jawabannya bukan sawah saya,melainkan sawah kita.Hanya satu yang menjadi milik pribadi orang Sipirok yaitu istri.


dat Dalihan Na Tolu merupakan filosofi hidup masyarakat Batak untukberinteraksidengansesamanya. Manakala konsep adat ini dirangkai harmonisasi kehidupan beragama, arah pandang akan sampai ke Tapanuli Selatan yaitu Kecamatan Sipirok, kampung halaman H.Raja Inal Siregar Mantan Gubernur Sumut, H.Arifin M. Siregar mantan Gubernur Bank Indonesia, H. Hasrul Harahap mantan Menteri Kehutanan, yang memiliki predikat sebagai barometer. Konon Jenderal Sarwo Edhi, mertuanya Presiden SBY menyebutnya sebagai daerah percontohan implementasi Pancasila. Sistem kekerabatan masyarakat Sipirok, sebenarnya tidak jauh berbeda dengan masyarakat Batak umumnya, menganut sistem kekerabatan berdasarkan garis keturunan dari pihak ayah patrilinial. Anak lelaki tidak hanya menjadi penerus keturunan, tetapi juga pewaris tanggung jawab keluarga pengganti peran ayah dan penerus marga ayahnya. Dengan demikian, terbentuk sistem kekerabatan yang mengikatketurunandenganmargayangdiwariskan. Misalnya, seorang kakek marga Siregar, maka anak hingga cucu dan cicitnya memiliki marga sama dengan sang kakek. Beberapa komunitas marga yang dapat kita jumpai di Siporok antara lain, Siregar, Hutasuhut, Pane, Sitompul, Harahap, Ritonga. Jadi, marga yang diwariskan ayah, akan melekat di belakang nama anak-anaknya. Ketika keturunan seorang ayah sudah melangsungkan perkawinan berarti mereka membentuk keluarga baru. Hubungan kekerabatandariseluruhanaklaki-lakiseorang ayah yang telah membentuk keluarga baru itu disebut kahanggi atau markahanggi (hubungan persaudaraan menurut pertalian darah berdasarkan marga yang sama). Fungsi merekadalamacaraadatmemilikikedudukan yang sejajar termasuk masalah tanggung jawab. Dalam hal tertentu kelompok marga yangberbedadapatjugadisebutmarkahanggi karena mengambil istri dari keluarga yang sama. Hubungan kekerabatan yang demikian ini disebut dengan kahanggi pareban. Dalam hubungan kekerabatan masyarakat Sipirok juga dapat kita jumpai yang namanya mora, yaitu kelompok kekerabatan pemberi anak

gadis dalam hubungan perkawinan. Sedangkan anak boru merupakan kelompok kerabat yang berstatus sebagai penerima anak gadis dari mora. Kedudukan anak boru dalam acara adat merupakan pihak yang harus selalu hormat kepada moranya. Misalnya dalam pesta perkawinan, pihak anak boru berperan sebagai juru masak di dapur termasuk menghidangkanmakanankepadatamu.Karenaitustruktur kekerabatan (kahanggi, mora, anak boru) dalam masyarakat Sipirok memiliki kedudukan sangat penting, selain menjadi penentu fungsional satu kelompok kekerabatan, juga menjadi syarat utama dapat terlaksananya acara adat. Apabila salah satu di antara unsur tersebut tidak ada, acara adat tidak dapat dilaksanakan. Masyarakat Sipirok menyebutnya dengan Dalihan Na Tolu (Tungku Bertiang Tiga). Maknanya apabila salah satu di antaranya tidak ada, maka periuk atau kuali sebagai tempat memasak tidak dapat diletakkan di atas tungku secara sempurna. Harmonisasi Harmonisasi kehidupan beragama di Sipirok akan terlihat lebih jelas pada momen pesta adat seperti perkawinan, masuk rumah baru, penabalan nama anak, bahkan saat meninggalnya anggota keluarga. Keperluan akomodasiacarapestaadatbiasanyaditangani pemeluk agama Islam walaupun yang memiliki hajatan berasal dari penganut agama Kristen. Hal ini sangat dimaklumi penganut Kristen karena umat Islam memiliki hukum agama mengenai makanan halal - haram. Untuk prosesi pelaksanaan acara adat, perbedaan agama tidak dipermasalahkan, selalu disesuaikan fungsi seseorang dalam acara adat tersebut. Kendati pihak mora menganut agama Islam, anak borunya menganut agama Kristen, pihak anak boru harus tetap hormat kepada moranya. Demikian juga sebaliknya, apabila moranya beragama Kristen, anak borunya beragama Islam juga harus tetap menghormati moranya. Hubungan kekerabatan yang demikian juga berlaku bagi pihak kahanggi walaupun mereka berbeda agama. Dengan implementasi tatanan adat yang demikian, tidak terlalu jelas kelihatan perbedaan

agama dalam hubungan masyarakat Sipirok. Namun tidak berarti kualitas keimanan mereka lebih rendah dibandingkan masyarakat beragama di daerah lain. Terciptanya pola pikir demikian, karena relasi kekerabatan ditata dalam sistem dalihan na tolu yang diwariskanturuntemurun.Apabilamelanggar tatananadat,berartimelanggarpetuahleluhur yang berarti pula menentang kehendak masyarakat sekitarnya—tentu saja dapat menjadi bahan pembicaraan, atau dikucilkan dari lingkungan masyarakatnya. Dengan demikian, kearifan lokal dalihan na tolu memiliki potensi kuat merajut hubungan antar umat beragama. Sebab perangkat adat (kahanggi, mora, anak boru) tidak bertentangan dengan hukum agama, sehingga tidaklah mengherankan sejak dulu (awal masuknya agama Islam dan Keristen ke Sipirok) hubunganantaraumatberagamatetaprukun dan belum pernah ada yang bisa mengganggunya. Sistem kekerabatan terajut dalam hubungan darah, kasih sayang, tolong menolong di antara sesamanya yang tercermin dan dijamin sistem dalihan na tolu. Hal ini tercermin puladarituturkata.Misalnyaapabilamasyarakat Sipirok ditanyakan ini rumah siapa? Jawabannya adalah rumah kita dan bukan rumah saya. Ini sawah siapa? Jawabannya bukan sawah saya, melainkan sawah kita. Hanya satu yang menjadi milik pribadi orang Sipirok yaitu istri. Bila ditanyakan itu istri siapa? Jawabannya adalah istri saya dan bukan istri kita. Harmonisasi dalam aspek agama dapat dilihat dari fenomena lokasi rumah ibadah, letakantaramasjiddangerejadalambeberapa desa tidak lebih dari radius 150 meter. Demikian juga sengketa antar pemeluk agama mengenaipertapakanrumahibadahtidakpernah kedengaran. Pemeluk agama Kristen sebagai agama minoritas, tidak pernah merasa terintimidasi dari pemeluk agama Islam untuk melaksanakan ibadah agamanya. Rasa saling pengertian di antara pemeluk agama senantiasa terjalin dengan baik. Konon, di daerah ini masih bisa kita jumpai tradisi Marjambar yaitu, pemberian bingkisan kue lebaran oleh pemeluk agama Islam kepada saudara, tetangganya yang beragama Kristen pada saat lebaran Idul Fitri. Sebaliknya pemeluk agama Kristen kepada pemeluk agama Islam pada saat Tahun Baru. Harmonisasi kehidupan beragama juga dapat dijumpai pada peristiwa meninggalnya warga. Untuk keperluan penggalian kubur biasanya dilakukan bersama antara pemeluk agamatanpakomando.Apabilayangmeninggal disemayamkan hingga malam hari, akan dijaga bersama antar pemeluk agama. Pemberangkatan jenazah ke pemakaman, tidak

jarangkatasambutanprosespemberangkatan disampaikanyangberagamaKristenwalaupun yang meninggal menganut agama Islam, demikian sebaliknya. Konon, pada beberapa tempatpemakananumumsepertiKecamatan Arse, Saipar Dolok Hole masih dapat ditemukan makam pemeluk Islam dan Kristen berdampingan.Pihakkeluargatidakmempersoalkannya, karena tidak jarang jenazah yang dimakamkan tersebut memiliki hubungan pertalian darah yang dekat. Menghadapi tahun politik 2014, yang digadang rawan konflik bernuansa SARA, sangat tepat apabila masyarakat Indonesia meniru harmonisasi masyarakat Sipirok dalam bingkai adat dalihan na tolu. Sehingga bangsa Indonesia dalam ke-Bhinnekaanya tetap rukun, damai dalam bingkai satu tanah air, satu bangsa dan satu bahasa. Semoga. Penulis adalah Dosen Fisipol Universitas Medan Area.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * Presiden: Pemberantasan korupsi lanjut - Siapa berikutnya, he...he...he * Penertiban alat peraga kampanye tebang pilih - Tanya kenapa? * Bupati Tapsel: Jangan pernah One Man Show - The Show Must Go On boleh ya pak! o ak D W



WASPADA Senin 13 Januari 2014


Tahun (Kejahatan) Politik Politik Uang Untuk Menang! Tak dipungkiri uang adalah pemeran utama dalam kehidupan. Kebutuhan yang beragam menjadikan banyak orang mencari berbagai cara mendapatkannya (uang). Belum lagi masalah kenaikan barang yang terjadi tiba-tiba, sempitnya lapangan kerja, dan sebagainya. Hal inilah yang menjadi masalah betapa uang dinomorsatukan. Sedangkan pendapatan seseorang berbeda-beda satu dan lainnya. Begitu pula kebutuhan, berbeda antara kebutuhan yang satu dengan yang lainnya. Si A yang tukang bordir berlapak di emperan toko, penghasilan satu hari berkisar Rp30-100 ribu. Jika kalkulasian pengeluaran atas kebutuhan si A yang memiliki 4 anak yang masih bersekolah tentu pendapatan itu sangatlah kurang. Belum pengeluaran untuk jajan anak-anak, makan 3 kali, transportasi pergi sana sini dan lain-lain. Hal tersebut menjadi alasan mengapa orang mencari uang dengan jalan pintas. Banyak hal yang perlu dipikirkan mengapa kalangan menengah ke bawah yang menjadi ‘mata pancing’ oknum politik. Bukan saja uang yang mereka tawarkan mulai dari barang, hingga janji masa depan. Siapa yang tidak mau tanpa otot dan pikiran langsung mendapatkan apa yang dibutuhkan? Politik dan uang mungkin merupakan dua hal berbeda namun tidak dapat dipisahkan. Untuk berpolitik orang membutuhkan uang dan dengan uang orang dapat berpolitik. Istilah politik uang yang dalam bahasa Inggris money politics mungkin istilah yang sudah sangat sering didengar. Istilah ini menunjuk pada penggunaan uang untuk mempengaruhi keputusan tertentu dalam Pemilu. Dalam pengertian seperti ini uang merupakan alat memengaruhi seseorang menentukan keputusan. Tentu saja dengan kondisi ini dapat dipastikan keputusan yang diambil tidak lagi berdasarkan baik tidaknya keputusan tersebut bagi orang lain tetapi keuntungan yang didapat dari keputusan tersebut. Musim pemilu nanti menjadi realita betapa berkuasanya ‘uang’ bagi mereka yang mengharapkan kemenangan. Masyarakat yang pendapatannya menengah ke bawah menjadi tujuan utama para oknum politik untuk melancarkan aksinya. Sudah menjadi rahasia umum para oknum politik yang akan ikutserta di Pemilu menghabiskan uang mencari pendukung ‘ilegal’. Sebagian masyarakat ada yang menerima uang tersebut tetapi tetap Golput (tidak ikut memilih), ada juga masyarakat yang menerima uang, tetapi memilih Caleg lain, dan ada juga yang jujur tidak menerima uang yang sedemikian rupa. Mustahil pada Pemilu kali ini tidak menerapkan politik uang.Walaupun kabar yang beredar bahwa politik uang tidak akan meningkatkan minat masyarakat sebagai pemilih untuk mencoblos Caleg terkait, tetapi politik uang pasti akan tetap diterapkan oleh Caleg yang ditujukan kepada pemilih yang mengharap imbalan. Bukan hanya melakukan politik uang, Caleg juga harus melakukan kampanye yang mencerdaskan masyarakatnya. Politik uang yang dipraktikkan oleh para pelakunya merupakan tindakan yang melanggar norma negara dan agama sekaligus. Pelanggaran ini dalam kenyataannya seringkali ditumbuhkan dengan sekedar hubungan timbal balik yang mutualistik berupa pemberian yang diberikan oleh satu pihak dan diterima pihak lain yang kebetulan memerlukan, karena pada hakekatnya memberikan sesuatu untuk memperoleh sesuatu secara tidak benar adalah perbuatan tercela. Sesungguhnya Islam melaknat praktik politik uang yang merupakan tindakan penyuapan yang meluluhlantakkan tata nilai dalam masyarakat yang sejatinya dipelihara dan dijunjung tinggi. Apalagi di Aceh, daerah yang dijuluki Serambi Makkah ini, pastinya para Caleg yang lebih memahami bahwa politik uang itu sangat melanggar norma termasuk norma agama. Politik uang sama dengan ‘virus’ menggerogoti dan melemahkan moral masyarakat. ‘Virus’ itu terlihat dari tiga hal efek negatif yang ditimbulkannya. Pertama, membuat masyarakat menjadi malas. Kedua, menjadi pemicu terjadinya lingkaran setan korupsi. Ketiga, munculnya pemimpin tidak sejati. Maka sangat diharapkan kepada para Caleg agar tidak menggunakan politik uang agar tanah Aceh tercinta ini memiliki pemimpin bersih dan jujur seperti yang diimpikan oleh masyarakat pada umumnya. Untuk ke depannya, menjalani hidup di kota yang aman dan damai bukan hanya sebatas mimpi belaka. Khairunnisa Mahasiswi Teknik Informatika Universitas Malikussaleh

Dedi Sahputra


Tetapi, sayang sekali, ia hanya seperti seorang mentor yang menyebut semua bentuk dan jenis kejahatan tanpa berdaya menghentikannya.Apa memang bisa berharap lebih besar kepada KPK?


ereka menyebut tahun politik, barangkali dengan maksud tahun kelonggaran segala macam aturan demi politik. Kurang lebih terbuka peluang melakukan kejahatan, terutama korupsi, asalkan tidak ketahuan atau kalaupun ketahuan harus dapat disiasati agar jangan beresiko apa pun kepada pelaku.Tahun politik (2013-2014) adalah akhir bagi kepemimpinan SBY yang tak boleh mencalonkan kembali menjadi Presiden RI. Kalau begitu kita di Indonesia tidak sekadar berganti tahun dengan segala macam pesta termasuk kembang api yang mengindikasikan kehampaan itu. Mengawali tahun 2014 ini mari kita coba lihat ke dua arah: ke belakang dan depan. Siapa tahu dari telaahan itu Indonesia masih menarik bagi minoritas orang yang tetap berpikir negeri eks jajahan Belanda ini harus diselamatkan. Uang dalam politik adalah sebuah keniscayaan. Persoalannya uang siapa? Ketika kejelasannya tak patut, maka masalah pun muncul. Uang jenis yang tak jelas ini berpengaruh amat negatif terhadap politik, dan lazimnya sangat dirasakan khususnya di negara-negara berkembang yang mulai menata kehidupan politik dan kenegaraannya dengan berbagai model perbandingan dan di bawah arahan mentor-mentor yang sarat kepentingan. Ahok dalam sebuah rapat resmi Komisi III DPR RI dengan Mendagri Gamawan Fauzi pernah menuturkan pengalamannya dalam politik sejak peralihan dari rezim Orde Baru. Kelompok mereka yang pada umumnya adalah pengusaha kaya etnis China, “mendompleng”(jikaistilahinidapatdigunakan)kepada arus kekuatan politik yang ada, dan saat itu dianggaptepatuntukmensupportPDIP(http:/ / Pilihanpartaiitubukanrumusmati,melainkan alternatif yang dianggap terbaik belaka dalam upaya mengendalikan politik dari balik layar. Tujuannya safety, tentu saja. Sebesar apa yang ingin mereka kuasasi dari Negara? Semuanya, jika bisa, selain serpihan yang tak berharga. Berbicara tentang suksesi demi suksesi di bawah label reformasi, tampaknya Ahok dan kelompok yang diindikasikannya jauh melampaui pikiran orang-orang yang ditempatkan menggawangi semua lembaga strate-

gisnegaradalamkepemiluan,kepemerintahan danplus politik.Iasepintastampakjujurketika berucap tak underestimated terhadap PNS karir (merekalah figur kepemimpinan terbaik karena pengalaman birokrasinya yang teratur dan teruji). Tetapi semua sudah dirusak, dan negara telah menata politik yang memudahkan untuk pemberian legitimasi bagi para penjahat untuk menjadi pemimpin. Gamawan Fauzi terlihat seperti“dikuliahi” saat Ahok mementahkan gagasan para profesor di belakang Gamawan Fauzi yang sudah merasa sangat benar akan memindahkan kejahatan perpolitikan Pemilukada kembali ke legislatif (ini memang aneh, kejahatan Pilpres diasumsikanmasihjauhlebihdahsyattetapitakdimasukkan sebagai agenda untuk dikembalikan ke kewenangan semula. Peneriak kembali ke UUD 1945, yang mungkin merasa lebih mudah mendikte lembaga representasi puncak dengan kapasitas ratusan orang, diduga kuat motifnya hanya mencari peluang keterpilihan terbesar di luar cara pilihan langsung yang pasti beraroma primordialistik Jawa atau bereferensi faham Islam). Peran Para Mentor Sekarang tentu sudah sangat terlambat untuk disadari oleh semua orang bahwa seberapa besar pun angka money politics yang diperlukanuntukmemenangkanPemilukada, secara kausalistik tak bisa dengan begitu saja dikaitkan dengan perilaku koruptif pascaketerpilihan figur jahat itu. Seseorang boleh tak punya uang, asalkan dapat diperkuda olehpemodalyanginginberkuasadibelakang kebijakan (shadow state). Namun itu pun sudah begitu cepat ditinggalkan di daerah. Terbukanyapeluangmenjadikayarayamelalui jabatan kenegaraan yang ditopang oleh fakta buruknya penegakan hukum atas pelaku tindak pidana korupsi telah mendorong semua pelaku erzats capitalis berbakat khusus dan para local bigboss untuk ramai-ramai beralih menjadi penguasa pemerintahan. Menjadi kepala desa saja tak mengapa, asalkan dapat menguasai seluruh sumberdaya alam yang ada, apalagi kepala daerah (wali kota/bupati/ gubernur)? Contoh ini dapat dipeluas dan diperlebar oleh siapa saja: ke atas, ke samping dan ke bawah. Bukankah selama ini menjadi wali

kota/bupati/gubernur itu sesuatu yang secara permissiveness dibolehkan korupsi secara besar-besaran? Harus ada kejujuran mengakui fakta ini, apapun partaimu. Jika teori lama masih berlaku, power tend to corrupt, maka makin berkuasa seseorang, atau makin tinggi jabatan yang diraihnya, tentu makin jahatlah ia karena semakin besar kewenangan korupsionalnya. Kalau tak percaya, atau keberatan, maka cabutlah teori power tend to corrupt itu sekarang setelah mempelajari fakta-fakta di sekitarmu. Hanya ada satu jawaban untuk semua kerumitan ini, yakni negara tak berdaya melakukan perancangan software dan legalframework (rambu hukum) yang memfasilitasi rakyat untuk mendapatkan pemimpin sejati. Itu semua karena mentor menginginkannya. Negara mentor itu mungkin adalah pihak yang sama dengan penentu pelatuk senapan yang harus diarahkan ke beberapa orang yang setelah menjadi mayat harus diidentifikasi sebagai teroris. Mentor itulah yang “memaksa” kita menjadi tuan rumah untuk perhelatan-perhelatan perluasan efek pasti Washington Consensus dan segenap program globalisasi dalam ekonomi maupun dalam bidang politik dan sosial budaya. Mentor itu selalu dengan atas nama pluralisme dan demokrasi merasa benar sendiri memaksa-maksakan kehendaknya tak hanya melalui tokoh-tokoh yang mereka bina menjadi agen dan perwakilan kepentingan kompradoristik. Dengan mekanisme itulah terjawabmengapaIndonesiamementingkanliberalisasi dalam semua produk perundangundangannya, sembari dengan ihlas mengeliminasi kepentingan substantif rakyat. Dilema Pemadam Kebarakan Saya sangat bergembira ketika sebuah stasiun televisi swasta mewawancarai komisioner KPK Bambang Widjajanto beberapa hari lalu tentang korupsi. Katanya sudah dapat ditrace bahwa setiap transisi di Indonesia adakehilanganuangnegarasecarataknormal. Transisi 1999-2004, transisi 2004-2009, dan transisi 2009-2014. Century Gate yang tak bolehselesaiituhanyalahbagianyangmenandakankebenaranfaktayangdibeberkanBambangWidjajanto, termasuk BLBI. Tetapi, sayang sekali, ia hanya seperti seorang mentor ilmukriminologiyangdapatmenyebutsemua bentuk dan jenis kejahatan tanpa berdaya menghentikannya. Meskipun begitu, bagi sayahalitupunsudahcukuplah.Apamemang bisa berharap lebih besar kepada KPK? Initahun-tahunpolitik(2013-2014).Malah sebetulnya jika meminjam rumus 2-1-2, pertengahan 2012 adalah awal tahun politik itu. Rumus2-1-2adalahlogikadanperilakupolitik pemerintahandiIndonesiauntuksemualevel.

Dua tahun pertama konsolidasi sambil utakatikkabinet.Setahunberikutnyabekerjamembuat kebijakan populis berbiaya fantastis. Dua tahun terakhir dari 5 tahun periode kepemimpinan adalah bekerja untuk memenangkan rezim dan partai, dengan menggunakan semua akses yang ada termasuk menyelewengkan uang Negara (APBN/APBD maupun non APBN/APBD). Jadi, jika KPK menganggap dirinya masih sangat penting di samping lembaga penegak hukum yang terus-menerus dianggap masih harus dibonsai dan tak perlu dinormalkan, makamestinyaiapunharusmenjawab.Paling tidak ada dua hal penting yang wajib dikerjakannya dalam tahun politik ini. Pertama, menangkal agar jangan ada lagi kerugian mengorbankan negara untuk sebuah suksesi sepertisebelum-sebelumnya.Kedua,menjadi penentu boleh tidaknya seorang koruptor (indikatif) menjadi Capres atau Cawapres. Tentu saja ia punya hak dan kewenangan, bukan cuma mengumumkan dengan begitu awam meniru gaya media komunikasi publik yang tak kritis, semua harta kekayaan para Capres dan Cawapres itu bukan? Atau jika tak berani, minta saja secara kilat UU ke DPR dan Presiden agar tugas mencari tahu asalusul harta kekayaan Capres dan Cawapres tak usah ada dalam domain kewenangan. Intinya, jika yang akan memimpin negara adalah orang yang menjadi bagian dari masalah (kekorupsian nasional), Indonesia tak mungkin terselamatkan. Penutup Lengkingan suara khas dari Freddie Mercury, vokalis band lawas Queen, terasa begitu menyentuh saat menyanyikan lagu Teo Torriate yang syairnya ditutup dengan kalimat Let us never lose the lessons we have learned (kita tak boleh kehilangan apa pun atas semua pelajaranyangtelahkitadapatkan).Membaca seluruh syair lagu ciptaan Bryan May ini, tampaknya Teo Toriate sedang berkisah tentang sebuah perpisahan yang berat, dan sukarnya membayangkan hari-hari setelah itu. Be not gone (janganlah pergi), diulangnya sampai dua kali, menggambarkan kecamuk jiwa yang sungguh minta dikasihani. Tetapi perpisahan itu mestilah terjadi. Itu alamiah. Tak bisa dilawan. Semua sudah tertakar. Siapa yang belum berpisah pasti sedang menunggu tibanya perpisahan. Maka buatlah perpisahan itu sebaik-baiknya dan ikhiri semuanya dengan sebaik-baiknya (khusnul khotimah). Penulis adalah Dosen FISIP UMSU, Koordinator Umum Pengembangan Basis Sosial Inisiatif & Swadaya (‘nBASIS).

Politisasi Kebijakan Kenaikan Elpiji

Negeri Beradab Jika pada tataran materi ada dinamika yang terus berkembang, maka pada tataran pemikiran (non materi) ada pergulatan, bahkan peperangan yang tiada henti. Kalau tataran materi hanya bisa diikuti oleh siapa saja, tetapi tataran pemikiran ini zona eksklusif—hanya ditetapi sedikit orang saja. Salah satu tataran pemikiran itu seperti yang diungkapkan Prof Usman Pelly dalam seminar dalam rangka HUT Waspada ke67 kemarin. Bahwa para ilmuan sosial Belanda yang banyak menulis mengenai Indonesia, cendrung menempatkan Indonesia (kelompok etnik) pada posisi hilir kebudayaan. Para teoritisi tersebut seperti M.Buys (1866), J.Bool (1904), M.Joustra (1926), atau Lekkerker (1916) menyimpulkan tidak ada produk genuine dari Indonesia. Ya n g a d a adalah produk pinjaman dari India, China dan Arab. Peci dan kopiahmisalnya, itu kita pakai karena meniru orang Arab, kain sarung jadi bagian dari adat karena meniru tradisi orang India. Bahkan untuk mengubur mayatpun baru kita tahu karena meniru tradisi dari Persia. Maka inilah negeri yang hidupnya jauh dari nilai-nilai peradaban sebagai penopangnya. Oleh karena ia belum beradab, maka ia perlu dibuat menjadi beradab. Dan untuk membuatnya jadi beradab itulah, maka kalau ada perlakuan kolonial yang di luar perikemanusian harus dianggap sebagai“pembudayaan”yangmembuatnya menjadi lebih beradab. Lihatlah! Bagaimana tataran pemikiran itu menjadi landasan bagi berlangsungnya dinamika pada tataran materi. Ini pattern yang baku belaka. Bahwa suatu aksi bahkan reaksi akan selalu dipengaruhi oleh tataran pemikiran yang mempengaruhinya. Singkatnyabegini:setiapapapunyangdilakukan seseorang, ia akan mencari pijakan pemikiran yang membenarkannya. *** Tapi Anda jangan dulu menganggap saya berpendapat serupa dengan orangorang Belanda itu. Para tokoh seperti Mohd. Said dan Ani Idrus bahkan menjadikan masalah ini sebagai salah satu“medan tempur” perang pemikiran terhadap kolonialisasi Belanda. Melalui buku-buku dan tulisan-tulisannya mereka melawan Belanda. Enak aja.., masak kita dibilang gak beradab. Maka perang pemikiran itu pun berlangsung. Di dalamnya juga termasuk interpretasi peristiwa-peristiwa. Bahwa berita tidak

Oleh Shohibul Anshor Siregar

sekedar disajikan, tetapi dilengkapi dengan “kunyahan” analisisnya hingga ketika ia tiba di hadapan rakyat, sudah menjadi sesuatu yang siap “telan”. Ini yang saya sebut sebagai zona eksklusif itu. Hanya para pejuang dengan kadar kesahihan pikiran saja yang bisa terlibat di dalamnya. Merekalah yang dengan berkeringat mengungkap ada penjajahan yang dibungkus rapih dengan wacana yang bergenre ilmiah, dan dijaga oleh beragam argumentasi yang tajam. Tapi yang namanya penjajahan dengan kebohongan melapisisnya, betapapun bagus pembungkusnya, ia tetap akan muncul lewat berbagai cara. Ia akan terasa dari perlakuan yang diterima, dari bahasa tubuh yang tak seirama, dari sinar mata yang asing, atau dari pengakuan yang tidak seukuran akal. Ini seperti ibu di pusat pasar itu. Dia baru sadar ditipu setelah ingat uang dan perhiasannya dilarikan orang necis bermulut manis dengan sinar mata aneh itu. *** Pria pengendara sepedamotor matic itu berhenti di pinggir jalan tempat tumpukkan sampah mulai menggunung. Kepalanya yang berhelm itu meruduk, satu per satu bungkusan yang diletakkan di pijakan kaki sepedamotor itu dibuang begitu saja. Anak kecil yang sedari tadi duduk di bon-cengan melihat dengan wajah lugu. Sepanjang jalan yang kemudian saya lalui, ada beberapa lagi tumpukkan sampah di pinggir jalan tempat orang membuang sampah dengan mudah. Maka ini tabiat kolektif yang tak terbantahkan. Perilaku buang sampah ini sudah jamak seperti halnya perilaku melanggar aturan lalu lintas, pembangkangan terhadap simbol-simbol, praktek perkoncoan, rekayasa hukum, eksploitasi kekuasaan, dan menjadi konsektrasi-konsentrasi konsumsi. Saya bisa mengira seseorang yang dalamdirinyapunyasemuakecenderungan itu: Naik mobil mewah buatan eropah dengan kebanggaan yang tak bisa tertutupi, sambil sebelah tangannya yang melingkar Rolex dan cicin safir Arab membuang remah-remah apelWashington ke jalanan dari balik kaca mobilnya. Dia adalah pejabat yanglolosdarijeratkorupsikarenamenyuap petugas teman seorganisasinya dulu. Tepat di sebuah badan jalan bertanda larangan parkir, mobilnya berhenti. Astaga..! Saya jadi mulai berpikir kalau para teoritisi Belanda itu tak sepenuhnya salah. (Vol.481, 13/1/2014)

Kolom foliopini dapat juga diakses melalui

40 persen gas dalam negeri. Maka sejatinya ada margin 20 persen selisih keuntungan usaha dari luar negeri yang bisa diperoleh dari Pertamina untuk membeli gas dalam negeri sendiri. Hal tersebut juga ditambah nominal angka Rp36,7 triliun dari subsidi tahun 2014. Maka harga penjualan gas di Indonesia sebenarnya tidaklah bermasalah. Harga rata-rata ekspor gas melalui pipa yang mencapaiUS$15,63perjutaperbritishthermal unit yang berarti produsen gas di dalam negeri memberikan subsidi sebesar US$ 10 juta bagi produksi gas elpiji 12 kg maupun 3 kg. Oleh karena itulah sejatinya tidak ada alasanbagiPertaminamenaikkanelpiji.Namun demikian, dari situlah timbul celah untuk melalukan politisasi harga gas dalam lingkup pembuatan kebijakan. Adapun celah yang dimaksudkan adalah kembali lagi kepada permasalahan tender pengadaan tabung gas yang sebenarnya menjadi titik krusial dalam menelaah kenaikan harga elpiji di awal 2014

ini.Dalampolatendertabunggasyangselama ini terjadi, 80 persen pembuatan tabung gas elpiji sebanyak 10 juta lebih sendiri diperebutkanoleh32perusahaanbesibajayangmenjadi pemenang tender. Sedangkan sisanya yang 20 persen sendiri dikuasai oleh BUMN atau dalam hal iniWIKA maupun Krakatau Steel yang mendapat jatah tersebut. Artinya terjadi proses bancakan dalam pola pengadaan tabung tersebut sehingga logika rente ekonomi berkembang dalam kebijakan subsidi gas elpiji tersebut. Ditinjaudarisegiharga,pengadaaantabung gas elpiji untuk impor sendiri lebih besar yakni 1013 US$ per metrik ketimbang hanya untuk dalam negeri saja yang berkisar 903 US$ per metrik. Hal itulah yang kemudian menyebabkan para korporasi pemenang tender pengadaan tabung gas condong berkonsentrasi untuk melakukan pengadaan gas impor karena lebih menguntungkan daripada untuk membuat tabung gas elpiji. Ditinjau dari segi konsumsi, konsumsi gas tabung impor memang sedikit namun bisa memberikan efek laba yang besar daripada harus melakukan subsidi bagi gas 12 kg. Maka dari lokus itulah, sebenarnyaadapermainandalampengadaan tabung gas dimana korporasi pemenang tender gas pada akhirnya mendorong Pertamina sebagai pemegang kuasa untuk setidaknya bisa menyetarakan pengadaan tabung gas dalam negeri bisa mendekati level pengadaan tabung gas luar negeri. Maka dikarenakan harga tabung gas elpiji iniadalahmurniaksikorporasiyangdilakukan

Pertamina besera sub korporasi pemenang tenderpengadaantabunggasnya.Olehkarena itulah, tidak mengherankan apabila pemerintah dalam hal ini Menteri BUMN maupun Menteri ESDM sendiri enggan melakukan intervensi kepada Pertamina karena itu merupakan inisiatif Pertamina sendiri. Adanya praktik kongkalingkong itulah yang menyebabkan adanya efek bola salju dalam perekonoian mikro dimana terjadi inflasi sementara bulan Januari 2014 sebesar 6-7 persen dalam minggu pertama. Kenaikan inflasi karena gaselpijikemudiandipicupulaketidaktegasan pemerintah dalam menentukan harga maupun transparansi informasi Pertamina untuk memberikan info kepada masyarakat perihal pengadaan tersebut. Konklusi yang bisa ditawarkan dalam mengurai solusi kenaikan gas elpiji sporadis ini adalah dengan memutus hubungan rente yang selama ini terjadi dalam proyek pengadaan tabung gas maupun adanya linearitas subsidi penjualan gas untuk bisa dialirkan kepada produksi tabung gas elpiji Pertamina. Maka logika pencari rente dalam memanfaatkan celah subsidi sebaiknya direduksi dikarenakan hal tersebut bisa menciptakan tahun stres politik bagi publik sehingga bisa jadi memunculkanadanyablunderpolitikterlebih lagi di tahun politik karena adanya kebijakan sporadis ini.

P) dan mendirikan Kursus Komputer Komunikasi (K-3) di Gedung Kampus STIK-P. Penutup HAImemandangjurnalismesebagaisarana perjuangan kemerdekaan, media penyadaran hak-hak politik rakyat bumi putra serta saluran advokasi bagi keadilan dan kemajuan bangsanya. Karena itu, pilihan jurnalisme merekaberbedajauhdenganjurnalismekapitalis yang berkembang saat ini: orientasi pasar, pragmatis dan kehilangan misi memajukan kesadaran bangsa.Tokoh pers semacam Rosihan Anwar, Muhammad Said, BM Diah, atau tokoh jurnalis perempuan seperti HAI, SK Trimurti, Toety Azis, juga Rohana Kudus dan Rasuna said, bukanlah jurnalis yang membayangkanmediamerekamenjadikonglomerasi yang menguasai pasar dan bilamana perlu menghalalkan segala cara memperkukuh bisnis media mereka. Mereka adalah pejuang yang meyakini jurnalismebisamenjadialatampuhmendidik bangsanya tidak lagi bodoh dan dijajah, lebih jauh setara kemajuan bangsa lainnya di dunia. Mereka adalah sosok pejuang, bukan sosok pedagangyangmenjualapasaja,yangpenting laku dan mampu mengakumulasi dan ekspansi modal. Herawati Diah menyebut sosok jurnalis semacam ini sebagai wartawan Republikeinyangkurangsekalimemikirkanmateri, hanyayakinkepadakebenaranmem-perjuangkannegarakesatuan.Merekaadalahwartawan yanghidupdengancita-citaperjuanganmemajukan bangsanya (Diah, di dalam Hajjah Ani Idrus 80 tahun, Apa Kata Mereka: 1998). HAI memilih suatu ideologi, yakni nasionalismemarhaenisme sebagai panduan perjuangannya. Karena itu HAI dekat dengan Bung Karno dan bergabung dalam PNI. Di masa Orde Baru pun, HAI tetap memberikan dukungan kepada PDI Megawati, meski pun

sudah tidak terlibat lagi secara langsung di dalam panggung politik. Dengan pilihan ideologis tertentu, seorang jurnalis mengamati, menuliskan hasil pengamatannya dengan satu cita-cita politik tertentu, bukan sekedar menulis atau memberitakan semata. Karena itu, ada perspektif yang ditawarkan, ada “isi” dan“prinsip”tertentuyangdisampaikankepada masyarakat.Yang lebih menarik, HAI pun mampupulamemadukannilaiideologisnasionalismemarhaenisme ini dengan ke-Islaman yang kuat. Ini menegaskan kemampuannya mengawinkan berbagai dialektika prinsip nilai ke dalam keteguhan sikap, kemandirian serta kapasitas berpikir, bertindak. HAI terlihat komplitdalamperpaduansikapdanpemikiran yang dibuktikan dari karya-karyanya, baik tulisan, politik, keorganisasian maupun pribadi kesehariannya. Semakin paripurna, karena kapasitas diri ini juga dibarengi kemampuan manajerialnya luar biasa, tegas dan teguh pendirian, HAI menggunakan medianya sebagai sarana memperjuangkan keyakinan politiknya. Tokoh pers yang ideologis tentu saja, akan sangat kukuh mempertahankan prinsip pers perjuangan. Di tangan HAI harian Waspada dan DuniaWanita bisa saja larut mengedepankan keuntungan material semata dan melupakan misi utama pers perjuangan. Tapi itu bukan pilihan sikap yang diambil HAI. Beliau berpegang teguh dengan prinsip perjuangan yang sekaligus menjadi prinsip hidupnya. Karena itu, meski beberapa kali mengalami masa sulit, HAI tetap setia kepada cita-citanya. HAI sejak lama peduli dengan organisasi wartawan,jugapendidikanjurnalistiksebagaimana Akademi Pers Indonesia dan yang palingakhirSTIK-P.HAIpercayamelaluipendidikan formal jurnalistik modern, generasi baru dunia pers akan terus lahir meneruskan cita-

cita jurnalis-pejuang yang telah meletakkan dasar perjuangan pers Indonesia. Sikapnya yang tegas dan berani ditandai keberaniannya sebagaiKetuaPWIMedanmemboikotliputan Pekan Olahraga Nasional karena panitia memberikan hak monopoli kepada pihak tertentu. Di tangannya harian Waspada dikenal sangat kritis dan tidak mudah takluk kepada tekanan penguasa. Bahkan, karena ketidaksetujuannya terhadap praktek poligami, HAI sempat berjarak dengan tokoh panutannya, Bung Karno. Karya HAI semakin komplit dengan keterlibatannya di dunia pendidikan. Dari mulai pendidikan anak usia dini hingga perguruan tinggi, pendidikan formal dan non formal, pendidikan umum dan Islam, sekolah umum dan kejuruan, ditekuni beliau hingga akhir hayatnya. Untuk dunia pendidikan, HAI pantas diberikan penghargaan sebagai salah seorang tokoh pendidikan karena karya-karyanya di bidang ini. HAI menyadari bahwa lewat dunia pendidikanlah cita-cita kebangsaannya bisa dicapai, selain melalui dunia pers. Sama halnya dengan dunia pers yang ditekuninya,HAItidakmenjadikanpendidikan yang digelutinya jatuh ke dalam praktek bisnis pendidikan yang lebih mengutamakan keuntungan. Yang semakin membedakannya dari tokoh lain, adalah kesukaannya kepada dunia seni. Ia menyukai musik, drama. Selain itu, HAI bahkan menyukai olahraga, khususnya sepakbola. Tokoh pemuda/olahraga Amran YS sangat terkesan dengan kepeduliannya pada olahraga yang paling digemari rakyat Indonesia ini. Kepeduliannya bukan saja melalui dukungan pemberitaan yang selalu positif kepada sepakbola, khususnya kepada PSMS, tetapi bahkan untuk datang langsung menyaksikanpertandingandistadionTeladan.

Oleh Wasisto Raharjo Jati Ada margin 20 persen selisih keuntungan usaha dari luar negeri yang bisa diperoleh dari Pertamina untuk membeli gas dalam negeri sendiri, ditambah Rp36,7 triliun dari subsidi tahun 2014. Maka sejatinya tidak ada alasan bagi Pertamina menaikkan elpiji.


encana kenaikan harga elpiji yang hendakdilakukanolehPemerintah sungguh menyentak publik dalam minggu pertama awal tahun 2014 ini. Pemerintah melalui Pertamina hendak menaikkan harga gas elpiji non subsidi 12 kilogram per 1 Januari yang kemudian direalisasikan nyata pada 22 April nanti dari semula Rp 5.850 per kg atau Rp 70.200 per tabung menjadi Rp 117.708 per tabung. Artinya terjadi kenaikan sebesar Rp4000 atau 68 persen dari harga semula. Sementara di tingkat eceran, di pasar harga elpiji 12 kg bergerak liar seolah tanpa kendalihinggamencapaiRp130ribudiYogyakarta, Rp133.500 di Aceh dan Rp145 ribu di Jakarta, bahkan di Jayapura mencapai Rp310 ribu per tabung. Secara matematis, kenaikan harga elpiji sendiri tidaklah menguntungkan secara lebih bagi kas Pertamina. Hal itu dikarenakan postureksporgasPertaminasendirimencapai 60 persen ke luar negeri daripada menyuplai

Penulis adalah Peneltii Pusat Penelitian Politik (P2P), Lembaga Ilmu Pengetahuan Indonesia (LIPI).

Sambung dari hal C6 seluruh Sumut, menuntut pembubaran Negara Bagian ‘Negara Sumatera Timur’ (NST). Selanjutnya menjadi anggota Angkatan-45 tingkatPusatJakarta.IajugamendirikanWanita Marhaeinis dan menjadi C.P. (Komisaris Provinsi) Wanita Demokrat. Tahun1960-1967menjadianggotaDPRGR Tingkat-I Prov.Sumut dari GolonganWanita. Tahun 1961 menjabat sebagaiWakil Sekretaris Jendral Front Nasional Sumatera Utara yang dibentuk Pemerintah RI. Tahun 1967-1970 menjadi anggota DPRGR Tingkat-I Sumut untuk Golongan Karya (wartawan). Selanjutnya, 1984 diangkat sebagai Penasehat Ikatan KeluargaWartawanIndonesia.Selainmenggumuliduniajurnalistikdanpolitik,iajugaberkecimpung dalam dunia pendidikan. Tahun 1953 mendirikan Taman Indria di Jl.SM. Raja 84,MedankhususuntukBalaiPenitipanAnak, Taman Kanak-kanak dan Sekolah Dasar. Tahun itu juga sempat mendirikan Bank Pasar Wanita selama dua tahun berkantor di Pusat Pasar 125, Medan. Tahun 1960 mendirikanYayasan Pendidikan Democratic di Medan dengan tujuan mengembangkan dunia pendidikan dengan mendirikan:DemocraticEnglishSchooldiJl.SM. Raja195,Medan(kemudiandibubarkankarena adanya larangan sekolah berbahasa asing). Ia mendirikan SD Swasta Katlia, di Jl.SM. Raja84,MedanyangkemudianmenjadiSekolah Tinggi Ilmu Komunikasi “Pembangunan”. Tahun 1978 mendirikanYayasan Pendidikan Democratic dengan membuka TK, SD, SMP Perguruan Eria di Jl.SM.Raja 195. Selanjutnya, 1984 mendirikan Sekolah Pendidikan Agama Islam setingkat SD, yaitu Madrasah Ibtidaiyah RohaniahdiJl.SelamatUjungSimpangLimun, serta membangun masjid di sampingnya. Kemudian, 1987 mendirikan Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-

Ekonomi & Bisnis


WASPADA Senin 13 Januari 2014

Otoritas Jasa Keuangan Catatan Gus Irawan LEPAS sudah tugas Bank Menghadapi awal tahun Sempat muncul stateIndonesia menjadi pengawas ini OJK sendiri sudah ment dari DPR RI soal perbankan. Sebab Otoritas mengingatkan industri jasa Jasa Keuangan (OJK) akan keuangan untuk mewaspadai pengawasan 10 BPR menggantikan fungsinya ungejolak dan kondisi global oleh BI belum tuntas. tuk semua tugas yang ber2014 yang diperkirakan masih Bahkan masuk dalam hubungan dengan lembaga sangat menentukan ke depan. pengawasan. Namun keuangan. Memang dalam masa kemudian dibantah BI. Otoritas Jasa Keuangan peralihan seperti ini kondisi Dengan hadirnya OJK (OJK) telah diatur dalam Unperbankan tidak terpengaruh. dang-undang Nomor 21 taMalah kondisinya cukup posikita berharap kinerja hun 2011 yang disahkan pada tif. Dilihat dari pertumbuhan perbankan terus 27 Oktober 2011 oleh Dewan kredit perbankan yang sebemeningkat dan berada Perwakilan Rakyat (DPR). lumnya dikhawatirkan bisa di jalur yang benar. Baik Dalam aturan itu jelas tumbuh di atas 25 persen, itu bank umum nasional, sejak Januari 2014, OJK meakan tetapi sekarang hanya BPR bahkan bank ngatur semua sistem dalam tumbuh 20 persen. daerah sekalipun! perbankan. Undang-undang Gubernur BI mengakatan itu juga menegaskan tentang kondisi perbankan nasional ketentuan mengenai organisehat, dan itu terlihat dari sasi dan tata kelola dari lembaga yang menga- pertumbuhan kreditnya yang tadinya dikhawasi otoritas pengaturan dan pengawasan watirkan ada di atas 25 persen ternyata sekarang ada di 20 persen, rasio non performing loanterhadap sektor jasa keuangan. Pembentukan OJK ini diharapkan fungsi nya secara nett juga ada di bawah 1 persen, rasio pengaturan dan pengawasan menjadi lebih kecukupan modal itu ada dibilangan 18 persen efisien dan terkoordinasi apalagi aset keuangan lebih, dan rasio terkait dengan return on asyang diawasi begitu besar. Apalagi aset set itu di atas 3 persen jadi secara umum industri keuangan yang akan diawasi lembaga ini luar perbankannya baik dan sehat dan itu akan dialihkan sesuai dengan amanat UU. biasa besar. Bahkan jika dibandingkan dengan kondisi OJK akan mengawasi total pengelolaan aset mencapai Rp 10. 000 triliun. Untuk mengelola 2001 lalu rasio kecukupan modal (CAR) saat aset keuangan begitu besar itu tentu diperlukan ini cukup baik. Pada 2001 lalu CAR perbankan ada di kisaran 20 persen-21 persen. good corporate governance . Dari 20012 sampai tahun 2013 itukan berarti Jika fungsi pengawasan terhadap bank itu diambilalih OJK maka total aset yang dimandori 12 tahun selisihnya, itu terjadi ekspansi yang oleh OJK rinciannya: aset perbankan sekitar tinggi sebetulnya, tetapi modal bank masih bisa Rp4.500 triliun, kapitalisasi pasar modal Rp 4.300 dijaga dikisaran 18 persen saat ini, itu tandanya triliun; asuransi Rp 600 triliun, reksadana, dana ada akumulasi modal yang luar biasa dalam pensiun dan multifinance sekitar Rp 500 triliun, perbankan kita, dan ini salah satu bukti perdan lembaga keuangan mikro sekitar Rp 35 bankan kita sehat, likuiditas juga dijaga dengan triliun. Aset yang dikelola OJK jauh lebih besar baik. Saya juga yakin kondisi perbankan saat ini dari APBN 2014 yang mencapai Rp 1.886 triliun. Kalau tidak dikelola dengan hati-hati, bisnis cukup terjaga. Kalau pun ada persoalan hanya kepercayaan di negara ini akan kembali runtuh. di satu atau dua bank saja. Idealnya, memang Apalagi penyimpangan di institusi keuangan ketika kewenangan itu beralih, tidak ada masih sangat tinggi terutama di lembaga pekerjaan rumah lagi yang dilimpahkan kepada keuangan dan perbankan. Hingga 20 Desember ‘juragan’bbaru, misalnya dari sisi kesehatan 2013, saja ada sekitar 845 pengaduan. Pengadu- bank yang berjumlah 120 bank umum dan 1.640 an itu sekitar 60 persen berasal dari lembaga bank perkreditan rakayat (BPR) di negeri ini. Sempat muncul statement dari DPR RI soal keuangan non bank, sekitar 20 persen dari pasar modal dan lainnya, dan 20 persen dari per- pengawasan 10 BPR oleh BI belum tuntas. Bahkan masuk dalam pengawasan. Namun bankan. Pengaduan sebagian besar berasal dari kemudian dibantah BI. Dengan hadirnya OJK bidang asuransi. Saat ini persoalan asuransi kita berharap kinerja perbankan terus masih banyak dikeluhkan oleh konsumen. Ke- meningkat dan berada di jalur yang benar. Baik banyakan pengaduan itu mengenai klaim yang itu bank umum nasional, BPR bahkan bank tidak dibayarkan oleh perusahaan asuransi. daerah sekalipun!


HARGA GAS MASIH TINGGI : Pekerja memikul tabung gas elpiji ukuran 12 Kg di gudang pengecer di Kebonjahe, Serang, Banten, Minggu (12/1). Meski PT Pertamina telah menurunkan kembali harga gas elpiji 12 Kg menjadi Rp1000/Kg tapi di tingkat pengecer gas masih dijual Rp105.000/tabung atau naik lebih dari Rp2.000/ Kg dari harga berlaku pada 2013.

Pemerintah Setuju Akuisisi Pertagas Dan PGN JAKARTA (Waspada): Pemerintah menyetujui opsi PT Pertamina (Persero) mengakuisisi PT Perusahaan Gas Negara (PGN). Demikian menurut risalah rapat Menteri Badan Usaha Milik Negara (BUMN) Dahlan Iskan bersama Dewan Direksi dan Komisaris Pertamina. Menurut risalah rapat tanggal 7 Januari 2014 yang salinannya diperoleh wartawan di Jakarta, Minggu (12/1), Deputi

Kementerian BUMN Dwiyanti Tjahjaningsih, Direktur Utama Pertamina Karen Agustiawan, dan Komisaris Utama Pertami-

na Sugiharto, termasuk di antara pejabat yang hadir dalam rapat itu. Hadir pula Komisaris Pertamina, antara lain Bambang Brodjonegoro, Edy Hermantoro, dan Mahmuddin Yasin, serta sejumlah Direktur Pertamina seperti Hari Karyuliarto dan Hanung Budya. Dalam risalah rapat tersebut, Pertamina menyatakan, penyatuan Pertagas dengan

LPS Mampu Tingkatkan Kepercayaan Investor Baru

Waspada / Rusli Ismail

BELAH PINANG : Seorang wanita di Desa Paru Keude, Lueng Putu, Kecamatan Bandar Baru, membelah pinang. Harga pinang melonjak drastis di Aceh.

Petani Gembira, Harga Pinang Naik BANDA ACEH (Waspada): Petani pinang di Provinsi Aceh mulai menikmati naiknya harga pinang yang sebelumnya sempat anjlok hingga dikisaran Rp2.500 per kg. Saat ini harga pinang petani sudah mencapai Rp6.500 per kg. “Kenaikannya lumayan untuk menambah pendapatan keluarga. Bulan kemarin harganya Rp2.500 per kg (pinang belah basah) dan Rp3.500 per kg (pinang bulat kering), “kata Sebaruddin, petani pinang di Indrapuri, Aceh Besar. Hal yang sama diakui Mahmuddin, petani pinang di Padang Tiji, Kab. Pidie. Pinang dari Kecamatan Padang Tiji memang terkenal memiliki unggulan. Sebaruddin, mengatakan, hasil pinang dari

daerahnya terbanyak di Pidie. Naiknya harga dirasakan mereka sejak akhir tahun 2013 lalu, dan harganya terus menanjak hingga saat ini. “Kalau kondisi harga pinang membaik, perekonomian masyarakat juga bisa cerah, “ katanya. Sedangkan rekan Saubhan, Nasrol, mengatakan, kesejahteraan petani akan lebih meningkat jika harga pinang terus naik. Kenaikan harga pinang membawa dampak pada perubahan kondisi pasar pekan Selasa yang berada di Pasar Ibukota Kecamatan Padang Tiji, Pidie tersebut. Jika pinang harganya lumayan, petani ramai ke pasar dan berbelanja kebutuhan dan sebaliknya, jika pinang anjlok harganya, maka pasar akan sepi. (b09)

Bank Syariah Perlu Stimulus Saingi Konvensional MEDAN (Waspada): Perbankan syariah memerlukan stimulus agar bisa bersaing dan memiliki market share yang lebih besar dibandingkan perbankan konvensional. “Sejauh ini bank Syariah hanya menguasai 6 persen produk perbankan, sisanya masih dikuasai oleh bank konvensional. Nah di Malaysia Bank syariah mampu menguasai 45 persen dan konvensional menguasai 55 persen,” kata pengamat ekonomi Sumut Gunawan Benjamin, Minggu (12/1). Gunawan menyebutkan, ada perbedaan yang sangat mencolok dan tentunya perbankan syariah di Indonesia memiliki potensi pertumbuhan yang sangat menjanjikan. Dia juga mengatakan aturan mengenai leveraging oleh BI juga diharapkan segera diimplementasikan di bawah kewenangan Otoritas Jasa Keunagan (OJK). Dengan begitu bank konvensional yang tidak memiliki cabang syariah tetap bisa menjual produk perbankan syariah. Dia mengatakan memang aturan ini sudah digodok, dan harusnya sudah bisa diimplementasikan. “Aturan tersebut akan memperbolehkan seorang karyawan bank konvensional dapat melakukan penawaran sekaligus terhadap produk keuangan Syariah. Dengan harapan, ada

pertumbuhan yang signifikan pada produk keuangan syariah,” katanya. Berdasar data yang dirilis BI pada Oktober 2013, aset perbankan syariah di Sumut mencapai Rp9,75 triliun sedangkan aset perbankan konvensional mencapai Rp191,33 triliun. Total aset perbankan di Sumut tercatat Rp201,08 triliun. Sementara itu kredit perbankan konvensional tercatat Rp140,9 triliun, sedangkan kredit perbankan syariah hanya Rp7,43 triliun. Total kredit perbankan pada Oktober 2013 sebesar Rp146,56 triliun. Demikian pula dengan Dana Pihak Ketiga (DPK) yang total nilainya Rp148,62 triliun pada Oktober 2013. Dari total tersebut, DPK perbankan konvensional tercatat Rp141,48 triliun sedangkan DPK perbankan syariah Rp5,72 triliun. Deputi Ekonomi dan Moneter Kantor Perwakilan BI Wilayah IX Sumut dan Aceh Mikael Budisatrio mengatakan, masyarakat masih lebih memilih meminjam dana melalui kredit di perbankan konvensional. Dimana, kredit melalui perbankan syariah tumbuh 11,9 persen, sedangkan konvensional tumbuh 19,41 persen. “Diharapkan pertumbuhan syariah terus mengalami peningkatan sesuai dengan yang diharapkan melampui target nasional,” ujarnya. (m41)

MEDAN (Waspada): Bursa Efek Indonesia (BEI) Medan optimis kehadiran Lembaga Penjamin Simpanan (LPS) yang direncanakan akan melindungi investor nantinya mampu meningkatkan kepercayaan bagi investor baru. Kepala Kantor BEI Wilayah Medan Pintor Nasution mengatakan, LPS diharapkan juga mampu menggenjot jumlah investasi di daerah, salah satunya di Sumatera Utara (Sumut). Apalagi, lembaga penjaminan merupakan salah satu faktor untuk menarik para investor khususnya di pasar modal. “Sekarang sudah ada anak perusahaan di BEI seperti LPS di perbankan yang bisa menjamin nasabah-nasabahnya. Di pasar modal sudah ada perusahaannya. Untuk besaran yang dijamin masih dalam tahap

kajian.Yang pasti belum sebesar LPS di perbankan,” ujarnya, kemarin. Namun demikian, lanjutnya, investor yang dijamin juga harus sesuai dengan kriteria ditetapkan oleh pelaku pasar dan disetujui Otoritas Jasa Keuangan (OJK). Saat ini, jumlah investor yang ada di Sumut tercatat sebanyak 17.662 orang dengan jumlah 29 perusahaan sekuritas. Untuk tahun ini, pihaknya akan melakukan koordinasi dengan BEI pusat untuk menargetkan jumlah investor baru. Sebelumnya, anggota Dewan Komisioner OJK Nelson Tampubolon mengatakan, kebijakan perlindungan terhadap pasar modal masih dalam tahap pembahasan. Dia mengatakan prosesnya sudah sampai disetujui menteri dan masih me-

nunggu tanda tangan dari Presiden agar dikeluarkan PP-nya. “Setelah ditandatangani maka akan dibahas berapa besaran yang akan dijamin per investor. Tentunya beda-beda dan disesuaikan dengan besaran investasi,” ujarnya. Seperti yang diketahui bahwa PT Penyelenggara Program Perlindungan Efek Indonesia (P3IEI) mulai 1 Januari 2014 akan menjadi lembaga perlindungan investor pasar modal. Dia juga mengatakan, pembentukan perusahaan perlindungan ini berlandaskan asas hukum Undang-Undang No. 8 Tahun 1995 Tentang Pasar Modal. “Saat ini yang diberikan mandat oleh Otoritas Jasa Keuangan (OJK) untuk melakukan perlindungan investor adalah P3IEI,” katanya. (m41)

Telkomsel Berikan Mobil Jumlah Pelanggan 131,5 Juta MEDAN (Waspada): Telkomsel menyelenggarakan Acara Pengundian Program Belanja Untung periode terakhir selama enam bulan program berlangsung, sekaligus dilakukan pengundian grand prize berupa satu mobil Honda Brio. Pengundian dilakukan Jumat (10/1) di Plaza Millenium, diraih Suparmin, pelanggan Telkomsel dari Medan. Sedangkan penjual yang beruntung mendapatkan hadiah grand prize diprogram Belanja Untung adalah Joni Salim dari Toko Garuda Ponsel. Manager Telkomsel Branch Medan Ihsan, mengucapkan terima kasih atas kepercayaan masyarakat selama ini. Telkomsel selalu menghadirkan berbagai apresiasi berupa program undian lainnya yang dapat di ikuti seluruh pelanggan. Pelaksanaan Program Belanja Untung ini berlangsung selama enam bulan dari 1 Juli 2013 hingga 31 Desember 2013. Pada setiap bulannya dilakukan pengundian untuk 15 pelanggan yang beruntung dengan hadiah berupa uang tunai Rp1 Juta untuk 10 Pemenang dan Speed Up PAD 8 untuk 5 pelanggan. Selain itu bagi toko yang melakukan penjualan

mendapatkan hadiah yang sama. Jika pelanggan melakukan pembelanjaan di tokonya memperoleh hadiah dari Program Belanja Untung. Telkomsel mengimbau pelanggan agar tetap berhatihati terhadap penipuan mengatasnamakan Telkomsel. Jika pelanggan menerima informasi menjadi pemenang salahsatu program undian Telkomsel, sebaiknya melakukan konfirmasi ke nomor layanan Call Center bebas pulsa Telkomsel yaitu 133 dari kartuHALO dan 155 dari kartu simPATI dan Kartu As. Selain itu pelanggan juga dapat mendatangi kantor layanan GraPARI Telkomsel terdekat. 131,5 juta Sementara itu, menutup tahun 2013, Telkomsel meraih pelanggan secara nasional sebanyak 131,5 juta. Itu berarti naik dari tahun 2012 yang hanya 125 juta pelanggan. Direktur Utama Telkomsel Alex J. Sinaga, mengatakan rasa syukur dan dan berterimakasih atas tingginya kepercayaan masyarakat terhadap produk dan layanan diberikan selama ini. “Tentunya, pencapaian selama tahun 2013 ini merupakan hasil dari teamwork dan kerja keras bersama seluruh elemen

yang berada di perusahaan.” Hingga kuartal ketiga 2013, Telkomsel tumbuh secara kuat year-on-year (YoY), baik dalam hal finansial maupun operasional. Telkomsel mencatat pertumbuhan double digit untuk revenue, EBITDA dan net income. Revenue tumbuh 10,4 persen YoY, yang ditopang oleh pertumbuhan data broadband, sementara EBITDA dan Net Income tumbuh sebesar 11,1 persen dan 11,9 persen YoY. Pertumbuhan yang positif ini juga berdampak pada tumbuhnya customer base. Di sepanjang tahun 2013 Telkomsel telah melakukan beberapa langkah strategis terkait dengan jaringan seperti menginvestasikan tambahan 3G carrier (2100 MHz) dan menambah jumlah BTS di berbagai pelosok di seluruh Indonesia. Tahun ini Telkomsel membangun sebanyak 15,000 BTS, sehingga secara total memiliki 67,000 BTS, dimana sebanyak 24,000 adalah BTS 3G. Selain luasnya jaringan, kesiapan Telkomsel di dalam mengadopsi teknologi baru layaknya 4G LTE juga telah sukses didemonstrasikan di Bali pada penyelenggaraan KTT APEC 2013.(m19/m06)

PGN merupakan langkah terbaik. Skenario yang diinginkan Pertamina adalah memerjerkan anak perusahaan, PT Pertagas dengan PGN. Selanjutnya, hasil merjer menjadi anak perusahaan Pertamina. Komposisi saham perusahaan hasil merjer Pertagas-PGN adalah Pertamina sebesar 3038 persen sebagai hasil konversi 100 persen saham Pertamina di Pertagas. Lalu, pemerintah Indonesia selaku pemegang 57 persen saham mayoritas PGN, bakal memiliki saham sebesar 36-40 persen. Dan publik yang menguasai 43 persen saham minoritas PGN, akan memiliki 26-30 persen saham di perusahaan hasil merjer Pertagas-PGN tersebut. Jika hak kepemilikan saham pemerintah sebesar 36-40 persen dikuasakan ke Pertamina, maka Pertamina akan menjadi pemegang saham mayoritas sekaligus pengendali perusahaan hasil merjer dengan porsi 7074 persen. Pertamina menilai, penyatuan Pertagas-PGN akan memberikan tambahan keuntungan bagi negara sebesar 2-3 miliar dolar AS per tahun. Itu diperoleh

dari pengurangan biaya bahan bakar pembangkit, dampak terhadap GDP, pengurangan subsidi, serta peningkatan pajak dan dividen. Keuntungan merjer lainnya adalah memangkas biaya pengembangan asset up stream gas dan menciptakan lapangan bagi 4.000 tenaga kerja. Sugiharto, mengatakan Pertagas menguasai pasokan gas sehingga merjer tidak akan menimbulkan keberatan publik selaku pemegang saham minoritas PGN. Karena justru bakal menjamin keberlangsungan perusahaan. Yasin, memaparkan proses akuisisi diperkirakan memerlukan waktu selama delapan bulan, termasuk eksekusi 3,5 bulan. Pengamat energi dari ReforMiner Institute Komaidi Notonegoro, menilai merjer Pertagas-PGN menjadi anak perusahaan Pertamina bernilai strategis dan mendorong efisiensi bisnis gas. “Gabungan dua perusahaan gas ini akan makin meningkatkan penguasaan negara atas sumber daya alam, sehingga makin menjamin keberlanjutan pasokan energi nasional,” katanya. (ant)

Stanley Fischer Nominasi Wakil Ketua The Federal Reserve WASHINGTON ( Waspada): Presiden Barack Obama, menominasikan mantan Gubernur Bank Israel Stanley Fischer, menjadi Wakil Ketua The Federal Reserve. Selain itu, Obama, juga menyebutkan dua nama yang akan melengkapi jajaran baru di bank sentral Amerika Serikat (AS) tersebut. Mengutip Reuters, Sabtu (11/1), Fischer, yang berpengalaman sebagai manajer krisis dan salah satu ekonom terkemuka di dunia, akan membantu kesuksesan Janet Yellen, sebagai pengganti Ben Bernanke, pada akhir bulan ini. Selain itu, Obama, juga menominasikan Pejabat Departemen Keuangan AS untuk Urusan International Lael Brainard melayani di dewan Fed. Satu lagi nama yang disebutkannya yaitu Gubernur Fed Jerome Powell, yang akan dicalonkan kembali karena akhir bulan ini masa berlakunya akan berakhir. Namun, ketiga nama tersebut harus dibawa ke Senat. Sebab, kedua suara-suara baru di meja Fed tidak dimungkinkan melakukan scale back atas kebijakan bank sentral.Sementara Brainard, seorang veteran administrasi Demokrat, dipandang cenderung untuk secara khusus fokus membantu pertumbuhan pekerjaan agar lebih cepat. Terutama, Fischer sebagai posisi kedua di sana harus dapat mengutamakan hal itu.Namun, Fischer yang berusia 70 tahun juga dikenal karena kesediaan untuk melakukan apa yang dia pikir terbaik, terlepas dari aturan ekonomi atau ekspektasi pasar. Sebagai Mantan kepala bank sentral Israel, ia sering mengejutkan para investor dengan keputusan tingkat suku bunganya. “Seperti Janet Yellen dan banyak lainnya, kecemerlangannya tidak perlu dipertanyakan lagi untuk mengetahui kapan dan bila tidak memperhatikan masalah akademik atau model, “ kata Adam Posen, presiden dari Peterson Institute for International Economics. (okz)

Harga Telur Ayam Naik LHOKSEUMAWE (Waspada): Harga enceran telur ayam di Lhokseumawe mengalami kenaikan, dari harga Rp1.000 per butir menjadi Rp1.500 per butir. Sepekan sebelumnya, para pedagang enceran menetapkan harga Rp5.000 untuk empat butir telur. Namun, sekarang untuk jumlah butir yang sama harganya tidak boleh kurang dari Rp6.000. “Bila sebelumnya kami membeli Rp30.000 per papan (30 butir), sekarang harganya sudah Rp40.000,” kata Saiful,37, seorang pedagang kelontong di Muara Dua, Lhokseumawe, Minggu (12/ 1). Memang, kata dia, kenaikan harga telur ini membuat ibuibu mengeluh. Namun, dikarenakan harga jual telur dari Medan ke Aceh naik, maka dengan sendirinya juga harga jual menjadi mahal. Seperti halnya juga kenaikan harga barang lain, naiknya harga telur disebabkan barang yang tersedia mulai langka.(b14)


WASPADA Senin 13 Januari 2014



Nurdin: Mari Bersaing Secara Fair JAKARTA (Waspada): Politisi senior Partai Hati Nurani Rakyat (Hanura) yang juga anggota Komisi XI DPRRI DR Ir Nurdin Tampubolon (foto) menyatakan, dirinya sebagai calon anggota DPRRI di daerah pemilihan Sumut 1, siap berkompetisi secara fair pada Pemilihan Umum (Pemilu) legislatif 9 April 2014 mendatang, sehingga terbangun suasana yang harmoni. “Saya siap bersaing, dan tentu kompetisinya harus berlangsung fair tanpa melukai satu sama lain. Kita harus memberikan pendidikan politik yang baik untuk masyarakat Sumut,” ujar Nurdin Tampubolon, Minggu (12/1) di Jakarta. Ketua DPP Partai Hanura ini, juga mengharapkan partisipasi seluruh media yang ada di Sumut, untuk memberitakan visi dan misi para caleg DPR maupun DPRD yang berimbang, sehingga rakyat pemilih bisa menilai caleg yang akan dipercayainya sebagai wakilnya di parlemen. “ Peranan media cukup besar memberikan masukan kepada rakyat akan sepak terjang calon wakilnya. Mari kita sama-sama memberikan yang terbaik, tanpa harus saling menjelek-jelekkan,” ajak Ketua Umum PB TAKO Indonesia ini. Anggota Badan Anggaran (Banggar) DPRRI

ini juga menegaskan kekonsistenannya untuk menyuarakan aspirasi rakyat dan memperjuangkan anggaran untuk memicu pembangunan di Sumut. “Masih banyak dibutuhkan Sumut dan harus kita perjuangkan di pemerintahan pusat,” tandasnya. Menurut alumni Fakultas Tehnik Mesin Universitas Sumatera Utara (USU) ini, persaingan yang ketat dan keras di Dapil Sumut 1, sesama caleg dari partai politik lain, bahkan persaingan caleg di dalam satu parpol, tidak harus dilakukan dengan saling menyakiti atau menjatuhkan. “ Bersaing ketat dan keras memang tidak terelakkan, tapi tidak seharusnya saling melukai atau saling menghina, menjatuhkan,” tukasnya. Nurdin pun mengajak para caleg di Dapil Sumut 1 untuk memberikan suasana kondusif, dengan terus bergandengan tangan menjalin persatuan dan kesatuan. “Apa pun yang kita lakukan sebagai caleg, semua tergantung rakyat. Kalau rakyat tidak menginginkan kita, maka kita harus terima dengan lapang dada. Kita harus siap dipilih dan tidak terpilih,” tutup Nurdin. (aya)

Gerindra Tak Gentar Jika PDIP Capreskan Jokowi JAKARTA (Waspada): Ketua Umum DPP Partai Gerindra, Suhardi memastikan pencalonan Prabowo Subianto sebagai presiden sudah final. Dia tak khawatir meski nantinya perolehan suara legislatif Gerindra di bawah PDIP dan Golkar, atau partai lainnya. “Sudah final sebagai capres dan tak mungkin diposisikan sebagai cawapres meski partai yang mengajak berkoalisi perolehan suara legislatif lebih tinggi,” kata Suhardi di Yogyakarta, Sabtu (11/1). Mantan dosen Fakultas Kehutanan Universitas Gadjah Mada ini mengatakan bahwa Gerindra siap bersaing jika nantinya PDIP mengusung Joko Widodo sebagai capres. “Kami siap untuk bersaing dengan Jokowi jika nantinya dicalonkan capres dengan elektabilitas lebih tinggi dari Prabowo Subianto,” ujarnya. “Toh, itu hanya survei dan tidak menggambarkan semua keinginan masyarakat. Dulu siapa yang membayangkan Jokowi menang di DKI?”

Suhardi menambahkan. Suhardi menyatakan, Gerindra bersedia melakukan koalisi dengan partai lain agar dapat mengusung Prabowo Subianto. “Kalau 3-4 partai sudah mengusung capresnya kan masih ada partai lain yang belum. Mereka siap diajak berkoalisi untuk memperoleh 20 persen suara di parlemen sebagai syarat mengusung capres dan cawapres,” ucap dia. Sebenarnya, kata Suhardi, berkoalisi dengan PDIP adalah pilihan ideal karena pernah berkolaborasi dalam Pilpres 2009 lalu. Namun, lanjutnya, kali ini Gerindra akan berkoalisi jika capres yang diusung adalah Prabowo. “Prabowo capres harga mati bagi Gerindra. Di sisi lain, masih ada “perjanjian” antara Prabowo dan Ibu Mega saat maju bersama menjadi capres dan cawapres dulu,” ucapnya. (vvn)

Pipa Gas Arun-Belawan Selesai Kuartal IV 2014

Akan Hilangkan Penggunaan BBM Bersubsidi Oleh Perusahaan JAKARTA (Waspada): Politisi Fraksi Partai Golkar dapil Aceh, Marzuki Daud yakin penggunaan Bahan Bakar Minyak (BBM) bersubsidi oleh perusahaan-perusahaan di Sumut dan Aceh akan beralih menggunakan BBG (bahan bakar gas) bila pipanisasi gas ArunBelawan selesai. Program pembangunan pipa transmisi gas Arun di AcehBelawan (Sumut) sepanjang 339 Km itu memang diperuntukkan untuk kepen-tingan masyarakat dan kebutuhan perusahaanperusahaan di Aceh dan Sumatera Utara. “Jadi Pemerintah dalam hal ini harus memberi suasana kondusif kepada masyarakat dan dunia usaha di Sumut dan Aceh yang membutuhkan gas sekaligus kondusif tanpa kecurigaan pihak manapun terhadap dugaan BBM Bersubsidi oleh perusahaan,” ungkap Marzuki Daud di Jakarta, Sabtu (11/1). Pembangunan pipa transmisi gas Arun-Belawan direncanakan akan selesai pada kuartal IV 2014. Program itu, kata Marzuki Daud yang juga anggota Komisi VI DPR RI itu, akan mempercepat program

konversi BBM ke bahan bakar gas (BBG). Dia mengharapkan dengan penuntasan pembangunan itu diprediksi sepanjang pipa yang membentang dari Aceh hingga Sumatera Utara itu bisa dibangun Stasiun Bahan Bakar Gas (SPBG) untuk melayani konsumen. Kehadiran pipa tersebut selain terjadi konversi BBM ke BBG dan dampaknya akan segera bisa menyasar sektor perkebunan dan pertambangan, yang selama ini dicurigai banyak menggunakan BBM bersubsidi pasti beralih secara resmi menggunakan BBG. Di wilayah Aceh dan Sumatera Utara banyak berdiri perusahaan perkebunan. Mulai dari kelapa sawit, karet dan kopi. Di Aceh misalnya setidaknya ada tujuh perusahaan kelapa sawit. Sementara di Sumatera Utara ada 60 perusahaan. Jumlah itu belum termasuk perkebunan karet, kopi dan lain sebagainya. Mobil-mobil pengangkut hasil perkebunan ke depan akan bisa segera menggunakan BBG. “Bila kilang LNG Arun dan pipa gas dari Belawan-Arun bisa dituntaskan, akan bisa menghidupkan industri di Aceh dan

Sumatera Utara. Tak hanya seperti industri besar seperti Pupuk Iskandar Muda (PIM), tetapi juga industri kecil dan industri rumah tangga di dua provinsi tersebut,”ujarnya. Bagi politisi dari Partai Golkar ini melihat pembangunan Kilang LNG Arun dan Pipanisasi Belawan-Arun itu juga bisa ikut memecahkan berbagai permasalahan energi nasional. Apalagi kalau nanti di sepanjang pipa yang membentang dari Aceh ke Medan itu juga bisa dibangun SPBG, maka kehadiran infrastruktur gas ini juga bisa mempercepat program konversi BBM ke BBG, khususnya di sektor perkebunan yang banyak tumbuh di dua wilayah tersebut. “Itu betul bisa terjadi,” tegas Marzuki Hingga kini pipa Arun-Belawan terus dikerjakan. Sampai dengan akhir tahun 2013 sudah 50 persen pengerjaan pembangunan pipa tersebut. Pada kuartal IV 2014 seluruh pembangunan jaringan pipa yang menghubungkan Arun-Belawan ini bisa selesai. Untuk membangun pipa tersebut Pertagas telah mengalokasikan anggaran sebesar Rp 500 miliar.(J07)

Undhar Amplikasikan Standar Kualifikasi Keilmuan MEDAN (Waspada): Universitas Dharmawangsa (Undhar) melaksanakan rapat kerja dalam rangka mengaplikasikan keputusan Menteri No. 73 Tahun 2013 yaitu setiap perguruan tinggi harus memiliki standar kualifikasi keilmuan. Dalam rapat kerja tersebut Prof. Dr. Darma Bakti MS dari USU sebagai narasumber mengungkapkan Kerangka Kualifikasi Nasional Indonesia (KKNI) bertujuan dan mengharapkan akan mengubah cara melihat kompetensi seseorang tidak semata-mata dari ijazah, tapi melihat kepada kerangka kualifikasi yang disepakati secara nasional sebagai dasar pengakuan terhadap hasil pendidikan seseorang secara luas yang akuntable dan transparan. Darma Bakti merasa bangga dengan Undhar. “Semoga Dharmawangsa dapat mengimbangi kualitas pendidikan yang ada di Indonesia,” ujarnya, kemarin. Menurut Rektor Undhar Kusbianto, SH, M.Hum, rapat kerja ini dilaksanakan selama dua hari agar tercapai rumusan tentang standar kompetensi untuk membekali ijazah mahasiswa yang menyelesaikan


RAPAT kerja Universitas Dharmawangsa (Undhar) dalam rangka mengaplikasikan keputusan Menteri No. 73 Tahun 2013 di kampus itu. pendidikannya, akan dibekali sertifikat tentang standar kompetensinya sehingga alumni Dharmawangsa memiliki daya saing yang tinggi. Rektor Kusbianto mengucapkan terimakasih kepada Prof. Dr. Darma Bakti MS yang telah menyampaikan kiat-kiat untuk mengaplikasi standar kompetensi dan KKNI. “Kami keluarga besar Universitas Dharmawangsa akan selalu mendoakan agar Prof. Dr. Darma bakti akan menjadi Rektor USU sehingga kerjasama lebih ditingkatkan.”

Waspada/David Swayana

KONDISI Desa Kebayaken setelah terjadi hujan lumpur, Sabtu (11/1) subuh.

H. Muzakkir, SE salah seorang unsur Yayasan Dharmawangsa menyambut baik maksud rapat kerja tersebut dalam mengaplikasikan standar kompetensi. Yayasan akan berusaha semaksimal mungkin memfasilitasi seluruh kebutuhan untuk mencapai lebih maksimal. “Insya Allah Universitas Dharmawangsa 2014 akan membuka Program Pascasarjana antara lain, Program Magister Administrasi, Magister Manajemen dan Magister Hukum. (rel/m13)

IDI Kawal Pelaksanaan JKN

JAK ARTA ( Waspada): Ikatan Dokter Indonesia (IDI) siap mengawal pelaksanaan Jaminan Kesehatan Nasional (JKN) dari sisi kesejahteraan petugas kesehatan.

“Jangan sampai tugas melayani bertambah, tapi tidak ada insentif yang memadai. Jadi seharusnya, tenaga kesehatan bisa mendapat pendapat jasa medik yang memuaskan, masyarakatpun menjadi bahagia,”kata Ketua IDI, Zaenal Abidin di Jakarta, Minggu (12/1). JKN yang dimulai sejak 1 Januari 2014 rencana akan melayani 121juta masyarakat. Dari jumlah itu, 86 juta di antaranya adalah masyarakat miskin yang masuk golongan Penerima Bantuan Iuran (PBI) sebesar Rp 19.225. Sisanya adalah peserta Jamsostek, TNI dan PNS. Targetnya, pada 2019 seluruh rakyat Indonesia menjadi anggota JKN.

Karena itu, IDI bersama sejumlah organisasi lain di antaranya Ikatan Bidan Indonesia (IBI), Ikatan Ahli Kesehatan Masyarakat Indonesia (IAKMI) dan Persatuan Dokter Gigi Indonesia (PDGI) membentuk satuan tugas yang akan bekerja mengawasi dan mengevaluasi implementasi JKN dan pembayaran terhadap puskesmas, dokter-dokter keluarga serta Rumah Sakit Umum Daerah. “Kami bahkan tengah memperjuangkan kepada pemerintah untuk memberikan insentif khusus kepada dokter di era JKN ini. Besarannya sekitar Rp 2,5 juta,” ujar Zaenal. Evaluasi yang akan dilakukan IDI terhadap kinerja BPJS Kesehatan akan dilaporkan setiap tiga bulan atau enam bulan sekali. Tidak hanya soal insentif bagi dokter dan tenaga kesehatan lainnya, melainkan juga keluhan-keluhan masyarakat

DPR Dukung Putusan MK JAKARTA (Waspada): Ketua DPR RI Marzuki Alie mendukung putusan Mahkamah Konstitusi (MK) yang membatalkan kewenangan DPR untuk memilih calon Hakim Agung yang diusulkan Komisi Yudisial (KY). Karena itu, ke depan, DPR hanya berwenang menyetujui atau tidak menyetujui calon yang diusulkan KY. “Saya dukung, DPR dilepaskan dari pemilihan profesi yang bisa diintervensi politik,”ujar Marzuki Alie di Gedung DPR, Jakarta, Jumat (10/1). Menurut Marzuki, Komisi Hukum (Komisi III) DPR tak perlu mengurus seleksi lembaga negara di bidang hukum. Dia menegaskan, dirinya sejak lama telah menyatakan bahwa lembaga hukum jangan dipilih melalui institusi DPR karena akan tersandera dengan politik. Seperti diberitakan, MK dalam putusannya membatalkan kewenangan DPR untuk memilih calon Hakim Agung yang diusulkan KY. MK pun membatalkan ketentuan UU KomisiYudisial dan UU Mahkamah Agung yang mewajibkan KY mengajukan calon dengan jumlah tiga kali kebutuhan. MK menyatakan KY cukup mengirimkan satu nama untuk satu kursi hakim agung. (aya)

soal kinerja para tenaga kesehatan itu sendiri. “Kita tidak bisa hanya menerima hak, tapi kewajiban juga harus dilaksanakan dengan baik. Apa kelebihan dan kekurangan program JKN bagi tenaga kesehatan, institusi kesehatan

dan masyarakat akan kami ikuti terus,” tambah dia. Sementara itu Direktur Utama BPJS, Fahmi Idris menyatakan kesiapannya untuk dikritik, termasuk oleh satgas bentukan IDI. Sepanjang kritik itu konstruktif, pihaknya akan

melakukan perbaikan sesuai keinginan stakeholder. “Tujuan JKN adalah melayani seluruh lapisan masyarakat. Tentu saja hal itu dapat terlaksana apabila sarana dan prasarananya baik dan terperhatikan,” tandas Fahmi. (dianw)

Menag: Waspadai Terhadap Pengipas-ngipas Konflik AMBON (Waspada): Menteri Agama Suryadharma Ali menyatakan, kota Ambon sebagai kota kerukunan antar umat beragama yang perlu dicontoh daerah-daerah lain di Indonesia dan perlu dicontoh oleh negara di luar negeri. Pernyataan itu disampaikan Menag saat melepas Gerak Jalan Kerukunan yang diikuti 17ribu orang antar umat beragama di Ambon, Sabtu (11/1). Di kota Ambon yang pernah mengalami konflik itu, Suryadharma Ali menyatakan terkesan dengan telah terciptanya kerukunan oleh semua pihak lintas agama di kota Ambon. Karena itu dalam kesempatan Silaturrahmi bersama tokoh lintas agama di Islamic Center Ambon, Menag meminta masyarakat mewaspadai terhadap pengipas-pengipas konflik antar

umat beragama. Seluruh umat antar agama harus menjaga kerukunan dengan proses yang terus dilaksanakan oleh semua pihak. Pelaksanaan Gerak Jalan Kerukunan, menurut Suryadharma Ali, untuk mengakrabkan sesama umat beragama. Gerak jalan kerukunan bukan karena ada masalah kerukunan antar umat beragama, karena namanya kerukunan adalah proses yang terus berlanjut dan harus kita jaga, ujarnya. “Bagi saya Ambon adalah kota kerukunan, saya terkesan dengan kerukunan di Ambon. Ambon berhasil menyelenggarakan MTQ 2012 dengan sukses ditengah kekhawatiran dari Jakarta. Pelaksanaan MTQ betul-betul sukses dan betul betul aman. Ambon telah membuktikan kota kerukunan dan saya menilai Ambon membuk-

tikan kerukunan sangat monumental, karena terwujud dengan baik. Ambon boleh dicontoh oleh daerah lain dan contoh bagi dunia,” kata Menag. Betapa sensitifnya masalah agama, budaya, suku, ada istiadat dan bahasa, kata Menag, jangan dijadikan kelemahan, tetapi kita jadikan kekuatan untuk membangun Ambon. Tidak ada keamanan tanpa kerukunan, tidak ada persatuan tanpa kerukunan. “Dengan modal kerukunan kita wujudkan pembangunan Ambon dan Indonesia yang berkeadilan,”ujarnya. Tiga Kerukunan umat beragama yang menjadi motto masyarakat Ambon adalah, Kerukunan intern umat beragama, Kerukunan antar umat beragama dan ketiga Kerukunan umat beragama dengan pemerintah.(J07)

Lenovo YOGA 2 Lebih Kompak Dan Makin ‘Cerdas’ JAKARTA (Waspada): Pemimpin di bidang komputasi multimode, Lenovo terus menunjukkan keunggulan inovasinya di ajang International Consumer Electronics Show (CES) 2014. Dalam ajang tersebut, Lenovo mengumumkan penambahan anggota baru dalam jajaran produk multi-mode yakni Lenovo YOGA 2, laptop multi-mode yang lebih pintar dengan empat mode yang unik. Lenovo YOGA 2 meneruskan reputasi desain Lenovo YOGA sebelumnya, yang bisa diputar dan dilipat 360 derajat, tapi kini dilengkapi dengan spesifikasi yang lebih canggih dengan harga yang dapat dijangkau oleh konsumen yang lebih luas. LenovoYOGA 2 terus diperbarui dengan fitur-fitur yang mudah digunakan oleh konsumen, sehingga menjadi desain trendsetter dengan fungsi software baru yang cerdas dengan harga Rp 16,999,000. Lenovo YOGA 2 juga semakin cerdas dengan lebih banyak aplikasi YOGA Picks, layanan unik dari Lenovo yang menyerupai concierge, dengan adanya rekomendasi aplikasi khusus untuk masing-masing mode pada LenovoYOGA 2. Pengguna akan makin menyukai mode Laptop, Stand, Tent, dan Tablet, tapi dalam paket yang lebih kompak dan spesifikasi yang makin meningkat. Chief Marketing Officer Lenovo, David Roman, Sabtu (11/ 1/2014), mengungkapkan dengan Lenovo YOGA 2, orang-orang tak perlu lagi memilih laptop atau tablet. Produk-produk multimode Lenovo adalah yang terbaik di dunia, plus mode-mode baru yang mampu memberikan interaksi yang lebih baik dan lebih mudah serta untuk menyaksikan konten digital pribadi didalamnya. ‘’Sekarang keputusan yang harus mereka ambil hanyalah memilih produk multi-mode Lenovo mana yang mereka inginkan,’’ujarnya. Lenovo YOGA 2 ini memiliki model 13 inci dengan ketebalan hanya 0,68 inci dan bobot 1,5 kilogram dan fitur prosesor hingga Intel Core i7 generasi ke-4, backlit keyboard, serta layar Super High Resolution hingga 3200x1800 QHD+. Lenovo YOGA 2 juga menawarkan penyimpanan yang besar untuk menyimpan datadata penting dengan kapasitas SSHD hingga 256GB. Khusus untuk Lenovo YOGA 2, Lenovo menawarkan portofolio solusi layanan terintegrasi termasuk perpanjangan garansi. Nah, jangan tunda-tunda lagi untuk memiliki Lenovo YOGA 2. Produk sudah tersedia di pasaran. (rel/m44)


DANSATGAS Pamtas Yonif 126/KC Letkol.Inf.Agusman Heri S.IP, foto bersama dengan anakanak dalam kegiatan cara sikat gigi sehat dan benar buat anak-anak, pengobatan massal dan pembagian sembako bagi masyarakat yang berada di wilayah Distrik Kalomdol.

Pamtas RI-PNG Yonif 126/KC Bakti Sosial Di Gunung Bintang KISARAN (Waspada): Satgas Pamtas Ri-PNG Yonif 126/KC Pos Oksibi, Kab. Pegunungan Bintan, bakti sosial dengan penyuluhan pola hidup sehat dan pembagian Sembako, Rabu (8/1) lalu. Danpos Oksibil Kapten Inf Eko MP, mengatakan, bahwa kegiatan itu merupakan bentuk kepedulian SatgasYonif 126/KC Pos Oksibil dalam meningkatkan kesejahteraan dan pelayanan kesehatan kepada masyarakat yang benar-benar membutuhkan bantuan pelayanan kesehatan yang berada di wilayah Distrik Kalomdol terdiri dari lima kampung (Imik, Arinkop, Dabolding, Tulo dan Kalomdol) “Kegiatan ini sangat didukung oleh Pemkab. Pegunungan Bintang dengan memberi dukungan bantuan obat-obatan dan tenaga medis. Masyarakat distrik Kalomdol yang mendapatkan pelayanan kesehatan itu benar-benar merasa terbantu karena pihaknya langsung

mendatangi penderita yang sekaligus dirasakan mengurangi beban biaya kesehatan mereka,” jelas Eko. Bakti sosial ini menurunkan 15 personil dan dibantu petugas Dinas Kesehatan Kab. Pegunungan Bintang, dalam memberikan pelayanan medis kepada masyarakat setempat. Sementara itu, Bakes Satgas Yonif 126/ KC Pos Oksibil Serka M. H. Rao menjelaskan bahwa pada umumnya masyarakat di wilayah ini menderita sakit malaria, gangguan pernafasan (ISPA) dan penyakit kulit. “Kegiatan ini kita mengajari anak cara gosok gigi yang benar, dan pola hidup sehat, sehingga tidak gampang sakit,” jelas Rao. Dansatgas Pamtas Yonif 126/KC Letkol.Inf.Agusman Heri S.IP, hadir dalam kegiatan tersebut bersama Asisten I Bupati Kab. Pegunungan Bintang Budi Wardaya S.Sos, Kepala Distrik Agus Hermawan SP,S.IP,M.Si menyampaikan

bahwa, pelayanan kesehatan kepada masyarakat ini dilakukan atas kerjasama dengan Kepala Distrik dan Dinas Kesehatan Kab.Pegunungan Bintang. “Selain memberikan obat kepada penderita, Satgas 126/ KC mengajak warga masyarakat agar membiasakan diri dengan pola hidup sehat. Seperti menjaga kesehatan badan, kebersihan makanan, mencuci tangan sebelum makan, membersihkan rumah dan membangun rumah dengan jendela yang mencukupi agar selalu ada pergantian udaradidalamrumah,”jelasHeri. Pada kesempatan itu juga sekaligus memberikan sikat gigi dan odol gratis kepada anakanak dan langsung mempraktekkan cara sikat gigi yang benar dan sehat sehingga menimbulkan kesadaran hidup sehat sejak dini bagi anak-anak, kegiatan Bakti Sosial ini di akhiri dengan pemberian bantuan sembako gratis kepada masyarakat yang telah berobat. (a15)



Gubernur Ke Rumah Duka Orangtua Wakapolda Aceh BANDA ACEH (Waspada): Gubernur Aceh Zaini Abdullah bersama istri Niazah A Hamid mengunjungi rumah duka almarhum Abdul Hamid bin Maddan, 82, orangtua Brigjen Pol Husein Hamidi, Wakapolda Aceh di Gampong Paya Pisang Klat, Kecamatan Bandar Dua Pidie Jaya, Sabtu (11/1) Orangtua Wakapolda ini meninggal pada Jumat (10/1) di Paya Pisang Klat dan dikebumikan di hari yang sama di gampong setempat. “Bersama gubernur juga hadir Wali Nanggroe Malik Mahmud Al-Haytar, Sekda Dermawan, Asisten III Muzakkar A Gani, Karo Isra Ilyas Nyak Tui dan sejumlah Kepala SKPA lainnya,” kata Nurdin F Joes, Kepala Biro Humas Pemprov Aceh ini mengatakan atas nama keluarga Wakapolda Husein Hamidi menyampaikan kehadiran Gubernur Zaini bersama istri dan Wali Nanggroe Malik Mahmud terasa sangat besar memberikan perhatian dengan berkunjung ke rumah duka. “Gubernur sengaja datang dari jauh, Banda Aceh ke gampong Paya Pisang Klat,” kata Husein. Husein juga menyampaikan kisah kecil di gampong itu yang berjarak sekitar 6 km ke selatan kota Ulee Gle. Ayah dan ibunya adalah asli Paya Pisang Klat, dan Husein terlahir di desa itu. Istri Husein berasal dari Kecamatan Trienggadeng, Pidie Jaya. Husein baru keluar dari Gampong Paya Pisang Klat setelah tamat SD, 1974. Lalu melanjutkan SMP di Samalanga Bireuen. Sementara SMA diselesaikan di Banda Aceh, seterusnya meniti karier di kepolisian dan masuk melalui jalur AKABRI. (b06)

300 Pengawas Pemilu Dilantik TAKENGEN (Waspada): Sebanyak 300 Pengawas Pemilu Lapangan (PPL) se Kabupaten Aceh Tengah dilantik, Sabtu (11/ 1) di Hotel Penemas Takengen. Pelantikan PPL, merupakan hasil seleksi yang dilakukan panitia pengawas pemilu kecamatan (panwascam) di 14 kecamatan di Aceh Tengah. Jumlah PPL dinilai belum sebanding dengan jumlah TPS di Aceh Tengah, berjumlah 466 TPS. Maryeni, Ketua Panwaslu Aceh Tengah mengatakan, PPL akan menjadi ujung tombak pengawasan pemilu di tingkat kampung (desa), dalam pesta demokrasi, pemilihan umum legislatif mendatang. Bekerja menjadi pengawas pemilu adalah sebagai bentuk kontribusi terhadap negara. Tanpa pengawasan, pemilu tidak akan terlaksana dengan baik. “Tanpa adanya pengawasan akan berimplikasi terhadap masa depan bangsa, karena tidak maksimal hasil dari pemilu,” jelas Maryeni. “Bekerja sebagai pengawas pemilu sama dengan bekerja untuk demokrasi dan bekerja untuk demokrasi sama dengan bekerja untuk masa depan bangsa dan negara yang kita cintai,” imbuhnya. Maryeni juga mengharapkan PPL harus mengedepankan independensi, karena sebagai ujung tombak pengawasan pemilu, pengawas akan memberikan kontribusi yang baik terhadap hasil pemilu. PPL juga harus berkoordinasi dengan panwaslu. “Tidak diskriminasi terhadap peserta pemilu, dan berpedoman pada peraturan perundang-undangan,” papar Maryeni. (b33)

Pemuda Aceh Perlu Diberi Kesempatan BANDA ACEH (Waspada): Pemuda sebagai penerus bangsa perlu terus dibina, dimotivasi dan diberi kesempatan untuk berkarya dan berkreatifitas dalam rangka pembangunan bangsa. “Kemajuan bangsa sangat ditentukan oleh pemuda, saatnya pemuda diberi kesempatan untuk terus berkarya dan mengabdi untuk bangsa ini,” jelas Ketua Gerakan Pemuda Al-Washliyah (GPA) Aceh, Irhamna Yusra, di Banda Aceh, Sabtu (11/1). Irhamna juga menyebutkan bahwa persoalan narkoba relatif dilakoni oleh pemuda, tindak kriminal dan risiko pengangguran, menjadi ancaman bagi pemuda. “Sekarang ini pemuda Aceh siaga narkoba, terutama pelajar tingkat sekolah menengah. Tidak hanya itu, tindak kriminal juga rentan terjadi oleh pemuda. Apabila tidak dilakukan advokasi, maka berpeluang pemuda Aceh akan kehilangan identitas,” katanya. Atas pertimbangan itulah, Pemuda AlWashliyah Aceh mencoba mengambil peran dalam membina dan memotivasi pemuda agar selalu meningkatkan kapasitas intelektual, bersungguhsungguh dalam bekerja dan selalu menjalankan perintah agama Islam. “Ini kesempatan bagi kami untuk ambil bagian dalam membina pemuda, terutama bagi kader dan pemuda Al Washliyah se-Aceh. Karena itu, kami pengurus GPA Aceh, mengundang pengurus GPA kabupaten/kota untuk konsolidasi dan menyusun program kerja untuk 5 tahun mendatang,” kata Irhamna. Ketua pelaksana kegiatan, Adnin A Salam, menyebutkan, Gerakan Pemuda Al Washliyah (GPA) Aceh menggelar kegiatan koordinasi dan konsolidasi pengurus GPA se- Aceh. Kegiatan ini dilaksanakan 11-12 Januari 2014 dipusatkan di Asrama Haji Banda Aceh. (b04)

YVCIKJ Bireuen Jadi Pelopor BIREUEN (Waspada): Para pengurus serta anggota Yamaha Vixion Club Indonesia Kota Juang (YVCIKJ), Bireuen, menjadi pelopor tertib berlalu lintas sehingga menjadi contoh bagi masyarakat. “Kami dari pihak Satlantas Polres Bireuen sangat mendukung hal yang dilakukan pengurus serta anggota YVCIKJ, walaupun mereka memiliki kendaraan roda dua besar serta umumnya masih muda-muda, namun mereka tetap tertib dalam berbagai hal berlalu lintas sehingga menjadi pelopor,” kata Kapolres Bireuen AKBP M Ali Kadafi melalui Kasatlantas AKP Thomas Nurwanto melalui Kanit Adhyaksa, Aipda Zulkifli, Kamis (9/1) Didampingi Ketua YVCIKJ, Atna Ricky dan wakilnya, Fauzan Azima, Zulkifli mengatakan, tertib berlalu lintas terus disosialisasikan kepada masyarakat di Bireuen, supaya yang selama ini telah nampak banyak perubahan tentang ketertiban berlalu lintas dapat ditingkatkan sehingga nanti pelanggaran berlalu lintas terus dapat ditekan. “Semoga masyarakat semakin meningkatkan kesadarannya dalam berlalu lintas,” harapnya. (cb02)

Senin 13 Januari 2014

Pemerintah Butuh Mitra Kampanye Hidup Sehat

Muchtar Husen Pimpin Al-Washliyah Banda Aceh BANDA ACEH (Waspada): Musyawarah Daerah (Musda)III AlWashliyah Banda Aceh menetapkan Muchtar Husen sebagai Ketua PD Al-washliyah Banda Aceh periode 2014-2019, sekaligus sebagai ketua tim formatur. Muchtar terpilih secara aklamasi sebagai Ketua PD Al-Washliyah Banda Aceh, setelah diusulkan 9 Pimpinan Cabang dan 4 organ bagian Al Washliyah tingkat Banda Aceh secara langsung dalam forum musda. “Karena hanya ada satu nama yang diusulkan peserta, maka pimpinan sidang menetapkan Muchtar Husen sebagai ketua defenitif Al-Washliyah Kota Banda Aceh periode 2014-2019,” papar Pimpinan Sidang Amsal Amri, di aula Dinas Syariat Islam Aceh, Sabtu (11/1) . Ketua PW Al Washliyah Aceh, Farid Wajdi Ibrahim dalam sambutannya meminta kepada semua peserta agar dapat memilih figur ketua yang tepat dengan tingkat kepedulian yang memadai. “Mengingat Al Washliyah Banda Aceh sebagai barometer karena berada di ibukota provinsi. Maka banyak kader Al Washliyah yang layak dan cakap untuk memimpin Al Washliyah Banda Aceh,” jelas Farid. Farid menambahkan, Al-Washliyah butuh figur ketua yang mampu dan mau menjaga dan membina ukhuwah dengan semua pihak. Secara khusus, Al Washliyah Banda Aceh perlu tenaga ekstra untuk menjaga dan mengembangkan lembaga pendidikan mulai dari TK sampai perguruan tinggi. Ketua panitia acara, Zulfa Fuadi, menyebutkan, musda juga menetapkan anggota tim formatur masing-masingYusra Jamali, Dimyati Thayyib, Zulfa Fuadi dan Julia Nurrahman. Tim formatur diberi kewenangan untuk menyusun pengurus lengkap PD Al Washliyah Kota Banda Aceh 2014-2019 dalam waktu 7 hari masa kerja. (b04)


Waspada/Zainuddin Abdullah

KASUS pelanggaran alat peraga kampanye oleh calon legislatif semakin meningkat dan merajalela di Kota Lhokseumawe, Minggu (12/1).

Pelanggaran Alat Peraga Merajalela Di Lhokseumawe LHOKSEUMAWE (Waspada) : Menjelang pelaksanaan pemilihan umum 2014 mendatang, Minggu (12/1), ternyata kasus pelanggaran alat peraga di tempat umum semakin meningkat dan merajalela dilakukan oleh setiap calon legislatif dari semua partai politik di Kota Lhokseumawe. Hal itu diungkapkan Ketua Panwaslu Kota Lhokseumawe Zainal Bakrie ketika dikonfirmasi kemarin di ruang kerjanya di Kecamatan Banda Sakti. Zainal mengaku hampir setiap calon legislatif dari semua partai politik bersaing dengan cara tidak sehat mengingat mereka yang hendak menjadi wakil rakyat justru saling berlomba – lomba melakukan pelanggaran alat peraga. “Saya tidak habis pikir dengan tingkah laku calon legislatif masa sekarang. Meski mereka

orang yang pintar, namun masih saja melakukan pelanggaran alat peraga di berbagai tempat umum,” tegasnya. Dampak buruk dari meningkatnya kasus pelanggaran alat peraga bukan hanya telah mengganggu kenyamanan masyarakat, tapi juga merusak fasilitas milik negara atau sarana umum. Alat peraga milik calon legislatif dari semua partai politik ditebar dengan acara menempel atau mengikat poster dan bendera bergambar di seluruh tempat umum, seperti trafo, tiang, kabel listrik milik PLN. Termasuk menjamah tempat ibadah, rumah sekolah dan rumah sakit. Padahal seluruh calon wakil rakyat itu sudah pernah membuat kesepakatan bersama dengan ikrar janji akan mematuhi aturan untuk tidak memasangkan alat peraga pada tempat umum yang bisa menimbulkan gangguan atau risiko bagi masyarakat. Kenyataan di lapangan,

malah hampir semua dari mereka yang melakukan pelanggaran alat peraga dan mengingkari komitmen yang sudah disepakati bersama. Akan tetapi, meski pun kasus pelanggaran alat peraga sudah sangat memprihatinkan, namun pihak Panwaslu Kota Lhokseumawe juga tidak bisa berbuat banyak. Lantaran belum ada peraturan yang membolehkan Panwaslu untuk bisa mengambil tindakan atau memberi sanksi pada pelangar alat peraga. Peraturan Komisi Pemilihan Umum Nomor 15 Tahun 2013 tentang Perubahan Pertama Atas Peraturan KPU Nomor 1 Tahun 2013 tentang Pedoman Pelaksanaan Kampanye sudah disahkan Kementerian Hukum dan HAM. Alat peraga kampanye pemilu DPR, DPD dan DPRD hanya dibolehkan untuk memasang satu baliho di masingmasing gampong ataupun kelurahan. (b16)

Pengurus IWAPI Harus Taat Hukum BANDA ACEH (Waspada): Pengurus Ikatan PengusahaWanita Indonesia (IWAPI) di Aceh harus berfikir untuk kemajuan dan terus berkembang agar Aceh lebih maju. “Pengurus IWAPI di Aceh juga harus taat hukum dan aturan,” kata Wakil SekretarisIWAPIAceh,RosieMalia saat dimintai pendapatnya soal kisruh IWAPI se-Indonesia, Sabtu (11/1) di Banda Aceh Harapan Rosie Malia tersebut diungkapkannya setelah melihat situasi kepengurusan IWAPI di Kabupaten Aceh Utara, di mana terjadi dualisme kepe-

mimpinan yakni kubu ketua pusat Elsa Syarif, dan kepengurusan kubu ketua pusat NitaYudi. “Kader IWAPI Aceh harusnya taat hukum, di mana saat ini sudah keluar putusan Mahkamah Agung (MA) Nomor 1556K/ PDT/2013 tanggal 9 Desember 2013 yang menyebutkan IWAPI pimpinan NitaYudi merupakan organisasi yang sah. Karena itulah kader dan pengurus IWAPi di Aceh harus bijak melihat kondisi, apalagi telah keluar putusan MA terkait lembaga tempat para pengusaha wanita bernaung.“Saya memin-

ta supaya kader di Aceh berkembang, jangan karena persoalan di pusat kita di Aceh menjadi terpecah, bagaimana IWAPI Aceh berperan dalam pembangunan,” ungkap Rosie Malia. Rosie yang dikenal sebagai pengusaha energi di Aceh meminta kader dan pengurus IWAPI Aceh Utara untuk kembali duduk bersama dan membahas kembali tujuan dasar pembentukan IWAPI, dan menaati hukum di mana telah keluar keputusan Mahkamah Agung terkait keabsahan lembaga IWAPI. (b08)

Pembagian Boat Diduga Ada Permainan LABUHAN HAJI RAYA (Waspada) : Pemberian bantuan kapal motor (boat) sarana penangkapan ikan dari Pemprov Aceh, dinilai tidak transparan, sejumlah kelompok nelayan di Kecamatan Labuhan Haji Barat, Kabupaten Aceh Selatan yang mengajukan proposal tidak mendapat bantuan, malah kelompok nelayan lain yang disinyalir tidak mengajukan proposal menerima realisasi bantuan tersebut. Hal tersebut diutarakan bendahara kelompok nelayan Jasa Laot, Kecamatan Labuhan Haji Barat, Jumari Abbas (Muad) kepada sejumlah wartawan, Sabtu (11/1). Disebutkan, pihaknya menyayangkan tidak transparannya pemerintah dalam memberikan bantuan kepada

masyarakat. Menurutnya, bantuan tersebut tidak tepat sasaran, sebab selain alokasinya salah, pihaknya juga menilai pemberian bantuan tersebut ada permainan oknum-oknum tertentu. “Jika pemerintah berlaku adil, maka pemerintah harus memberikan bantuan tersebut kepada pihak yang benar-benar membutuhkan yang selama ini telah berusaha keras dalam pengurusannya,” kata Muad. Terkait masalah itu, lanjut Muad, pihaknya untuk sementara akan menahan dua unit boat kapasitas 40 GT dengan anggaran Rp4 miliar lebih tersebut, sembari menunggu penjelasan dari pihak terkait. “Boat yang sudah siap digunakan itu untuk sementara kami tahan,

bila memang boat itu bukan untuk kami, maka kami dengan berharap kepada pemerintah untuk memberikan satu unit boat tersebut kepada kelompok nelayan kami selaku pengaju permohonan,” tegas Muad. Seoarang anggota tim pemenangan Zaini Abdullah-Muzakir Manaf (ZIKIR) pada Pemilukada lalu, Hermansyah mengakatan, pihaknya berharap kepada pemerintah untuk lebih transparan, mengingat ZIKIR merupakan harapan masyarakat Aceh. Lebih lanjut disebutkan, situasi dan kondisi di lapangan saat ini sedikit menegangkan, sebab sejumlah anggota kelompok nelayan merasa tidak percaya dengan kebijakan pemerintah. (cza)

BANDA ACEH (Waspada): Pemprov Aceh membutuhkan mitra dengan berbagai pihak untuk menyosialisasikan gerakan hidup sehat. Gerakan hidup sehat itu perlu digalakkan mengingat prevalensi penyakit jantung cukup tinggi di Aceh. “Pemprov Aceh sudah melakukan berbagai cara untuk sosialisasi gerakan sehat di kalangan masyarakat. Tapi sosialisasi itu tidak berarti apaapa jika tidak mendapat dukungan dari berbagai elemen masyarakat,” kata Gubernur Aceh Zaini Abdullah dalam sambutan yang dibacakan Asisten II HT Said Mustafa, saat membuka Simposium danWorkshop Electrocardiography bertama “Langkah Cerdas Hidup Sehat Tanpa Penyakit Jantung” di aula Balai Kota Banda Aceh, Sabtu dan Minggu (11-12/1). Kata dia, berdasarkan data hasil survei Klub Jantung Sehat di Aceh hasilnya 37 dari 1.000 orang Aceh ternyata menderita penyakit jantung. “Di sinilah perlu peran aktif Yayasan Jantung Indonesia,” kata gubernur. Menurut gubernur, tingginya angka penderita jantung di Aceh disebabkan beberapa hal. Di antaranya, masyarakatnya malas berolahraga, budaya makan makanan berkolestrol tinggi serta kurang makan buah-buahan.

Oleh sebab itu, Pemprov Aceh meminta YJI untuk memperbanyak klub jantung sehat guna menyosialisasikan gerakan ini. SMF Kardiologi dan Kedokteran Vaskular Rumah Sakit Umum Zainal Abidin (RSUZA) Banda Aceh Adi Purnawarman menuturkan, penyakit jantung, disebabkan karena pola hidup masyarakat yang tidak sehat, seperti merokok. Dia menyebutkan, 90 persen lebih pasien penderita sakit jantung disebabkan oleh kebiasaan merokok. “Di Aceh saya pernah menemukan seorang pasien yang baru 32 tahun, tapi terkena serangan jantung. Jadi sakit jantung tidak berdasarkan usia,” kata dia. Disebutkankan, hal itu terjadi karena faktor risikonya rokok, bahkan perokok pasif juga lebih rentan terkena penyakit jantung karena ikut menghirup asap rokok. Berdasarkan data yang disebutkan dr Adi, ada tiga kabupaten di Aceh saat ini tercatat sebagai daerah yang masyarakatnya paling banyak terserang penyakit jantung. Bahkan, tiga daerah ini masuk dalam lima besar tertinggi kasus jantung dalam skala nasional. “Ketiga kabupaten itu Aceh Selatan, Aceh Tengah, dan Bener Meriah,” kata dosen Fakultas Kedokteran Universitas Syiah Kuala ini. (b07)

Pemkab Aceh Tengah Usul Revisi Tata Ruang TAKENGEN (Waspada): Upaya merevisi Rencana Tata RuangWilayah (RTRW) Kabupaten Aceh Tengah, merupakan sesuatu yang mendesak, bahkan menjadi prioritas guna mendukung perencanaan pembangunan jangka panjang di daerah tersebut. Salah satu bagian yang harus direvisi adalah penataan Pola Ruang Kawasan Hutan. Selama ini kawasan hutan Aceh Tengah mengacu pada surat Keputusan Menteri Kehutanan Nomor : 170/Kpts-II/2000 yang membagi Kawasan Hutan (Taman Buru, Hutan Lindung, Hutan Produksi, Hutan Produksi Terbatas) seluas 78.59 persen, sedangkan untuk Areal Penggunaan Lain (APL) seluas 21.41 persen. Sehingga, dari luas seluruh wilayah Kabupaten Aceh Tengah 445.404,12 hektare, area yang dapat difungsikan untuk dapat digarap masyarakat hanya seluas 95.346,74 hektare. Pemerintah Kabupaten Aceh Tengah mengusulkan Revisi Kawasan hutan dalam RTRW untuk Area Penggunaan Lain (APL) ke Kementerian Kehutanan RI, yang semula 95.346,74 ha atau 21,41 persen menjadi 156.082,53 ha atau 35,04 persen. Terbatasnya APL, diakui Bupati Aceh Tengah Nasaruddin, akan berdampak bagi pengembangan wilayah itu di masa mendatang, terutama kebutuhan lahan yang tidak sebanding dengan pertambahan penduduk. Terlebih lagi, menurut Nasaruddin, sebenarnya penetapan kawasan hutan sesuai Keputusan

Menteri Kehutanan, tidak didasari data dan fakta empirik di daerah. Penetapan kawasan taman Buru Linge misalnya, sebagai kawasan hutan konservasi yang sama sekali tidak bisa dijamah, padahal kenyataannya di kawasan tersebut telah berdomisili masyarakat berikut lahan perkebunan jauh sebelum keputusan menteri dikeluarkan. “Bahkan, sebelum Indonesia merdeka sudah ada warga yang bermukim dan berkebun di sana,” imbuh Nasaruddin ketika diminta tanggapannya soal revisi yang diajukan Pemkab Aceh Tengah, Sabtu (11/1). Nasaruddin mengatakan, inilah yang mendasari perlunya revisi RTRW sebagai legalitas penggunaan lahan yang memang selama ini sudah ditempati masyarakat. Bupati Nasaruddin juga menambahkan untuk meyakinkan permintaan revisi RTRW, Pemkab setempat telah menyusun data pendukung berupa analisis, peta, pernyataan tokoh masyarakat, surat pernyataan masyarakat yang sudah bertempat tinggal di lokasi yang ditetapkan sebagai kawasan hutan serta kondisi tanaman tua di kebun masyarakat maupun bukti otentik lainnya. “Apabila ini tidak diselesaikan berakibat terjadi kendala pembangunan, administrasi kepemilikan dan keresahan masyarakat yang bertempat tinggal di peta kawasan hutan,” kata Nasaruddin. (b33)

Oknum Wartawan Coba Peras Pejabat MANGGENG RAYA (Waspada) : Mengaku sebagai wartawan dari media ternama di Sumatera dan mengatasnamakan LSM Team Operasional Penyelamat Aset (Topan), AD, dilaporkan mencoba melakukan pemerasan terhadap sejumlah kadis di Kabupaten Aceh Barat Daya. AD mencoba meminta dana dengan dalih untuk membuka kantor cabang LSM Topan di wilayah Abdya dan sebagai bentuk partisipasi dari Kadis yang menjadi target pemerasan. Informasi dihimpun, Sabtu (11/1), diketahui sejumlah kadisa di Abdya yang nyaris menjadi korban pemerasan, di antaranya Kadis Kelautan dan Perikanan Abdya Sulaiman, Kadis Kebudayaan Pariwisata Pemuda dan Olahraga Ahsin dan Kadis Pertanian dan Perikanan Adusmin serta Kadis Perhubungan Eddy Sumarjan. Berlagak sudah kenal dan akrab, AD menjumpai sejumlah kadis dan memberitahu sedang mengadakan penghimpunan dana. Uang yang terkumpul rencananya akan dibantukan untuk biaya menyewa gedung yang akan dijadikan sebagai kantor sekretariat LSM Topan di wilayah itu. Kadis Budparpora Abdya, yang nyaris menjadi korban pemerasan mengakui adanya tindakan oknum wartawan luar daerah tersebut. Disebutkan, AD sempat berulang kali menghubungi Ahsin untuk memastikan dana tersebut untuk segera dapat disalurkan. Namun, Kadis Budparpora Abdya tidak menyanggupi permintaan AD, sebab keuangan yang tidak memungkinkan. “Saya sempat didatangi dan dihubungi

beberapa kali, ia datang dengan tujuan untuk meminta bantuan dana, namun hal itu tidak mungkin dikabulkan mengingat keuangan kantor tidak menentu. Saya juga merasa curiga, sebab oknum tersebut tidak pernah terlihat sebe-lumnya di Abdya,” katanya. Tidak sampai di situ, AD kembali menghubungi Kadis Budparpora dengan maksud meminta uang untuk biaya ongkos menuju Kota Banda Aceh. Namun lagi-lagi Kadis Budparpora tidak menyanggupi permintaan itu. Ketua Balai Persatuan Wartawan Indonesia (PWI) Abdya Zainun Yusuf terkait hal tersebut mengecam keras tindakan oknum yang mengatasnamakan wartawan. Menurutnya, seorang wartawan itu dalam menjalankan tugas sebagai peliput berita harus dibekali dengan tanda pengenal ataupun surat tugas dari pimpinan redaksi. “Kalau dia tidak bisa menunjukkan tanda pengenal dan sejenisnya meskipun dia mengaku dari anggota keorganisasian wartawan, maka dia tidak berhak mendapatkan konfirmasi dari seorang narasumber,” jelasnya. Selain itu, tindakan meminta uang kepada narasumber yang dilakukan oknum wartawan juga tidak dibenarkan, sebab hal itu bertentangan dengan kode etik jurnalistik (KEJ). “Saya mengimbau para kadis dan masyarakat agar tidak terpengaruh dengan hal-hal seperti itu, dan kalau ada yang mengalami hal yang serupa segera laporkan kepada pihak berwajib,” imbuhnya. (cza)


WASPADA Senin 13 Januari 2014

B11 Pengusaha Lampung Bangun Pabrik Makanan Di Aceh Utara

Kurang Bayar Bagi Hasil Migas Rugikan Aceh Utara LHOKSEUMAWE (Waspada): Kekurangan pembayaran bagi hasil migas merugikan pendapatan Pemkab Aceh Utara. DPRK setempat mendesak bupati mengambil langkah konkrit terhadap masalah tersebut. Panitia Anggaran (Panggar) DPRK Aceh Utara pada rapat paripurna beberapa waktu lalu menegaskan, kurang bayar bagi hasil migas merugikan daerah. Dana bagi hasil pemerintah pusat tersebut merupakan bagian dari pendapatan daerah penghasil gas alam ini. Terjadi kurang bayar, menurut panggar DPRK, akibat Dinas Pengelolaan Kekayaan dan Keuangan Daerah (DPKKD) hanya menunggu PMK Lifting yang dikeluarkan pemerintah pusat. “Kami menilai tidak ada upaya perhitungan rill, berapa yang Aceh Utara dapat,” tegas panitia anggaran dalam pendapat akhirnya yang dibacakan Abdul Hadi. Dalam pendapat panggar juga disebutkan, dari tahun 2003 sampai 2010 senilai Rp435.952.054.822 terjadi kurang bayar dari pemerintah pusat kepada Pemkab Aceh Utara. Kepala DPKKD Aceh Utara, M Nasir mengatakan, saat ini kekurangan pembayaran bagi hasil migas hanya Rp80 miliar. Namun jumlah tersebut akan dihitung kembali dalam pendapatan bagi hasil tahun berikutnya. M Nasir juga menjelaskan, terjadinya kurang bayar bagi hasil migas tidak merugikan daerah. “Terjadinya kurang bayar, akibat penghitungan dua bulan akhir tidak dimasukan,” jelasnya. Sisa tersebut akan dimasukkan kembali pada penghitungan tahun 2014. (b15)

ACEH UTARA (Waspada): Pada tahun ini, salah seorang pengusaha dari Lampung akan membangun pabrik pengolahan makanan yang berbahan baku nenas dan pisang di Kabupaten Aceh Utara. Perusahaan itu nantinya akan menampung 15.000 tenaga kerja. Hal itu disampaikan Muhammad Jamil, Wakil Bupati Aceh Utara, Minggu (12/1). Selain mengolah makanan, pengusaha tersebut juga akan mengekspor buah nenas dan pisang segar keluar negeri. Untuk membangun pabrik pengolah makanan berbahan baku nenas dan pisang itu, pengusaha tersebut telah melakukan survei ke delapan kabupaten di Provinsi Aceh, dan mereka sudah memutuskan untuk memilih Aceh Utara sebagai tempat mendirikan pabrik dan menjadikan Aceh Utara sebagai kebun pisang dan nenas perusahaan itu nantinya. “Hasil survei mereka menunjuk Aceh Utara merupakan daerah yang tepat, karena selain ekspor memiliki pelabuhan juga tingkat kesuburan tanah yang cukup bagus untuk menanam pisang dan nenas,” kata Wakil Bupati Aceh Utara Muhammad Jamil. Luas lahan untuk keperluan menanam nenas dan pisang belum disampaikan secara rinci oleh pengusaha tersebut dan mereka juga belum menentukan di kecamatan mana kebun tersebut akan dibuka. Nantinya, produk makanan berbahan baku nenas dan pisang itu akan diekspor ke Timur Tengah, Singapura, Eropa dan Amerika. Ekspor barang dapat langsung dilakukan melalui Pelabuhan Krueng Geukueh, jika mereka memilih Aceh Tengah dan Bener Meriah lokasinya jauh dan akan menghabiskan biaya transportasi yang lebih mahal. (b18)

Ketua Karang Taruna Bireuen Baca Waspada Sejak SMA Ketua Ka rang Taruna Bireuen Zulkifli (foto) mengatakan, dirinya, bukan sekarang baru mengenal harian Waspada, melainkan dirinya sudah menjadi langganan membaca harian ini sejak dirinya duduk di bangku SMA. “Kedekatan saya dengan harian Waspada bukan karena saya kenal dengan wartawan dan bukan pula karena saya pernah magang ikut pelatihan di kantornya beberapa tahun lalu, namun kedekatan dan telah menjadi langganan membacanya sejak saya duduk di bangku SMA,” katanya, Minggu (12/1). Diakuinya, dirinya sudah hobbi membaca koran khusunya harian Waspada sejak masih duduk di bangkus SM, rubrik yang menjadi pilihannya saat itu antara lain, halaman depan, berita olahraga. “Saat itu sekitar 1980-an seingat saya halaman Aceh masih terbatas. Namun, kecintaan saya membaca Waspada terus berlanjut sampai saya kuliah di Medan, di mana koran yang didirikan oleh alm H Mohd Said ini telah menjadi sarapan pagi saya sebelum saya berangkat kuliah sambil minum teh dan sarapan pagi pada gerobak kopi milik orang Aceh, saya cari dulu koran Waspada karena saat itu pemilik gerobak kopi biasa dia juga berlangganan banyak koran,” katanya. Zulkifli juga mengaku, menyebut nama koran Waspada rasanya tidak asing lagi baginya, karena berita yang disajikan enak dibaca dan sesuai perkembangan zaman, buktinya bisa dilihat dari masa ke masa harian ini tetap eksis. “Saya pribadi sangat terkesan dengan manajemen harian Waspada,” kata Zulkifli. Sehubungan itu, Zulkifli mengharapkan kepada jajaran redaksi supaya memasuki uaia Waspada ke-67 supaya tetap terus merapatkan barisan tanpa henti untuk mengevaluasi diri baik jajaran redaksi, wartawan dan agen-agen di daerah serta juga narasumber yang telah banyak membantu informasiinformasi bagi wartawannya di lapangan. Abdul Mukthi Hasan

Waspada/Maimun Asnawi

HAFIFUDDIN, guru besar yang juga Ketua STAIN Malikussaleh terpilih periode 2014-2018, Minggu (12/1) saat berdialog dengan Azwar Abubakar, MenPAN-RB

Azwar Abubakar

STAIN Malikussaleh Layak Jadi IAIN LHOKSEUMAWE (Waspada): Azwar Abubakar, Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi (MenPAN-RB), Minggu (12/ 1) mengunjungi kampus Sekolah Tinggi Agama Islam Negeri (STAIN) Malikussaleh. Pada kunjungan tersebut MenPAN-RB mengingatkan pihak kampus untuk terus menerus meningkatkan mutu para dosen guna melahirkan sarjana yang berkompetensi sesuai program studi masing-masing.

Selain itu, kampus STAIN Malikussaleh harus didesain selayaknya tempat wisata sehingga para mahasiswa memandang kampus sebagai tempat yang menyenangkan dan tidak menjadi beban bagi mereka. “STAIN Malikussaleh harus mampu melahirkan sarjana yang siap pakai dan mampu bersaing di dunia kerja. Kualitas lulusan harus betul-betul dijaga,” kata Azwar Abubakar pada DR Hafifuddin, Ketua terpilih untuk periode 2014-2018, Bastiar, Pembantu Ketua III, M Saleh, Sekjur Dakwah dan Prof Ja-maluddin, Direktur Pascasarjana Komunikasi Penyiaran Islam. Azwar Abubakar mengatakan, STAIN Malikussaleh layak

untuk ditingkatkan statusnya menjadi Institut Agama Islam Negeri (IAIN) menggantikan IAIN Ar-Raniry Banda Aceh yang telah berubah status menjadi Universitas Islam Negeri (UIN) Banda Aceh. Hafifuddin, guru besar yang juga sebagai ketua terpilih mengaku begitu gembira menerima kunjungan MenPAN-RB ke STAIN Malikussaleh, mengapa tidak, proses penegerian STAIN Malikussaleh dilakukan berkat usaha dan kerja keras Azwar Abubakar dulu, bukan hanya itu, lahan tempat didirikan kampus STAIN hari ini juga bisa dibebaskan atas bantuan Azwar Abubakar. Untuk melahirkan sarjana

yang berkualitas ke depan, STAIN Malikussaleh akan mendirikan dayah tinggi, karena mahasiswa yang mondok dengan mahasiswa yang tidak mondok berbeda kualitasnya, kemudian akan menyiapkan tenaga dosen dan staf administrasi yang handal, termasuk persoalan perekrutan caloh mahasiswa baru harus menjaring mahasiswa yang berkualitas, proses belajar mengajar pun harus ditingkatkan, begitu juga dengan kualias keagamaan, karena itu ke depan, setiap alumni STAIN Malikussaleh minimal mampu membaca khutbah jumat dan membaca doa, karena STAIN merupakan kampus yang berbasis ilmu agama Islam. (b18)

BKM Maju Bersama Gelar RWT Dan Khitan Massal


SISWA SMPN 2 Langsa sedang mengikuti kegiatan Perjusami di lapangan sepak bola sekolahnya, Minggu (12/1)

Pramuka SMPN 2 Langsa Gelar Perjusami

LANGSA (Waspada): Badan Keswadayaan Masyarakat (BKM) Maju Bersama Gampong Karang Anyar, Kecamatan Langsa Baro, menggelar acara RembugWarga Tahunan (RWT) dan khitan massal, di balai gampong setempat, Minggu (12/1) dihadiri warga yang terdiri dari BKM, aparat pemerintahan gampong Karang Anyar, masyarakat, anak-anak peserta khitanan masal, Faskel Tim 28, Askorkot CD, dan Askorkot Selaras PNPM Mandiri Perkotaan (MP) Langsa. Koordinator BKM Maju Bersama, Suyitno mengatakan, kegiatan Program Nasional Pemberdayaan Masyarakat (PNPM) Mandiri di Karang Anyar meliputi tiga aspek, yaitu, lingkungan (infrastruktur), sosial, dan

ekonomi. Unit pelaksana kegiatan lingkungan (infrastruktur) pada 2013 telah membangun rabat beton sepanjang 168 m. Unit pelaksana kegiatan ekonomi mengelola modal bergulir sebanyak Rp325.077.190,54 yang pada Desember tahun 2013 mampu menghasilkan jasa pinjaman sebesar Rp 32.069. 132,54. Jasa bersih tersebut berdasarkan hasil musyawarah BKM dan koordinasi dengan perangkat pemerintahan gampong dialokasikan untuk dana sosial sebesar Rp11.800.000,00, penambahan modal Rp12.000. 000,00, operasional lembaga Rp3. 500.000,00 dan koordinasi dengan perangkat pemerintahan gampong Rp1.500.000,00. Khusus alokasi dana sosial digu-

nakan untuk khitan massal 20 anak, santunan anak yatim, dan bantuan pembangunan masjid gampong Karang Anyar. Diakuinya, pelaksanaan PNPM di gampongnya bisa berjalan baik karena koordinasi yang baik antara BKM dengan pemerintahan gampong dan dukungan masyarakat Karang Anyar serta bimbingan dari Faskel PNPM MP Tim 28. Dalam hal pengelolaan modal bergulir tingkat pengembalian pinjaman 100 persen, artinya tidak ada kredit macet. Bantuan modal dari PNPM juga telah menjadi akselerator kemajuan perekonomian gampong. Banyak usaha industri rumah tangga yang berkembang pesat dengan jenis produksi keripik singkong, keripik buah, roti, bakso, siomay,

LANGSA (Waspada): Pramuka Gudep L-021 L-022 SMP Negeri 2 Langsa menggelar kegiatan perkemahan, Jumat-SabtuMinggu (Perjusami) di lapangan bola SMPN 2 Langsa, Minggu (12/1) dibuka Kamabigus SMPN 2 Langsa Kak Yusniar, dihadiri Ketua Panitia Ade Suhendra dan dibantu dengan consultant kegiatan M Prawira Haji. Menurut ketua panitia, Ade Suhendra, persiapan di dalam kegiatan ini dilakukan dalam sebulan lalu agar para siswa yang mengikuti Perjusami mampu bersaing dengan teman-teman di dalam kegiatan tersebut. “Di mana peserta dari siswa SMPN 2 Langsa berjumlah 25 orang dengan kegiatan yang dibentuk semacam perlombaan seperti kompas, tali-menali, PPGD, Bivak, Simaphore, Morse, dan Sandi,” katanya. Lanjut Ade, tujuan dalam kegiatan ini ialah membina para siswa Pramuka SMPN 2 Langsa agar mampu bersaing di dalam even-even kagiatan Pramuka tingkat kota, provinsi maupun nasional. (m43)

Tiba (light, asal, waktu)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*


Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Waspada/H AR Djuli

KETUA Pelaksana Baksos Gempar Unsyiah Iskandar Zulkarnain menyerahkan plakat bungong jaroe kepada Kadis Kesehatan Bireuen Yurizal pada acara penutupan Baksos di Meunasah Batee Raya, Sabtu (11/1)

Baksos Gempar Berakhir Sukses BANDAR JULI (Waspada) : Kegiatan bakti sosial Gerakan Mahasiswa Keperawatan Peduli Masyarakat (Gempar) Fakultas Keperawatan Unsyiah di Desa Batee Raya, Kecamatan Juli telah berakhir sukses ditutup Kadis Kesehatan Bireuen dr Yurizal, Sabtu (11/1). Kadis Kesehatan Bireuen Yurizal dalam sambutannya antara lain menyampaikan salut kepada para mahasiswa Fakultas Keperawatan Unsyiah yang sukses melaksanakan bakti sosial

kepada masyarakat Desa Batee Raya, Alue Unoe dan Desa Seuneubok Peuraden. Pembantu Dekan-2 Keperawatan Unsyiah Ardia Putra menyampaikan penghargaan dan terima kasih kepada Pemkab Bireuen, Kapolres, Dandim, Dinkes, RSU dr Fauziah, Puskes Juli dan Juli Dua yang telah memberikan dukungan openuh terhadap pelaksanaan baksos di Batee Raya. (b12)

sabun. Selain itu, BKM Maju Bersama berencana untuk membangun unit pemasaran bersama (trading house) untuk produkproduk KSM penerima modal bergulir PNPM MP. Tekad itu untuk mendorong agar segera terwujud one village one product (satu gampong, satu produk unggulan) di mana Karang Anyar mencanangkan diri sebagai pusat produksi dan pemasaran makanan jajanan di Kota Langsa. Keuchik Karang Anyar, Ahmad Tukiran, berharap agar Pemko Langsa mendukung rencana pemerintah Gampong Karang Anyar dan masyarakatnya dengan membuat kebijakan lintas sektor dan menyediakan anggaran yang memadai untuk mewujudkan Karang Anyar sebagai sentra produksi dan pemasaran makanan jajanan. SKPD yang seharusnya turut terlibat adalah Diskoperindag yang menyediakan dana dan pendampingan teknis pengelolaan usaha, Dinas Kesehatan yang mengawasi kualitas produksi dari aspek kesehatan, Dinas Pariwisata yang mempromosikan desa Karang Anyar sebagai pusat produksi dan pemasaran makanan jajanan, dan PU yang berkewajiban untuk menyediakan infrastruktur pendukung kegiatan produksi dan pemasaran. Menurutnya, jika hal tersebut bisa dilakukan secara simultan, maka visi Karang Anyar sebagai pusat produksi dan pemasaran makanan jajanan bisa segera terwujud dan menjadi percontohan bagi gampong lain. Senior Fasilitator PNPM MP Tim 28, Syawaluddin, menyampaikan apresiasi atas kerja keras, kebersamaan, keikhlasan, kejujuran, transparansi, dan prakarsa yang sifatnya inovatif dari BKM Maju Bersama. Dari sekian banyak gampong peserta program PNPM M hanya sedikit yang melakukan secara benar dan hasilnya juga bagus. Yang paling mudah untuk dijadikan indikator kinerja manajemen BKM adalah pengelolaan dana bergulir. Jika pengelolaan dana bergulir transparan dan akuntabel, hampir bisa dipastikan untuk kegiatan infrastruktur dan sosial juga akan berjalan baik. (cms)

Peningkatan Status Indikator Peningkatan Pencerahan LANGSA (Waspada): Melihat perkembangan proses pendidikan yang terjadi di STAIN Zawiyah Cot Kala Langsa, maka upaya peningkatan status menjadi IAIN yang sedang dilakukan oleh pihak kampus ini sudah layak. Karena pada hakikatnya peningkatan status lembaga pendidikan merupakan salah satu indikator peningkatan pencerahan masyarakat. “Saya juga mendukung penuh upaya peningkatan status STAIN menjadi IAIN ini,” kata Menteri Pendayagunaan Aparatur Negara dan Reformasi Birokrasi Azwar Abubakar saat mengunjungi kampus STAIN Zawiyah Cot Kala Langsa di Gampong Meurandeh, Langsa Lama, bersama Wali Kota Langsa Usman Abdullah, Sabtu (11/1). Dijelaskan, sebagai wujud dari dukungan tersebut, dirinya akan mengagendakan STAIN Langsa dalam Peraturan Presiden (Perpres) tentang peningkatan status perguruan tinggi. Untuk peningkatan status STAIN menjadi IAIN, akan diagendakan paling lambat tiga bulan ke depan. Dirinya juga berharap, dengan upaya peningkatan status ini, lembaga pendidikan STAIN Langsa dapat menjadi lembaga pendidikan umat. “Sebagai lembaga pendidikan Islam, STAIN harus mampu membentuk kecerdasan, keterampilan dan etika bagi mahasiswa serta civitas akademika secara keseluruhan. Juga harus mampu mengarahkan mahasiswa untuk tidak mengharapkan PNS sebagai kerja, tapi dorong mahasiswa menjadi mandiri,” kata Azwar. Puket I STAIN Zawiyah Cot Kala Langsa Basri Ibrahim mengatakan, pihaknya menyambut baik dukungan MenPAN RB RI terkait upaya peningkatan status menjadi IAIN Zawiyah Cot Kala. Menurutnya, seiring dukungan menteri negara tersebut, pihak kampus akan melakukan pembenahan secara internal dan persiapan menyongsong peningkatan status menjadi IAIN secara matang.(cms)

Pelajar SD Ditubruk Mobil LANGSA (Waspada): Mobil penumpang jenis Honda CRV BK 115 RA menubruk seorang pengendara sepeda dayung yang dikendarai M Syafrizal, 9, pelajar SD, warga Dusun Setia, Desa Karang Anyar, Kec. Langsa Baro Pemko Langsa, di Jalan Kebun Baru-Timbang Langsa tepatnya di simpang tiga SDN 2 Karang Anyar, Dusun Setia Desa Karang Anyar, Kec. Langsa Baro, Langsa. “Akibat kecelakaan itu, pelajar tersebut meninggal dunia, Minggu (12/1)sekirapukul09:00,”kataKapolresLangsaAKBPHHariadimelalui Kasat Lantas AKP Kamila kepada wartawan, Minggu (12/1). Menurut Kapolres, kronologis kejadiaan berawal dari sebelumnya mobil penumpang Honda CRV BK 115 RA yang dikemudikan Villa Nurmalinda, 19, mahasiswi, warga Dusun I Desa Pondok Kelapa Gading, Kec. Langsa Baro, melaju dari arah PTP Nusantara I Kebun Baru menuju Geudubang dengan keceptan sedang. Sementara sepeda dayung yang dikendarai M Syafrizal melaju dari arah Jalan Karang Anyar menuju Kebun Baru, namun sesampainya di TKP pengemudi Honda CRV kurang hati-hati tidak mengutamakan sepeda dayung yang sedang melaju dari Jalan Karang Anyar menuju Jalan Kebon Baru Timbang Langsa. Sehingga mobil tersebut menubruk bagian depan samping kanan sepeda dayung. Selajutnya, korban dibawa ke Rumah Sakit Umum Daerah Langsa (RSUD). “Kasus ini sudah ditangani pihak kepolisian Polres Langsa,” kata Kapolres Langsa. (m43)

Perubahan Moral Target Napi Pulkam IDI (Waspada): Berbagai kegiatan keIslaman terus diisi dengan mengundang para pemateri khususnya ustadz dari luar ke Rumah Tahanan Negara Cabang Idi, Kabupaten Aceh Timur. Targetnya adalah untuk perubahan moral sebagai modal para narapidana (napi) pulang kampung (pulkam). “Seseorang yang masuk ke lembaga ini penuh penyesalan. Saat berada di dalam tugas dari rutan merubah pola pikir jahat menjadi baik. Targetnya adalah sekembali ke masyarakat mampu menjadi warga negara yang beretika dan berakhlakul karimah,” kata Kepala Rutan Idi Yusnaidi, Minggu (12/1) di Idi. Dia menambahkan, kegiatan utama di dalam Rutan Idi adalah pengajian rutin. Para napi dibina melalui berbagai ritual keIslaman yang diawali penyampaian materi oleh para ustdaz. “Ini tujuannya untuk merubah pola pikir para napi yang sedang dibina di lembaga ini. Tidak ada alasan di saat keluar dari lembaga ini para napi tidak merubah sikap dan prilaku, namun pembinaan yang lebih diharapkan nantinya adalah kepedulian aparatur desa,” kata Yusnaidi. (b24)

Waspada/M Ishak

KEPALA RUTAN IDI menyampaikan arahan di Rutan Idi, Aceh Timur, baru-baru ini


Klik . . . Klik . . .

WASPADA Senin 13 Januari 2014

Syukuran HUT 67 Harian WASPADA KUE ULANG TAHUN: Pimpinan Harian Waspada memotong kue ulang tahun pada syukuran 67 tahun Harian Waspada di Hotel Soechi Medan, Sabtu (11/1).

TRIO WASPADA: Tiga Karyawan Waspada yakni Austin Antariksa, Hang Tuah J Said dan Erucakra Mahameru saat membawakan sejumlah lagu memeriahkan HUT 67 Harian Waspada di Hotel Soechi Medan, Sabtu (11/1). Waspada/Muhammad Faisal

Waspada/Surya Efendi

Waspada/Surya Efendi

Waspada/Hang Tuah J Said

PEMENANG FEATURES: Pemred Harian Waspada H Prabudi Said diabadikan bersama para wartawan pemenang tulisan (features) usai penyerahan hadiah memeriahkan HUT 67 Waspada di Hotel Soechi Medan, Sabtu (11/1).

KARYA TULIS: Wapemred H Teruna J Said diabadikan bersama para pemenang tulisan memeriahkan HUT 67 Harian Waspada di Hotel Soechi Medan, Sabtu (11/1).

Waspada/Hang Tuah J Said

25 TAHUN MENGABDI: Komisaris Harian Waspada Indra Buana Said menyerahkan penghargaan kepada empat karyawan yang telah mengabdi selama 25 tahun pada HUT 67 Harian Waspada di Hotel Soechi Medan, Sabtu (11/1).

Waspada/Hang Tuah J Said

LUCKY DRAW: Komisaris Harian Waspada Indra Buana Said menyerahkan hadiah lucky draw berupa TV LED kepada salah seorang karyawan percetakan pada perayaan HUT 67 Waspada di Hotel Soechi, Sabtu (11/1).

PEMIMPIN dan karyawan Harian Waspada foto bersama usai merayakan HUT Harian Waspada ke-67 di Hotel Soechi Medan, Sabtu (1/11). Waspada/Arianda Tanjung

Waspada,senin 13 januari 2014