Page 1

Harga Eceran Rp3.000,-

AS Bantah Sembunyikan MH370 Di Diego Garcia KUALA LUMPUR, Malaysia (Waspada): Amerika Serikat membantah keras tuduhan bahwa pihaknya telah menutup-nutupi misteri yang menyelimuti hilangnya pesawat Malaysia Airlines MH370 yang hilang sejak 8 Maret lalu dalam penerbangannya dari Kuala Lumpur ke Beijing di China. Dalam berbagai diskusi, termasuk di media sosial, bahwa AS berada di balik hilangnya jet Boeing 777 itu, namun melalui Kedutaanbesar AS di Malaysia, Washington menyebut semua itu ‘teori-teori konspirasi yang tidak berdasar.’ Melalui emailnya kepada New Straits Times, Kedubes AS di Malaysia menyebut pernyataan MH370 disembunyikan di Diego Garcia adalah tudingan liar. Diego Garcia terletak di tengah-tengah Samudera India, dari arah barat daya Indonesia dan di selatan India. Lanjut ke hal A2 kol. 5

Demi Kebenaran Dan Keadilan

WASPADA

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

RABU, Kliwon, 16 April 2014/16 Jumadil Akhir 1435 H

No: 24551 Tahun Ke-68

Terbit 24 Halaman

Pencarian MH370 Masuki Tahap Baru PERTH, Australia (AP): Pencarian pesawat Malaysia Airlines MH370 memasuki tahapan baru, dengan diluncurkannya kapal selam mini robotik Bluefin-21 untuk mencari jejak pesawat tersebut di selatan Samudera India, di lepas pantai Australia. Penyelaman pertama oleh kapal selam robot itu gagal menemukan jejak MH370. Misi pertama Bluefin itu dibatalkan setelah kapal selam mini itu melampaui kedalaman maksimum yang harus ditempuhnya dalam melaksanakan operasi pencarian itu, demikian menurut AL Amerika Serikat Selasa (15/4). Kendaraan Tanpa Awak Yang Bergerak Sendiri di Bawah Air (AUV) Bluefin-21 tidak mengalami kerusakan dan direncanakan melakukan tugas keduanya Selasa sore di bawah Samudera India, cuaca tampaknya mengizinkan. Lanjut ke hal A2 kol. 1

AP

KAPAL SELAM MINI ROBOTIC : Pasukan Pertahanan Australia sedang menurunkan kapal selam mini robotik dinamakan Bluefin-21 yang dilengkapi sonar untuk melanjutkan pencarian jejak pesawat Malaysia Airlines MH-370, di kawasan selatan Samudera Hindia, Selasa (15/4).

SDA Tuding DPW PPP Makar Konvensi Capres PD Lanjut JAKARTA (Waspada): Ketua Umum DPP Partai Demokrat (PD), Susilo Bambang Yudhoyono, Selasa(15/4) malam menggelar rapat dengan Komite Konvensi Calon Presiden di kediaman SBY di Puri Cikeas, Bogor. Komite Konvensi meminta petunjuk kepada SBY, apakah sebaiknya ajang tersebut tetap diteruskan atau dihentikan. Ini karena perolehan suara Demokrat dalam Pemilu Legislatif yang tidak mencapai target. Partai itu berada di urutan keempat dengan perolehan suara di kisaran 9 persen berdasarkan hasil hitung cepat.

Dengan capaian itu, Demokrat tak bisa usung Capres sendiri. “Komite Konvensi minta petunjuk tentang kelangsungan Konvensi. Kemarin kan pelaksanaannya ditunda menjelang pileg,” kata Sekjen Komite Konvensi, Suaidi Marasabessy, ketika dihubungi wartawan. Rapat antara Majelis Tinggi Demokrat pimpinan SBY dan Komite Konvensi akhirnya memutuskan untuk meneruskan Konvensi. “Konvensi akan berlanjut dengan satu kali debat terakhir di Jakarta akhir bulan April ini. Setelah itu akan disurvei

hasilnya,” ujar Suaidi. Namun, ia belum tahu persis kapan hasil konvensi diumumkan. “Pengumuman pemenang konvensi diharapkan sebelum pendaftaran Capres-Cawapres ke KPU. Pendaftaran mulai 10 Mei dan berakhir 20 Mei. Jadi di antara itu,” kata Suaidi. Rapat di Cikeas malam ini, ujar Suaidi, dihadiri Ketua Komite Konvensi, Maftuh Basyuni, Wakil Ketua Komite Konvensi Taufiqurrahman Ruki, dia, dan Roy Suryo. Menurut informasi, rapat dimulai pukul 20.00 dan berakhir sekitar pukul 22:00.(vn)

JAKARTA(Waspada): Ketua Umum PPP Suryadharma Ali menyatakan pengajuan mosi tidak percaya kepada ketua umum, yang dilakukan oleh sejumlah Dewan Pimpinan Wilayah (DPW), merupakan perbuatan melanggar AD/ART partai dan tindakan makar. “Jangankan 26 DPW, 1000 DPW pun untuk menjatuhkan ketum, itu bukan forumnya. Perbuatan itu melanggar AD/ ART partai dan dikategorikan makar sehingga DPP PPP layak memberi sanksi,” kata Suryadharma Ali. Ia menegaskan mosi tidak percaya yang disampaikan oleh 26 Dewan Pimpiman Wilayah (DPW) itu tidak akan mampu melengserkan ketua umum partai itu. “Dalam Anggaran Dasar PPP, kalau mau menjatuhkan ketua umum, ada mekanisme, yaitu Muktamar Luar Biasa (MLB). Untuk menuju MLB diawali dengan Musyawarah Kerja Cabang, Musyawarah Kerja Nasional. MLB harus mendapat dukungan 2/3 DPW dan cabang seluruh Indonesia,” kata Suryadharma di Gedung DPP PPP di Jakarta, Selasa(15/4). Ia menyebutkan, alasan

mosi tidak percaya pada dirinya tak lebih dari alasan yang dicari-cari seperti menghadiri kampanye Partai Gerindra di Gelora Bung Karno. “Tidak ada etika yang saya langgar. Tidak ada aturan yang sayang langgar. Instruksi 1109 adalah untuk para caleg yang dilarang berkampanye dengan partai lain. Sementara saya adalah ketum dan tidak mencalonkan diri sebagai anggota legislatif,” katanya. Menghadiri kampanye Partai Gerindra, katanya, merupakan sebuah kehormatan dan memanfaatkan momentum. “Dalam politik, kehadiran saya adalah sebuah kehormatan. Saya bilang tepat saat hadiri kampenya Gerindra, Ini momentum. Dalam politik momentum penting,” pungkas SDA.

Rahudman Ditahan Di Tg. Gusta MEDAN (Waspada) : Wali Kota Medan non aktif, Rahudman Harahap resmi ditahan di rumah tahanan (Rutan) Tanjung Gusta Medan. Rahudman dijemput tim Jaksa Penuntut Umum (JPU) dari Kejaksaan Tinggi Sumatera Utara (Kejatisu) bersama puluhan personil Brimobdasu Detasemen A dan satu unit Baracuda dari kediamannya di Jl. Sei Serayu No 56, Selasa (15/4) siang. Pantauan Waspada, saat penjemputan terpidana kasus korupsi Tunjangan Penghasilan Aparatur Pemerintahan Desa (TPAPD) Kab. Tapanuli Selatan tahun 2005 yang meru-

gikan negara sebesar Rp1,5 miliar itu, terlihat Koordinator Pidana Khusus Kejatisu Hendrik Silitonga, Kasi I Intel Kejatisu Marcos Simaremare, Kasi III Intelijen Boby, Kasipenkum Kejatisu Chandra Purnama Pasaribu dan JPU Polem Siregar serta puluhan personil Brimobdasu. Rahudman dibawa menggunakan mobil Kijang Innova BK 789 OO.Sebelumnya, personil Brimobdasu dengan senjata posisi siaga membuat pagar betis mengawal keluarnya mobil yang membawa Rahudman dari rumahnya yang berpagar kuning keemasan.

Koordinator Pidana Khusus Kejati Sumut Hendrik Silitonga, yang menjadi Ketua Tim Eksekusi Rahudman Harahap , menyatakan Wali Kota Medan nonaktif itu kooperatif dan tidak melawan saat dibawa ke Rutan Tanjung Gusta Medan untuk menjalani hukuman 5 tahun penjara. “Beliau (Rahudman) welcome menerima kami di rumahnya. Saat mau dibawa ke Rutan, beliau welcome dan langsung setuju,”kata Hendrik kepada wartawan usai menyerahkan Rahudman ke Rutan Tanjung Gusta Medan. Lanjut ke hal A2 kol. 7

Lanjut ke hal A2 kol. 3

Soal UN Tentang Jokowi Tersebar Di 18 Provinsi Antara

MOSI TIDAK PERCAYA KETUM PPP: Ketua DPW PPP Wilayah NTT Zaidin Umar (tengah) didampingi Ketua DPW PPP Wilayah Sumut Fadly Nurzal (ketiga kanan) dan Ketua DPW PPP Wilayah Jawa Barat Rahmad Yasin (ketiga kiri) bersama perwakilan DPW PPP Indonesia mengangkat tangan mereka seusai memberikan keterangan mengenai pelanggaran Ketua Umum DPP PPP Suryadharma Ali di Jakarta, Selasa (15/4). Zaidin Umar bersama perwakilan 27 DPW PPP menyatakan Mosi tidak percaya kepada Suryadharma Ali.

39 TPS Di Sumut Bermasalah Kotak Suara Di Nisel Sengaja Dibakar MEDAN (Waspada): Polda Sumut mendata 39 Tempat Pemungutan Suara (TPS) yang tersebar di Sumut bermasalah saat pelaksanaan Pemilu Legislatif (Pileg) Rabu (9/4), sehingga harus dilakukan pencoblosan ulang. “Permasalahannya karena adanya kecurangan dan surat suara tertukar, “ kata Kasubbid Pengelola Informasi dan Dokumentasi (PID) Humas Polda

Sumut AKBP MP Nainggolan, Selasa (15/4). Dari keseluruhan TPS itu, kata MP Nainggolan, 25 TPS di antaranya terdapat di Nias Selatan dan satu TPS di kabupaten induk (Nias). Untuk Kab. Nias sudah dilakukan pemungutan suara ulang pada Jumat (11/4). Sedangkan satu TPS di Nias sudah dilakukan pemungutan suara ulang Sabtu (12/4). Sementara 12 TPS lainnya sudah

direkomendasikan oleh Panitia Pengawas Pemilu (Panwaslu) untuk melakukan pemungutan suara ulang. MP Nainggolan mengatakan, 13 TPS lain yang tersebar di beberapa kabupaten/kota di Sumut, juga melakukan pemungutan suara ulang karena surat suara yang diterima tertukar antardaerah pemilihan (Dapil) di Sumut. Lanjut ke hal A2 kol. 5

JAKARTA (Waspada): Munculnya soal terkait politik praktis yang menyebut-nyebut nama Gubernur DKI Jakarta, Joko Widodo atau Jokowi membuat ‘gerah’ Kementerian Pendidikan dan Kebudayaan. Dalam keterangan pers, Wakil Menteri Pendidikan dan Kebudayaan (Wamendikbud), Musliar Kasim menegaskan pihaknya tidak bermaksud memasukkan unsur politik dalam dunia pendidikan, mengingat Jokowi yang kini adalah calon presiden. “Tidak ada unsur politik sama sekali. Tapi kami akan segera menelusuri kenapa soal yang sangat sensitif itu masuk dalam ujian. Seharusnya soal yang bernuansa politik memang tidak ada dalam dunia pendidikan,” kata Musliar dalam keterangan pers di Jakarta, Selasa (15/4). Dia didampingi Kepala Badan Penelitian dan Pengembangan (Kabalitbang)

Kemdikbud, Furqon dan Ketua Badan Standar Nasional Pendidikan (BSNP), Edy Baskoro. Dalam UN hari pertama, Senin (14/4) nama Jokowi muncul di salah satu soal Bahasa Indonesia. Soal tersebut berada di Paket P3 yang disebar ke 18 provinsi. Dari 20 varian soal yang ada di dalam kelas, ada 3 varian yang tertera soal tentang otobiografi Jokowi. Itu artinya ada 187 ribu dari total 3,1 juta siswa peserta UN SMA dan paket C di seluruh Indonesia yang membaca soal tersebut. ”Hanya 6 persen saja dari total siswa, tapi memang itu cukup mengganggu,” kata Musliar. Meski demikian, Musliar menolak jika Kemdikbud dikatakan kecolongan dalam kasus ini. Menurut dia, soal-soal UN 2014 yang jenisnya mencapai 18 ribu sudah dibuat sejak Juli 2013. Pembuatnya adalah

Lanjut ke hal A2 kol. 3

Mata’ul Ghurur Oleh Tgk. H. Ameer Hamzah Belumkah datang waktunya bagi orang-orang yang beriman, untuk tunduk hati mereka mengingat Allah dan kepada kebenaran yang telah turun kepada mereka...? (QS. al Hadid:16)

Lanjut ke hal A2 kol. 3

waspadamedan.com Waspada Daily

@Harian_Waspada

Naskah Soal Tertukar, Ratusan Siswa SMK Batal UN MEDAN (Waspada): Hari kedua pelaksanaan Ujian Nasional (UN) 2014, Selasa (15/4), tidak berjalan lancar seperti hari pertama. Ratusan siswa/i SMK sejumlah sekolah di Sumatera Utara batal mengikuti ujian karena naskah soal UN tertukar. “Ya benar ada, naskah soal UN tertukar, akibatnya sejumlah siswa SMK di beberapa sekolah di Sumut batal mengikuti ujian, “ kata Kepala Badan

Pengembangan Sumberdaya Manusia Pendidikan dan Kebudayaan & Penjaminan Mutu Pendidikan (BPSDMPK & PMP), Prof Dr Syawal Gultom MPd. Menjawab Waspada, di gedung Serba Guna Universitas Negeri Medan (Unimed), Selasa, (15/4) siang, Prof Syawal Gultom mengatakan, siswa/i SMK yang batal UN kemarin, akibat naskah tertukar, kembali mengikuti ujian

Fenomena Gerhana Bulan Merah Darah

Al Bayan

BANYAK orang mengakui beriman dan bertaqwa kepada Allah SWT. Mereka mendirikan salat, puasa, bayar zakat, naik haji ke Baitullah, bahkan salat tahajjud tengah malam. Sehari-hari tampil dengan atribut-atribut keIslaman seperti memelihara janggut, bersurban, memakai peci, membaca khutbah, mengurus partai Islam. Terkesan memang sebagai seorang shaleh. Tetapi benarkah mereka shaleh dan sudah beriman sesuai yang dikehendaki syariah Allah? Tunggu dulu! Rupanya masih jauh dengan kebenaran Alquranulkarim. Sebab mereka tertipu oleh nafsunya, mereka masih menolak hukum Allah dan membanggakan hukum taghut. Mereka masih hidup dengan riba dan menafikan

Waspada/Surya Efendi

POLISI mengawal ketat di samping mobil yang membawa Wali Kota Medan non aktif Rahudman Harahap ketika proses eksekusi yang dilakukan tim Kejaksaan Tinggi Sumut dari kediamannya di Jl. Sei Serayu Medan, Selasa (15/4).

Waspada/Surya Efendi

WARGA kembali menggunakan hak suaranya dalam pencoblosan ulang untuk DPRD Medan di TPS 34 Sei Agul, Medan Barat, Selasa (15/4).

Coblos Ulang Di DS, Dua Warga Ditangkap PERCUT SEITUAN (Waspada): Dua warga ditangkap PPL dan Panwas saat hendak melakukan coblos ulang Pemilu Legislatif yang digelar Panitia Pemungutan Suara (PPS) Kec. Percut Seituan di tiga TPS, Selasa (15/4). Informasi Waspada peroleh, coblos ulang di 3 TPS,yakni TPS 34, 39 dan TPS 45 berlangsung pukul 07:30, karena dalam Pemilu 9 April terdapat surat suara tertukar, khusus Caleg DPRD Kabupaten. Lanjut ke hal A2 kol. 3

MEDAN (Waspada): Gerhana Bulan akan melewati sebagian wilayah Indonesia, Selasa (15/4). Gerhana Bulan ini akan tampak lebih merah atau masyarakat luas mengen a l n y a m e r a h d a ra h (blood moon). Di Medan, warna bulan memang tampak merah dilihat dari kasat mata. Kepala Lembaga Penerbangan dan Antariksa Nasional (LAPAN), Thomas Djamaluddin, menjelaskan penampakan gerhana bulan yang merah itu terkait dengan kualitas atmosfer Bumi yang dalam kondisi bagus. Thomas menegaskan istilah merah darah itu bukan istilah yang dikenal

Lanjut ke hal A2 kol. 3

susulan 22 April 2014. “Kita jamin materi naskah soal UN bagi peserta UN susulan tidak bocor. Diapastikan aman, materi soalnya pun dipastikan tidak sama dengan sudah diujikan, “ kata Syawal didampingi Koordinator Pengawas UN Universitas Negeri Medan Prof Dr Khairil Ansari dan Kabag Humas Unimed, M.Surip. Lanjut ke hal A2 kol. 1

Ada-ada Saja 70 Tahun Jadi Pelayan Bar SEORANG wanita berusia 100 tahun telah mengabdikan dirinya selama 70 tahun untuk menjadi pelayan bar tertua di dunia. Meski sudah sangat tua untuk bekerja sebagai pelayan b a r, D o l l y S a v i l l e , t i d a k berencana untuk pensiun. Saville, bekerja tiga hari seminggu di The Red Lion Hotel diWendover, Buckinghamshire, Inggris. Nenek bercucu tiga

Lanjut ke hal A2 kol. 2

Serampang Waspada/Surya Efendi

Bulan diabadikan di atas langit Kota Medan, Selasa (15/4) malam. Warna bulan memerah ini disebut Gerhana Bulan Merah Darah (Blood Moon) dan hanya dapat dilihat jelas di wilayah Indonesia Timur.

- Hai partai Islam, bersatulah...! - He...he...he...


Harga Eceran Rp 3.000

Demi Kebenaran Dan Keadilan

Waspada/Surya Efendi

COBLOS ULANG: Warga kembali menggunakan hak suaranya dalam pencoblosan ulang untuk DPRD Medan (kertas hijau) di TPS 34 Sei Agul, Medan Barat, Selasa (15/4).

WASPADA

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

RABU, Kliwon, 16 April 2014/16 Jumadil Akhir 1435 H

No: 24551 * Tahun Ke-68 Terbit 24 Halaman

39 TPS Di Sumut Bermasalah MEDAN (Waspada): Polda Sumut mendata 39 Tempat Pemungutan Suara (TPS) yang tersebar di Sumut bermasalah saat pelaksanaan pemilihan legislatif (Pileg) Rabu (9/4) lalu, sehingga harus dilakukan pencoblosan ulang. “Permasalahannya karena adanya kecurangan dan surat suara yang tertukar, sehingga 39 TPS di Sumut terpaksa melakukan pencoblosan ulang,” kata Kasubbid Pengelola Informasi dan Dokumentasi (PID) Humas Polda Sumut AKBP MP Nainggolan, Selasa (15/4). Dari keseluruhan TPS itu, Lanjut ke hal A2 kol 1

Rahudman Ditahan Di Tg. Gusta

Antara

MEDAN ( Waspada): Wali Kota Medan non aktif, Rahudman Harahap resmi ditahan di rumah tahanan (Rutan) Tanjung Gusta Medan. Rahudman dijemput tim Jaksa Penuntut Umum (JPU) dari Kejaksaan Tinggi Sumatera Utara (Kejatisu) bersama puluhan personil Brimobdasu Detasemen A dan satu unit Baracuda dari kediaman terpidana Jl. Sei Serayu No 56, Selasa (15/4) siang. Pantauan Waspada, saat penjemputan terpidana

PERSONEL Brimob bersiaga di samping mobil yang membawa Walikota Medan non aktif Rahudman Harahap ketika proses eksekusi yang dilakukan tim Kejaksaan Tinggi Sumut, di Medan, Selasa (15/4).

Lanjut ke hal A2 kol 3

127 Caleg & Simpatisan Tersangka Banjir Bandang Landa Aceh Tenggara KUTACANE (Waspada): Hujan deras yang mengguyur kawasan Aceh Tenggara sejak Senin (14/4) sore hingga Selasa (15/4) dini hari mengakibatkan banjir bandang melanda tiga desa di Kec. Semadam dan satu desa di Kec. Lawe Sigala Gala. Pantauan Waspada, banjir melanda Desa Kampung Baru ,Titi Pasir ,Beringin Gayo,Kec. Simpang Semadam ,dan Desa kayu Mbelin Kec. Lawe Sigala gala.Delapan rumah di Desa Kampung Baru dan Titi Pasir dan satu jembatan rusak. Menurut warga setempat,

suara gemuruh air dan batuabatuan serta kayu gelondongan pada Senin malam mengejutkan mereka yang tinggal di sekitar desa hingga membuat warga berhamburan keluar rumah. Delapan rumah warga terlihat bergerak dan akhirnya ambruk dan hanyut terseret arus sungai. Bahkan harta benda lainnya juga turut hanyut bersama dengan rumah. Kedelapan rumah tersebut adalah milik warga Desa Kampung Baru serta Titi Pasir yaitu Asmaniar, 40, Rasid, 55, Dedi, 50, Selamah, 41, Ishak,

52, Kas, 48, Saidah, 35, serta Sarwan, 44, sebagian warga terlihat mengungsi ke daerah yang aman. “Bencana yang melanda kali ini kuat dugaaan akibat perambahan liar oleh oknum yang tidak bertanggung jawab, daerah Kecamatan Emadam ini. Wakil Bupati Aceh Tenggara Ali Basrah yang terjun ke lokasi, memerintahkan pihak PU Pengairan menurunkan alat berat embersihkan bebatuan yang betaburan di badan jalan. Meskipun tidak Lanjut ke hal A2 kol 6

JAKARTA (Waspada): Mabes Polri telah melakukan penyelidikan terhadap ratusan kasus tindak pidana pemilihan umum (Pemilu) sebagai tindak lanjut dari laporan Bawaslu terhitung sampai 14 April 2014. “Sebanyak 117 kasus tindak pidana Pemilu, Polri sebagai penerusan pihak Bawaslu di tingkat pusat dan daerah, ada 59 kasus dalam proses sidik, 42 kasus sudah selesai (P21) dan 15 kasus diberhentikan (SP3),” kata Kepala Bagian Penerangan Umum Mabes Polri, Kombes Pol Agus Riyanto kepada wartawan, Selasa (15/4). Agus menambahkan, dari kasus-kasus tersebut sebanyak 127 orang telah ditetapkan sebagai tersangka. “Yang jelas mereka ada Caleg, simpatisan, beberapa pendukung, termasuk di dalamnya pejabat pemerintah yang melakukan pelanggaran. Semua itu tahapan sebelum masa kampanye sampai masa pemungutan dan penghitungan suara,” ujarnya. Dua Ditangkap Gunakan Surat Suara Orang Lain Di tempat terpisah, Panitia Pemungutan Suara (PPS) Kec. Percut Seituan, Selasa (15/4), melakukan pencoblosan ulang Pemilu Legislatif di 3 TPS. Lanjut ke hal A2 kol 6

Ratusan Massa Rusak Kotak Suara Di PPK Sosa SOSA (Waspada): Ratusan orang mengobrakabrik balai desa yang dijadikan tempat penghitungan suara oleh Panitia Pemungutan Kecamatan (PPK) Sosa, Kab Padanglawas, Selasa (15/4) sore. Aksi massa tersebut mengakibatkan kerusakan dan hilangnya kotak suara yang belum terhitung. Sementara, seorang anggota Panitia Pemungutan Suara (PPS) terluka parah. Informasi Waspada himpun, peristiwa terjadi sekitar

pukul 15:30.Akibat kejadian itu, PPK terpaksa menghentikan perhitungan surat suara. Menurut sumber, sebelum diobrak-abrik, balai desa tersebut dilempari batu oleh massa.Kemudian,Ketua PPK Sosa Raja Mahmud Lubis bersama Camat Sosa Agussalim Nasution menghentikan perhitungan surat suara karena keamanan tidak kondunsif. Lalu, mereka bersama Kapolsek Sosa menggelar rapat tentang kelanjutan

penghitungan di ruang camat yang bersebelahan dengan balai desa. Namun, saat rapat berlangsung ratusan orang mendobrak dinding balai desa yang terbuat dari kayu dan kawat, kemudian mengobrakabrik dan merusak kotak suara yang belum dihitung. Massa juga melemparkan kotak suara ke luar ruangan. Se l a i n i t u , P P S D e s a Lanjut ke hal A2 kol 1

SDA Tuding DPW PPP Makar JAKARTA(Antara): Ketua Umum PPP Suryadharma Ali menyatakan pengajuan mosi tidak percaya kepada ketua umum, yang dilakukan oleh sejumlah Dewan Pimpinan Wilayah (DPW ), merupakan perbuatan melanggar AD/ART partai dan tindakan makar. “Jangankan 26 DPW, 1000 DPW pun untuk menjatuhkan ketum, itu bukan forumnya. Perbuatan itu melanggar AD/ART partai dan dikategorikan makar sehingga DPP PPP layak memberi sanksi,” kata Suryadharma Ali. Ia menegaskan mosi tidak percaya yang disampaikan oleh 26 Dewan Pimpiman Wilayah (DPW) itu tidak akan mampu melengserkan ketua umum partai itu. “Dalam Anggaran Dasar PPP, kalau mau menjatuhkan ketua umum, ada mekanisme, yaitu Muktamar Luar Biasa (MLB). Untuk menuju MLB diawali dengan Musyawarah Lanjut ke hal A2 kol 1 Waspada/Ali Amran

SALAH satu rumah warga Semadam, Agara, ambruk dihantam banjir bandang yang melanda dua kecamatan, Senin (14/4) malam. Delapan rumah hanyut dan rusak berat, satu jembatan ambruk dan ratusan rumah warga terendam paska meluapnya beberapa sungai di Agara.

125 Siswa Bolos UN Di Aceh Utara Dua Menikah Dan 1 Meninggal ACEH UTARA (Waspada): Sebanyak 125 dar i 7.216 peserta UN SMA di Kab. Aceh Utara, tidak mengikuti ujian (bolos) pada hari pertama. Dari 125 siswa yang bolos UN, dua orang di antaranya menikah dan 1 orang meninggal. Hal tersebut disampaikan Razali, Kadis Pendidikan, Pemuda dan Olahraga Aceh Utara didampingi Zulkarnaini, Sekretaris Ujian Nasional, Selasa (15/4) di ruang kerjanya. Kedua siswi yang menikah berasal dari SMA Negeri 2

Langkahan dan SMA Negeri 2 Baktya. Siswa meninggal dunia dari SMA Negeri I Matangkuli. Sedangkan dari SMA Negeri I Tanah Jambo Aye dikabarkan satu peserta UN tidak dapat mengikuti UN karena sakit. Sedangkan 121 siswa lainnya tidak hadir tanpa keterangan yang jelas dari pihak keluarga. Dan kata Zulkarnaini, 121 siswa itu dominan siswa yang tidak lulus UN tahun lalu. Kemungkinan, mereka tidak mengikuti UN pada tahun ini disebabkan ada

di antara mereka yang sudah bekerja atau karena alasan lainnya. Padahal nama-nama mereka telah didaftarkan sebagai peserta UN oleh pihak sekolah. Ketidakhadiran 121 siswa tersebut akan memmpengaruhi persentase kelulusan pada tahun ini. Bagi yang tidak hadir karena keterangan yang jelas seperti sakit dan dapat dibuktikan dengan surat keterangan dokter, maka kepada

Kadiskes Langkat Tersangka Dugaan Korupsi Jampersal Rp4,2 M STABAT (Waspada): Penyidik Polres Langkat menetapkan Kadis Kesehatan Kab. Langkat, dr. G bersama Bendahara SL dan Kasubag Keuangan Dinkes, SU, menjadi tersangka kasus dugaan penyimpangan dana Jampersal tahun 2012/2013 senilai Rp4,2 miliar. Penetapan itu diperoleh dari Kasi Pidsus Kejari Stabat, Ricardo Marpaung yang telah menerima surat pemberitahuan dimulainya penyidikan (SPDP) terhadap ketiga tersangka. “Kami menunggu berkas perkaranya,” ujar Ricardo ketika dikonfirmasi wartawan Selasa (15/4). Tentang berkas perkara tiga tersangka lain yang sebelumnya telah ditahan dalam kasus sama, menurut Kasi Pidsus, penyidik masih punya waktu 14 hari untuk meneliti dan mengecek berkas, apakah memenuhi unsur untuk disidangkan. Sementara itu Kapolres Langkat melalui Kasat Reskrim AKP Rosyid Hartanto yang dikonfirmasi, belum bersedia memberi penjelasan terkait tambahan tiga tersangka Lanjut ke hal A2 kol 7

Lanjut ke hal A2 kol 5

Al Bayan

Oleh: H. Ameer Hamzah Belumkah datang waktunya bagi orang-orang yang beriman, untuk tunduk hati mereka mengingat Allah dan kepada kebenaran yang telah turun kepada mereka...? (QS. al Hadid:16)

Lanjut ke hal A2 kol 2

waspadamedan.com Waspada Daily

@Harian_Waspada

Hari Kedua UN Di Medan

Naskah Soal Tertukar, Ratusan Siswa SMK Batal UN MEDAN (Waspada): Hari kedua pelaksanaan Ujian Nasional (UN) 2014, Selasa (15/4), tidak berjalan lancar seperti hari pertama. Ratusan siswa/i SMK sejumlah sekolah di Sumatera Utara batal mengikuti ujian karena naskah soal UN tertukar. “Ya benar ada, naskah soal UN tertukar, akibatnya sejumlah siswa SMK di beberapa sekolah di Sumut batal mengikuti ujian, “ kata Kepala Badan

Pengembangan Sumberdaya Manusia Pendidikan dan Kebudayaan & Penjaminan Mutu Pendidikan (BPSDMPK & P M P ) , P ro f Dr Sy a w a l Gultom MPd. Menjawab Waspada, di gedung Serba Guna Universitas Negeri Medan (Unimed), Selasa, (15/4) siang, Prof Syawal Gultom mengatakan, siswa/i SMK yang batal UN kemarin, akibat naskah tertukar, kembali mengikuti ujian

Puluhan Wanita Terjaring Polisi Syariah

Mata’ul Ghurur

BANYAK orang mengakui beriman dan bertaqwa kepada Allah SWT. Mereka mendirikan salat, puasa, bayar zakat, naik haji ke Baitullah, bahkan salat tahajjud tengah malam. Sehari-hari tampil dengan atribut-atribut keIslaman seperti memelihara janggut, bersurban, memakai peci, membaca khutbah, mengurus partai Islam. Terkesan memang sebagai seorang shaleh. Tetapi benarkah mereka shaleh dan sudah beriman sesuai yang dikehendaki syariah Allah? Tunggu dulu!

Waspada/Syarif Ali Usman

SEJUMLAH kotak suara yang dirusak massa berserakan di luar balai desa Sosa, Senin (15/4).

Waspada/Aldin Nl

PENASIHAT Presiden, HS Dillon, WaKIL Dubes AS, pengusaha nasional kelahiran Aceh, Abdul Latif, Gubernur Aceh Zaini Abdullah, Ketua DPR Aceh Hasbi Abdullah,Wali Nanggroe Aceh Malik Mahmud pada diskusi “ go invest in Aceh “ di hotel Four Seassons Jakarta, Selasa (15/4).

Aceh Tanpa Investor Sulit maju KSAD Jamin Keamanan JAKARTA (Waspada): Aceh tanpa kehadiran investor sulit maju dan berkembang. Sebab itu, berbagai cara dilakukan untuk menarik minat investor. Salah satunya melalui forum bisnis (basiness forum) yang

dilaksanakan Soegeng Sarjadi Syndicate, di Jakarta, Selasa ((15/4). “Kalau Aceh mau maju perlu kehadiran investor dan investor datang bila stabilitas politik dan keamaan terja-

min,” kata Sugeng Sarjadi. Ac a r a d i h a d i r i K S A D Jenderal TNI Budiman, Wakil Dubes Amerika Serikat, Dubes Iran, pelaku bisnis, pengusaha Lanjut ke hal A2 kol 2

BANDA ACEH (Waspada): Puluhan wanita terjaring razia penegakan qanun syariat Islam Aceh yang digelar Satuan Polisi Pamong Praja dan Wilayatul Hisbah di Banda Aceh, Selasa (15/4).Dari 59 orang pelanggar, satu di antaranya digiring ke kantor Satpol PP dan WH Aceh. Kepala Seksi Penegakan dan Penindakan Satpol PP dan WH Aceh Samsuddin mengatakan, kegiatan tersebut merupakan razia rutin untuk menegakkan Syariat Islam pasca pemilihan umum. Selain razia siang, Satpol PP dan WH menggelar razia pada malam hari. “Kemarin kan Pemilu jadi kami juga banyak kegiatan dan setelah Pemilu razia rutin kembali dilakukan baik siang maupun malam hari,” katanya. Menurut Samsuddin, pasca pengesahan qanun Nomor 7 tahun 2013 tentang Hukum Acara Jinayah oleh Pemprov Aceh 13 Desember April, pihaknya juga telah memiliki kewenangan menahan pelanggar Syariat Islam. Dengan demikian berbagai sanksi yang diatur dalam qanun akan diterapkan secara perlahan. Samsuddin marwan, jika selama batas waktu tersebut pelanggar tidak dapat dibina, maka Satpol PP dan WH akan melimpahkan kasus yang ditangani ke Mahkamah Syariah. Lanjut ke hal A2 kol 3

susulan 22 April 2014. “Kita jamin materi naskah soal UN bagi peserta UN susulan tidak bocor. Diapastikan aman, materi soalnya pun dipastikan tidak sama dengan sudah diujikan, “ kata Syawal didampingi Koordinator Pengawas UN Universitas Negeri Medan Prof Dr Khairil Ansari dan Kabag Humas Unimed, M.Surip. Lanjut ke hal A2 kol 1

Ada-ada Saja

70 Tahun Jadi Pelayan Bar SEORANG wanita berusia 100 tahun telah mengabdikan dirinya selama 70 tahun untuk menjadi pelayan bar tertua di dunia. Meski sudah sangat tua untuk bekerja sebagai pelayan bar, Dolly Saville, tidak berencana untuk pensiun.

Lanjut ke hal A2 kol 5

Serampang - Hai Partai Islam bersatulah ....! - He.... he....he....


Berita Utama

A2 SDA Tuding .... Kerja Cabang, Musyawarah Kerja Nasional. MLB harus mendapat dukungan 2/3 DPW dan cabang seluruh Indonesia,” kata Suryadharma di

Naskah Soal .... Horuan dan Desa Hapung yang masih berada di dalam balai desa dan dikawal pihak kepolisian ikut jadi sasaran massa, mengakibatkan Ketua PPS Desa Hapung Ali Amri mengalami luka 20 jahitan dan di rawat di Puskesmas Ujung Batu. Kepada Waspada, Ketua PPK Sosa Raja Mahmud Lubis mengatakan akibat aksi massa tersebut 12 kotak suara hilang,

Naskah Soal .... Dia menegaskan naskah soal UN yang tertukar adalah mata pelajaran matematika untuk siswa SMK dan terjadi di sejumlah SMK di Sumut, antara lain di Kab. Batubara, Padang lawas. Padang Sidempuan, dan Medan. “Hal itu diketahui, ketika label pada sampul naskah UN tertulis matematika SMK jurusan teknologi, namun setelah dibuka, ternyata isinya soal matematikanya SMK jurusan ekonomi bisnis atau sebaliknya, akibatnya siswa batal ujian, “ katanya. Prof Syawal menegaskan, pihaknya akan melakukan penelusuran.”Kita selidiki mengapa bisa tertukar. Dugaan semantara mungkin kelalain atau kurang telitinya petugas memasukkan naskah UN ke amplop,” ujarnya. Dia akan memanggil pihak percetakan untuk diminta penjelasan. Dia berharap, kasus tertukarnya naskah soal UN tidak terulang pada hari ketiga UN Rabu (16/4) dan UN SMP

39 TPS Di Sumut .... kata MP Nainggolan, 25 TPS di antaranya terdapat di Nias Selatan dan satu TPS di kabupaten induk (Nias). Untuk Kabupaten Nias sudah dilakukan pemungutan suara ulang pada Jumat (11/4). Sedangkan satu TPS di Nias sudah dilakukan pemungutan suara ulang pada Sabtu (12/4). Sementara 12 TPS lainnya sudah direkomendasikan oleh panitia pengawas pemilu (Panwaslu) untuk melakukan pemungutan suara ulang. MP Nainggolan mengatakan, 13 TPS lain yang tersebar di beberapa kabupaten/kota di Sumut, juga melakukan pemungutan suara ulang karena surat suara yang diterima tertukar antardaerah pemilihan (dapil) di Sumut. Di Kab. Labuhanbatu terdapat tiga TPS dan sudah melakukan pemungutan suara ulang pada Minggu (13/4). Kemudian satu TPS di Padangsidimpuan dan telah diulang pada Senin (14/4). “Sedangkan yang melakukan pemungutan suara ulang pada Selasa (15/ 4) masing-masing di Tanjungbalai satu TPS, Simalungun tiga TPS dan Medan lima TPS,” kata Nainggolan.

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. ...., Me1+. 2. Rh2, Mh4+. 3. Rg1 atau Mh3, MxBd8. Putih menyerah. Jawaban TTS: TTS

Kesehatan

Gedung DPP PPP di Jakarta, Selasa(15/4). Ia menyebutkan, alasan mosi tidak percaya pada dirinya tak lebih dari alasan yang dicari-cari seperti menghadiri 22 rusak dan yang masih utuh sebanyak 250 kotak. Sedangkan jumlah kotak suara secara keseluruhan sebanyak 284 kotak yang tersebar di 39 desa se Kec Sosa. Sementara kotak suara yang belum dihitung termasuk kotak suara Desa Horuon, Hapung, Hapung Torop, Handio, Mandian, Sosa Dolok, Pasir Jae, Pasar Ujung Batu, Aek Tinga dan Dua TPS di Desa Ujung Batu. (a34) nanti. Sebab, seluruh naskah soal tidak bisa diambil, bahkan dibuka sebelum ujian digelar. Kata Prof Syawal, meski ada sedikit gangguan pada hari kedua ini, namun, secara umum pelaksanaan UN 2014 di Sumut berjalan lancar. Bahkan, lebih baik dari tahuntahun sebelumnya. Dia menyarakan, kepada semua pihak, kalau mengetahui kebocoran soal atau kecurangan dalam pelaksanaan UN segera laporkan agar ditindak lanjuti sesuai aturan berlaku. Dia memastikan, kebocoran soal sulit terjadi karena pengawasan dan pengawalan begitu ketat. Selain itu, soal UN dibuat dalam 20 variasi sehingga menyulitkan para peserta yang ingin berbuat curang. Sedangkan untuk pemindaian lembar jawaban UN tingkat SMA dan sederajat masih untuk 10 kab/kota. Diharapan 25 April semua sudah rampung dan 20 Mei 2014 pengumuman UN akan dilakukan. Koordinator Pengawas UN Tentang terbakarnya 11 kotak surat suara di PPK Kec. Lolomatua, Nisel pada Senin (14/4) pukul 02:50, Nainggolan menyebutkan diduga sengaja dibakar oleh orang-orang tak bertanggung jawab. “Motifnya kita belum tahu karena pelakunya masih dalam penyelidikan. Tapi diduga sengaja dibakar,” kata dia. Dugaan itu muncul karena di lokasi kejadian ditemukan botol air mineral mengandung minyak tanah, juga kapuk. “Dari hasil pemeriksaan di TKP ditemukan bukti bahwa asal api dilempar melalui ventilasi jendela ruangan dengan menggunakan kapuk yang sudah diberi minyak tanah,” ujar Nainggolan. Dari 11 kotak surat suara yang terbakar, lima kotak suara berisi 1.171 surat suara yang sudah dicoblos hangus terbakar, sedangkan enam kotak lagi berisi 1.239 surat suara tidak terbakar, hanya kotaknya saja yang terbakar. (m27)

Aceh Tanpa .... nasional kelahiran Aceh, Abdul Latif (pemilik Sarinah), Ketua Apindo Sofyan Wanandi, Gubernur Aceh Zaini Abdullah, Ketua DPR Aceh, Hasbi Abdullah, Wali Nanggroe Aceh, Malik Mahmud, pelaku bisnis dan kalangan pengusaha Aceh di Jakarta dan pengusaha lokal, Makmur. Sofyan Wanandi membenarkan keamanan menjadi faktor yang menentukan minat pengusaha dalam berinvestasi. Namun jika pengusaha terlalu konservatif, akhirnya justru pengusaha sendiri yang rugi karena tidak bisa berkembang. “Pengusaha itu pengecut, paling takut keamanan. Kita tidak berani tanpa tahu persis risiko yang dihadapi,” kata Ketua Umum Asosiasi Pengusaha Indonesia (Apindo) Sofjan Wanandi pada sesi tanya jawab dipandu Hendri Saparina dari Center Of Reform Economics. Sebelumnya KSAD Jenderal Budiman menjelaskan, situasi keamanan di Aceh cukup kondusif. Dia mengakui belakangan ini ada ketegangan, ekses dari Pemilu Legistatif. Tapi, kata dia, secara umum keamanan Aceh relatif

Al Bayan ....

Jawaban Sudoku:

3 6 1 8 5 2 9 7 4

4 8 5 9 7 3 2 1 6

7 9 2 6 4 1 8 3 5

2 3 6 7 1 8 4 5 9

8 7 4 2 9 5 3 6 1

5 1 9 3 6 4 7 2 8

9 5 3 4 2 6 1 8 7

1 4 8 5 3 7 6 9 2

6 2 7 1 8 9 5 4 3

Rupanya masih jauh dengan kebenaran Alquranulkarim. Sebab mereka tertipu oleh nafsunya, mereka masih menolak hukum Allah dan membanggakan hukum taghut. Mereka masih hidup dengan riba dan menafikan etos kerja dan jual beli yang halal. Mereka menonton aurat di televisi dan anti-jilbab, masih berkiblat kepada budaya kaplat dan menganggap u s a n g b u d a y a b e r a d a b. Mereka masih menghalalkan yang haram dan mengharamkan yang halal. Mereka masih cinta dunia dan takut mati. Mereka yang terkesan shaleh saja ternyata masih jauh dengan keimanan, bagaimana dengan orang-orang yang hidupnya terang-te-

kampanye Partai Gerindra di Gelora Bung Karno. “Tidak ada etika yang saya langgar. Tidak ada aturan yang sayang langgar. Instruksi 1109 adalah untuk para caleg yang dilarang berkampanye dengan partai lain. Sementara saya adalah ketum dan tidak mencalonkan diri sebagai anggota legislatif,” katanya. Menghadiri kampanye Partai Gerindra, katanya, merupakan sebuah kehormatan dan memanfaatkan momentum. “Dalam politik, kehadiran saya adalah sebuah kehormatan. Saya bilang tepat saat hadiri kampenya Gerindra, Ini momentum. Universitas Negeri Medan Prof Dr Khairil Ansari menambahkan, semua persoalan, terkait pelaksaan UN akan dilaporkan ke Balitbang pusat. “Sejauh ini belum ada kita terima informasi patal terkait UN, dan kalau ada langsung kami teruskan ke Balitbang,” ucapnya. Menanggapi tertukarnya naskah soal UN tersebut, dia mengatakan, secara psikologi, bisa membuat konsentrasi siswa terganggu. Sementara itu, Ketua Panitia UN 2014 Sumut Henri Sirega ketika dikonfirmasi terkait banyak naskah soal UN SMK tertukar di sejumlah sekolah di Su m u t , m e n g a k u b e l u m mengetahu. “Saya belum tahu saya cek dulu ya,” katanya. (m49)

Rahudman ....

Hari Pertama Masuk Kerja

Bupati Deliserdang Pimpin Rapat Dengan SKPD Dan Camat LUBUKPAKAM (Waspada) : Hari pertama masuk kantor, setelah dilantik Gubsu H Gatot Pujo Nugruho menjadi Bupati dan Wakil Bupati Deliserdang, H Ashari Tambunan dan H Zainuddin Mars, Selasa (15/4) pagi, melakukan peninjauan ke seluruh ruangan kerja di Sekretariat Pemkab Deliserdang. Saat meninjau ruangan kerja para Kepala Bagian (Kabag), Bupati dan Wakil Bupati yang didampingi Sekdakab Drs H Asrin Naim, Asisten II H Redwin SH, Asisten III Drs H Rahmad Nasution MAP dan Kasat Pol PP Jannes Manurung SE dengan ramah menyalami dan berdialog kepada pegawai yang sedang melaksanakan tugas. Sebelumnya Bupati dan Wabup bersama Sekdakab Drs H Asrin Naim menggelar pertemuan bersamad Asisten I H Syafrullah S.Sos,MAP, Asisten II H Redwin SH, Asisten III Drs H Rahmad Nasution MAP dan Kadis PU Bina Marga Ir Faisal di Ruang Kerja Bupati di Lantai II . Setelah itu, Bupati H Ashari Tambunan dan Wabup H Zainuddin Mars menggelar

kasus korupsi Tunjangan Penghasilan Aparatur Pemerintahan Desa (TPAPD) Kab. Tapanuli Selatan tahun 2005 yang merugikan negara sebesar Rp1,5 miliar itu, terlihat Koordinator Pidana Khusus Kejatisu Hendrik Silitonga, Kasi I Intel Kejatisu Marcos Simaremare, Kasi III Intelijen Boby, Kasipenkum Kejatisu Chandra Purnama Pasaribu dan JPU Polem Siregar serta puluhan personil Brimobdasu. Rahudman dibawa menggunakan mobil Kijang Innova BK 789 OO.Sebelumnya, personil Brimobdasu dengan senjata posisi siaga membuat pagar betis mengawal keluarnya mobil yang membawa Rahudman dari rumahnya yang berpagar kuning keemasan. Koordinator Pidana Khusus Kejati Sumut Hendrik Silitonga, yang menjadi Ketua Tim Eksekusi Rahudman Harahap , menyatakan Wali Kota Medan nonaktif itu kooperatif dan tidak melawan saat dibawa ke Rutan Tanjung Gusta Medan untuk menjalani hukuman 5 tahun penjara. “Beliau (Rahudman) welcome menerima kami di rumahnya. Saat mau dibawa ke Rutan, beliau welcome dan langsung setuju,”kata Hendrik kepada wartawan usai menyerahkan Rahudman ke Rutan Ta n j u n g G u s t a M e d a n .

Hendrik menyatakan mantan Sekda Tapsel itu merupakan warga negara yang paling taat hukum. “Saya justru salut sama beliau. Tadi di mobil, kami pun duduk berdampingan dan berbincang-bincang. Anak dan istrinya juga welcome,” ujar Hendrik. Ditanya pengamanan eksekusi Rahudman yang melibatkan puluhan personel Brimob bersenjata lengkap dan didukung satu unit Baracuda, Hendrik menyatakan hal itu sesuai Protap (prosedur tetap) pengamanan yang ditentukan. “Itu standar pengamanan,” katanya. Sementara itu, Kepala Rutan Tanjung Gusta Toni Nainggolan mengatakan, Rahudman diserahkan ke Rutan sekitar pukul 12.50. Menurutnya, Rahudman ditempatkan di blok khusus Tipikor, yakni Blok A Kamar III bersama 9 tahanan dan narapidana korupsi lainnya, di antaranya Basyrah Lubis ( m a n t a n Bu p a t i Pa d a n g Lawas), Azzam Rizal (Dirut PDAM Tirtanadi) dan Ridwan Panjaitan (asisten pribadi Gubsu H Gatot Pujo Nugroho). “Rahudman menempati Blok A Kamar III, kapasitasnya 5 orang, namun saat ini terisi 10 tahanan,” katanya dan menambahkan, pihaknya telah memeriksa kesehatan Rahudman dan dinyatakan sehat.

baik dan salah satu provinsi yang aman untuk berinvestasi. Karena itu, KSAD berkomitmen membantu, menjaga dan menjamin keamanan Aceh bersama Polri agar kegiatan pembangunan berjalan lancar tanpa kendala dan investasi untuk kesejahetaran Aceh segera terwujud. Gubernur Aceh Zaini Abdullah berharap tidak ada lagi stikma bahwa kondisi Aceh tidak aman. Misalnya, isu tentang pelaksanaan Syariat Islam melanggar HAM, wanita asing harus pakai jilbab, harus dikhitan bila masuk Aceh, isu pertentangan pemerintah pusat dan Aceh dan soal gangguan keamanan. Informasi itu, sebut Gubernur, tidak benar dan tidak berdasar. Sampai saat ini, situasi di Aceh aman. “Kita sekarang membutuhkan investasi besar untuk membangun Aceh, dan stikma buruk menjadi kenangan,” katanya. Bagi Sugeng Sarjadi Syndicate, Aceh bisa menjadi model bagi investasi di seluruh daerah di tanah air bila membangun Aceh pasca konflik dan bencana tsunami. Sebelum forum business dibuka, HS Dillon, Abdulah

Latif, Gubernur Aceh, Ketua DPRA, Pangdam Iskandar Muda Pandu Wibowo, dan Sugeng Sarjadi, menggelar diskusi.yang antara lain perlunya bidang pertanian dan peternakan digalakkan untuk meningkatkan pendapatan masyarakat Aceh. Untuk percepatan investasi, Gubernur menyatakan, setidaknya ada 4 poin yang ditawarkan. Pertama, letak geografis Aceh sangat strategis di pintu Selat Malaka. Posisi ini menjadi pintu gerbang perdagangan ke berbagai tujuan seperti Afrika, Timur Tengah, dan juga Australia. Kedua, Aceh memiliki undang-undang dan aturan khusus yang pro terhadap investasi. Di antaranya adalah UU No 1/2006 tentang Pemerintahan Aceh yang memberikan kewenangan penyelenggaraan pemerintahan. Ketiga adalah kawasan pelabuhan bebas Sabang. Zaini meyakini pelabuhan itu akan menjadi pusat investasi ideal di masa depan. Keempat adalah sumber daya alam yang melimpah. Zaini mengatakan, berbagai komoditi pertanian, sumber daya laut, dan mineral mudah sekali didapatkan di Aceh. (b01)

rangan jauh dengan ajaran Islam. Misalnya dalam berpakaian, hiburan, bahkan dalam pandangan hidup mereka yang sekular? Mereka hanya mengaku Islam tetapi tidak pernah ke masjid. Mereka menghabiskan waktu di t e m p a t - t e m p a t h i b u ra n malam. Mereka mengaku Islam tetapi anti-hijab. Sebenarnya Allah telah mengingatkan mereka supaya jangan seperti orang-orang yang sebelumnya telah diturunkan al-kitab kepadanya, kemudian berlalulah masa yang panjang atas mereka, lalu hati mereka menjadi keras. Dan kebanyakan di antara mereka adalah orang-orang yang fasik. Padahal, kehidupan dunia ini penuh fatamorgana, per mainan, melalaikan,

sebagaimana firman Allah SWT yang kita kutip di atas. Dalam surat yang sama ayat 20 Allah berfirman: Ketahuilah, bahwa sesungguhnya kehidupan dunia itu hanyalah permainan dan suatu yang melalaikan, perhiasan dan bermegah-megah antara kamu serta berbanggabangga tentang banyaknya harta dan anak-anak, seperti hujan yang tanaman-tanamannya mengagumkan para petani, kemudian tanaman itu menjadi kering dan kamu lihat warnanya kuning, kemudian ia menjadi hancur. Dan di akhirat nanti ada azab yang keras dan ampunan dari Allah serta keridhaan-Nya. Dan kehidupan dunia ini tidak lain hanyalah kesenangan yang menipu.

rapat perdana dengan seluruh pimpinan SKPD dan 22 camat untuk menyatukan persepsi guna mensukseskan visi dan misi yang telah mereka sampaikan pada rakyat Deliserdang baik melalui sosialisasi pada masa pencalonan maupun di hadapan sidang paripurna DPRD. H Ashari Tambunan menyebutkan apa yang telah menjadi visi dan misi mereka (H Ashari Tambunan-H Zainuddin Mars) sudah merupakan janji kepada rakyat Deliserdang. ‘’ Karenanya visi dan misi harus menjadi acuan dalam proses perjalanan pemerintahan lima tahun ke depan,’’ kata Bupati. (a06)

125 Siswa Bolos .... siswa bersangkutan masih diberikan kesempatan untuk mengikuti UN susulan yang dilaksanakan, Senin (21/4). Namun, bagi mereka yang tidak pernah ikut, hingga UN berakhir tidak diberikan kesempatan kedua, kecuali mereka mengikuti pendidikan paket C tahun depan. (b18) “Dia sehat. Berkasnya pun lengkap,”katanya. Pengamatan di lapangan, pasca penahanan Rahudman, mulai pukul 13.00, anak-anak dan sejumlah kerabat Rahudman terlihat berkunjung ke Rutan Tanjung Gusta. Sejumlah PNS berseragam Pemko Medan juga terlihat di sana. Sebelumnya, Humas Pengadilan Negeri Tindak Pidana Korupsi, Nelson J Marbun SH, saat dikonfirmasi mengatakan telah resmi mengirimkan surat putusan MA ke masing-masing pihak. “Sudah dikirimkan pada Jumat kemarin.Begitu tiba langsung kita kirim. Itu dikirim Juru Sita pengadilan ke masing-masing, Kejaksaan Negeri Padang Sidempuan dan Kejaksaan Tinggi Sumatera Utara dan penasehat hukum terdakwa,” ujar Nelson Marbun. Namun, lanjut Nelson, tim penasehat hukum Benny cs enggan menerima surat salinan putusan dan mengatakan langsung saja kirim ke terpidana. Dalam putusan tim yudisial Hakim, Prof.DR Mohammad Askin,SH, MS Lumme, SH, DR Artidjo Alkostar, SH, LL.M, Panitera, berdasarkan amar putusan perkara dengan nomor register 236 K/PID.SUS/ 2014 menyatakan terpidana bersalah memvonis 5 tahun bui. Terpidana dijerat Pasal 2 ayat 1 Jo Pasal 18 Undang-undang nomor 31 tahun 1999 sebagaimana diubah Undangundang nomor 20 tahun 2001 Jo 55 ayat 1 ke-1 KUHPidana dengan denda sebesar 200 juta rupiah jika tidak dibayar maka denda itu digantikan hukuman 6 bulan kurungan dan uang pengganti sebesar Rp. 480 juta subsider 1 tahun penjara Rp500 juta serta uang penganti Rp480 juta kepada Rahudman.(m38)

Ada-ada Saja .... Saville, bekerja tiga hari seminggu di The Red Lion Hotel di Wendover, Buckinghamshire, Inggris. Nenek bercucu tiga orang itu mulai bekerja di bar tersebut sejak 1940, ketika usianya masih 26 tahun. Saat itu tahta Inggris masih dipegang oleh Raja George VI. Winston Churchill masih menjadi PM dan Inggris berada dalam kemelut Perang Dunia II. Selama tujuh dasawarsa terakhir dia melayani sejumlah orang terkenal, seperti Pierce Brosnan, Ted Heath, Stanley Matthews, Vera Lynn, Margot Fonteyn, dan Elizabeth Taylor. Sampai enam tahun lalu, Saville masih bekerja setidaknya enam jam sehari selama seminggu dan hanya pernah memiliki dua minggu cuti sakit. Sa a t i n i Sa v i l l e t e l a h mengurangi pekerjaannya menjadi tiga shift dalam seminggu, tapi dia masih menghabiskan berjam-jam untuk membersihkan meja, gelas, dan melayani para pelanggan. “Saya sangat mencintai pekerjaan saya, dan saya mencintai orang-orang yang datang ke bar, itu membuat saya jauh lebih baik daripada hanya duduk-duduk di rumah,” kata Saville, seperti dikutip oleh Orange, Selasa (15/4). “Saya tidak pernah berpikir akan bertahan selama ini, tapi saya sangat mencintai setiap menitnya. Keluarga saya terus bertanya apakah saya ingin berhenti? Tapi, saya tidak punya rencana untuk pensiun,” ungkapnya. (ok/r-m10)

127 Caleg ....

WASPADA Rabu 16 April 2014 orang ini bermula saat kedatangan M. Fairan ke TPS 34 untuk mencoblos. Saat Fairan berada di dalam TPS, salah seorang petugas curiga karena nama yang dipanggil usianya dinilai sangat berbeda jauh dengan orangnya. Saat diinterogasi, diketahui M. Fairan ternyata menggunakan surat suara atas nama Irfan Harahap berumur 20 tahun, sesuai daftar pemilih. Hal yang hampir sama juga dilakukan T. Saruma, 46, yang mencoblos di TPS 39. Dalam mencoblos, T. Saruma menggunakan kertas suara atas nama Susi Julanti Herawati Sinaga. Kedua orang tersebut langung dibawa ke kantor Panwas Kecamatan untuk dimintai keterangan. Dalam klarifikasi yang dilakukan petugas Panwaslu Kec. Percut Seituan, T. Saruma mengaku disuruh seseorang untuk mencoblos menggunakan kertas suara orang lain di TPS 39, dan disuruh memilih Caleg DPRD Kab. Deliserdang dari Partai Demokrat, Jaresman Sitanggang dengan imbalan uang Rp35.000. “Saya ditemui orang ber-

n a m a Nu r h a s a n a h y a n g menyuruh mencoblos Caleg dari Partai Demokrat atas nama Jaresman Sitanggang di TPS 39, dengan iming-iming diberi uang Rp35.000. Namun uangnya belum saya terima,” kata Saruma di hadapan petugas Panwaslu Kecamatan. Sedangkan M. Fairan yang diketahui warga Kel. Bandar Selamat Kec. Medan Tembung, disuruh seseorang untuk memilih Caleg PDIP dari Kab. Deliserdang, Syahminan Nasution. Ketua Panwaslu Kec. Percut Seituan Fahmi Itqam, didampingi anggota Edi Harahap mengatakan pihaknya seg era m eni n d ak lan j u t i laporan dari pihak PPL dan PPS, dengan memanggil pihak terkait guna dimintai keterangan, termasuk orang yang menyuruh Fairan dan T. Saruma .Hasilnya akan dilaporkan kepada Panwaslu Kab. Deliserdang. Hal sama dikatakan Ediaman Purba, SE dari Panwaslu Kab. Deliserdang devisi pengawasan, penindakan dan Humas. ‘’Temuan ini dapat dikatakan sebagai pelanggaran pidana,’’ kata Purba. (crul)

Dari razia sejak pukul 10:00 hingga 11:30 tersebut petugas menjaring sedikitnya 59 pengendara roda dua. Umumnya mereka yang terjaring karena mengenakan busana yang membentuk lekuk tubuh. “Ada satu wanita asal luar Aceh yang terpaksa kami bawa untuk dibina di kantor tadi. Tapi sudah kami lepas,” katanya. Selain wanita lima di antaranya laki-laki yang terjaring karena menggunakan celana pendek. Mereka diperkenankan melanjutkan perjalanan setelah diberi pembinaan di lokasi razia tepatnya di kawasan Lamnyoeng Jln. Teuku Nyak Arief. (cb06)

Kadiskes Langkat .... tersebut. “Nanti kita sampaikan ya,” janjinya. Dalam perkara pemotongan dana Jampersal, Polres Langkat telah menahan tiga tersangka yakni PO selaku Kabid Pelayanan Kesehatan Dinkes, drg. SO (Kepala Seksi yang membawahi program Jampersal) dan wanita SA, Bendahara Program Jampersal. Penahanan ketiganya setelah polisi melakukan operasi tangkap tangan (OTT) pada 20 Desember tahun lalu di Ruang Pelayanan Kesehatan Dinkes Langkat, dengan barang bukti uang tunai Rp1.652.165.000. Secara rinci Rp

1.350.000.000 disita dari meja t e r s a n g k a d r g . S O, R p 245.255.000 dari meja tersangka SA, Rp53.260.000 disita dari meja saksi Eva dan Rp 3.650.000 dari tangan saksi Maria. Dari total dana tersebut, Rp200 juta menurut penyidik telah disisihkan ketiga tersangka sebagai fee, dan masih ada ratusan juta rupiah bagian mereka yang belum sempat diamankan. Sebelumnya, Kadis Kesehatan dr. G membantah memerintahkan anggotanya memotong dana tersebut baik secara langsung mau pun tertulis. (a03)

Banjir Bandang ....

(Jamkesos) Dinas Sosial Aceh, Selasa (15/4) di Banda Aceh. Dikatakannya, bantuan yang dikirimkan untuk menjamin kebutuhan dasar bagi korban banjir. “Bantuan yang kita kirim sebagai tambahan buffer stok logistik yang sebelumnya telah dikirimkan ke Dinsosnakertrans Agara,” ujarnya. Bantuan yang dikirim Dinsos itu, berupa beras dua ton, mi instan 8.000 bungkus, kain batik panjang 498 lembar, selimut 300 potong, lauk pauk 500 paket, tenda gulung 50 lembar, air mineral, daster, kaus, baju anak, migor, kecap,

sarden, sambal dan gula. Burhanuddin menyebutkan berdasarkan laporan Koordinator Tagana Aceh Tenggara, banjir bandang yang melanda empat desa itu menyebabkan sekitar 2.500 warga saat ini mengungsi. “Informasi sementara 2.500 orang sudah mengungsi,” cetusnya. Desa-desa yang dilanda banjir di Kecamatan Semadam itu, Desa Pasar Puntung yang penduduk 736 jiwa atau 176 kepala keluarga, Desa Titi Pasir berpenduduk 986 jiwa atau 262 KK serta Desa Kampung Baru berpenduduk 649 jiwa atau 211 KK. (b06/b26)

Ketiga TPS, yakni TPS 34, 39 dan TPS 45, yang melakukan coblos ualng karena dalam Pemilu 9 April terdapat surat suara tertukar, khususnya untuk Caleg DPRD Kabupaten. Namun,dalam peristiwa itu, dua warga ditangkap petugas PPL bersama Panwas karena menggunakan surat suara orang lain. Informasi Waspada peroleh, pencoblosan ulang yang dilakukan pihak PPS berlangsung mulai pukul 07:30,setelah pihak PPS di tiga TPS tersebut melayangkan surat panggilan kepada sejumlah warga agar menggunakan hak pilihnya kembali. Dalam pelaksanaan pencoblosan ulang ini, panitia pengawas lapangan (PPL) bersama Panwaslu menangkap dua warga yaitu M. Fairan, 46, warga Kel. Bandar Selamat Kec. Medan Tembung , dan T. Saruma, 45, (wanita) warga Pa s a r 3 Ta n a h Ga ra p a n , Amplas. Ketua Panwaslu Kec. Percut Seituan, Fahmi Itqam didampingi Edi Harahap menjelaskan, tertangkapnya dua

Puluhan Wanita ....

ditemukan korban jiwa dalam insiden ini,namun kerusakan tempat tinggal warga cukup banyak. 2.500 Korban Banjir Mengungsi Dinas Sosial Aceh mengirimkan bantuan masa panik dan kebutuhan dasar untuk korban pengungsi banjir bandang, yang melanda sejumlah desa di Kecamatan Semadam, Aceh Tenggara. “Bantuan kebutuhan dasar untuk pengungsi kita berangkatkan siang ini dari Banda Aceh,” ungkap Burhanuddin, Kabid Jaminan Kesejehteraan Sosial


A2

Berita Utama

Kadis Kesehatan, Bendahara Dan Kasubag Keuangan Dinkes Langkat Jadi Tersangka STABAT (Waspada): Penyidik Polres Langkat menetapkan Kadis Kesehatan Kab. Langkat, dr. G bersama Bendahara SL dan Kasubag Keuangan Dinkes, SU, menjadi tersangka kasus dugaan penyimpangan dana Jampersal tahun 2012/2013 senilai Rp4,2 miliar. Penetapan itu diperoleh dari Kasi Pidsus Kejari Stabat, Ricardo Marpaung yang telah menerima surat pemberitahuan dimulainya penyidikan (SPDP) terhadap ketiga tersangka. “Kami menunggu berkas perkaranya,” ujar Ricardo ketika dikonfirmasi wartawan Selasa (15/4). Tentang berkas perkara tiga tersangka lain yang sebelumnya telah ditahan dalam kasus sama, menurut Kasi Pidsus, penyidik masih punya waktu 14 hari untuk meneliti dan mengecek berkas, apakah memenuhi unsur untuk disidangkan. Sementara itu Kapolres Langkat melalui Kasat Reskrim AKP Rosyid Hartanto yang dikonfirmasi, belum bersedia memberi penjelasan terkait tambahan tiga tersangka tersebut. “Nanti kita sampaikan ya,” janjinya. Dalam perkara pemotongan dana Jampersal, Polres Langkat telah menahan tiga tersangka yakni PO selaku Kabid Pelayanan Kesehatan Dinkes, drg. SO (Kepala Seksi yang membawahi program Jampersal) dan wanita SA, Bendahara Program Jampersal. Penahanan ketiganya setelah polisi melakukan operasi tangkap tangan (OTT) pada 20 Desember tahun lalu di Ruang Pelayanan Kesehatan Dinkes Langkat, dengan barang bukti uang tunai Rp1.652.165.000. Secara rinci Rp1.350.000.000 disita dari meja tersangka drg. SO, Rp245.255.000 dari meja tersangka SA, Rp53.260.000 disita dari meja saksi Eva dan Rp3.650.000 dari tangan saksi Maria. Dari total dana tersebut, Rp200 juta menurut penyidik telah disisihkan ketiga tersangka sebagai fee, dan masih ada ratusan juta rupiah bagian mereka yang belum sempat diamankan. Sebelumnya, Kadis Kesehatan dr. G membantah memerintahkan anggotanya memotong dana tersebut baik secara langsung mau pun tertulis.(a03)

Naskah Soal Tertukar, ... Dia menegaskan naskah soal UN yang tertukar adalah mata pelajaran matematika untuk siswa SMK dan terjadi di sejumlah SMK di Sumut, antara lain di Kab. Batubara, Padang lawas. Padang Sidimpuan, dan Medan. “Hal itu diketahui, ketika label pada sampul naskah UN ter0tulis matematika SMK jurusan teknologi, namun setelah dibuka, ternyata isinya soal matematikanya SMK jurusan ekonomi bisnis atau sebaliknya, akibatnya siswa batal ujian, “ katanya. Prof Syawal menegaskan, pihaknya akan melakukan penelusuran.”Kita selidiki mengapa bisa tertukar.Dugaan semantara mungkin kelalain atau kurang telitinya petugas memasukkan naskah UN ke amplop,” ujarnya. Dia akan memanggil pihak percetakan untuk diminta penjelasan. Dia berharap, kasus tertukarnya naskah soal UN tidak terulang pada hari ketiga UN Rabu (16/4) dan UN SMP nanti. Sebab, seluruh naskah soal tidak bisa diambil, bahkan dibuka sebelum ujian digelar. Kata Prof Syawal, meski ada sedikit gangguan pada hari kedua ini, namun, secara umum pelaksanaan UN 2014 di Sumut berjalan lancar. Bahkan, lebih baik dari tahun-tahun sebelumnya. “Hingga hari kedua ini, belum ada informasi mengenai hal-hal yang dapat mecederai pelaksanaan UN. Kalau isu soal kunci jawaban beredar itu setiap tahun ada, namun, semua bohong belaka artinya setelah diteliti tidak benar,” katanya. Bahkan, tahun lalu, lanjutnya, siswa/i yang percaya isu kunci jawaban disebarkan oleh pihak tidak bertanggung jawab mendapat nilai rendah.”Untuk itu, diingatkan kembali agar anak-anak tidak percaya terhadap isu kunci jawaban itu, karena itu selain tidak benar, juga menyesatkan, “ tukasnya. Dia menyarakan, kepada semua pihak, kalau mengetahui kebocoran soal atau kecurangan dalam pelaksanaan UN segera laporkan agar ditindak lanjuti sesuai aturan berlaku. Dia memastikan, kebocoran soal sulit terjadi karena pengawasan dan pengawalan begitu ketat. Selain itu, soal UN dibuat dalam 20 variasi sehingga menyulitkan para peserta yang ingin berbuat curang. Sedangkan untuk pemindaian lembar jawaban UN tingkat SMA dan sederajat masih untuk 10 kab/kota. Diharapan 25 April semua sudah rampung dan 20 Mei 2014 pengumuman UN akan dilakukan. Koordinator Pengawas UN Universitas Negeri Medan Prof Dr Khairil Ansari menambahkan, semua persoalan, terkait pelaksaan UN akan dilaporkan ke Balitbang pusat. “Sejauh ini belum ada kita terima informasi patal terkait UN, dan kalau ada langsung kami teruskan ke Balitbang, “ ucapnya. Menanggapi tertukarnya naskah soal UN tersebut, dia mengatakan, secara psikologi, bisa membuat konsentrasi siswa terganggu. Sementara itu, Ketua Panitia UN 2014 Sumut Henri Siregar ketika dikonfirmasi terkait banyak naskah soal UN SMK tertukar di sejumlah sekolah di Sumut, mengaku belum mengetahui. “Saya belum tahu saya cek dulu ya, “ katanya. (m49)

Pencarian MH370 ... “Bluefin-21 tidak mampu menyelesaikan misi pencarian pertamanya setelah melakukan pencarian selama enam jam, karena melampaui batas maksimum operasinya di kedalaman laut,” kata pernyataan AS. Kendaraan itu pulih dan layak untuk dioperasikan kembali setelah operasi enam jam pertama dan memberikan data yang kemudian diunduh. Jawaban Problem Catur, “Data dianalisis dan tidak ada obyek yang menarik yang TTS Dan Sudoku ditemukan,” kata pernyataan itu. “Kenda-raan ini dalam bahan Dari Halaman Sport. yang baik dan kondisi kerja.” Kapal selam yang dilengkapi sonar itu dikerahkan Senin maJawaban Problem Catur: lam dari kapal Australia Samudra Shield, yang telah mempelopori 1. ...., Me1+. perburuan MH370 yang hilang 8 Maret dengan 239 orang di atas 2. Rh2, Mh4+. kapal. (malaysiainsider/m10)

3. Rg1 atau Mh3,

Ada-ada Saja ...

MxBd8. Putih menyerah. Jawaban TTS: TTS

Kesehatan

Jawaban Sudoku:

3 6 1 8 5 2 9 7 4

4 8 5 9 7 3 2 1 6

7 9 2 6 4 1 8 3 5

2 3 6 7 1 8 4 5 9

8 7 4 2 9 5 3 6 1

5 1 9 3 6 4 7 2 8

9 5 3 4 2 6 1 8 7

1 4 8 5 3 7 6 9 2

6 2 7 1 8 9 5 4 3

orang itu mulai bekerja di bar tersebut sejak 1940, ketika usianya masih 26 tahun. Saat itu tahta Inggris masih dipegang oleh Raja George VI. Winston Churchill masih menjadi PM dan Inggris berada dalam kemelut Perang Dunia II. Selama tujuh dasawarsa terakhir dia melayani sejumlah orang terkenal, seperti Pierce Brosnan, Ted Heath, Stanley Matthews, Vera Lynn, Margot Fonteyn, dan Elizabeth Taylor. Sampai enam tahun lalu, Saville masih bekerja setidaknya enam jam sehari selama seminggu dan hanya pernah memiliki dua minggu cuti sakit. Saat ini Saville telah mengurangi pekerjaannya menjadi tiga shift dalam seminggu, tapi dia masih menghabiskan berjam-jam untuk membersihkan meja, gelas, dan melayani para pelanggan. “Saya sangat mencintai pekerjaan saya, dan saya mencintai orang-orang yang datang ke bar, itu membuat saya jauh lebih baik daripada hanya duduk-duduk di rumah,” kata Saville, seperti dikutip oleh Orange, Selasa (15/4). “Saya tidak pernah berpikir akan bertahan selama ini, tapi saya sangat mencintai setiap menitnya. Keluarga saya terus bertanya apakah saya ingin berhenti? Tapi, saya tidak punya rencana untuk pensiun,” ungkapnya. (ok/r-m10)

WASPADA Rabu 16 April 2014

Sidang Hari Jadi Provsu Dihadiri 30 Anggota Dewan

Gubsu: Berikan Pengabdian Terbaik Untuk Sumut Waspada/HM Husni Siregar

BUPATI H Ashari Tambunan dan Wabup H Zainuddin Mars didampingi Sekdakab Drs H Asri Naim dan para Asisten memimpin rapat dengan SKPD dan Camat, di Aula Cendana Kantor Bupati Deliserdang Lubuk Pakam,Serlasa (15/4).

H Ashari- H Zainuddin Pimpin Rapat Dengan SKPD Dan Camat LUBUKPAKAM (Waspada) : Hari pertama masuk kantor setelah dilantik Gubsu H Gatot Pujo Nugroho menjadi Bupati dan Wakil Bupati Deliserdang, H Ashari Tambunan dan H Zainuddin Mars, Selasa (15/4) pagi, meninjau ke seluruh ruangan kerja di Sekretariat Pemkab Deliserdang. Saat meninjau ruangan kerja para Kepala Bagian (Kabag), Bupati dan Wakil Bupati yang didampingi Sekdakab Drs H Asrin Naim, Asisten II H Redwin SH, Asisten III Drs H Rahmad Nasution MAP dan Kasat Pol PP Jannes Manurung SE dengan ramah menyalami dan berdialog kepada pegawai yang sedang melaksanakan tugas. Sebelumnya Bupati dan Wabup bersama Sekdakab Drs H Asrin Naim menggelar pertemuan bersama Asisten I H Syafrullah S.Sos,MAP, Asisten II H Redwin SH, Asisten III Drs H Rahmad Nasution MAP dan Kadis PU Bina Marga Ir Faisal di Ruang Kerja Bupati di Lantai II .

Setelah itu, Bupati H Ashari Tambunan dan Wabup H Zainuddin Mars menggelar rapat perdana dengan seluruh pimpinan SKPD dan 22 camat untuk menyatukan persepsi guna mensukseskan visi dan misi yang telah mereka sampaikan pada rakyat Deliserdang baik melalui sosialisasi pada masa pencalonan maupun di hadapan sidang paripurna DPRD. H Ashari Tambunan menyebutkan apa yang telah menjadi visi dan misi mereka (H Ashari Tambunan-H Zainuddin Mars) sudah merupakan janji kepada rakyat Deliserdang. ‘’ Karenanya visi dan misi harus menjadi acuan dalam proses perjalanan pemerintahan lima tahun ke depan,’’ kata Bupati. Menurut Bupati, amanah yang telah diberikan rakyat Deliserdang kepada dirinya bersama H Zainuddin Mars akan dijalankan dengan penuh tanggung jawab. Pada kesempatan itu, Bu-

pati menekankan kepada seluruh pimpinan SKPD dan para Camat untuk bekerja maksimal dengan penuh semangat dan keikhlasan. ‘’ Prinsip kalau bisa dipermudah mengapa dipersulit harus tertanam kepada diri kita sebagai abdi dan pelayan masyarakat,’’ imbuhnya. Dalam pertemuan itu, Bupati secara tegas menyebutkan di bawah kepemimpinannya bersama H Zainuddin Mars, mereka tetap melanjutkan apa yang telah dilakukan Drs H Amri Tambunan. Sementara itu, Wakil Bupati H Zainuddin Mars menekankan kepada seluruh pimpinan SKPD dalam menyusun program kerja agar mengacu kepada visi dan misi yang telah mereka tawarkan kepada rakyat Deliserdang. Melanjutkan, memantapkan dan meningkatkan pembangunan Deliserdang merupakan muara dari visi dan misi lima tahun ke depan yang harus kita capai. (a06)

SDA Tuding DPW PPP ...

PPP mengajukan mosi tidak percaya terhadap Ketua Umum PPP, Suryadharma Ali terkait kehadiran dirinya dalam kampanye Partai Gerindra beberapa waktu lalu. Namun, DPW PPP menegaskan tidak ada upaya penggulingan terhadap jabatan Suryadharma sebagai pimpinan partai berlambang Ka’bah itu. Ketua Dewan PimpinanWilayah PPP Jawa Barat, Rachmat Yasin mengatakan forum tersebut hanya sebatas protes dan bentuk kekecewaan atas keha-

diran Suryadharma pada kampanye parpol pesaing. “Yang mau menggulingkan (SDA) itu siapa? Kita hanya minta pertanggungjawaban ketua umum atas tindakannya,” ucap Rachmat di Kantor DPP PPP,Jalan Diponegoro , Menteng, Jakarta Pusat, Selasa (15/4). Dia menjelaskan, mosi tidak percaya dilakukan juga lantaran tidak ada klarifikasi dari Suryadharma atas tindakannya yang berujung pada kekecewaan para kader. (Ant/okz)

‘’ Kedua orang tersebut langsung kita bawa ke kantor Panwas Kecamatan untuk dimintai keterangan,’’ kata Fahmi. Saat klarifikasi di kantor Panwas Kecamatan, T. Saruma mengaku disuruh seorang berinisial Nur dengan menggunakan undangan orang lain di TPS 39, dan disuruh memilih Caleg DPRD Kab. Deliserdang dari Partai Demokrat atas nama Jaresman Sitanggang dengan imbalan uang Rp35.000. “Namun uangnya belum saya terima,” kata Saruma di hadapan petugas Panwas Kecamatan. M. Fairan warga Kel. Bandar Selamat Kec. Medan Tembung, mengaku disuruh seseorang untuk memilih Caleg PDIP dari Kab. Deliserdang atas nama Syahminan Nasution. Ketua Panwaslu Kec. Percut Seituan Fahmi Itqam, didampingi anggota Edi Harahap mengatakan pihaknya segera menindaklanjuti la-

poran dari PPL dan PPS, dengan memanggil pihak terkait guna dimintai keterangan, termasuk orang yang menyuruh Fairan dan T. Saruma . Hal samadikatakanEdiamanPurba,SE dari Panwaslu Kab. Deliserdang devisi pengawasan, penindakan dan Humas. ‘’Temuan ini dapat dikatakan sebagai pelanggaran pidana,’’ kata Purba. (crul)

“Jadi saya tidak perlu minta maaf kepada kader dan para caleg PPP soal tersebut,” imbuhnya. Di tempat yang sama, 26 DPW PPP menyampaikan mosi tidak percaya kepada Ketum PPP Suryadharma Ali. Alasannya, Ketuam menghadiri kampanye partai lain pada saat kader dan Caleg PPP berkampanye memenangkan PPP. Mosi Tidak Percaya Sebanyak 26 pimpinan DPW

Coblos Ulang Di DS, ... Namun, Panitia Pengawas Lapangan (PPL) bersama Panwaslu curiga terhadap dua warga yaitu M. Fairan, 46, warga Kel. Bandar Selamat Kec. Medan Tembung , dan T. Saruma, 45, (wanita) warga Pasar 3 Tanah Garapan, Desa Amplas. Ketua Panwaslu Kec. Percut Seituan, Fahmi Itqam didampingi Edi Harahap menjelaskan, tertangkapnya dua orang ini saat kedatangan M. Fairan ke TPS 34 untuk mencoblos. Namun, nama yang dipanggil usianya dinilai sangat berbeda jauh dengan orangnya. Saat diinterogasi, M. Fairan ternyata menggunakan surat suara atas nama Irfan Harahap berumur 20 tahun, sesuai daftar pemilih. Hal yang hampir sama dilakukan T. Saruma, 46, yang mencoblos di TPS 39. T. Saruma menggunakan nama Susi Julanti Herawati Sinaga.

Fenomena Gerhana Bulan ... dalam astronomi, sebutan itu hanyalah penamaan dari masyarakat. “Itu efek hamburan cahaya Matahari oleh atmosfer Bumi, ini biasa. Gerhana Bulan yang semula berwarna kuning karena ada hamburan itu sehingga jadi merah,” jelas Thomas, Selasa (15/4). Gerhana Bulan terjadi saat Matahari, Bumi, dan Bulan berada pada satu garis lurus. Bumi berada di antara Matahari dan Bulan. Dia menambahkan, gerhana ini secara maksimal hanya teramati di wilayah Pasifik dan Amerika saja. Untuk wilayah Indonesia, kata Thomas, hanya wilayah bagian timur yang dapat menikmati gerhana merah darah itu. “Wilayah Papua dan sekitarnya dapat melihat mengamati mulai Bulan terbit sampai akhir gerhana. Gerhana terjadi siang sampai sore saja, mulai 12.58 hingga 16.33 WIB atau 14.58 hingga 18.33 WIT,” ujar nya.(net/m46)

Soal UN Tentang Jokowi . .. guru-guru handal dan dosen-dosen berbagai perguruan tinggi terkemuka. Setelah melewati sekian seleksi dan revisi soal, naskah soal UN dicetak pada 24 Februari 2014. “Kita tidak merasa kecolongan, karena soalnya sudah dibuat sejak Juli 2013. Artinya, saat itu nama Jokowi belum muncul sebagai calon presiden,” tukas Musliar. Dijelaskan Musliar, dalam proses pembuatan soal, tim pembuat soal sudah memiliki kisi-kisi yang berasal dari BSNP. Penyusunan soal tersebut harus berpedoman pada kisi-kisi yang ada. Terkait munculnya soal tersebut, Ketua BSNP, Edy Baskoro juga berjanji akan mengeceknya lebih lanjut. Termasuk menelusuri mengapa soal yang dinilai tidak netral tersebut bisa masuk dalam soal-soal UN. Hal yang sama juga dikatakan Menteri Pendidikan dan Kebudayaan (Mendikbud) Mohammad Nuh. Ketika ditanya dalam kesempatan berbeda, dia menolak berkomentar lebih jauh terkait munculnya soal yang menggemparkan itu, termasuk kemungkinan potensi kebocoran soal UN. “Nanti saja komentarnya, kita akan cek dulu,” kata mendikbud. (dianw)

Al Bayan ... etos kerja dan jual beli yang halal. Mereka menonton aurat di televisi dan anti-jilbab, masih berkiblat kepada budaya kaplat dan menganggap usang budaya beradab. Mereka masih menghalalkan yang haram dan mengharamkan yang halal. Mereka masih cinta dunia dan takut mati. Mereka yang terkesan shaleh saja ternyata masih jauh dengan keimanan, bagaimana dengan orang-orang yang hidupnya terangterangan jauh dengan ajaran Islam. Misalnya dalam berpakaian, hiburan, bahkan dalam pandangan hidup mereka yang sekular? Mereka hanya mengaku Islam tetapi tidak pernah ke masjid. Mereka menghabiskan waktu di tempat-tempat hiburan malam. Mereka mengaku Islam tetapi anti-hijab. Sebenarnya Allah telah mengingatkan mereka supaya jangan seperti orang-orang yang sebelumnya telah diturunkan al-kitab

AS Bantah ... “Ini adalah teori konspirasi tidak berdasar yang sudah terbukti tidak benar di seluruh dunia dan Sekretaris Pers Gedung Putih secara khusus sudah mengutarakan ini 18 Maret,” kata Atase Pers Kedubes AS di Kuala Lumpur Harvey Sernovitz. Teori paling dikenal adalah bahwa Philip Woods, warga negara AS yang menaiki MH370 memposting sebuah foto yang diambil secara sembunyi-sembunyi melalui ponselnya yang kemudian diketahui lokasinya ada di Diego Garcia. (mi/nst/m10)

39 TPS Di Sumut ... Di Kab. Labuhanbatu terdapat tiga TPS dan sudah melakukan pemungutan suara ulang pada Minggu (13/4). Kemudian, satu TPS di Padangsidimpuan dan telah diulang pada Senin (14/4). “Sedangkan yang melakukan pemungutan suara ulang pada Selasa (15/4) masing-masing di Tanjungbalai satu TPS, Simalungun tiga TPS dan Medan lima TPS,” kata Nainggolan. Tentang terbakarnya 11 kotak surat suara di PPK Kec. Lolomatua, Nisel pada Senin (14/4) pukul 02:50, Nainggolan menyebutkan diduga sengaja dibakar. “Motifnya kita belum tahu karena pelakunya masih dalam penyelidikan. Tapi diduga sengaja dibakar,” kata dia. Dari 11 kotak surat suara yang terbakar, lima kotak suara berisi 1.171 surat suara yang sudah dicoblos hangus terbakar, enam kotak lagi berisi 1.239 surat suara tidak terbakar, hanya kotaknya yang terbakar. (m27)

kepadanya, kemudian berlalulah masa yang panjang atas mereka, lalu hati mereka menjadi keras. Dan kebanyakan di antara mereka adalah orang-orang yang fasik. Padahal, kehidupan dunia ini penuh fatamorgana, permainan, melalaikan, sebagaimana firman Allah SWT yang kita kutip di atas. Dalam surat yang sama ayat 20 Allah berfirman: Ketahuilah, bahwa sesungguhnya kehidupan dunia itu hanyalah permainan dan suatu yang melalaikan, perhiasan dan bermegah-megah antara kamu serta berbanggabangga tentang banyaknya harta dan anakanak, seperti hujan yang tanaman-tanamannya mengagumkan para petani, kemudian tanaman itu menjadi kering dan kamu lihat warnanya kuning, kemudian ia menjadi hancur. Dan di akhirat nanti ada azab yang keras dan ampunan dari Allah serta keridhaan-Nya. Dan kehidupan dunia ini tidak lain hanyalah kesenangan yang menipu.

MEDAN (Waspada): Peristiwa memalukan dipertontonkan anggota DPRD Sumut, saat digelar sidang paripurna istimewa memperingati hari jadi ke-66 Provinsi Sumut , Selasa (15/4). Rapat yang dipimpin ketua dewan H.Saleh Bangun, hanya dihadiri 30 dari 100 anggota dewan dan sidang sempat molor satu jam. Peringatan Hari Jadi Ke66 Provsu tahun ini mengambil tema ‘Dengan Hari Jadi Ke-66 Mari Satukan Tekad dan Berdaya Saing Menuju Masyarakat Sejahtera.’ Sementara Gubsu H. Gatot Pujo Nugroho, dalam sambutannya menyebutkan tema tersebut berkenaan dengan visi Sumut 2013-2018, yaitu ‘Menjadi ProvinsiYang Berdayasaing Menuju Sumatera Sejahtera.’ Untuk mewujudkan itu, menurut Gatot, diperlukan kesamaan persepsi dari seluruh komponen masyarakat Sumut terhadap tantangan yang dihadapi pada tahun-tahun mendatang.Juga adanya tekad yang sama dalam mengatasi tantangan tersebut. Berangkat dari motto Provinsi Sumut yakni, ‘tekun berkarya, hidup sejahtera, mulia berbudaya, maka telah dirumuskan misi pembangunan Sumut tahun 2013-2018. Visi tersebut, kata Gatot, diantaranya, membangun reformasi birokrasi secara berkelanjutan guna mewujudkan tata kelola pemerintahan yang baik dan bersih serta pelayanan publik yang prima. Membangun sumberdaya manusia yang memiliki integritas dalam berbangsa dan bernegara, relegius dan berkompetensi tinggi, membangun dan meningkatkan kualitas infrastruktur daerah untuk menunjang kegiatan ekonomi melalui kerjasama antar daerah, swasta, regional dan internasional. Seterusnya, meningkatkan kualitas stan-dar hidup layak, kesehatan dan keadilan serta mengurangi ketimpangan antar wilayah. Visi yang terakhir adalah membangun dan mengembangkan ekonomi daerah melalui pengelolaan sumber daya alam lestari berkelanjutan dan berwawasan lingkungan. Untuk seksesnya visi tersebut, Gatot mengajak semua pihak untuk memberikan pe-

ngabdian terbaik dan optimis, Provinsi Sumatera Utara akan menjadi pusat pertumbuhan ekonomi bagian barat. Menurut Gatot, keberadaan Kualanamu International Airport (KNIA), secara langsung akan mendukung Kawasan Ekonomi Khusus (KEK) Sei Mangke di Kab. Simalungun, sebagai wujud nyata pengembangan program nasional Masterplan Percepatan Perluasan Pembangunan Ekonomi Indonesia (MP3EI). Bahkan, pemerintah pusat berencana meningkatkan KNIA menjadi Bandara berkonsep aerotropolis. Yakni sebuah konsep Bandara yang terintegrasi dengan berbagai kawasan bisnis, sekaligus menjadi kota metropolis.

Peringatan Hari Jadi ke66 Provsu ditandai peluncuran buku Sumatera Utara Bangkit. Buku itu sebagai pedoman bagi aparatur dan masyarakat Sumut untuk membangun budaya kerja. Pada acara itu Pemprovsu memberikan penghargaan kepada mantan Gubsu, mantan Wakil Gubsu, mantan Ketua DPRD Sumut, dan mantan Sekdaprovsu. Hadir antara lain, Wakil Gubsu HT. Erry Nuradi, Sekdaprovsu Nurdin Lubis, unsure Forum Koordinasi Pimpinan Daerah Provsu, Kepala Perwakilan Bank Indonesia Wilayah IX, beberapa bupati dan walikota, mewakili DPR dan DPD RI, serta para undangan lainnya. (m12)

Rahudman Ditahan ... Hendrik menyatakan mantan Sekda Tapsel itu merupakan warga negara yang paling taat hukum. “Saya justru salut sama beliau. Tadi di mobil, kami pun duduk berdampingan dan berbincangbincang. Anak dan istrinya juga welcome,”ujar Hendrik. Ditanya pengamanan eksekusi Rahudman yang melibatkan puluhan personel Brimob bersenjata lengkap dan didukung satu unit Baracuda, Hendrik menyatakan hal itu sesuai Protap (prosedur tetap) pengamanan yang ditentukan. “Itu standar pengamanan,” katanya. Sementara itu, Kepala Rutan Tanjung Gusta Toni Nainggolan mengatakan, Rahudman diserahkan ke Rutan sekitar pukul 12.50. Menurutnya, Rahudman ditempatkan di blok khusus Tipikor, yakni Blok A Kamar III bersama 9 tahanan dan narapidana korupsi lainnya, di antaranya Basyrah Lubis (mantan Bupati Padang Lawas), Azzam Rizal (Dirut PDAM Tirtanadi) dan Ridwan Panjaitan (asisten pribadi Gubsu). “Rahudman menempati Blok A Kamar III, kapasitasnya 5 orang, namun saat ini terisi 10 tahanan,” katanya dan menambahkan, pihaknya telah memeriksa kesehatan Rahudman dan dinyatakan sehat. “Dia sehat. Berkasnya pun lengkap,”katanya. Pengamatan di lapangan, pasca penahanan Rahudman, mulai pukul 13.00, anak-anak dan sejumlah kerabat Rahudman terlihat berkunjung ke Rutan Tanjung Gusta. Sejumlah PNS berseragam Pemko Medan juga terlihat di sana. Sebelumnya, Humas Pengadilan Negeri Tindak Pidana Korupsi, Nelson J Marbun SH, saat dikonfirmasi mengatakan telah resmi mengirimkan surat putusan MA ke masing-masing pihak. “Sudah dikirimkan pada Jumat kemarin.Begitu tiba langsung kita kirim. Itu dikirim Juru Sita pengadilan ke masingmasing, Kejaksaan Negeri Padang Sidimpuan dan Kejaksaan Tinggi Sumatera Utara dan penasehat hukum terdakwa,” ujar Nelson Marbun. Namun, lanjut Nelson, tim penasehat hukum Benny cs enggan menerima surat salinan putusan dan mengatakan langsung saja kirim ke terpidana. Dalam putusan tim yudisial Hakim, Prof.DR Mohammad Askin,SH, MS Lumme, SH, DR Artidjo Alkostar, SH, LL.M, Panitera, berdasarkan amar putusan perkara dengan nomor register 236 K/PID.SUS/2014 menyatakan terpidana bersalah memvonis 5 tahun bui. Terpidana dijerat Pasal 2 ayat 1 Jo Pasal 18 Undang-undang nomor 31 tahun 1999 sebagaimana diubah Undang-undang nomor 20 tahun 2001 Jo 55 ayat 1 ke-1 KUHPidana dengan denda sebesar 200 juta rupiah jika tidak dibayar maka denda itu digantikan hukuman 6 bulan kurungan dan uang pengganti sebesar Rp 480 juta subsider 1 tahun penjara Rp500 juta serta uang penganti Rp480 juta kepada Rahudman. (m38)


Medan Metropolitan

WASPADA Rabu, 16 April 2014

A3

Dugaan Korupsi PLTA Asahan

Hari Ini Poldasu Periksa Humas PT PLN Sumut MEDAN (Waspada): Penyidik Tindak Pidana Korupsi (Tipikor) Poldasu akan memeriksa pejabat hubungan masyarakat (Humas) PT PLN Sumut terkait dugaan korupsi pembangunan base camp untuk akses ke PLTA Asahan III di Dusun Batu Mamak, Desa Meranti Utara, Kec. Pintu Pohan Meranti, Kab. Tobasa. Pemeriksaan akan dilakukan, Rabu (16/4) hari ini, sebagai tindaklanjut dari pemeriksaan mantan GM PT PLN Sumut Bintatar Hutabarat. “Rencananya besok diperiksa, masih sebagai saksi,” kata Kanit I Tipikor Dit Reskrimsus Poldasu AKP Wahyu Bram kepada wartawan, Selasa (15/4). Selain itu, penyidik Tipikor juga akan memeriksa seorang kepala desa di Tobasa. “Namanya belum bisa saya sampaikan, tetapi pada Rabu pejabat humas PTPLN, kemudian Kamis Kepdes diperiksa,” sebutnya. Penyidik Tipikor Poldasu sebelumnya menyebutkan, penahanan Bupati Tobasa Kasmin Simanjuntak yang sudah ditetapkan sebagai tersangka kasus itu, masih terkendala audit BPKP yang belum selesai, juga masih diperlukan keterangan saksi-saksi dari PT PLN. Poldasu juga masih membidik tersangka dari PT PLN Sumut. “Kemungkinan akan ada tersangka dari pihak PT PLN, karena mengetahui terjadinya korupsi, dan kemungkinan juga menikmati hasilnya. Namun ini masih di dalami,” tutur Wahyu. Menurut dia, untuk membuktikan itu, pihaknya masih mengumpulkan dua alat bukti, yaitu dokumen dan adanya aliran dana kepada yang dicurigai. Sementara itu, Kasubbid Pengelola Informasi dan Dokumentasi (PID) Humas Poldasu AKBP MP Nainggolan mengatakan, kasus korupsi pelepasan lahan seluas 9 Ha senilai Rp17 miliar di Dusun Batu Mamak yang menjadikan Bupati Tobasa sebagai tersangka masih terus ditelusuri. “Penyidik masih melengkapi bukti-bukti lainnya. Kasus korupsi tidak gampang, tidak seperti kasus kriminal lainnya, perlu bukti akurat seperti dokumen serta bukti aliran dananya. Juga saksisaksi yang menguatkan,” kata Nainggolan.(m27)

Dinkes Medan Segera Bayar Klaim JPKMS Waspada/Andi Aria Tirtayasa

DUA personel Polri sedang membawa FA ke dalam mobil patroli setelah tertangkap basah menggunakan surat C6 milik orang lain saat melakukan pencoblosan ulang di TPS 20 Kel. Cinta Damai, Kec. Medan Helvetia, Selasa (15/4).

Gunakan C6 Orang Lain

Tiga Pemilih Pesanan Diamankan MEDAN (Waspada): Tertangkap menggunakan surat undangan (C6) milik orang lain pada pencoblosan ulang di TPS 20 Kel. Cinta Damai, Kec. Medan Helvetia, seorang pria berinisial FA, 24, asal Sidikalang, Kab. Dairi, diamankan oleh petugas Panwas Kec. Medan Helvetia, Selasa (15/4). Tersangka FA, yang bermukim di rumah kos milik Timbul

Siahaan di Jln. Karya, Kec. Medan Barat, selanjutnya diboyong ke Polsek Medan Helvetia guna proses hukum. Informasi yang diperoleh, siang itu tersangka FA dan dua orang temannya masing-masing berinisial SS dan MP (wanita) datang ke lokasi tempat pemungutan suara (TPS) 20 untuk melaksanakan pencoblosan ulang di TPS 20 Kel. Cinta Damai, Kec. Medan Helvetia, dengan menggunakan surat suara milik orang lain. Dua pemilih SS dan MP sudah berhasil mencoblos tanpa diketahui oleh petugas. Namun, saat giliran FA dipanggil, petugas KPPS memeriksa surat C6 atas nama Arison Sihaloho. Dari hasil pemerik-

saan data-data nama pemilih, diketahui Arisona Sihaloho berusia 60 tahun lebih sedangkan FA masih muda sehingga menimbulkan kecurigaan. Petugas KPPS TPS 20 dan Panwas Kec. Medan Helvetia segera menginterogasi FA. Dari pengakuan FA, akhirnya diketahui bahwa mereka bertiga (FA, SS, dan MP) disuruh oleh seorang anggota tim sukses dari salah satu caleg di daerah pemilihan (Dapil) III tersebut berinisialVS. Selanjutnya, petugas Panwas Kec. Medan Helvetia dan Intel Polsek Medan Helvetia segera mengamankan FA ke kantor Camat Medan Helvetia. Di Percut Seituan Pada hari yang sama, petu-

gas Panwas Kec. Percut Seituan mengamankan dua pemilih yang menggunakan urat suara (C6) milik orang lain, saat pelaksanaan pencoblosan ulang di TPS 39 Dusun V dan TPS 34 Dusun IX Desa Sei Rotan. Seorang di antaranya sempat memasukkan suaranya ke dalam kotak suara, sedangkan seorang lagi diamankan saat akan melakukan pencoblosan. Kedua pemilih pesanan tersebut masing-masing berinisial MP, 69, warga Jln. Bersama, Kel. Bandarselamat, Kec. Medan Tembung, dan TS, 46, warga Pasar III Datuk Kabu Gang Raja, Desa Tembung, Kec. Percut Seituan. Informasi yang diperoleh di kepolisian, pemilih pesanan

berinisial MP diamankan di TPS 34, berawal sekira pukul 10:00, usai memasukkan pilihannya ke kotak suara. Sejumlah warga dan petugas KPPS TPS tersebut curiga dengan keberadaannya, apalagi warga tidak mengenalnya. Saat diinterogasi, MP mengaku disuruh seorang wanita berinisial A, 27, warga Desa Sei Rotan Gg Kutilang, agar mencoblos partai tertentu dengan Caleg nomor urut 2, dan diberi imbalan Rp50 ribu. Sedangkan TS diamankan di TPS 39 karena warga curiga dengan gerak-geriknya. Saat diinterogasi, TS mengaku disuruh oleh seorang wanita berinisial N, 47, warga Pasar 3 Datuk Kabu, Desa Tembung,

agar mencoblos partai tertentu dengan caleg nomor urut 1 dan diberi imbalan Rp35 ribu. Terpisah, Kapolsek Percut Se i t u a n Ko m p o l Ro n a l d Sipayung ketika dikonfirmasi membenarkan adanya dua pemilih pesanan yang menggunakan surat C6 milik orang lain. “Kedua pemilih pesanan itu masih menjalani pemeriksaan oleh pihak Panwaslu Kec. Percut Seituan,” sebutnya. Sementara itu, Komisioner Panwaslu Kec Percut Seituan Edi Harahap ketika dikonfirmasi membenarkan adanya pemilihan ulang di 3 lokasi dan diamankan dua orang pemilih menggunakan C6 milik orang lain. (h04)

Di TPS 15 Kelurahan Belawan Bahari

PKS, PBB Dan PKPI Tidak Mendapat Suara

Waspada/ Rustam Effendi

PETUGAS KPPS TPS 15 Kel. Belawan Bahari, Kec. Medan Belawan melakukan penghitungan pada pemungutan suara ulang di TPS tersebut, Selasa (15/4).

BELAWAN (Waspada): Pemungutan suara ulang khusus untuk DPRD Sumut I di TPS 15, Kelurahan Belawan Bahari, Kecamatan Medan Belawan, Selasa (15/4), berlangsung aman dan lancar. Proses pemungutan suara dimulai sejak pukul 07:00 hingga pukul 13.00. Berdasarkan hasil penghitungan yang dimulai sejak pukul 13:00, diketahui Partai Keadilan Sejahtera (PKS), Partai Bulan Bintang (PBB) dan Partai Keadilan Persatuan Indonesia (PKPI) tidak mendapatkan suara. Sedangkan, Partai Demokrat (PD) meraih suara terbanyak dengan jumlah 67 suara disusul Gerakan Indonesia Raya (Gerindra) 54 suara dan Partai Amanat Nasional (PAN) 46 suara. Dalam catatan Daftar Pemilih Tetap, yang berhak menggunakan hak pilih di TPS tersebut sebanyak 484 orang dan yang menggunakan hak pilih sebanyak 271 orang. Sedangkan suara sah sebanyak 268 dan tiga suara dinyatakan tidak sah. Ketua KPPS 15 Kel. Belawan Bahari, Asnaniwati Simbolon mengatakan, jumlah kehadiran warga dalam pemilihan ulang ini menurun jika dibanding dengan sebelumnya. “Pada pemilihan kemarin yang hadir sebanyak 303 orang, sedangkan hari ini hanya 271 orang,” katanya. (h03)

MEDAN (Waspada): Pihak RSU Dr. Pirngadi Medan (RSPM) mengatakan, Dinas Kesehatan (Dinkes) Medan berencana membayar klaim JPKMS yang tertunggak sebesar Rp6 milliar. Rencana pembayaran klaim itu, kata Wakil Direktur Bidang Administrasi Umum RSUD Dr. Pirngadi Syarifuddin Irsan Dongoran, sudah disampaikan Kadis Kesehatan Medan kepada pihak rumah sakit pekan lalu. “Sebelumnya, Dinkes Medan sudah membayar klaim secara bertahap. Dari total klaim sebesar Rp11 miliar, tinggal Rp6 miliar lagi yang tersisa. Surat pengajuan sudah masuk ke Bagian Keuangan Pemko Medan dan akan cair dalam waktu dekat,” ujar Irsan Dongoran, Selasa (15/4). Sementara itu, Kabag Hukum dan Humas RSPM Edison Peranginangin mengungkapkan, pembayaran klaim JPKMS ke RSPM masih dalam proses dan segera dicairkan. Berdasarkan penyampaian secara lisan yang diterimanya, klaim akan dibayar sekitar 2-3 hari mendatang. “Tapi saya rasa tidak akan lama lagi utang itu segera dibayar,” ucapnya. Menurut Edison, dana yang bakal diterima ini, tentu akan sangat membantu operasional rumah sakit. Karena hingga kini, masih banyak utang obat kepada pihak farmasi yang belum dibayarkan. Sedangkan, Kepala Dinas Kesehatan Kota Medan Usma Polita Nasution mengatakan, proses verifikasi klaim JPKMS sudah selesai dilakukan dan sudah diajukan ke Kabag Keuangan Pemko. “Biasanya paling lama seminggu pencairan. Jadi minggu depan klaimnya sudah cair,” jelasnya. (h02)

Pemilihan Pengurus HMJ PGMI Ricuh Mahasiswa Saling Lapor Polisi MEDAN (Waspada): Acara pemilihan pengurus Himpunan Mahasiswa Jurusan (HMJ) Pendidikan Guru Madrasah Ibtidaiyah di kampus Institut Agama Islam Negeri (IAIN) Jln. Pancing Medan, Senin (14/4) sekira pukul 13:00, berakhir dengan kericuhan. Seorang mahasiswa yang merasa tidak senang, melakukan pemukulan terhadap panitia penyelenggara Muhammad Zulfhadli, 20, hingga mengalami pendarahan pada hidung dan mulutnya. Informasi yang diperoleh di kepolisian, pemilihan pengurus HMJ PGMI tersebut dimenangkan oleh Torkis. Tiba-tiba seorang mahasiswa memukul wajah Muhammad Zulfhadli, yang merupakan anggota panitia, karena diduga merasa tidak senang dengan hasil keputusan tersebut., Tidak terima dipukul, Zulfhadli langsung mengadu ke Polsek Percut Seituan. Saat itu, Zulfhadli didampingi lima rekannya yang menjadi saksi atas pemukulan tersebut, masing-masing bernama Dani Hasibuan, Dedi, Soada Nasution, Jamil Nasution dan Iqbal., * Menurut pengakuan Soada dan Dani, korban dipukul pelaku tanpa sebab yang jelas. “Baru saja selesai pemilihan. Setelah tahu siapa yang menang, si Fhadli pergi mengawal ketua jurusan. Di situlah terjadi kericuhan. Fhadli dipukul oleh Muarif,” ujar Soada., Beberapa jam kemudian, setelah Zulfhadli membuat laporan pengaduan, Muarif yang merupakan lawannya, mendatangi kantor Polsek Percut Seituan untuk membuat laporan pengaduan. Muarif mengaku hendak mengadukan balik Zulfhadli karena telah mengeroyok dirinya dan teman-temannya. Ketika dikonfirmasi lebih jauh tentang pemukulan itu, Muarif tidak mau menjawab. “Nanti saja bang. Saya tidak mau berkomentar.” ujar Muarif. Kapolsek Percut Seituan Kompol Ronald Sipayung membenarkan laporan keduanya. “Laporan kedua mahasiswa tersebut tetap diterima. Untuk memastikan siapa yang benar, akan kita proses berdasarkan keterangan saksi-saksi dan keterangan dari keduanya,” tegas Ronald. (h04)

Oknum TNI Tipu Calon Istri MEDAN (Waspada): Petugas Polsek Medan Kota menangkap oknum TNI atas dugaan melakukan penipuan terhadap calon istrinya, di depan Mapolsek Medan Kota, Selasa (15/4). Penangkapan tersangka berinisial RA, 28, warga Marendal, yang telah disersi (lari dari kesatuan) dengan pangkat terakhir Prajurit Satu (Pratu) berlangsung dramatis karena oknum tersebut mencoba melarikan diri. Namun, kepungan empat personel Polsek Medan Kota membuatnya tak bergerak. Dia kemudian diamankan bersama sepedamotor Honda Beat BK 6939 VAG yang dikendarainya.

Menurut keterangan, oknum TNI itu diduga melakukan penipuan terhadap Sri, 30, warga Perumnas Mandala, karena meminta sejumlah uang. “Dia meminta uang Rp2 juta ke saya, katanya untuk mengurus surat-surat pernikahan kami di Kodam, sudah saya beri tapi dia minta Rp3 juta lagi,” kata Sri saat membuat laporan pengaduan di Polsek Medan Kota. Merasa ditipu, keluarga Sri membuat siasat dengan mengatur pertemuan untuk menyerahkan uang Rp3 juta itu di pusat perbelanjaan Jln. Sisingamangaraja Medan. Namun, pertemuan itu pindah ke warung persis di depan Polsek Medan Kota.

“Ini berhasil kami rekam sebagai bukti dia minta Rp3 juta untuk tambahan mengurus surat nikah itu, tapi saat orangtuaku minta penjelasannya dia mencoba kabur,” ujar Sri. Kini oknum aparat tersebut masih dalam pemeriksaan penyidik Polsek Medan Kota sembari menunggu Polisi Militer (PM) untuk menindaklanjutinya. Mengaku Khilaf Sementara itu, oknum TNI RA mengakui perbuatannya. Dia mengatakan khilaf dan siap menikahi Sri. “Saya serius dengan dia, saya siap menikahinya,” ujar RA. Selain itu, RA

membantah dirinya oknum aparat gadungan. Meski sudah empat tahun disersi, namun dia belum dipecat. “Saya sudah sidang militer satu kali tapi belum putus,” ujarnya yang mengaku telah bekerja sebagai sekuriti di Komplek CBD Polonia Medan. “Saya komandan regu disitu,” tuturnya. Kapolsek Medan Kota Kompol PH Sinaga melalui Kanit Reskrim AKP Faidir Chaniago mengatakan masih memproses kasus tersebut. “Masih terus diselidiki, anggota kita juga masih berkoordinasi dengan kesatuan yang bersangkutan,” kata Faidir.(m27)


Medan Metropolitan

A4

WASPADA Rabu, 16 April 2014

Masih Ada Warga Miskin Takut Ke RS

Dinkes Medan Harus Dievaluasi

Waspada/ Rustam Effendi

MANDI DI DEKAT TUMPUKAN SAMPAH: Dua bocah mandi di pinggiran pantai yang dipenuhi tumpukan sampah di sekitar Tempat Pendaratan Ikan (TPI) Bagan Deli, Kel. Bagan Deli, Kec. Medan Belawan, Selasa (15/4). Air pasang atau banjir rob yang sering melanda kawasan itu, membawa tumpukan sampah hingga ke pinggiran pantai. Salah satu penyebab semakin meluasnya wilayah genangan air laut diduga akibat penimbunan daerah resapan air (rawa-rawa) untuk dijadikan terminal peti kemas seperti di kawasan Kel. Bagan Deli dan Belawan Satu.

UN Berakhir

Siswa MA Sedekahkan Seragam MEDAN (Waspada): Ujian Nasional (UN) berakhir hari ini, Rabu (16/ 4). Siswa Madrasah Aliyah (MA) diingatkan menjadi contoh bagi siswa lainnya agar tidak melakukan aksi coret seragam sekolah. Hal ini disampaikan Kepala Kantor Kementerian Agama (Kakan Kemenag) Wilayah Provinsi Sumatera Utara Drs Abd Rahim, M.Hum, Selasa (15/

4). Menurutnya, dengan tidak melakukan aksi coret seragam sekolah berarti telah melakukan kebajikan pada diri sendiri karena melindungi pakaian dari hal yang kotor. “Lebih baik lagi memberi perlindungan kepada seragam sekolah tersebut dengan hal yang lebih bermanfaat yakni menyedekahkannya kepada yang memerlukan. Saya yakin masih banyak siswa kurang mampu yang membutuhkan pakaian sehingga menyedekahkannya dari siswa yang berkemampuan adalah tindakan arif dan bijaksana serta berpahala,” ujarnya.

Rahim juga mengingatkan agar siswa MA yang sudah menyelesaikan UN, tetap belajar sembari menunggu pengumuman kelulusan sebagai persiapan untuk Perguruan Tinggi. Tahun lalu, kata Rahim, berdasarkan laporan yang diterima dari Kabid Pendidikan Madrasah Drs. H. Tohar Bayoangin, MAg tercatat bahwa lulusan MA banyak yang masuk Perguruan Tinggi Negeri (PTN) di Medan maupun Pulau Jawa. Hal ini menjadi bukti kongkrit bahwa siswa madrasah punya kemampuan akademik yang bisa diperhitungkan dan mampu

bersaing dengan siswa lainnya. “Sebagai generasi Islam, siswa MA harus merasa punya tanggungjawab terhadap perbekalan ilmu yang mereka miliki dan diraih dengan mengikuti pendidikan berkelanjutan. Karena itu, usai UN harus tetap belajar dan mempersiapkan diri masuk jenjang PTN demi masa depan lebih baik,” ujar Rahim. Dia juga mengharapkan agar semua siswa MA yang ada di Sumatera Utara tetap menjaga almamater dan menghormati pihak sekolah jika akan melakukan kegiatan yang sifatnya perpisahan atau kegiatan lain sebagai luapan kegembira-

an usai melaksanakan Ujian Nasional. Komisi B Sementara itu, Ketua Komisi B DPRD Medan Landen Marbun, SH bersama anggota DPRD Medan Ir. Yahya Payungan Lubis mengunjungi SMAN 3 dan SMAN 4 saat berlangsung Ujian Nasional. Usai kunjungan, Landen Marbun menyebutkan, kegiatan UN berjalan lancar dan tidak ada kendala. Dia berharap kegiatan UN tahun ini akan lebih baik dari tahun sebelumnya dan menjadi tolak ukur bagi masingmasing sekolah yang akan mengembalikan siswa kepada

orangtua setelah mendapatkan ilmu yang cukup. “Dengan bekal ilmu itu, siswa akan mempunyai kesempatan melanjutkan pendidikan ke jenjang perguruan tinggi atau bekerja,” ujarnya.

MEDAN (Waspada): Kasus M Yunus Ramadhan, 8, penderita Tuberkulosis (TB) kelenjar, menjadi salah satu bukti masih ada warga miskin di Medan, yang takut untuk berobat ke rumah sakit. Akibatnya, sudah dua tahun mengidap penyakit itu, baru Sabtu (12/4), mendapat perawatan intensif di RS. Sehingga, leher pada bocah warga Jln. Melati, Kel. Sari Rejo, Kec. Medan Polonia, terus mengeluarkan nanah. “Kasus ini menjadi contoh kalau fungsi dari Puskesmas selaku jajaran Dinas Kesehatan (Dinkes) Medan sendiri belum maksimal, artinya mereka terkesan masih menunggu bola, bukan menjemput bola. Sesungguhnya, petugas Puskesmas banyak yang tahu (kasus si Yunus), tapi ini persoalan mental. Jadi, mereka masih menunggu masyarakat yang datang,” kata anggota DPRD Medan Bahrumsyah kepada Waspada, Senin (14/4). Menurut dia, saat ini Puskesmas masih terkesan fokus pada administrasi pasien yang ingin berobat, bukan sebagai pusat pelayanan. Dalam kasus ini, Dinkes Medan sendiri harus dievaluasi dan direformasi. “Masih banyak warga Medan yang miskin takut untuk berobat. Cobalah ke Puskesmas, sebagian arogansi petugas-petugas medis masih nampak di sana. Mereka lebih pada persoalan administrasi pada mengobati, artinya bukan pelayanan dulu yang didahulukan, tetapi administrasi yang dipertanyakan,” sebutnya. Kata Bahrum, penduduk Kota Medan masih ada yang mengalami persoalan administrasi kependudukan. “Orang-orang pinggiran inikan masih banyak yang tidak mengurus Kartu Keluarga (KK), dan orang-orang ini sangat rentan sekali kehilangan kartu identitasnya. Makanya, ketika ada orang yang mau berobat itu dicuekin, karena permasalahan administrasi tidak lengkap. Seharusnya, pihak Puskesmas peka terhadap persoalan ini,” ujarnya. Namun, ketika kasus itu menjadi konsumsi media atau komunitas publik baru rasa simpati itu muncul. “Jadi sebenarnya tidak harus sekelas wali kota yang datang ke rumahnya, baru bisa mendapat layanan kesehatan. Ini setelah pejabat turun baru sibuk semuanya. Maunya, pihak Puskesmas melaporkan kepada Dinkes Medan jika ada persoalan masyarakat miskin yang tidak terlayani,” tutur Bahrum. Maka dari itu, kata dia, Dinkes Medan harus diisi oleh orang-orang yang peka dan peduli kepada masyarakatnya. “Saya yakin masih banyak YunusYunus lain di Medan Utara yang terabaikan kesehatannya. Jadi saya minta Dinkes Medan ini jangan asik saja dengan urusan siapa yang memasok obat, mau merehab Puskesmas, dan lainnya,” ujarnya. Sementara itu, pengamat sosial Arifin Saleh Siregar SSos, MSP menuturkan, belajar dari kasus Yunus ini, maka Pemko Medan harus menginstruksikan kepada lurah dan keplingnya untuk mendata kembali orang yang nasibnya sama seperti Yunus. “Jangan karena temuan media, baru semuanya jadi heboh. Ini menjadi pintu masuk atau momen bagi Plt Wali Kota untuk memerintah lurah dan kepling mendata ulang wargawarganya,” katanya. Jika ditemukan ada kasus masyarakat miskin yang menderita sakit dan tidak mendapat pelayanan kesehatan di RS, segera laporkan ke atasannya. “Ini tanggungjawab pemerintah. Kepling sebenarnya ujung tombak ini, karena kepling yang mengetahui warganya,” tutur Arifin Saleh yang juga Ketua Prodi Ilmu Kesejahteraan Sosial Fisip UMSU ini. (h02)

Tidak Hadir Sebelumnya, Sekretaris panitia UN Disdik Medan Drs. Zulhanif menyebutkan untuk pelaksanaan UN hari kedua, ada 162 siswa yang tidak hadir.Yakni, IPA 69 siswa, IPS 92 dan Matematika Keagamaan 1 orang. “Mereka masih punya kesempatan untuk ikut ujian susulan,” ujarnya.(m37)

Kasus Penganiayaan Caleg

Besok Istri Anggota DPRD Sumut Diperiksa MEDAN (Waspada): Penyidik Polsek Medan Timur merencanakan akan memeriksa istri anggota DPRD Sumut berinisial An, Kamis (17/4) besok. Surat panggilan sudah dikirimkan kepada An yang diduga melakukan penganiayaan terhadap seorang caleg wanita pada kampanye pemilihan legislatif di Lapangan Gajah Mada, Kec. Medan Timur. “Surat panggilan terhadap An sudah dilayangkan dan Kamis (17/4), terlapor akan diperiksa,” sebut Kanit Reskrim

Polsek Medan Timur AKP Syarifur Rahman saat dikonfirmasi wartawan, Selasa (15/4), terkait kasus penganiayaan yang dialami caleg wanita Nur Asiyah Tanjung. Menurut Syarifur, dari hasil penyidikan sementara, setelah memeriksa saksi korban Nur Asiyah Tanjung, 43, dan seorang saksi lainnya, motif penganiayaan tersebut dilatarbelakangi cemburu. “Pelaku cemburu dengan korban (Nur Asiyah Tanjung), lantaran suaminya yang juga mencalonkan diri

sebagai caleg dengan korban di parpol itu pada pemilihan legislatif,” katanya. Syaifur mengaku, untuk saksi yang dimintai keterangan baru dua orang. Selanjutnya, dalam pekan ini dijadwalkan akan diperiksa lagi satu orang untuk lebih menguatkan. Disinggung apakah terlapor akan ditahan usai diminta keterangannya, dia belum bisa memastikannya. “Kita gelar dulu per-karanya untuk menentukan statusnya,” ujarnya.

Sebelumnya, Syaifur mengatakan, pihak terlapor sepertinya bakal ditetapkan sebagai tersangka dalam kasus ini. Pasalnya, tim penyidik yang menangani kasus ini tinggal melengkapi beberapa pemeriksaan saksi dan menunggu hasil visum dari rumah sakit. Sementara itu, Nur Asiyah Tanjung mengatakan, hingga saat ini pihak terlapor sama sekali tidak ada itikad baik atau menghubunginya untuk meminta maaf. “Belum ada. Biar sajalah dan

kita lihat perkembangannya di kepolisian,” sebutnya. Disebutkannya, oknum anggota DPRD Sumut berinisial PS juga tidak ada meminta maaf atas kelakuan istrinya. “Semua teman-teman di partai PAN sudah tahu kasus ini dan saya menunggu tindakan kepo-lisian,” katanya. Sebagaimana diberitakan sebelumnya, An, 47, istri dari anggota DPRD Sumut, dilaporkan Nur Asiyah Tanjung ke Polsek Medan Timur karena telah melakukan penganiayaan

dengan cara mencakar dan menyiram wajah korban menggunakan saus cabe saat kampanye di Lapangan Gajah Mada, Sabtu (5/4) sore. Akibat penganiayaan tersebut, korban mengalami luka cakar di bagian pipi sebelah kanan. Kasusnya sudah dilaporkan korban sesuai dengan bukti lapor bernomor LP/402/IV/14/ resta Medan/Sektor Polsek Medan Timur, tertanggal 5 April 2014 yang diterima Ka SPK Aiptu T Hutapea. (h04)

Waspada/Mursal AI

M. Yunus Ramadhan, 8, penderita TB kelenjar, mendapat perawatan di RSU Mitra Sejati Medan.


Medan Metropolitan

WASPADA Rabu, 16 April 2014

A5

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-280 12 Palembang GA-266 13. Batam GA-270 14. Penang GA-804 15. Pekanbaru GA-276 16. Tanjungkarang GA-270

05.20 09.05 11.00 12.20 13.25 14.05 17.00 18.35 20.35 09.40 10.45 06.00 10.25 10.55 06.00 10.25

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Palembang Batam Penang Pekanbaru Tanjungkarang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-143 GA-281 GA-267 GA-271 GA-805 GA-277 GA-271

08.00 08.55 10.15 11.20 13.05 16.00 17.30 19.35 22.10 12.35 19.05 15.45 18.00 13.20 08.45 18.00

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Bangkok 9 Bandung 10 Surabaya 11 Bandung 12 Penang 13 Pekanbaru 14 Singapura 15 Kuala Lumpur

QZ-8050 06.20 QZ- 8054 17.40 AK- 1351 08.00 AK-1355 17.55 QZ-8072 14.25 AK-1581 18.45 AK-1357 21.20 QZ-8084 14.15 QZ-7987 08.45 QZ-7611 13.15 QZ-7981 17.10 QZ-8078 06.25 QZ-8028 11.30 QZ-664 07.45 QZ-8052 13.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Penang Pekanbaru Singapura Kuala Lumpur

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-1580 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8079 QZ-8029 QZ-665 QZ-8053

08.30 10.55 07.35 17.00 16.35 18.30 21.05 16.40 11.30 09.55 19.55 08.35 12.50 10.35 15.55

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT-207 JT- 301 JT-395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.40 08.05 13.35 2010 18.00 20.40 19.30 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.05 17.20 17.50 19.45 10.25 15.55 09.20 18.25. 21.05 22.20 23.50 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur

MH-861 MH-865 NH-841

09.40 15.45 07.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur

MH-860 MH-864 MH-840

08.50 15.00 06.15

SILK AIR 1 Singapura 2 Singapura 3 Singapura

MI-233 MI-237 MI-235

08.40 20.35 13.15

Singapura Singapura Singapura

MI-234 MI-238 MI-236

07.35 19.50 12.20

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang 9 Jakarta

SJ-021 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021 SJ-017

13.15 15.55 16.50 10.20 17.20 12.50 07.20 16.00 08.05

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang Jakarta

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020 SJ-016

18.10 16.20 14.55 11.50 15.45 14.20 09.50 14.10 17.20

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

10.45

Jakarta

RI-093

08.55

Jadwal Perjalanan Kereta Api No KA

U28 A U30 A U32 A U34 A U27 A U29 A U31 A U33 A U37 A U38 A U39 A U40 A U41 A U42 A U43 A U44 A U35 A U36 A U45 A U46 A U47 A U48 A U49 A U50 A U51 A U52 A U53 A U54 A U55 A U56 A U57 A U58 A U59 A U60 A

Nama KA

SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SRI BILAH SIREKS SIREKS PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI PUTRI DELI SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA SRI LELA

Kelas

Dari

Tujuan

EKS/BISNIS BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS EKS/BISNIS BISNIS EKS/BISNIS EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI EKONOMI

MEDAN MEDAN MEDAN MEDAN RANTAU P RANTAU P RANTAU P RANTAU P SIANTAR MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TEBING T MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN

Berangkat

RANTAU P RANTAU P RANTAU P RANTAU P MEDAN MEDAN MEDAN MEDAN MEDAN SIANTAR MEDAN TANJUNG MEDAN TANJUNG B MEDAN TANJUNG B MEDAN TEBING TINGGI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI MEDAN BINJAI

07.47 10.17 15.44 23.03 07.52 14.58 17.18 23.13 08.08 14.30 07.50 06.49 13.06 13.11 19.36 17.33 05.42 18.44 05.46 05.02 07.14 06.30 09.15 08.30 12.18 10.00 13.53 13.09 16.49 14.37 19.00 18.16 21.40 20.56

Datang

13.56 15.46 22.02 04.38 14.04 10.17 22.55 04.47 11.54 18.24 12.54 11.11 18.01 17.45 00.29 22.24 07.42 20.57 06.15 05.31 07.43 06.59 09.44 08.59 12.47 10.29 14.22 13.38 17.18 15.06 19.29 18.45 22.09 21.25

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu

Kuala Namu- Medan

No. KA

No. KA

Berangkat

Diduga Lakukan Pelecehan Seksual

Lurah Gaharu Diadukan Ke Polisi MEDAN (Waspada): Diduga melakukan pelecehan seksual terhadap seorang warganya, oknum Lurah Gaharu, Kec. Medan Timur berinisial AJ dilaporkan oleh seorang

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

MANDALA AIRLINE 1 Singapura RI-861

Waspada/Rizky Rayanda

Warga dan kepala lingkungan di Kelurahan Tegal Sari Mandala mengangkat kabel listrik yang jatuh di tengah Jln. Denai Medan, Senin (14/4). Keberadaan kabel listrik itu mengganggu kelancaran arus lalulintas di ruas jalan tersebut.

Tiba KNIA

Berangkat KNIA Tiba Medan

U62 04:00 04:37 U61 05:05 06:50 U2A 04:50 05:27 U65 07:33 08:15 U4A 06:15 06:52 U1A 08:00 08:46 U6A 07:16 07:53 U3A 09:05 09:49 U8A 08:20 08:57 U5A 09:25 10:10 U10A 09:10 09:47 U7A 10:20 11:07 U12A 10:40 11:17 U9A 11:50 12:37 U14A 11:10 11:47 U11A 12:25 13:09 U16A 12:10 12:47 U13A 13:25 14:12 U18A 13:45 14:22 U15A 14:55 15:42 U20A 14:15 14:52 U17A 15:30 16:14 U22A 15:15 15:52 U19A 16:25 17:12 U24A 16:45 17:22 U21A 17:55 18:42 U26A 17:15 17:52 U23A 18:30 19:14 U66 18:15 18:52 U25A 19:56 20:40 U68 19:17 19:54 U67 20:40 21:17 U70 20:01 20:38 U69 21:15 21:59 U72 21:10 21:57 U71 23:30 00:07 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

janda beranak tiga ke Polresta Medan. Kepada sejumlah wartawan, Selasa (15/4), Dra Sri Yanti Nasution, 38, warga Jln. Gaharu Gang Parmin, Kel. Gaharu, Kec. Medan Timur, menuturkan, dugaan pelecehan seksual tersebut dilakukan AJ pada Januari 2014 lalu. Saat itu, korban ber-

sama anaknya dan temannya Erna, 37, warga Kec. Medan Marelan, mendatangi kantor Kelurahan Gaharu untuk mengurus surat ahli waris. Sesampainya di kantor kelurahan, Yanti bertemu dengan oknum lurah AJ. Di dalam ruang kerja oknum lurah tersebut, Yanti menjelaskan maksud dan tujuannya yakni untuk membuat surat ahli waris atas nama dirinya. Setelah beberapa lama berbincang, anak korban dan teman wanitanya ke luar dari dalam ruang kerja lurah karena akan memanggil tukang beca yang akan mengantarnya pulang. Namun, tiba-tiba saja oknum lurah tersebut mendekati dirinya dari belakang dan mencium lehernya. “Saat anak dan

teman saya keluar dari ruangan, tiba-tiba AJ menghampiri saya yang duduk beralaskan bantal. Dia duduk tepat di belakang saya dan dia mencium leher saya,” kata Yanti. Dia mengaku sempat berontak dan melawan. “Saya berontak dan bisa lepas. Lalu, saya marah-marah kok semudah itu bapak perlakukan saya, mentang-mentang saya janda,” sebutnya. SelanjutnyaYanti pun meninggalkan ruangan lurah tersebut. Beberapa hari kemudian, kata Yanti, saat dirinya berada di Medan Marelan, oknum lurah tersebut menghubungi dirinya via telepon seluler. Dalam perbincangan via telepon seluler itu, oknum lurah tersebut akan menjemput Yanti di Marelan.

Setibanya di Medan Marelan, AJ menghampiri dirinya. Setelah berbincang sebentar akhirnya AJ mengajak pulang dan keduanya pulang dalam satu mobil yang dikendarainya oknum lurah tersebut. Dalam perjalanan, keduanya pun berbincang-bincang. Lalu, AJ mengajak makan di salah rumah makan kawasan Jln. Bilal. “Setelah makan, kami pulang. Namun, entah di jalan mana dia memberhentikan laju mobilnya. Di situlah dia melakukan hal yang tidak jauh berbeda waktu berada di dalam ruang tamunya. Saya pun berontak minta pulang. Lalu saya tanya mengenai surat ahli waris saya, dia malah mengalihkan pembicaraan,” tutur Yanti. Tidak terima perlakuan

Poldasu Dalami Kasus Pemukulan Mantan Wakil Wali Kota MEDAN (Waspada): Penyidik Subdit III/Umum Dit Reskrimum Poldasu mendalami dugaan pemukulan dialami mantan Wakil Wali Kota Medan Ramli Lubis, dengan terlapor Ketua Kadin Sumut Ivan Iskandar Batubara. Pendalaman kasus itu dengan memeriksa dua saksi yang melihat peristiwa tersebut. “Kasusnya masih didalami, saat ini sudah dua saksi kita periksa. Kedua saksi mengaku melihat pemukulan itu,” kata Kasubdit III/Umum Dit Reskrimum Poldasu AKBP Rudi Rifani kepada wartawan di Mapoldasu, Senin (14/4). Tetapi, kata Rudi, pihaknya belum dapat menyimpulkan apakah Ivan Batubara sebagai

tersangka, karena masih dibutuhkan keterangan saksi-saksi. Namun, bila keterangan saksi mencukupi dan menyatakan adanya pemukulan, yang bersangkutan bisa dijadikan tersangka. “Kita lihat saja hasil pemeriksaannya nanti,” kata dia menyebutkan, jika keterangan saksi lengkap dan hasil visum menyatakan ada tindak kekerasan dialami Ramli Lubis, maka Ivan Batubara akan jadi tersangka. Menurut Rudi, hasil visum dari rumah sakit menyatakan Ramli Lubis mengalami kekerasan, dan menjadi salah satu petunjuk untuk dilakukan penyelidikan. “Visum sudah ada, ini salah satu petunjuk untuk dilakukan

penyelidikan,” ujarnya. Namun, Refman Basri SH, kuasa hukum Ivan Batubara mengatakan, berdasarkan keterangan kliennya, tidak ada pemukulan. “Saya sudah tanyakan kepada yang bersangkutan, tidak ada pemukulan,” kata Refman mengaku, pihaknya siap jika diminta keterangan penyidik Polda. “Siap, tentu kita siap, kami juga ada saksi-saksi yang melihat tidak adanya pemukulan itu,” sebutnya. Sebagaimana diketahui, dugaan pemukulan terhadap Ramli Lubis terjadi September 2013 di Lantai II Gedung Dit Reskrimum Poldasu. Saat itu, penyidik Subdit II/Harda Tahbang memanggil keduanya

untuk dilakukan konfrontir atas kasus peralihan lahan seluas 10 ribu Ha di Kab. Mandailing Natal (Madina), antara Ramli Lubis dan Ivan Batubara. Disebutkan, ketika istirahat pemeriksaan, Ramli Lubis pergi ke kamar mandi lantai II. Saat dia keluar kamar mandi, berpapasan dengan Ivan Batubara yang hendak masuk ke kamar mandi. Tiba-tiba Ramli Lubis menjerit, mengaku kepalanya dipukul Ivan Batubara. Ramli Lubis kemudian dibawa kuasa hukumnya ke rumah sakit untuk visum. Usai menjalani visum, dia mengadukan kasus itu ke Sentra Pelayanan Kepolisian Terpadu dengan nomor register LP/935/ IX/2013/SPKT.(m27)

oknum lurah tersebut, Jumat (11/4), Yanti mengadukan oknum lurah tersebut ke Polresta Medan dengan nomor laporan polisi STTLP/ 892/ K/ IV/ 2014/ Resta Medan. Dalam laporan itu, oknum lurah diduga telah melanggar Pasal 281 ayat 1 KUHPidana. Menanggapi tuduhanYanti, Lurah Gaharu Ahmad Juliansyah yang dikonfirmasi Waspada di ruang kerjanya membantahnya. “Tuduhan tersebut tidak benar. Silakan saja tanya kepada warga saya, apakah seorang lurah pantas melakukan hal itu atau tidak,” ujarnya. Kata Ahmad Juliansyah, Yanti memang pernah datang menemuinya untuk mengurus surat ahli waris. “Karena suratnya tidak diproses oleh Kepala

LingkunganVII Siti Rahma, tidak memenuhi persyaratan, maka saya tidak berani menandatanganinya,” sebutnya. Menurut dia, Kepala Lingkungan VII tidak berani menandatangan surat pernyataan karena sepengetahuan kepling tersebut orangtua Yanti masih hidup dan tinggal di kawasan Perumnas Helvetia. “Surat pernyataan ahli waris itu tidak ditandatangani kepling. Sebab, orang tuanya masih hidup cuma belum diketahui keberadaannya. Disebut-sebut orangtuanya tinggal di Perumnas Helvetia. Tapi dia malah buat surat ahli waris, ini kan jelas melenceng. Ini siasat dia saja untuk menggertak saya agar memuluskan proses surat ahli waris,” kata Juliansyah. (h04/m39)

Dikeroyok Sopir Taksi Ngadu Ke Polisi MEDAN (Waspada): Korban pengeroyokan sopir taksi Eduard Fransisco Hutapea, 24, warga Jln. Gaperta, Kel. Helvetia Tengah, Kec. Medan Helvetia, membuat laporan pengaduan ke Polsek Medan Helvetia, Senin (14/4). Informasi yang diperoleh di kepolisian, saat itu Eduard berboncengan sepedamotor dengan temannya mengisi bensin di SPBU Jln. Kapten Muslim. Saat temannya mengisi bensin, Eduard berjalan menemui sejumlah sopir taksi yang sedang mangkal di depan SPBU tersebut. Kemudian Eduard bertanya kepada seorang sopir taksi, alamat temannya bernama Budi yang dulu bekerja sebagai sopir taksi Blue Bird. Ternyata, sopir taksi yang ditanya korban tidak senang karena merasa terganggu atas pertanyaan korban. Akibatnya, keduanya bertengkar dan berakhir dengan perkelahian. Sopir taksi lainnya datang bukan melerai, melainkan ikut memukuli korban hingga mengalami babak belur. Setelah menganiaya korban, para sopir taksi itu kabur meninggalkan korban. “Awalnya aku isi bensin sepedamotor sama kawanku. Habis itu, maksud aku nanya kawan aku si Budi yang pernah jadi sopir taksi Blue Bird. Tiba-tiba sopir itu ngamuk, padahal sudah kubilang sama dia bahwa aku cuma bertanya aja. Malah dipukulinya aku rame-rame,” ujar Eduard kepada petugas Polsek Medan Helvetia.(h04)

Eldin Hadiri Raker Komwil 1 APEKSI Medan - Batam Jalin Kerjasama MEDAN (Waspada): Ketua Komisariat Wilayah I Asosiasi Pemerintah Kota Seluruh Indonesia (Komwil I APEKSI) Dzulmi Eldin menghadiri Rapat Kerja di Hotel Harmoni One Batam Centre Jln. Engku Putri Batam Centre-Batam, 16 - 18 April 2014. Kabag Hubungan Kerjasama Setda Kota Medan Rivai Nasution kepada Waspada, Selasa (15/4), mengatakan, Raker Komwil I APEKSI diikuti 24 wali kota se Sumbagut yakni Provinsi Sumatera Utara, Sumatera Barat, Provinsi Aceh, Provinsi Riau dan Provinsi Kepulauan Riau. Adapun 24 wali kota yang direncanakan hadir yakni Wali Kota Banda Aceh, Sabang, Lhokseumawe, Langsa, Subussalam, Payakumbuh, Padang, Padangpanjang, Sawahlunto, Solok, Pariaman, Bukittinggi, Medan, Pematangsiantar, Tanjungbalai, Tebingtinggi, Binjai, Sibolga, Padangsidempuan, Gunungsitoli, Pekanbaru, Dumai, Tanjungpinang dan Batam sebagai penyelengara. Acara ini dirangkaikan dengan pawai budaya, panggung kesenian dan ladies program dari masing-masing kota. Pawai budaya dimulai dari Simpang Mc Donald Nagoya menuju lokasi finish di Hotel Nagoya Plaza yang diikuti para wali kota bersama istri berjalan kaki dengan berpakaian daerah diiringi tim kesenian dan budaya dari masing-masing daerah. “Ada juga pertunjukkan seni budaya di Panggung Hiburan di Hotel Harmoni One Batam Centre yang menampilkan utusan dari masing-masing kota secara bergiliran,” katanya. Rivai mengatakan, Plt Wali Kota Medan sebagai Ketua Komwi I APEKSI akan memberi sambutan pada pembukaan Raker tersebut. Raker Komwil I APEKSI akan dibuka Menteri Dalam

Negeri. Pada diskusi juga akan dipaparkan tentang Implementasi UU No. 5 Tahun 2014 tentang Aparatur Sipil Negara (ASN) terhadap Penguatan Aparatur Pemerintah Kota. Menurut Rivai, salah satu isu yang akan diangkat tentang UU No. 5 Tahun 2014 tentang ASN yakni pasal 123 yang menyebutkan setiap PNS yang ingin maju pada Pilkada gubernur, wakil gubernur, wali kota, wakil wali kota, bupati dan wakil bupati harus mengundurkan diri dari PNS. “Pasal ini sangat menghambat karier PNS untuk menjadi Waspada/Ist pemimpin daerah, makanya ini akan dibawa dalam Raker dan Plt.Wali Kota Medan Dzulmi Eldin menerima penghargaan dari Kementeriaan Perhubungan merupakan rekomendasi di bidang ketertiban lalulintas, beberapa waktu lalu. kepada pemerintah pusat sehingga dilakukan judicial review agar pasal tersebut ditinjau Pemko Medan di bidang ekonomi, koperasi, UMKM, perdagangan dan industri. Kemudian, bidang kebudayaan dan kembali,” kata Rivai Dia menambahkan, pada Raker Komwil I Apeksi juga akan pariwisata, bidang promosi dan investasi, bidang pendidikan dilakukan penandatangan MoU antara Pemko Batam dengan serta pertanian dan kelautan. (m50)


A6

Medan Metropolitan

WASPADA Rabu 16 April 2014

Seminar Akbar Revolusi Belajar Bahasa Arab MEDAN (Waspada): Lembaga Terjemahan Bahasa Arab (LTBA) bekerjasama dengan Lafazh Book Jakarta akan mengadakan Seminar Akbar Revolusi Belajar Bahasa Arab, di Aula Kampus IAIN Sumatera Utara, Sabtu (19/4) mendatang. Ketua LTBA HMYusuf Sinaga Lc, MA, didampingi Humas Imam Pratomo MHI, Selasa (15/4) mengatakan, seminar akbar ini diadakan karena bahasa Arab merupakan bahasa yang sangat penting bagi umat Islam. “Hal ini dikarenakan bahasa Arab adalah bahasa Alquran dan al-Hadits. Oleh karena Alquran diturunkan dengan bahasa Arab, maka dirasa sangatlah penting guna memahami isi kandungan Alquran yang memang diturunkan menggunakan bahasa Arab,” kata Yusuf. Menurut dia, sebagai pembicara pada seminar tersebut adalah DR Syairozi Dimyathi MED (Alumni Universitas Al-Azhar Kairo, Penerjemah Kenegaraan & Penulis Buku) dan H Nanang Firdaus LC, MA (Alumni Universitas Al-Azhar Kairo, Penerjemah & Penulis Buku). “Kami dari panitia penyelenggara mengharapkan bagi siapa saja yang berkecimpung dengan bahasa Arab, agar ikutserta dalam seminar ini dengan biaya yang relatif murah hanya Rp50.000 per orang. Panitia memberikan fasilitas sertifikat nasional, makalah, snack/makan siang & buku. Bagi yang berminat dapat mendaftar kepada H Muhammad Yusuf Sinaga Lc, MA ( Direktur LTBA) Hp 082164045929, H Zulfahmi Lc, MA (Dosen Bahasa Arab IAIN-SU) Hp 081265569119, M Raja Perkasa Alam Hrp (Ka. Perpus PPMDH TPI Medan) Hp 085360663332, Sazli Inayah Sigalingging (Mahasiswa Seni Rupa Unimed) Hp 082361161807 dan Nazri Alwi Hp 085362710107,” tutur Imam Pratomo. (cwan)

Di PN Medan

Terdakwa Dihukum Percobaan, Keluarga Korban Ngamuk

Waspada/Rudi Arman

KANIT Turjawali Sat Lantas Polresta Medan AKP Rosmawati bersama anggota melakukan penindakan terhadap pengendara sepedamotor yang tidak memakai helm di Jln. Krakatau simpang Jln. Cemara Medan, Selasa (15/4).

179 Kendaraan Ditilang MEDAN (Waspada): Sat Lantas Polresta Medan kembali melakukan penindakan terhadap 179 pengendara sepedamotor di daerah pinggiran yang ada di wilayah hukum Polresta Medan, Selasa (15/4).

“Dari 179 pengendara yang ditilang dengan perincian helm 65, surat-surat 44, marka 15, rambu, terobos lampu merah, 50 SIM dan lain-lain 5,” kata Kasat Lantas Kompol M Budi Hendrawan. Ada empat titik ruas jalan

yang dilakukan penindakan atau razia yakni di Jln. Katamso/ Avros, Jln. Bilal, Jln. Alfalah simpang Jln. SM Raja, Jln. Cemara simpang Jln. Krakatau. Budi Hendrawan didampingi Kanit Turjawali AKP Rosmawati mengatakan, razia dilaksanakan khusus di daerah pinggiran karena masih banyak pengendara yang tidak memakai helm, menerobos lampu merah, dan melawan arus. “Pengendara yang melawan arus ini berpotensi kecelakaan lalulintas dan sangat rawan bagi pengendaranya maupun pengendara lainnya,” sebutnya. Bagi pengendara yang tidak bisa menunjukkan kelengkapan surat-surat, kendaraannya disita dan diboyong ke Sat Lantas Polresta Medan. “Yang tidak bisa

tunjukkan surat kendaraan, sepedamotornya kita amankan,” ujarnya. Razia ini, kata dia, merupakan atensi dari pimpinan agar Sat Lantas tetap melakukan razia agar pengendara di Medan, sadar akan tertib berlalulintas. “Jangan karena ada anggota Sat Lantas saja pengendara tertib berlalulintas, tapi begitu tidak ada polisi terus melanggar tertib berlalulintas,” tutur Budi. Menurut dia, budaya seperti ini harus ditinggalkan. “Ada polisi ataupun tidak ada, pengendara harus tertib berlalulintas,” katanya. Selain itu, siang maupun malam pengendara sepedamotor harus tertib berlalulintas. “Malam haripun kalau mengendarai sepedamotor ha-

Tersangka Trafficking Ajukan Prapid MEDAN (Waspada): Tersangka Evelin Purba, 58, warga Jln. Pertiwi Gg Bersama Medan, yang ditangkap dan ditahan atas dugaan melakukan tindak pidana perdagangan orang (trafficking) mengajukan pra peradilan (prapid). “Permohonan pra peradilan sudah didaftarkan ke Paniteraan Pengadilan Negeri (PN) Medan,” ujar Rahmad Sidik SH dan Husni Thamrin Tanjung SH selaku kuasa hukum tersangka Evelin Purba, usai mendaftarkan permohonan prapid di PN Medan, Selasa (15/4). Menurut Evelin Purba (pemohon) melalui Rahmad Sidik, alasan pengajuan pra peradilan dilakukan karena menilai penangkapan dan penahanan

terhadap pemohon tidak sah. Awalnya, pemohon ditangkap pada 30 Januari 2014 karena diduga melakukan tindak pidana Perdagangan Orang sebagaimana dimaksud dalam UU No.21 Tahun 2007. Namun, saat dibuat berita acara pemeriksaan (BAP) sebagai tersangka, pemohon tidak dikenakan pasal sebagaimana tercantum dalam surat perintah penangkapan, tetapi dikenakan UU No.23 Tahun 2002 tentang Perlindungan Anak. Dengan demikian, kata Rahmad, surat perintah penangkapan dan penahanan terhadap pemohon menjadi tidak sah. Sebab, pemohon ditangkap bukan berdasarkan UU No. 23 Tahun 2002 tentang Perlindu-

ngan Anak. Selain itu, menurut Rahmad, dalam pemeriksaan pemohon pada 30 Januari 2014 pukul 04:30 (sesuai BAP), dinyatakan ketika dilakukan pemeriksaan pemohon didampingi penasehat hukum bernama Untung Hariono SH. Padahal, pemohon tidak ada didampingi penasehat hukum tersebut dan saat pemeriksaan pemohon hanya dihadapkan pada pihak kepolisian. “Berdasarkan hal tersebut, maka pemohon mengajukan permohonan agar Ketua Pengadilan Negeri segera mengadakan sidang pra peradilan sesuai dengan hak-hak Pemohon menurut KUHAP pasal 77, 78 dan 79,” tambah Husni Thamrin. (m38)

rus memakai helm,” sebutnya. Dengan dilaksanakan

kegiatan tersebut, diharapkan dapat tercipta kamseltibcar

lalulintas dan kamtibmas di malam hari. (m39)

Baru Tujuh Klinik Berikan Layanan TB Sesuai DOTS M E D A N ( Wa s p a d a ) : Fasilitas kesehatan berupa klinik atau balai pengobatan di Sumut, masih minim memberikan pelayanan terhadap penderita Tuberkulosis (TB), sesuai standar DOTS (Directly Observed Treatment Shortcourse) atau pengawasan langsung pengobatan. Dari 1.628 klinik/balai pengobatan, baru 7 yang memberikan layanan sesuai standar DOTS. Begitu juga dengan RS swasta, dari 113 RS swasta, baru 24 RS swasta yang melayani pasien TB. “Dalam penanggulangan TB ini, Dinkes Sumut mengharapkan dukungan klinik atau dokter praktik swasta dalam penerapan standar pengobatan TB,” kata Kabid Penanggulangan Masalah Kesehatan (PMK) Dinkes Sumut dr NG Hikmet MKes, melalui Kasi Bimbingan dan Penangulangan Pencegahan Penyakit (Bimdal P2) Dinkes Sumut Sukarni SKM, Selasa (15/ 4). Begitu juga dengan dokter praktik swasta yang melayani pasien TB di Sumut, sangat minim. Hanya satu orang dokter praktik swasta spesialis dan tiga orang dokter praktik swasta umum yang melapor memberikan layanan TB sesuai standar

DOTS. “Untuk itulah, Dinkes Sumut mengadakan kegiatan atau workshop kepada dokter swasta agar melayani pengobatan TB yang berstandard ISTC (Internasional Standard TB Care),” ujarnya. Menurut Sukarni, agar pengendalian program TB di Sumut bisa berjalan lancar, dukungan dari dokter praktik swasta sangat dibutuhkan. Karena, berdasarkan evaluasi Riskesdas (Riset Kesehatan Dasar) 2010 dan Balitbangkes (Badan Penelitian dan Pengembangan Kesehatan) 2011, sebenarnya pasien TB banyak yang berobat ke praktik swasta. “Terutama untuk menemukan pasien TB MDR (Multidrug Resistant Tuberkulosis), yakni kasus TB yang sudah resisten dengan pengobatan TB lini pertama,” sebutnya. Dengan kerjasama dari dokter praktik swasta, diharapkan dapat menekan biaya kesehatan secara signifikan. Untuk kasus TB reguler, biaya yang dikeluarkan pemerintah untuk obat sebesar Rp400 ribu hingga Rp1,2 juta. Untuk kasus TB MDR, biaya yang dikeluarkan tak kurang dari Rp100 juta per kasus. “Dengan ditemukannya kasus TB lebih awal, peningkat-

an angka kematian juga dapat diturunkan dan kemungkinan kesembuhan TB MDR lebih kecil dibanding TB reguler,” tutur Sukarni. Pada peringatan hari TB sedunia kemarin, tema yang diangkat yakni ‘Temukan dan Sembuhkan TB’. Tema yang ditetapkan 24 Maret 2014 tersebut, intinya mendorong seluruh provinsi untuk memulai upaya menemukan, mengobati dan menyembuhkan serta meningkatkan akselerasi menuju Zero TB Death atau nol kematian TB. Kabid Penanggulangan Masalah Kesehatan (PMK) Dinkes Sumut Hikmet menambahkan, penyakit TB dapat disembuhkan bila minum obat secara teratur selama 6 bulan, dengan bantuan Pengawas Minum Obat (PMO) dan penderita mendapatkan gizi yang baik. “Namun, kalau pengobatan yang tidak sesuai standar atau tidak selesai minum obat TB sejak awal, maka kuman akan resisten terhadap obat di pengobatan lini pertama atau pengobatan yang biasa. Ini menyebabkan TB MDR. Pengobatan TB MDR lebih lama, sampai 18 bulan dengan pengobatan di lini kedua yang lebih mahal,” sebut Hikmet.

Pemprovsu Luncurkan Buku Budaya Kerja MEDAN (Waspada): Bertepatan dengan peringatan ulangtahun ke 66, Pemerintah Provinsi Sumatera Utara meluncurkan buku budaya kerja. Buku setebal 276 halaman berjudul Sumut Bangkit tersebut dilaunching Gubernur Sumatera Utara H Gatot Pujo Nugroho ST, MSi, di depan wartawan unit DPRD Sumut dan Pemprovsu, di Gubernuran Jln. Sudirman Medan, Selasa (15/ 4). Selain wartawan, kegiatan ini juga diikuti para kepala SKPD di jajaran Pemprov Sumut. Karena para SKPD nanti akan mengaplikasikan budaya kerja dalam kinerja sehari-hari melayani masyarakat. Buku berjudul ‘Sumut Bangkit’ ini, menurut Gubsu, merupakan tindak lanjut workshop budaya kerja di awal tahun 2014 lalu. Dalam buku ini Gubsu, Wagubsu, Sekdaprovsu dan seluruh SKPD di jajaran Pemprov Sumut merumuskan sebuah semangat baru yang akan menjadi budaya kerja. Melalui buku ini

Pemprovsu ingin mengubah pola pikir (mindset) dan budaya kerja (culture set) reformasi birokrasi di provinsi ini. Buku yang diserap dari buah pemikiran seluruh pejabat eselon II setingkat pimpinan satuan kerja perangkat daerah (SKPD) Pemprovsu itu disadur oleh tim Pemprovsu dan LMT Trustco. Untuk memperkaya khasanah buku yang berfokus pada membangun budaya kerja dengan berbasis nilai ini, Gubsu H Gatot Pujo Nugroho ST, MSi didampingi Wagubsu Ir HT Erry Nuradi MSi, Sekdaprovsu H Nurdin Lubis SH, MM selaku pengarah buku membuka diri untuk bedah buku tersebut dengan wartawan. Bedah buku yang dihadiri Editor BS Wibowo dari Trustco Jakarta, dan hampir seluruh pimpinan SKPD tersebut menyusul peluncurannya di Gedung DPRD Sumut pada acara HUT ke-66 Provinsi Sumut pada siang harinya. Gubsu memaparkan ten-

tang program reformasi birokrasi pemerintah sehingga akan terjadi perubahan pola pikir dan budaya kerja yang mendukung visi, misi, dan nilai-nilai organisasi serta kebijakan terkait dengan pembangunan budaya kerja. “Buku ini juga menjelaskan nilai-nilai organisasi, perilaku utama dan aspek lain yang terkait. Di bagian akhir buku ini diberikan inspirasi budaya organisasi yang berisi gagasan nyata atau contoh konkrit yang terkait dengan nilai-nilai yang relevan,” tutur Gubsu yang berharap buku ini bisa lebih dijabarkan dalam poin-poin yang lebih aplikatif dan mudah dioperasikan jajaran birokrasi Pemprovsu. Wagubsu Tengku Erry Nuradi di depan wartawan mengaku sangat bahagia, karena hadirnya buku ini akan menjadi refleksi dan cermin bagi para birokrat. “Ini bisa menjadi refleksi, cermin dan spirit baru kita di momen usia ke-66 Pemprov Sumut. Harus kita munculkan motivasi, spirit kita sebagai superteam,” katanya.

Waspada/Amir Syarifuddin

GUBSU Gatot Pujo Nugroho foto bersama Wagubsu HT Erry Nuradi, Sekda Nurdin Lubis, dan editor BS Wibowo pada peluncuran buku berjudul Sumut Bangkit, di Gubernuran Jln. Sudirman Medan, Selasa (15/4). Buku ini, menurut Sekdaprovsu Nurdin Lubis, merupakan sebuah capaian istime-

wa. Lepas dari sejumlah kekurangan, kata dia, sepanjang usia Pemprov Sumut baru kali ini ada

semangat menuangkan serta merumuskan budaya kerja dalam bentuk tertulis. (m28)

MEDAN (Waspada): Suasana tenang mendadak heboh di Pengadilan Negeri Medan, Selasa (15/4). Pasalnya, keluarga korban penganiayaan ngamuk dan coba menerobos masuk ke dalam ruang hakim karena majelis hakim hanya menghukum pelakunya Steven Manulang percobaan 3 bulan. Dalam persidangan yang digelar di Ruang Cakra V itu, majelis hakim yang diketuai oleh Agustinus beranggotakan Serliwaty dan Waspin Simbolon menghukum terdakwa Steven percobaan 3 bulan. Padahal, Jaksa Penuntut Umum (JPU) Irma Hasibuan menun-tut terdakwa 4 bulan penjara. Akibat putusan hakim itu, keluarga korban tidak terima lalu mengamuk dan mencoba menerobos ruang hakim. “Mau mengadu kemana kami? Pakai hati nurani kau hakim,” kata AJ Parapat, orangtua korban. Para pengunjung dan security yang melihat kejadian itu langsung menghadang keluarga korban untuk masuk ke ruangan hakim. Saling tolak menolak pun terjadi. Namun, satu perwakilan keluarga korban mencoba untuk berbicara kepada hakim ketua Agustinus. Meski satu perwakilan sudah diberi masuk, orangtua korban tetap meneriaki hakim tersebut. “Gak takut kau sama Tuhan ya. Saksi polisi udah ada, visum juga udah ada. Jaga hatimu hakim,” sebut Parapat. Suasana sedikit tenang setelah perwakilan itu keluar ruangan. Namun, majelis hakim tetap pada pendiriannya. Kepada wartawan, AJ Parapat selaku orangtua korban Victor Parapat mengatakan, kejadian penganiayaan itu pada April 2013 di dekat rumahnya Jln. Keruntung, Kec. Medan Tembung. “Masalahnya hanya lihat-lihatan. Terdakwa (Steven) yang preman kampung tidak senang dilihat anak saya (Victor). Terus anak saya dilempar selop, dibalikan anak saya lagi selopnya,” ujarnya. Karena tidak senang, Steven bersama temannya berinisial KS (DPO) mengeroyok Victor hingga luka lecet di bagian lehernya. “Harusnya masuk penjara lah. Kenapa jadi tahanan kota. Di Polresta Medan terdakwa ditahan satu hari,” tutur Parapat. (m38)

Warga Jatim Dirampok MEDAN (Waspada): Warsinem, 33, warga Dusun Tumpu, Desa Batok, Kec. Gemang, Kab. Madiun, Jawa Timur, bersama teman prianya WN Jepang Yoichi Hasgawa dirampok dua pelaku di depan Indomaret Jln. S. Parman Medan, Senin (14/4) malam. Akibatnya, Warsinem menderita luka-luka pada perlengan tangan dan siku tangan kiri akibat terseret ke aspal. Informasi Waspada peroleh di lapangan, korban bersama temannya usai berbelanja di Indomaret dengan berjalan kaki. Ketika hendak menyeberang jalan menuju ke tempat penginapannya di Hotel Grand Swiss Bell Jln. S Parman, tiba-tiba dua pelaku mengendarai sepedamotor merampok tas sandang yang dipegang korban. Akibat tarikan itu cukup keras, korban Warsinem terjatuh dan terseret ke aspal, hingga tas berisikan uang Rp7.500.000, dua handphone, kartu E-KTP, ATM BRI, tiket pesawat terbang Lion Air tujuan Medan–Surabaya dan lainnya dibawa kabur penjahat tersebut. Sedangkan temannyaYoichi Hasgawa,WN Jepang, melihat kejadian itu tidak bisa berbuat apa-apa. Satpam Hotel Grand Swiss Bell bersama warga melihat kejadian itu segera memberikan pertolongan terhadap korban. Setelah tamu hotel itu diobati pada luka-lukanya langsung dibawa ke Polsek Medan Baru membuat laporan pengaduan. Usai membuat laporan pengaduan, korban didampingi teman prianya WN Jepang itu melakukan visum di rumah sakit. Hingga kini pelakunya belum berhasil dibekuk. Selesai menjalani pemeriksaan, korban Warsinem didampingi Yoichi Hasgawa mengatakan, perampok itu beraksi cukup cepat. “Akibatnya, saya terjatuh dan terseret ke aspal karena mempertahankan tas, tapi pelaku tetap menarik tas hingga tasnya berhasil dibawa kabur mereka,” ujarnya. (m36)

Warga Harapkan Bantuan Pipa Distribusi Air Bersih MEDAN (Waspada): Ketua Umum Forum Wartawan Peduli Air Sumatera Utara (Forwara) mendesak Dinas Tarukim Sumut khususnya Dinas Tarukim Kota Medan membantu kesulitan warga untuk mendapatkan air bersih. Ketua Forwara Sumut Alian Nafiah Siregar, Selasa (15/4), menyebutkan, bantuan berupa pipa untuk mendistribusikan air bersih dari Dinas Tarukim Sumut maupun Dinas Tarukim Kota Medan sangat dibutuhkan warga. “Tanpa adanya bantuan pipa tersebut, warga akan kesulitan mendapatkan air bersih. Karena yang dikeluhkan warga saat ini biaya distribusi air sangat besar,” tegas Alian Siregar. Menurut Alian, besarnya biaya pipa untuk distribusi air bersih ke rumah warga dapat diminimalisir jika Dinas Tarukim Sumut maupun Dinas Tarukim Kota Medan dapat menyediakan pipa tersebut. Sedangkan pihak PDAM Tirtanadi selaku penyedia air bersih dapat membantu warga untuk mengalirkan sumber air bersihnya melalui jaringan pipa tersebut ke rumah warga. Alian menyebutkan perlu adanya kerjasama yang baik antara Dinas Tarukim Sumut maupun Dinas Tarukim Medan dengan PDAM dalam pengadaan pipa dan air bersih untuk warga. Dengan adanya kerjasama yang baik antara kedua instansi pemerintah ini, kesulitan warga akan air bersih bisa terselesaikan dengan cepat. Menurut Alian, pihaknya banyak mendapat pengaduan dari warga yang ingin mendapatkan air bersih dari PDAM Tirtanadi. Namun karena ketiadaan pipa distribusi menyebabkan masyarakat sulit untuk memperoleh air bersih. Sebagaimana informasi yang diterima, kata Alian, daerah yang airnya cukup bagus dengan debit air di atas 03 antara lain Jln. Jermal dan sekitarnya, kawasan Medan Denai, Medan Amplas, Medan Sunggal, Jln. Sei Mencirim, kawasan Diski, Delitua, Medan Tembung, Lubukpakam, Labuhandeli dan Medan Labuhan. Alian juga mendesak agar kerjasama Dinas Tarukim Sumut dan Dinas Tarukim Kota Medan dengan PDAM Tirtanadi segera terwujud untuk pengadaan jaringan pipa distribusi air bersih. Di sisi lain, PDAM Tirtanadi diminta tidak mempersulit warga yang membutuhkan air bersih.(m30)


Nusantara

WASPADA Rabu 16 April 2014

A7

AirAsia Luncurkan Tiga Rute Internasional Baru Dari Johor Bahru SEPANG (Waspada): AirAsia hari ini mengumumkan peluncuran tiga rute internasional terbaru dari hub Johor Bahru yang akan menghubungkan kawasan selatan Malaysia menuju 2 kota di Indonesia yaitu Yogyakarta (4x seminggu) dan Lombok (3x seminggu). Selain itu, AirAsia juga akan meluncurkan rute penerbangan langsung dari Johor Bahru menuju Ho Chi Minh City (4x seminggu). Adapun ketiga rute tersebut akan dioperasikan oleh AirAsia Malaysia (AK). Peluncuran tiga rute internasional ini akan memberikan pilihan yang lebih beragam bagi masyarakat Johor Bahru yang hendak bepergian ke tiga kota tersebut tanpa harus melakukan transit di Kuala Lumpur terlebih dahulu. Dalam rangka merayakan peluncuran rute internasional terbaru dari Johor Bahru menuju Yogyakarta, Lombok dan Ho Chi Minh City, AirAsia menawarkan harga promosi mulai

dari Rp 0 untuk tanggal pemesanan mulai 15 – 20 April 2014 dan periode perjalanan mulai 11 Juli 2014 – 30 April 2015. Penawaran harga spesial itu saat ini telah tersedia di website www.airasia.com dan aplikasi mobile AirAsia yang dapat digunakan dari perangkat iPhone, Android, Blackberry Z10, dan Windows Phone. Head of Commercial AirAsia Malaysia, Spencer Lee mengatakan, Johor Bahru adalah salah satu hub terpenting AirAsia di Malaysia. Kami melihat potensi yang dimiliki oleh kota ini khususnya dalam pengembangan rute internasional. Peluncuran 3 rute penerbangan terbaru dari Johor Bahru menuju Yogyakarta, Lombok dan Ho Chi Minh City merupakan bentuk komitmen kami dalam mengembangkan konektivitas dari dan menuju negara bagian selatan Malaysia. Kami berharap dapat terus menghadirkan ruterute terbaru di masa mendatang seiring dengan dukungan besar

Cawapres ARB, Golkar Dekati PKB, PKS Dan Hanura JAKARTA (Waspada): Meski belum ada partai yang memutuskan untuk koalisi untuk Pilpres 9 Juli 2014 mendatang, namun tiga partai (PDIP, Golkar dan Gerindra) terus gerilya untuk mencari pasangan cawapres. Ketua Umum DPP Golkar Aburizal Bakrie (ARB) pun kini sedang menimang-nimang cawapres dari Hanura, PKB dan PKS. “Kemungkinan Cawapres ARB dari tiga partai, yaitu Hanura, PKB dan PKS. Apalagi, dari tiga cawapres itu hanya satu. Nggak enak dengan yang dua, sehingga Golkar tidak enak menyebut nama itu, rasanya tidak etis kalau disebutkan sekarang,” tegas Ketua DPP Golkar Hajriyanto Y Thohari pada wartawan di Gedung DPR RI Jakarta, Selasa (15/4). Menurut Wakil Ketua MPR RI itu, nantinya bangunan koalisi itu akan kuat dengan tiga partai tersebut. Pembicaraan juga sudah kian intensif dilakukan dengan ketiga parpol itu. “Koalisi Golkar dengan Hanura, PKB dan

PKS itu angkanya sudah di atas 40 persen,” tambahnya. Dengan demikian, lanjut Hajriyanto, kandidat cawapres sudah kian mengerucut ke tiga nama, yaitu Hanura, PKB dan PKS. Tiga nama itu akan segera diumumkan awal Mei. “Mudah-mudahan sebelum 3 Mei 2014, karena kira-kira 3 Mei. Golkar akan menyelenggarakan Rapimsus,” kata Hajriyanto. Dia juga enggan menyatakan siapa tiga nama itu karena Rapat Pimpinan Khusus (Rapimnasus) itu akan memutuskan satu dari tiga nama cawapres ARB itu pada 3 Mei 2014 mendatang. Bahwa satu-satunya forum pengambilan keputusan untuk menetapkan capres-cawapres itu di Rapimnasus tersebut. Karena itu peta koalisi Golkar juga tak jauh dari tiga partai itu. Untuk menjajaki bakal cawapresnya, bahkan Ical telah melakukan komunikasi intensif dengan Hanura, PKB dan PKS.(J07)

yang diberikan oleh Bandara Internasional Senai saat ini,” katanya dalam keterangan pers yang diterima Waspada, Selasa (15/4). Selain Yogyakarta dan Lombok, AirAsia saat ini melayani 15x penerbangan per minggu yang menghubungkan Johor Bahru dan Indonesia seperti Jakarta (4x seminggu), Bandung (4x seminggu), dan Surabaya (7x seminggu), menjadikannya sebagai maskapai yang memiliki konektivitas terbaik antara Malaysia dan Indonesia. AirAsia juga menghubungkan Johor Bahru dengan beragam destinasi domestik kawasan Malaysia melalui 91x penerbangan per minggu menuju Kuala Lumpur, Penang, Kuching, Miri, Sibu, dan Kota Kinabalu. Secara keseluruhan, AirAsia telah melayani sebanyak 106x penerbangan per minggu dari hub Johor Bahru. Selain itu, menyambut musim liburan Idul Fitri tahun ini, AirAsia Malaysia (AK) juga mengumumkan penerbangan tambahan (extra flight) untuk beberapa rute dari Kuala Lumpur menuju

Lagi, FSGI Terima Pengaduan Kecurangan UN JAKARTA (Waspada): Dua hari pelaksanaan Ujian Nasional (UN), Forum Serikat Guru Independen (FSGI) menerima pengaduan masyarakat yang mengarah pada kecurangan pelaksanaan Ujian Nasional (UN). Sekretaris FSGI, Retno Listyarti dalam jumpa pers di Jakarta, Selasa (15/4) mengatakan, posko UN FSGI pada Senin (14/4) menerima banyak pengaduan berbentuk sms, surat elektronik dan what’s up

(wa) dari masyarakat terkait perilaku yang mengarah pada tindakan kecurangan dalam UN. Pada hari pertama UN itu, mata pelajaran yang diujikan adalah Bahasa Indonesia dan Geografi untuk jurusan IPS. Untuk jurusan IPA, yang diujikan hari pertama adalah Bahasa Indonesia dan Biologi. Sejumlah kecurangan terjadi di DKI Jakarta, Garut, Indramayu, Bekasi, Depok (Jawa Barat) dan Medan (Sumut). Di DKI Jakarta, Indramayu dan Garut, misalnya, ada laporan tentang

Bupati: Sudah Sesuai Aturan Sebelumnya para calon ang-gota legislatif daerah pemilihan Aceh, serta tokoh masyarakat, pemuda dan LSM, mendesak KPU Pusat untuk menyeleng-garakan Pemilu ulang di seluruh TPS di Kab. Aceh Tenggara. Di samping meminta pemilu ulang, para caleg, tokoh masyarakat, LSM Aceh Tenggara ini juga meminta Bawaslu melakukan audit atas Kinerja KIP, PPK, PPS dan KPPS Kab. Aceh Tenggara , serta membawa masalah tersebut ke DKPP serta meminta aparat kepolisian untuk pro-aktif, mengusut tuntas dugaan pelanggaran Pemilu. Adapun caleg, toloh dan LSM yang tertera dalam rilis yang diterima Waspada adalah atas nama Andi HS (Partai Golkar), Sayed Fuad Zakaria (Partai Golkar), Muntasir Hamid (Partai Golkar), T.Riefky Harsa (Parati Demokrat), Muslim Ayub (Partai Amanat Nasional), H.Armen Desky (Tokoh Masyrakat), Rudi H. Poeloengan (Pegiat LSM), Kharudin Selian,SH (Praktisi HUkum), Tgk.Yasir (Tokoh Agama), Nasrulzaman ( Tokoh Pemuda), Ratna Simatupang (Aktivis Wanita), Lilik Asosiasi Jasa Angkutan dan Dayat (Ormas Pesikab). Sesuai Aturan Sementara Bupati Aceh Tenggara H. Hasanuddin Breuh menegaskan pelaksanaan Pemilu Legislatif di daerahnya sudah berjalan sesuai aturan dan berlangsung demokratis. “Tidak ada yang dilanggar.Jadi, kenapa banyak timbul protes. Saya kira wajar karena barangkali harapan yang protes itu tidak kesampaian,” kata Hasanuddin kepada Waspada, Minggu (13/4). Hasanuddin menjelaskan saat ini hasil penghitungan suara di daerahnya belum selesai. Banyak caleg yang kurang beruntung perolehan suaranya, lantas mereka menyampaikan kebenaran yang direkayasa. ”Seolah-olah pelasanaan Pemilu di Agara penuh dengan kecurangan, kata Hasanuddin. Statemen Bupati Aceh Tenggara Hasanuddin ini menjawab tudingan yang dituduhkan sejumlah caleg DPR-RI tentang dugaan kecurangan terkait Pemilu di Agara. (aya)

Kronologi Alotnya Perundingan Diyat Pembebasan Satinah JAKARTA (Waspada): Ketua Satuan Tugas WNI/TKI Terancam Hukuman Mati di Luar Negeri, Maftuh Basyuni menjelaskan kronologi proses negosiasi yang dilakukan oleh tim utusan Presiden Susilo Bambang Yudhoyono (SBY) ketika melobi keluarga ahli waris Nura Al Garib, majikan Satinah binti Junaidi. Maftuh dan tim awalnya berpikir mereka hanya akan berada di Arab Saudi selama lima hari. Namun, diluar dugaan mereka terpaksa memperpanjang kunjungan kerja menjadi hingga 12 hari. Hal itu diungkap Maftuh di ruang media Kementerian Koordinator Politik, Hukum dan Keamanan (Kemenpolhukam),Jakarta, Selasa (15/4). Menurut Maftuh, lamanya kunjungan kerja mereka di Saudi disebabkan pihak keluarga ahli waris turut mengikuti semua pemberitaan yang ada di tanah air melalui media Saudi. Mereka tidak begitu suka dan merasa tersinggung dengan pemberitaan yang bernada memojokkan ibu mereka, Nura Al Garib. Tiba di Saudi pada 31 Maret 2014, tim utusan khusus Presiden SBY langsung menemui Gubernur Qaseem. Hal itu dilakukan, karena apabila menemui perwakilan keluarga ahli waris, diduga tidak akan diterima dengan ramah. “Tidak dilempar sendal juga sudah bagus. Jadi, sudah tentu penerimaannya tidak akan jauh lebih baik,” kata Maftuh. Selain menemui Gubernur, tim juga menggunakan strategi menemui tokoh atau ulama terkenal di sana. Jajaran pemerintah di Saudi, ujar Maftuh, sangat bersimpati dengan kasus yang dialami Satinah. ”Terlebih, kami membawa surat dari Presiden SBY,” imbuh pria yang dulu pernah menjabat sebagai Menteri Agama ini. Pihak keluarga ahli waris awalnya hanya menginginkan Satinah dieksekusi pancung. Tetapi, setelah melalui pendekatan, keluarga mulai berubah pikiran. Dari yang awalnya bersedia memaafkan dengan memberikan uang

diyat senilai SR15 juta lalu turun menjadi SR10 juta.”Pihak keluarga awalnya mau memberi maaf bagi Satinah asal membayar uang diyat senilai SR10 juta. Namun, pihak pemerintah daerah kemudian menilai nominal itu terlalu tinggi,” kata Maftuh. Oleh sebab itu mereka menyarankan agar mengikuti apa yang tertulis di dalam hadits Nabi Muhammad SAW yaitu uang diyat setara 100 unta atau SR500 ribu. “Namun, keluarga ahli waris tetap menolak. Mereka tetap berkukuh meminta SR10 juta. Kami sempat menawarkan untuk membayar sesuai nominal diyat kasus TKI Darsem yakni SR2 juta, tetap ditolak,” ujar Maftuh. Nominal diyat sempat diturunkan lagi oleh keluarga ahli waris menjadi SR7 juta atau Rp21,1 miliar. Tetapi pemerintah hanya bersedia membayarkan uang diyat senilai SR4 juta. Pihak keluarga, ujar Maftuh, tetap tidak mau menerima nominal tersebut.”Kejadian itu berlangsung di rumah keluarga korban. Akhirnya saya katakan, silakan eksekusi kalau begitu,” kata dia. Gertakan itu ternyata berhasil. Pihak keluarga ahli waris akhirnya sepakat dengan nominal SR7 juta. Dana senilai SR5 juta dibayarkan secara tunai, sementara sisanya, SR2 juta dibayar dengan cara mencicil selama dua tahun. ”Kemudian, mereka berubah pikiran lagi. Nominal SR2 juta boleh dicicil hingga lima tahun,” ujar Maftuh. Baru bisa menghela nafas sementara, Maftuh kembali dikejutkan, karena keluarga ahli waris berubah pikiran lagi. Mereka merasa tersinggung dengan isi pemberitaan di Indonesia. “Maka mereka minta agar SR7 juta dibayar tunai saat itu juga,” kata dia. Maftuh dan tim mau tidak mau harus mengulang kembali proses negosiasi sejak awal. Pihak keluarga baru menurun emosinya, kata Maftuh setelah Presiden SBY kembali mengirimkan surat yang ditujukan kepada keluarga ahli waris. (vn)

pengawas ruang yang menemukan peserta UN membawa telepon selular berisi kunci jawaban. Soal yang diujikan yaitu Geografi. “Tidak tanggung-tanggung, kunci jawaban Geografi itu untuk 17 paket,” kata Retno. Di Bekasi, Depok (Jawa Barat), Madiun (Jawa Timur) dan Medan, ada pengawas silang menyaksikan para siswa menulis kunci jawaban UN Bahasa Indonesia di mushola dan kantin sekolah, sebelum ujian dimulai. Ada dugaan para siswa diminta oleh tim sukses sekolah untuk

datang pukul 05:00 WIB untuk menuliskan soal Di Sidoarjo, Jawa Timur telah terjadi kecurangan dalam pelaksaan UN karena siswa melakukan jual beli kunci jawaban UN. Caranya, kunci jawaban dikirim melalui email lalu diperbanyak untuk dibawa masuk ke dalam kelas. Terkait laporan FSGI, Wamendikbud Musliar Kasim mengingatkan agar siswa tidak percaya pada adanya fenomena kunci jawaban. “Siapa bisa menjamin kunci

jawaban itu benar? Kami yakin, karena ada 20 variasi soal di dalam ruang kelas. Artinya setiap murid memiliki soal yang berbeda-beda,” kata Musliar. Posko UN yang dikelola Kemdikbud sendiri mengklaim adanya pengurangan pengaduan masyarakat. Jika pada UN tahun lalu jumlah pengaduan masyarakat mencapai 381, tahun ini diperkirakan berkurang. “Karena sampai hari kedua UN ini jumlahnya masih 159 pengaduan. Jauh berkurang,” imbuh Musliar. (dianw)

Ombudsman: Pengawas UN Banyak Lakukan Pelanggaran

Pelanggaran Pemilu Legislatif Di Aceh Tenggara

JAKARTA (Waspada): Dugaan pelanggaran Pemilu legislatif 2014 secara masif terjadi di Aceh Tenggara, hal ini disampaikan ketua LSM Komnas Pengawas Aparatur Negara Aceh Tenggara, Rudi Hartono Pulungan kepada wartawan, Minggu (13/4). Menurut Rudi, ada kepala desa di wilayah itu menjadi penyelenggara pemilu atau Ketua PPS saat pemungutan suara berlangsung.”Ini jelas pelanggaran Pemilu secara masif dan terstruktur, ada kepala desa di Aceh Tenggara menjadi penyelenggara pemilu, dan ini tidak sesuai dengan UU No. 8 tahun 2012 tentang penyelenggara Pemilu,” ujarnya. Rudi Hartono yang juga mantan ketua KPU Aceh Tenggara menduga penyimpangan penyelenggaraan pemilu di Aceh Tenggara untuk memenangkan salah seorang caleg DPR RI. “Kami melihat ada indikasi penggelembungan suara di Aceh Tenggara untuk memenangkan caleg DPR RI dari parpol tertentu yang saat ini sedang menjabat Ketua DPR Kab. Aceh Tenggara yang didukung oleh Bupati yang juga ketua parpol yang sama dengan caleg tersebut. Kami minta Panwaslu pusat dan Kapolda Aceh turun tangan “ katanya. Tak hanya itu, Rudi juga menyayangkan sikap KPPS di Aceh Tenggara yang tidak membagikan surat suara C1 kepada saksi dan hasil rekapitulasi suara yang tidak diberikan kepada setiap saksi parpol. Dari 16 kecamatan dan 518 TPS di Aceh Tenggara, Rudi menyebutkan beberapa TPS, yang bermasalah seperti TPS di desa Barung, kelurahan kota, Desa Seulawah Sigala Timur, dan Laweh Sagu. Selain itu, temuan di lapa-ngan pemungutan suara di Aceh Tenggara pada 9 April lalu dilakukan di rumah warga di desa Muara Seria. Sementara di kecamatan yang sama desa Sejahtera, pencoblosan ilegal dilakukan di dapur rumah warga. Meski hari pencoblosan berjalan aman, pelanggaran pemilu kerap terjadi di beberapa kabupaten di Aceh.

Padang, Palembang dan Solo. Sehubungan dengan penerbangan tambahan ini, AirAsia juga menawarkan kursi promo mulai dari Rp 179.000 untuk penerbangan dari Kuala Lumpur menuju Palembang, Rp 219.000 untuk penerbangan dari Kuala Lumpur menuju Padang dan Rp 359.000 untuk penerbangan dari Kuala Lumpur menuju Solo. Penawaran kursi promo penerbangan tambahan tersebut kini sudah tersedia di situs www.airasia.com, mulai hari ini sampai 20 April 2014 untuk periode keberangkatan mulai 24 Juli sampai dengan 30 September 2014. Selain itu penawaran harga spesial ini juga tersedia di aplikasi mobile AirAsia. Harga penawaran spesial untuk penerbangan tambahan (extra flight) berlaku untuk sekali jalan, sudah termasuk fuel surcharge dan pajak Bandara (airport tax) (belum termasuk biaya tambahan lainnya).(j02)

Antara

KUNCI JAWABAN UN BEREDAR: Warga menunjukkan kunci jawaban Ujian Nasional (UN) yang beredar di lingkungan pelajar di tempat fotokopian Jalan Arjuna, Tegal, Jateng, Selasa (15/4).

Sutiyoso Belum Percaya PKPI Tak Lolos Ke DPR JAKARTA (Waspada): Ketua Umum PKPI, Sutiyoso lebih percaya pada penghitungan real count melalui KPU daripada hasil quick count, PKPI diprediksi tak lolos ke Senayan. Pada Pileg 2014 ini, Ketum PKPI Sutiyoso, optimistis akan lolos PT (ambang batas perolehan suara untuk DPR RI) 3,5 persen melalui penghitungan KPU. PKPI menunggu penghitungan suara di KPU awal Mei mendatang. “Saya optimis, PKPI lolos PT DPR, dan saya belum yakin dengan quick count. Masak perolehan PKPI dan PBB sama dengan tahun 2009,” tukas Sutiyoso mempertanyakan pada wartawan seusai bertemu dengan Ketua MPR Sidarto Danusubroto di Gedung MPR, Jakarta, Selasa (15/4). Dengan demikian Sutiyoso menungggu hasil penghitungan KPU (real count KPU). “Seharusnya, menurut logika suara PKPI meningkat seiring menyusutnya jumlah partai peserta Pemilu. Pada Pemilu 2009 ada 34 partai, sedangkan di 2014 ada 12 partai peserta,” ujarnya yakin. Perolehan PBB juga sama dengan pemilu 2009. Angkanya sama. Kanapa? “Karena LSI ini sudah melakukan survei lalu diumumkan PKPI dan PBB tidak lolos. Saat pemilu juga akan menghitung, maka harus dicocokkan. Jadi gak cocok dengan survei kan. Angka yang diambil juga aneh saja. Bahwa tidak mungkin angka kita sama dengan pemilu tahun 2009. Sekarang kuenya lebih banyak kok. Sedangkan sekarang partainya hanya 12, bukan 34,”tambahnya. (j07)

Lenovo Umumkan Pemenang Untuk Ajang Dance Delight WASPADA(Surabaya): Lenovo dengan bangga untuk kedua kalinya membawa Dance Delight, salah satu kompetisi internasional street dance terbesar di dunia yang paling fenomenal, ke Indonesia. IndonesiaDance Delight Vol. 2, hari ini memasuki putaran final dengan tiga tim terpilih akan mewakili Negara Indonesia di putaran berikutnya dari kompetisi Dance Delight. Dance Delight merupakan gelombang baru budaya street dance terdepan di Jepang ketika diciptakan pertama kali oleh Mitsuhiro Harada yang juga dikenal sebagai Machine, pemimpin legendaris tim break dance Angel Dust Breakers. Enam belas tahun kemudian Dance Delight telah memperoleh pengakuan di seluruh dunia dengan partisipasi dari berbagai kota seperti Paris (Perancis), New York (AS), Taipei (Taiwan), Shanghai (China), Seoul (Korea) dan Singapura dan sekarang, Indonesia. Kompetisi Indonesia Dance Delight Vol. 2 ini dimulai sejak 12 Maret 2014 lalu di mana lebih dari 100 tim telah mengirim video mereka hingga pendaftaran ditutup padal 30 Maret. Tiga juri online yang masing-masing berasal dari Indonesia, Jepang dan Singapura, memberi penilaian kepada tim-tim yang yang mendaftar berdasarkan pada kriteria Musikalitas/Koreografi, Teknik, Orisinalitas/Penampilan, Kostum dan Tampilan secara keseluruhan, penilaian dilakukan pada tanggal 31 Maret dan 1 April, dimana telah terpilih sebanyak 25 tim sebagai Top 25 Dance Delight Vol. 02 selection. Semua tim dalam Top 25 Dance Delight Vol. 02 selection asal Indonesia telah mempertunjukkan kemampuan mereka pada 12 April 2014 di 89 Ballroom, Ciputra World, Surabaya, di hadapan ketiga juri utama. Tiga tim yang terpilih dan berhasil meraih nilai tertinggi adalah The Dude, Four Thirteen, The Freak Chicks. Tim dengan skor terbaik akan mendapat penghargaan menjadi wakil Indonesia di ajang FinalDance Delight Vol. 05 di Singapura, dengan biaya akomodasi dan tiket pesawat ditanggung oleh Lenovo. Tim dengan skor kedua terbaik masing-masing anggota tim akan mendapat hadiah berupa Lenovo Tablet; dan tim dengan skor ketiga terbaik masing-masing anggota tim akan mendapat hadiah berupa Lenovo Smartphone. Jika menang di Singapura, tim Indonesia tersebut akan mengikuti ajang kompetisi di Dance Delight Vol. 21 di Jepang pada bulan Agustus 2014, dengan seluruh biaya akomodasi dan tiket pesawat juga ditanggung oleh Lenovo. “Kami sangat bangga dapat berpartisipasi dalam kompetisi ini, dimana hal ini merupakan perwujudan dari misi kampanye brand “For Those Who Do” yang memungkinkan mereka-mereka yang memiliki bakat untuk mengambil tindakan dan mengubah impian mereka menjadi kenyataan,” ujar Rajesh Thadani, Country General Manager, Lenovo Indonesia baru-baru ini. (rel/m44)

MEDAN (Waspada): Pengawas Ujian Nasional (UN) banyak yang melakukan pelanggaran karena belum memahami Prosedur Operasi Standar (POS) Penyelenggaraan UN Tahun Pelajaran (TP) 2013/2014 yang diterbitkan Badan Standar Nasional Pendidikan (BSNP). Hal itu diungkapkan Kepala Perwakilan Ombudsman Sumut Abyadi Siregar seusai meninjau pelaksanaan UN di SMAN 1 Percut Sei Tuan dan SMAN 1 Labuhan Deli, Selasa (15/4). Saat meninjau, Abyadi didampingi Asisten Ricky Nelson Hutaheran dan Tetty boru Silaen. Abyadi menjelaskan, dari pantauan yang dilakukan di dua sekolah di Kabupaten Deli Serdang itu, ditemukan pelanggaran yang dilakukan pengawas UN, mulai dari pelanggaran ringan sampai sedang. Di antaranya, pengawas menggunakan handphone depan pintu ruang ujian, sehingga menimbulkan keributan yang dapat mengganggu konsentrasi peserta ujian. “Pengawas UN di Sumut belum memiliki pemahaman yang sama terhadap POS Penyelenggaraan UN yang diterbitkan BSNP. Baik itu pengawas dari perguruan tinggi maupun pengawas di ruangan ujian, sehingga penerapannya berbeda-beda,” katanya.

Abyadi mencontohkan temuan di SMAN 1 Percut Sei Tuan. Di sekolah ini, masih ditemukan ada pengawas ujian tidak melem/melak lembar jawaban di ruang ujian, tetapi dilakukan di ruang pengawas. Padahal dalam POS Penyelenggaraan UN yang diterbitkan BSNP, LJUN harus dilem/dilak di ruang ujian setelah ujian selesai. “Pengawas satuan pendidikan dari perguruan tinggi, juga tidak tahu kalau LJUN itu harus dilem/dilak di ruang ujian. Pemahaman dia, itu dilem di ruang pengawas karena dia harus tandatangan. Padahal seharusnya pengawas dari satuan pendidikan yang mendatangi setiap ruang ujian untuk tandatangan,” jelas Abyadi. Selain itu, lanjut Abyadi, pihaknya juga menemukan pengawas mengobrol-ngobrol di ruang ujian sehingga dapat menganggu ketenangan peserta ujian. Hal ini sejatinya merupakan pelanggaran karena dikhawatirkan dapat mengganggu peserta ujian. Hal serupa juga ditemukan di SMAN 1 Labuhan Deli. Asisten Ombudsman Ricky Hutahaean menambahkan, di SMAN 1 Labuhan Deli, pihaknya menemukan pengawas berbicara menggunakan HP di depan

pintu ruang ujian sehingga menimbulkan keributan. Selain itu, pengawas juga tidak mendampingi siswa yang akan pergi ke toilet. “Kita lihat pengawasan di sekolah ini tidak ketat. Ada pengawas mengobrol dengan HP di depan pintu ruang ujian dan itu terdengar cukup keras. Kemudian siswa yang permisi ke toilet, itu tidak didampingi,” ungkap Ricky. Pelanggaran lain yang dilakukan pengawas di SMAN 1 Labuhan Deli yaitu dikumpulkannya LJUN sebelum waktu ujian berakhir. “Biasakan ada pengumuman 5-10 menit sebelum waktu berakhir. Tapi ini masih diumumkan, sudah dikumpulkan. Mungkin salah dengar atau bagaimana,” imbuhnya. Abyadi Siregar menambahkan, pelanggaran-pelanggaran yang dilakukan pengawas UN ini disebabkan ketidakpahaman terhadap POS Penyelenggaraan UN yang diterbitkan BSNP. Semua temuan ini akan menjadi catatan Ombudsman selaku lembaga negara pengawas eksternal pelayanan publik. Dikatakan Abyadi, selama pelaksanaan UN 2013/2014, Ombudsman Sumut akan melakukan pengawasan di tiga kabupaten/kota di Sumut, yakni di Medan, Deli Serdang, dan Binjai. (m13)

MPR Usulkan Lembaga Negara Bahas Putusan MK JAKARTA (Waspada): Wakil Ketua MPR RI Ahmad Farhan Hamid akan mengusulkan kepada pimpinan lembaga negara yang terdiri dari Presiden, MPR RI, DPR RI, DPD RI, Mahkamah Konstitusi (MK), Komisi Yudisial (KY), Badan Pemeriksa Keuangan (BPK), dan Mahkamah Agung (MA), untuk berkumpul membahas putusan MK terkait pembatalan istilah, frase Empat Pilar bangsa, yang sudah disosialisasikan selama lima tahun terakhir ini. “Saya akan usulkan agar semua lembaga negara berkumpul dan konsultasi membahas putusan MK menyangkut pembatalan istilah 4 pilar tersebut. Sebab, kalau tidak khawatir akan terjadi kesalahpahaman dalam pelaksanaan atau sosialisasi 4 pilar itu ke depan,” tandas Farhan Hamid dalam diskusi ‘4 pilar pasca putusan MK’ di Jakarta, Senin (14/4) bersama budayawan Radhar Panca Dahana dan Ketua PBNU dan mantan anggota DPR RI FPG Slamet Effendy Yusuf, SH. Menurut Farhan Hamid, awalnya istilah 4 pilar disepakati oleh fraksi-fraksi di MPR RI, dan kemudian diamanahkan ke MPR RI dan Ketua MPR RI alm.Taufik Kiemas langsung memutuskan menggunakan istilah 4 pilar tersebut untuk sosialisasi Pancasila, UUD NRI 1945, NKRI, dan Bhinneka Tunggal Ika. “Jadi, bagi MPR RI berkewajiban untuk menyosialisasikan prinsip-prinsip dasar berbangsa dan bernegara itu,” ujarnya. Farhan mengatakan, MPR RI wajib mentaati putusan MK tersebut karena bersifat final dan mengikat. Kalaupun istilah itu harus diganti, mungkin

dengan sosialisasi UUD NRI 1945, atau sosialisasi konstitusi. Karena itu, perlu kese-pahaman bersama, agar dalam pelaksanaannya tidak salah. Kita kan tidak mau berhadapan dengan KPK,” tukasnya. Ketua Pengurus Besar Nahdlatul Ulama (PBNU) H. Slamet Effendy Yusuf mengusulkan istilah itu diubah menjadi ‘Sosialisasi hasil amanemen UUD NRI 1945’ atau dengan ‘Bukan 4 pilar’ dan sebagainya.“Saya sendiri merasa lega dengan putusan MK itu, karena frase-istilah itu tidak konstitusional, tak ada dalam UUD NRI 1945. Saya menolak istilah itu, karena saya ingat Orde Lama dan Orde Baru, di mana istilah yang datang dari atasan langsung diterima dan disosialisasikan ke masyarakat. Seperti halnya manifesto politik dan lain-lain yang kadang kita tidak mengerti maksudnya,” tandas Slamet Effendy Yusuf. Untuk itu, Slamet menghargai putusan MK tersebut agar MPR dan elit bangsa ini tidak mengulangi penggunaan kesalahan-kesalahan istilah yang tidak perlu. Kenapa MK Urusi Istilah 4 Pilar Budayawan Radhar Panca Dahana justru menyatakan heran, kenapa Mahkamah Kons-titusi (MK) ngurusi istilah 4 pilar bangsa yang diputus bertentangan dengan konstitusi itu. Bukankah istilah, frase menjadi kewajiban pusat bahasa untuk meluruskan atau menafsirkannya? Bangsa ini memang mempunyai persoalan terminologi bahasa, dan sebanyak 50 persen intelektual Indonesia sama, dan bahkan tidak memahami istilah-istilah itu.

“Lebih heran lagi, putusan MPR RI yang terdiri dari 560 orang itu dibatalkan hanya oleh 9 orang anggota MK. Itu berarti terjadi perang opini antara MK dan MPR RI. Harusnya itu tak perlu ada, karena pengejawantahan kedaulatan rakyat adalah MPR/DPR/DPD RI. Sekaligus sebagai penafsir dan pelaksana konstitusi,”tegas Radhar. Menurut Radhar, justru berbahaya kalau ada persoalan bangsa yang mendasar dan substantif lalu diserahkan dan diputus oleh hanya 9 orang. “Itu seolah 9 orang itu sebagai orangorang suci dan setengah dewa. Padahal, rujukan seluruh lembaga negara dan rakyat ini adalah konstitusi. Persoalannya, apakah seluruh institusi itu sudah mengikuti konstitusi?” katanya mempertanyakan. Karena itu, lanjut Radhar, semua harus dikembalikan pada proporsinya masingmasing. “Kalau tidak, maka terjadi pengkhianatan terhadap konstitusi itu sendiri. Seperti halnya kontrak PT Freeport dengan royalti hanya 3 persen pada perusahaan Amerika Serikat itu. Itu kan jelas peram-pokan gilagilaan dan dibiarkan oleh negara. Konstitusionalkah yang demi-kian ini?” tegas Radhar lagi. Dengan demikian, apapun istilahnya menurut Radhar, mau pilar, tiang, dan sebagainya, yang terpenting itu melaksana-kan dan menaati konstitusi negara. “Tak perlu membesar-besarkan istilah, tapi substansi dari konstitusi itu sendiri malah diabaikan. Termasuk siapa Capres yang bisa membawa masa sulit bangsa ini ke depan akan lebih baik?” pungkasnya.(j07/aya)


A8 1 CM

WASPADA

Rp. 22.000

2 CM

BURSA AUTOMOTIVE Informasi Pembaca

Bursa Automotive AC BR CL ND DB

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

I N FO DAI H AT SU Pick Up DP 10 Jtan, Xenia Dp 20 Jtan, Terios DP 30 Jtan, Luxio, GM Minibus, Sirion, Proses Mudah, Cepat dan Paling Murah. INFO ADWIN 0 8 2 1 6 1 1 6 9 7 2 1 SHOWROOM DAIHATSU (PROMO) Terios DP 30Jtan atau Angs 3,2Jtan Xenia DP 20Jtan atau Angs 2,5Jtan *Ayla DP 20Jtan * PU DP 10Jtan HOT BONUS TV 50”. Hub 0 8 5 2 7 7 4 7 2 5 4 2

FORD FOCUS MODEL JAZZ RS OVER KREDIT Th 2006 Spt Baru, sisa 8x 5.500.000. Balik DP 65Jt Nego. Hub 0852 6134 0538 H Y U N D A I GRAND AVEGA MERAH OVER KREDIT Th 2012. Kilometer Baru 5000, Spt Baru, Sisa 25 x 4.200.000. Balik DP 60Jt Nego Abis. Hub 0 8 2 3 6 4 3 2 0 0 5 2

Rp. 33.000

3 CM

Rp. 44.000

HONDA STREAM 1.7 M/T Thn 2002. Biru, BK Mdn, Rp. 95Jt. Hub 0 8 5 3 7 0 8 9 9 8 9 3 I SU Z U PANTHER PICK UP 04. Bak Std, BK, Htm, Ban Baru, Mls, Hrg 72Jt. Hub 0852 6022 9691 ISUZU PANTHER LS TURBO Thn 2007. Coklat Muda Met, Plat B, Rp. 140Jt. Hub 0852 7538 3218 DIJUAL I SU Z U PANTHER Hi- Grade 95. Mulus, siap pakai, Hitam, Rp. 66Jt. Hub 0 8 1 3 7 0 6 3 0 5 1 1 KIA VISTO Model Atoz Hitam Met Th 2003 Sgt Orisinil, Vr, Br, Ps, Pw, Cl, Ac Dingin Full Sound Pake Tv, Hrg 56Jt Nego. Hub 0 8 2 3 6 1 1 5 8 6 2 5

OPEL BLAZER LT INJECTION Biru Th 97. Sgt Mulus, Ex Dokter, Mesin Sehat, Ac Dingin, Hrg 44Jt Nego Abis. Hub 0853 7354 0433

SUZUKI SIDEKICK DRAG ONE Thn 2000. Silver, Plat B, Rp. 67Jt Nego. Hub 0852 7538 3218

H Y U N DAI i 20 Bensin M/T Thn 2010. Silver, BK Mdn, Rp. 107Jt. Hub 0812 6594 2789

S U Z U K I BALENO GX Th’97. Wrn Hitam, BK Asli Medan, Mobil Ctk, Rp. 59Jt. Hub 0813 9728 0999

H O N D A ACCORD PRESTIGE Thn 88. Hitam, Mulus, BK Medan, Orisinil, Ac, Dvd, P. Window, P. Steering, Central Lock, Pr, Br, Terima BBN, Rp. 26Juta/Nego. 0 8 1 2 6 5 7 8 7 9 0

SU Z U K I SIDEKICK DRAG ONE OVER KREDIT Th 99. Sgt Orisinil, Hitam, Sisa 12 x 2.410.000, Pake TV, Balik Dp 55Jt Nego. Hub 0823 6452 5302

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

4 CM

Rp. 55.000

JUAL SUZUKI CARRY FUTURA Minibus 1.3 Thn 94. BK Mdn, Ac/Tape. W. Hitam, Cantik. Harga 35Jt Nego. Hub 0812 6393 235

6 CM

Rp. 121.000

TOYOTA VIOS MATIC 2003. Hub 0852 6113 7592

BURSA DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA/ RU SH /T ERI OS/X EN I A

SUZUKI JIMNY Long Pick Up Kanvas 4x4 OFROAD Th 91. Ban Cangkul Comodo MT, Pengapian CDI 90 Amfer, Bisa Karaoke, Hrg 95Jt Nego. Hub 0823 6115 8626 BUMFER ARB

T OY O T A SE SALOON SGT Orisinil Th 86. Hrg 32Jt Nego. Hub 0 8 1 2 6 0 6 3 7 8 2 3

Rp. 1.350.000,Jok (model press) + Alas

DEALER TOYOTA BARU READY STOCK All Type TOYOTA, Bunga Ringan Dan Cicilan Murah, 1 s/d 6 Tahun, Cash/ Kredit. Hub Annuar Damanik 0 8 2 3 7 0 8 8 0 8 1 5

T OY O T A 1 0 0 % B A R U

TOYOTA AVANZA G ‘09. Silver, Mulus, Mobil Pribadi, BK Asli Mdn, Pajak Feb’15. Rp. 126Jt Nego. 0 8 1 3 1 1 4 2 5 9 0 9

Website : http://alfaatihtravel.com Email : alfaatihtourtravel@gmail.com Facebook : alfaatihtourtravel

HP. 081362106106, 085277251151, 081264853281 H A R G A PA K E T V. I . P ( B ) Harga / USD

9 hari 14 hari 12 hari + Dubai 14 hari + Turki 14 hari + Aqsa

TOYOTA KIJANG COMANDO SHORT 6 Speed Th 90. Mulus, Lampu Grand, Vr, Br, RTP, Ac Dingin, Hrg 40 Jt Nego. Hub 0812 6281 6585

T OY OT A KIJANG JANTAN Th’88. Warna Hijau, BK Medan, Ac Dingin, Velg Racing, siap pakai, Harga 36Jt Nego. Hub 0 8 1 3 7 5 8 9 0 6 9 4

Umroh & Haji Services

J lh. H a ri :

Hubungi:

DO RE M I J OK M OBI L JL. S. PARMAN BLOK DD No. 3-4 (DEPAN ST. THOMAS 2 MEDAN) Telp. 061-4522123, 0812 6550 123, 061-6639123 JL. MAKMUR No. 10 A, MEDAN (MASUK DARI JL. ADAM MALIK / JL. KARYA) TELP. 061-6639123, 6636123, 0812 6550123

2.300,2.700,2.800,3.300,3.800,-

Pa k e t :

Madinah – Makkah Madinah – Makkah Madinah – Makkah – Dubai Madinah – Makkah – Turki – Dubai Madinah – Makkah – Aqsa

KREDIT ANDA - SULIT CAIR ? - DITOLAK ? Hub 0822 - 770 - 18625

MINI & EFEKTIF IKLANKAN PRODUK ANDA

MULTAZAM UMROH & MANASIK HAJI 2014 *UMROH REGULER 09 HR ( 25 APRIL, 5 ,19 MEI, 10 JUNI 2014) *UMROH REGULER 11 HR (12 MEI 2014) *UMROH REGULER 14 HR (28 MEI 2014) *UMROH PLUS TURKY 12 HR (21 APRIL 2014) *UMROH PLUS DUBAI 11 HR (10 MEI 2014) *UMROH PLUS AQSHA DAN JORDANIA (ISRA’ MIRAJ, 24 MEI 2014) *UMROH 2 MGG AWAL, 2 MGG AKHIR, S/ FULL RAMADHAN 1435 H LU P MANASIK HAJI H SETIAP HR SABTU : 14.00 - 16.00 WIB ON HR MINGGU : 09.00 - 11.00 WIB BERTEMPAT : MESJID AGUNG MEDAN JLN. PANGERAN DIPONEGORO

H ARGA PAK ET U M ROH DI BU LAN SYA’BAN 1 4 3 5 /2 0 1 4 Jlh. Hari : Harga / USD Paket : 14 hari 2100 Madinah - Makkah

K AN T OR PU SAT : JLN. TITI PAPAN / PERTAHANAN NO. 10 SEI SIKAMBING D MEDAN

Tersedia : Tiket Domestik & Internasional Hotel Voucher, Travel Document J a la n De na i N o. 1 6 8 , M e da n - Sum a t e ra U t a ra T e lp./Fa x . 0 6 1 -7 3 3 1 1 1 5

H P. 0812.6495.8456, 0813.6137.2321 0852.0648.6301, 0823 6252 6008 TELP. 061- 4576116 FAX 061-4512319

PEN ER I M A A N GU R U PERGU RUAN AS-SYAFI ’I YAH I N T ERN ASI ON AL M EDAN MEMBUTUHKAN : GU RU K ELAS (PGSD), B. I N DON ESI A, B. I N GGRI S, S E N I B U D AY A , A G A M A , P E N J A S , O T O M O T I F, KOM PU T ER, BP (KONSELING), TATA USAHA, SAT PAM SYARAT : A. DIUTAMAKAN LAKI - LAKI B. S1/AKTA IV BERPENGALAMAN 2 TAHUN C. MEMILIKI LAPTOP DAN MENGUASAI POWER POINT D GURU KESENIAN (DAPAT BERMAIN ORGAN / KEYBOARD E. GURU KOMPUTER MENGUASAI ANIMASI DAN 3 DMAX F. LAMARAN DITULIS TANGAN G. PASPHOTO 3 X 4 = 2 LEMBAR KIRIM LAMARAN LENGKAP KE JL. KARYA WISATA II NO. 1 MEDAN JOHOR

BURSA TRAVEL / WISATA

BUTUH DANA S O LU S I DA N A C E PAT Proses 5 Jam Cair, Tanpa Usaha, Terjamin. Jaminan : SHM, HGB, SK Camat, BPKB Mobil, Spd Mtr, Mobil Kredit/Over Leasing, Bantu Pelunasan BPKB. Hub Sdr Rinaldi HP 0821 6757 1653, 0853 6100 3453

I nfo Pe m e sa na n I k la n H ub. PI N BB 2 6 2 4 7 F5 E H P. 0 8 7 7 1 7 8 4 4 0 3 5 - 0 8 1 1 6 0 4 6 9 0

HARGA SUDAH TERMASUK PPN 10%

AL FAATIH TOUR & TRAVEL

SERVICE/ASSESORIES

TOYOTA INNOVA V Bensin Th’08. Manual, Wrn Abu - Abu Met, Pakai TV, ex wanita, Rp. 165Jt. Hub 0821 6767 7000 / 7851402

DI J U AL

FAX.4531010

6 CM x 1,5 kolom Rp. 165.000

8 CM Rp. 137.500

SUZUKI ESTEM 1.6 Biru Sgt Mulus Th 94. Vr, Br, Ps, Pw, Cl, Dvd, Ac Dingin, Hrg 40Jt Nego. Hub 0 8 5 3 7 3 5 4 0 4 3 0

Ready Stock, Agya, Etios, Avanza, Rush, Innova, Fortuner, All New Yaris. Hub H ERY 0 8 5 2 6 2 9 7 5 5 5 5

Rabu, 16 April 2014

PAKET UMROH TERMURAH (FLIGHT GARUDA INDONESIA) - (MES -JED-MES) Direct Flight (Tgl. 1 Mei ‘14 - 20 Juni ‘14)

Dengan Harga 1.550 USD 3 KALI MIQAT TOUR PERJALANAN : All in + Jabal Magnit, Pemerasan Susu Unta, Musium Ka’bah, Hudaibiyah, Dll

HAJI PLUS 10.000 USD

GULA DARAH ELIN SEMPAT MENCAPAI 434 mg/dl

Daftarkan segera diri Anda, untuk apa menunggu lama, kami menyediakan Haji Plus d e n g a n K u o t a Te r b a t a s De nga n Fa silit a s: H ot e l Gra nd Z a m za m (H ot e l N o. 1 di Sa udi Ara bia ) Dan Travel Yang Berpengalaman

I N FO LEBI H LAN J U T H U B:

PT. AL’MUCHTAR TOUR & TRAVEL Jl. Sisingamangaraja No. 180 Medan Te lp: (0 6 1 ) 7 8 7 1 8 6 0 H P: 0 8 1 2 6 0 7 4 0 6 9 7 (SH ELLY )

BURSA BUSANA/ ACCESORIES

PECI MAHKOTA MENJUAL PECI TEMPAHAN Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan Dibuka sampai malam Jam 21.30 WIB

BURSA FOTO COPY

BURSA

KLINIK TERAPY/ ALAT VITAL

MAK EROT YANG TERUJI

KESEHATAN

DAN T ERBU K T I

PENGOBATAN ALTERNATIF TERAPI URAT

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna K H U SU S WAN I T A: K H U SU S PRI A: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DI J AM I N 100% K ON SU LT ASI U M U M : H AN YA T EM PAT - Buka aura K AM I K LI N I K - Cari jodoh M AK EROT - Pelaris - Mencari orang hilang J L. LAK SAN A N O. 6 2 A M ASU K DARI J L. AM ALI U N Y U K I SI M PAN G RAYA M EDAN (PRAK T EK T ETAP) H P: 0 8 1 2 4 0 3 8 3 3 3 - w w w.t e ra pia lat vit a lm a ke rot .c om

BURSA KOMPUTER

-Stroke -Asam Usat -Asam lambung Ringan/ Kronis (Sakit Maag) -Rematik -Keseleo -Urat kejepit -Ginjal

-Lumpuh -Migran -Sakit Gigi -Darah Tinggi -Gula -Usus Turun - Kejantanan Pria

Alamat Jalan Jahe 8 No. 37 Perumnas Simalingkar (Medan). HP 0813 7535 3566 (Bpk. Handi)

BURSA ALAT MUSIK

F D C D

BURSA ALAT KANTOR DI J U AL ALAT - ALAT KANTOR Meja / Kursi Dan 4 Unit AC Kondisi 80%. Berminat Hub HP 0 8 2 1 1 1 8 7 4 9 8 7

Layar LED, Wifi, LAN FireWire, DVDR Multi RW, Modem, FM Tuner, Graphic Hardware, Smartcard USB 2.0 5 in 1 Media Reader Banjir Bonus & Hadiah Komplit & Siap pakai Bergaransi 5 HARI SAJA

BURSA PERABOT T EM PAH AN M U RAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1.750.000 /mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 75107000

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. Spring Bed 5 kaki 2 lapis Rp. Spring Bed 4 kaki 2 lapis Rp. Spring Bed 3 kaki 2 lapis Rp. Spring Bed 3 kaki Dorong Rp. Garansi Per 10 tahun

1.250.000 1.200.000 1.100.000 1.000.000 1.150.000

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

DIGITAL

Keterangan lebih lengkap silahkan hubungi: TELPON : 061 - 4576602 FAX : 061 - 4561347

Medan Mall - 0823 6075 0597

AH A COM PU T ER

Jl. Asrama Pondok Kelapa No. 26 Ringroad (Dpn Ktr Pajak) 0823 6659 9423 0852 1090 7422 (061) 845 6003

Hub Telp. (061) 661.8116 - (061) 661.6802 - 75107000

Anda Butuh Perabot Jepara Asli?

KIRIMKAN... DATA IKLAN MINI ANDA DALAM BENTUK

BU RU AN !! READY STOCK T Y PE LAI N

* Format: JPG - TIFF (Photoshop)

BURSA PERHOTELAN Since 1952

KENANGA CITI HOTEL My Residence in Medan

J l. Sisinga m a nga ra ja N o. 8 2 Medan Te lp. (0 6 1 ) 7 3 4 .2 1 0 6

BURSA PELUANG USAHA BOSS VENTURE Keuntungan pasti perhari 5 jt selama 90 hari (NON MLM). Hub PT. BVI. Telp 021-41196301 atau SMS “Berminat” HP 0 8 7 8 7 6 6 2 6 1 1 1 - 0 8 2 3 1 2 7 8 1 3 6 6 .

Klik www.bossventureautoprofit.com

TUKANG BANGUNAN - Bangun Baru / Renovasi - Tempat Tinggal - Ruko - Gudang - Dan Lain - Lain Kami Siap bekerja sama, Bapak ingin Membangun, Terkendala Dengan Tukang. Hubungi Kami 0813 7710 4418 DI J U AL Alat - Alat Pangkas 3 Kursi. Lengkap, Kaca 4 Keping Besar, Harga Nego. HP 0823 7035 4378

SERVICE KONSTRUKSI

WC WC

TUMPAT/ SAL. AIR

8 4 5 .8 9 9 6 0812.631.6631 Bergaransi/ Jl.Kpt. Muslim

Jl. P. BRAYAN MEDAN

HP. 0813 7035 7291 0813 6210 8239 Ada Garansi

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


Luar Negeri

WASPADA Rabu 16 April 2014

Dubes Jordania Untuk Libya Diculik Di Tripoli TRIPOLI, Libya (CNN): Duta besarJordaniauntukLibyadiculik diTripoliSelasa(15/4),kataMenlu kedua negara. Dubes Fawaz alAytan diculik, menurut Kemlu

Jordan. Supirnya cidera. Seorang jubir bagi Kemlu Libya mengatakan, konvoi dubes itu diserang olehsejumlahpriabertopengyang menaiki dua mobil dan al-Aytan

dibawa pergi. Para pejabat telah sering menjadi sasaran dan diintimidasi oleh kelompok milisi berbeda di negarayangterpecahitu.Minggu,

Pemberontak Makin Kuat Kuasai Gedung Di Ukraina HORLIVKA, Ukraina (AP): Para pemberontak pro-Rusia yang menduduki gedung-gedung pemerintah di seluruh Ukraina Timur Selasa (15/4) makin memperkuat posisi mereka dan mendirikan barikade baru sementara tank Ukraina berada pada jarak 70 km dari satu kota yang dikendalikan oleh orangorang bersenjata pro-Moskow. Jalan ke Slovyansk, sebuah kota sekitar 160 km timur dari Rusia yang telah datang di bawah kontrol yang lebih aman dari orang-orang bersenjata sejak Sabtu, yang dihiasi dengan pospos pemeriksaan. Salah seorang dari pemberontak berdiri di pintu masuk ke kota dengan melam-

baikanbenderaRusia.Sementara yang lainnya membawa tanda yang bertulisan “Jika kita tidak melakukannya, tidak akan ada orang yang berbuat.” Meskipun kekhawatiran meningkatakanadanyaserangan jarak dekat oleh pasukan pemerintahUkraina,kotatampaktenang pada tengah hari Selasa itu. Di Kiev, penjabat Presiden Ukraina, Oleksandr Turchynov, mengumumkansatu‘operasiantiteroris’untukmengikishabis‘kaum separatis.’ Pemberontak yang kebanyakanbersenjata,melanjutkan pendudukangedungpemerintah, polisi dan administratif di hampir sembilan kota berbahasa Rusia ditimurUkraina.Merekamenuntut

Bau Aroma Politik Makin Terasa Dalam Tragedi MH370 PUTRAJAYA, Malaysia (Waspada): PM Malaysia Najib Razak mengecam pernyataan dari pemimpin oposisi Malaysia Anwar Ibrahim mengenai penguakan misteri hilangnya pesawat Malaysia Airlines MH370. Anwar mengatakan dia bisa memecahkan misteri MH370 dalam hitungan detik. Memasuki hari ke-39 hilangnya pesawat MH370, Najib mengatakan bahwa Malaysia membutuhkan dukungan dari dalam dan luar negeri. Ini mengingat rumitnya pencarian dan tantangan yang dihadapi. “Pernyataan dari pemimpin oposisi (Anwar Ibrahim) sangat tidak logis dan terkesan menyebutkan rakyat Malaysia bodoh,” ujar Najib, seperti dikutip Bernama, Selasa (15/4). Suratkabar China, SouthernWeekly mengutip pernyataan dari Anwar Ibrahim pada 5 April lalu, yang mengatakan bila dia PM Malaysia,diahanyabutuhsatudetikuntukmemecahkanisuhilangnya MH370.Pesawat Boeing 777-200ER Malaysia Airlines MH370 hilang sejak 8 Maret 2014 lalu dengan membawa 239 penumpang. Pesawat lepas landas dari Kuala Lumpur dengan tujuan Beijing, China. 24 Maret 2014, PM Najib menyatakan pesawat jatuh di selatan Samudera India, di dekat Perth, Australia. Sementara hingga saat ini proses pencarian dari pesawat nahas itu masih tetap berlangsung. Proses pencarian pun mulai melibatkan robot kapal selam Bluefin21.Sebelumnya,timpencarimasihmencobamendeteksisinyalkotak hitam MH370, namun baterai dari kotak hitam diyakini sudah tidak aktif lagi karena sudah melebih batas waktu 30 hari.(ok/r-m10)

oto-nomiyanglebihluasdanlebih dekat dengan Rusia. Pemerintah sentralsejauhinitidakberhasiluntuk meredampemberontakan,karena makinbanyakpasukankeamanan lokalyangberpalingpadamereka. Sementara itu, Presiden RusiaVladimir Putin menunjuk PM Krimea saat ini sebagai pejabat gubernur semenanjung itu, suatu keputusan untuk memperkokoh status semenanjung itu sebagai wilayah Rusia. Sergei Aksyonov , yang telah menjadi perdana menteri sejak awal langkah kawasan itu untuk memisahkandiridariUkraina,akanmenjabat posisi itu hingga pemilihan umum , menurut dekrit yang diterbitkan di laman Kremlin . Saat kedua tokoh itu bertemu di kediaman presiden di Moskow, PutinberterimakasihkepadaAksyonovatasbantuannyadalammewujudkan Krimea sebagai wilayah Rusia,denganmengatakankepadanya,“IniadalahprestasiAndayang pertama dan terutama.” Aksyonov berjanji kepada Putinbahwadiatidakakanmengecewakannya. Aksyonov yang proMoskow telah bertindak sebagai pejabat perdana menteri semenanjungitusejakFebuari.PMKrimea Anatoliy Mohilyov digulingkan setelah kelompok bersenjata mengambil alih gedung kementerian dan anggota parlemen kemudian memilih Aksyonov yang berusia 41 tahun untuk mengisi pos itu. Kiev mengancam akan melancarkan serangan militer terhadap para separatis dan menuduh Moskowmengaturaksikekerasan di provinsi yang penduduknya menggunakan bahasa Rusia untuk mengulangi kembali skenario di Krimea.(m10)

PM baru terpilih Libya Abdullah al-Thinni mundur setelah serangan terhadap dirinya dan keluarganya. Seorang pemukim mengatakankepadaCNNbahwaal-Thinni bersama keluarganya ketika konvoinya diserang milisi di dekat daerah di mana dia tinggal di Tripoli. Setelah mereka selamat dari serangan itu dan masuk ke

kawasan dekat bandara Tripoli, tembakan sengit terjadi di daerah tersebut. Al-Thinni mengatakan dia dan anggota kabinet akan melanjutkan kerja mereka sebagai pemerintah pelaksana sampai PM baru dipilih Kongres Nasional Umum, parlemen sementara negara itu. (m23)

Serangan Bom Tewaskan 71 Orang Di Nigeria ABUJA, Nigeria (Waspada): Sebanyak 71 orang tewas akibat ledakan bom di terminal bus di ibukota Nigeria, Abuja, dan Presiden Goodluck Jonathan menuding kelompok Boko Haram sebagai pelaku serangan paling mematikan yang pernah dialami kota tersebut. Bom yang juga melukai 124 orang tersebut mengguncang terminal Nyanya di Abuja Senin (14/4) pukul 06:45 waktu setempat (00:45 WIB) saat tempat tersebut dipenuhi oleh warga sipil yang hendak pergi bekerja, lapor AFP. Bom tersebut meninggalkan lubang sedalam 1,2 meter dan menghancurkan puluhan kendaraan. Ledakan tersebut ‘berasal dari sebuah kendaraan’ yang diparkir di dalam terminal, kata kepala departemen SAR Badan Nasional Manajemen Darurat Charles Otegbade. Saatmengunjungilokasikejadian,ituPresidenJonathanmenyatakan Nigeria akan mengatasi pemberontakan kelompok Boko Haram—yang pada masa lalu dituduh bertanggung jawab atas pembunuhan ribuan warga sipil di Nigeria sejak 2009. “Persoalan Boko Haram telah mencoreng sejarah negara di masa pembangunan ini. Namun kami akan mengatasinya. Masalah Boko Haram hanya sementara,” kata Jonathan. Kelompok Boko Haram, yang menginginkan berdirinya negara Islam di bagian utara Nigeria, sebelumnya juga telah melancarkan sejumlah serangan bom di sekitar ibu kota—termasuk di antaranya peledakan bom mobil di kantor PBB yang menewaskan 26 orang pada 2011 lalu. Jonatahan sendiri dikritik oleh banyak kalangan karena dinilai tidak dapat mengatasi kekerasan dari Boko Haram. Dia diperkirakan sulit memenangi pemilu presiden pada tahun depan karena persoalan tersebut. Menurut pengamat Adetokunbo Mumuni, serangan bom terbaru di ibu kota Nigeria akan memperburuk kredibilitas Jonathan di mata publik dalam penanganan kekerasan yang dilakukan Boko Haram. Ledakan bom tersebut akan menjadi pengingat bahwa strategi pemerintah dalam meredam pemberontakan “tidak memadai dan tidak berhasil,” kata Mumuni dalam sebuah pernyataan tertulis. Sejumlah pakar mengatakan bahwa kekuatan militer tidak akan menghentikan pertumpakan darah. Mereka mendesak pemerintah untuk memberdayakan ekonomi kelompok miskin di daerah utara di mana anak-anak muda yang tidak memiliki pekerjaan memilih menjadi anggota Boko Haram. Nigeriaadalahprodusenminyakdenganskalaekonomiterbesar di Afrika. Meskipun demikian, lebih dari 80 persen penduduknya hidup dengan penghasilan kurang dari 2 dolar AS per hari.(bbc/ m10)

A9 China Tangkap 160 Anggota Geng Kriminal Yang Menipu Pengobatan SHANGHAI, China (Reuters): Pihak berwenang di China menangkap 160 anggota geng kriminal di ibukota keuangan Shanghai setelah kelompok itu mengarahkan pasien ke klinik medis palsu dan menjual obat kepada mereka dengan harga tinggi, kata polisi Selasa (15/4). Kelompok itu telah menipu lebih 500 korban dengan nilai AS$273.400, dengan menggunakan dokter palsu untuk menaikkan harga obat dan memberikanresepobatdalamjumlah banyak, kata Departemen Kepolisian di blog-nya. Tindakan korupsi merajalela di system pelayanan kesehatan di China, dikarenakan sedikitnya dokter, sementara penyuapan menyebabkan biaya pelayanan kesehatan mahal dan menciptakan keteganganantarapetugaskesehatan dan pasien. Memberikan pelayanan ke-

sehatan yang terjangkau dan mudah diperoleh merupakan salah satu program kunci pemerintah baru Presiden Xi Jinping, di mana anggaran pelayanan kesehatan China ditetapkan AS$1 triliun tahun 2020, menurut laporan dari McKinsey & Co. Lebih 600 pejabat polisi Shanghai melancarkan operasi sengat pada 2 April, setelah tujuh bulan melakukan penyelidikan, dan menahan 160 tersangka dalam penyerbuan ke rumah-rumahanggotakelompokitudikota tersebut dan menyita berkotakkotak obat-obatan dan senjata api palsu, kata polisi. Kelompok itu akan mengarahkan pasien ke empat klinik palsu, dengan menempatkan sejumlah orang di beberapa rumahsakit dan stasiun kota. Para dokter palsu ini kemudian menjual obat kepada mereka dengan harga 10 kali lipat dari harga se-

benarnya. Penipuan semacam ini sering ditujukan pada migrant yang datang ke Shanghai untuk mendapatkan perawatan kesehatan, kata media resmi China mulai dari Shanghai Daily dan kantor berita Xinhua. Secara terpisah, Xinhua mengatakan, pihak berwenang telah menyita lebih 1,61 juta kondom palsu merek Durex dan menangkap 20 orang yang terlibat dalam produksinya di timur Provinsi Zhejiang. Polisi di Provinsi Henan juga menangkap 19 orang karena menjual ‘alat medis tiruan’ yang terbuat dari ‘limbah dari luar negeri’, tambah Xinhua. China telah berusaha menumpas produksi dan penjualan barang palsu, di negara di mana segala benda mulai dari bahan pangan dasar seperti beras dan telur sampai iPhone dan onderdil mobil, bisa menjadi sasaran pemalsuan.(m23)

Presiden China Desak Bangun Kekuatan Udara, Luar Angkasa BEIJING, China (Antara/ AFP): Presiden China Xi Jinping mendesakdilakukannyaintegrasi kekuatan pertahanan udara dan angkasa, yang oleh para pakar Selasa (15/4), dinilai merupakan tanggapan atas militerisasi angkasa luar oleh negara-negara pesaingnya termasuk Amerika Serikat. China mengatakan bahwa program luar angkasanya bersifat damai, namun klaim tersebut pada 2007 pernah dipertanyakan ketika pihak militer menggunakanrudaldaratuntuk menghancurkan salah satu satelit miliknya sendiri di orbit. Menurut beberapa laman, China Mei lalu juga melakukan tes sebagai bagian dari program baru rudal balistik anti-satelit. Xi mengatakan kepada angkatanudaranegaraituuntuk “mempercepatintegrasiwilayah

udara dan mempertajam kapabilitas pertahanan dan serangan mereka”, demikian dilaporkan kantorberitaXinhua,Senin,tanpa menjelaskanlebihlanjutapayang harus dilakukan untuk itu. HarianmilikpemerintahChina DailypadaSelasamengutipWang Ya’nan, wakil pemimpin redaksi majalah Aerospace Knowledge di Beijing yang mengatakan bahwa

langkahtersebutmerupakanrespon atas “kebutuhan saat ini.” Artikel China Daily menyebutkan “ide menggabungkan kemampuan udara dan luar angkasa bukan hal baru bagi AU China”. Namun program luar angkasa China sebelumnya lebih fokus pada masalah komersial dan sains, bukannnya untuk pertahanan.

AS Dan UE Siapkan Sanksi Baru Bagi Rusia WASHINGTON ( Waspada): Uni Eropa dan AS akan memberi sanksi baru kepada Rusia terkait aksinya di Ukraina yang menyebabkan kerusuhan di bagian timur negara itu. Sanksi itu mengemuka setelah para menteri luar negeri nega-

Korban Ranjau Darat Naik 90 Persen Di Kamboja PHNOM PENH, Kamboja (Antara/Xinhua-OANA): Korban ranjau darat dan artileri yang tidak meledak meningkat pesat dalam dua bulan pertama tahun ini, kata satu laporan Otoritas Bantuan Korban dan Tindakan Ranjau Kamboja Selasa (15/ 4). Negara melaporkan 40 korban, enam orang meninggal dan 34 luka-luka, selama periode Januari-Februari tahun ini, naik 90 persen dari 21 korban, dua orang tewas dan 19 luka-luka, dibandingkan periode yang sama tahun lalu, kata laporan itu. Negara Asia Tenggara itu merupakan salah satu negara terburuk diduniadalamhalmenderitaranjaudarat. Satuperkiraan4.000.0006.000.000 ranjau darat dan amunisi lainnya yang tersisa dari tiga dekade perang dan konflik internal yang berakhir pada tahun 1998.Lima provinsi baratlaut menderita terburuk akibat ranjau darat dan artileri yang tidak meledak di Battambang, Banteay Meanchey , Oddar Meanchey, Pailin dan Preah Vihear.

Gema Internasional

ra-negara anggota Uni Eropa bertemu di Luksemburg. Mereka sepakat memperluas “daftar sanksi terbaru untuk Rusia seperti pembekuan aset dan pencabutan visa.” Saat ini ketegangan terusmeningkatdiUkrainasetelah kelompok militan bersenjata proRusia menempati beberapa gedung pemerintah di kota-kota bagian timur. Senin (14/4), demikian klaim AS, pesawat jet tempur Rusia terbangrendahdidekatkapalperang AS di Laut Hitam. Presiden AS BarackObamatelahmelakukankontak telefon dengan Presiden Rusia Vladimir Putin Senin malam. KelompokproRusiamenyerangkantor kepolisian di wilayah timur Ukraina. Putin mengatakan kepada Obama bahwa tuduhan campur tangan Rusia di Ukraina merupakan“informasiyangtidakberdasar danpatutdipertanyakan.”Menurut Kremlin,kerusuhanditimurUkraina merupakan akibat “keengganan danketidakmampuanpemimpin di Kiev untuk memperhitungkan kepentinganpendudukberbahasa Rusia di wilayah itu.” Di sisi lain, Obama mengatakan kepada Putin bahwa dia “sangat prihatin” terhadap dukungan Rusia kepada kelompok militan bersenjata. (afp/m10)

Putin Dan War Game SELEPAS mengakhiri jabatannya sebagai PM Rusia dan Presiden Dmitry Medvedev bersedia pula ‘meluncur’ ke jabatan perdana menteri yang ditinggalkan Putin karena dia akan maju lagi ‘mengambil’ jabatan Presiden Federasi Rusia. Majunya kembali menjadi penguasa di Kremlin telah mendapatpenentangandandemonstrasi besar-besaran di seantero Rusia. Vladimir Putin terpilih kembali untuk ketiga kalinya sebagaiPresidenMaret2012lalu. Dicurigai, Putin melakukan tindakan-tindakan tak terpuji untuk meraih suara pemilih. Komisi Pemilihan Umum dalampenghitungansuararesmi menyatakan bahwa Putin menang dengan 63 persen suara pemilih, dia mengalahkan empat pesaingnyayangdikatakansebagai‘pelengkappenderita’demokrasi ala Rusia (baca: Putin). Setelah terpilih, Putin mulai melakukantindakankeraspada para penentangnya sementara dia memobilisasi konstuensinya yang semakin menyusut melawan musuh iamjinernya: Barat yang kuat, berbahaya yang mempengaruhi pola pikir sebagian tertentu rakyat Rusia. Undang-undang untuk itu telah diloloskan tentang pembatasan berkumpul publik dan kegiatan NGO (organisasi non-pemerintah); sekitar tiga lusin warga dari berbagai elemen sosial politik telah dipenjarakan. Tindakan keras yang diambil cukup efektif: apabila risiko demonstrasi menjadi tinggi, jumlah protes dan pemrotes berkurang menjadi kecil karena hilangnya kepemimpinan gerakan pemrotes dan timbulnya saling tuduh sesama kelompok penentang ini. Tentang usaha mobilisasi, hasilnya beragam: pengakuan terhadap rating Putin sebagaimanadiukurolehLevadaCenter satu-satunya organisasi polling independenkembalimelambung

setelah pemilihan tetapi kemudian terbenam lagi. Pengakuan yang tinggi ini yang dinikmatinya sekitar 70 persen dianggap sebagai memori yang jauh. Olimpiade Musin Dingin di SochimenaikkanratingPutinpada tingkat pasca pilpres dan sewaktu Rusia melakukan invasi ke Ukraina ratingnya telah terdorong melebihi 70 persen. Poll Levada yang dilaksanakan pada minggu kedua Maret lalu menunjukkan betapa efektif mesin propaganda pemerintah: mayoritas rakyat Rusia percaya bahwa Ukraina tak memiliki pemerintahan yang legitimate,bahwaparapemimpin etnis Rusia di sana berada dalam bahaya dan disalahkan menimbulkan perpecahan dengan kelompok nasionalis. Menurut sejarah, bahwa Rusia adalah sebuah negeri yang ‘terkepung,’dikelilingiolehbanyak musuh dan terus menerus seolaholahberadadijurangmalapetaka, secara sentralistik oleh politik Rusia, secara umum dan lebih tegasnyakhususpolitikPutin.Dalam kampanye propagandanya terhadap Ukraina, Kremlin telah menggunakancitraterusanPerang Dunia II, termasuk Swastika (Jerman). Akhir tahun lalu, Rusia dimobilasi untuk melawan laki-laki ‘gay,’lesbian,dan‘agen luar negeri.’ Hasilnya bahwa seseorang bisa disebutfacist,Westerner,Ukranian, American, atau gabungan dari semuanya. Dan kepada rakyat Rusia,seseorangatausemuaistilahistilah ini secara pendek disebut: enemy. Jika situasi di Rusia di bawah Putin,bisadikatakansecaraumum di negara-negara authoritarian dapat disebut bahwa takaran “opinipublik”terkenalsangattidak dapat dipercaya, bukan karena pengukurannyatidakakurattetapi lebih karena warganya dalam masyarakat seperti itu sensitif dan responsif pada setiap perubahan kekuasaan. Opinidapatberubahsewaktu-

waktu ibarat membalikkan uang picisan di tangan. Putin dengan intuitifnya merasakan hal ini, mengapa mobilisasi kampanye anti-Ukraina-nya mengikuti jalan secara all-out menyerang media independen yang masih eksis di Rusia, seperti saluran televisi independen, Dozhd-TV, atau Rain-TV yang sudah di ambang tutup setelah dihentikan penggunaan satelit dancablecarriers.Demikianjuga halnya dengan pemilik on-line news yang paling luas, Lenta ru yang independen kemudian digantidenganseorangkakitangan Kremlin. Kamis lalu, rakyat menemukan bahwa tiga independentnews-and-commentarysites menghilang, meskipun rakyat Rusia masih bisa mengaksesnya di luar Rusia. Denganmembungkamatau melenyapkan para pengeritiknya, Putin tetap maju ke depan dengan war game yang telah dimulainya. Jalan yang ditempuh untuk menggalang popularitasnya ialah dengan cara mengeskalasikan retorika perangnyadanusahaperangitusendiri. Putin akan melanjutkan dengan melukiskanWesterner/ Facist/Ukrainiansebagaimusuh yang lebih berbahaya dan invasi Rusia ke Ukraina adalah lebih penting.Haliniberarti,Putintidak berminat dalam hal mencari solusi damai. Atau sebagaimana beberapa analis Barat dengan harapan penuh menganjurkan suatu strategi jalan keluar yang memungkinkan Putin ‘tidak hilangmuka.’Saya(penulis)melihat Putin akan jalan terus dengan pemikirannya, dia memerlukan perang di Ukraina agar berlangsung terus dan menyebar. Bagi rakyat Ukraina, kalau memang terjadi sungguh sangat mengerikan. DanbagiRusiasendiri,akan berkembang lebih terisolasikan dari pergaulan dunia dan itu artinya memiskinkan rakyat Rusia. Yah, begitulah! (Kosky)


Sport

A10

WASPADA Rabu 16 April 2014

Lawan Ngaku Nyonya Tua Lebih Super ROMA ( Waspada): Gol Sebastian Giovinco dan Fernando Llorente, Senin (Selasa WIB), membawa Juventus menang tandang 2-0 atas Udinese pada giornata 33 Liga Seri A. Tambahan tiga poin di Stadiun Friuli ini sekaligus memastikan Super Juve merestorasi keunggulan delapan angkanya di atas tim peringkat dua AS Roma. Allenatore Francesco Guidolin bangga dengan perjuangan pasukannya, namun dia mengaku Si Nyonya Tua memang lebih super. “Kami menjalani laga yang bagus, kami berani, dan saya puas dengan penampilan kami,” jelasnya. “Tapi Anda hanya dapat melepas topi karena mereka lebih superior dibandingkan Anda. Juve mengendalikan permainan, mereka kuat secara fisik, mereka merupakan

tim terkuat di kejuaraan,” tambah Guidolin, seperti dilansir Sky Sports, Selasa (15/4). Semula ada pemikiran Juve asuhan Antonio Conte, yang takluk 0-2 di markas Napoli dua pekan silam, kembali bakal tergelincir di Friuli. Namun pemikiran demikian segera terhapus, setelah pertandingan berlangsung berat sebelah. Giovinco membuka keunggulan tim tamu menit 16. Llorente menambahi gol kedua 10 menit berselang untuk membuat Udinese memiliki tugas sangat berat di Stadion Friuli yang nyaris kosong. “Pada pertandingan seperti ini, kami dapat kehilangan angka-angka. Udinese tim yang membiarkan Anda mengendalikan situasi, kemudian menghantam Anda melalui serangan balik,” ucap Conte. “Namun saya pikir kami melakukannya dengan tepat perihal sikap, fokus, dan aplikasi,” katanya menambahkan.

Udinese 47% 0 12 1 3 1 12 2 1 0

Dengan kondisi penyerang Carlos Tevez yang mengalami cedera otot aductor, Giovinco mendapat kesempatan langka untuk berduet dengan Llorente. Bomber mungil berjuluk ‘Atomic Ant’ itu memaksimalkannya dengan mencetak gol pembuka. Giovinco merangsek melewati Maurizio Domizzi dan menaklukkan kiper Simone Scuffet dengan sepakan kaki kiri yang mengarah ke sudut jauh sang kiper. Giovinco nyaris menggandakan golnya beberapa menit kemudian. Tetapi kali ini Scuffet mampu membendung sepakan rendah sang penyerang hingga hanya menghasilkan tendangan sudut. Menit 26 Llorente tanpa kesulitan memasukkan bola ke gawang I Friulani. Itu merupakan gol ke-14 yang dibukukan striker Spanyol tersebut musim ini di Seri A, semuanya dari permainan terbuka.

AP

(m15/ant/afp/sky/uefa)

STRIKER Juve Fernando Llorente merayakan golnya ke gawang Udinese dengan rekan-rekannya di Stadion Friuli, Selasa (15/4) dinihari WIB.

Juve

Penguasaan Bola 53% 2 Skor Akhir 11 Tembakan Total 3 Tembakan Tepat 5 Tembakan Pojok 1 Penyelamatan 15 Pelanggaran 2 Offsides 3 Kartu Kuning 0 Kartu Merah *Sumber ESPN

Klasemen Liga Seri A Juventus 33 28 3 2 71-22 AS Roma 33 24 7 2 68-19 Napoli 33 20 7 6 63-35 Fiorentina 33 17 7 9 56-37 Inter Milan 33 13 14 6 55-35 Parma 33 13 12 8 53-42 Torino 33 13 9 11 49-42 AC Milan 33 13 9 11 50-44 Lazio 33 13 9 11 44-44 Atalanta 33 14 4 15 38-44 Hellas 33 14 4 15 50-57 Sampdoria 33 11 8 14 40-49 Genoa 33 10 9 14 36-43 Udinese 33 11 5 17 35-46 Cagliari 33 7 12 14 31-45 Chievo 33 8 6 19 30-49 Bologna 33 5 13 15 27-51 Livorno 33 6 7 20 36-64 Sassuolo 33 6 7 20 32-62 Catania 33 4 8 21 24-58

87 79 67 58 53 51 48 48 48 46 46 41 39 38 33 30 28 25 25 20

Optimis Minus Mesin Gol MADRID (Waspada): Seperti halnya Barcelona, Real Madrid juga bermasalah dalam kelengkapan pemain pilar, ketika bertarung pada final Copa Del Rey dinihari WIB nanti di Stadion Mestalla, Valencia. Bek sayap Marcelo diperkirakan absen karena cedera otot belakang. Bek sentral Sergio Ramos semestinya dapat bugar setelah absen saat Madrid menang 4-0 atas Almeria, Sabtu lalu, namun belum juga ada konfirmasi pasti dari Los Blancos. Pemain terbaik dunia Cristiano Ronaldo masih diragukan dapat mentas, karena cedera otot paha belakang yang dideritanya saat menang 3-0 atas Borussia Dortmund dua pekan silam di Liga Champions. Mesin gol Madrid asal PorKAPTEN Barca Carles Puyol siap membela entrenador Gerardo Martino. -AP-

Barca Krisis Bawah MADRID (Waspada): Barcelona diterpa badai krisis jelang menjajal Real Madrid pada final Copa Del Rey dinihari WIB nanti di Stadion Mestalla. Tak hanya mental menyusul kekalahan dengan skor identik 0-1 dari Granada di La Liga dan Atletico Madrid di Liga Champions, tetapi juga krisis komposisi pilar terutama di bagian bawah. Setelah ditinggal bek sentral Gerrard Pique, El Barca kini juga harus kehilangan Marc Bartra. Menurut Football Espana, Selasa (15/4), bek muda Spanyol itu menderita cedera hamstring, sehingga tak bisa diturunkan melawan El Barca. Entrenador Gerardo ‘Tata’ Martino tak punya banyak pilihan, sebab stok pemain belakang Barca memang sangat sedikit. Sejaih ini hanya Javier Mascherano yang bisa diandalkan mengawal jantung pertahanan Blaugrana. Opsi lain yang bisa dilakukan Tata adalah memainkan gelandang bertahan Alex Song atau Sergio Busquets sebagai tandem Mascherano, yang sejatinya berposisi sebagai gelandang tengah.

Langkah itu sudah dilakukan Tata akhir pekan lalu, hasilnya Lionel Messi cs menyerah di markas Granada. Harapan lainnya, kondisi kapten Carles Puyol bisa pulih, setelah bergelut dengan cedera sepanjang musim ini. “Saya masih berusaha keras untuk menyiapkan diri jelang final Copa. Saya ingin bermain di semua laga-laga terakhir musim ini,” ungkap Puyol. “Masih ada waktu tersisa dan saya akan melakukan segalanya untuk berupaya sembuh, fit dan turun bermain. Kita lihat saja besok,” tambah bek veteran Spanyol tersebut. Tata sendiri sedang dikritik kinerjanya, menyusul anjloknya penampilan dan prestasi Neymar cs sepanjang bulan ini. Beberapa media Spanyol malah melansir kemungkinan Tata dipecat sebelum musim ini berakhir, lengkap dengan memunculkan calon pengganti, di antaranya Diego Simeone (Atletico Madrid) dan Juergen Klopp (Borussia Dortmund). Tapi menurut Puyol, Tata tak layak dijadikan kambing hitam. “Sangat mudah untuk mengkritik pelatih ketimbang 25 pemain. Tapi jika sesuatu

berjalan salah, maka itu kesalahan semua orang,” bela Puyol. “Saya berharap yang terbaik untuknya. Dia pelatih hebat dan punya kontrak satu tahun lagi. Kami siap mati untuknya dan dia rela mati demi kami,” katanya menambahkan. Puyol pun mengajak seluruh elemen untuk melupakan kekalahan dari Granada dan melangkah ke depan dengan memenangi Piala Raja kemudian berjuang mempertahankan mahkota La Liga. “Saya ingin mengatakan kepada fans bahwa kami akan memberikan yang terbaik dan kami harus tetap bersama, semua hal akan menjadi lebih mudah,” pintanya. “Kami kehilangan beberapa hal dan membiarkan kami mendapatkan kritikan. Sekarang kami akan bertarung di final dan lima pertandingan lagi di liga,” tambah Puyol. Barca sejauh ini menjadi pengoleksi terbanyak Piala Raja dengan prestasi 26 kali juara. Berikutnya Athletic Bilbao (23), Real Madrid (18), Atletico Madrid (10), Valencia (7), Real Zaragoza (6), Sevilla (5), dan Espanyol (4). (m15/ant/fe/sky)

tugal itu sudah tidak tampil pada tiga pertandingan terakhir dan kelihatannya masih riskan untuk dimainkan melawan El Catalan. Namun entrenador Carlo Ancelotti optimis, Los Blancos mampu mengatasi Los Cules kendati mentas minus sang mesin gol, yang kini memimpin daftar top skor Liga Champions dan La Liga. “Ronaldo akan selalu dirindukan, tapi para pemain tidak akan mengatakan ‘Ya Tuhan, apa yang bisa kita lakukan tanpa dia?’ Mereka punya kepercayaan diri,” ucap Ancelotti. “Mereka sudah menunjukkan bisa menang tanpa Ronaldo. Ini kesempatan kami untuk tampil bagus di final,” papar pria Italia itu melalui Marca, Selasa (15/4). Meski sudah kembali berlatih normal, Ronaldo masih diragukan bermain di Mestalla. Bintang berusia 29 tahun itu sepertinya lebih diproyek-

“Seharusnya kami menang di Bernabeu, tapi sekarang kami punya peluang untuk melampiaskan dendam. Saya pikir duel final nanti akan berjalan dengan tensi tinggi. Tidak pernah mudah menghadapi Barcelona, tapi filosofi permainan mereka selalu sama, yakni banyak mengontrol bola,” beber Ancelotti. “Dalam laga melawan Barca, kamilah yang pantas menang. Itu bukanlah El Clasico yang normal, karena banyaknya penalti yang terjadi,” timpal bek Kepler Pepe lewat Football Espana. Bek asal Portugal itu yakin, El Clasico di final Copa Del Rey kali ini akan berjalan sangat seimbang, karena berlangsung di tempat netral. “Kami akan memainkan permainan kami dan pastinya fans akan mendukung kami. Tidak ada yang difavoritkan. Kami punya peluang sama dan Madrid sudah siap,” pungkas Pepe. (m15/ant/rtr/mrc/fe) ENTRENADOR Carlo Ancelotti tidak mau memaksakan Christiano Ronaldo main melawan Barca di Stadion Mestalla. -AP-

Kans Kebangkitan Citizens LONDON (Waspada): Kekalahan 2-3 dari Liverpool akhir pekan lalu pada matchday 33 Liga Premier, tidak membuat str iker E din Dzeko ( foto depan) pesimistis menatap peluang juara Manchester City. Bomber Bosnia-Herzegovina itu yakin, Citizens segera bangkit dengan titik balik ketika menjamu Sunderland dinihari WIB nanti di Etihad Stadium. “Saya sungguh yakin, seperti saat terakhir kami memenangi gelar (2012), bahwa persaingan ini akan berlangsung ketat sampai akhir,” ucap Dzeko, seperti dilansir Sky Sports, Selasa (15/4). The City kini menduduki peringkat tiga dengan 70 poin dari 32 laga, tetapi masih punya dua pertandingan tunda di kandang sendiri melawan Sunderland dan Aston Villa. “Terlalu awal untuk mengatakan hasil hari Minggu

Radja, Claudia Bantah KDRT ROMA (Waspada): Kabar tak sedap menerpa kehidupan gelandang anyar AS Roma, Radja Nainggolan. Pemain berdarah Batak itu dilaporkan melakukan aksi kekerasan dalam rumah tangga (KDRT) terhadap istrinya, Claudia Lay. Disebutkan, seseorang melihat pasangan suami istri penggemar tato itu bertengkar di jalanan Cagliari. Orang itu lantas melaporkan kejadiannya kepada polisi. Akibat KDRT tersebut, Claudia (foto) dilaporkan terpaksa dirawat selama 20 hari di rumah sakit. Tetapi pasutri yang sudah dikaruniai seorang anak itu sama-sama membantah kabar dimaksud. “Siapa yang yang berkelahi dengan suami? Itu hanya perselisihan,” tulis Claudia dalam akun twitter pribadinya, seperti dikutip dari Football Italia, Selasa (15/4). “Itulah hanyalah adu argumen. Saya tidak menampar dia. Apa kalian bercanda,” timpal Radja. “Saya ingin mengatakan kepada semua orang, pikirkan urusan Anda sendiri. Ada beberapa masalah dalam keluarga, namun saya tak pernah menampar seseorang,” tambah gelandang Belgia tersebut. Polisi Cagliari mengatakan kepada kantor berita Ansa, Claudia memang menangis di mobil ketika mereka mendatangi tempat kejadian. Kabar itu tentunya dapat mengganggu usaha Radja membantu Roma menjuarai Liga Seri A serta menembus Timnas Belgia asuhan pelatih Marc Wilmots. Nainggolan sebelumnya mengklaim, dirinya sudah pantas untuk mentas di Piala Dunia 2014, Juni mendatang. “Di sini (Roma) saya mendapat kesempatan untuk lebih

sikan untuk pertandingan semifinal Liga Champions melawan Bayern Munich pada 23 dan 29 April mendatang. “Kondisi Ronaldo semakin membaik setiap harinya, saya tidak bisa mengatakan dia akan absen. Tapi kami tidak ingin mengambil risiko. Jika dia tidak main, saya tidak akan mengubah permainan. Para pemain tahu gaya permainan tim,” klaim Ancelotti. Mantan pelatih Paris SG, Chelsea, AC Milan dan Juventus itu yakin, trofi pertama musim ini dari Piala Raja akan memperbesar peluang untuk merajai La Liga dan Eropa. “Final ini penting untuk banyak alasan,” tegasnya. “Pertama, karena ini merupakan gelar pertama musim ini yang dapat kami menangi. Kedua, karena kami menghadapi tim hebat Barcelona. Semua itu membuat duel ini memiliki banyak kepentingan. Memenangi trofi pertama musim ini sangat memotivasi kami,” tambah Ancelotti. Apalagi, El Real dua kali kalah dari El Barca di pentas La Liga musim ini. Luka Modric cs tumbang 1-2 di Camp Nou dan 3-4 dalam duel dramatis di Santiago Bernabeu, 23 Maret lalu.

Wordpress.com

dikenal. Seorang pemain harus dinilai akan apa yang telah dilakukannya di lapangan, selebihnya terserah pelatih,” klaimnya. Sejak gabung I Giallorossi dari Cagliari, Januari lalu, bintang berusia 25 tahun itu memang sangat berperan di lapangan tengah Roma. Tapi sepanjang karirnya, Nainggolan baru lima kali membela tim senior Belgia sejak melakoni debut tahun 2009 silam. “Saya telah bermain baik dalam beberapa tahun belakangan. Jadi saya rasa saya pantas mendapat tempat di tim nasional Belgia,” pungkas Nainggolan. (m15/vvn/fi/ansa)

Premier League Malam Ini (GMT) Everton v C Palace Man City v Sunderland

18:45 18:45

Klasemen Liga Premier Liverpool 34 Chelsea 34 Man City 32 Everton 33 Arsenal 33 Tottenham 34 Man United 33 Southampton 34 Newcastle 34 Stoke City 34 West Ham 33 C Palace 33 Hull City 33 Aston Villa 33 Swansea 34 West Brom 33 Norwich 34 Fulham 34 Cardiff 34 Sunderland 32

Mirror

lalu akan menentukan perburuan gelar juara berakhir. Sebab, kami masih punya enam pertandingan untuk dimainkan, sedangkan Liverpool

maupun Chelsea sama-sama punya empat laga sisa,” papar Dzeko. “Orang-orang bicara soal tekanan dan hal-hal seperti itu,

24 5 23 6 22 4 19 9 19 7 18 6 17 6 13 9 14 4 11 10 10 7 11 4 10 6 9 7 8 9 6 15 8 8 9 3 7 8 6 7

5 5 6 5 7 10 10 12 16 13 16 18 17 17 17 12 18 22 19 19

93-42 77 66-24 75 86-32 70 53-31 66 56-40 64 48-48 60 56-38 57 50-45 48 38-52 46 38-48 43 37-44 37 24-39 37 34-40 36 35-49 34 45-50 33 40-51 33 26-53 32 34-74 30 30-64 29 29-54 25

tapi itu tidak terlalu penting. Hanya yang memenangi pertandingan paling banyak antara saat ini dan akhir musim yang jadi juara,” katanya lagi.

Bek Martin Demichelis juga punya keyakinan demikian. Apalagi Liverpool dan Chelsea masih saling bertarung pada matchday 36, sehingga bisa saja menghasilkan keuntungan bagi pasukan Manuel Pellegrini. “Kami akan berjuang sampai akhir. Tak ada satu pun yang meninggalkan stadion (Anfield) dan berpikir bahwa mereka sudah juara,” tegas Demichelis melalui DailyStar. Kans kebangkitan Citizens memang sangat besar untuk menguasai klasemen akhir Liga Premier. Pasalnya, lawan-lawan mereka berikutnya relatif lebih lunak dibandingkan The Reds maupun The Blues, yakni West Brom, Crystal Palace, Everton dan West Ham United. “Mere k a j u g a m a s i h memungkinkan untuk membuat kesalahan. Semoga kami bisa memenangkan laga-laga tersisa dan ada saatnya kesalahan dibuat Liverpool,” harap Demichelis. (m15/vvn/sky/ds)

El Matador Paling Mahal RIO DE JANEIRO (Antara/ AFP): Spanyol, Argentina dan Brazil, memiliki anggota tim termahal dari 32 tim yang berkompetisi di Piala Dunia 2014. Menur ut laporan keuangan konsultan analisis olahraga Pluri Consultoria, yang dikutip Selasa (15/4), skuad sang juara bertahan asuhan entrenador Vicente Del Bosque (foto) bernilai sekitar 486,9 juta euro. Taksiran harga El Matador itu mengungguli nilai 474,1 juta euro untuk Argentina dan 470,2 juta euro untuk tuan rumah Brazil. Perusahaan itu menilai tim Jerman memiliki nilai 445,6 juta euro, disusul Prancis yang melebihi nilai anggota tim Inggris. Les Bleus bernilai 398,6 juta euro, dan 354,2 juta euro untuk pasukan Roy Hodgson. Belgia mengungguli Italia dengan 336,1 juta euro, sedangkan Gli Azzurri 322,4 juta euro.

Laporan itu juga menilai, bintang Argentina dan Barcelona Lionel Messi merupakan pemain dengan nilai tertinggi, yakni 138,1 juta euro. Namun angka itu turun 1,4 persen dari perkiraan nilainya tahun lalu. Superstar Portugal dan Real Madrid, Cristiano Ronaldo, justru nilainya naik 11,4 persen dibanding tahun lalu. Setelah mendapat penghargaan pemain terbaik dunia,

nilai Ronaldo 107,3 juta euro, lebih besar dari sepertiga total nilai 287 juta euro bagi keseluruhan tim Portugal. Honduras menjadi tim dengan nilai terkecil, hanya bernilai sekitar 32,3 uta euro atau kurang dari seperempat nilai Messi. Harga Honduras separuh dari nilai 67,4 juta euro bintang Brazil dan Barcelona, Neymar Junior, yang harganya naik 22,5 persen.

AP

Edi Simon Telah Tiada MEDAN (Waspada): Mantan pemain nasional dan PSMS Medan tahun 1960-an, Edi Simon, meninggal dunia di kediamannya Kompleks POR Pelita Jaya Sawangan, Depok, Jawa Barat, Minggu (13/4) malam. Menurut Sekretaris Umum PSMS pimpinan dr Fauzi Nasution SpB, Julius Raja SE, almarhum dikebumikan Senin (14/4) diberangkatkan dari rumah duka dan diantar puluhan mantan pemain PSSI

maupun PSMS yang berdomisili di Jakarta dan Jawa Barat. Edi Simon, berhasil membawa PSMS Junior menjuarai Piala Suratin 1980, telah banyak melahirkan pemain-pemain berkaliber di antaranya Ricky Yakobi, Edi Harto, H Juanda, Sutrisno, Supardi, Bambang Usmanto, dan lainnya. Almarhum meninggal dunia karena stroke. Mantan Pelatih PSSI U-19 di tahun 1988 itu terakhir menangani Diklat Sepakbola Sa-

wangan. Sebelumnya, almarhum pernah menangani Diklat Sepakbola Medan. Ketua Harian PSMS, Drs Azam Nasution MAP, Selasa (15/4), menyatakan sepakbola nasional khususnya Sumut dan Medan telah kehilangan sosok pelatih dan pembina sepakbola andal. Raja menambahkan Edi yang terkenal sebagai pelatih bertangan dingin itu meninggalkan seorang istri dan dua orang anak. (m17)


Sport

WASPADA

A11 Tiga Poin Pertama Persiraja

Rabu 16 April 2014

Ungguli PSMS Medan 1-0 BANDA ACEH (Waspada): Persiraja mengawali kompetisi Divisi Utama Liga Indonesia 2014 dengan hasil maksimal. Laskar Rencong mengemas tiga poin pertama dengan meraih kemenangan tipis atas PSMS Medan 1-0 di Stadion H Dimurthala, Banda Aceh, Selasa (15/4).

Munawardi Ismail/Waspada

GELANDANG Persiraja, Fitra Ridwan (10), mencetak gol tunggal untuk kemenangan Laskar Rencong atas PSMS Medan, Selasa (15/4).

Kijang Gunung Belum Beruntung Ditaklukkan PSPS Pekanbaru 0-1 PEKANBARU (Waspada): PS Bintang Jaya Asahan gagal mencuri poin di kandang PSPS Pekanbaru dalam laga pertamanya di kompetisi Divisi Utama Liga Indonesia 2014, Selasa (15/4) sore. Klub berjuluk Kijang Gunung ini kalah tipis 0-1 atas klub mantan kontestan Indonesian Super League (ISL) itu. Gol tunggal PSPS tercipta di menit 25, saat barisan pertahanan Bintang Jaya tidak mampu menahan serangan PSPS. Di saat Bintang Jaya berusaha mengejar ketertinggalan, justru pemain belakang Luis diganjar kartu merah karena dinilai wasit melakukan pelanggaran keras. Akibatnya, Kinjang Gunung hanya tampil dengan 10 pemain dan harus menerima kekalahan. “Saya puas dengan penampilan anak-anak dan kemampuan mereka sudah sama dengan PSPS. Kekalahan ini karena kami belum beruntung saja,” ujar Sekretaris Tim PS Bintang Jaya, H Azwar Mahmud, saat dihubungi Waspada, kemarin.

Divisi Utama LI 2014

Waspada/Sapriadi

SKUAD PS Bintang Jaya Asahan gagal mencuri poin di kandang PSPS Pekanbaru dalam laga pertamanya di kompetisi Divisi Utama Liga Indonesia 2914, Selasa (15/4). Menurut Azwar, berdasarkan evaluasi pertandingan, Bintang Jaya dinilai cukup kelelahan karena baru tiba di Pekanbaru pada Senin (14/5) pukul 12.00. Dua jam setelah sampai, timnya baru ke Stadion Kaharuddin Nasution, sehingga hanya bisa latihan 30

menit. Sedangkan untuk Selasa pagi, saat Bintang Jaya ingin melanjutkan latihan di stadion, tidak diizinkan oleh panitia. “Pemain Bintang Jaya tidak cukup istirahat, ditambah lagi mereka hanya bermain 10 orang setelah satu pemain ke-

disapa Rocky didampingi Kadis PUD Mahyeddin, Selasa (15/4), meninjau langsung sejumlah venue yang sedang dibangun, termasuk Gedung ISC di Titi Baro serta lintasan balap motor di Pusat Perkantoran Pemkab Aceh Timur di Idi Rayeuk. Tidak hanya itu, pantauan Waspada, sejumlah lokasi pertandingan cabang olahraga

lain juga terus dipersiapkan seperti lapangan tembak di sisi kanan Kantor Satpol PP dan WH serta lokasi panjat tebing di sisi kanan lapangan upacara di Idi. Kabid Sarana dan Prasarana PP Pora XII/2014, Mahyeddin, mengatakan pihaknya sangat optimis Pora di Aceh Timur akan berlangsung sukses. Pihaknya terus mengawasi

Waspada/M Ishak

BUPATI Aceh Timur, Hasballah HM Thaib, meninjau lintasan balap motor persiapan ajang Pekan Olahraga Aceh (Pora) XII/2014 pada Juni mendatang.

na kartu merah. Namun demikian, hal ini akan menjadi pembelajaran sehingga pada pertandingan berikutnya tidak terulang lagi,” ucap Azwar. Selasa (22/4) mendatang, PS Bintang Jaya menjamu Persirja Banda Aceh di Stadion Mutiara Kisaran. (a15)

hadapi lawan-lawan tangguh di Pora nanti, Aceh Timur sudah menyiapkan pemain-pemain terbaik,” ujar Ketua Umum Pengcab PSTI Aceh Timur, Saifuddin, Selasa (15/4). Menurutnya, meski daerah lain jauh-jauh hari sudah menyatakan siap menurunkan pemain-pemain terbaik berstandar nasional, PSTI

Problem Catur

TTS TOPIK

Hitam melangkah, memakan Bd8 dalam tiga langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1

A

B

C

D

E

F

Aceh Timur selaku tuan rumah tidak pernah gentar sedikit pun menghadapi perlawanan tim-tim tamu. “Tim kami sudah siap bertanding dengan kemampuan terbaik untuk meraih medali emas. Saat ini tim sepak takraw Aceh Timur sedang mempersiapkan 12 pemain. Mereka saat ini menjalani pemusatan

G

H

MEDAN (Waspada): Laga perdana PSBL Langsa mengarungi kompetisi Divisi Utama Liga Indonesia 2014 berakhir kurang memuaskan. Dijamu PS Kwarta di Stadion Teladan Medan, Selasa (15/4), PSBL kalah 0-1. Bertindak sebagai tim tamu, PSBL tampil defensif di awal permainan. Di lini depan, skuad besutan Anwar pun hanya mengandalkan satu penyerang dalam diri Zainuddin ditopang Kiki Harisandi dan kapten Moussa Traore yang sesekali naik. Sebaliknya, PS Kwarta belum berani melancarkan serangan dan masih mencari-cari celah. Hal ini berakibat bola lebih banyak berkutat di tengah lapangan dan alur permainan monoton. Sebelum jeda, playmaker anyar tuan rumah Jorge Alberto Abdala nyaris mencetak gol. Namun sepakannya hanya membentur mistar gawang PSBL yang dikawal Oki Rengga. Begitu babak kedua dimulai, pola kedua tim berubah. PSBL menempatkan dua striker, sedangkan gelandang

Waspada/Austin Antariksa

KAPTEN PSBL Moussa Traore (8) menghalau bola dari serbuan pemain PS Kwarta dalam laga perdana Divisi Utama Liga Indonesia 2014 di Stadion Teladan Medan, Selasa (15/4).

pembangunan sejumlah venue, termasuk persiapan penginapan atlet di sekolahsekolah. “Persiapan Panitia Penyelenggara Pora di Aceh Timur semakin matang, terutama dari segi pembangunan sejumlah venue. Kami optimis semua fasilitas akan selesai dibangun tepat pada waktunya, sehingga Pora berlangsung sukses,” kata Mahyeddin. Ditambahkan, pada akhir Mei 2014 seluruh venue termasuk Gedung ISC dutargetkan sudah siap dibangun. Menurutnya, meski baru 1,5 tahun memusatkan pemerintahan di Idi pasca-pemekaran dari Langsa, Aceh Timur siap menyukseskan Pora. “Tentunya dengan dukungan masyarakat dan semua pihak pelaksaaan Pora bisa sukses. Kami berkomitmen dan sudah siap menyelenggarakan Pora dengan lebih baik dari penyelenggaraan sebelum-sebelumnya,” pungkas Mahyeddin. (b24)

Ratusan Pelajar Bireuen Ikut Porseni

latihan berjalan,” sebutnya. “Dari 12 atlet dimaksud, empat di antaranya sudah punya pengalaman hingga ke luar negeri. Insya Allah, tim akan menjalani TC penuh pada Mei nanti. Namun sebelum itu tim akan melakukan ujicoba Tur Sumatera Utara guna mengasa mental pemain,” tandas Saifuddin. (b24)

KOTA JUANG (Waspada): Sejumlah 336 pelajar Madrasah Ibtidaiyah (MI) yang tergabung dalam Gugus MI Bireuen, mengikuti Pekan Olahraga dan Seni (Porseni) di MIN Cot Meurak Bireuen, 14-17 April 2014. Ketua Gugus MI Bireuen, Sardani SPd, mengatakan kegiatan ini memperlombakan sembilan cabang olahraga dan seni, yakni lari 80 meter, sepakbola, lomba azan, MTQ, hifzil Alquran, pidato, kaligrafi, cerdas cermat, dan rebana. “Semoga Porseni ini dapat memunculkan bibit unggul di bidang olahraga dan seni,” ujar Sardani yang juga Kepala MIN Cot Meurak. Sejumlah sekolah yang mengirimkan pesertanya dalam kegiatan ini adalah MIN Bireuen, MIN Juli, MIN Cot Batee, MIN Cot Trieng, MIN Blang Bladeh, MIN Blang Rheum, MIS Cot Keutapang, dan MIN Cot Meurak. (cb02)

PSTI Aceh Timur Target Emas IDI (Waspada): Pengurus Cabang Persatuan Sepak Takraw Indonesia (PSTI) Aceh Timur target meraih medali emas Pekan Olahraga Aceh (Pora) XII/2014. Sebagai tuan rumah, tim sepak takraw Aceh Timur sudah siap menghadapi lawanlawan tangguh daerah lain. “Persiapan tim terus kami lakukan. Bahkan untuk meng-

Fitra yang mengambil tendangan free kick itu sukses menempatkan bola ke pojok paling kiri gawang PSMS. Kiper tim tamu Guntur Pranata hanya terpana melihat bola mengoyak jalanya. Skor 1-0 bertahan hingga wasit Yudi Prasojoin. Pemain Persiraja yang mengenakan pita hitam tanda berkabung, memulai kompetisi dengan kombinasi pemain tua dan muda. Sebelum mengawali pertandingan, kedua kesebelasan berdoa serta menghening cipta karena tuan

gol. “Finishing memang masih menjadi kendala kita hingga sekarang,” ujarnya. Meski sukses mengutip tiga poin perdana, Akhyar mengaku aksi Safrizani cs di lapangan belum memuaskan pihaknya. “Kami harus segera mencari solusi dari tumpulnya lini depan, dengan membuat persiapan lebih matang di pertandingan kedua,” katanya. Pelatih PSMS, Kustiano, mengakui pertandingan kedua tim berlangsung alot dan bagus. “Kedua tim sudah bermain bagus, hanya saja kami yang tidak bisa mencetak gol,” ungkapnya. Mantan Pelatih PSAP Sigli ini menerima kekalahan dari pasukan Lampineueng. “Kami tidak ingin mencari kambing hitam dengan kekalahan ini. Kami akan perbaiki kekurangan hari ini pada laga selanjutnya,” papar Kustiono. (b07)

PSBL Kalah Beruntung

Persiapan Pora Makin Matang IDI (Waspada): Persiapan yang dilakukan Panitia Penyelenggara (PP) Pekan Olahraga Aceh (Pora) XII/2014 di Kabupaten Aceh Timur semakin matang. Tidak sebatas pembangunan fasilitas outdoor dan indoor Gedung Idi Sport Centre (ISC), sejumlah fasilitas lain juga dipacu. Bupati Aceh Timur, Hasballah HM Thaib atau akrab

Memulai laga musim ini di Grup I, sebenarnya tuan rumah sedang didera sejumlah problem. Tapi publik Banda Aceh bersyukur, berbagai masalah yang sedang dihadapi Laskar Rencong tidak membebani pemain saat tampil di lapangan. Kemenangan 1-0 dipastikan tuan rumah lewat sepakan terarah Fitra Ridwan pada menit 59. Bola tendangan bebas diberikan usai pemain bawah tim tamu mengganjal seorang pemain depan Laskar Rencong.

rumah dalam suasana berkabung atas meninggalnya Mawardy Nudin dan Zahruddin. Baik Persiraja maupun PSMS berusaha membangun serangan sepanjang pertandingan. Tuan rumah punya peluang lebih dulu mencetak gol. Sayangnya, dua kans lewat Septi Hariansyah gagal mengoyak jala tim tamu. Persiraja mencetak gol di menit 22. Hanya saja, hentakan Angga Parnanda yang membuat bola membentur mistar dan terpantul ke dalam gawang tidak menjadi gol akibat pemain bernomor 9 ini terperangkap offside. Skor kacamata bertahan hingga turun minum. Pelatih Laskar Rencong, Akhyar Ilyas, mengatakan skuadnya mampu menguasai permainan. Dia juga menyayangkan sejumlah peluang yang gagal dikonversi menjadi

PS Kwarta mulai berimprovisasi. Sayang, dewi fortuna belum berpihak kepada pasukan Elang Biru. Pasalnya, PS Kwarta berha-

Waspada/Abdul Mukthi Hasan

PERSONIL grup drum band MIN Bireuen menunjukkan kebolehan mereka dalam acara pembukaan Porseni Gugus MI Bireuen di MIN Cot Meurak Bireuen, Senin (14/4).

KESEHAT TAN KESEHA

sil memecah kebuntuannya. Menit 57, umpan tarik Ikhsan Lubis sempat mengenai pemain belakang PSBL sehingga kiper mati langkah. Alhasil, bola liar di muka gawang yang kosong mudah ditanduk M Ismail Ramadani. Moussa Traore cs pun tak patah arang. Serangan bertubi-tubi mereka lancarkan ke jantung pertahanan tuan rumah yang dikoordinir Roni Fatahillah. Kewalahan dengan agresivitas tim tamu, para pemain PS Kwarta mulai bermain keras. Kondisi serupa diladeni anak-anak PSBL, sehingga tensi kedua tim memanas. Wasit pun mengeluarkan tiga kartu kuning kepada pilar PSBL, masing-masing Raf-

sanjani, Hendrik Handoko, dan Fachrul Razi. Tak hanya itu, dahi Traore juga sempat berlumuran darah dan terpaksa diperban. “Awalnya kami memang tampil bertahan dan mengandalkan serangan balik. Di babak kedua, kami bermain dengan dua penyerang, tapi belum beruntung juga. Toh demikian, anak-anak sudah berusaha maksimal,” ungkap coach Anwar. “Kami akui PS Kwarta meraih kemenangan karena mampu memanfaatkan peluang. Sebaliknya kami masih beradaptasi dengan lapangan, apalagi rumput licin. Biar begitu, kami terima kekalahan ini,” sebut Anwar sportif. (m33)

Tamsis Dominasi Kejuaraan Wadokai BINJAI (Waspada): Perguruan Taman Siswa (Tamsis) Binjai tampil sebagai juara umum Kejuaraan Antardojo Wadokai bertajuk Taman Siswa Cup I/2014. Kejuaraan tersebut berakhir Selasa (15/4) di Perguruan Tamsis. Tamsis Binjai menjadi juara umum dengan meraih 5 medali emas, 1 perak, dan 2 perunggu. Medali emas diraih Lala Tantri Sagala (2), Ledy De Vega Sagala, Siti Hardiyanti, dan Dandi Taman Dani. Perak disumbangkan Siti Hardiyanti. Sebelumnya, kejuaraan dibuka resmi Ketua Perguruan Tamsis Binjai Ki H Prabowo didampingi Ki Raharji, Kordinator Ki Ahyal Muhajar, dan Faizal Amri. Menurut Ki H Prabowo, Kejuaraan ini mendapat restu Wakil Wali Kota Binjai Timbas Tarigan SE dan Ketua Forki Binjai Maruli Sagala. Kejuaraan ini total diikuti 11 dojo yang berasal dari Binjai dan Langkat. (a04)

Sudoku MENDATAR

MENURUN

1. Organisasi para dokter (singkatan). 3. Singkatan Majelis Kehormatan Etik Kedokteran (menangani pengaduan pasien) 5. Kode Etik Kedokteran Indonesia (dokter bersumpah untuk mentaati dan mengamalkannya). 8. Kulit yang menebal dan mengeras. 9. Pohon yang rasa kulitnya pahit, digunakan sebagai obat antimalaria. 11. Kehilangan daya ingat terutama tentang masa lalu. 13. Kata penggolong bagi pil atau tablet. 15. Anggota badan digunakan untuk makan dan minum. 17. Alat untuk memeriksa saluran hidung. 18. Rumah Sakit Islam. 20. Pusing, seolah keadaan sekitar berputar-putar. 22. Integrated Ultrasonic Transducer. 24. Pembantu dokter, selain suster. 25. Air Susu Ibu. 27. Sembuh; Pulih. 29. Ilmu kebidanan. 32. Standard Oxygen Required. 33. Rasa nyeri haid. 34. Takaran obat untuk sekali pakai (kelebihan berarti over——).

1. Perkakas untuk memanaskan bayi prematur. 2. Lemah syahwat. 3. Penyakit yang ditularkan oleh nyamuk anofeles. 4. Pipa karet yang dimasukkan ke saluran kandung kemih. 5. Buah mirip sawo, kaya vitamin C (155%). 6. Panggilan akrab dokter. 7. Bisul pada tengkuk. 10. Suntik. 12. Cairan memabukkan, banyak dipakai dalam industri dan pengobatan. 14. Ahli dalam pembuatan obat-obatan untuk dijual di apotek. 16. Berasa sakit seperti ditusuk-tusuk. 19. Spesialis Anak. 21. Tidak muda lagi. 23. Kuat (Inggris). 24. Sakit perut seperti diremas-remas. 26. Spesialis Telinga, Hidung dan Tenggorok. 28. Radang bernanah. 30. Spesialis Urologi. 31. Intra Uterine Device.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari 10 menit. Jawabannya di halaman A2 kolom 1.

4 7 3 6 4 2 9 6 5 4 1 3 1 5 4 3 5 6 5

9 1 1 9 4 5 8 6 2 6 7 7 2 7 2 ***440


Sport

WASPADA Rabu 16 April 2014

A11

PSMS Tanpa Kambing Hitam Dipecundangi Persiraja BANDA ACEH (Waspada): Persiraja Banda Aceh mengawali kompetisi Divisi Utama Liga Indonesia 2014 dengan kemenangan 1-0 atas PSMS Medan di Stadion H Dimurthala, Banda Aceh, Selasa (15/4). Pelatih PSMS, Kustiono, mengakui pertandingan kedua tim berlangsung alot dan bagus. Mantan Pelatih PSAP Sigli ini pun menerima kekalahan dari pasukan Lampineueng. “Kami tidak ingin mencari kambing hitam dengan kekalahan ini. Kami akan perbaiki kekurangan hari ini pada laga selanjutnya,” papar Kustiono. Sebenarnya tuan rumah sedang didera sejumlah problem. Tapi publik Banda Aceh bersyukur berbagai masalah yang sedang dihadapi Laskar Rencong tidak membebani pemain saat tampil di lapangan. Kemenangan tuan rumah dipastikan lewat sepakan terarah Fitra Ridwan menit 59. Bola tendangan bebas diberikan usai pemain bawah Ayam Kinantan mengganjal pemain depan Laskar Rencong. Tampil sebagai eksekutor, Fitra

sukses menempatkan bola ke pojok kiri gawang PSMS yang dikawal Guntur Pranata. Pemain Persiraja yang mengenakan pita hitam tanda berkabung, memulai kompetisi dengan kombinasi pemain tua dan muda. Sebelum mengawali pertandingan, kedua kesebelasan berdoa serta menghening cipta karena tuan rumah dalam suasana berkabung atas meninggalnya Mawardy Nurdin dan Zahruddin. Sebenarnya Persiraja sudah mencetak gol di menit 22. Hanya saja, hentakan Angga Parnanda yang membuat bola membentur mistar dan terpantul ke dalam gawang tidak menjadi gol akibat offside. Pelatih Persiraja, Akhyar Ilyas, mengatakan skuadnya mampu menguasai permainan. Namun, Akhyar juga menyayangkan sejumlah peluang yang gagal dikonversi menjadi gol oleh pemain depan. Dikatakan, finishing memang masih menjadi kendala timnya. Meski sukses mengutip tiga poin, Akhyar mengaku aksi Safrizani cs belum memuaskan. (b07)

Waspada/Austin Antariksa

GOL kemenangan PS Kwarta atas PSBL di laga perdana Divisi Utama Liga Indonesia 2014 di Stadion Teladan Medan, lahir dari sundulan kepala M Ismail Ramadani (2 kanan), Selasa (15/4).

Burung Sumatera Terbang Tinggi Divisi Utama LI 2014 MEDAN (Waspada): Laga perdana PS Kwarta mengarungi kompetisi Divisi Utama Liga Indonesia 2014 berakhir dengan kemenangan. Menjamu PSBL Langsa di Stadion Teladan Medan, Selasa (15/4), Burung Sumatera menang 1-0.

Waspada/Hang Tuah J Said

ANDALAN Real STIK-P David Swayana (kanan) sulit diimbangi Immortal dalam lanjutan Liga Futsal STIK-P di Lapangan De Futsal, Jl STM Medan, Selasa (15/4).

Real STIK-P Tak Terbendung MEDAN (Waspada): Kendati masih menyisakan satu pertandingan, Real STIK-P sudah memastikan gelar juara Liga Futsal Sekolah Tinggi Ilmu Komunikasi “Pembangunan” (STIK-P) Medan, Selasa (15/4). Kepastian itu didapat Austin Tumengkol cs setelah mengalahkan Immortal 6-4. Raihan tiga angka tersebut menjadikan Real STIK-P mengantongi nilai sembilan dari tiga laga. Perolehan tim gabungan dosen, alumni, dan mahasiswa tingkat akhir ini sudah tidak mungkin terkejar oleh pesaingnya. Dalam laga kontra Immortal, Real STIKP tampil dominan dan langsung mencetak tiga gol di babak pertama. Ketiga gol disumbangkan Andi Arispati, Jafar Wijaya, dan Phillip Joseph. Mengawali babak kedua, Immortal mencuri gol lewat Reza Perdana. Tak ingin kehilangan peluang mengamankan trofi, Real STIK-P memasukkan David Swayana. Masuknya alumnus tersebut terbukti menjadi mimpi buruk bagi Immortal. Pasalnya, David langsung mencetak gol begitu menginjakkan kaki di lapangan. Keunggulan Real STIKP diperbesar dua gol tambahan dari Andi. Agak mengendur, gawang Real yang dikawal Dio Utama dibobol Reza, Ade Juanda, dan T Furqon. Skor 6-4 bertahan hingga peluit panjang.

“Alhamdulillah kami berhasil mengamankan gelar kampiun sesuai target awal. Meski mayoritas pemain tua, terbukti semangat juang dan kekompakan kami tak tertandingi para junior. Kami pun berharap ini menjadi motivasi bagi mereka untuk mengejar prestasi di kemudian hari,” ujar duet veteran Real, Austin dan David. Bagi Immortal, kekalahan ini menjadikan mereka wajib menang di laga pamungkas melawan Gunners FC. Menariknya, kedua tim berpeluang menjadi runner-up karena samasama memiliki empat poin. Selain kedua tim tersebut, Peluru FC juga punya kans merebut medali perak. Melawan Spartan ’13, Lihavez Suprima cs unggul 5-3. Asa Peluru dihidupkan lima gol yang dihasilkan Rahmad Hidayat, Christopel, Fiqih Adi, dan Arif Rahman Hakim (2). Ketiga gol Spartan lahir dari kaki Steven dan M Nor Darmansyah (2). Bila menang di laga terakhir kontra Real STIK-P dan bersamaan duel Immortal melawan Gunners berakhir seri, Kamis (17/4) besok, gelar runner-up disandang Peluru FC. Bila salah satu dari Immortal atau Gunner menang, Peluru hanya bisa merebut gelar juara ketiga dengan catatan menang atas Real STIK-P. (m33)

Yonkav 6/Serbu Olahraga Antarbalalyon MEDAN (Waspada): Batalyon Kavaleri 6/ Serbu Asam Kumbang menggelar olahraga bersama antarbatalyon di lapangan olahraga Yonkav di Jl Asam Kumbang, Selasa (15/4). Cabang yang dipertandingkan di antaranya sepakbola, bola voli, tenis lapangan, dan lainnya mendapat sambutan cukup meriah dari masing-masing suporter batalyon. Hadir dalam kegiatan tersebut Komandan Batalyon (Danyon) dari Yon Armed dan Yon Zipur serta Detasemen Polisi Militer dan tuan rumah Yon Kavaleri. Danyon Kavaleri 6/Serbu Letkol Kav Yudi Prasetio melalui Pasi Intel Lettu Kav Widi Kuncoro mengatakan, kegiatan

olahraga bersama ini bertujuan mempererat tali silaturahim sesama anggota TNI-AD. “Setelah disibukkan dengan tugas di kesatuan masing-masing, kita kumpul bersama melaksanakan kegiatan olahraga. Dengan berolahraga badan menjadi sehat, begitu juga dengan rohani kita,” kata Kuncoro. Pantauan Waspada, kegiatan olahraga bersama batalyon ini menjadi hiburan tersendiri bagi warga Yonkav yang datang beramai-ramai ke lapangan olahraga menyaksikan berbagai pertandingan. Pertandingan sepakbola yang paling banyak penontonnya karena masing-masing batalyon dengan suporter saling memberikan dukungan agar timnya yang sedang bermain memperoleh kemenangan. (m39)

Waspada/Rudi Arman

TTS TOPIK

Problem Catur Hitam melangkah, memakan Bd8 dalam tiga langkah.

Jawaban di halaman A2. 8

7

6

5

4

3

2

1

A

B

C

D

E

F

PARA pejabat dari masing-masing batalyon melakukan pertandingan tenis di lapangan Yonkav 6/Serbu, Jl Asam Kumbang Medan, Selasa (15/4).

G

H

Kendati berstatus sebagai tuan rumah, skuad besutan Slamet Riyadi bermain hatihati di awal permainan. Playmaker anyar PS Kwarta, Jorge Alberto Abdala, pun belum nyetel karena masih beradaptasi. Ditambah Alberto sedikit terkejut dengan cuaca terik. Sebaliknya, PS Kwarta belum berani melancarkan serangan

dan masih mencari-cari celah. Hal ini berakibat bola lebih banyak berkutat di tengah lapangan dan alur permainan monoton. Sebelum jeda, Jorge Alberto nyaris mencetak gol. Namun sepakannya hanya membentur mistar gawang PSBL yang dikawal Oki Rengga. Begitu babak kedua dimu-

lai, pola kedua tim berubah. PSBL menempatkan dua striker, sedangkan barisan gelandang PS Kwarta mulai berimprovisasi dan menemukan irama. Terbukti, tuan rumah memecah kebuntuan lewat gol M Ismail Ramadani. Menit 57, umpan tarik Ikhsan Lubis sempat mengenai pemain belakang PSBL sehingga kiper mati langkah. Alhasil, bola liar di muka gawang yang kosong mudah ditanduk Ismail. Ketinggalan, Moussa Traore cs pun tak patah arang. Serangan bertubi-tubi mereka lancarkan ke jantung pertahanan PS Kwarta yang dikoordinir Zico Aifa dan Roni Fatahillah. Frustrasi tak kunjung

mampu mencetak gol, para pemain PSBL mulai bermain keras. Akibatnya, pemain kedua kubu kerap melakukan pelanggaran hingga tensi permainan memanas. Pelipis Roni pun terluka dan terpaksa dilarikan ke rumah sakit. Begitupula dahi Moussa Traore berlumuran darah hingga perlu diperban. Hingga akhir laga, skor 1-0 bertahan untuk PS Kwarta. “Saya akui anak-anak belum in di awal pertandingan karena masih grogi, apalagi mereka melakoni debut kompetisi. Barulah babak kedua mereka mulai percaya diri dan berani improvisasi. Syukurlah, kami berhasil meraih kemenangan,” ujar pelatih PS Kwar-

ta, Slamet Riyadi. M Ismail Ramadani, pencetak gol kemenangan Burung Sumatera, juga tak bisa menutupi kegembiraan bahwa timnya berhasil merebut poin penuh. Kepada Waspada, Ismail mengaku bangga menjadi penentu keberhasilan timnya. “Ini menjadi kebanggaan tersendiri bagi saya. Gol ini pun saya persembahkan kepada PS Kwarta dan keluarga tercinta,” sebut pemilik nomor punggung 21 ini. “Kami bermain terlalu bertahan, tapi pemain sudah berusaha maksimal. PS Kwarta layak menang karena mereka mampu memanfaatkan peluang,” aku coach PSBL, Anwar. (m33)

Kijang Gunung Belum Beruntung PEKANBARU (Waspada): PS Bintang Jaya Asahan gagal mencuri poin di kandang PSPS Pekanbaru dalam laga pertamanya mengarungi kompetisi Divisi Utama Liga Indonesia 2014, Selasa (15/4). Klub berjuluk Kijang Gunung ini kalah tipis 0-1 atas mantan kontestan Indonesian Super League (ISL) itu. Gol tunggal PSPS tercipta di menit 25 oleh Ifrawadi, saat barisan pertahanan Bintang Jaya lengah. Di saat Bintang Jaya berusaha mengejar ketertinggalan,

justru bek Luis Irsandi diganjar kartu merah karena dinilai wasit melakukan pelanggaran keras. Akibatnya, Kijang Gunung hanya tampil dengan 10 pemain dan sulit mengimbangi permainan lawan. “Saya puas dengan penampilan anak-anak dan kemampuan mereka sudah sama dengan PSPS. Kekalahan ini karena kami belum beruntung saja,” ujar Sekretaris Tim PS Bintang Jaya, H Azwar Mahmud, saat dihubungi Waspada. Menurut Azwar, berdasar-

Wakil Sumut Terus Melaju BWF World Junior Championship 2014 ALOR STAR, Malaysia (Waspada): Pebulutangkis putra junior masa depan Indonesia berdarah Sumut, Anthony Sinisuka Ginting, melaju ke babak 8 Besar BWF World Junior Championship 2014. Pada laga berlangsung di Stadion Sultan Abdul Halim, Alor Star, Malaysia, Selasa (15/4), Ginting menundukkan Kantawat Leelavechabutr (Thailand) 21-10, 21-16. Tiket babak 8 Besar dipastikan dengan mengalahkan Seung Jae Seo (Korsel) 2220, 12-21, 21-18. Langkah mulus Ginting menyusul Jonatan Christie yang lebih dulu lolos dengan mengungguli Soon Yang Bernard Ong (Singapura) 21-23, 21-9, 21-9. Sebelumnya, M Bayu Pangesthu menang atas Pham Hong Nam (Vietnam) 21-11, 21-7. “Saya sempat kehilangan konsentrasi di game kedua, karena dapat lapangan yang berangin. Kontrol bola agak sulit sehingga banyak pukulan ke luar,” kata Ginting. “Pada game kedua, lawan juga tampil lebih sabar. Tapi saya masih bisa mengatasi perlawanannya. Sebetulnya dia tidak terlalu berbahaya, poin yang ia peroleh juga lebih banyak dari kesalahan saya sendiri,” tambahnya. Berbeda di tunggal putri, Indonesia gagal hanya menyisakan wakil setelah Ruselli Hartawan, Fitriani, dan Aurum Winata kalah. Di ganda putri, Apriani/Rosyita Eka Putri Sari menang atas Hye Jeong Kim/Hee Yong Kong (Korsel) 21-18, 21-16. Ganda campuran mencetak kejutan ketika M Rian Ardianto/ Rosyita Eka memaksa unggulan kedua Jung Ho Kim/Hye Jeong Kim (Korsel) bertekuk lutut 22-24, 21-14, 21-15. Reinard Dhanriano/Nisak Puji Lestari mengatasi Alexander Bond/Ditte Soby Hansen (Denmark) 11-21, 21-17, 21-13. Di ganda putra, Rian yang berpasangan dengan Hendrik Clinton mengungguli Sze Fei Goh/Jinn Hwa Tan (Malaysia) 21-23, 21-12, 21-19. (yuslan)

kan evaluasi pertandingan, Bintang Jaya dinilai cukup kelelahan karena baru tiba di Pekanbaru pada Senin (14/4) siang. Dua jam setelah sampai, timnya uji lapangan ke Stadion Kaharuddin Nasution. Pada Selasa pagi, panitia tidak memberi izin saat Bintang Jaya ingin melanjutkan latihan di stadion. “Pemain Bintang Jaya tidak cukup istirahat, ditambah lagi mereka hanya bermain 10 orang setelah Luis kena kartu merah. Namun demikian, hal

Waspada/Sapriadi

SKUAD PS Bintang Jaya Asahan gagal mencuri poin di kandang PSPS Pekanbaru dalam laga pertamanya mengarungi kompetisi Divisi Utama Liga Indonesia 2014, Selasa (15/4). ini akan menjadi pembelajaran sehingga pertandingan berikutnya tidak terulang lagi,” ucap Azwar.

Pada Selasa (22/4) mendatang, PS Bintang Jaya menjamu Persiraja Banda Aceh di Stadion Mutiara Kisaran. (a15)

Timnas U-19 Cepat Adaptasi JAKARTA (Waspada): Pelatih Timnas U-19, Indra Sjafri, menilai proses adaptasi anak asuhnya berjalan bagus sehingga mampu tampil maksimal saat menjalani pertandingan ujicoba melawan tuan rumah Uni Emirat Arab (UEA). Evan Dimas cs pada ujicoba melawan UEA di Tyeyab Awana Stadium, Dubai, Senin (14/4) malam, mampu menang telak 4-1. Kemenangan besar ini di luar dugaan karena lawan yang dihadapi merupakan salah satu tim kuat di Asia. “Proses adaptasi berlangsung dengan cepat. Bahkan semua pemain langsung menunjukkan kemampuan terbaik sejak awal pertandingan,”

kata Indra Sjafri seperti dilansir Tim Media PSSI, Selasa (15/4). Menurut dia, kemenangan besar atas tuan rumah UEA jelas mampu membangkitkan moral anak asuhnya. Apalagi tim Garuda Jaya ini diharapkan mampu meraih hasil maksimal pada Piala AFC U-19 di Myanmar pada akhir tahun nanti. Meski demikian, pihaknya meminta kepada semua pemain untuk tidak langsung puas diri karena tantangan lebih berat masih menghadang. Timnas dihimbau lebih fokus, apalagi akan kembali menjalani laga ujicoba kedua melawan UEA. “Ada tiga atau empat pe-

main inti UEA yang tidak bermain. Bagi kami bukan soal, karena kami yakin semua tim akan lebih baik seiring waktu,” kata pelatih asal Sumatra Barat itu. Sesuai rencana, pertandingan ujicoba kedua antara Timnas U-19 dan Timnas UEA U-19 di Tyeyab Awana Stadium, Dubai, akan digelar pada Rabu (16/4) ini. Pada laga ketiga Tur Timur Tengah itu, Indra Sjafri mengaku belum menentukan komposisi pemain yang diturunkan. Meski demikian, pelatih dengan lisensi A AFC mengaku puas dengan performa tim saat mengalah UEA di pertandingan pertama. (m42/ant)

Tamsis Dominasi Kejuaraan Wadokai BINJAI (Waspada): Perguruan Taman Siswa (Tamsis) Binjai tampil sebagai juara umum Kejuaraan Antardojo Wadokai bertajuk Taman Siswa Cup I/2014. Kejuaraan tersebut berakhir Selasa (15/4) di Perguruan Tamsis. Tamsis Binjai menjadi juara umum dengan meraih 5

KESEHAT TAN KESEHA

medali emas, 1 perak, dan 2 perunggu. Medali emas diraih Lala Tantri Sagala (2), Ledy De Vega Sagala, Siti Hardiyanti, dan Dandi Taman Dani. Perak disumbangkan Siti Hardiyanti. Sebelumnya, kejuaraan dibuka resmi Ketua Perguruan Tamsis Binjai Ki H Prabowo didampingi Ki Raharji, Koordi-

nator Ki Ahyal Muhajar, dan Faizal Amri. Menurut Ki H Prabowo, Kejuaraan ini mendapat restu Wakil Wali Kota Binjai Timbas Tarigan SE dan Ketua Forki Binjai Maruli Sagala. Kejuaraan ini total diikuti 11 dojo yang berasal dari Binjai dan Langkat. (a04)

Sudoku MENDATAR

MENURUN

1. Organisasi para dokter (singkatan). 3. Singkatan Majelis Kehormatan Etik Kedokteran (menangani pengaduan pasien) 5. Kode Etik Kedokteran Indonesia (dokter bersumpah untuk mentaati dan mengamalkannya). 8. Kulit yang menebal dan mengeras. 9. Pohon yang rasa kulitnya pahit, digunakan sebagai obat antimalaria. 11. Kehilangan daya ingat terutama tentang masa lalu. 13. Kata penggolong bagi pil atau tablet. 15. Anggota badan digunakan untuk makan dan minum. 17. Alat untuk memeriksa saluran hidung. 18. Rumah Sakit Islam. 20. Pusing, seolah keadaan sekitar berputar-putar. 22. Integrated Ultrasonic Transducer. 24. Pembantu dokter, selain suster. 25. Air Susu Ibu. 27. Sembuh; Pulih. 29. Ilmu kebidanan. 32. Standard Oxygen Required. 33. Rasa nyeri haid. 34. Takaran obat untuk sekali pakai (kelebihan berarti over——).

1. Perkakas untuk memanaskan bayi prematur. 2. Lemah syahwat. 3. Penyakit yang ditularkan oleh nyamuk anofeles. 4. Pipa karet yang dimasukkan ke saluran kandung kemih. 5. Buah mirip sawo, kaya vitamin C (155%). 6. Panggilan akrab dokter. 7. Bisul pada tengkuk. 10. Suntik. 12. Cairan memabukkan, banyak dipakai dalam industri dan pengobatan. 14. Ahli dalam pembuatan obat-obatan untuk dijual di apotek. 16. Berasa sakit seperti ditusuk-tusuk. 19. Spesialis Anak. 21. Tidak muda lagi. 23. Kuat (Inggris). 24. Sakit perut seperti diremas-remas. 26. Spesialis Telinga, Hidung dan Tenggorok. 28. Radang bernanah. 30. Spesialis Urologi. 31. Intra Uterine Device.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari 10 menit. Jawabannya di halaman A2 kolom 1.

4 7 3 6 4 2 9 6 5 4 1 3 1 5 4 3 5 6 5

9 1 1 9 4 5 8 6 2 6 7 7 2 7 2 ***440


Sport

A12

WASPADA Rabu 16 April 2014

Singkirkan Suns, Grizzlies Rebut Tiket Playoff PHOENIX, AS (Waspada): Memphis Grizzlies berhasil merebut tiket terakhir ke babak playoff NBA musim ini. Tiket diraih dengan menyingkirkan Phoenix Suns dalam laga lanjutan di Phoenix, AS, Selasa (15/4).

AP

PEMAIN Memphis Grizzlies Mike Conley (11) melepaskan umpan melewati Miles Plumlee (22) di laga lanjutan NBA di Phoenix, AS, Selasa (15/4). Grizzlies menang 97-91.

PenampilanagresifMikeConley dan Zach Randolph di 68 detik terakhir di pertandingan ini. Akhirnya, Grizzlies berhasil meraih kemenangan atas Suns dengan skor 97-91 untuk mendapatkan tiket terakhir di posisi

delapan Wilayah Barat. Suns sempat memimpin 9190 lewat sumbangan angka dari Miles Plumlee saat pertandingan tersisa 1 menit 27 detik.Tapi, Conley yang menerima umpan dari Randolph, langsung melepaskan

Lorenzo Berharap Argentina Tak Serupa Austin AUSTIN, AS (Waspada): Perburuan gelar buat Jorge Lorenzo di dua seri awal berujung pahit. Setelah terjatuh di Losail, joki Movistar Yamaha ini malah kena penalti drive-through akibat jump start. Menyadari startnya buruk di musim ini, Lorenzo enggan menatap lama-lama papan klasemen MotoGP. Buatnya, belum waktunya untuk fokus terhadap persaingan juara. Perhatiannya kini berkonsentrasi penuh pada upayanya untuk kembali kompetitif dan tentunya, mengincar raihan podium pertamanya. “Saya tak harus memikirkan persaingan gelar sekarang, awal musim ini saya jalani dengan sangat, sangat buruk,” ungkap Lorenzo, sebagaimana disadur Speed, Selasa (15/4). “Tapi masih ada 16 seri balapan dan sekarang, target saya adalah mencapai level kompe-

titif sesegera mungkin dan berupaya keras mendapatkan podium pertama saya, sekaligus memperjuangkan kemenangan secepatnya,” lanjutnya. Menanggapi kritik yang belakangan menguntitnya, Loren-

zo hanya bisa merespons dingin. Namun jangan sangka keterpurukannya di dua seri awal menjatuhkan spirit dan motivasinya. “Sekarang sangat mudah untuk mengatakan bahwa Lorenzo tak lagi sama, bahwa Lo-

Cedera Crutchlow Tidak Parah AUSTIN, AS (Waspada): Pebalap tim Ducati, Cal Crutchlow dikabarkan menderita dislokasi pada jari kelingkingnya ketika mengalami kecelakaan pada seri kedua MotoGP Grand Prix (GP) Austin dini hari tadi.Tetapi ia diprediksikan akan berada dalam kondisi fit dalam dua minggu kedepan jelang GP Argentina, 27 April. Seperti yang diketahui, joki kelahiran 28 tahun silam tersebut terjadi ke perlombaan berjalan 12 lap dan harus melalui bantuan tim medis untuk keluar dari lintasan.Pada awalnya kekhawatiran atas kondisi Crutchlow sangat tinggi, jika melihat pembengkakan yang terjadi di salah satu jarinya. Namun, kekhawatiran itu pun sirna ketika pihak medis memberikan keterangan resmi bahwa mantan joki Yamaha Tech 3 ini hanya menderita di lokasi pada jari kelingking dan memar di tangan kanannya. Tetapi pernyataan tim medis tidak buru-buru diamini oleh pihak Crutchlow. Mantan juara SuperSport World Championship ini akan mengunjungi seorang dokter spesialis di San Diego Selasa (15/4), untuk pemeriksaan lebih lanjut. “Saya hanya mengingat sedikit kecelakaan tersebut, itu adalah sudut cepat dan tampak seperti kecelakaan normal tapi saya terjebak dengan motor. Akibatnya tangan saya terbentur dengan amat keras, saya mengalami dislokasi pada kelingking dan pembengkakan pada tangan,” tutur Crutchlow, kepada Eurosport. (ers/m47)

Pasang Iklan Telp. 4528431 HP. 081370328259

Email: iklan_waspada@yahoo.co.id waspada.iklan@gmail.com

lemparan tiga angka sehingga membuat Grizzlies berbalik unggul 93-91 saat pertandingan tersisa 1 menit delapan detik. Suns kembali mencoba mencetak poin untuk menyamakankedudukan.Sial,GoranDragic membuat kesalahan sehingga bola berhasil direbut oleh Randolph yang membuat angka berubah menjadi 95-91 dengan waktu tersisa 47,4 detik lagi. “Ini sangat stres, berada dalam sebuah pertandingan yang kedua tim membutuhkan kemenangan ini. Setiap kami mem-

buat angka, mereka mampu membalasnya,” kata Conley, diberitakan ESPN, Selasa (15/4). “Saya ingin memberikan pujian kepada Suns yang bermain sepenuh hati. Kami mampu mengatasi perlawanan Suns sepanjang pertandingan itu,” lanjut pemain yang menghasilkan 14 poin dan tujuh assist itu. Randolph menjadi topskor untuk Grizzules dengan mengemas 32 poin dan sembilan rebound. Dari kubu Suns, pemain cadangan Markief Morris menghasilkan angka tertinggi 21 poin, se-

Untuk atas nama klien kami “RESTORAN GARUDA SIANTAR”, beralamat di Jl. Ahmad Yani No. 113 Kota Pematang Siantar, dengan ini kami beritahukan

Sesuai dengan surat dari salah seorang pemegang saham kepada Direksi perseroan, maka dengan ini mengundang seluruh Pemegang Saham PerseroanTerbatas PT. EMBUN SARI ABADI, berkedudukan di Medan untuk menghadiri Rapat Umum Pemegang Saham Luar Biasa yang akan diselenggarakan pada:

- Bahwa sebagai Kuasa Hukum Manajemen Restoran Garuda Siantar, Restoran Garuda Rantau Prapat membantah keras pemberitaan yang tidak benar tersebut pada harian tersebut.

Atas Pelantikan:

- Bahwa pihak Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar telah membuat surat resmi bantahan berita No. 16/35/D.Kom/Pms kepada harian “Tribun Siantar” yang menerbitkan pemberitaan tersebut.

Bapak H. Zainuddin, Mars

- Bahwa pihak Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar telah membuat surat resmi bantahan berita No. 16/36/D.Kom/Pms kepada Pimpinan Harian “Metro Siantar” yang menerbitkan pemberitaan tesebut.

Sebagai Wakil Bupati Deliserdang Periode 2014-2019 Oleh Gubernur Sumut Bapak H Gatot Pujo Nugroho, ST, MSi

- Bahwa pihak Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar telah membuat surat resmi bantahan berita No. 16/37/D.Kom/Pms kepada Pimpinan Harian “Siantar 24 Jam” yang menerbitkan pemberitaan tersebut.

Pada Sidang Paripurna DPRD Deliserdang di Lubuk Pakam, Senin, 14 April 2014 Ttd:

Drs Hasiholan Sinaga

Muhammad Ridwan

Ketua

Sekretaris

Herman Sagita Bendahara

Spoelstra, karena butuh waktu bermain setelah absen cukup lama akibat cedera hamstring.Tapi, Wade juga kurang maksimal dan hanya menyumbangkan sembilan poin dan tiga assist. “Tidakakanadakekecewaan. Ketika playoff dimulai, kami punya musim baru dan kami akan sangatmenantikannya,”ujarWade. Michael Beasley menjadi penyumbang angka terbanyak untuk Heat dengan 18 poin. Toney Douglas mencetak 14 poin, sementara Ray Allen 13 poin. (esp/m47)

dangkan Goran Dragic dan Charming Frye sama-sama menghasilkan 14 poin untuk tuan rumah. DiWashingtong, Miami Heat menelan kekalahan dariWashington Wizards yang membuat Indiana Pacers dipastikan menjadi unggulan teratas Wilayah Timur di babak playoff. Heat dikalahkan Wizards pada pertandingan di Verizon Center. Tampil tanpa LeBron James dan Chris Bosh, sang juara bertahan menyerah dengan skor 93-114. DwyaneWade tetap diturunkan oleh pelatih Heat, Erik

PEMBERITAHUAN

Pengurus Persatuan Sepakbola Deliserdang (PSDS )

dan

108-113 100-110 95-93 95-108 98-104 89-101 119-104

PANGGILAN RAPAT UMUM PEMEGANG SAHAM PT. EMBUN SARI ABADI MEDAN

- Bahwa kami Pihak Manajemen Restoran Garuda Siantar tidak pernah ditunjukkan buktinya (nasi kotak) yang terdapat serangga oleh pihak wartawan harian tersebut.

Bapak H. Ashari Tambunan

Boston - Philadelphia Milwaukee - Toronto Charlotte - Atlanta Orlando - Chicago San Antonio - Houston Oklahoma City - New Orleans LA Lakers Utah

renzo sudah berubah. Baiklah, saya terima kritik-kritik itu. Tapi apa yang bisa saya lakukan? Saya akan bekerja keras dan ketika situasi bertambah sulit, biasanya saya malah semakin termotivasi,” tambah Lorenzo. Setidaknya di GP Americas lalu, Lorenzo bisa mendapatkan poin pertamanya berkat finis di posisi 10. Pastinya, usai jeda singkat menjelang seri Santiago del Estero di GP Argentina, target lebih tinggi jadi acuan walau dengan harapan, trek baru di Argentina tak menyerupai sulitnya trek Austin. “Jika trek di Argentina sama dengan di Austin, tentu akan berat. Tapi jika treknya normal, mungkin akan lebih mudah dan lebih baik buat saya,” tutup jawara MotoGP 2010 dan 2012 itu. (spe/m47)

kepada pelanggan/relasi, masyarakat umum, instansi sipil dan militer sebagai berikut: - Dengan adanya pemberitaan Harian “Tribun Siantar, Metro Siantar dan Siantar 24 Jam” pada Edisi Jumat, 11 April 2014 yang ditulis media yang mana pemberitaannya amat sangat merugikan manajemen Restoran Garuda Siantar, Restoran Garuda Rantau Prapat dan Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar, yang telah kami jalin bersama dengan baik dan benar.

Sebagai Bupati Deliserdang

Hasil Lain

- Bahwasanya pihak Bank Indonesia menyatakan: a. WARTAWAN TERSEBUT TIDAK HADIR DALAM ACARA PERTEMUAN YANG DISELENGGARAKAN OLEH DEPUTI PERWAKILAN BANK INDONESIA PEMATANG SIANTAR. b. WARTAWAN YANG ADA MELIPUT ACARA TERSEBUT MENGAMBIL KETERANGAN DARI ORANG LAIN YANG TIDAK DIKENAL DAN BUKAN SEBAGAI KARYAWAN PERWAKILAN BANK INDONESIA PEMATANG SIANTAR. c. PIHAK PERWAKILAN DEPUTI BANK INDONESIA PEMATANG SIANTAR MENYATAKAN KALAU PUN ITU SUATU KEKHILAPAN YANG TIDAK DISENGAJA OLEH PIHAK RESTORAN GARUDA SIANTAR, MERUPAKAN HAL YANG LAZIM DAN NORMAL DAPAT TERJADI KEPADA PEMILIK RUMAH MAKAN YANG LAIN (ADA 250 KOTAK CUMA 1 KOTAK YANG BERMASALAH). d. PIHAK PERWAKILAN DEPUTI BANK INDONESIA PEMATANG SIANTAR MEMBANTAH BERITA TERSEBUT KARENA MERUGIKAN PIHAK MANAJEMEN RESTORAN DAN BANK INDONESIA PEMATANG SIANTAR. - DENGAN INI KAMI BERTINDAK SEBAGAI KUASA HUKUM RESTORAN GARUDA PEMATANG SIANTAR MEMPERTEGASKAN BAHWA JARINGAN RESTORAN GARUDA PEMATANG SIANTAR, GARUDA RANTAU PRAPAT, MILIK KLIEN KAMI TIDAK SAMA DENGAN RESTORAN GARUDA YANG LAIN DAN TIDAK MEMILIKI HUBUNGAN. BERBEDA PEMILIK, BERBEDA PIMPINAN, BERBEDA MANAJEMEN, BERBEDA FINANCIAL DAN OPERASIONAL. Demikian kami sampaikan pemberitahuan ini, agar masyarakat umum, relasi/pelanggan kami dapat memakluminya. Medan, 16 April 2014

Kuasa Hukum Restoran Garuda Siantar Bambang Abimayu, SH & Rekan-Rekan

BAMBANG ABIMAYU, SH

Hari/Tanggal : Rabu, tanggal 30 April 2014 Pukul : 16.00 WIB s/d selesai Tempat : Kantor PT. EMBUN SARI ABADI Komplek Setia Budi Point B No. 14 Medan Dengan agenda rapat sebagai berikut: 1. Memutuskan dan mengundurkan diri sebagai pelaksana kemitraan pembukaan proyek perkebunan kelapa sawit di lahan milik anggota KUD Makarti Desa Rawa Makmur, Kecamatan Kolang, Kabupaten Tapanuli Tengah. 2. Pembubaran PT. EMBUN SARI ABADI 3. Hal-hal yang timbul dalam rapat. Demikian kami sampaikan, atas perhatian dan kerjasama Ibu kami ucapkan terima kasih. Medan, 14 April 2014 dto

Drs. IGNASIUS SAGO Direktur


Sport

WASPADA

A12 Tiket Tersisa Milik Memphis PHOENIX, AS (Waspada): Memphis Grizzlies akhirnya berhasil merebut tiket terakhir playoff NBA musim ini. Keberhasilan ditentukan Grizzlies dengan menyingkirkan Phoenix Suns 97-91, Selasa (15/4). Penampilan agresif Mike Conley dan Zach Randolph pada 68 detik terakhir menjadi kunci kemenangan Grizzlies. Dengan begitu, Grizzlies menempati posisi delapan Wilayah Barat. Suns sempat memimpin 91-90 lewat Miles Plumlee saat tersisa 1 menit 27 detik. Tapi, three point Conley membawa Grizzlies berbalik unggul 9391. Suns berusaha mencetak poin untuk menyamakan skor. Sialnya, Goran Dragic membuat kesalahan sehingga bola direbut Randolph yang langsung menambah poin Grizzlies dengan sisa 47,4 detik lagi. Setelah itu, free throw Marc Ga-

sol mengamankan tiket Grizzlies. “Ini sangat stres, berada dalam sebuah pertandingan yang kedua tim membutuhkan kemenangan ini. Setiap kami membuat angka, mereka mampu membalasnya,” kata Conley. Conley total menghasilkan 14 poin tujuh assist bagi Grizzlies. Randolph menjadi top skor timnya dengan 32 angka sembilan rebound. Dari Suns, Markief Morris menghasilkan angka tertinggi yakni 21 poin. Di Washington, tuan rumah Wizards memaksa Miami Heat menelan kekalahan. Dengan begitu, Heat otomatis peluang merebut predikat ung-

gulan utama Wilayah Timur yang akhirnya menjadi milik Indiana Pacers. Tampil tanpa LeBron James dan Chris Bosh, juara bertahan menyerah 93-114. Dwyane Wade memang tetap diturunkan pelatih Erik Spoelstra, karena butuh waktu bermain setelah absen lama akibat cedera. Namun, Wade tampil kurang maksimal dan hanya menyumbangkan sembilan angka.

“Tidak akan ada kekecewaan. Ketika playoff dimulai, kami punya musim baru dan kami akan sangat menantikannya,” ujar Wade. Michael Beasley menjadi penyumbang angka terbanyak Heat dengan 18 poin. Toney Douglas mencetak 14 poin dan Ray Allen menambah 13 angka. Wizards dimotori Trevor Ariza 25 angka, sedangkan Nene memberi tambahan 18 poin.

Wilayah Timur meloloskan Pacers, Heat, Wizards, Charlotte Bobcats, Toronto Raptors, Chicago Bulls, Brooklyn Nets, dan Atlanta Hawks. Kontestan Wilayah Barat diwakili Grizzlies, San Antonio Spurs, Oklahoma City Thunder, LA Clippers, Portland Trail Blazers, Golden State Warriors, Houston Rockets, dan Dallas Mavericks. (m33/ap) MIKE Conley (11) menjadi bintang Memphis Grizzlies dalam kemenangan atas Phoenix Suns dalam lanjutan kompetisi NBA, Selasa (15/4). -AP-

Hasil Selasa (15/4) Philadelphia 76ers v Boston Celtics Toronto Raptors v Milwaukee Bucks Washington Wizards v Miami Heat Charlotte Bobcats v Atlanta Hawks Chicago Bulls v Orlando Magic Houston Rockets v San Antonio Spurs New Orleans Pelicans v Oklahoma City Thunder LA Lakers v Utah Jazz Memphis Grizzlies v Phoenix Suns Golden State Warriors v Minnesota T’wolves

Rabu 16 April 2014

113-108 110-100 114-93 95-93 108-95 104-98 101-89 119-104 97-91 130-120

FIA Tolak Banding Red Bull PARIS (Waspada): Kenyataan pahit harus diterima kubu Red Bull, terkait banding yang diajukan untuk pebalap Daniel Ricciardo (foto) pada GP Australia 2014. Pengadilan internasional FIA memutuskan untuk menolak banding tersebut. Sebelumnya, Ricciardo yang finish runner-up didiskualifikasi oleh FIA, lantaran melanggar peraturan soal pembatasan penggunaan bahan bakar. Akibatnya, driver asal Australia itu pun gagal meraih poin pada seri pembuka Formula One (F1). “Setelah mendengar pernyataan dari sejumlah pihak dan memeriksa pengajuan mereka, pengadilan memutuskan untuk tetap mempertahankan keputusan #56 yang dikeluarkan oleh stewards,” demikian hasil putusan FIA, Selasa (15/4). “(Keputusan itu sendiri) adalah dengan mengabaikan hasil GP Australia 2014 untuk mobil tim Infiniti Red Bull Racing #3 (Daniel Ricciardo),”

f1live

sambung pernyataan tersebut. Ditolaknya banding tersebut membuat Ricciardo kian terpuruk pada ajang F1 musim ini. Pebalap berusia 24 tahun tersebut kini masih tertahan di peringkat 10 klasemen sementara. Di seri kedua yang digelar di Malaysia, Ricciardo gagal finish dan hanya me-

nempati urutan empat di seri Bahrain. Duet Ricciardo di Red Bull, Sebastian Vettel berada di peringkat enam. Juara bertahan asal Jerman ini gagal finish di seri pembuka, merebut podium ketiga di Malaysia, dan harus puas di urutan enam GP Bahrain. (m33/auto)

Pasang Iklan HP. 081370328259 Email: iklan_waspada@yahoo.co.id

PEMBERITAHUAN Untuk atas nama klien kami “RESTORAN GARUDA SIANTAR”, beralamat di Jl. Ahmad Yani No. 113 Kota Pematang Siantar, dengan ini kami beritahukan

kepada pelanggan/relasi, masyarakat umum, instansi sipil dan militer sebagai berikut: - Dengan adanya pemberitaan Harian “Tribun Siantar, Metro Siantar dan Siantar 24 Jam” pada Edisi Jumat, 11 April 2014 yang ditulis media yang mana pemberitaannya amat sangat merugikan manajemen Restoran Garuda Siantar, Restoran Garuda Rantau Prapat dan Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar, yang telah kami jalin bersama dengan baik dan benar.

zimbio

Mattiacci Ganti Domenicali MARANELLO, Italia (Waspada): Ferrari sudah menunjuk ketua tim baru sebagai pengganti Stefano Domenicali yang memutuskan mundur. Marco Mattiacci (foto) dipilih untuk mengisi penting di tim ‘Kuda Jingkrak’ itu. Usai Ferrari menuai hasil buruk dalam tiga balapan awal di musim balap Formula One (F1) 2014, Domenicali pun mengundurkan diri. Catatan terbaik Ferrari cuma menempati posisi keempat dalam tiga seri balapan awal. Raihan itu dibukukan oleh Fernando Alonso saat beradu cepat di seri GP Australia dan Malaysia. Presiden Ferrari, Luca di Montezemolo, langsung mengambil langkah cepat mencari pengganti Domenicali dengan menunjuk Mattiacci yang juga CEO Ferrari Amerika Utara. Di Montezemolo pun langsung berharap Mattiacci bisa segera melakukan perubahan ke arah lebih baik. “Saya doakan yang terbaik untuk Marco Mattiacci, seorang manajer yang tahu nilai dari perusahaan ini, dan dia menerima tantangan ini dengan antusias,” ucap Di Montezemolo. (m47/auto)

- Bahwa kami Pihak Manajemen Restoran Garuda Siantar tidak pernah ditunjukkan buktinya (nasi kotak) yang terdapat serangga oleh pihak wartawan harian tersebut.

Pengurus Persatuan Sepakbola Deliserdang (PSDS ) Atas Pelantikan:

Bapak H. Ashari Tambunan Sebagai Bupati Deliserdang

dan

Bapak H. Zainuddin, Mars

- Bahwa sebagai Kuasa Hukum Manajemen Restoran Garuda Siantar, Restoran Garuda Rantau Prapat membantah keras pemberitaan yang tidak benar tersebut pada harian tersebut. - Bahwa pihak Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar telah membuat surat resmi bantahan berita No. 16/35/D.Kom/Pms kepada harian “Tribun Siantar” yang menerbitkan pemberitaan tersebut. - Bahwa pihak Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar telah membuat surat resmi bantahan berita No. 16/36/D.Kom/Pms kepada Pimpinan Harian “Metro Siantar” yang menerbitkan pemberitaan tesebut.

Sebagai Wakil Bupati Deliserdang Periode 2014-2019 Oleh Gubernur Sumut Bapak H Gatot Pujo Nugroho, ST, MSi

- Bahwa pihak Kepala Perwakilan Deputi Bank Indonesia Pematang Siantar telah membuat surat resmi bantahan berita No. 16/37/D.Kom/Pms kepada Pimpinan Harian “Siantar 24 Jam” yang menerbitkan pemberitaan tersebut.

Pada Sidang Paripurna DPRD Deliserdang di Lubuk Pakam, Senin, 14 April 2014

- Bahwasanya pihak Bank Indonesia menyatakan: a. WARTAWAN TERSEBUT TIDAK HADIR DALAM ACARA PERTEMUAN YANG DISELENGGARAKAN OLEH DEPUTI PERWAKILAN BANK INDONESIA PEMATANG SIANTAR. b. WARTAWAN YANG ADA MELIPUT ACARA TERSEBUT MENGAMBIL KETERANGAN DARI ORANG LAIN YANG TIDAK DIKENAL DAN BUKAN SEBAGAI KARYAWAN PERWAKILAN BANK INDONESIA PEMATANG SIANTAR. c. PIHAK PERWAKILAN DEPUTI BANK INDONESIA PEMATANG SIANTAR MENYATAKAN KALAU PUN ITU SUATU KEKHILAPAN YANG TIDAK DISENGAJA OLEH PIHAK RESTORAN GARUDA SIANTAR, MERUPAKAN HAL YANG LAZIM DAN NORMAL DAPAT TERJADI KEPADA PEMILIK RUMAH MAKAN YANG LAIN (ADA 250 KOTAK CUMA 1 KOTAK YANG BERMASALAH). d. PIHAK PERWAKILAN DEPUTI BANK INDONESIA PEMATANG SIANTAR MEMBANTAH BERITA TERSEBUT KARENA MERUGIKAN PIHAK MANAJEMEN RESTORAN DAN BANK INDONESIA PEMATANG SIANTAR. - DENGAN INI KAMI BERTINDAK SEBAGAI KUASA HUKUM RESTORAN GARUDA PEMATANG SIANTAR MEMPERTEGASKAN BAHWA JARINGAN RESTORAN GARUDA PEMATANG SIANTAR, GARUDA RANTAU PRAPAT, MILIK KLIEN KAMI TIDAK SAMA DENGAN RESTORAN GARUDA YANG LAIN DAN TIDAK MEMILIKI HUBUNGAN. BERBEDA PEMILIK, BERBEDA PIMPINAN, BERBEDA MANAJEMEN, BERBEDA FINANCIAL DAN OPERASIONAL. Demikian kami sampaikan pemberitahuan ini, agar masyarakat umum, relasi/pelanggan kami dapat memakluminya.

Ttd:

Drs Hasiholan Sinaga

Muhammad Ridwan

Ketua

Sekretaris

Herman Sagita Bendahara

Medan, 16 April 2014

Kuasa Hukum Restoran Garuda Siantar Bambang Abimayu, SH & Rekan-Rekan

BAMBANG ABIMAYU, SH

PANGGILAN RAPAT UMUM PEMEGANG SAHAM PT. EMBUN SARI ABADI MEDAN Sesuai dengan surat dari salah seorang pemegang saham kepada Direksi perseroan, maka dengan ini mengundang seluruh Pemegang Saham Perseroan Terbatas PT. EMBUN SARI ABADI, berkedudukan di Medan untuk menghadiri Rapat Umum Pemegang Saham Luar Biasa yang akan diselenggarakan pada: Hari/Tanggal : Rabu, tanggal 30 April 2014 Pukul : 16.00 WIB s/d selesai Tempat : Kantor PT. EMBUN SARI ABADI Komplek Setia Budi Point B No. 14 Medan Dengan agenda rapat sebagai berikut: 1. Memutuskan dan mengundurkan diri sebagai pelaksana kemitraan pembukaan proyek perkebunan kelapa sawit di lahan milik anggota KUD Makarti Desa Rawa Makmur, Kecamatan Kolang, Kabupaten Tapanuli Tengah. 2. Pembubaran PT. EMBUN SARI ABADI 3. Hal-hal yang timbul dalam rapat. Demikian kami sampaikan, atas perhatian dan kerjasama Ibu kami ucapkan terima kasih. Medan, 14 April 2014 dto

Drs. IGNASIUS SAGO Direktur


Sumatera Utara

WASPADA Rabu 16 April 2014

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:27 12:41 12:28 12:35 12:35 12:31 12:28 12:24 12:30 12:30

‘Ashar 15:38 15:49 15:39 15:44 15:44 15:45 15:40 15:35 15:42 15:40

Magrib 18:34 18:48 18:35 18:43 18:42 18:36 18:34 18:30 18:37 18:37

‘Isya

Imsak

Shubuh Syuruq

Kota

19:43 19:58 19:44 19:52 19:51 19:45 19:43 19:39 19:46 19:46

04:53 05:05 04:54 04:59 04:59 04:59 04:54 04:50 04:56 04:55

05:03 05:15 05:04 05:09 05:09 05:09 05:04 05:00 05:06 05:05

L.Seumawe 12:33 L. Pakam 12:27 Sei Rampah12:26 Meulaboh 12:37 P.Sidimpuan12:25 P. Siantar 12:26 Balige 12:26 R. Prapat 12:23 Sabang 12:40 Pandan 12:27

06:19 06:30 06:19 06:25 06:25 06:24 06:20 06:15 06:22 06:21

Zhuhur ‘Ashar 15:42 15:38 15:37 15:47 15:38 15:37 15:38 15:35 15:48 15:40

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:41 18:33 18:32 18:44 18:30 18:32 18:31 18:28 18:48 18:32

19:50 19:42 19:41 19:54 19:39 19:41 19:40 19:37 19:58 19:41

04:58 04:52 04:51 05:03 04:52 04:52 04:52 04:49 05:04 04:54

05:08 05:02 05:01 05:13 05:02 05:02 05:02 04:59 05:14 05:04

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:27 12:28 12:38 12:31 12:28 12:35 12:23 12:33 12:26 12:25

18:32 18:34 18:46 18:36 18:34 18:42 18:29 18:39 18:32 18:32

19:41 19:43 19:55 19:46 19:44 19:51 19:38 19:49 19:41 19:41

04:54 04:55 05:02 04:58 04:53 04:59 04:49 05:59 04:53 04:51

05:04 05:05 05:12 05:08 05:03 05:09 04:59 05:09 05:03 05:01

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:24 12:31 12:29 12:24 12:26 12:23 12:23 12:33 12:27 12:22 12:23

15:38 15:45 15:41 15:36 15:38 15:37 15:37 15:42 15:39 15:34 15:35

18:28 18:35 18:34 18:30 18:32 18:28 18:28 18:40 18:32 18:27 18:29

19:37 19:44 19:43 19:40 19:41 19:37 19:37 19:50 19:42 19:36 19:38

04:52 04:59 04:55 04:50 04:53 04:51 04:51 04:57 04:54 04:49 04:50

05:02 05:09 05:05 05:00 05:03 05:01 05:01 05:07 05:04 04:59 05:00

06:23 06:18 06:17 06:28 06:18 06:17 06:18 06:15 06:30 06:19

15:40 15:40 15:47 15:43 15:39 15:44 15:35 15:45 15:39 15:37

06:19 06:20 06:28 06:23 06:19 06:25 06:15 06:25 06:18 06:17

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:17 06:24 06:21 06:16 06:18 06:16 06:16 06:23 06:19 06:14 06:15

24 Peserta UN Di Langkat Tak Hadir Di Deliserdang 8 Peserta DO STABAT (Waspada): Ujian Nasional (UN) hari kedua tingkat SMA sederajat di Kab. Langkat, Selasa (15/4), 24 siswa tidak hadir. Sementara di Kab. Deliserdang, 8 siswa DO (Drop Out) dari sekolah masing-masing. Informasi dihimpun dari Kadis Pendidikan Langkat, Sujarno, ke 24 pelajar dari 11.668 jumlahpesertakeseluruhansiswa yang tidak bisa mengikuti ujian akhir tersebut, dikarenakan sakit. “Mereka yang tidak mengikuti UN disarankan untuk mengikuti ujian susulan 21 April mendatang di sekolah masingmasing,” kata Sujarno seraya menambahkan, 24 pelajar dimaksud terdiri dari 16 orang tingkat SMK dan 8 dari tingkat SMA, tersebar di 23 kecamatan. Sementara itu keterangan diperoleh dari Kasi Mapenda Kemenag Langkat, Drs. Rahmat, Kakan Kemenag turut meninjau pelaksanaan UN Selasa (15/4) di PonpesUlumulQurandandiMadrasah Muhammadiyah Stabat. Pada hari pertama peninjauan dilakukan di MAN 2Tanjungpura. “Alhamdulillah semua berjalan lancar,” kata Rahmad Selasa sore. Di Langkat secara keseluruhan peserta UN tercatat 5.112 dari tingkat SMA, 4.915 dari SMK dan 1.641 dari tingkat Madrasah Aliyah. Untuk hari ketiga UN pelajar akan diuji dengan mata pelajaran Bahasa Inggris dan Ekonomi. 8 Siswa DO Sementara hari kedua pelak-

sanaanUjianNasional(UN)tahun 2014untuktingkatSLTA/sederajat di Sub rayon 06 Deliserdang, 8 siswa tergabung di Sub Rayon 06 Deliserdang terpaksa tidak bisa mengikutinya karena drop out dari sekolah masing-masing. Hal itu dikatakan Ketua Sub Rayon 06 Deliserdang yang juga Kepala SMU Negeri 1 Batangkuis, Drs Darwin, MM didampingi Wakasek Bidang Humasy Drs. Marlon Ritonga, M.Si kepada Waspada di ruang kerjanya, Selasa (15/4). Dijelaskan, pelaksanaan UN tingkat SLTA/sederajat yang dilaksanakan serentak di Indonesia, Senin hingga Rabu, di Batangkuis berjalan lancar. Khusus untuk Batangkuis, SMU Negeri 1 tahun ini dipercaya sebagai Ketua Sub Rayon 06 Deliserdang dengan jumlah peserta terdaftar 496 orang berasal dari 10 sekolah. Sekolah yang berada di Sub Rayon 06 Deliserdang yang mengikuti UN tahun 2014 ini masing-masing SMAN 1 Batangkuis sebanyak 188, SMA Amir Hamzah 30, SMA Prima 34, SMA swasta Bandung 10, SMA Bina Siswa 40, SMA swasta PGRI 37 sebanyak48,SMAswastaIskandar 25, SMA Santa Lusia 37, SMA Al Masdar 46, SMA Yapim Taruna

Listrik Padam, Penghitungan Terganggu STABAT (Waspada): Penghitungan surat suara Pileg tingkat kecamatan di Kab. Langkat serentak dimulai Senin (14/4). PPK masingmasing membacakan hasil dari tiap-tiap kelurahan maupun desa disaksikan pengurus parpol dan disesuaikan oleh saksi dari masingmasing caleg. Pantauan di aula Kantor Camat Stabat, penghitungan sempat terhenti karena listrik padam mulai pukul 13:00 hingga pukul 15:00. Petugas terpaksa menggunakan genset untuk mempermudah proses penghitungan. Hingga pukul 18:00 penghitungan belum selesai dan disepakati dilanjutkan Selasa (15/4) pagi. Sesuai jadwal, pihak KPU Langkat baru akan merekapitulasi dan menetapkan hasil penghitungan suara tingkat kabupaten pada 19 - 21 April mendatang. Humas KPU Langkat T. Benyamin menuturkan kotak berisi surat suara yang telah dihitung di tingkat kecamatan wajib dibawa dengan pengawalan ke Kantor KPU Langkat dan selanjutnya di Kantor KPU juga dikawal aparat kepolisian, untuk mengantisipasi berbagai bentuk kecurangan.(a03)

9 Caleg Lolos Dari Dapil I Binjai Tanpa PDIP BINJAI (Waspada): 9 Calon legislatif yang lolos dari Dapil I Binjai KotadanBinjaiBarat,hanyaduaincumbent,limalainsebagaipendatang baru. Keterangan diperoleh, Selasa (15/4), PDI Perjuangan (PDIP) yang tradisi calegnya ada di empat dapil, pada Pemilu 2014, di Dapil I gagal meraih kursi. Partai Golkar yang pada Pemilu 2009, meraih tiga kursi, kini hanya mendapatkan satu kursi diwakili H. Noor Sri Syah Alam Putra. Dapil I, Partai Demokrat masih dipercaya pemilih dan meraih dua kursi diwakili Njoreken Pelawi dan HM Sazali. Enam kursi legislatif bakalan diisi wajah lama dari PPP yaitu H. Antasari Lubis, S.PDi. Empat lagi pendatang baru yaitu dari Partai Hanura Elmita yang memperoleh suara tertinggi. Kemudian NasDem dr. Edy Putra, Wakil PKS terpilih Ari Amjah Surbakti, Gerindra, Ambi Suswandi Buana, PAN, Hj. Ema Gata. Dari sembilan caleg terpilih di Dapil I Binjai Kota dan Binjai Barat, dua di antaranya perempuan yaitu Elmida dari Hanura dan Hj. Ema Gata dari PAN. Sementara Dapil II, III dan IV masih dilakukan perhitungan.(a04)

Batangkuis 14, serta SMA swasta YapimTaruna Sei Rotan 23 siswa. “Dari keseluruhan jumlah tersebut, 8 siswa yang tergabung diSubRayon06Deliserdangtidak hadir mengikuti UN sejak hari pertama tanpa alasan hingga dinyatakan drop-out (DO) sehingga keseluruhan siswa yang ikut UN berjumlah sebanyak 488 orang,” kata Darwin. Adapun nama siswa yang tidak dapat mengikuti UN sejak hari pertama adalah Suci Ramadani (SMA Negeri 1 Batangkuis), Farida Hanum (SMA swasta Amir Hamzah), Siti Khadijah (SMA swasta Amir Hamzah), Dewi Kartini Tampubolon (SMA swasta Amir Hamzah), Azizah Harahap (SMA swasta Al Masdar), Airuddin (SMA swasta Al Masdar), Daniel Oki Setyawan Nadeak (SMA swasta Al Masdar) serta Ongli Feni Sitinjak (SMA swasta Iskandar). BaikDarwinmaupunMarlon menambahkan, untuk tahun ajaran 2013-2014 ini, siswa yang

mengikuti Ujian Nasional ini berasal dari dua jurusan masingmasing IPA dan jurusan IPS dengan bidang study yang diujikan yaitu Bahasa Indonesia, Matematika dan Bahasa Inggris ditambah bidang study masinmasinjurusanyaituFisika,Biologi, Kimia dan Ekonomi. Mengenai system pengawasan yang dilakukan dalam pelaksanaan UN ini, mereka menyebutkan bahwa pelaksanaan UN ini dilakukan dengan system silang artinya sejumlah guru yang bertugasdiSMUNegeri1melakukan pengawasan ke sekolah lain yang berada dalam sub rayon 06, begitu sebaliknya. Di samping itu ada juga pengawas yang bersifat independent didatangkan dari Unimed selain pengawasan dari sejumlah polisi. “Kami berharap seluruh siswa yang mengikuti UN tahun iniagardapatmengikutipetunjuk yang berlaku dalam mengerjakan soal serta mengerjakannya dengan sungguh-sungguh, sehingga

nantinya dapat lulus 100%. Sebab segala soal yang diujikan dalam UNsebenarnyamerupakanmata pelajaran yang setiap hari diajarkan di sekolah masing-masing,” kata Darwin. Di Percut Sementara pelaksanaan UN di SMAN 1 Percut Seituan Jl. Irian BaratSampali,Kec.PercutSeituan, jugaberlangsungtertibdanlancar. KepalaSMAN1PercutSeituan Muliadi, S.Pd, M.Si didampingi Wakasek Kurikulum Drs Iswandi, Wakasek Kesiswaan H. Bafrianto dan KTU Hairul Anwar mengatakan, 339 siswa/i terdiri dari 161 orang jurusan IPA dan 178 IPS mengikuti UN. SMK Budi Satrya Sedangkan Kepala SMK Swasta Budi Satrya Medan Tembung, Edi Sarman, MT mengatakan, pihaknya mengikutsertakan 139 siswa/i dari dua keahlian dengan rincian akutansi 105 orang, adminsitrasi perkantoran 34 orang. (a03/crul/m24)

Gubsu: Manfaatkan KNIA Untuk Percepatan Pembangunan LUBUKPAKAM (Waspada): Gubernur Sumatera Utara H. Gatot Pudjo Nugroho mengharapkan Bupati dan Wakil Bupati Deliserdang yang baru dapat memanfaatkan keberadaan Kualanamu International Airport (KNIA) untuk percepatan pembangunan di Kab. Deliserdang. “Bandara Kualanamu bisa menjadi keunggulan daerah karena akan diikuti dengan pembangunan infrastruktur seperti jalan tol dan non tol. Ini akan menggerakkan ekonomi masyarakat, akan memunculkan pusat pertumbuhan ekonomi baru,” ujar Gubsu pada sambutannya usaimelantikH.AshariTambunan sebagai Bupati Deliserdang dan H. Zainuddin Mars sebagai WabupDeliserdangmasajabatan 2014-2019.

Begitu pun Gubsu mengingatkan agar Pemkab mampu menciptakan regulasi yang mendukung investasi, merevisi aturanyangmenghambat.“Sebab investasi amat berkontribusi dan memberi akumulasi positif bagi daerah,” kata Gubsu. Sebelumnya, Gubsu minta agarAshariyangjugaadalahKetua PW NU Sumut ini dapat berbuat lebih baik lagi buat masyarakat Deliserdang, melanjutkan program pembangunan yang belum selesai. Sementara kepada wakil bupati yang sudah memiliki pengalaman 5 tahun mendampingi bupatisebelumnya,Gubsumengharapkan dapat bertugas lebih optimal dengan pengalaman yang sudah dimiliki. Sementara bagi para kontestan yang belum terpilih, Gubsu

mengimbau untuk berbesar hati menerima. “Visi misi mungkin berbeda, namun semua punya tujuan yang sama meningkatkan kesejahteraan masyarakat,” ujar Gubsu sambil mengimbau agar bupati dapat melakukan konsolidasi kekuatan untuk membangun Deliserdang. Hadir dalam kesempatan itu anggota DPR RI Hasrul Azwar, anggota DPD RI Parlindungan Purba dan Rudof M. Pardede, Plt. Wali Kota Medan Dzulmi Eldin, Bupati Langkat Ngogesa Sitepu, Bupati Sergai Soekirman, Wali KotaTanjungbalai danWakil Bupati Batubara. Unsur FKPD di antaranya Pangkosek Hanudnas III, Wadanlantamal Medan, Sekda Provsu Nurdin Lubis, Rektor IAIN dan Rektor Unimed.(m16)

Panwaslu Provinsi Diminta Awasi Rekapitulasi Suara LANGKAT (Waspada): Panwaslu Provinsi Sumut diminta mengimbau jajarannya yang bertugas di Kab/Kota mau pun kel/desa untuk jeli mengawasi hasil rekapitulasi suara Pileg 2014 secara berjenjang di KPU. “Pengawasanitupentingagar rekapitulasi suara benar-benar validdantidakterjadibias,sehinggawakilrakyatyangterpilihsesuai pilihan hati nurani rakyat,” ujar Maysarah, SH anggota Badan BantuanHukumDPDPDIPerjuanganSumutyangjugaCalegDPRD ProvinsiSumutdariPDIPerjuangan kepada Waspada, Minggu (13/4). Dikatakan, rekapitulasi suara harus diawasi di setiap tingkatan, karenadalamprosespenghitungan rawan terjadi kecurangan dengan berbagai modus. “Seperti laporan warga kemarin, di beberapa TPS di Kec. Sei Lepan dan Brandan Barat banyak ditemui

suara batal. Ini sangat merugikan caleg dan masyarakat yang ingin mencoblossesuaikeinginannya,” terang pengacara nelayan itu. Maysarah menambahkan, ini karena minim sosialisasi dan momentum itu dimanfaatkan pihak-pihak tertentu. “Berdasarkan laporan tim saya di lapangan banyak suara batal di Langkat. Hal itu sangat merugikan caleg dan warga yang tidak dapat menyampaikanaspirasisesuainurani melalui Pileg,” jelasnya. Dia juga mengharapkan Panwaslu Kecamatan dan kel/ desa lebih jeli mengawasi kecurangan yang beragam modus. “Seperti di salah satu TPS Pondok DelapanKec.Hinaiterjadikejanggalan dalam menghitung suara. Berdasarkan laporan tim saya, mencoblos nomor caleg dan nomor partai dinyatakan suara untuk partai. Padahal peraturan

KPU menyatakan apabila mencoblos nomor caleg dan nomor partai dinyatakan suara sah untuk caleg,” imbuhnya. Dia juga menyesalkan keberadaan petugas PPS di Langkat yang tidak memahami peraturanKPU.“Padahalpetugas PPS yang seharusnya menjadi pengadildiTPSmalahmerugikan semua pihak. Untuk itu, KPU haruslebihselektifdalammemilih petugas panitia penghitungan suara,” ucapnya. Akibat banyaknya laporan yang merugikan itu, Maysarah NasutionmintaPanwasluProvinsi Sumut mengimbau jajarannya di kab/kota mau pun kelurahan/ desa untuk lebih intensif mengawasi rekapitulasi suara. “Bila perlu beri sanksi kepada jajarannya yang terlibat pelanggaran di lapangan,” tegas Maysarah.(c01)

Waspada/Asrirrais

CALEG bersama tim sukses menemui Ketua Panwaslu Kec. Besitang melaporkan hilangnya perolehan suara mereka.

Banyak Suara Hilang, Caleg Minta Pleno Di PPK Dihentikan BESITANG (Waspada):Tiga Caleg di Besitang minta rapat pleno di Panita Pemilihan Kecamatan (PPK) dihentikan, menyusul adanya temuan dugaan hilangnya prolehan suara. Ketiga Caleg yang merasa perolehan suaranya banyak yang hilang, menggiring Ketua Panwaslu, Sayuti, menuju lokasi pleno PPK, Selasa (15/4). Ketua DPC Partai Keadilan Sejahtera (PKS) yang juga Caleg DPRD Langkat, Hasan Basri Harahap, minta pelaksanaan pemilu diulang karena banyaknya dugaan terjadi kecurangan. Sesuai data formulir C1 yang diterima PKS, khusus di Kel. Kampunglama, total jumlah suara yang diperoleh mencapai 253 suara, tapi hasil pleno di tingkat kelurahan (D1) suara berkurang menjadi 34 suara. “SelisihperolehansuaraantaradatadiC1dengan hasil pleno hampir merata terjadi,” ujarnya seraya mengecam kinerja Panwaslu yang dianggap tak proaktifmenerimapengaduanpelanggaran,padahal sebelumnya telah dilaporkan secara lisan. Kecaman senada juga dilontarkan Caleg PKPI, Imam Wibowo. “Panwaslu tidak berperan menangkap pelaku politik uang. Ironis, praktik

politik uang yang marak terjadi, tapi tak satu pun ada yang tertangkap petugas Panwaslu,” tegasnya. Sedangkan Caleg dari Partai Nasdem, Hotman Manurung, sempat terlihat kesal dengan Ketua Panwaslu karena dianggap lamban merespon pengaduanmerekaatastemuanbanyaknyahilang suara. Ketua Panwaslu Kec. Besitang, Sayuti, di hadapan Caleg dan beberapa pengurus parpol mengatakan pihaknya tetap memproses laporan yang masuk, tapi dia tak berhak menghentikan pleno di PPK. Secara terpisah Ketua PPK, M. Idris, mempersilahkan para Caleg masuk ke ruang pleno untuk menyampaikan keberatan sepanjang tetap menjaga semangat sportivitas. Idris menjelaskan, hasil penghitungan suara belum final. “Kami tidak pernah mempunyai iktikad mem-mark up suara,” tegasnya. Menanggapi protes ini, proses penghitungan suaradiPPKdiskorsementara.KetuaPPKbersama PanwasludanCalegsesuairencanaakanmenggelar rapat, namun sampai pukul 16:40, Caleg dari PKS belum juga hadir.(a02)

Wali Kota T. Tinggi: ‘UN Jangan Menjadi Momok’ Sedangkan Kadis Pendidikan Drs. H. TEBINGTINGGI (Waspada): Ujian Nasional (UN) tingkat SMA/MA/SMK yang digelar serentak Pardamean Siregar, MAP memaparkan, jumlah mulai 14 hingga 16 April 2014 diikuti 4.131 siswa peserta UN SMA/Sederajat di Kota Tebingtinggi se Kota Tebingtinggi berjalan tertib dan aman. 4.131 siswa terdiri dari SMAN 975 siswa, SMA Wali Kota Tebingtinggi Ir. H. Umar Zunaidi Swasta 1.012, Madrasah Aliyah (MA) Negeri 81 Hasibuan, MM melakukan peninjauan dan siswa, MA Swasta 228 siswa, SMK Negeri 949 siswa memotivasi siswa yang ikut UN agar tidak takut. dan SMK Swasta 886 siswa. Sedangkan jumlah Wali Kota mengunjungi sejumlah sekolah, yakni ruang ujian yang disediakan untuk SMA/MA/ Madrasah Aiyah Negeri, SMA Ir. H. Djuanda, SMK seluruhnya 136 ruangan. Hadir pada kegiatan peninjauan UN tersebut SMAN 1 dan SMAN 2. “Ujian Nasional jangan ditakuti, jangan KapolresTebingtinggi, AKBP H. Enggar Pareanom, menjadi momok, yang penting tingkatkan S.Ik, Kadis Pendidikan Drs. H. Pardamean Siregar, kemampuan, pembelajaran dan disiplin waktu MAP serta Kepala Kantor Kemenag Tebingtinggi agar memperoleh hasil yang baik. Saya juga HM Hasbie, MH.(a09) dahulu melewati ujian seperti kalian, tapi hal ini tidak dijadikan beban. UN harus dijadikan motivasi untuk ke depan, sehingga seluruh siswa bisa masuk perguruan tinggi negeri dan meraih cita-cita yang diimpikan,” kata Umar Zunaidi Hasibuan. Wali Kota juga menuturkan rasa syukur karena UN berjalan sesuai diharapkan. “Kami bersyukur karena distribusi soal sesuai jadwal waktu yang telah ditentukan, pengawasdariprovinsidatang Waspada/Ist tepatwaktu,pengamanansoal WALI KOTA Ir. H. Umar Zunaidi Hasibuan berdialog dengan dari Polres Tebingtinggi juga sudah hadir, dan peserta hadir guru soal kesiapan menghadapi UN TA 2014 didampingi Kapolres padawaktunya,”ujarWaliKota. AKBP Enggar Pareamon, S.Ik.

Wali Kota Binjai Kembangkan Pertanian Perkotaan:

Pertahankan Rambutan, Budidayakan Jambu Air HAMPIR setiap kota di Indonesia punya ciri khas, seperti Bandung dikenal sebagai kota

kembang, Bogor kota hujan, Malang dengan apelnya. Jogyakarta populer sebagai kota pen-

didikan. Negara tetangga, juga dikenal di Indonesia dengan buahnya,sepertidurianBangkok,

Waspada/ Riswan Rika

WAKIL Menteri Pertanian memperlihatkan varitas jambu air Deli Hijau bersama Wali Kota HM Idaham di perkebunan Sunardi.

Jeruk Taiwan dan lainnya. Binjai dikenal sebagai kota rambutan. Kemana pun, jika melihat buah rambutan orang pasti ingat kota Binjai. Rambutan Binai yang terbaik dan populer adalah rambutan Brahrang. Sulit ditandingi,kelekangan,manisdan berair, serta buahnya besar. Populasi buah rambutan di kota Binjai kini mulai berkurang, Tanaman rambutan tersingkir dengan perkembangan pembangunan, pohonnya yang besar memerlukanruangyangluas,dan rambutan merupakan buah musiman dan sulit dikembangkan. Pemko Binjai tetap konsekuen mempertahankan ciri khas Binjai sebagaikotarambutanyangsudah dikenal di seantero negeri ini. Selain mempertahankan rambutan, Binjai mengembangkan varitas buah jambu air Deli Hijau dan Kesuma Merah. Kedua varitasi sudah mendapat hak paten dari Kementrian Pertanian RI pada 2013, setelah rambutan di tahun 1997. Jambu Deli Hijau dan Kesuma Merah menjadi idola di kota Binjai dan Sumatera Utara, bah-

kan sudah sampai ke Penang. Renyah dan manis rasa jambu airDeliHijaudanKesumaMerah, mempunyai kadar gula yang tinggi dari jambu air lainnya di Indonesia, dan mengandung vitamin C sampai 210.463 mg/ 100gram, kadar airnya 81, 596 %, dan kadar gula 9 sampai 12,4 brix. sekarang dipercaya sebagai buah hidangan di setiap sidang kabinet RI di Jakarta. Varitas jambu air Deli Hijau dan kesuma merah, merupakan olahan Sunardi, 43, warga Kelurahan Payarobah, Kec. Binjai Barat. Pendidikan Sunardi dari STM itu, ternyata punya kemauan seperti orangtuanya yang petani. Dari berbagai buah yang dilakukan ujicoba.Sunarditertarikmelakoni agrobisnis dari penangkaran tanaman buah . Sunardi mencoba 400 batang tanaman jambu air dari dua varietas Deli Hijau dan Kesuma Merah yang lebih dikenal dengan Jambu madu. Ternyata varitas yang dari coba-coba itu, menghasilkan produk unggulan dikota Binjai. Potensi sistem pertanian yang sesuaidenganwilayahperkotaan,

langsung direspon Wali Kota Binjai HM Idaham. Sunardi sendiri mengakui perhatian Pemko Binjai terhadap usaha pertaniannya sangat luar biasa, sampai diperoleh hak paten dari Kementan RI.Wali Kota HM Idaham, tanpa sungkan, ikut mempopulerkan dan mencari pangsa pasar untuk jambu air Deli Hijau dan kesuma Merah.BahkansampaikePenang. BegitujugaKonsulJepangberjanji memperkenalkan buah jambu air Deli Hijau dan Kesuma Merah di negeri matahari itu. Wali Kota Binjai HM Idaham mengemukakan, varitas jambu air Deli Hijau dan Kesuma Merah sangat cocok untuk pertanian dikawasan perkotaan. Sebab sistem penanamannya hanya mempergunakan media (pot besar), tidak langsung ke tanah. Pemeliharaannya tidak sulit, asal jangan kurang air. Dan hasilnya, memberi peluang usaha bagi masyarakat. Sehingga bisa dijadikan pekerjaan selingan yang mampu meraih untung besar. “Peluang usaha itu perlu dikembangkan demi kesejahteran masyarakat Binjai,” ujarnya. Me-

lalui usaha pembudidayaan tanaman jambu air, Kota Binjai bisa menjadi sentra penghasil buah tropis unggulan di Provinsi Sumatera Utara. Selain mengembangkan sejumlah pembudidayaan tanaman buah, hal tersebut dapat terwujud dengan membuat sebuah kawasan khusus daerahagrowisata.SehinggaBinjai yang sudah dikenal sebagai kota buahrambutan,akanlebihdikenal sebagai kota penghasil buah. Kepala Dinas Pertanian Kota Binjai ir. Edy Gunawan, menjelaskan, Senin (14/4), selain rambutan, jambu air Deli Hijau dan KesumaMerah,kinidipersiapkan guna memperoleh hak paten untuk varitas Jambu Kelutuk varitas tanpa biji. Alpukat (Pokat) varietasidolayangbuahnyamencapai 6 sampai 8 ons, ditambah varitas jambu air varitas jumbo hijau. Edy Gunawan mengakui, banyak daerah mengundang Sunardi guna memberikan pengalaman pertaniannya. Bahkan Dirjen Holtikutula Kementerian Pertanian RI mengundang Sunardi sebagai nara sumber di Bogor dan pada 21 sampai 24 diYog-

yakarta bertajuk “tehnik produksi benih agribisnis pada jambu air”. Kadis Pertanian Binjai Ir. Edy Gunawan dan pengusaha Jambu air Deli Hijau Sunardi, salut terhadapkeperhatianWaliKotaBinjai HM Idaham, untuk meningkatkan kota Binjai sebagai kota penghasil buah. “Tekad Idaham memajukan kota Binjai luar biasa,” ujarnya. Sebab dengan populernya Jambu Deli Hijau dan Kesuma Merah, membuat Wakil MenteriPertanian RI, langsung turun ke lokasi penangkaran benih jambuairdikebunmilikSunardidi Kelurahan Paya Robah, Kec. Binjai Barat. Kadis Pertanian Ir. Edi Gunawan, mengakui potensi jambu air Deli Hijau selain menjadi perhatianWaliKota, Menteri Pertanian RI juga memberi bantuan untukpengadaanbenih,sehingga varitas jambu air Deli Hijau dan Kesuma Merah bisa lebih di masyarakat. Sebab punya keuntungan ganda bagi masyarakat. Menanam dan memelihara menuju sejahtera. * Riswan Rika


Sumatera Utara

B2 WASPADA Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Opini, Artikel & Agama: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: H.Akmal AZ Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkili Harahap. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Efendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: Zultamser. Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); ; T. Junaidi (Hiburan); Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi), Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkili Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Efendi, Mursal Alfa Iswara, Andi Aria Tirtayasa. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Efendi, Hamdani, Rizky Rayanda. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra, Agustian Akhmad. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Munawardi Ismail, (Koordinator Liputan) Muhammad Zairin, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanaiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar. Singkil: Tarmizi Ripan, Mansurdin.

INDRAPURA(Waspada): 58 Siswa SMK Amir Hamzah Indrapura, Kec. Airputih, Kab. Batubara terpaksa harus mengikuti ujian susulan 22 April mendatang, karena ujian Matematika pada Selasa (15/4) salah jurusan. Kepada Waspada, Kepala Sekolah SMK Amir Hamzah Ir M Yakup mengatakan, hari ini tidak jadi ujian jurusan Tata Busana dan Administrasi Perkantoran, karena materi ujian matematika yang diterima tidak sesuai dengan jurusan yang ada disekolah.

“Karena di SMK Amir Hamzah ini hanya ada jurusan Administrasi Perkantoran dan Tata Busana. Seharusnya ujian hari ini Matematika perkantoran. Tetapi yang kami terima matematika teknologi, jadi ujiannya batal,” kata Yakup. Ujian yang diselenggarakan

hari ini hanya satu mata pelajaran matematika. Dengan gagalnya ujian hari ini 22 siswa jurusanTata Boga dan 36 jurusan Administrasi Perkantoran tidak serta merta pulang.Meskipuntidakujianmereka tetap menunggu temannya dari jurusan lain sehingga seluruh siswa pulang pukul 09.30. Secara terpisah, Kapolsek Indrapura AKP. JTarigan membenarkan adanya masalah dalam materisoalmatematikaUNdiSMK Amir Hamzah. “Disepakati para siswaakanmengikutiujiansusulan, Selasa 22 April,” kataTarigan.(c05)

Hari II UN Di Asahan Lancar

69 Siswa Tidak Hadir KISARAN (Waspada): Hari kedua Ujian Nasional tingkat SMA/sederajat berjalan dengan lancar, namun sedikitnya ada 69 siswa yang tidak hadir mengikuti ujian. Hal itu diungkapkan Kasi Pendidikan Menengah, Dinas Pendidikan Asahan Herlis, saat dikonfirmasi Waspada, melalui telepon, Selasa (15/4). Dia menuturkan bahwa untuk tingkat SMA dari 4.383 dan yang tidak hadir sebanyak 18 siswa, sedangkan untuk SMK terdaftar 3.230 dan tidak hadir 20 orang, dan untuk

MA terdaftar 1.723 dan yang tidak hadir sebanyak 31 orang. “Siswayangtidakhadir,dugaan awal karena berhenti sekolah, dan ada yang sakit. Namun demikian, sampai saat ini kita masih melakukan pengecekan ulang penyebab siswa itu tidak hadir,” jelas Herlis. Herlisjugamenuturkan,sampai saat ini UN berjalan deng-an lancar belum ada gangguan apapun,karenasampaisaatinipihaknya selalu memonitor 110 sekolah, ditambah lima lokal paket C. “Sampaisaatinisemuaberjalan

dengan lancar, dan tanpa ada gangguan apapun,” jelas Herlis. Sementara untuk ujian susulan, lanjut Herlis, akan dilaksanakan pekan depan, dan siapa siswa yang tidak ikut UN masih punya kesempatan.“Kitamasihmendata kembali,siswayangtidakikutUN, dan berapa siswa yang punya hak ikut ujian susulan,” jelas Herlis. Sebelumnya, catatan Waspada pada UN 2013 terdata 62 siswa itu terdiri 28 siswa SMK, 18 SMA, dan16MA,sedangkanuntuk2012 ada 76 siswa yang tidak mengikuti UN. (a15)

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO  Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.  Perwakilan dan Biro Banda Aceh: Jalan Ratu Syaiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.  Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.  Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Mengantisipasi Sengketa Relokasi Pasar Bakti Harus Pindah KISARAN (Waspada): Mengantisipasi perselisihan paham antara peziarah di perkuburan Tionghoa di Jl. Syeh Hasan dengan pedagang, sehingga relokasi pasar bakti di depan Pemakaman Umum Tionghoa harus segera dipindahkan. Hal itu diungkapkan salah satu masyarakat Rusli, saat berbincang dengan Waspada, Selasa (15/4). Menurutnya, bila situasi ini terus dipertahankan, maka selisih paham antara akan terjadi, mengingat banyaknya para peziarah makam yang merasa kesulitan. Beberapa waktu lalu mobil peziarah kesulitan melintas jalan dan akhirnya mobil lecet. Namun peziarah masih pengertian dan tidak tidak terjadi keributan. “Kita bukan mencari masalah, dan mencari siapa yang benar. Namun karena tempat dan keadaan yang memaksa kondisi ini terjadi. Pedagang mempunyai hak untuk mencari lapak untuk berjualan. Namun demikian para peziarah juga mempunyai hak,” jelas Rusli. Rusli mengatakan, bila para pedagang terus berjualan di wilayah itu, dan peziarah merasa kesulitan untuk melakukan aktivitas. Maka dikhawatirkan selisih paham akan terjadi. “Arah menuju sengketa itu sudah mulai terlihat, namun masih bisa diredam. Tapi bila situasi ini terus dipertahankan, cepat atau lambat keributan pasti terjadi,” jelas Rusli. Rusli juga mengatakan, pajak relokasi itu sudah berjalan hampir dua tahun. Dan peziarah masih mengerti dengan keadaan. Namun bila situasi ini terus berjalan, dan ketika dua belah pihak sudah merasa terganggu, ketertiban masyarakat pasti akan terganggu. Pengurus PC Ikatan Tionghoa Indonesia (Inti) Kab. Asahan Arifin Widjaja, berpendapat sama, dan berharap Pemkab Asahan bisa mengambil langkah cepat. Bila gedung Pasar Bakti telah selesai terhadap, maka secepatnya digunakan jangan menunggu lagi. “Kita hanya ini semua masyarakat bisa hidup tenang, dan toleransi sesama masyarakat bisa berjalan. Karena semua lapisan masyarakat mempunyai hak yang sama,” jelas Arifin. (a15)

Waspada/Iwan Has

SEJUMLAH saksi dari Parpol peserta Pemilu mengikuti pleno rekapitulasi penghitungan suara Pileg 2014 di aula Kantor Camat Talawi, Selasa (15/4).

Tujuh Parpol Usung Kader Dari Dapil IV TALAWI (Waspada): Partai politik yang mengusung kadernya ke legislatif dari Dapil IV Batubara, Kec. Talawi/Tanjungtiram dalam Pileg Tahun 2014 terdiri partai Golkar, PBB, Gerindra, PAN, PDIP, PPP dan Hanura. ‘’Ini data sementara Parpol peserta Pemilu yang diprediksi mengusung kadernya ke Legislatif untukDapilIV,’’tukassejumlahsaksiParpolpeserta Pileg kepada Waspada, Selasa (15/4). Data perolehan suara Parpol tersebut sewaktu-waktu dapat berubah, karena proses

perhitungan suara hasil Pileg masih berlangsung di tingkat kecamatan. Sedangkan suara tertinggi diraih Partai Golkar kini disebut mencapai 18.457 meliputi Kec. Talawi, 9025, Tanjungtiram, 9432. Sampai berita ini dikirimkan penghitungan suara dalam pleno PPKTalawi di aula kantor camat setempat masih berlangsung. Selain dihadiri saksi dari Parpol juga caleg mendapat pengawasan aparat Kepolisian, diawali dari penghitungan suara DPR RI, DPD dan DPRD Provsu/Kab. (a13)

Pembukaan Kotak Suara Di TPS 11 Pelanggaran Pemilu TANJUNGBALAI (Waspada): Ketua Panwaslu KotaTanjungbalai Dedi Hendrawan mengatakan, pembukaan kotak suara TPS 11 di Kel. Gading beberapa waktu lalu merupakan pelanggaran tindak pidana pemilu. “Berdasarkan hasil pemeriksaan dokumen/ saksi dan musyawarah ketua dan anggota pengawas Pemilu, maka kasus yang dilaporkan dengan nomor Laporan 02/LP/PILEG/IV/2014 tanggal 11 April diduga memenuhi unsur-unsur pelanggarantindakpidanaPemilu,danselanjutnya diteruskan ke Penyidik Kepolisian untuk ditindaklanjuti sesuai peraturan perundangundangan yang berlaku,” kata Dedi, dalam surat yangditandatanganinya,perihalpenerusandugaan pelanggaran pidana Pemilu tertanggal 13 April 2014. Dedi menerangkan, pembukaan kotak suara tersebut telah melanggar peraturan karena dibuka di luar jadwal. Kalaupun harus dibuka di luar

waktu yang telah ditentukan, katanya, maka harus ada persetujuan dari seluruh partai politik. “Tersangkanya Ketua PPS, karena menurut pemeriksaan yang kami lakukan, dialah orang yang pertama kali membuka gembok dan segel,” ujar Dedi dikonfirmasi Waspada, Senin (14/4). Tapimenurutnya,tidaktertutupkemungkinan akan ada tersangka lainnya seperti anggota Panwaslu dan Komisioner KPU yang turut menyetujui pembukaan kotak itu. Hal itu ujarnya akan dibuktikan pada penyidikan di Kepolisian Resort Tanjungbalai nanti. “Untuk sementara, Ketua PPS tersangkanya, nanti setelah pengembangan kemungkinan bakal ada tersangka lain. Kan bukan dia saja yang ada di sana dan dia pasti tidak mau sendirian,” tutur Dedi. Sebelumnya, ratusan massa berunjukrasa di kantor Komisi Pemilihan Umum (KPU) Kota Tanjungbalai protes karena kotak suara yang telah bersegel dibuka, Jumat (11/4). (a32/a14)

Telusuri Pelanggaran Pileg Mengarah Money Politics Waspada/Rasudin Sihotang

Penerbit: PT Penerbitan Harian Waspada

Rabu 16 April 2014

Salah Soal, 58 Siswa SMK Ujian Susulan

Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 

Hubungi kami

WASPADA

KETUA KPPS (pegang kertas) saat menghitung perolehan suara.

Pemungutan Suara Ulang Di LP Pulo Simardan TANJUNGBALAI (Waspada): Pemungutan suara ulang dilakukan di TPS 16 Lembaga Pemasyarakan (LP) Kel. Pulosimardan, Kec. Datukbandar Timur, Kota TanjungbalaiuntuktingkatanDPR RI, Selasa (15/4). Pemungutan ulang itu dilakukan di TPS Khusus itu karena pada hari pencoblosan Rabu,ditemukan19lembarkertas suara bergambar buah-buahan (simulasi). KPU lalu menggelar rapat dan diputuskan pemungutan suara ulang di TPS 16 namun hanya untuk DPR RI.

Hasil perolehan suara teratas diraih Nomor Urut 5 caleg Partai GerindraSortamanSaragihdengan 80 suara. Diikuti posisi kedua AhmadDoliKurniaTanjungdengan perolehan 65 suara nomor urut 2 dari Partai Golongan Karya. Sedangkandiurutanketigadiraih dr Capt Anton Sihombing nomor urut 1 Partai Golongan Karya. Sementara Fadly Nurzal PPP memperoleh 5 suara, Iskandar PKB 5 suara, Ali Umri NasDem 4 suara,Tritamtomo PDIP 3 suara, Jonny Buyung Saragi Partai Demokrat 2 suara, Ansory PKS 1

suara, dan Nasril Bahar PAN 1 suara. Total perolehan suara partai NasDem 5 suara, PKB 10 suara, PKS 6 suara, PDIP 18 suara, Golkar 102 suara, Gerindra 105 suara, Demokrat 10 suara, PAN 1 suara, dan PPP 7 suara, Hanura 4suara,sedangkanPBB,danPKPI tidak mendapat suara. Total pemilih 284 orang dan surat suara yang tidak sah sebanyak 16 lembar. Untuk situasi proses pencoblosan hingga penghitungan terpantau aman dan lancar di bawah pengawalan petugas kepolisian. (a32)

Tabungan Simpedes BRI T. Balai Meningkat TANJUNGBALAI (Waspada): Tabungan Simpedes yang dihimpun Kantor Cabang BRITanjungbalai tumbuh pesat, hingga mencapai Rp235 miliar di posisi Desember 2013. Angka tersebut, melonjak Rp12 miliar dibanding posisi Desember 2012 yang nilai tabungannya Rp213 miliar. “Terimakasihkepadaseluruh nasabah, terutama Simpedes, yang telah memberikan kepercayaan kepada BRI untuk menyimpankan dananya dalam bentuk tabungan,” kata Pemimpin Cabang BRI Tanjungbalai M. Bayu Pancakusuma, diwakili AMBM Ismul Bahri pada penarikan undianSimpedessemesterII2013 di kantor cabang Tanjungbalai, Selasa (15/4).

Penarikanundianitu,dihadiri WakilWaliKotaTanjungbalaiRolel Harahap, Kabag Humas Darul Yana Siregar, Kakan Kemenag Tanjungbalai Hayatsyah dan para nasabah BRI Tanjungbalai. Lebih lanjut dikatakan, saat ini BRI kian komitmen dalam memberikan kemudahan bertransaksi para nasabahnya, baik di kota maupun desa, serta lebih mengenalkan lagi kepada masyarakat tentang penggunaan mesin ATM, dan layanan e-Banking seperti SMS Banking, phone banking atau mobile banking. Sementara itu, puluhan nasabahBRICabangTanjungbalai yang memegang rekening Simpedes, ketiban rezeki. Mereka berhasil memenangkan undian

denganhadiahsepedamotor,dan berbagaiprodukelektronik.Selain itu, satu nasabah yang memiliki rekeningdiBRIUnitTelukNibung, Nurhana, juga berhasil mendapatkan hadiah utama berupa satu unit mobil Daihatsu All New Xenia 1.0. Untuk hadiah utama, penarikan undian dan penyerahan duplikat kunci mobil dilakukan olehWakilWali KotaTanjungbalai Rolel Harahap. “ Undian Simpedes Semester II 2013 ini merupakan wujud apresiasi dan terima kasih BRI kepada masyarakat yang selama ini menjadi nasabah setiatabunganSimpedessehingga program tabungan itu menjadi melegenda di kalangan masyarakat,” ujar Ismul Bahri. (a14)

Waspada/Rahmad F Siregar

PIMPINAN dan karyawan BRI Cabang Tanjungbalai berfoto bersama perwakilan nasabah, seusai penarikan undian Simpedes semester II 2013, Selasa (15/4).

LIMAPULUH (Waspada): Panwaslu untuk melakukan penelusuran pasca Pileg di Batubara, karena tidak menutup kemungkinan terjadi dugaan pelanggaran Pemilu yang mengarah permainan money politics, baik melalui kupon belanja dilakukan caleg. ‘’Kupon ini bergambarkan salah satu caleg dariParpolyangbersaingsebagaimanaditemukan di Dapi) IV Kec. Tanjungtiram/Talawi,’’ sebut sejumlah masyarakat kepada Waspada, Selasa (15/4). Kupon belanja itu, selain bergambarkan sang caleg juga dibawahnya tertulis Rp50.000, dan dapat ditelusuri Panwaslu beserta unsur terkait,

agar pelaksanaan Pemilu berlangsung Jurdil dan tidak dikotori oleh permainan mengarah money politics. Kupon belanja yang tujuannya untuk memenangkan salah satu caleg tersebut telah di foto dan dapat dijadikan bukti bila diperlukan. ‘’Ini sengaja kita simpan sebatas dokumentasi, karena tidak ada pengaduan masyarakat untuk ditindaklanjuti jika hal itu bagian dari dugaan pelanggaran dalam Pileg,” tukas sumber Waspada di Panwaslu Kec. Tanjungtiram sambil memperlihatkan foto kupon belanja tersebut dan menunggu pengaduan dari masyarakat untuk menindaklanjuti. (a13)

Warga Minta Pemkab Batubara Tertibkan Orang Gila INDRAPURA ( Waspada): Warga dan pengguna jalan diinti Kota Indrapura, Kec. Airputih, Kab. Batubara setiap hari disuguhkan dengan pemandangan orang gila tanpa pakaian, sehingga meresahkan warga setempat. Ketua PD Muhammadiyah Kab. Batubara Drs. Junaidi Raju menyikapi kondisi wajah kota terbesar di Batubara, kepada Waspada baru baru ini mengatakan, seharusnya pemerintah melalui dinas terkait tanggap dengan kondisi ini sehinggaKotaIndrapurasedapdipandang.“Orang gila yang nyaris tidak berpakaian dan kerap mempertontonkan bagian vitalnya itu jelas - jelas

mengganggu rasa kesusilaan, meskipun dia orang gila tapi itu tidak boleh dibiarkan,” kata Junaidi. Sementara itu tokoh masyarakat Airputih H. Muslim Ismail mengatakan, orang gila yang kerap memperlihatkan alat kelaminnya dan dilihat siapa saja yang melintas sangat mengganggu pemandangan. “Pemerintah harusnya melihat ini suatupersoalanyangmestiditangani,jadikesannya tidak seperti dibiar - biarkan. Sudah berapa lama oranggilaitubegitudiKotaIndrapura,”kataH.Muslim. Terpisah, Camat Airputih Fahruddin Ritonga menjawab Waspada mengatakan, pihaknya akan menanggulangi masalah ini usai pileg. (c05)

Ketua Dewan Pendidikan Pantau Pelaksanaan UN RANTAUPRAPAT (Waspada): Ketua Dewan PendidikanKab.Labuhanbatu,NgampuniTarigan, SPd menilai pelaksanaan Ujian Nasional (UN) tahun 2014, untuk tingkat SMA, SMK, Madrasah Aliyah,jauhlebihbaikdibandingkandengantahun sebelumnya. Karena pada tahun ini, lembar soal ujian telah sampai di masing-masing sekolah tepat waktu. “Di hari pertama pelaksanaan ujian, tidak ada diterima informasi yang menyebutkan, tertukarnyalembarujian,”ucapNgampuniTarigan seusai melakukan pemantauan pelaksanaan UN di hari pertama, Rabu (14/4). Disebutkannya, di hari pertama pelaksanaan UN, Dewan Pendidikan Kab. Labuhanbatu, menurunkan tim terdiri dari Ngampuni Tarigan SPd wakil-wakil ketua Anim Hasibuan MPd,

Yuniman Zebu MM dan Wakil SekretarisYasmir Chaniago,langsungkeSMANegeri2RantauUtara, SMABudhisJayanti,SMAPerguruanPanglimaPolem Rantauprapat dan SMA Katholik Bintang Timur. Katanya, berdasarkan informasi yang disampaikan para kepala sekolah yang di kunjungi, ternyata pelaksanaan UN berjalan sebagaimana mestinya. Pada tahun ini tidak ditemukan keterlambatan lembar soal ujian sampai sekolah. Selain itu, ucap Ngampuni Tarigan, hingga berakhirnya pelaksanaan UN di hari pertama, untuk dua mata pelajaran yang di ujikan, juga tidak ditemukan tertukarnya lembar soal ujian. “Pelaksanaan UN di hari pertama, di sejumlah SMA baik negeri maupun swasta yang ada di Kota Rantauprapat, telah berjalan sebagaimana mestinya”, ujar Ngampuni Tarigan. (c07)

Banyak Catatan Menodai Pelaksanaan Pileg Langkat LANGKAT (Waspada): Pesta demokrasi untuk memilih wakil rakyat telah usai. Tapi banyak catatan yang menodai pelaksanaan pesta yang digelar lima tahun sekali ini. Catatan jamak terjadi dalam kasus dugaan politik uang yang dilakukan sejumlah oknum Caleg. Kasus yang mencederai pelaksanaan pesta demokrasi ini menuai banyak sorotan publik. Presedium Kesatuan Nelayan Tradisional Indonesia (KNTI) Region Sumatera, Tajruddin Hasibuan kepada Waspada, Senin (14/4) menyatakan prihatin atas sikap mental oknum caleg termasuk warga pemilih. “Saya mencermati praktik politik uang nyaris berlangsungmeratadiSumateraUtara,khususnya diwilayahTelukaru,Kab.Langkat,”ujarnyamengaku kecewamelihatfenomenaPemiluPilegyangterjadi. Diamengatakan,bagaimanamasyarakatmau mengharapkanfiguranggotalegislatifyangmemiliki

integritas kalau proses pemilihannya saja banyak diwarnaipelanggaranberbentukpolitiktransaksional. Politik pragmatis ini, kata Tajruddin, berlangsung sangat sistemik, ditandai transaksi uang pada saat menjelangpencoblosanmarakterjadihampirmerata hingga sampai ke pelosok kampung. “Jika politik uang menjadi budaya, maka ke depan sistem demokrasi di Indonesia dapat rusak dan ini sangat berbahaya bagi kemajuan sistem demokrasi,” tegasnya. Seharusnya, kataTajruddin, pelaksanaan pesta demokrasi dapat memberi pencerahan atau pendidikan politik yang baik bagi elemen masyarakat, bukan malah sebaliknya. Ia berharap para legislator yang terpilih dari hasil produk Pemilu dapat menjalankan amanah rakyat, bukan sebaliknya berupaya mengembalikan modal politik yang sangat mahal dengan menghalalkan berbagai macam cara.(a02)


Sumatera Utara

WASPADA Rabu 16 April 2014

B3

Temuan Panwaslu Taput

Warga Siborongborong Gunakan C-6 Orang Lain TAPUT (Waspada): Panitia Pengawas (Panwas) Tapanuli Utara menemukan empat warga menggunakan undangan memilih (formulir C-6 ) milik orang lain saat pemungutan suara di tempat pemungutan suara (TPS) di Kec. Siborongborong. Keempat warga tersebut masih berstatus pelajar berinisial Y warga Jalan Tugu Siborongborong, SS, RN dan M. Mereka ketahuanmenggunakanundangan pemilih orang lain pada saat mau melakukan pencoblosan di TPS IV Lumbandapdap Desa Pohan Tonga. Demikian antaralain disampaikan Ketua Panwaslu Taput Eduard Lumbantobing ke-

pada wartawan di kantor Panwaslu Jalan Raja Johannes Hutabarat, Senin (14/4). Ia menjelaskan, berkas keempat orang yang ketahuan menggunakan formulir C-6 milik orang lain itu akan diteruskan ke sentrapenegakanhukumterpadu (Gakumdu)Taput untuk diproses sesuai aturan main. “Tiga hari paling lambat, berkas keempat

DPRD Simalungun Desak Polisi Tuntaskan Kasus Perambah Hutan SIMALUNGUN (Waspada): Ketua DPRD Simalungun, Binton Tindaon, mendorong polisi untuk menuntaskan penanganan kasus pembalakan liar di Kec. Dolok Silou dengan mengungkap pelaku utamanya. “DPRD Simalungun mendukung dan mendorong Polres Simalungun menuntaskan penanganan kasus pembalakan liar di Dolok Silou hingga pelaku utamanya ditangkap, jadi bukan hanya para pekerja yang dijadikan korban,” kata Binton, kemarin. Sedangkan pihak penyidik Polres Simalungun, memastikan bakal bertambahnya tersangka kasus pembalakan liar di kawasan hutan Kec. Dolok Silou dimaksud. Bahkan, menurut Kepala Satuan Reserse Kriminal (Reskrim) Polres Simalungun,AKPWPasaribu,tersangkabarudalamkasuspembalakan liar di kawasan hutan Dolok Silou bisa lebih dari satu orang. “Daripendalamanyangdilakukanpenyidikdalammenanganikasus pembalakanliardikawasanhutanKecamatanDolokSilou,sudahmengarah kepada tersangka baru, namun perannya nanti akan diinformasikan setelah ditetapkan,” ujar Pasaribu, Senin (14/4). Terkait kemungkinan tersangka baru yang ditetapkan merupakan oknum pejabat Pemkab Simalungun yang juga diduga menjadi otak pelaku dalam kasus perambahan hutan di Dolok Silou, Pasaribu mengatakan bisa ya, namun bisa juga tidak. Disinggung kesulitan polisi untuk menentukan tersangka utama dalam kasus tersebut, menurut Pasaribu, sejauh ini polisi belum kesulitan dan masih terus mendalaminya termasuk dalam mengungkap otak pembalakan liar di Dolok Silou. Dalam kasus pembalakan liar di Dolok Silou, tambahnya, polisi juga sudah memeriksa saksi baru yaitu seorang caleg berinisial EB, yang masih akan didalami perannya. (a29)

UN Di Kab. Pakpak Bharat Ditarget Lulus 100 Persen PAKPAK BHARAT (Waspada): Bupati Pakpak Bharat Remigo Yolando Berutu, MBA melakukan peninjauan pelaksanaan Ujian Nasional (UN) pada hari kedua, Selasa (15/4). Target kelulusan UN SMA sederajat di Pakpak Bharat 100 persen. Bupati bersama Kepala Dinas Pendidikan mengunjungi beberapa SMA di Kab. Pakpak Bharat, yakni SMA Negeri I Salak, SMA Negeri Sigunung dan Madrasah Aliyah Swasta Sibande di Kecamatan STTU Jehe. Peninjauan pertama dilakukan di SMA Negeri I Salak, selanjutnya rombongan bergerak menuju Kecamatan STTU Jehe meninjau SMA Negeri Sigunung dan Madrasah Aliyah Swasta Sibande. Pemantauan di tiga sekolah tersebut hanya dilakukan dari luar kelas. Bupati mengatakan, penyelenggaraan UN tingkat SMA tahun ini jauh lebih baik jika dibandingkan tahun sebelumnya. Bupati juga menyampaikan, target kelulusan pada UN tahun ini seratus persen. “Dengan berbagai persiapan yang kita lakukan jauh-jauh hari melalui Dinas Pendidikan Kabupaten Pakpak Bharat untuk menghadapi UN, diharapkan tingkat kelulusan bisa seratus persen,” katanya. nal. Kadis Pendidikan Jalan Berutu, SPd, MM menjelaskan UN tingkat SMA di Kabupaten Pakpak Bharat tahun ini diikuti 729 peserta. (csb)

Curanmor Rawan Di Berastagi BERASTAGI (Waspada): Pencurian kendaraan bermotor (Curanmor) rawan di kota wisata Berastagi, Kab. Karo. Warga diingatkan agar senantiasa berhati-hati. Peristiwa curanmor ini antaralain dialamai wisatawan Jhon Heri, 19,wargaDusunIIDesaSukaDameKac.Kutalimbaru,Kab.Deliserdang yang berkunjung ke Berastagi tepatnya di Bukit Kubu, Rabu (9/4). “Saya main ke Bukit Kubu bersama pacar, dan kami masuk secara resmi dengan membayar uang tiket Rp 30 ribu per kereta sekitar jam 10.00,” ungkap Heri kepada Waspada di halaman Mapolsek Berastagi, Selasa (15/4). Dikatakannya, kereta Vixion BK3025 ABQ yang dia kendarai terparkir di halaman dekat lobi dijaga petugas. Namun, begitu sekitar jam 12.30, ketika dia sendang hendak ke luar dari lokasi tersebut, kendaraannya sudah tidak terlihat lagi. “Saya mencariin kereta saya tapi tidak dapat ditemukan. Dengan ditemani petugas Bukit Kubu, saya juga disarankan oleh petugas tersebut untuk membuat laporan ke Polsek Berastagi,” ungkapnya. Panit Reskrim Polsek Berastagi Ipda S. Galingging kepada Waspada mengatakan, korban sudah membuat laporan.“Ini segera kita proses,’’ ujarnya. (c19)

Wali Kota P. Siantar Tinjau UN Di MAN PEMATANGSIANTAR (Waspada):WakilWali Kota Pematangsiantar,Drs.Koni Ismail Siregar beserta tim tugas pemantau pelaksanaan Ujian Nasional (UN) di kota pematangsiantar,menga ku puas dan memberikan aspirasi terhadap upaya peningkatan fasilitas yang telah dipersiapkan serta diperbuat Kepala Madrasah Aliyah Negeri (MAN) Pematangsiantar selama ini. SalahsatuyangmenjadiperhatianWakilWaliKotaketikamelakukan pemantauanpelaksanaanUNdiMANjalanSingosariPematangsiantar, Senin pagi itu, adalah penempatan ruang ujian serta penggunaan fasilitas CCTV di setiap ruang ujian. Dalam kunjungan langsung ke MAN, Wakil Wali Kota terlihat didampingi Sekda Pematangsiantar,Drs.Donver Panggabean, Ketua Dewan pendidikan Pematangsiantar,Drs.HB.Si regar,ketua komite MAN, Drs.Armaya Siregar. Rombongan diterima Kepala MAN Drs.Marzuki Saragih dan salah seorang staf bidang kurikulum Heri Sutopo,MPd. WakilWali Kota sebelumnya didaulat menjadi pembina upacara bendera yang diikuti 234 siswa yang mengikuti pelaksanaan UN tahun ini di sekolah tersebut. Secara umum, tim pemantau UN dari Pemko Pematangsiantarmenyebutkan,pelaksanaanUNdiMANPematangsiantar berlangsung lancar, tertib dan aman. Dibantu CCTV TimpengawasUjianNasional(UN)dariDinasPendidikanProvinsi Sumut dipimpin ketuanya, Yulhani, Selasa (15/4) melakukan pemantauan secara langsung pelaksanaan UN di sejumlah sekolah di Pematangsiantar. Di Madrasah Aliyah Negeri (MAN) Pematangsiantar, tim yang diterimakepalasekolahnyaDrs.MarzukiSaragih,mendapatpenjelasan seputar penggunaan perangkat monitor CCTV yang dipasang di setiapruangujian.Jumlahruanganyangdigunakanuntukpelaksanaan ujian13ruangandansaturuangandipergunakanbagipetugaspengawas. Tim pengawas yang menyaksikan secara langsung kegiatan UN dengan pengawasan monitor CCTV, mengakui, hal tersebut cukup membantu bagi petugas pengawas guna terciptanya pelaksanaan ujian yang bersih dan jujur. (crap/c16)

orang tersebut akan kami teruskankesentraGakumdusetempat untuk diproses,” terangnya. Selain penggunaan formulir c-6 oleh orang lain, pihaknya juga mengakui kalau pihaknya ada banyakmenerimalaporanpengaduan pelanggaran selama pencoblosan berlangsung. “Tidak hanya itu saja, banyak pelanggaran yang terindikasi namun semuanya bisa diselesaikan ditingkat KPPS. Di antaranya kesulitan bagi para pemilih untuk menentukan pilihan lantaran suara hanya terdiri dari tulisan tanpa disertai gambar calegnya. Sehingga banyak yang didam-

pingi. Sebenarnya hal seperti ini kan tidak boleh tapi ya kita sudah diselesaikan di tempat pemilihan langsung,” ucapnya. Ia juga mengakui kalau pihaknya menemukan beberapa kendala dalam pelaksanaan pemilihan kemarin, kendala itu di antaranya teknik administrasi dan pelanggaran pemilu yang menjurus ke tindak pidana. “Secara administrasi ada beberapa kendala terkait temuan terkhusus teknis administrasi seperti melipat surat suara. Sebab adabanyakpemilihyangmelapor dan mengaku kesulitan melipat surat suara, sehingga ada yang

tertukar tempat seperti surat suara DPRD Taput masuk ke kotak surat suara DPR-RI dan sebaliknya,” paparnya. Selain itu, disebutkan, keempat anak sekolah tersebut, disuruh oknum Kepala Sekolah (Kasek) berinisial PRS untukmencoblossalahsatucaleg. “Yangjelassemuapengaduan terkait pelanggaran Pileg diteruskan untuk diproses sesuai aturan yang berlaku,” ujar Ketua Panwaslu Taput. Sementara Oknum Kasek PRS yang dihubungi wartawan, Selasa (15/4), menyangkut tuduhan menyuruh muridnya untuk mencoblos, tidak berhasil. (tim)

Hari Ini, Gubsu Lantik Bupati/Wabup Taput TARUTUNG (Waspada) Hari ini, Rabu (16/4), Gubsu H. Gatot Pujo Nugroho ST, MSi dijadwalkan mengambil sumpah/janji sekaligus melantik pasangan Drs Nikson Nababan/Drs Mauliate Simorangkir MSi (NIKMAT) menjadi Bupati /Wakil Bupati Kabupaten Tapanuli Utara (Taput) priode 2014 – 2019. Pelantikan Bupati danWakil BupatiTaput ini dilakukan dalam SidangParipurnaIstimewaDPRD Taput di Gedung SopoPartungkoan Tarutung, dipimpin Ketua DPRD FL Fernando Simanjuntak SH.MH. Sesuai jadwal yang diterima, proses pelantikan dimulai pukul 9:00. Gubsu H. Gatot Pujo Nugrohomengambilsumpah/janjidan pelantikan Nikson/Mauliatei menjadi pemimpin Kabupaten Taput 2014-2019 juga dirangkai

dengan berbagai acara formal dan doa. Syukuran diadakan di rumah Dinas Bupati Taput. “PelantikanNikson/Mauliate menjadi Bupati danWakil Bupati Taput periode 2014 – 2019 dijadwalkan dilakukan Gubsu H. Gatot Pujo Nugroho. Semua menyangkut persiapan maupun proses pelantikan sudah rampung. Termasuk undangan berbagai elemen masyarakat dan para tokoh politik nasional,” ujar PLH Bupati Taput Drs HP Marpaung kepadaWaspada, Selasa (15/4). Sesuai jadwal, Gubsu dan rombongan tiba di Tarutung pukul 09.00, setelah pukul 08.30 mendarat di Bandara Silangit. Dalam tiga hari ini pihak panitia pelantikan tampak sibuk mempersiapkanacarapelantikan, suasana sepanjang Jalan Sisingamangaraja Tarutung dalam ke-

adaan bersih dan dihiasi spanduk maupun umbul-umbul. Semua perlengkapan untuk acara pelantikansudahsiap,keadaanGedung Sopo Partungkoan tempat pelantikan Bupati-Wakil Bupati Taput sudahditatadenganrapi,susunan kepanitiaanuntukpelantikanjuga sudah siap” ujar HP Marpaun. Disebutkan, untuk mengamankan pelantikan itu, aparat kemanan juga ikut diturunkan. PelantikanNikson/Mauliatesebagai pemimpin di Kabupaten Taput sesuaidenganKeputusanMendagri NO131–12-1561tahun2014tentang pengesahanpengangkatanBupati Taput masa jabatan 2014 – 2019. HP Marpaung menyebut, parapolitisiPDI-Pmaupunpolitisi dan mantan Bupati/WakilBupati Taput juga diundang antaralain DR RE Nainggolan, Drs Frans A Sihombing MM. (a21)

Penggelembungan Suara Diduga Di Simalungun PEMATANGSIANTAR (Waspada): Kapolres Simalungun diminta agar mengimbau seluruh Caleg, tim sukses partai dan penyelenggara Pemilu legislatif (Pileg) agar bekerja sesuai aturan, karena penggelembungan suara untukCalegtertentudan formulir C1 tentang perolehan suara masing-masing partai dan Caleg seolah-olah bisa diubah, diduga terjadi di Kab. Simalungun. “Pemilu merupakan hak dan kedaulatan rakyat yang tertinggi. Caleg dan tim sukses diharapkan tidak memberi informasi yang tidak akurat, antara lain seolaholah formulir C1 bisa diubah,” ujar anggota DPR RI Komisi IV asal Partai Golkar Dr. Capt. Anthon Sihombing, MM kepada wartawan di kediamannya, Jalan Jend. Sudirman, Kota Pematangsiantar, Senin (14/4). Sihombing yang merupakan

Caleg DPR RI nomor satu Partai Golkar di Dapil Sumut III dan mengklaim bakal duduk di DPR RI dengan perolehan suara ranking I 85.000 suara terutama dari Pematangsiantar, Simalungun dan Karo, disamping Dairi, Asahan,Tanjungbalai, Batubara dan Pakpak Bharat menyebutkan sesuai hasil survei yang dilakukan pihaknya, banyak Caleg yang mengaku bisa merubah rekapitulasi suara dengan merubah rekapitulasi perolehan suara dan pleno di kecamatan. “Padahal semuanyaitu,berdasarkanC1yangakan dikirimkan ke KPU Pusat.” Di Simalungun, cetus Sihombing, diduga terjadi penggelembungan suara ke Caleg tertentu untuk DPR RI, hingga Caleg itu memperoleh suara yang dinilai tidak wajar yang sangat jauh berbeda dengan rekapitulasi di kelurahan.

“Kami mendapat informasi penggelembungan suara Caleg itu terjadi di Kecamatan Hatonduhan serta kecamatan lainnya dankamisiapmembawamasalah itu kemanapun dan akan menempuh jalur hukum,” ujarnya. “Polisi dan TNI serta para tokoh masyarakat harus ikut berperan dan bertanggungjawab tentang berbagai informasi yang didugasengajadisimpangsiurkan tentang formulir C1 bisa diubah. Padahal, ada data pembanding yakni data Panwaslu dan data manual lainnya,” ujar Sihombing dan menurutnya saat ini sudah mulai banyak caleg yang merasa tidak puas dan tidak dapat menerima hasil C1 serta sudah ada mengatur persiapan dan langlahlangkahkeMahkamahKonstitusi, apalagi di Simalungun menjadi pertanyaan mengapa mengakses formulir C1 agak sulit. (a30)

Panwaslu Nisut Didesak Proses Kasus Politik Uang NIAS UTARA, Lotu (Waspada): Sejumlah calon legislatif (Caleg) berasal dari Daerah Pemilihan III, Kab. Nias Utara (Nisut)mendesakPanwasluuntuk menindaklanjuti penangkapan tim sukses dari salahsatu Parpol berinisial FH yang diduga membagi-bagikan uang kepada masyarakat agar memilih salah seorang Caleg berinisial EZ. Panwaslu juga diminta untuk memberikansanksikepadaCaleg

tersebutdenganmendiskualifikasi yang tim suksesnya ditangkap warga saat membagi-bagikan uang di Desa Hilimbowo Kare, Kec. AlasaTalumuzoi (ATM), Kab. Nias Utara, Rabu (9/4). Desakan itu disampaikan salahseorang Caleg Dapil III, Kab. Nias Utara yang tidak mau namanya disebutkan kepada wartawan melalui telepon seluler, Senin (14/4). Dia juga menuturkan, sebe-

Waspada/Bothaniman Jaya Telaumbanua

UANG Rp4.8 juta dan catatan nama warga yang disita dari oknum Tim Sukses salah satu Caleg di Dapil III, Kab. Nias Utara.

lum ditangkap, tim sukses Caleg EZ berinisial FH telah dibuntuti sejak mengikuti pertemuan dengan EZ di salahsatu rumah, dan warga juga melihat ketika EZ menyerahkan uang dan mandat kepada FH. Ketika FH ditangkap saat hendak membagi-bagikan uang,ditanganpelakuditemukan uang Rp4,8 juta, catatan nama sejumlahwargadanmandatsaksi. Menanggapi kasus tersebut, sejumlah tokoh masyarakat dan para Caleg khususnya dari Dapil III Kabupaten Nias Utara mendesak Panwaslu menindaklanjuti kasus tersebut, serta memberikan sanksi kepada caleg yang melakukan money politic. Ketua Panwaslu Kecamatan Alasa Talumuzoi, Manotona Zebua yang dihubungi wartawan melalui telepon seluler, Sabtu (12/ 4), membenarkan jika warga dan Linmas telah mengamankan oknumFNsebagaitimsuksesdari Caleg EZ. Menurut Manotona Zebua, kasus tersebut sedang diproses dan diklarifikasi untuk dapat diambil keputusan. ManotonaZebuamenyebutkanbarangbuktiyangdiamankan dari FH berupa uang Rp4,8 juta, mandatuntuktimpemantaudan saksi Partai Demokrat. “Terkait uang yang diamankan dari FH Rp4,8juta,pelakumengakuiuang tersebut milik pribadinya, sedangkan mandat yang diambil dari FH, pengakuannya adalah mandat tim pemantau,” ungkap Manotona. KadesHilimbowoKare,Alibudi Zebua yang dihubungi melalui teleponselulerpadahariyangsama membenarkankejadianpenangkapan tersebut, tetapi dia tidak tahu awalpenangkapan,karenadiabaru tiba di lokasi pada pagi harinya sekira pukul 05:30. (a25)

Waspada/Bothaniman Jaya Telaumbanua

TIM Penyidik Kejari Gunungsitoli saat melakukan penggeledahan di Kantor Sekretariat DPRD Kota Gunungsitoli, Senin (14/4) terkait kasus dugaan korupsi dana Setwan yang belum dipertanggungjawabkan Rp800 juta.

Kasus Dugaan Korupsi Rp800 Juta

Kejari Geledah Kantor Setwan Gunungsitoli GUNUNGSITOLI (Waspada): Penyidik Kejaksaan Negeri Gunungsitoli melakukan penggeledahan di Kantor Sekretariat DPRD Kota Gunungsitoli, Senin (14/4). Penggeledahan Kantor Setwan Kota Gunungsitoli terkait kasus dugaan korupsi dana Setwan Kota Gunungsitoli tahun anggaran 2012 yang merugikan negara sesuai audit Badan Pemeriksa Keuangan (BPK) sekira Rp800 juta. Pada penggeledahan Kantor Setwan DPRD Kota Gunungsitoli, penyidik Kejari Gunungsitoli dipimpin Kasi Pidsus Junius Zega, SH, MH didampingi Kasi Intelijen Rabani Halawa, SH, MH dibantu sejumlah penyidik pembantu berhasil menyita barang bukti berupa surat pertanggungjawaban dan beberapa dokumen pendukung serta sebuah laptop yang diduga menyimpan arsip terkait dana Setwan DPRD Kota Gunungsitoli 2012. Usai melakukan penggeledahan di Kantor Setwan DPRD Kota Gunungsitoli, tim penyidik Kejari Gunungsitoli melanjutkan penggeledahan di rumah orangtua tersangka FH mantan bendahara Setwan DPRD yang saat ini sudah masuk dalam daftar pencarian orang (DPO) Kejari Gunungsitoli di Jalan Lagundri, Perumnas Fodo, Kec. Gunungsitoli Selatan, Kota Gunungsitoli.

Sekwan DPRD Kota Gunungsitoli, Kurnia Zebuayangditemuiwartawanusaipenggeledahan membenarkan jika tim dari Kejari Gunungsitoli telah melakukan penggeledahan di Kantor Setwan DPRD Kota Gunungsitoli. Menurut dia, penggeledahan yang dilakukan berdasarkan surat perintah dari Pengadilan Tindak Pidana Korupsi Medan. Kurnia menyebutkan, dokumen yang disita tim penyidik Kejari Gunungsitoli dari Kantor Setwan DPRD Kota Gunungsitoli adalah surat pertanggungjawaban terkaitkasusdugaankorupsi dana Setwan DPRD Kota Gunungsitoli tahun 2012 yang melibatkan mantan bendahara setwan Kota Gunungsitoli FH. Kasi Pidsus Kejari GunungsitoliYunius Zega, SH,MHyangditemuidiKantorKejariGunungsitoli mengatakan, penggeledahan dilakukan untuk menindaklanjutikasusdugaankorupsidanasetwan Kota Gunungsitoli tahun 2012 yang merugikan negara berdasarkan audit BPK sekira Rp800 juta. Yuniusmenjelaskanhinggasaatinikeberadaan tersangkatidakdiketahuidantersangkasudahmasuk DPO Kejari Gunungsitoli, serta surat DPO tersebut sudah dikirimkan ke Kejagung. Dia juga berharap agarwargayangmengetahuikeberadaantersangka mau melapor ke Kejari Gunungsitoli maupun kejaksaan yang ada di seluruh Indonesia. (a25)

Waspada/Micky Maliki

PENGENDARA sepedamotor terlihat ekstra hati-hati untuk mengelakkan lubang saat melintas di Jalan Pendidikan Desa Jaranguda, Kec. Merdeka.

Jalan Di Berastagi Dibiarkan Rusak BERASTAGI(Waspada): Erupsi Gunung Sinabung salahsatu penyebab penurunanan jumlah wisatawan yang datang ke dataran tinggi Kab Karo. Namun, buruknya infrastruktur jalan juga menjadi permasalahan serius. Kondisi ini terjadi di Desa Jaranguda Jalan Pendidikan Kec Merdeka, yang merupak lintasan wisatawan penjalan kaki ke Gunung Sibayak. ‘’Kondisi jalan sangat menghawatirkan pengguna jalan, bahkan tak jarang para pelintas di jalan wisata tersebut terjatuh dan mengalami lakalantas akibat menghidari lubang besar sepanjang Jalan Pendidikan,’’ ujar J Pelawi, 47, warga Desa Jaranguda kepada Waspada,kemarin. Ia menambahkan, perbaikan jalan kabupaten ini sebelumnya sempat dilakukan, namun baru beberapa bulan kondisi jalan sudah mulai berlubang. Pantauan Waspada di sepanjang Jalan Pendidikan Desa Jaranguda ini, terlihat, mulai masuk hingga di penghujung jalan tampak beberapa lubang besar dengan kedalaman 15-20cm, padahal jalan ini juga merupakan salahsatu jalan alternatif bila terjadi kemacetan panjang di inti Kota Barastagi. Warga yang tinggal di sepanjang Jalan Pendidikan mengaku sudah tidak tahu harus berbuat

apa dengan kondisi jalan wisata yang sudah membahayakan ini. Beberapa cara dilakuka warga dengan menimbun memakai bebatuan sisa bangunan, namun semuanya hanya sia-sia. Jalan yang sudah ditimbun kembali rusak saat hujan mengguyur. Selainitu,saathujanderas,lubangbesarseperti kubangan kerbau di sepanjang jalan itu, tak jarang mengakibatkan pengguna jalan celaka karena lubang tertutup genangan. Warga mendesak pemerintah daerah segera memperbaiki jalan rusak ini, tidak justru dibiarkan yang tentu akan semakin rusak. Seorang wisatawan asal Belanda Ingried Rooslot, 54, yang datang ke Berastagi bersama tiga teman senegaranya, saat akan melakukan perjalanan ke Gunung Sibayak, mengaku tiga tahun lalu dia pernah berkunjung ke Berastagi, namun dia sangat menyayangkan kondisi jalan yang dibiarkan rusak parah. Camat Merdeka, Kasman Sembiring yang di temui Waspada mengaku, dengan kondisi jalan yang semakin parah, pihaknya telah mengajukan bahkan berkoodinasi ke PU Kabupaten. Dia mengakui, Jalan Pendidikan Desa Jaranguda merupakan jalan alternatif bila terjadi kemacetan di inti kota Berastagi. (c10)

UN Di P. Siantar, Kehadiran 98 Persen PEMATANGSIANTAR (Waspada): Ujian Nasional (UN) tingkat SMA/MA dan SMK negeri dan swasta di Kota Pematangsiantar pada hari pertama, Senin (14/4) berjalan lancar, aman dan tertib serta tingkat kehadiran siswa mengikuti UN mencapai 98 persen. “Tingkat kehadiran siswa peserta UN pada hari pertama 98 persen, dimana kehadiran untuk tingkat SMA sederajat dari 5.791 peserta, yang tidak hadir 35 peserta dan SMK dari 3.778 peserta yang tidak hadir 56 peserta, dengan alasan sakit,” sebut Kadis Pendidikan Pematangsiantar Drs. Resman Panjaitan saat meninjau pelaksaan UN ke sekolah-sekolah di antaranya SMA Negeri 1 Jalan Parsoburan, SMA Negeri 3 Jalan Pane dan SMA Negeri 4 Jalan Pattimura bersamaWali Kota Hulman Sitorus, SE, Kajari Rudi Pamenan, SH, Ketua PN, Kabag Humas dan Protokoler Pemko Drs. Daniel H Siregar serta lainnya. Resman Panjaitan menjelaskan, dalam pelaksanaan UN TA 2013/2014 yang akan berlangsungselamatigahari,dimanauntuktingkat

SMA dua mata pelajaran per hari dan SMK satu mata pelajaran, selain menggunakan kamera CCTV di setiap ruangan ujian, pengawasan proses pelaksanaan UN tingkat SMA sederajat di Pematangsiantar juga melibatkan pihak Polres. “Untuk mengantisipasi terjadinya kecurangan selamaUN,sertasesuaidenganJuknisdariMenteri Pendidikan dan Kebudayaan, pemasangan CCTV harus dibuat di setiap blok ruangan ujian serta diawasi pihak kepolisian dengan berpakaian sipil,” terang Resman Panjaitan seraya menambahkan jumlah peserta penyelenggara UN tahun 2014 untuk Pematangsiantar 75 orang dan semua berasaldariUnimedMedan,dimanauntuktingkat SMA 38 peserta penyelenggara, SMK 31 penyelenggara dan MA enam penyelenggara. Wali Kota menyebutkan UN yang dilaksanakan berjalan dengan lancar, baik dalam distribusi Lembar Jawaban Komputer (LJK), naskah soal ujian sesuai dengan jadwal, pengawas hadir semua,pengamanansoalsudahdiamankanPolres dan peserta UN dapat hadir tepat waktu. (a30)


Sumatera Utara

B4

WASPADA Rabu 16 April 2014

Jalinsum Via Sosopan Nyaris Putus Total SOSOPAN (Waspada): Jalan Lintas Sumatera (Jalinsum) di Desa Ulu Aer, Kec. Sosopan, Kab. Padanglawas (Palas) mengalami longsor dan nyaris putus total jika tidak segera ditangani instansi terkait. Badan jalan tinggal sekira satu meter lagi! Demikian pantauan Waspada, Selasa (14/ 4), menyusul hujan yang turun di wilayah Kec. Sosopan dalam beberapa hari belakangan ini telah membuat beberapa titik di wilayah kecamatan itu mengalami longsor. Bahkansepertidikilometer154JalanAekGodang Sibuhuanmengalamilongsortergerusair,sehingga mengakibatkan badan jalan beberapa hari belakangan longsor dan badan jalan hanya tinggal sekira satu meter, sehingga sulit dilalui kendaraan, baik kendaraan roda empat maupun roda dua. Camat Sosopan Sulaiman Harahap, S.Sos kepada Waspada, mengungkapkan, begitu mengetahuijalanlongsordansulitdilalui,langsung melaporkan kondisi ini ke pemerintah kabupaten juga ke Dinas Bina Marga untuk mendapatkan penanggulangan darurat agar masyarakat tetap bisa melintas, baik untuk mengangkut hasil bumi maupuntransportasianak-anakyangmauberangkat ke sekolah, seperti SMP dan SMA Sosopan. Kata camat, kondisi ini telah berlangsung beberapahari.Diamengakui,daerahnyamemang benar-benar terkenal rawan longsor. Saat ini saja terdapat18titiklongsorsepanjangjalinsumSosopan.

Waspada/Idaham Butarbutar

KADIS PU Pertamben Palas Ir. Ulil Fadil Nasution, Kaban Penanggulangan Bencana Daerah, Arpan Nasution, S.Sos bersama Kanit Lantas Tinjau lokasi longsor di kilometer 154 Jalinsum Sosopan, Selasa (15/4).

Diduga Gelembungkan Suara, Caleg PPP Adukan Caleg PPP SIBUHUAN ( Waspada): Diduga melakukan kecurangan dan penggelembungan suara, Ketua PPP Padanglawas (Palas) Ir. Samson Fareddy Hasibuan MAP yang juga caleg Nomor urut 1 bersama Tabaroni caleg nomor urut 5, daerah pemilihan (dapil) IV Palas, Senin (14/4), mengadukan AH, caleg nomor urut 4 dari partai dan dapil yang sama. Samsom Fareddy mengatakan, pelanggaran dilakukan saat pencoblosan berlangung di tempat pemungutan suara (TPS) 1 dan TPS 2 Desa Ujung Batu Kec. Sosa, Daerah Pemilihan (dapil) IV Palas, dimana saksi dan KPPS mencoblos sendiri sisa kertas suara yang tidak terpakai dan disinyalir kertas suara yang ber-

jumlah ratusan lembar itu digunakan untuk mendongkrak perolehan suara AH yang merupakan caleg PPP nomor urut 4, sehingga diduga terjadi penggelembungan perolehan suara. Kata Samson, sejumlah saksi dan anggota KPPS lainnya yang menemukan pelanggaran tersebut telah membuat surat pernya-

Mayat Warga Gunungtua Mengapung Di Sungai PANYABUNGAN (Waspada): Mayat warga Desa Gunungtua Bondar Ayuara , Kec. Panyabungan, Kab. Mandailing Natal (Madina) diketahui bernama Mahmud Nasution, 43, ditemukan warga Gunungtua Julu mengapung di hulu Bondar Batofik Desa Gunungtua Julu, Selasa (15/4) sekira pukul 06:00 . Keterangan dihimpun Waspada, jenazah terlihat warga sudah mengapung di hulu sungai Batofik Desa Gunungtua Julu. Sebelum penemuan mayat, warga sudah mencium bau tak sedap selama tiga hari belakangan ini, sehingga warga pergi membersihkan hulu Bondar Batopik sampai akhirnya menemukan mayat yang wajahnya sudah sulit dikenali. Sebelum proses evakuasi dilakukan, ratusan masyarakat berdatangan ke TKP untuk melihat langsung kondisi korban. Setelah itu tak lama berselang, anggota Polsek Panyabungan tiba dan mengevakuasi jenazah ke RSU Panyabungan untuk otopsi. Abdul Somat, salahseorang keluarga korban mengatakan, Mahmud Nasution sudah lima hari tidak pulang kerumah. Darmawati Nasution kakak kandung almarhum Mahmud saat dijumpai di RSU Panyabungan mengatakan, pihak keluarga akan membawa jenazah untuk dikebumikan. (c14)

taan di atas materai 6000 yang menyatakan bahwamerekatelah benarmengetahuiadanyapelanggaran dan kecurangan yang terjadi dalam pemilu legislatif pada TPS I dan II Desa Ujung Batu, Kec. Sosa . Kemudian isi surat tersebut juga menyatakan kepada Panwascam Kec. Sosa Kab. Palas agar kecurangantersebutdiprosessesuai peraturan yang berlaku. Surat tersebut ditandatangani delapan orang KPPS dan saksi Parpol. Kedelapan saksi tersebut yakni anggota KPPS TPS 1, Jamal Nasution, Ketua KPPS TPS 2 Pajar Nasution, anggota KPPS TPS 2 Amron Siregar, anggota KPPS TPS 2 Bahagia Harahap, anggota

KPPS TPS 2 Sabar Hasibuan. Kemudian, saksi Partai Hanura TPS 2, Irsat Lubis, Saksi Partai Demokrat, Marwan Pulungan, kemudian Koordinator Saksi Partai Hanura di Lima Desa Ujung Batu Kec. Sosa, Tabaroni Lubis. Ketua PPP Palas Ir. Samson Fareddy Hasibuan bersama empatCalegpartaidariDapiltersebut meminta agar pihak KPUD Palas membatalkan surat suara untuk TPSIdanII danmelakukanpemungutan suara ulang di dua TPS. Ketua Panwaslu Palas. Abdul Rahman Daulay, Selasa (15/4) yangdijumpaidiSibuhuanmembenarkan pengaduan tersebut. Kata Rahman Senin (14/4) malam sentra penegakan hukum

terpadu (gakumdu) Padanglawas telah melakukan gelar perkara tentang masalah tersebut. “Tinggal menunggu keputusan Gakumdu apakah masalah itu masukdalampidanapemiluatau pelanggaranadministrasipemilu,” ujar Rahman. Devisi Hukum Komisioner KPUD Palas Indra Syahbana Nasution SH mengatakan KPUD Palas lebih condong memidakan bila ada penyelenggara pemilu yang terkait dalam masalah tersebut. Sementara untuk melakukan pencoblosan ulang sudah tidak memngkinkan karena hari ini batas rekapitulasi tingkat desa atau PPS, kecuali ada kuputusan Mahkamah Konstitusi. (a34)

JENAZAH Mahmudin Nasution saat berada di RSU Panyabungan.

Pelajar Ikuti Penyuluhan P4GN PANYABUNGAN (Waspada): Sebagai langkah awal pencegahan dan pemberantasan penyalahgunaan serta peredaran gelap narkoba (P4GN), Badan Narkotika Nasional Kabupaten (BNNK) Mandailing Natal menggelar penyuluhan kepada ratusan pelajar di enam sekolah SMP, SMA dan SMK swasta dan negeri terdapat di daerah itu. “Untuk mempersempit ruang peredaran narkoba di kalangan masyarakat khususnya pelajar, BNNK Madina akan terus melakukan penyuluhan P4GN kepada pelajar. Pada awal tahun 2014 ini, ada enam sekolah yang telah kami kunjungi yakni SMA Negeri 2 Plus, SMA Negeri 1 Hutabargot, SMK Mitra Mandiri, SMA Muhammadiyah 13 Panyabungan, SMK Willem Iskander dan SMP Negeri 1 Panyabungan Utara,” ucap Kepala Badan Narkotika Nasional Kabupaten (BNNK) Madina AKBP Eddy Mashuri Nasution, SH, MH, Jumat (11/4). Eddy Mashuri didampingi Kasi Pencegahan Hj. Tiurlan Siregar dan Kasi Pemberdayaan Masyarakat Armen, Spd mengatakan, penyuluhan narkoba penting dilakukan kepada generasi muda terutama pelajar. Bahaya narkoba harus disosialisasikan sejak dini kepada para pelajar, karena mereka sangat rentan terhadap pergaulan bebas dan penggunaan narkoba. Hal yang sama disampaikan Kasi Pencegahan Hj. Tiurlan Siregar, bahwa pengawasan terhadap pelajar memang harus dilakukan secara intensif untuk mengatisipasi berbagai hal, karena usia remaja usia yang mengkhawatirkan. Sementara Armen sebagai Kasi Pemberdayaan Masyarakat menerangkan, BNNK Madina akan terus meningkatkan pencegahan danpemberantasannarkobadenganmelaksanakankegiatanpenyuluhan secaraberkesinambungan,sehinggaseluruhpesertaP4GNdapatmenimba ilmu pengetahuan dan ilmu sebanyak-banyaknya sekaligus menyebarkannya ke sekolah-sekolah lain. (a28)

WargaTambang Bustak Ramai-ramai Cari Emas PANYABUNGAN ( Waspada): Dalam semingguterakhir,ratusanwargaTambangBustak, Kec. Kotanopan, Kab. Mandailing Natal ramairamai mencari emas secara tradisional (mandulang, bahasa mandailing ) di sepanjang Daerah Aliran Sungai Batang Gadis. Mereka mencari emas di pasir yang telah ditumpukkan kemudian dibersihkan. Amatan Waspada Senin, (14/4), sejak pagi warga sudah berdatangan ke sekitar aliran sungai tersebut. Mereka berebutan mengambil tumpukan pasir yang sudah dikumpulkan alat berat untuk dijual sebagai bahan bangunan. Masing-masing mereka membawa ember dan alat lainnya untuk membawa pasir ini kemudian dibawa ke sungai untuk dibersikan. Abdul Sani Lubis, 43, salahseorang warga Tambang Bustak yang ikut dalam mencari emas tersebut mengatakan, mulai seminggu yang lewat ratusan warga Tambang Bustak dan sekitarnya

sudah ikut mencari emas untuk dijual. Umumnya mereka menggunakan alat tradisional, sebagian warga mendapat emas. “Awalnya ada warga yang coba-coba mencari emas di pasir yang sudah ditumpukkan alat yang berat yang kebetulan sedang mengumpulkan pasir dan batu untuk dijual sebagai bahan bangunan. Setelah dibersihkan, ternyata warga ini mendapat emas, setelah mereka jual harga mencapaiRp500.000sampai1juta.Halinidiketahui warga lainnya, akhirnya warga mulai dari anakanak sampai yang usia tua berbondong-bondong ikut mencari emas,” ujarnya. Pantauan di lapangan, jumlah warga yang ikut mencariemasinisemakinharisemakinbertambah. Umumnyamerekamengajakkeluargamereka,mulai darianak-anaksampaidewasa.“Uangyangdidapat untuk tambahan uang jajan di sekolah, Bang,” ujar M. Nuh salah seorang siswa SD di daerah tersebut yang ikut langsung mencari emas ini. (c15)

Kelulusan Di Paluta Diharap 100 Persen GUNUNGTUA (Waspada): Hari pertama pelaksanaan Ujian Nasional (UN) tingkat SMA, SMK danMadrasyahAliyahNegeridan Swastadi PadanglawasUtara(Paluta) berjalan baik, Senin (14/4). Plt Sekda Kabupaten Paluta, Tongku Palit Hasibuan SE AK MSi didampingi Kepala Dinas Pendidikan Paluta Drs.Hazairin Hasibuan saat monitoring ke sejumlahsekolahdiwilayahPaluta memberikan semangat kepada siswa dan menyarankan supaya telitidalammemberikanjawaban. Sebelum pelaksanaan ujian berlangsungdimintakepadasiswa supaya berdoa agar Allah SWT memberikan kesehatan dan pikiran jernih.

“Saya harapkan pelaksanaan UNtahuniniberjalantertib,aman dan sukses. Semua pihak harus bekerja keras agar UN di Paluta adalah yang terbaik di wilayah Sumatera Utara,” harap Plt Sekda. Menurutnya, dalam pelaksanaan UN ini yang dilaksanakan mulai Senin, 14 hingga Rabu 16 April2014,mudah-mudahanpara siswa/i yang ikut melaksanakan UN diharapkan lulus 100%. Dan Ia juga memberikan motivasi kepada siswa/i dalam menjawab soal ujian. Senada juga diungkapkan, Kabid Dikemnum Paluta, Umar Pohan menambahkan, sangat berterima kasih kepada pihak kepolisian yang telah bersedia

membantu pemerintah dalam melakukanpenyimpanannaskah dan pendistribusian naskah ke sekolah penyelenggara di wilayah Kabupaten Padanglawas Utara. “Terimaksih pak atas kerjasamanya,” ucapnya. Lanjut Umar Pohan, jumlah siswa yang mengikuti UN 2014 ini yakni 2.513 siswa, dengan rinciansiswaSMA964siswa,SMK 558siswadanMA991siswa.Sedangkan jumlah sekolah yang dipakai untuk pelaksanaan UN tahun ini sebanyak, 49 sekolah dengan rincian 10 sekolah SMA, 6 Sekolah SMKdan33sekolahMA.Pantauan Waspada,pengawasandilakukan para guru-guru dan pengawas independenperguruantinggi.(a35)

Suara DPRD SU Di Psp, Golkar Unggul Telak Waspada/Sarmin Harahap

‘’Hal ini telah sering dilaporkan ke pemerintah kabupaten dan provinsi, namun belum pernah mendapat penanganan yang serius, karena jalan Sosopan ini merupakan jalan provinsi, diharap agar pemerintah provinsi serius menanganinya,’’ katanya. Kadis PU Pertamben Padanglawas, Ir. Ulil Fadil Nasution, MM bersama Kaban Penanggulangan Bencana Daerah, Arpan Nasution, S.Sos, yang langsung turun ke lokasi melakukan peninjauan menyampaikan kepada Waspada, Pemkab Padanglawas telah sering melaporkan kondisi jalinsum Sosopan yang rawan longsor. Apalagi, kata dia, kondisi serupa hampir setiap tahun terjadi, ketika musim penghujan tiba, puluhan titik longsor sepanjang jalinsum Sosopan akan kembali longsor, malah terkadang sampai mengancam jiwa masyarakat yang melintas. Menurut Dinas Bina Marga Provsu UPT Gunungtua, Hasian Dasopang ketika dipertanyakan upaya yang akan dilakukan untuk menangani kondisi jalinsum Sosopan yang rawan longsor itu, katanya sementara dilakukan penanggulangan darurat agar tetap bisa dilalui masyarakat pengguna jalan. Katanya untuk tahun ini telah ada dianggarkan sekitar Rp1 miliar lebih untuk penanggulangan bencanadijalinsumSosopan,termasukpembuatan bronjong, tembok penahan, drainase, dan cutting tebing serta pelebaran jalan, tegasnya. (a33)

P.SIDIMPUAN (Waspada): Perhitungan suara partai politik dan calon anggota DPRD Sumatera Utara (Sumut) Daerah Pemilihan (Dapil) 7 di enam kecamatan se Padangsidimpuan (Psp) sudah dilakukan. Untuk sementara Partai Golkar unggul telak, disusul Gerindra dan PAN. Data diperoleh Waspada dari Panitia Pemilihan Kecamatan (PPK) dan Panwascam, Senin (14/3), jumlah perolehan suara tersebut tidak beda jauh dengan milik posko parpol dan caleg yang dipublikasikan beberapa hari setelah pemungutan suara. Partai Golkar meraih 17.067 suara dengan caleg peraih suara tertinggi Chaidir Ritonga (7.599). Berdasarkan data enam kecamatan, suara Chaidir paling banyak di Kec. Sidimpuan Selatan yang merupakan kampung halamannya (2.544) dan Sidimpuan Utara (2.190). Caleg Partai Golkar peraih suara tertinggi kedua adalah HA Yasir Ridho Lubis yang juga Sekretaris DPD Golkar Sumut (2.093). Disusul Doli Sinomba Siregar (1.556), HRYuriandi Siregar (1.508), suara partai (1.474), Hasni Delaila Harahap (1.222),

dan sisanya suara caleg lain. Parpol suara tertinggi kedua adalah Gerindra dengan 10.233 suara. Parlinsyah Harahap caleg peraih suara terbanyak (1.958), disusul Rahmianna Delima Pulungan (1.844), suara partai (1.811), Zainuddin Arifin (1.421) dan sisanya suara caleg lain. Peraih tertinggi ketiga adalah Partai Amanat Nasional (PAN) dengan 9.453 suara. Borkat S.Sos.MM, merupakan caleg dengan suara tertinggi (4.809). Paling banyak di Kec. Sidimpuan Utara atau daerah tempat tinggalnya (2.165), dan Sidimpuan Hutaimbaru (1.488). Caleg PAN berikutnya, Iskandar Sakti Batubara (2.125). Kemudian disusul suara partai (915), Usman Hasibuan (576), Ahmad Aswan Waruwu (302), Syafaruddin Hasibuan (146), dan sisanya suara caleg lain. Tertinggi keempat adalah Partai Demokrat (9.116), dengan caleg suara terbanyak Aswar Syamsi(2.186).SuaraKetuaDPRD Kota Padangsidimpuan ini paling banyak di Kec. Sidimpuan Utara (960). Di Kec. Sidimpuan Selatan yang merupakan tempat tinggalnya cuma 44 suara. Caleg Demokrat dengan suara tertinggi berikutnya adalah

Tia Isah Ritonga (1.506), Mohd. Ike Taken Hasibuan (1.142), suara partai (1.391), Jamaluddin Hasibuan (944), dan sisanya suara caleg lain. Parpol kelima suara tertinggi adalah PDI Perjuangan (8.657) dengan caleg suara terbanyak Sutrisno Panggabean (2.598). Posisi enam, Partai Keadilan Sejahtera (PKS) dengan 8.657. dan caleg peraih suara terbanyak Khoiruddin Rambe (2.551). Selanjutnya Partai Bulan Bintang (7.881) dengan caleg suara terbanyak Zulkarnaen Nasution juga mantan Wali Kota Padangsidimpuan (5.192). PKPI berada diurutan delapan (7.996), dengancalegsuaraterbanyakRobi Agusman Harahap (4.538). Posisi kesembilan adalah Hanura (5.991), disusul Partai Persatuan Pembangunan (4.873), Partai Kebangkitan Bangsa (3.832). Urutan paling terakhir adalah Partai NasDem dengan 3.382 suara. Akumulasi suara parpol dan caleg DPRD Sumut dari Dapil 7 di Kota Padangsidimpuan ini merupakan data sementara. Untuk pastinya masih menunggu hasil perhitungan dan penetapan dari KPU Kota Padangsidimpuan. (a27)

Waspada/Alpin Lubis

DALAM seminggu terakhir, ratusan warga Tambang Bustak, Kec. Kotanopan, Kab. Mandailing Natal ramai-ramai mencari emas secara tradisional (mandulang) di sepanjang Daerah Aliran Sungai Batang Gadis.

Pemkab Tapsel Launching Penyerahan DHKP Dan SPPT P.SIDIMPUAN (Waspada): Pemkab Tapanuli peta, dan piutang PBB dari KPP Pratama. Atas Selatan menyerahkan Daftar Himpunan Keteta- bantuan konsultan dan pendampingan KPP Prapan Pajak (DHKP) dan Surat Pemberitahuan tama, bulan lalu kita sudah mencetak 77.725 SPPT Pajak Terhutang (SPPT) Pajak Bumi Bangunan PBB P2 tahun 2014,” kata Syahrul M Pasaribu. Untuk saat ini, Pemkab Tapsel sedang Perkotaan dan Perdesaan (PBB P2) kepada camat, kepala desa, dan para wajib pajak, Senin (14/4). memproses pendaftaran 1.000 SPPT PBB P2. Penyerahan secara simbolis 77.725 lembar Termasuk di dalamnya SPPT dari Desa Batu Satail, SPPT PBB P2 tahun 2014 dengan nilai ketetapan Kec. Sipirok, dan Desa Bukkas, Kec. Angkola Rp2,4 miliar ini merupakan yang pertama kalinya Sangkunur. AkhirAprilinidirencanakansemuanya (launching). Yakni, sejak Pemkab Tapsel diberi sudah selesai. Pada kesempatan itu Syahrul mengatakan, wewenang mengelola PBB daerah sesuai amanat UU No.28 tahun 2009 tentang Pajak Daerah dan Pemkab Tapsel telah menaikkan NJOP tanah di daerahnya, dari Rp5.000 per meter menjadi Retribusi Daerah. Hadir Bupati Tapsel, Syahrul M Pasaribu, Rp10.000. Terjadi peningkatan 100 persen atau Wakil Bupati, Aldinz Rapolo Siregar, Kepala Kantor jika dirupiahkan Rp5.000. Sementara Kadis PPKADTapsel, H. Sulaiman Pelayanan Pajak (KPP) Pratama Padangsidimpuan, Iman Pinem, Pimcab Bank Sumut P.Sidim- Lubis SE, melaporkan, penyerahan SPPT PBB puan, Hifzan Lubis, Kadis Pendapatan, Penge- P2inimerupakanyangpertamasetelahwewenang lolaanKeuangandanAsetDaerah,SulaimanLubis, mengelola PBB diserahkan pemerintah pusat pimpinan SKPD, Camat, Lurah, Kepala Desa, ke Pemkab Tapsel. ‘’Semua soft copy keperluan Sistem Manajemen Informasi Objek Pajak dan wajib pajak. KepalaKPPPratamaPadangsidimpuan,Iman (SISMIOP) telah kita terima dari KPP Pratama,” Pinem, menyebut, Pemkab Tapsel merupakan katanya. (a27) pemerintah daerah paling aktifdankooperatifdiTapanuli Bagian Selatan (Tabagsel) dalam upaya peningkatan pelayanankepadamasyarakat wajib pajak. PemkabTapseljugadaerah paling tercepat dalam entri data dan pencetakan SPPT PBB P2 tahun 2014. KPP Pratama akan mengajukan usul kepada Menteri Keuangan agar menetapkan Pemkab Tapsel sebagai salah satu daerahpercontohandiIndonesia. Bupat Tapsel, H. Syahrul M Pasaribu SH, mengatakan, UU No.28 tahun 2009 tentang PDRD telah ditindaklanjuti dengan Perda No.16 tahun 2010 tentang Pajak Daerah. PBB P2 yang selama ini merupakan pajak pusat, sejak 1 Januari 2014 sudah menjadi Waspada/Sukri Falah Harahap pajak daerah. BUPATI Tapsel, Syahrul M Pasaribu, secara simbolis “Februari kemarin kita menyerahkan 77.725 SPPT PBB P2 tahun 2014 kepada perwakilan terima semua soft copy data, Camat, Lurah, Kepala Desa, dan Wajib Pajak.


Ekonomi & Bisnis

WASPADA Rabu, 16 April 2014

KURS BANK MANDIRI Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.482 9.226 10.857 15.959 3.175

Beli 11.318 8.977 10.560 15.617 2.912

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.450 9.144 10.765 15.833 3.081

KURS BI

KURS BANK BNI

KURS BANK BCA Beli 11.400 9.094 10.695 15.753 3.011

Mata Uang Dolar AS Dolar Singapore Dolar Australia Euro Real Arab Saudi

Jual 11.500 9.437 11.001 16.090 3.251

Beli 11.350 8.837 10.501 15.590 2.851

Mata Uang Jual Dolar AS 11.501 Dolar Singapore 9.194 Dolar Australia 10.800 Euro 15.928 Real Arab Saudi 3.066

Beli 11.387 9.102 10.688 15.768 3.036

Antara

SUPLAI BIBIT AYAM Pedagang memilih ayam sebelum di potong di salah satu rumah potong hewan di Jakarta, Selasa (15/4). Kementerian Perdagangan akan mengatur suplai bibit ayam atau day old chicken (DOC) dan impor bibit indukan ayam atau grand parent stock (GPS) untuk menstabilkan harga ayam.

Negara (BUMN) Dahlan Iskan, mengatakan besarnya ego sektoral masing-masing BUMN itu membuat realisasi pembangunan energi tersebut menjadi terhambat.“PLN dan Pertamina ego sektoralnya luar biasa, hingga negara kena sandera,” kata Dahlan, di Kantor Kementerian BUMN, Jakarta, Selasa (15/4). Dahlan menyebutkan, saat ini Pertamina memiliki sembilan geotermal di Indonesia. Sedangkan PLN merupakan satu-satunya yang siap membeli hasil produksi geotermal milik Pertamina. Segala upaya untuk merealisasikan hal itu pun harus

terkendala akibat ego sektoral PLN yang lebih tinggi. Dahlan menjelaskan, dia telah mengumpulkan kedua jajaran direksi BUMN tersebut untuk merealisasikan proyek geothermal itu. Terobosan tersebut pun tidak memandang peraturan yang selama ini menjadi penghalang, dan pada akhirnya mencapai kata sepakat dan tidak ada yang dirugikan, dengan ketentuan IRR yang dikehendaki bersama sebesar

Tomat Di Aceh Tengah Rp300 Per Kg

JAKARTA (Waspada): DPR RI mengaku belum bisa merestui akuisisi Bank Tabungan Negara (BTN) ke Bank Mandiri. Karena hal tersebut harus dibahas terlebih dahulu oleh dua komisi di DPR. Wakil Ketua Komisi XI DPR Harry Azhar Azis, mengatakan itu di Jakarta, Selasa (15/4). Katanya, akuisisi harus melalu Komite Privatisasi dan mendapat izin DPR. ‘’Tidak bisa semudah itu Bank Mandiri mencaplok Bank BTN. Sangat disayangkan rencana akuisisi Bank BTN dilakukan diam-diam. Karena privatisasi seluruh perusahaan

Pertamina (Persero) dan PT PLN (Persero) diharapkan dapat segera mewujudkan geotermal sebagai energi pengganti bahan bakar minyak (BBM). Jika kedua perusahaan tersebut bisa merealisasikannya, maka Indonesia akan menjadi produsen geotermal terbesar di dunia. Menteri Badan Usaha Milik

TAKENGEN (Waspada): Harga tomat di Aceh Tengah dan Bener Meriah kian mengkhawatirkan sejak sebulan terakhir. Harganya hanya Rp300 per kg. Akibatnya, para petani mengaku bangkrut. “Harga tomat sangat murah. Padahal, sebelumnya agen pembeli sempat menghargainya Rp8.000 per kg. Turunnya harga membuat kami sangat merugi,” kata Musda, petani Kec. Atu Lintang kepada Waspada, Senin (14/4) di Takengen. Menukiknya harga secara drastis membuat petani merugi. Biaya produksi tidak dapat tertutupi. “Biasanya untuk bertanam satu pati (paket) bibit tomat atau sekira 1.000 batang, dibutuhkan modal setidaknya Rp1,2 juta, tidak termasuk ongkos tenaga selama 3 bulan masa perawatan. Namun kini, bisa mencapai sekitar Rp2 juta. Naiknya biaya bertanam dipengaruhi langkanya sebagian jenis bubuk bersubsidi, seperti Za atau urea,” jelasnya. (cb09)

Pupuk Bio Organik Hasilkan 10,9 Ton Padi Per Hektare SIGLI (Waspada): Hasil panen perdana padi, menggunakan pupuk bio organik di lahan percontohan (Demplot) Desa Jeumpa, Kec. Sakti, Kab. Pidie, Senin (14/4), mencapai 10,96 ton/haktare. Ini melebihi target yang ditetapkan 8 ton/hektare. Panen padi perdana di Demplot bio organik, pada lahan milik Tgk.Ibrahim, di Desa Jeumpa, Kec.Sakti, merupakan Program Peningkatan Produksi Pangan Berbasis Korporasi (GP3K) kerjasama PT. Pupuk Iskandar Muda, dengan Departemen Pengembangan Bisnis melalui Penelitian pupuk Bio-Organik PT. PIM, dan BPPT Pusat Jakarta dan Badan Penyuluhan Pertanian (BPP) Pidie. Dalam pelaksanaanya program ini juga melibatkan masyarakat. Ketua GP3K, PT PIM Mustafa Tahir, Senin (14/4), mengatakan, program ini tidak saja dilaksanakan di Pidie, tapi juga di Kab. Pidie Jaya. Panen kali ini di Desa Jeumpa, dikelola Staf GP3K dan unit pengembangan bisnis PT PIM, dengan menerapkan pola tanam 2-1 dan pemakaian pupuk bio organik, serta pemupukan berimbang 2,3,5. Dijelasknya panen padi perdana ini, juga sudah dilakukan di Kecamatan Jangka Buya, Pidie Jaya dengan jumlah dicapai 11,2 Ton/ Ha. “ Tujuan dari program ini, untuk mengejar target surplus beras 10 juta ton pada 2014, sebagai mana intruksi presiden nomor 5/tahun 2011” demikian Mustafa. (b10)

14 persen. “Setelah itu kita putuskan sepakat, kita tunjuk pihak ketiga, internasional, disepakati kedua pihak, netral ahli bidang geotermal dan penyusunan biaya proyek geotermal, disepakati SKM dari Selandia Baru,” ungkapnya. Namun setelah jauh membahas dengan melibatkan pihak ketiga, PLN masih keberatan dengan biaya-biaya pembangunan geotermal yang sebelumnya telah disepakati ber-

sama. Menurutnya, jika masih menjabat sebagai Direktur Utama PLN, maka dia akan segera merealisasikan proyek pembangunan geotermal tersebut. Sebab dari awal dibicarakan, sudah menemui kata sepakat. “Ternyata keputusan SKM ini PLN enggak mau juga, masih dianggap kemahalan. Karena ini negara yang disandera, ego sektoralnya tinggi,” tutup Dahlan. (okz)

DPR Belum RestuiAkuisisi BTN pelat merah harus mendapat restu DPR,” katanya. Harry menambahkan, pemerintah yang diwakili kementerian BUMN hingga kini belum pernah menyampaikan rencana akuisisi Bank BTN. Termasuk juga pelepasan saham pemerintah kepada Bank Mandiri. ‘’Kita belum pernah diajak untuk bahas itu. Kalaupun ada rencana itu, kementerian BUMN harus kirim surat ke kementerian keuangan dan DPR. Untuk pembahasannya di DPR melibatkan komisi VI dan XI. Dua komisi ini bisa setuju atau tidak. Bisa pula berbeda putus-

an. Jadi, proses privatisasi BUMN itu panjang,’’ ungkap Harry. Menurutnya, proses privatisasi BUMN memang tidak mudah, karena menyangkut aset negara. Oleh sebab itu DPR harus terlibat di dalamnya mengenai finalisasi akuisisi BTN oleh Mandiri Dia mengakui banyak isu privatisasi yang menyerang BTN, diharapkan hal itu tidak mengganggu kinerja. “Sejauh ini, DPR menilai eksistensi BTN sebagai bank fokus perlu dipertahankan. Jadi keberadaan BTN perlu dipertahankan,” tuturnya. (j03)

Dishub Sumut Berharap Aksi Mogok Tidak Berlarut-larut MEDAN (Waspada) : Pimpinan Angkutan Khusus Pelabuhan (Angsupel) Belawan diimbau dapat mempertimbangkan kepentingan lebih luas tentang pergerakan arus barang di Belawan. Dengan begitu diharapkan aksi mogok yang dilakukan pemilik truk tidak berlarut-larut. Kepala Bidang (Kabid) Darat Dishub Sumut Darwin Purba, mengatakan itu di kantornya, Selasa (15/4). Dia menanggapi peristiwa mogok operasional ratusan truk pengangkut barang antar pulau sejak Senin (14/4). Dar win menyatakan, pihaknya tidak bisa ikut campur dalam masalah mogok angkut-

an terkait dengan denda Rp 3 miliar dari KPPU (Komisi Pengawas Persaingan Usaha) Medan atas dugaan Organda melakukan kartel. ‘’Masalah ini sudah masuk ke ranah hukum. Sebaik-nya kedua belah pihak menyelesaikannya terlebih dahulu,’’ katanya. Memang, kata Darwin, peristiwa mogok operasional angkutan tidak hanya terjadi di Pelabuhan Belawan saja. Beberapa beberapa waktu lalu juga terjadi di Pelabuhan Tanjung Perak, Surabaya. Pada tanggal 3 Juni 2013 juga terjadi pemogokan besar-besaran di Pelabuhan Tanjung Priok Ja-

karta. Ketua DPP Organda Sumut Haposan Siallagan, saat dikonfirmasi via telepon selular, menyatakan mogok yang dilakukan belum tahu kapan berakhir. “Kami sedang memperjuangkan nasib orang banyak berkaitan dengan mogok angkutan ke Pelabuhan Peti Kemas Belawan,” kata Siallagan. Begitupun, kata dia, masalah ini akan dibicarakan pada rapat khusus, Selasa siang, menyikapi masalah yang bakal terjadi kedepan. “Kami sedang ber-siap-siap mau rapat terkait mogok angkutan barang,” kata Ketua DPD Organda Sumut. (m32)

Berebut Ikan Segar Di Pantai Manohara HAMPARAN pantai berpasir putih itu sejak puluhan tahun lalu digunakan nelayan tradisional sebagai lokasi pendaratan ikan hasil tangkapan mereka. Kini di lokasi itu bukan saja didarati sampan tapi juga oleh boat ikan. Berbeda dengan lokasi pendaratan ikan di daerah lain, di Pantai Manohara, Balek, Meureudu, setiap pagi diramaikan oleh warga dari luar Meureudu. Mereka datang dari Kecamatan Trienggadeng, Meurah Dua, dan Ulim. Letak yang sangat mudah dijangkau dan tersedia ikan yang masih segar merupakan daya tarik masyarakat membeli ikan langsung dari nelayan di atas hamparan pantai yang juga sejak lama dikenal sebagai lokasi wisata. Setiap hari pembeli dan pedagang berbaur menawar harga ikan dari para nelayan yang baru mendarat dari laut. Jumlah warga semakin padat pada pagi hari Sabtu dan Minggu. Bersama keluarga, masyarakat datang ke daerah itu sambil menikmati sarapan pagi

di pondok dan kafe yang ada di sepanjang pantai tersebut. Seperti pada hari Sabtu dan Minggu pekan lalu, usai shalat subuh, ratusan warga, menuju Pantai Manohara. Mereka berwisata sambil membeli ikan beragam jenis yang masih segar. Sering terjadi, warga seperti berlomba menawarkan harga ikan. Seperti ada ketentuan tidak tertulis, seseorang sedang menawar ikan, maka orang lain harus bersabar bila berminat. Berlomba menawar harga ikan di pantai tersebut merupakan pemandangan yang menarik. Tidak jarang, ikan nelayan ditawar dengan harga sangat tinggi, oleh orang yang sangat bersemangat melihat ikan kegemarannya. Itu dilakukan agar tidak ada tawaran yang lebih besar terhadap ikan tersebut. Perairan Laut Meureudu dan sekitarnya memilki potensi ikan laut beragam jenis. Sayangnya, nelayan sejak puluhan tahun lalu masih saja mendaratkan ikan ke atas hamparan pantai. Rusli Ismail

Organda Dipersilahkan Ajukan Keberatan Ke Pengadilan Negeri MEDAN (Waspada): Komisi Pengawas Persaingan Usaha (KPPU) Sumatera Utara sangat menyayangkan aksi mogok yang dilakukan Organisasi Angkutan Darat (Organda) karena dapat mengakibatkan terganggunya kegiatan perekonomian di Sumut. Namun bila, Organda menolak atas putusan KPPU terkait kartel, mereka dipersilahkan untuk mengajukan keberatan ke Pengadilan Negeri. “Pihak-pihak yang tidak menerima putusan KPPU dapat mengajukan keberatan ke Pengadilan Negeri sebagaimana diatur dalam UU No.5 tahun 1999 tentang Larangan Praktek Monopoli dan Persaingan Usaha Tidak Sehat. Pengadilan Negeri yang akan memeriksa keberatan pelaku usaha tersebut apakah putusan yang dibuat KPPU sudah tepat,” kata Ketua KPPU Sumut Abdul Hakim Pasaribu, menanggapi aksi mogok Organda tersebut, di Medan Selasa (15/4). Abdul Hakim menyebutkan, pihaknya telah memutuskan perkara No.06/KPPU-I/2013 tentang dugaan pelanggaran UU No.5 tahun 1999 terkait Penetapan Tarif Angkutan Kontainer ukuran 20", 40", dan 2x20" di 12 rute dari dan menuju Pelabuhan Belawan tahun 2011 dan 2012. KPPU menjatuhkan hukuman denda bagi pelaku usaha mulai kisaran Rp22 juta sampai Rp828 juta. “Penolakan Organda terhadap putusan KPPU inilah yang mendasari aksi mogok yang

dilakukan di Pelabuhan Belawan,” ujarnya. Dijelaskannya, putusan KPPU dibuat berdasarkan hasil pemeriksaan yang telah dilakukan terhadap saksi, ahli dan pelaku usaha. KPPU telah melakukan proses pemeriksaan perkara tersebut sesuai prosedur dan putusan tersebut sudah berdasarkan pada alat bukti yang cukup sebagaimana yang telah diatur dalam UU No.5 tahun 1999. “Namun demikian, apabila ada pelaku usaha yang dijatuhi hukuman tidak menerima putusan KPPU tersebut, dapat mengajukan keberatan ke Pengadilan Negeri. Berdasarkan ketentuan dalam UU No.5 1999 cukup jelas diatur putusan tidak dapat diubah oleh KPPU. Putusan KPPU hanya dapat diubah melalui Pengadilan Negeri, tergantung putusan nantinya apakah menguatkan putusan Komisi atau tidak,” jelasnya. Abdul Hakim menjelaskan, perjanjian penetapan tarif angkutan kontainer ukuran 20", 40" dan 2x20" di 12 rute dari dan menuju Pelabuhan Belawan yang ditandatangani beberapa anggota Organda Belawan merupakan salah satu bentuk perjanjian kesepakatan harga yang bertentangan dengan UU persaingan usaha. “Prilaku penetapan harga atas barang dan jasa mengakibatkan terbatasnya pilihan konsumen untuk mendapatkan harga kompetitif, penetapan harga juga mengakibatkan terhambatnya persaingan di antara pelaku usaha yang bersepakat,” ujarnya. (m41)

Ekspor Sumut Naik Tipis 0,52 Persen

Negara Tersandera Ego Pertamina Dan PLN JAKARTA (Waspada): PT

B5

MEDAN ( Waspada): Berkurangnya permintaan beberapa komoditas utama dari sejumlah buyer (pembeli) membuat ekspor Sumatera Utara pada Januari-Maret 2014 hanya mengalami kenaikan tipis 0,52 persen dari periode yang sama tahun sebelumnya 1,182 miliar Dolar AS menjadi 1,188 miliar Dolar AS. Berdasarkan Surat Keterangan Asal (SKA) Dinas Perindustrian dan Perdagangan (Disperindag) Sumut pada Januari hingga Maret 2014, dari sejumlah komoditas utama seperti Minyak Kelapa Sawit atau Crude Palm Oil (CPO) hanya naik 0,2 persen menjadi 803,711 juta dolar AS dari 802,072 juta Dolar AS. Sedangkan komoditas utama lainnya mengalami penurunan di antaranya karet yang turun 19,9 persen menjadi 138,527 juta Dolar AS dari periode sebelumnya 173,059 juta Dolar AS. Kemudian, kopi arabica yang turun 7,68 persen menjadi 1,754 juta Dolar AS dari periode sebelumnya 64,975 juta Dolar AS. Selanjutnya, ekspor biji coklat (kakao) juga turun 49,6 persen menjadi 11.652 juta Dolar AS dari periode yang sama di 2013 sekitar 23,148 juta Dolar AS. Ka s i E k s p o r Ha s i l Pe r t a n i a n d a n Pertambangan Disperindag Sumut Fitra Kurnia mengatakan, secara umum realisasi ekspor hasil pertanian dan pertambangan Sumut menurun. Hal ini dikarenakan, kondisi negara-negara tujuan ekspor produk-produk masih belum terlepas dari krisis ekonomi. “Sebagian besar ekspor komoditas memang mengalami penurunan. Begitupun, ada pertumbuhan ekspor Sumut di periode Januari

hingga Maret 2014. Inilah yang membuat ekspor Sumut naik 0,52 persen dari periode yang sama di tahun sebelumnya,” katanya, Selasa (15/4). Teh hitam misalnya, kata Fitra, komoditas tersebut mengalami peningkatan 86,04 persen menjadi 86,04 persen menjadi 1,566 juta Dolar AS. Kemudian, rempah-rempah naik 110,6 persen menjadi 5,182 juta Dolar AS dan hasil laut udang naik 164,5 persen menjadi 83,034 juta Dolar AS. “Tentunya, naiknya nilai ekspor sejumlah komoditas merupakan prestasi yang menggembirakan. Kita harapkan kinerja ekspor di akhir tahun semakin membaik,” tandasnya. Sebelumnya Gabungan Perusahaan Karet Indonesia (Gapkindo) memang telah memprediksi bahwa pertumbuhan ekspor karet Sumatera Utara (Sumut) 2014 bakal melambat dari tahun sebelumnya. Hal ini mengingat adanya pemangkasan ekspor karet sebesar 10 persen pada tahun ini. Sekretaris Eksekutif Gapkindo Sumut Edy Irwansyah menyebutkan, pengurangan ekspor karet sengaja dilakukan, jika tidak dilakukan nilai karet bisa jatuh lagi dan harga akan tidak terkontrol. Apa yang dilakukan Gapkindo adalah untuk menyeimbangkan supply and demand agar harga karet di tingkat dunia seimbang. “Saat ini, petani karet sudah menjerit. Kita prediksi harga karet di 2014 tidak akan lebih dari 2,5 dolar AS per kilogram. Sementara harga kontrak di Mei sekitar 184,9 Sen per kg atau sekitar Rp18.500 sampai Rp19.000 per kg di tingkat pabrik,” jelasnya. (m41)

Aset Perbankan Sumut Rp212 Triliun MEDAN (Waspada): Aset perbankan Sumatera Utara di Februari 2013 mencapai Rp212,58 triliun atau tumbuh 0,46 persen (mtm) dan naik 16,12 persen secara tahunan (yoy). Tingginya pertumbuhan tahunan aset ini dipicu oleh peningkatan penghimpunan dana. Kepala Perwakilan BI Wilayah IX SumutAceh Difi Ahmad Johansyah mengatakan, dibandingkan Januari 2014, tingkat pertumbuhan bulanan lebih tinggi di mana aset tumbuh negatif 1,56 persen (mtm). Sedangkan tingkat pertumbuhan tahunan juga lebih tinggi dibandingkan periode yang sama tahun lalu yang hanya tercatat sebesar 14,27 persen (yoy). “Pertumbuhan aset perbankan konvensional sekitar 16,1 persen dibandingkan bulan yang sama di tahun 2013 (yoy) dan syariah tumbuh 16,52 persen (yoy). Dari sisi perbankan konvensional, pertumbuhan tersebut lebih tinggi dibandingkan pertumbuhan tahun lalu yang tercatat sebesar 13,13 persen (yoy). Sedangkan pertumbuhan aset perbankan syariah periode laporan turun cukup signifikan dibandingkan tahun sebelumnya yang tercatat sebesar 41,1 persen (yoy),” katanya, kemarin. Meski demikian, kata dia, secara keseluruhan share aset perbankan syariah Sumut mencatat 5,04 persen, meningkat sedikit dibandingkan tahun sebelumnya yang tercatat sebesar 5,03 persen. Sedangkan untuk penghimpunan Dana Pihak Ketiga (DPK) perbankan, secara bulanan tumbuh 0,4 persen (mtm) atau 14,24 persen (yoy). Meski secara bulanan pertumbuhan DPK melambat, namun secara tahunan pertum-

buhan DPK periode laporan meningkat signifikan dibandingkan tahun lalu yang hanya mencapai 7,56 persen (yoy). “Tingginya pertumbuhan tahunan DPK didorong oleh pertumbuhan pada perbankan konvensional 14,31 persen (yoy) dan perbankan syariah 12,45 persen (yoy). Pada perbankan konvensional, pertumbuhan DPK tersebut meningkat signifikan dibandingkan tahun sebelumnya yang tercatat 7,07 persen (yoy), namun perbankan syariah mengalami penurunan pertumbuhan di mana sebelumnya tercatat 21,06 persen (yoy),” ujarnya. Berdasarkan pangsanya, kata Difi, penghimpunan DPK didominasi perbankan konvensional dengan pangsa mencapai 96,1 persen. Penghimpunan DPK yang cukup signifikan dalam bentuk deposito dan giro yang masing-masing tumbuh 24,96 persen dan 8,06 persen. Di sisi lain, tabungan tumbuh melambat dari 11 persen di tahun lalu menjadi 6,69 persen pada periode laporan. “Meningkatnya penghimpunan DPK dalam bentuk deposito salah satunya dipengaruhi oleh peningkatan suku bunga perbankan. Suku bunga deposito naik dari 5,39 persen pada bulan Februari tahun 2013 menjadi 7,1 persen,” ujarnya. Sementara itu, meski pertumbuhannya meningkat signifikan, suku bunga giro menunjukkan sedikit penurunan dari 2,2 persen menjadi 2,14 persen. Meningkatnya penghimpunan dana ini menggambarkan cukup tingginya kepercayaan masyarakat terhadap perbankan di Sumut. (m41)

Pemerintah Berencana Lepas Saham Di BTN

Waspada / Rusli Ismail

Suasana pagi hari di Pantai Manohara, Desa Balek, Kec. Meureudu, Kab. Pidie Jaya dipadati warga membeli ikan yang masih segar sambil berwisata dengan keluarga. Foto direkam, Minggu (13/4)

JAKARTA (Waspada): Pemerintah melalui Kementerian BUMN berencana melepas sahamnya di PT Bank Tabungan Negara Tbk (BTN). Hal itu akan diputuskan dalam Rapat Umum Pemegang Saham Luar Biasa (RUPSLB) bank itu 21 Mei 2014. “Surat dari Deputi BUMN Bidang Jasa Keuangan sudah kami terima. Keputusannya kami serahkan sepenuhnya kepada pemegang saham,” kata Dirut BTN Maryono di Kantor Kementerian BUMN di Jakarta, Selasa (15/4). Menurut Maryono, dirinya belum dapat menjelaskan detil dari surat yang dimaksud, karena harus menunggu arahan dari Kementerian BUMN selaku kuasa pemegang saham BTN. “Tunggu saja pernyataan dari Kementerian BUMN yang memiliki domain soal BTN,” ujarnya. Saat ini santer isu bahwa Bank BTN, bank yang khusus menangani pembiayaan kredit perumahan tersebut akan diakuisisi oleh PT Bank Mandiri Tbk. Sebelumnya wacana akuisisi BTN juga sudah pernah bergulir pada 2006. Ketika itu, pihak yang disebut-sebut berminat adalah PTBNI Tbk.

Terkait dengan hal itu juga muncul indikasi di publik bahwa rencana penjualan saham BTN tersebut erat hubungannya dengan pelaksanaan Pemilu 2014, terkait kebutuhan dana oleh partaipartai tertentu. “Soal itu saya tidak komentar. Internal BTN tidak mempunyai kewenangan apa-apa soal itu,” kata Dirut BTN Maryono. Maryono yang sebelumnya pernah menjabat Dirut Bank Century ini hanya mengatakan bahwa direksi BTN saat ini fokus menjalankan transformasi usaha. “Transformasi BTN dalam rangka melakukan perubahan dan pengembangan, sehingga betul-betul menjadi market leader di bidang pembiayaan perumahan,” tegas Maryono. Pada tahun 2013 BTN membukukan laba bersih sebesar Rp1,56 triliun, tumbuh 14,53 persen dibanding tahun 2012 sebesar Rp1,36 triliun. Pada saat yang sama, aset tumbuh 17,38 persen menjadi Rp131,17 triliun, dari sebelumnya Rp111,7 triliun. Adapun kredit yang disalurkan pada 2013 tembus Rp100,46 triliun, tumbuh 23,41 persen dari sebelumnya hanya Rp81,41 triliun. (ant)


Opini

B6

WASPADA Rabu 16 April 2014

TAJUK RENCANA

Blusukan Jokowi Dalam UN Tanggung Jawab Mendikbud

M

enteri Pendidikan dan Kebudayaan RI Muhammad Nuh cepat tanggap menggelar rapat khusus membahas munculnya soal blusukan JokoWidodo (Jokowi) dalam soal Ujian Nasional (UN) mata pelajaran Bahasa Indonesia untuk tingkat SLTA/sederajat. Rapat dimaksud untuk mencari tahu siapa yang bersalah memasukkan ‘’soal politis’’ yang mengidolakan Gubernur DKI Jakarta sekaligus Capres dari PDIP itu. Kalau Mendikbud kemarin baru bersidang mencari tahu siapa yang bersalah, apa motivasi,dansanksiyangbakaldijatuhkanpascatimpembuatsoalUN, KomisiPerlindungan Anak Indonesia (KPAI) mendesak agar Kemendikbud melakukan investigasi seputar soal kontroversial itu karena jelas-jelas terindikasi kepentingan politik. Boleh saja Ketua KPAI Asrorun Ni’am Sholeh menduga adanya upaya politisasi UN melalui soal Bahasa Indonesia yang berisi cerita tentang blusukan Jokowi, yang isinya cenderung penggiringan opini dan pengidolaan tokoh. Sebab, Jokowi termasuk tokoh politik dan terlibat langsung dalam pemilu 2014. Oleh karena itu soal itu bukan saja tidak etis tapi terlarang karena ranah Intisari: pendidikan sudah terkontaminasi politik ‘Kemendikbud harus gen- praktis. Pertanyaan berikutnya, ada apa Ketle mengakui kesalahan mendikbuddenganJokowi?Apakahinterjajaran elite Kemendikbud sudah disudan meminta maaf pada nal supi oleh kepentingan politik untuk memasyarakat atas kebobo- menangkanJokowidalamPilpresJulimenatau sebaliknya soal tak patut itu lan soal politis dalam UN’ datang, disengaja diorder untuk memancing kemarahan masyarakat khususnya orangorang parpol guna merusak citra dan merontokkan elektabilitas Jokowi. YangpastiUNadalahinstrumenakademiksehinggamenjadibermasalahjikaditunggangi kepentingan politik. Itu sebabnya harus diusut dan ditindak tegas siapa pun yang terlibat di dalamnya sehingga kasus serupa tidak terulang lagi. Tidak tertutup kemungkinan pembuatan soal itu dilakukan jauh hari sebelum UN diselenggarakan, katakanlah setahun lalu. Sedangkan pencapresan Jokowi ditetapkan baru dua pekan sebelum pemilu legislatif berlangsung 9 April lalu. Tim pembuat soal tidak sadar dan atau tidak yakin Jokowi bakal mendapat mandat dari PDIP menjadi Capres. Intinya tidak disengaja. Namun seharusnya soal blusukan Jokowi itu tidak sampai lolos jika tim pembuat soal dan pengawasnya kritis dan tanggap alias tidak berandaiandai. Hemat kita, sebaiknya Mendikbud membentuk tim khusus mengusut masuknya soal politis dalam UN anak SMU. Biarkan tim independen bekerja dan pastikan ada sanksi tegas agar kasus serupa jangan sampai terulang lagi. Dan yang kena sanksi tidak hanya pembuat soal, tapi juga pihak-pihak dua tingkat di atasnya, termasuk pengawas. Harusnya setiap soal dibaca ulang oleh tim khusus yang benar-benar profesional. Alangkah elegannya jika Kemendikbud tidak lepas tangan dengan peristiwa memalukan yang terjadi di dalam institusinya. Dan sebagai pihak yang paling bertanggung jawab, Prof M. Nuh diminta atau tidak, didesak atau tidak, cukup proporsional rasanya kalau ia mengundurkan diri dari jabatannya. Sebab, kesalahan yang dilakukan anak buahnya terbilang sulit dimaafkan karena korbannya tidak hanya dunia pendidikan dan anak didik, tapi juga bisa bermasalah dalam catatan sejarah bangsa. Sebab, saat ini Jokowi memang lagi manis-manisnya, lagi bersih-bersihnya, lagi tren-trennya, namun ke depan, apalagi kalau berhasil dalam Pilpres dan menjadi orang nomor satu, bisa saja ia membuat kesalahan-kesalahan sehingga keteladanannya luntur oleh kuatnya pengaruh kekuasaan. Tentunya wajar kalau Jokowi saja menolak dirinya ditokohkan sedemikian rupa dan dinarasikan dalam soal UN sebagai tokoh teladan. Usul Jokowi sebaiknya soal terkait biografi tokoh panutan diambil dari sosok pahlawan nasional. Hal itu sangat bijak karena peran dan jasa para pahlawan cukup besar di negeri ini dan orangnya sudah meninggal dunia sehingga keteladanannya dapat dipertanggungjawabkan. Kemendikbud harus mengakui kesalahannya dan meminta maaf pada masyarakat dengan terjadinya kebobolan soal keteladanan dari blusukan Jokowi dalam UN. Konsekuensinyaharusadayangbertanggungjawab,siapadia?JawabnyaadalahMendikbud Prof M. Nuh.Walaupun usia kabinet pemerintahan Presiden Susilo BambangYudhoyono hanya hitungan bulan, namun sebagai bentuk tanggung jawab pemimpin langkah mundur merupakan jawaban sepadan.+

APA KOMENTAR ANDA SMS 08116141934

Faks 061 4510025

Facebook Smswaspada

+6281361408983 Besok pemilu kita harus memilih pemimpin yang adil dan bertanggung jawab terhadap Negara +628126401610 Sistim PILEG sekarang ini..menjadi kan anggota dewan yg duduk d’DPR..menjadi tak berkualitas...menang kerena uang...tolong kembali seperti yg dulu..yg mana partai yg nentu kan orang nya..berdasar no urut...tq

Hasil Pemilu & Pemilih Cerdas Oleh Dr Drs H.Ramli Lubis, SH, MM Sukses Pemilu juga ditentukan oleh tingkat kecerdasan pemilih dalam menentukan pilihannya.

R

akyat Indonesia telah menjatuhkan pilihannya pada Pemilihan Umum Legislatif (Pileg) 9 April lalu. Pilihan rakyat Indonesia tersebut memiliki peran besar dalam pelaksanaan Pemilu tersebut. Berhasil tidaknya, sukses tidaknya Pemilu banyak ditentukan oleh pilihan rakyat tersebut—di samping faktor-faktor lain tentunya. Makna Pemilu itu sendiri di antaranya tercantum di dalam Undang-undang No.3 tahun 1999 tentang Pemilihan Umum dalam bagian menimbang butir b dan c. Butir b; Bahwa Pemilihan Umum merupakan sarana untuk mewujudkan kedaulatan rakyat dalam rangkakeikutsertaanrakyatdalampenyelenggaraan pemerintahan negara; Butir c, bahwa Pemilihan Umum bukan hanya bertujuan untuk memilih wakil-wakil rakyat yang akan duduk dalam lembaga permusyawaratan/ perwakilan, melainkan juga merupakan suatu sarana untuk mewujudkan penyusunan tata kehidupan negara yang dijiwai semangat Pancasila dan Undang-Undang Dasar 1945 dalam Negara Kesatuan Republik Indonesia. Sedangkan secara administratif sukses Pemilu ditentukan tiga hal. Pertama, sukses perencanaan dan penyusunan program dan anggaran serta penyusunan peraturan pelaksanaan. Kedua, sukses penyelenggaraan dengan bobot kualitas pengelolaan oleh penye-

+628126329716 Golput muncul krn ada yg TIDAK BERES terhadap yg dipilih,dari pada Kecewa kemudian lebih baik ambil jalan pintas,krn wakil rakyat yg dipilih umumnya jadi koruptor dan tdk pernah memikirkan nasib rakyat +628126329716 Kepada Caleg Aceh utara yg berhasil terpilih utk DPRK,DPRA dan DPR Pst harus tahu bahwa yg mendudukkan Anda2 di tempat tsb adalah RAKYAT dan bukanWARISAN dari orgtua,tunjukkan kinerja anda utk rakyat. +6281264646262 PLN, kamu dengar tidak intruksi pak gubernur SUMUT, PLN di 9 april jgan sampe mati lmpu, trnyta mati lampu juga pada malam hari . +6285297487646 SEDIH TERAMAT SEDIH,BATUBARA TELAH DIBELI ORG BERDUIT.YA ALLAH, jauhkan kami dari musibah,amin. +6282362125095 Kepada para caleg terpilih agar segera menghapus istilah tenaga kerja kontrak/ honor menjadi tenaga kerja tetap/PNS dan menghabisi para pejabat kantor yg menyalahgunakan jabatan +6281265078051 Gawat pengadilan Tipikor Pengadilan Negeri Medan membebaskan kasus korupsi PLN yang dilakukan tersangka an Hermawan.setelah menyerahkan uang sebesar Rp 23,9 milyar.sungguh sangat menyedihkan wajah pengadilan Tipikor di Indonesia khusus nya di kota Medan bagaimana akan habis kasus korupsi bisa habis di negara kita kalau kasus korupsi bisa dibayar +6285207065513 Sejak kelahirannya hingga berkompetisi slama era Pemiu yg mayoritas pendduduk muslim di Neg ini Partai yg brzskan Islam semisal Partai PPP berlambang KA’BAH atau KIBLAT nya umat Islam se DUNIA ini blm pernah sjrhnya dimenangkan olh umat islam itu sendiri. Perlu rs’y di evaluasi ulang ttg LAMBANG PPP ini , jgn2 ini sebuah peringatan atau Isyarat dari Allah Subhana wata’ala bhw lanbang KA’BAH itu bkn utk ajang Politik bagi Politikus2 MUNAFIK . Disrnkan agr pd pemilu 2019 nnti PPP ganti lambang dr KA’BAH menjadi KALIGRAFI 2 KALIMAT SYAHADAT yg diapit oleh dua silang pedang sebagai simbol Idiologi. +6285207065513 Sepanjang sejarah pemilu sejak zaman otoriter mendiang Soeharto dgn Orbanya sampai era reformasi partai2 islam semisal PPP , PKS dan PBB selalu KONYOL n jadi bulan2an partai Nasionalis/partai terbuka n partai2 Liberal yg tumbuh subur di negeri yg Penuh tipu daya syaithon ini. Petinggi2 Islam , akademisi islam serta intelectual islam n para Ulama2 dr berbagai berbagai disiplin ilmu selalu mengumandangkan agr umat islam tdk GOLPUT tp tdk punya kebanggaan punya partai islam. Itulah karakter islam indonesia yg berlambang burung GARUDA hasil khayalan ahli lukis.

Pemilih Cerdas Hal yang paling urgen dalam pelaksanaan Pemilu, khususnya dalam menentukan pilihanadalahdiperlukannyakecerdasanpemilih. Kecerdasan tersebut juga nantinya yang akan menentukan seberapa berkualitas para wakil rakyat yang akan duduk di parlemen. Pemilu yang menghasilkan wakil rakyat yang berkualitas yang bekerja untuk kemaslahatan bangsa dannegaranyaadalahmuaradarikeberhasilan

demokrasi klasik yang menyebutkan bahwa Pemilu adalah sebuah transmission of belt— yang dengannya kekuasaan yang berasal dari rakyat kemudian bergeser menjadi kekuasaan negara—pada titik selanjutnya berubah bentukmenjadiwewenangpemerintahuntuk melaksanakanpemerintahandanmemimpin rakyat. Jadi seperti kata para ahli bahwa Pemilu merupakansebuahcarauntukmemilihwakilwakil rakyat. Ini berarti yang memilih adalah rakyat dan yang dipilih adalah para wakilnya untuk menyuarakan aspirasi rakyat itu sendiri. Pernyataan ini secara jelas menunjukkan bahwa peran kecerdasan pemilih sangat berartibahkanmenentukankualitaswakilrakyat bahkan kualitas perjalanan secara bangsa. Oleh karenanya apabila di periode pemerintahan yang lalu—masa Gus Dur misalnya, menyebutkan anggota dewan sebagai anak TamanKanak-kanak(TK).Ataudimasaperiode pemerintahan belakangan ini di mana banyak tindak pidana dilakukan para anggota dewan hasil Pemilu, maka hal ini tidak bisa lepasdarikecerdasaranrakyatdalammemilih. Karena mereka yang duduk di parlemen itu adalahmerekayangdipiliholehrakyatpemilih. Artinya tanggung jawab masyarakat pemilih tidak bisa dihilangkan begitu saja karena menghantarkan mereka ke kursi parlemen. Oleh karenanya begitu strategisnya kepedulianpemilih,danbegitupentingnyamenjadi cerdas sebagai pemilih. Semoga kita adalah orang-orang yang memilih dengan cerdas pada Pemilu kemarin.

Penutup Dalam tataran ilmu politik, dikenal teori

Penulis adalah Mantan Wakil Wali Kota Medan.

Dua Rezim Pelaksana Pemilu

+6281397071980 Untuk jajaran direksi PTPN III yg Terhormat, tolong naikan gaji karyawan, masa nunggu selama 2 tahun dapatnya hanya 200rb, itupun untuk rapel 3 bulan. Soalnya kami capek pak, kerja terus, tp itungannya ga jelas. +6282167170674 Bangsa dan rakyat Indonesia masih sangat segar ingatannya ada dua pulau terjual perusahaan BUMN kapal tangker pun terjual hanya untuk mengatasi masalah negara di bidang keuangan.dua pulau tersebut adalah pulau sepadan dan ligitan PT INDOSAT dan KAPAL TANGKER hal yang demikian jangan ter ulang kembali dan kita sebagai bangsa dan negara Indonesia harus mewaspadainya.jangan lagi asset negara kembali terjual oleh bangsa Indonesia yang tidak baik tersebut.menjual asset bukan menghilangkan masalah tetapi menambah masalah baru hati hati memilih partai ya pada pemilihan presiden nanti.

lenggara Pemilu, dukungan pemerintah dan partisipasi masyarakat untuk memberikan hak pilihnya di TPS. Ketiga, sukses hasil sesuai standar kualitas dan kuantitas yang telah ditetapkanpadaperundang-undangan,terutama menyangkut manajemen Pemilu (pelaksanaan, penghitungan dan pengawasan pemilu yang benar dan efektif). Untuk sampai pada pemahaman Pemilu tersebut di atas sekaligus mencapai sukses Pemilu, secara umum ada langkah-langkah dalampelaksanaanmanajemenPemilu,yakni kerangka hukum Pemilu; kode etik dan hubungan kerja KPU dengan KPU daerah; persyaratan pencalonan anggota legislatif; proses pencalonan; berhubungan dengan stakeholder; manajemen kampanye; tata cara pemungutan suara; prosedur penghitungan suara; dan evaluasi.

Pemilu. Pemilihcerdasadalahpemilihyangsecara proaktif mencari tahu informasi mengenai para calon legislatif (Caleg), rekam jejak, integritas, kompetensi, kapasitas dan kapabilitas mereka. Jika seorang pemilih menggunakan hak pilihnya dengan perangkat pengetahuan yang baik tentang seorang Caleg, maka inilah sebaik-baik pilihan. Dan cara seperti inilah yang diharapkan akan memberikan perubahan ke arah yang lebih cerah dalam perpolitikkan dan pembangunan bangsa. Jadi perubahan dan kesejahteraan bangsa bukan tergantung semboyan para Caleg ataupun calon presiden, tetapi adalah pada kemampuan pemilih untuk mengenali para calon wakilnya dengan sebaik-baiknya. Ini tentuberkebalikandenganpemilihpasifdalam seperti mereka yang ikut-ikutan tanpa mempedulikan kemampuan dan kapasitas Caleg. Pemilih seperti ini tidak memiliki sensitivitas kita terhadap informasi yang diterimanya tentang seorang Caleg tertentu. Oleh karenanya sukses Pemilu juga ditentukan oleh tingkat kecerdasan pemilih dalam menentukan pilihannya. Karena itu, kualitas hasil Pemilu yang memunculkan anggota legislatif sebagai output-nya—tidak hanya ditentukan oleh partisipasi aktif kita sebagai pemilih dalam memberikan hak suara kita dengan mendatangi TPS—tetapi juga tergantung dari sejauhmana kejelian kita menentukan pilihan dan memberikan suara kepada Caleg yang benar-benar tepat untuk dijadikan wakil rakyat.

Oleh Fadmin Prihatin Malau Meskipun bangsa Indonesia telah mewujudkan demokrasi tetapi harus membayar mahal karena biaya Pemilu tinggi, rawan stabilitas, tidak efisien dan kurang efektif.

H

asil hitungan cepat (quick count) PDI Perjuangan menjadi jawara setelah meraih suara terbanyak dan Harian Waspada pada Hari Kamis, 10 April 2014 berita Headline-nya berjudul: Logo PDIP 19,65 persen, Logo Partai Golkar 14,56 persen, Logo Partai Gerindra 11,8 persen. Arti dari judul berita itu ada tiga partai politik (Parpol) menjadi pemenang peraihan suara pada Pemilihan Umum (Pemilu) pada 9 April 2014. Judul headline HarianWaspada itu sangat menariksebabdalamhitungancepatituPartai Demokrat (9,6 persen), Partai Kebangkitan Bangsa (9,3 persen), PAN (7,3 persen), PKS (6,9 persen), Partai NasDem (6,8 persen), PPP (6,7 persen), Hanura (5,4 persen), Partai BulanBintang(1,6persen)danPKPI(1persen). Hasil itu mengindikatorkan peta kekuatan Parpol berubah dalam hitungan puluhan jamsajaatautidaksampaisatuharisatumalam atau 24 jam. Perlu dicatat bahwa hitung cepat bukan data resmi tetapi diprediksikan data resmi berdasarkan hitungan manual tidak akan mengalami perubahan yang banyak. Dikatakanberubahdalamhitunganpuluhan jam, sebab Partai Demokrat pada Pemilu 2009 meraih 20,8 persen suara sehingga berkuasa.Tetapi kini hanya meraih 9,6 persen suara. Artinya kekuasaan itu berubah begitu cepat. Hal yang sama juga dialami PKS yang raihansuaranyamenjadi6,9persendibanding Pemilu 2009 sekitar 7,8 persen. Sementara itu Partai Nasional Demokrat (NasDem) sebagai partai pendatang baru mampu meraih 6,8 persen suara. Sedangkan Partai Gerindra meraih 11,8 persen dibanding Pemilu 2009 hanya 4,4 persen suara. Artinya, kekuasaan yang dikuasai selama lima tahun bisa berubah. Hal ini satu pertanda sistem rezim di Indonesia telah berubah, tidak seperti ketikarezimeraOrdeBaruyangpetakekuatan politik tidak dapat berubah dengan hitungan jam. Harus ada proses panjang yang dilalui karena memang sistem yang digunakan tidak memungkinkanmengubahkekuasaandalam hitungan puluhan jam. Sistem politik era Orde Baru, kekuasaan

penuh tidak berada di tangan rakyat atau sistem politik era Orde Baru kurang (tidak) demokratis karena rakyat (masyarakat) tidak berdaya untuk mengubah peta kekuatan politik dengan suaranya. Pada era Orde Baru, masyarakat (rakyat) memang diberi kebebasan untuk memilih partai akan tetapi tersandung dengan sistem yang dibangun yakni demokrasiterpimpin.Bebastetapitidakbebas secaratotal,sifatotoritermasihdikedepankan. Beda UU Dan Pelaksanaan Pada era Orde Baru, Pemilu berdasarkan Undang Undang (UU) No.15Tahun 1969 dan pada era Reformasi berdasarkan UU No.3 tahun 1999. Bila dicermati kedua UU ini pada dasarnya sama yakni sama-sama melaksanakan Pemilu yang bersifat langsung, umum, bebas, rahasia, serta jujur dan adil (LUBER JURDIL). Namun, dalam pelaksanaannya berbeda sehingga menjadi serupa tapi tidak sama. SerupatapitidaksamaterlihatpadaPemilu era Orde Baru peserta Pemilu diusahakan hanya tiga partai (PDI, PPP,Golkar) dan kekuatan politik ada di tangan penguasa atau partai berkuasadenganmembangunkekuatanaparat dan represi politik serta negara memonopolilegitimasipelaksanaanPemilu.Sedangkan pada era Reformasi penyelenggaranya pemerintah lewat Komisi Pemilihan Umum (KPU) yang lebih bebas dan mandiri. Partai peserta Pemilu selalu berubah-ubah jumlahnya, Pemilu 1999 diikuti 48 Parpol, 2004 diikuti 24 Parpol, 2009 diikuti 38 Parpol, 2014 diikuti 12 Parpol ditambah 3 Parpol lokal. Membandingkan sistem politik adalah membandingkan sistem politik antara dua negara atau antara dua rezim atau dua era kepemimpinan secara keilmuan cukup banyak teorinya, seperti teori David Easton, Gabriel Almond, Herbert Spiro dan lainnya. Teori system perbandingan politik itu bisa dilihat dalam realitas politik masyarakat (rakyat) Indonesia. Teorisistempolitikyangmembandingkan dua rezim (kekuasaan) bisa diaplikasikan dengan kekuasaan era Orde Baru dan era

Reformasi. Perbandingan aplikasi realitas antara rezim era Orde Baru dengan rezim era reformasi secara teori Herbert Spiro membandingkan kedua sistem dengan melihat minimalempathalyaknistabilitas,fleksibilitas, efisiensi, dan efektivitasnya. Teori Herbert Spiro ini lebih cenderung teraplikasi pada pemilu era Orde Baru yakni Pemilu yang lebih stabil dibandingkan era Reformasiyangacapkalimenimbulkankonflik antarapihakyangkalahdenganyangmenang. Pemilu era Orde Baru lebih efisiensi dari biaya dan sistem pelaksanaannya. Namun, Pemilu era Reformasi sekarang ini kekuatan ada di tangan pemilih (rakyat) yakni rakyat dapat menentukan pilihannnya dan pilihan rakyat itu mampu mengubah peta politik secara cepat. Teoritentangkekuasaanyangbisadiambil atau diganti oleh rakyat atau masyarakat ini tidak ada dalam teori Herbert Spiro.Variabel stabilitas, fleksibilitas, efisiensi, dan efektivitas yang ada dalam teori Herbert Spiro belum (tidak) bisa rakyat (masyarakat) dengan mudah menjatuhkan rezim (kepemimpinan) yang sedang berkuasa. Demokrasi yang sesungguhnya tidak masuk dalam teori sistem politik Herbert Spiro. Hari ini, Pemilu pada 9 April 2014 lalu, kekuatan rakyat dapat mengubah peta politik secara cepat. Hasil hitungan cepat Pemilu April 2014 menjadi jawaban yang pasti akan teori sistem kekuasaan pelaksanaan pemilu yang tidak (kurang) demokrasi. Bangsa atau rakyat Indonesia telah berhasil membangun system politik yang demokratis sehingga kekuasaan pada dasarnya ada pada rakyat yang memilih pemimpin bangsa. Hal yang menjadi catatan penting meskipun bangsa Indonesia telah mampu mewujudkan demokrasi di Indonesia tetapi harus membayar mahal karena biaya Pemilu yang mahal, rawan stabilitas, tidak efisien dan kurang efektif. Namun, kekuasaan yang dimiliki penguasa tidak melekat dalam dirinya, kekuasaan itu ada di tangan rakyat sebagai pemilih. Dua rezim (kekuasaan) era Orde Baru yang rakyat tidak memilikinya tetapi kekuasaan era Reformasi ada di tangan rakyat.Ya, rakyat berkuasa pada era reformasi akan tetapi rakyat masih juga sulit untuk mendapatkan nasi atau penghidupan. Mana yang dipilih era Orde Baru dengan sistem politik demokrasi terpimpin atau era Reformasi dengan sistem politik demokrasi di tangan rakyat. Dua rezim pelaksanaan

Pemilu ini menjadi realita memiliki fakta nyata yang harus diuji, kaji lebih dalam untuk mencari mana yang paling baik dan menguntungkan bagi rakyat. Generasi yang pernah ikut dalam Pemilu Orde Baru yang penulis tanya selalu memberi nilai Pemilu pada masa Orde Baru jauh lebih baik. Benar penilaian itu jika dari segi sistem pelaksanaannya, tetapi jika dari menentukan pilihan, Pemilu era Reformasi jauh lebih baik. Buktinya rakyat dengan mudah mengubah petakekuatanpolitikdalamhitunganpuluhan jam saja. Hal inilah yang menjadi berita utama Harian Waspada Medan. Penulis adalah Dosen Fakultas Pertanian Universitas Muhammadiyah Sumatera Utara (UMSU) Medan.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau email: opiniwaspada@yahoo.com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata dan kartu pengenal (KTP) penulis. Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di media manapun. Isi tulisan menjadi tanggung jawab penulis.

SUDUT BATUAH * Gubsu ingatkan KDh jamin kesehatan warga - Biar tak berobat ke luar negeri * Golkar Sumut klaim peroleh 18 kursi - Berkat berita di Waspada, he...he...he * Wajah baru duduki DPRD Medan - Wajah baru, stok lama!

o k D Wa

el


Opini

WASPADA Rabu 16 April 2014

B7

Tentang BPJS Kesehatan Delapan tahun terahir perogram kesehatan di Indonesia sangat berpihak kepada masyarakat kecil. Tingkat harapan hidup sehat semakin tinggi. Karena pemerintah menggulirkan berbagai program berobat gratis. Ada Jamkesmas, Askeskin, Jamsostek, Medan Sehat dll. Pokoknya jika sakit, Anda akan berobat gratis di rumah sakit pemerintah atau swasta yang dihunjuk. Secara psikologis harapan hidup semakin tinggi, penyakit takut, tubuh makin sehat. Namun malang, sepertinya hidup sehat ini sebentar lagi tinggal kenangan. Harapan hidup sehat mulai terusik dengan program Jaminan Kesehatan Nasional (JKN) yang mulai digulirkan per 1 Januari 2014. Namanya BPJS Kesehatan atau Badan Penyelenggara Jaminan Sosial Kesehatan. Dengan lambang payung di atasnya, kata pemerintah, program sehat model baru ini bagus, seperti logonya, dapat melindungi masyarakat. Hari berganti, minggu pun berlalu. Sudah tiga bulan BPJS ini berjalan mulai terdengar keluhan masyarakat. Kalau dulu berobat gratis, tapi sekarang bayar. Kalau dulu, jika sakit berat, langsung saja bawa berobat ke RS Pemerintah, kemudian jemput surat keterangan miskin dari kantor lurah. Tetapi sekarang bayar dulu baru berobat. ”Maaf pak, bayar dulu tunggakan iuran 3 bulan, setelah itu baru Bapak bisa berobat kemari,” tutur perawat di salah satu RS. Teman saya bilang, sepertinya BPJS Kesehatan ini ‘beda tipis’ dengan asuransi kesehatan. Karena untuk mendapat perawatan kita harus bayar premi lebih dahulu. Bahkan lebih baik lagi Asuransi Kesehatan karena selain mendapat perobatan gratis, uang premi Anda tidak hilang, bahkan mendapat beberapa bonus tambahan. Tetapi kalau BPJS Kesehatan, hanya fasilitas perawatan yang gratis, tapi obat beli sendiri, dan uang preminya hilang. Sepertinya program yang kemarin sangat menolong rakyat. Tingkat hidup sehat mulai meningkat. Mungkin program sehat kemarin ada kebocoran di sana sini, ada penyalahgunaan pasien ‘kaya ngaku miskin’, atau manipulasi data oleh RS Swasta yang jahat. Namun masih bisa diperbaiki, cukup buatkan saja badan pengawas yang independen, untuk menghindari kebocoran. Bukan dengan menukarnya atau menghapuskannya. Saya kira pemerintah dapat meninjau kembali UUD No.40 Tahun 2011, sebagai payung hukum BPJS Kesehatan ini. Katanya pemerintah mau memberdayakan ekonomi rakyat, kok malah mengutip uang rakyat. Kalau beginilah wajah BPJS Kesehatan tersebut maka plesetan dari kepanjangan BPJS ini bukan Badan Penyelengara Jaminan Sosial, tetapi Badan Penyelenggara Jadi Sakit (BPJS). Nada Sukri Pane Hamparanperak

Untuk Para Guru Guru adalah para pahlawan panutan yang digugu dan ditiru. Seorang manusia jadi banyak tahu hal-hal bermanfaat dan segala ilmu pengetahuan karena peran guru. Oleh karenanya guru sangat mulia. Tidak cuma itu. Guru juga adalah sosok orang yang memberikan teladan kepada anak didiknya. Segala nilai moral, etika, dan sopan santun dicontohkan para guru untuk mendidik anak-anak didiknya. Jadi kalau ada orang yang baik perangainya, sopan santunya, dan tinggi ahklaknya, itu pasti karena ada peran guru di sana. Oleh karenanya di masa Ujian Nasional (UN) ini, kami berharap guru tetaplah menjadi guru yang digugu dan ditiru. Wahai bapak ibu guru, janganlah engkau tinggalkan keteladanan ini demi persoalan yang tak semestinya. Wahai para guru, janganlah engkau berikan kunci jawaban kepada anak didikmu karena itu hanya akan mengotori keuliaanmu. Janganlah engkau contohkan kecurangan kepada anak didikmu karena itu akan peranmu sebagai pendidik. Yang terjadi biarkanlah terjadi. Tetaplah pada jati dirimu. Tuhan pasti tidak akan luput mencatat budi baikmu, istiqomahmu. Nama dan alamat ada pada redaksi.

Antara Korea Dan Indonesia Perkembangan drama Korea di Indonesia semakin pesat, hal ini terbukti dari semakin banyaknya tayangan drama Korea di siaran televisi swasta Indonesia. Bukan hanya drama Korea, tetapi juga banyaknya masyarakat Indonesia meniru-niru para artis Korea yang muncul di televisi. Baik dari penampilan maupun tingkah lakunya. Misalnya saja di salah satu majalah remaja, seorang remaja putri ingin berpenampilan seperti Bae Suzy. Penampilan diusahakan semaksimal mungkin agar persis dengan cewek Korea tadi. Selain itu, sudah banyak juga buku-buku yang beredar tentang belajar bahasa Korea, dengan berbagai judul menarik. Sehingga masyarakat, khususnya remaja, sangat tertarik mempelajari bahasa Korea, agar mampu berbicara bahasa yang digunakan para artis yang digemarinya, walaupun hancur-hancurnya lumayan. Masih kenal dengan Primus Yustisio? Masih ada menjumpai film atau drama yang dibintangi si Primus ini? Pastinya masih ya. Kita masih bisa bisa melihat akting Primus ini di salah satu siaran swasta. Primus ini adalah lelaki kelahiran tahun 1975. Di sinetron yang sekarang, dia sudah berperan sebagai seorang bapak yang memiliki putri yang sudah menikah, berarti bakal punya cucu, itu artinya sudah menjadi seorang kakek-kan? Coba bandingkan dengan seorang aktor yang bernama Jang Dong Gun, pemeran Kim Do Jun di film Gentlemen’s Dignity. Lelaki ini terlahir di tahun 1972. Berarti lebih tua dari Primus. Tetapi dalam filnya, Dong Gun ini masih memiliki peran sebagai lelaki lajang atau single. Selain di antara keduanya, ada juga bintang film Indonesia yang namanya Nikita Willy, cewek kelahiran 1994, tetapi di usia yang baru menginjak kepala dua itu, Nikita sudah pernah memerankan cewek dewasa, punya pacar dan menikah. Coba bayangkan, cewek yang belum berusia 20 tahun harus berperan sebagai istri. Bagaimana dia mampu menjiwai perannya? Kemudian seorang aktris Korea yang bernama Shin Min Ah, aktris yang lahir 1984 memerankan Arang pada drama Korea Arang and The Magistrate. Usia terpaut 10 tahun dengan Nikita Willy, tapi dia masih memerankan peran wanita utama yang belum menikah alias single. Coba Anda bandingkan peran masing-masing pemain. Saya lebih suka menyaksikan drama Korea dibandingkan dengan drama Indonesia. Bukan berarti saya tidak memberikan apresiasi lebih terhadap drama Indonesia. Tetapi hal tersebut memang tidak dapat saya pungkiri. Aktris Korea lebih dapat membawakan perannya tersebut. Mengapa tidak? Dalam kehidupan nyata, dia memang sudah mengalaminya. Misalnya Jang Dong Gun tadi, dia pasti sangat menikmati perannya sebagai lelaki lajang, karena memang dia sudah mengalaminya. Jadi, Dong Gun ini sangat alami dalam menjalani perannya. Kemudian bagaimana dengan Nikita Willy yang masih berusia 19 tahun mencapai 20 tahun harus menjalani perannya sebagai istri, padahal dalam kehidupan sehari-hari dia masih remaja putri. Apakah dia benar-benar bisa menikmati perannya? Hal ini terlihat jelas bagaimana caranya membawa peran tersebut. Saya memang bukan ahli peran, tapi saya penikmat peran seorang pemain drama ataupun film. Mungkin sebagian besar penonton merasa oke saja ketika menonton drama tersebut, tapi saya tetap bisa merasakan ketidaknyamanan ataupun kurang menikmati perannya Nikita Willy. Jadi sebenarnya tidak salah jika aktor atau aktris yang digunakan sebagai pemeran utama pada sinetron Indonesia adalah mereka para aktor/aktris yang sudah senior walaupun sudah berusia mendekati 40 atau lebih, agar lebih dewasa. Fhitri Andriyani Siregar, SE Guru Ekonomi Pesantren Modern Unggulan Terpadu Darul Mursyid

Medan: Kota Tidak Nyaman Oleh Budi Agustono Jika saling curiga mengalami pembiaran, warga kehilangan kepercayaan terhadap penegak hukum—yang akan menurunkan kohesi sosial hingga menyebabkan warga apatis— yang mendorong egoisme dan individualisme.

S

ebagai ibukota provinsi, Medan merupakan kota terbesar, teramai dan terkenal. Kota yang didirikan pemerintah Belanda dan pemilik modal perkebunan kolonial ini pada mulanya bukan untuk menyejahterakan masyarakat pribumi, tetapi dirancang untuk keperluan mempercepat eksploitasi surplus ekonomi dari pedalaman ke negeri pusat kapitalisme kolonial,Belanda.SejakberdirinyakotaMedan penduduknya terus bertambah dari masa ke masa, terutama lagi sesudah kehadiran perkebunan, kota ini menjadi tempat peruntungan hidup berbagai warga negara dunia untuk meraup kemakmuran. Sebagai tempat mencari kemakmuran, tidak pelak membuat kota ini menjadi hidup, dinamis dan sumber penghidupan masyarakat dunia dan penduduk lokal. Keberadaan industri perkebunan ini mengubah Medan yang tadinya hanya sebuah kampung bermetamorfosis menjadi kota indah yang dikelilingi bangunan modern kolonial dan hutan belantara yang siap dibuka untuk lahan beroperasinya perkebunan dan pemukiman baru. Dengan suntikan modal besar kolonial inilah Medan menjadi kota modern. Sebagai kota modern, Medan terus berkembang dan berbenah dari waktu ke waktu. Layaknya kota modern di belahan dunia lain, Medan yang dulunya dikelilingi hutan belantara, kini diselimuti hutan beton menjulang tinggi, perkantoran, pemukiman, perbelanjaan modern, sarana hiburan dan rumah toko yang terus bermunculan di sekitar jantung kota. Seturut dengan laju perkembangan fisik kota, berbagai persoalan sosial yang melekat dalam pembangunan kota terus ber-

munculan. Bersamaan dengan makin masifnya bekerjanya modal besar di berbagai sektor industri bermunculan kerusakan lingkungan. Beberapa sungai yang sebelumnya menjadi sumber air bersih publik perlahan berisi muatan racun alias limbah industri yang membahayakan kesehatan. Sejalan dengan kerusakan lingkungan, karena terjadi perusakan hutan dan bertaburnya hutan beton yang mengabaikan keharmonisan lingkungan, setiap kali hujan datang kota Medan selalu banjir. Meskipun beragam program telah digulirkan untuk pencegahan banjir, tetapi program penanggulangan banjir itu tenggelam bersamaan hantaman banjir di sekitar kota. Selain banjir, di ruas jalan mulai dari jantung kota sampai ke pinggiran kota suasanakemacatanterusmenghantuipublikakibat semakin tingginya volume kendaraan. Setiap harinyakemacetanmenyergapdijalanutama kota.Kemacetanmembuatketidaknyamanan warga. Apatisme Ketidaknyamanan warga tidak hanya berhenti pada banjir dan kemacatan, tetapi suasana ketidaknyamanan ini semakin dirasakan menggurita jika melihat merajalelanya kekerasan jalanan yang mengintai warga di seluruh penjuru kota Medan. Belakangan ini warga dihantui ketakutan dengan para remaja yang bergabung dalam “geng kereta”. Kegiatan dan perangai geng kereta ini semakin nekad menubruk aturan hukum dannormamasyarakat.Gengkeretamemangsa siapa saja, merampas, menggarong, membikin onar, dan merampok yang dengan en-

teng sekali mencederai korbannya. Tidak hanya itu geng kereta menganggap dirinyasebagairajajalananyangkebalhukum. Saat geng kereta melintas mereka membawa senjata tajam dan kelewang untuk memangsa korbannnya, bahkan polisi lalu lintas yang merazia kendaraan geng kereta dianggap lawan. Kehadiran mereka bagaikan siluman, tidak tahu kapan datangnya, tetapi jika bereaksimendatangkankorban.Keberadaangeng kereta meresahkan dan mendisrupsi keamanankota.Meskiaparatpenegakhukummemburu, tetapi sampai sekarang belum ada tindakan tegas dari membasmi geng yang semakin brutal ini. Selain geng kereta, masalah lain yang membikin rasa tidak nyaman warga adalah Narkoba. Peredarannya semakin tak terkendali. Hampir setiap harinya terdapat warga yang tertangkap mengedarkan Narkoba. Narkoba telah menjangkiti siswa, generasi muda dan keluarga. Peredarannya semakin terbuka bahkan sering ditemukan sarang peredarannya di perumahan dan perkampungan. Ironisnya aparat penegak hukum terlibat peredaran Narkoba dan dikendalikan dari balik jeruji penjara. Aparat penegak hukum telah berupaya menggulungnya, tetapi bisnis haram ini masih terus merajalela hingga mengganggukenyamananwargakotaMedan karena telah menjerat generasi muda. Saatiniperampokan,penjambretan,pencurian, dan penodongan atau kekerasan jalanan ini kerap terjadi di penjuru kota. Tiada hari tanpa kekerasan jalanan. Aksi kekerasan semakin hari semakin meninggi, berlangsung kapan saja tanpa mengenal waktu dan tanpa mengenal sasaran mangsanya. Para pelaku nekad menjalankan aksinya di tengah keramaian kota. Sewaktu Medan menjadi tuan rumah pertemuan internasional yang dihadiri pejabat tinggi negara- negara asing, para tamu asingyangsedangmenikmatikeindahankota, tanpa dinyana mengalami perampokan. Perampokan ini sangat menurunkan citra kota sebagai kota yang tidak aman dan tidak nyaman. Aksi perampokan terhadap tamu asingitumendapatliputanmediainternasional sehingga menjadi kampanye gratis tentang

ketidaknyamanan kota Medan. Wajah kota Medan tercoreng dan komunitasinternasionalberfikirulangmengunjungi wilayah ini sebagai tujuan wisata. Kasus perampokan tamu asing menurunkan minat turis mancanegara berkunjung ke Medan. Namunditengahmeningkatnyaaksikriminalitas ini aparat penegak hukum seolah tidak dapat berbuat banyak mengatasi aksi kekerasan jalanan.Warga kota, karena silih bergantinya aksi kekerasan jalanan ini, tidak merasakan kehadiran aparat penegak hukum memberantas penyakit sosial yang meresahkan masyarakat ini. Menyaksikan keadaaan demikian ditambah lagi tanpa merasakan kehadiran aparat penegak hukum, membuat masyarakat kecewadanmarahatasperampokan,penjambretan,pencuriandankebringasangengkereta yang terus berlangsung. Kejengkelan dan amarah masyarakat ditunjukkan dengan mengeroyok dan memukul pelaku kekerasan jalanan ini sampai tewas. Sama seperti pelaku kekerasan jalanan yang menekuk hukum, amarah dan kejengkelan warga juga menubruk hukum. Meski melanggar hukum, tapi membabakbelurkanpelakukekerasanjalanan adalah cara masyarakat menjatuhkan hukuman terhadap pelaku. Kekerasanjalananyangterusberlangsung akanmembuatmasyarakatdilandaketakutan, kecemasan dan ketidaknyamanan. Jika suasana ini semakin tidak terkendali masyarakat akan mengalami suasana saling curiga dan tidak percaya satu sama lain. Jika saling curiga dan tidak percaya satu sama lain mengalami pembiaran,niscayawargasemakinkehilangan kepercayaan terhadap aparat penegak hukum. Masyarakat yang kehilangan kepercayaan terhadap aparat penegak hukum akan menurunkan kohesi sosial. Menurunnya kohesi sosial akan menyebabkan warga menjadi apatis. Apatisme masyarakat akan mendorong percepatan warga kota Medan bergerak menuju egoisme dan individualisme. Penulis adalah Sekretaris Program Studi Magister Ilmu Sejarah, Fakultas Ilmu Budaya, USU.

Masyarakat Ekonomi Asean (MEA) Oleh Mohd. Nawi Purba MEA diikuti 10 negara anggota Asean dengan total penduduk 600 juta jiwa dan sekitar 42 persen berada di Indonesia.Artinya, MEA akan menempatkan Indonesia sebagai pasar utama, baik untuk arus barang maupun arus investasi.

S

ukaatautidaksuka,Indonesiaharus segera mempersiapkan diri menyongsong pemberlakuan MasyarakatEkonomiAsean(MEA) pada awal 2015. Dengan segala potensi yang dimiliki dan usaha untuk selalu berbenah diri menuju kawasan yang lebih baik serta bermartabat, sehingga terbuka peluang untuk bekerjasamadanbersinergipositiftidakhanya dengan daerah lain atau investor secara nasional, tetapi juga secara regional (negaranegara Asean). Jika MEA 2015 benar-benar diberlakukan mulai 1 Januari 2015 masyarakat Indonesia tidak boleh menganggap enteng. Karena realisasi pencapaian nantinya dapat berupa barang, jasa, investasi, tenaga kerja terampil dan aliran modal akan lebih bebas keluar masuk di antara negara anggota Asean tanpa hambatan baik itu tarif maupun nontarif. MEA akan menjadikan Asean seperti sebuah negara besar. Penduduk di kawasan Asean akan mempunyai kebebasan masuk ke suatu negaradankeluardarisuatunegaradikawasan Asean tanpa hambatan berarti. Penduduk mempunyai kebebasan dan kemudahan memilih lokasi pekerjaan yang dianggap memberikan kepuasan bagi dirinya. Selain itu setiap anggota Asean tanpa

hambatan yang berarti dapat menjaring konsumen untuk produk-produknyadari negara-negara lain sesama anggota Asean. Hal itu tentunya akan menjadi peluang emas bagi setiap negara yang sudah memiliki persiapan yang matang. Tetapi di lain pihak bisa menjadi bumerang bagi negara-negara yang tidak atau kurang mempersiapkan diri menyambut MEA. Dapat kita bayangkan apabila produk dari negara-negara Asean lain menyerbu pasar Indonesia, maka produk lokal akan kalahbersaingdenganprodukluarjikakualitas dan pelayanan yang baik tidak dilakukan dilakukan pasar Indonesia. Contoh seperti buah-buahan dari Thailand dengan harga lebih murah dan kualitas lebih baik mampu menembus pasar Indonesia. Kita harus siap dan waspada terhadap segala kemungkinan. Indonesia dengan jumlah penduduk 247 juta jiwa merupakan pangsa pasar paling besar di kawasan Asean. Oleh sebab itu upaya peningkatan kualitas Sumber Daya Manusia (SDM) dan penguatan sistem pemerintahan menjadi kunci untuk menghadapi persaingan global, termasuk di dalam menghadapi implementasi kesepakatan perdagangan bebas di lingkungan negara-negara Asia Tenggara (Asean economy community).

Sosialisasi MEA Pemerintah bersama seluruh pemangku kepentingan, seperti asosiasi pengusaha lebih men-sosialisasikan MEA 2015 dalam upaya peningkatan kegiatan ekonomi nasional. Sosialisasitersebutbertujuanuntukmemberikan informasi dan pemahaman kepada seluruh stakeholder yang berkaitan dengan MEA agar mampu bersaing secara sehat di berbagai bidang. Kawasan Asean sebagai pasar tunggal, dengan pembebasan bea tarif masuk antar negara maka terjalin kerjasama yang saling menguntungkan. Segera disosialisasikan bahwa pemberlakuan MEA 2015 bisa menjadi tantangan, peluang dan ancaman, bergantung kesiapan seluruh stake holder suatu negara. Sehingga Indonesia harus mampu memanfaatkan momentumtersebutdenganmeningkatkandaya saing, agar menjadi “pemain” bukan “penonton”. Menurut situs Bank Indonesia pelaksanaan MEA ini diikuti 10 negara anggota Asean yang memiliki total penduduk 600 juta jiwa dansekitar42persenjumlahpendudukAseean itu berada di Indonesia. Artinya, pelaksanaan MEA sebenarnya akan menempatkan Indonesia sebagai pasar utama yang besar, baik untuk arus barang maupun arus investasi. Pembangunan Infrastruktur Salah satu kendala yang cukup dirasakan saat ini adalah pembangunan infrastruktur. Dukungan untuk menjadikan Indonesia mampu bersaing dalam MEA 2015 serta rangkaian program dan kegiatan pembangunan yang dijalankan selama ini menjadi kurang bermakna apabila pemerintah tidak memahami yang menjadi kendala pembangunan nasional. Pemerintahbelumberhasildalampembangunan infrastuktur seperti pembangunan

transportasi massal yang terintegrasi dan infrastruktur transportasi umumnya untuk keseluruhan wilayah Indonesia. Kegagalan pembangunan infrastuktur berdampak pada high cost economy dan lemahnya daya saing produk Indonesia di luar negeri. Denganmelemahnyadayasaingpadasaat diberlakukannya MEA 2015, maka Indo-nesia hanya menjadi surga bagi produk asing tetapi tidak mampu bersaing dengan negara Asean laindalammeraihinvestasiasinglangsung,karena lemahnyadayasaingdaerahakibatterkendalanya pembangunan infrastruktur. Dari data APBN 2014 dapat kita lihat, untuk pembangunan infrastruktur keberpihakanpemerintahbelumkelihatanjelas.Salah satuindikasinyaadalahmenurunnyaanggaran infrastruktur sebesar Rp8,8 triliun. Dimana anggaran untuk pembangunan infrastruktur APBN Perubahan 2013 adalah Rp192,6 triliun, sedangkan pada APBN 2014 menjadi Rp184,2 triliun. Ini berarti anggaran belanja modal (infrastruktur)turunRp8,4triliun.Asumsivariabel inflasi 2014 sebesar 5,5 persen maka nilai riil anggaran belanja modal anjlok Rp8,8 triliun. Pemerintah yang akan datang perlu melihat kendala-kendala tersebut sebagai tantangandanmembantumempersiapkanmasyarakat Indonesia dalam menyongsong MEA 2015. Dengan timbulnya pemahaman masyarakat tentang pentingnya mempersiapkan diri menyambut MEA 2015 maka daya saing produknasionalsemakinmeningkatsehingga pertumbuhan ekonomi dapat semakin baik dan merata. Semoga.

Penulis adalah Mahasiswa Magister Manajemen USU Medan.


Agenda

B8 06:00 GO SPOT 07:30 Dahsyat 10:30 INTENS 11:00 SILET 12:00 SEPUTAR INDONESIA SIANG 12:30 BUKA - BUKAAN 14:00 Indonesian Idol 16:00 CEK AND RICEK 16:30 SEPUTAR INDONESIA 17:00 CINTA ANAK CUCU ADAM 19:15 ANAK - ANAK MANUSIA 21:00 TUKANG BUBUR NAIK HAJI THE SERIES 22:30 Box Office Movie

CATATAN

06:30 SL Inbox 08:45 Halo Selebriti 10:00 SCTV FTV Pagi 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:30 Liputan 6 Petang 17:00 Get Married The Series 2 18:15 Diam-Diam Suka 19:45 Tiba-Tiba Cinta 21:00 Emak Ijah Pengen Ke Mekah 22:30 I Like This

07:00 Animasi Spesial 07:30 Animasi Spesial 08:30 Mister Maker Comes To Town 1 09:00 Pose 09:30 Layar Unggulan 11:00 Diantara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 14:00 Tuntas 14:30 Lintas Petang 15:00 Animasi Spesial 16:30 Animasi Spesial3 17:30 Tendangan Si Madun Returns 18:30 Mnctv Sport Platinum-1 21:00 Raden Kian Santang 22:00 Suka-suka Uya 23:30 Cerita Pilihan 00:30 Midnite Great Sale 01:00 Lintas Malam

08:25 Curious George 08:55 Gon 09:25 Little Krisna 11:25 Topik Siang 11:55 Seputar Obrolan Selebriti 12:55 Mr. Bean 13:25 Tom & Jerry 13:55 Bima Sakti 14:25 Little Krishna 14:55 Bernard Bear 15:25 Curious George 15:55 Gon 16:25 Marsha & The Bear 16:55 Pesbukers 19:25 Campur-Campur 20:25 Pesbukers Best Of The Best 21:55 Sinema Spesial 23:55 Cakrawala

07:30 Semarak Sinema Spesial 08:30 Sinema Pagi 10:30 Live Kiss Pagi 11:30 Live Patroli 12:00 Sinema Pintu Taubat Siang 14:00 Hot Kiss 15:00 Live Fokus 15:30 Trending Topic 16:30 Berani Nekat 17:00 New Famili 100 18:00 Audisi D’Academy 20:00 Sinetron Unggulan : Bara Bere 21:00 Sinetron Unggulan 22:00 Sinema Unggulan

08:05 8 Eleven Show 12:00 Metro Siang 13:00 Wideshot 17:00 Metro Hari Ini 18:00 Prime Time News 19:30 Lebih Dekat 20:05 Mata Najwa 21:30 Otoblitz 22:00 Top 9 News 2 2 : 3 0 St a n d Up Comedy Show 23:05 Realitas 23:30 Metro Sport

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Pierce Brosnan Tidak Puas Sebagai James Bond Pierce Brosnan mengaku dia tidak cukup bagus saat berperan sebagai agen rahasia James Bond. Brosnan memainkan karakter James Bond di film GoldenEye, Tomorrow Never Dies, The World is Not Enough dan Die Another Day sebelum digantikan Daniel Craig pada 2005. Pada The Telegraph seperti dikutip Digital Spy, dia mengatakan, “Saya merasa terjebak di tengah pusaran waktu antara Roger dan Sean. “Kekerasannya

tidak pernah terlihat nyata, kebrutalan orang-orangnya tidak teraba. Rasanya karakterisasi terlalu lembut dan tidak nyata, hanya permukaan saja. Tapi bisa jadi itu berhubungan dengan rasa kurang percaya diri saya saat memerankannya.” Saat ditanya apakah dia pernah menonton ulang film-film Bond diperankannya, Brosnan menjawab, “Saya tidak pernah ingin menonton diri sendiri sebagai James Bond. Karena akting saya tidak cukup bagus. Rasa-

07:30 Saatnya Kita Joged 09:30 Sinema Indonesia Pagi 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 14:45 Insert Investigasi 15:15 Show Imah 16:45 Reportase Sore 17:30 Oh Ternyata 18:30 Slide Show 19:30 YKS 22:30 Bioskop TransTV 01:00 Reportase Malam

07:00 Live News Apa Kabar Indonesia Pagi 09:30 Live News Kabar Pasar Pagi 10:00 Coffee Break 11:30 Live News Kabar Siang 13:30 Ruang Kita 14:30 Live News Kabar Pasar 15:30 Live News Kabar PEMILU 16:30 Sorotan Kasus 17:00 Live News Kabar Petang 19:00 Meja Bundar 20:00 Live News Apa Kabar Indonesia Malam 21:00 Live News Kabar Malam 22:00 Menyingkap Tabir 22:30 Kabar Arena

08:00 Kungfu Panda 08:30 Chuggington 09:00 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Siang Seru Sama Sule 14:00 Seleb On Cam 14:30 Spot On 15:00 Fokus Selebriti 15:30 Lawan Tawa 16:30 Ada Ada Aja 17:30 Spongebob Squarepants 19:00 Big Movies 21:00 Big Movies 23:00 Big Movies

07:30 Selebrita Pagi 08:15 Spotlite 09:15 Syafa’at 10:00 Ceplas Ceplos LIVE 11:30 Redaksi Siang 12:00 Selebrita Siang 12:45 Laptop Si Unyil 13:15 Bocah Petualang 13:45 Dunia Binatang 14:15 Tau Gak Sih 14:45 Mancing Mania 15:15 Jejak Petualang 15:45 Orang Pinggiran 16:15 Redaksi Sore 17:00 Opera Van Java 18:30 Hitam Putih 19:30 On The Spot 20:30 CCTV 21:15 ILK (Indonesia Lawak Klub) 22:15 Bukan Empat Mata 23:30 Dua Dunia 01.00 Redaksi Malam **m31/G

Selamatkan New York Dari Kehancuran

nya tidak menyenangkan.” Meskipun begitu, Brosnan tetap mensyukuri masa-masa saat dia menjadi James Bond karena telah membuka beragam pintu kesempatan. “Itu adalah anugerah membuat saya bisa membuat perusahaan produksi dan film sendiri.” Brosnan akan tampil dalam film The Love Punch juga dibintangi Emma Thompson. Film tersebut dirilis di Inggris 18 April mendatang. (ant)

capesonfilm.com

Film The Amazing SpiderMan 2 digarap sutradara Marc Webb, penulis skenarionya Alex Kurtzman, Roberto Orci dan Jeff Pinker dibintangi Andrew Garfield , Emma Stone, Dane DeHaan, Jamie Foxx, Paul Giamatti, Sally Fiel dan Chris Cooper. Seperti dilansir digitalspy, Andrew Garfield berperan sebagai manusia laba-laba dalam The Amazing Spider-Man 2 secara fisik dan emosional menghadapi bandit super Electro dimainkan Jamie Foxx , Green Goblin diperankan Dane DeHaan dan Rhino dilakoni Paul Giamatti. Film arahan Marc Webb ini kembali mempertemukan Peter Parker dan kekasihnya Gwen Stacy digawangi aktris cantik Emma Stone. Aktivitas super penjahat Electro merupakan pembukaan yang menyegarkan film The Amazing Spider-Man 2. Bandit

DeHaan lain lagi, kejahatan sang playboy ini begitu komplek seperti leluhurnya James Franco. Pewaris perusahaan raksasa Oscorp itu dulunya merupakan sosok baik dan bersahabat dengan Peter. Namun ambisinya mengenai kekacauan genetik yang menjadi obsesi ayahnya menyebabkan ia menjadi orang jahat. Sementara karakter lain diperankan Paul Giamatti pelaku kriminal dengan aksen Rusia dan Felicity Jones sebagai pekerja perusahaan Oscorp. Sebelumnya, tiga video diluncurkan secara online untuk mempromosikan film superhero ini. Setiap video berdurasi 60 detik dipetik dari adegan The Amazing Spider-Man 2 dengan komentator Stan Lee menjadi pembantu kreator produksi ini. Video pertama terfokus pada penjahat Harry Osborn dan

akuisisinya pada riset percobaan industri raksasa Oscorp. Secara ringkas video itu menonjolkan Jamie Foxx sebagai sosok Max Dillon sebagai pekerja perusahaan yang bergerak dalam bidang penyelidikan ilmiah. Video lain menggambarkan karakter Garfield sebagai seorang pahlawan menjalani misi membasmi kejahatan dengan memburu konvoi membawa bahan kimia berbahaya plutonium pimpinan Rhino. Garfield berusaha menghalangi agar konvoi tidak sampai ke NewYork. Film ini terus berjalan dengan penggambaran aksi Peter Parker yang mampu menyelematkan kota NewYork dari kehancuran sebagai dampak zat kimia berbahaya. Film ini memaparkan bagaimana proses perubahan Jamie Foxx menjadi bandit Electro karena kecelakaan yang dialaminya. Nur

Trio Idol Dan Cicio Gencar Himpun Penggemar

Ubay Selamat Dari Eliminasi Indonesian Idol Para juri menyelamatkan M Yusuf Nur Ubay dari eliminasi pada pertunjukan spektakuler kedelapan Indonesian Idol 2014 berlangsung Jumat malam sampai Sabtu dini hari. Ubay hampir meninggalkan kompetisi karena gagal mendapatkan dukungan banyak penonton setelah menyanyikan lagu Satu-Satunya Cinta dari Mahadewi dan Take A Bow dari Rihanna pilihan Ahmad Dhani. Para juri menilai dia mampu membawakan kedua lagu itu dengan teknik menyanyi dan penjiwaan bagus tapi tidak banyak penonton yang mengirimkan dukungan sehingga dia berada di posisi dua terbawah dalam perolehan suara. Lagu Moves Like Jagger dia bawakan pada kesempatan terakhir juga tak membuahkan banyak dukungan dan menyelamatkannya dari eliminasi. Tapi juri memutuskan untuk mempertahankan dia di kompetisi. “Kami menggunakan hak veto untuk Ubay,” kata Dhani, salah satu juri dalam kompetisi menyanyi itu. Dengan demikian, penyanyi berusia 18 tahun dinilai punya musikalitas tinggi dan suara bagus itu bisa bergabung dengan lima kontestan lain mengikuti tahapan kompetisi selanjutnya. Bersama Husein Alatas, juga berada di posisi tidak aman, dia bisa melanjutkan kompetisi dengan Yuka Tamada, Nowela Elizabeth, Di Muhammad Devirzha, dan Giofanny Elliandrian untuk memperebutkan gelar Indonesian Idol 2014.

Ubay

Rabu 16 April 2014

The Amazing Spider-Man 2,

Pierce Brosnan

Tebaran pujian Para juri memuji penampilan semua kontestan saat membawakan lagu-lagu pilihan mereka. Anang Hermansyah, Titi DJ dan Tantri Kotak langsung berdiri dan bertepuk tangan setelah Virzha menyanyikan lagu Anang berjudul Aku Lelakimu. Tiga juri lain juga menyukai penampilannya. “Kamu tuh sudah paket komplit. Enggak ada kata-kata lagi, pokoknya keren,” kata Tantri. Setelah Virzha menyanyikan lagu Everybody’s Changing dari Keane, Anang pun berdiri sambil bertepuk tangan dan juri yang lain memuji kemampuannya memberikan karakter pada setiap lagu dia bawakan. Selain itu juri menyebutYuka sebagai penyanyi cerdas mampu tampil natural dengan gayanya sendiri saat menyanyikan lagu Mahadewa berjudul Immortal Love Song dan lagu All I Wanna Do dari Sheryl Crow pilihan Dhani. Usai Gio menyanyikan lagu Bintang-Bintang karyanya, Titi DJ langsung naik ke panggung dan memeluknya. Dia mengaku puas melihat Gio menyanyikan lagunya dengan gaya baru lebih berenergi. Para juri juga menyebut penampilannya asik saat membawakan No Doubt berjudul Don’t Speak pilihan Titi. Pujian juga diberikan para juri kepada Husein. Ia dinilai sukses membawakan lagu Pelan-Pelan Saja dari band Kotak dan Unintended dari Muse pilihan Tantri. Sementara Nowela Elizabeth mendapat banyak pujian juri saat menyanyikan lagu Sang Dewi dan The One That Got Away pilihan Titi DJ.(ant)

WASPADA

Cicio dan Trio Idol

POTENSI besar penonton horor remaja belum tergarap dengan baik dan maksimal melecut semangat trio jebolan ajang Indonesia Idol – Dera – Karin – Olla Rossa serta mantan penyanyi cilik Cicio Manasero belakangan sukses di dunia seni peran, bahu-membahu menghimpunnya. Memanfaatkan momentum pemutaran film Kesurupan Setan yang mereka bintangi mulai 17 April 2014 nanti, keempatnya mencoba lebih dekat sambil memanjakan para penggemar film horor remaja lewat acara nonton bereng. “Lewat gelar acara nonton bareng film Kesurupan Setan tahap pertama di bioskop Bekasi, Bogor, Jakarta dan Pondok Gede, kami berempat siap bahu-membahu dan gencar menghimpun penonton film horor remaja. Caranya, dengan memberi kesempatan pada mereka

bermanja-ria sambil foto bareng dengan para pemain pendukung film besutan sutradara Subakti IS ini,” papar Dera Idol Siagian kepada Waspada di markas Ganesa Perkasa Film Jl Caringin – Jakarta Barat, baru-baru ini. Menurut biduan peringkat tujuh Indonesian Idol 2012 ini, ia bersama tiga pemain film lainnya bersemangat menghimpun khalayak penggemar lantaran inilah kesempatan terbaik bagi kami untuk menjelaskan bahwa film Kesurupan Setan berbeda dengan film horor kebanyakan sudah tayang di bioskop. “Film horor kami bintangi benar-benar untuk remaja, semua umur dan keluarga, lantaran tanpa bumbu adegan vulgar apalagi seks. Magnet kuat film Kesurupan Setan justru lewat serangkaian adegan menega-

ngkan berbumbu musikal. Karena saya – Rossa dan Karin bakal melantunkan lagu theme song film bertajuk Sahabat bernuansa pop dan ngebeat,” jelas gadis tomboy berdarah Batak kelahiran Cianjur, 2 Desember 1993 juga bakal melantunkan satu lagu lainnya dalam adegan film itu. Sutradara Subakti IS menambahkan road show nonton bareng dan foto mesra bareng artis Kesurupan Setan di bioskop Jabodetabek tak tertutup kemungkinanberlanjutkeluarJawa.“Buat penonton yang ingin foto dengan artis pendukung, cukup nonton filmnya. Dan tiket bios-kopnya jangan dibuang untuk kemudian menjadi tiket foto ba-reng idola mereka,”jelassut-radarakawakan sukses menyut-radarai sinetron Pernikahan Di-ni,Yang Masih Di Bawah Umur, Tendangan Dari Langit, dan film Leak, menutup pembicaraan. * (AgusT)

Syahrini Beri Roh Baru Lagu Nike Ardilla K E N D AT I b e b e r a p a penyanyi kurang berhasil mempopulerkan kembali lagulagu milik almarhumah Nike Ardilla, namun Syahrini pan tang mundur. Wanita kelahiran Bogor, 1 Agustus 1982 ini, tetap ngotot merealisasikan obsesi lamanya mendaur ulang lagu Sandiwara Cinta dipopulerkan artis serbabisa dan meninggal dunia pada kecelakaan mobil di Jl Martadinata – Bandung, 19 Maret 1995 silam. “Mempopulerkan kem bali lagu-lagu hits milik penya nyi Indonesia era 1990-an termasuk dilantunkan Nike Ardilla, merupakan program rekaman single album saya kedepan. Kendati tak mudah, tapi dengan upaya keras dan persiapan matang saya optimis bisa melakukannya – minimal mengulang sukses mempopu lerkan lagu Aku Tak Biasa milik Alda Risma tiga tahun silam,” papar Syahrini kepadaWaspada selepas jumpa pers SCTV Music Awards (SMA) 2014 di Jakarta, baru-baru ini. Agar sukses mendaur ulang lagu Sandiwara Cinta menjadi andalan album Nike Ardilla rilisan tahun 1995 silam, dirinya pun telah minta restu dari Deddy Dores dan keluarga almarhumah. “Berbekal restu dari pen cipta lagu dan keluarga, proses rekaman single tersebut ber jalan lancar dan maksimal. Sehingga saya merasa bisa

Syahrini memberi roh dan warna baru pada lagu Sandiwara Cinta,” tandas Syahrini bakal memper dengarkan lagu daur ulang Sandiwara Cinta untuk pertama kalinya pada malam puncak SMA disiarkan langsung dari Hall D – Kemayoran, Jakarta 17 April 2014.

Seperti diketahui, beberapa penyanyi seperti Nafa Urbach dan terakhir Dike Ardilla men coba keberuntungan dengan mendaur ulang lagu-lagu Nike Ardilla, gagal mengukir sukses melebihi lagu aslinya. Akibat nya, pupularitas mereka tak bertahan lama dan tenggelam

dengan sendirinya. “Semoga dengan memberi roh dan warna baru lagu Sandiwara Cinta akan kembali hidup dan digemari sebanyak mungkin penikmat musik di tanah air,” harap Syahrini – no minator Penyanyi Solo Wanita Paling Ngetop SMA 2014 bersama Agnes Monica, Maudy Ayunda, Raisa dan Rossa. “Kalau memenangkan per saingan dengan empat no minator dan meraih piala SMA untuk kelima kalinya, saya akan menikah tahun ini,” ceplos pelantun lagu duet Jangan Memilih Aku bersama Anang Hermansyah ini. Nominasi SMA tahun ini terdiri 12 kategori, juga diwarnai persaingan ketat solois pria – Afgan, Budi Doremi, Cakra Khan, Judika dan Sammy Simorangkir. Lalu, katageri duo/group band Paling Ngetop yakni Geisha, Noah, Setia band, Ungu dan Wali. Kategori Penyanyi Dangdut Paling Ngetop antara Inul Daratista, Nasar, Saiful Jamil, Siti Badriah dan Zaskia Gotik. Malam puncak SMA 2014 disi arkan langsung SCTV Kamis malam (17/4), selain dime riahkan penyanyi dan band papan atas, juga menampilkan aksi illusionis Demian Aditya dengan pemandu acara An dhika Pratama, Gading Marten, Bianca Liza, Ivan Gunawan dkk. * (AgusT)

Skenario Sekuel Avatar Rampung Enam Pekan James Cameron mengungkapkan bahwa skenario untuk tiga sekuel Avatar akan rampung dalam enam pekan mendatang. Sang sutradara memberi informasi terkini tentang perkembangan filmnya, dia mengakui ada tekanan seiring nyaris rampungnya penulisan skenario. “Film kedua, ketiga dan keempat akan diproduksi secara simultan. Semuanya masih praproduksi sekarang karena kami sedang merancang makhluk-makhluk, setting, dan karakter akan ada untuk tiga film,” kata dia dalam sesi tanya jawab dengan Reddit seperti dikutip Digital Spy. “Dan kami akan menyelesaikan ketiga skrip dalam, saya bisa bilang, enam pekan lagi.. Selalu ada tekanan, entah itu film baru atau sekuel, untuk membuat sesuatu yang menghibur dan memukau penonton.” “Saya merasakan tekanan itu sepanjang perjalanan karir, jadi tidak ada yang baru. Tekanan terbesar saat ini adalah memotong adegan yang saya suka demi membuat durasi film ini masuk akal. Sekuel pertama dari Avatar 3D rencananya dirilis pada Natal 2016 dan film selanjutnya pada 2017 dan 2018. Sam Worthington dan Zoe Saldana akan kembali dalam tiga film mendatang mulai proses produksi pada 2015. (ant)


Aceh

WASPADA Rabu 16 April 2014

B9 Korupsi Dana Hibah Cakra Donya

Penyidik Kejati Periksa Sekda Lhokseumawe BANDA ACEH (Waspada): Tim penyidik Kejaksaan Tinggi Aceh, Selasa (15/4) memeriksa tiga tersangka dalam kasus dugaan korupsi bantuandanahibahdariBiroKesraPemerintahan Aceh tahun anggaran 2010 sebesar Rp1 miliar. Tersangka yang diperiksa di antaranya Ketua Badan Penasihat Yayasan Cakra Donya Lhokseumawe yang kini menjabat sebagai Sekda Kota Lhokseumawe inisial DY, 51, warga Aron Muara Dua Lhokseumawe, kemudian SekretarisYayasan Cakra Donya inisial AN, 48, warga Kuta Blang Lhokseumawe. Dan yang terakhir adalah Ketua Yayasan Cakra Donya dan juga sebagai Direktur PT Griya Cakra Donya RM, 27, yang merupakan putra dari Sekda Lhokseumawe. Kajati AcehTarmizi melalui Kasipenkum Amir Hamzah menjelaskan, pemeriksaan ketiga orang tersebut merupakan yang pertama kalinya sejak statusnya ditetapkan sebagai tersangka oleh Kejati Aceh. “Sekda Lhokseumawe, DY dan putranya RM, serta AN ketiganya diperiksa di ruangan terpisah di kantor Kejati Aceh sejak pagi hingga sore, tersangka turut didampingi kuasa hukumnya,” Waspada/Dede

KERTAS bertuliskan ayat Alquran dan Hadist (tulisan ayat suci Alquran dan Hadist sengaja dikaburkan) yang dijadikan pembungkus tempe yang ditemukan warga di pusat pasar Kota Langsa, Selasa (15/4)

Ayat Alquran Jadi Pembungkus Tempe LANGSA (Waspada): Warga Langsa dikejutkan dengan penemuan kertas bertuliskan ayat suci Alquran dan Hadist pada kertas pembungkus tempe dan dijual sembarangan di Pusat Pasar Kota Langsa, Selasa (15/4).

Kadis Syariat Islam Kota Langsa Ibrahim Latif menyatakan, setelah menerima laporan tersebut, pihaknya menerima laporan dari masyarakat dan menyerahkan beberapa bungkusan tempe yang dibungkus dengan kertas bertulisan ayat Alquran dan Hadist yang ditemukan dari penjual tempe di Pasar Langsa,

Surya Paloh Layak Jadi Cawapres IDI (Waspada): Ketua Dewan Pimpinan Pusat (DPP) Partai Nasional Demokrat (Nasdem) Zulfan Lindan menegaskan, Surya Paloh selaku Ketua Umum Partai Nasdem layak diusung sebagai Calon Wakil Presiden (Cawapres) pada Pemilu Presiden 2014 mendatang yang berpasangan dengan Joko Widodo dari PDIP. “Kita mendukung koalisi antara PDIP dengan Partai Nasdem, tapi apabila PDIP tidak menerima Surya Paloh sebagai cawapres, maka Nasdem akan menjadi partai politik oposisi,” kata Zulfan Lindan yang didampingi Ketua DPC Partai Nasdem Aceh Timur Nyak Musa Husein dalam temu pers, Selasa (15/4), Idi Rayeuk. Menurutnya, figur dan eksistensi Surya Paloh dapat bersinergi dengan program-program kerja Joko Widodo. Ketua DPC Partai Nasdem Aceh Timur Nyak Musa Husein mengatakan mendukung sepenuhnya keputusan DPP Partai NasdemyangmengusungJokowisebagaiCapres,Namun,pihaknya tetap mendesak cawapres adalah Surya Paloh. (cri)

Waspada/Yusri

KETUA DPP Partai Nasdem Zulfan Lindan saat memberikan keterangan pers terkait pengusungan Surya Paloh sebagai Cawapres pada Pilpres 2014 mendatang, Selasa (15/4)

Kemenag Aceh Gelar Penilaian Keluarga Sakinah SIMPANG ULIM (Waspada): KantorWilayah (Kanwil) Kementerian Agama Provinsi Aceh kembali menggelar penilaian terhadap keluarga sakinah, KUA teladan dan masjid teladan. Adapun penilaian keluarga sakinah yang dilakukan oleh tim dari Kanwil Kemenag Aceh Bustamam didampingi Kakanmenag Kabupaten Aceh Timur Faisal Hasan, Selasa (15/4). Ketua tim penilai Bustamam mengatakan, adapun penilaian utama untuk kategori keluarga sakinah yakni penilaiannya lebih kepada hubungan sosial kemasyarakatan dan kondisi kelayakan rumah secara umum. (cri)

Selasa (15/4). Lanjut Ibrahim, terkait penemuan bungkusan tempe yang dibungkus dengan kertas bertulisanayatAlquranselanjutnyakita bawa permasalahan tersebut dalam rapat Forum Komunikasi Umat Bersama di Kantor Kesbangpol Kota Langsa dihadiri

Ketua MPU, Ketua FKUB Zulkarnean, Kepala Kantor Kementerian Agama dan Kepala Badan Kesbangpoldansejumlahpengurus dan Anggota FKUP. “Karena itu menyangkut masalah agama, maka kasus tersebut harus diusut tuntas. Kalau tidak diusut kita khawatir terjadi

gesekan-gesekan dalam kehidupan beragama,” tandasnya Ibrahim menyayangkan kepada masyarakat yang sengaja menjual kertas-kertas bertuliskan ayat Suci Alquran dan Hadis untuk dijual kiloan, yang selanjutnya dimanfaatkanparapedaganguntuk membungkus tempenya. (m43)

Tujuh Parpol Tolak Hasil Pemilu KOTA JANTHO (Waspada): Tujuh partai politik di Kabupaten Aceh Besar menolak hasil pelaksanaan Pemilu Legislatif 2014 di daerah itu. Ketujuh partai politik tersebut, NasDem, PKB, PDI Perjuangan, PAN, Hanura, PNA dan PDA. Informasi diperoleh, Senin (14/4), penolakan oleh ketujuh partai itu karena ditemukannya berbagai kecurangan dan tindakanyangtidaksesuaiaturandalam proses Pemilu di Aceh Besar. Kondisi itu terlihat jelas saat ditemukansejumlahpelanggaran di Kecamatan Kuta Malaka yang merupakan Daerah Pemilihan (Dapil) 4 Aceh Besar, di mana pada Sabtu (12/4), pengurus Partai PDA dan PAN memergoki anggotaPPKKecamatanKutaMalaka sedang membuka kotak suara tanpa dihadiri para saksi dari partai politik. Menurut informasi, saat dipergoki, sebagian anggota PPK sedang mengisi Form C-1. Pengurus kedua partai tersebut menemukankotaksuaratidakdalam keadaan terkunci dan tersegel.

“Kami juga menemukan kotak suara dalam keadaan kosong, hal ini telah melanggar Pasal 10, Pasal 17 dan Pasal 24 Peraturan KPU Nomor 27Tahun 2013. Kondisi ini diperparah ketika kami ketahui bahwa anggota PPK Kuta Malaka berinisial As dan Mu merupakan kader salah satu partai politik lokal. Hal tidak lazim lainnya, kami menemukan anggota Panwascam juga berada di tempat, tapi tidak mengambil sikap apapun. Selain itu, kami juga mendapatkan informasi bahwa salah satu anggota Komisioner KIP Aceh Besar juga berada di sana,” kata Darwis, Sekretaris Bapilu Partai Damai Aceh (PDA) Aceh Besar. Darwis menyebutkan, dengan kejadian itu, pihaknya mendapati adanya kecurangan, mulai dari proses pencoblosan di TPS sampai ke tahap rekapitulasi di tingkat kecamatan yang dilakukan oleh pihak tertentu bersama pihakpenyelenggarapemilu.“Parahnya lagi, kami juga menemukan adanya kader partai politik terlibat sebagai penyelenggara

pemilu dan Panitia Pengawas Pemilu Kecamatan,” kata Darwis, yang juga calon legislatif dari PDA Aceh Besar. Juru bicara partai politik yang menolak hasil pemilu Legislatif 2014 di Kecamatan Kuta Malaka, Aceh Besar Irmansyah mengatakan,dalamsuratyangditujukan kepada Panwaslu Aceh Besar dan ditandatangani tujuh pengurus partai politik yang menolak hasil pemilu 2014 disebutkan, selain telah terjadi pelanggaran aturan pemilu, partai politik juga telah menemukan penggelembungan suara untuk salah satu partai politik.HalituterjadidiTPSGampong Lambaro Samahani. Ketua Panwaslu Aceh Besar menyatakanpihaknyatelahmendengarinformasitentangrencana ketujuh partai tersebut. “Namun, sampai saat ini surat itu belum sampai ke saya. Kalau memang nanti dikirimkan ke Panwaslu, ya akan kita pelajari,” kata Zubir didampingi Ketua Divisi Hukum Panwaslu Aceh Besar Ainal Mardhiah. (b05)

kata Amir Hamzah. Belum dijelaskan secara pasti hari penahanan ketiga tersangka tersebut, karena penyidik sedang melakukan pengembangan lebih lanjut kasus yayasan penerima dana hibah tersebut. “Dalam waktu dekat ini kita akan lakukan penahanan, kita tunggu dulu hasil tim penyidik,” tambah Amir. Seperti diberitakan sebelumnya, Kejati Aceh menetapkan tiga tersangka setelah memeriksa sejumlah saksi dalam kasus dugaan tindak pidana korupsi terhadap dana hibah dari Biro Kesra Pemerintah Aceh tahun anggaran 2010. Kasus tersebut merupakan perkara dugaan tindak pidana korupsi realisasi belanja hibah pada Biro Keistimewaan dan Kesejahteraan Rakyat SekretariatDaerahAcehtahunanggaran2010kepada Yayasan Cakradonya Lhokseumawe, dengan sangkaan bantuan dana hibah proyek Lean Clearing tersebut lahir berdasarkan permohonan yang dilakukan KetuaYayasan Cakradonya, Reza Maulana kepada Gubernur Aceh Irwandi Yusuf ketika itu. Menurutpenyidikkejati,danasebesarRp1miliar tersebut, ternyata Yayasan Cakradonya belum berbadanhukumsaatmenerimadanatersebut.(cb01)

Kades Ujung Tombak Berantas Narkoba BIREUEN (Waspada): Kepala Badan Narkotika Nasional (BNNK) Bireuen Agussalim mengharapkan, selain melaksanakan tugas rutin pemerintahan, para kepala desa seharusnya juga mampu menjadi ujung tombak pencegahan penyalahgunaan narkoba. Demikian diucapkan Agussalim pada aara Advokasi Implementasi Inpres Nomor 12 tahun 2011tentangPencegahanPemberantasan,Penyalahgunaan Peredaran Gelap Narkoba (P4GN) kepada para kepala desa di Oproom Kantor Pusat Pemkab Bireuen, Selasa, (15/4).

Dengan demikian, katanya, semua kades akan meningkatkan peran dan menjadi pelopor dalam menyampaikan informasi kepada masya-rakat di desa mengenai program pemerintah ten-tang pemberantasan narkoba yang dilaksanakan BNN. Dia menjelaskan, melalui program P4GN semua masyarakat, terutama yang berdomisili di pedesaan akan memiliki pengetahuan tentang bahaya narkoba. “Setelah mengikuti kegiatan ini, kepaladesaharusmensosialisasikankepadamasyarakatnyatentangbahayanarkoba,”harapAgussalim. (b17)

Maling Gasak Pasar Grosir BIREUEN(Waspada):Instalasilistrikdigedung pusat grosir milik Pemerintah Kabupaten Bireuen digasak maling. Pencuri menjarah kabel dan lampu yang terpasang pada plafon ruangan bangunan di Desa Geulanggang Teungoh, Kecamatan Kota Juang itu. Aksi pencurian barang milik pemerintah dimaksud, diketahui setelah Kadis Perindag, Koperasi, dan UKM Bireuen, Darwansyah bersama stafnya dan Asisten Bidang Ekonomi dan Pembangunan, Muzakkir Aziz meninjau bangu-

nan ini, Selasa (15/4). Darwansyah mengatakan, selain menggondol kabel dan lampu, maling juga mengambil fitting dan perangkat pengatur daya listrik. Dia menduga pencurian itu dilakukan lebih dari satu orang. Asisten II Setdakab Bireuen Muzakkir Azis mengatakan, ketika serah terima dengan pihak penyewa sebelumnya, instalasi listrik pada bangunan itu masih lengkap. “Setelah itu malah di lantai dua sempat digunakan oleh pihak lain lagi untuk membuat wahana rumah hantu,” katanya. (b17)

Audit Pungutan Akkes Di Aceh Utara LHOKSEUMAWE (Waspada): Protes mahasiswa Akademi Kesehatan (Akkes) Aceh Utara terhadap tingginya biaya praktik menjadi perhatian sejumlah elemen masyarakat. Pihak kampus diharapkan lebih transparan dengan pengutipan dari mahasiswa. Sekjen LSM Koalisi Bersatu Rakyat Aceh (Kobra), Amri Usman, Selasa (15/4) menyebutkan,

lembaga pendidikan milik PemkabAcehUtaraharussegeradiaudit. “Akkes milik Pemkab Aceh Utara jangan jadi lahan korupsi,” tegas Amri Usman. Selainitu,tambahSekjenKobra, pihak kampus jangan menghalangi aksi mahasiswa yang inginmenyampaikanaspirasinya. Direktur Akkes Aceh Utara, Rizal Husni mengakui pungutan biaya praktik tahun ini Rp3,5 juta

per mahasiswa. Menurut dia, pesertapraktiktahuninilebihsedikit sehingga terpaksa dikutip biaya lebih tinggi. Terkait pemanggilan orangtua mahasiswa, menurut Rizal, hanyauntukmenjelaskantentang biaya tersebut. “Kita tidak pernah menghalangi mahasiswa protes. Tapi kita panggil orangtua hanya untuk menjelaskan tentang biaya praktik,” jelas Rizal. (b15)

Avanza Tabrak Hercules KOTA JANTHO (Waspada): Kecelakaan lalu lintas kembali terjadi di Jalan Raya Banda AcehMedan. Kali ini, sebuah mobilToyotaAvanzayangmelajudariarah Medan menuju Banda Aceh, menabrak truk Mitsubishi Hercules yangdatangdariarahberlawanan. Sejumlah saksi mata menyebutkan, kecelakaan itu terjadi saat Avanza BL 885 PC yang dikemudikan Syukri Abdul Latif, 35, warga

Keumangan Cut, Kecamatan Mutiara,Pidie,hendakmemotong kendaraan di depannya sehingga tidak melihat truk Hercules bernomor Polisi BL 8774 AA yang datang dari arah berlawanan. Akiban kejadian itu, baik Avanza maupun truk Hercules yang dikemudikan Ambia, 35, penduduk Gampong Babah Jurong,Kecamatan Kuta Baro, Kabupaten Aceh Besar, mengalami ringsek. Sedangkan pengemudi

kedua kendaraan itu selamat. Kasat Lantas Polres Aceh Besar AKP M Nuxir membenarkan kejadian itu. Ia menyebutkan, kecelakaan antara mobil Avanza dengan truk Hercules itu terjadi di kawasan Gampong Bak Dilip Lamteungoh, Kecamatan Sukamakmur, Aceh Besar. “Kasusnya kini sudah ditangani pihak kepolisian dan kedua pengemudi sedang dimintai keterangan,” ujarnya. (b05)

Waspada/M.Syafrizal

WAKIL Wali Kota Langsa Marzuki Hamid saat menerima kunjungan tim Kementerian Menko Kesra, Selasa (15/4)

Peraturan Menteri Hambat Pengembangan Pelabuhan Kuala Langsa LANGSA (Waspada) : Sejumlah peraturan MenteriRIyangtidakmemperbolehkanbeberapa jenis barang masuk melalui Pelabuhan Kuala Langsa, membuat pengembangan pelabuhan yang menjadi kebanggan warga Kota Langsa tersebut terhambat. Sehingga beberapa jenis barang harus masuk melaluiPelabuhanBelawandiMedan,Sumutdengan mengeluarkan biaya yang lebih mahal,” kataWakil Wali Kota Langsa Marzuki Hamid, saat menerima kunjungan tim Kementerian Menko Kesra RI, di aula rapat Wali Kota Langsa, Selasa (15/4). Menurutnya, jauh akan lebih efisien jika

barang-barangyangdilarangmasukkarenaregulasi beberapa menteri bisa melalui Pelabuhan Kuala Langsa.Karenanya,diharapkankepadatimKementerianMenkoKesrayangtelahberkunjungkeLangsa untuk bisa memfasilitasi agar beberapa jenis barang yang dilarang masuk bisa masuk melalui Kuala Langsa, sehingga jasa industri dapat berkembang kembali. Staf ahli bidang UMKM dan Ekonomi Kreatif Menko Kesra RI Wahnarno, menjelaskan tujuan mereka datang ke Kota Langsa untuk melihat bidang-bidang apa yang bisa dilakukan kerjasama dengan Pemerintah Kota Langsa. (cms)

Kantongi Sertifikat Nol Kilometer Sabang Berawal Dari Mimpi Waspada/Yusri

TIM Kemenag Aceh didampingi Kakanmenag Aceh Timur saat melakukan penilaian keluarga sakinah di Desa Pucok Alue Dua, Kecamatan Pante Bidari, Selasa (15/4)

Waspada/Zainuddin Abdullah

PANASTERIK: Seorang petugas kebersihan dari Badan Lingkungan Hidup dan Kebersihan (BLHK) Kota Lhokseumawe, menggunakan payung untuk menghindari teriknya matahari, Selasa (15/4) ketika mendorong gerobak sampah di Jalan Darussalam Kec. Banda Sakti. Panas terik yang menyengat terjadi beberapa hari belakangan ini.

“BOLEH bermimpi, tapi jangan lupa kerja nyata karena dengan kerja nyata, mimpi menjadi realita”. Ungkapan ini patut menggambarkan empat pemuda yang tergolong dalam komunitas aneh yakni Komunitas Vespa Rongsok. Keempat pemuda tersebut, Bandeng berasal dari Solo, Kipli dari Pasuruan, Untung dari Cikampek dan Jhon dari Pasuruan dengan bermodalkan tekad dan boleh dibilang nekad melakukan perjalanan dari Solo menuju Sabang, Provinsi Aceh dengan vespa butut (tua) yang penuh sampah sejak tanggal 3 November 2013. Dalam perjalanannya, keempat pemuda yang terhenti ketika melintas di Jalan Medan-Banda Aceh, tepatnya di Gampong Seuneubok Meuku,

Kecamatan Idi Timur, Aceh Timur. Ternyata salah satu vespa yang dikendarai sedang mengalami trouble mesinnya. Di sela-sela mereka memperbaiki vespa, Senin (14/4), kepada beberapa wartawan yang kebetulan melintas mengatakan, keinginan mereka mengelilingi Sumatera terutama di titik “Nol Kilometer” Kota Sabang berawal dari mimpi salah satu dari mereka. Keempat pemuda itu mengaku nekad mengendarai vespa butut berkeliling Sumatera karena sudah diizinkan orang tua dan itu merupakan hobi mereka. “Kami juga ingin menemui saudara-saudara kami di Pulau Sumatera terutama komunitas vespa rongsok,” kata Jhon seraya menambahkan, misi tersebut juga untuk menambah teman

dan kawan se nusantara. Hal senada juga dikatakan Bandeng, dirinya dan temannya merasa bangga karena dengan berbekal tekad dan nekad akhirnya tercapai mimpi mengunjungi pulau paling barat Indonesia, pulau Sabang Aceh. Mereka mengaku, banyak suka dukanya selama melakukan perjalanan dari Solo hingga Sabang sejak bulan November 2013 lalu. Namun mereka kompak menjawab bahwa susah senang mereka tanggung bersama. “Pokoknya susah senang kami rasa bersama,” kata Bandeng. Mengakhiri pembicaraan, mereka mengatakan kalau akan melanjutkan perjalanan menuju Aceh Tamiang hingga perbatasan Sumatera, namun mereka akan singgah di komunitas vespa di Kota Langsa dan Aceh Tamiang. M Ishak

Waspada/M Ishak

PEMUDA asal luar Aceh dengan Vespa butut ketika diabadikan di kawasan Jalinsum Banda Aceh – Medan, persisnya di Desa Seuneubok Muku, Kecamatan Idi Timur, Selasa (15/4)


B10 Aceh Kebun Sawit Rakyat Aceh Capai 53% Dari Total Luas Perkebunan BANDA ACEH (Waspada): Ketua Umum Gabungan Pengusaha Kelapa Sawit Indonesia (GAPKI), Joefly J. Bachroeny, mengatakan, Indonesia merupakan penghasil sawit terbesar di dunia. Saat ini, kata dia, dengan lahan perkebunan kelapa sawit seluas 9 juta hektar, Indonesia memproduksi sawit sebesar 26 jutatonminyaksawitdengannilai produksi 25,7 miliar dolar Amerika. Angka ini diperkirakan akan meningkat menjadi 30 juta ton pada akhir tahun 2014 ini. “PenghasilanminyaksawitIn-

donesiasudahmelampauiMalaysia semenjak tahun 2006,” ujar Joefly di Banda Aceh, Selasa (15/4). Menurutdia,strukturindustri sawit tergolong sehat dan seimbang karena peran petani sangat signifikan. “Jadi, jangan sampai salahpersepsibahwaperkebunan itu hanya dikuasai oleh perusahaan-perusahaanbesar,”ujarnya. Kata Joefly, komposisi kebun rakyat di Aceh mencapai 53 persen dari total luasan perkebunan dan angka ini melebihi rata-rata nasional.Bahkan,industriminyak sawit sangat berperan dalam meningkatkan ekonomi nasional, karena mampu mengurangi angka pengangguran, meningkatkan pembangunan daerah. Industri sawit juga telah men-

ciptakan pusat perkebunan dan ekonomibarudiluarJawa,seperti Sumatera, Kalimantan, dan Sulawesi. KetuaGabunganPerusahaan PerkebunanAceh(Gaperda),Sabri Basyah, menyebutkan, minyak sawitmerupakanpenghasildevisa kedua terbesar setelah minyak dan gas bumi. Pada tahun 2013 menghasilkan devisa sebesar 19 miliar dolar dan volume ekspor kurang lebih 21 juta ton. Sebagai wujud keseriusan Gapki dan Gaperda untuk pengelolaanperkebunandiAceh,kedua organisasi ini meresmikan kantornya yang terletak di jalan Ratu Safiatuddin Banda Aceh, Minggu (13/4) lalu. “Peresmian kantor ini adalah

sebagaitindaklanjutdaripermintaanGubernurAcehagarinvestor perkebunan berkantor di Aceh,” kata Sabri. Sementara pada pengukuhan Dewan Pengurus Gaperda 2014-2019 dan GAPKI Aceh 20142017 di Banda Aceh, Sabtu (12/ 4) malam lalu, Gubernur Aceh, Zaini Abdullah, mengharapkan agar para pengusaha perkebunankelapasawitdapatmenjalankan usahanya di Aceh, untuk men-dukung pertumbuhan ekonomi masyarakat Aceh. Selain itu, gubernur juga mengharapkanperusahaan-perusahaan perkebunan yang ada di Aceh menjalankan programpro-gram yang pro rakyat dan para pengusaha dapat mendiri-

kan kantornya di Aceh. “Dengan begitu, PAD akan masuk ke Aceh,” kata Zaini Abdullah. Menurut dia, Aceh merupakan wilayah yang aman untuk investasi dan Pemerintah Aceh berkomitmenuntukmelindungipara pengusahanya. “Kita akan melakukan berbagai cara, agar pengusaha-pengusaha perkebu-nan akan datang menanamkan modalnya di Aceh,” ujar gubernur dalam acara yang dihadiri seratusan pengusaha perkebunan ini. Gaperda dan Gapki merupakan wadah komunikasi sekaligusmenghimpunperusahaan demi kesejahteraan para anggota pengusaha kelapa sawit dan juga rakyat Aceh. Pengurus Gaperda Acehsaatiniberanggotakan40perusahaanindustrikelapasawit.(b04)

UN Di Aceh Selatan Lancar TAPAKTUAN(Waspada): PelaksanaanUjianNasional(UN) hari pertama di Kabupaten Aceh Selatan,Senin(14/4),berlangsung aman dan lancar. “Hingga saat ini belum diperolehlaporanadanyakendaladalam pelaksanaanUNhariini,”kataKadis Pendidikan Aceh Selatan H.YusafrankepadaWaspadadiTapaktuan, Senin (14/4). Menurutnya, UN tahun ini diikuti 3.232 peserta dari 23 SMA,sepuluh SMK dan sebelas Aliyah. Pihaknya bersama kepala sekolahmemotivasiparasiswa agar giat belajar menghadapi UN ini. Sebelumnya Wabup Aceh Selatan Kamarsyah seusai membukasecararesmidimulainyaUN diSMA1Tapaktuanmemintapara siswa benar benar dapat mengisi jawaban dengan jelas sesuai data dan tidak gegabah mengisinya. Kata dia, hasil belajar selama tigatahun,akanditenukandengan nilai UN menuju kesuksesan ke jenjang yang lebih tinggi. “Keberhasilan ini sangat tegantung dari usaha dan belajar keras siswa sendiri,”tambahnya.(b30)

Sidang Pleno KIP Abdya Ditunda MANGGENG RAYA (Waspada) : Komisi Independen Pemilihan (KIP) Kabupaten Aceh Barat Daya (Abdya) menunda pelaksanaan sidang pleno hasil pemilihan legislatif (Pileg) beberapa hari ke depan, hal itu karena KIP masihmenungguhasilrekapitulasi suara pemilihan dari Kecamatan LembahSabil,karenaadasatudesa sedangdilakukanperbaikandata. Pokja DPT KIP Abdya, Elfiza SH MH Selasa (15/4) menjelaskan, untuk menyelesaikan perekapan di Kecamatan Lembah Sabil,pihaknyaakanlangsungturun ke kecamatan dimaksud, supaya proses perekapan akan lebih cepat. “Kita pastikan hari ini perekapan di Kecamatan Lembah Sabil akan selesai, meskipun hingga malam nanti, seperti perekapan yang terjadi di Kecamatan Manggeng,hinggausaipukul04:00pagi tadi,”ungkapnya. Disamping itu, lanjut Elfiza, beberapa kecamatan lainnya sudahselesaimelakukanperekapan untuk jumlah suara masing-masing caleg dari DPR-RI, DPD, DPRA dan DPRK. Delapan Kecamatan yang sudahmelakukanperekapanyaitu, Kecamatan Manggeng,TanganTangan, Setia, Blangpidie, Susoh, Jeumpa,KualaBateedanBabahrot, sementara Kecamatan Lembah Sabilsedangdilakukanperekapan yang dijadwalkan hari ini. “Selesai perekapan keseluruhan nanti, kita akan segera melakukan persiapan untuk pelaksanaan sidang pleno KIP, Insya Allah 3 hari setelah data dikecamatan terkumpul semuanya,” demikian Elfiza.(cza)

Kotak Suara Mulai Diantar KOTA JANTHO (Waspada): Kotak suara yang berisi surat suarahasilPemiluLegislatif2014mulai diantar oleh Panitia Pemilihan Kecamatan (PPK) di Kabupaten Aceh Besar. Kotak suara tersebut diangkut dengan truk yang disediakan khusus, dikawal personel polisi dan prajurit TNI, serta masing-masing Muspika. Kotak-kotak suara tersebut, diantar setelah dilakukan rekapitukasi dan sidang pleno di tingkat kecamatan, Minggu (13/4). Di Kecamatan Peukan Bada, Kabupaten Aceh Besar, kotak suara diantar Sabtu sore setelah dilakukan rekapitulasi. Ketua KIP Aceh Besar Cut AgusFadillahmengatakan,pihaknyabelumbisamemastikanangkanya karena seluruh surat suara hasil pemilihan terkumpul. (b05)

WASPADA Rabu 16 April 2014

Waspada/Dede

WALI Kota Langsa Usman Abdullah diwakili Asisten I Bidang Pemerintahan, Zainal Arifin saat menyematkan tanda peserta kepada peserta Prajabatan di aula SMKN 3 Langsa, Senin (14/4)

Image PNS KKN Tak Benar LANGSA (Waspada): Image negatif tentang Pegawai Negeri Sipil (PNS) yang melekat dan tertanam bahwa PNS cenderung korupsi, kolusi dan nepotisme atau untuk menjadi PNS harus menyiapkan dana suap yang jumlahnya sangat fantastis dan melakukan tindakan indisipliner semua itu tidaklah benar. DemikiandikatakanWaliKotaLangsa Usman Abdullah diwakili Asisten I Bidang Pemerintahan, Zainal Arifin saat membuka diklat prajabatan calon pegawai negeri sipil golongan I dan II di lingkunganPemkoLangsadiaulaSMKN1Langsa, Senin (14/4). Menurutnya,apabilaseorangPNSmelakukan tindakanKKNakanadatindakanUndang-Undang

Tipikor dan Peraturan Pemerintah No.53 Tahun 2010 tentang Disiplin, PNS, jadi pola pikir negatif seperti ini harus dihilangkan. Karena dapat berpengaruh kepada konsep diri dari seorang PNS. Kepala Badan Kepegawaian, Pelatihan dan Pengembangan,SyahrulThaibmenyatakan,tujuan diklatprajabataninimerupakanbagiandaripersyaratan pengangkatan CPNS menjadi PNS. Selain itu, membentuk wawasan kebangsaan, kepribadian dan etika PNS. Kemudian, meningkatkan pengetahuan, keahlian, keterampilan dan sikap supaya dapat melaksanakan tujuan secara profesional dan dilandasi kepribadian dan etika PNS sesuai kebutuhan instansi. (m43)

Danramil Pimpin Gotroy Buat Jembatan LANGSA (Waspada): Komandan Koramil 15/MPY Kapten Muhammad AR memimpin kegiatan gotong royong bersama masyarakat Desa Matang Cicin, Kecamatan Manyak Payed, Kabupaten Aceh Tamiang, Selasa (15/4). Gotong royong itu dilaksanakan untuk memperbaiki satu buah jembatan yang sudah lama rusak di desa tersebut, dan selama ini sangat sulit dilalui karena lantainya yang terbuat dari kayu semua sudah patah-patah, tidak ada lagi yang utuh, lubang-lubang pun selalu siap menelan korban, jika masyarakat yang menggunakannya

kurang hati-hati. Menurut Danramil, pihaknya berinisiatif memperbaikijembatantersebutdenganmengajak masyarakat melakukan gotong royong bersama, karena dia merasa kasihan setiap melewati jembatan itu selalu melihat ada anak-anak sekolah yang bersusah payah menyeberang sungai. “ Kalau bukan kita yang buat lalu siapa lagi,” demikian katanya seraya mengharapkan setelah jembatan itu selesai agar masayarakat bersamasama juga menjaganya dengan baik supaya dapat bertahan lama.(b20)

Waspada/M. Ishak

ABSEN: Banyak meja dan kursi peserta UN kosong akibat absen di SMKN 1 Idi, Aceh Timur, Senin (14/4).

166 Peserta UN Absen, MAN Idi Gunakan Naskah Kopian MAS Nurul Fata Kurang Soal Bahasa Inggris IDI (Waspada): 166 dari 3.979 pesertaabsenharipertamapelaksanaanUjianNasional(UN)Tahun Anggaran (TA) 2014, Senin (14/ 4). Ketidakhadiran peserta terbanyak terjadi di SMKN 1 Idi, dari 185 peserta yang terdaftar disana mencapai 53 peserta tidak hadir. Kepala Bidang Pendidikan Menengah(Dikmen)DisdikAceh Timur Ridwan S.Pd menjawab Waspada petang kemarin menyebutkan, sebanyak 166 peserta absenpadaharipertamaUNTingkat SMA/SMK/MA Tahun 2014. Rinciannya, 65 dari 610 peserta SMK dipastikan tidak hadir, sementara peserta yang hadir 545 peserta. “UntukpesertaUNSMA/MA jumlah peserta yang tidak hadir yakni IPA sebanyak 63 peserta dan IPS sebanyak 38 peserta.Total peserta UN SMA/MA yang tidak hadir yakni 101. Jadi total peserta UN SMA/SMK/MA yang tidak

hadir yakni 166 peserta,” ujar Ridwan disela-sela penerima LJK UN SMA/SMK/MA se Aceh Timur petangkamarindiRuangDikmen Disdik Aceh Timur di Idi. Gunakan naskah kopian KepalaKantorKemenagAceh Timur, H. Faisal Hasan ZZ melalui Kasi Pendidikan Madrasah Fadli, S.Ag ketika dikonfirmasiWaspada membenarkan adanya kekurangan naskah soal di Madrasah Aliyah Negeri (MAN) Simpang Ulim. Dalam koordinasi dengan pihakDinasPendidikansetempat pihaknya juga tidak dapat menutupi kekurangan, karena jumlah kekurangan tergolong banyak, sehingga pihak panitia di madrasah tersebut mengkopi naskah soal sesuai dengan kebutuhan. “Naskah soal Bidang Study Giografi di MAN Simpang Ulim kurang4ruangatausetidaknya80 eks.Setelahkitalakukankoordinasi,

sehingga kita mengambil inisiatig melakukan kopian, tetapi butirbutir soal tetap terang,” kata Fadli. Dalammengkopinaskahsoal tersebut, lanjut Fadli, panitia ikut didampingiTimIndependendari PerguruanTinggi (PT) dan pihak kepolisian dari Polres Aceh Timur yang ditugaskan ke MAN Simpang Ulim. “Meskipun waktu harus diulur akibat mengkopi naskahsoal,namunpelaksanaanUN berjalan lancar dan tertib, tetapi waktumengerjakanharusditambah dari jadwal sebelukmnya,” kata Fadli. Distribusi soal kurang Lain halnya Madrasah Aliyah (MAS) Nurul Fata Aceh Timur. NaskahsoalBahasaInggriskurang 4 ruang, sehingga proses pelaksanaan ujian harus ditunda menunggukedatangansoal.“Setelah kita koordinasi dengan Panitia Pelaksana (Panpel) UN Disdik Aceh Timur akhirnya kekura-

ngan tersebut tertutupi, karena dalam kekurangan terjadi dalam proses pendistribusian sebelumnya,” kata Fadli. Soal Sulit Sejumlah peserta UN di SMKN 1 Idi mengaku, butir-butir soal yang dikerjakannya tergolong sulit dan tingkat kesulitannya sangat tinggi khusus Bidang Study Bahasa Indonesia. Bahkan, salah satu peserta sempat mengaku ke teman-teman hanya mengerjakan 15 dari 50 butir soal Bahasa Indonesia. “Diasedangmenangis,karena dia tidak mengisi Lembaran Kerja Komputer (LJK) sebanyak 35 butir, karena dia mengaku tidak bisa menjawab,” kata salah seorang peserta UN SMKN 1 Idi seraya mengaku, meskipun angka kesulitan tinggi namun dia mengaku mengerjakan seluruhnya asal LJK penuh terisi dengan harapan benar seluruhnya. (b24)

Lima Siswa Di Aceh Besar Absen KOTA JANTHO (Waspada): Lima siswa SMA di Kabupaten Aceh Besar dilaporkan tidak mengikuti Ujian Nasional (UN) hari pertamayangmulaiberlangsung, Senin (14/4). Dari laporan yang diterima Dinas Pendidikan Aceh Besar, keempat siswa yang tidak mengikuti UN hari pertama, satu dari SMA Negeri 1 Lhoong, tiga dari SMA Swasta Tgk. Chik Kuta Karang dan satu dari SMA Swasta

Malem Putra. Sementara dua siswa yang tersangkuthukumdankinidalam titipan pengadilan di Rutan PerempuandanAnakLhokngaserta di Lembaga Pemasyarakatan Kajhu, Aceh Besar, mengikuti ujian yang berlangsung 14-16 April. IG yang menjalani penahanan di Rutan Perempuan dan Anak Lhoknga, mengikuti UN di sekolahnyadibawahpengawalansipir

penjara. Sedangkan K yang ditahan di LP Kajhu, mengikuti UN di dalam LP diawasi oleh pengawas dari Dina Pendidikan Aceh Besar. KabidPendidikanMenengah DinasPendidikanAcehBesarSaiful saat memantau pelaksanaan UN kemarin mengatakan, jumlah peserta UN di Kabupaten Aceh Besar tahu ini sebanyak 3.946siswa,terdiridarisiswaJuru-

sanIPA 2.623 orang, Jurusan IPS 1.205 orang dan Agama 118 orang. “Dari jumlah tersebut, lima orang tidak hadir,” kata Saiful. Bupati Aceh Besar Mukhlis Basyah mengecek pelaksanaan ujian di MAN Sibreh dan SMA Ali Hasjmy. SedangkanWakil Bupati H. Syamsulrizal memantau di SMANegeri1Sukamakmur,MAN Montasikdan SMANegeri1Darul Imarah. (b05)

Salwa Islami Athirah, Duta Langsa OSN IPS SMP LANGSA (Waspada): Pelajar SMPNegeri9Langsa,SalwaIslami Athirah, kelasVIII-I menjadi duta Kota Langsa dalam ajang OlimpiadeSainsNasional(OSN)bidang studi Ilmu Pengetahuan Sosial (IPS) di tingkat provinsi di Banda Aceh pada 18 April mendatang. Kepala SMP Negeri 9 Langsa, Bukhari M, mengatakan kepada wartawan di ruangannya, Senin (14/4). Menurutnya, Salwa menjadi duta Kota Langsa diajang OSN setelah dirinya terpilih menjadi juara II di tingkat Kota Langsa dalam event serupa yang dilaksanakan pertengahan Maret lalu. “Mudah-mudahan dengan prestasi ini, Salwa bisa mengharumkannamasekolah,khususnya Kota Langsa dalam OSN terse-

Waspada/Dede

KEPALA SMP Negeri 9 Langsa, Bukhari M didampingi Salwa Islami Athirah saat berada di ruangan kepala sekolah, Senin (14/4)

but,” katanya. Diakui Bukhari, pada tahun-

tahun sebelumnya SMPN 9 Langsa selalu mendapat juara

II dalam beberapa kali kegiatan di Kota Langsa, belum ada satu siswayangbisasampaikeprovinsi da-lam prestasi apapun. Namun, kehadiran Salwa yang menjadi duta Kota Langsa di bidang studi IPS pada OSN mendatang, setidaknyabisamenjadikebanggaan sekolah dan guru. “Kita berharap, kesempatan ini dapat dimanfaatkan terus oleh Salwa untuk belajar lebih giat lagi sebelum pertandingan agar bisa memetikprestasigemilanghingga ke tingkat nasional,” tandasnya. Salwa Islami Athirah yang ditemui wartawan mengaku senang bisa menjadi duta OSN bidangstudiIPSditingkatProvinsi Aceh. “Meski agak deg-degkan, tapi saya optimis bisa bersaing dengan sekolah lain. InsyaAllah bisa mengharumkan nama Kota Langsa dan membawa nama baik sekolah. Karena saat ini saya terus melakukanevaluasipembelajaran sejauh mana materi yang telah dipelajari bersama pembimbing,” kata Salwa yang lahir 15 April 2000 ini. (m43)

Waspada / Ibnu Sa’dan

MASYARAKAT Matang Cincin bersama anggota TNI dari Koramil 15/ Manyak Payed sedang bergotong royong mengganti lantai jembatan yang patah dengan papan dari pohon kelapa.

Bawaslu dan KIP Terancam Di Praperadilankan BANDA ACEH(Waspada): Badan Pengawas Pemilu dan Komisi Independen Pemilihan Aceh terancam dipra-pradilankan jika hingga batas waktu 5 Mei mendatang belum menyelesaikan laporan pelanggaran pemilu. Meski telah menerima berbagai laporan pelanggaran, kedua penyelenggara pemilu itu dinilai belum menindaklanjuti laporan yang telah diterimannya hingga tuntas. “Kami yakin bahwa Bawaslu dan KIP tidak akan mampu menyelesaikan berbagai laporan pelanggara yang diterimannya. Jika hingga batas waktu 5 Mei tidak ada apapun yang dilakukan, kami akan Pra-pradilan Bawaslu,”kata Askhalani salah satu anggota Konsorsium Pemilu Bersih Aceh mewakili GeRAK Aceh saat berorasi di kanor Bawaslu Aceh dikawasan Geucue Komplek Banda Aceh, Senin (14/4). Selain Asqalani, unjukrasa yang dimulai sekira pukul 10.00 Wib, di Kantor Bawaslu Aceh, turut dihadiri puluhan mahasiswa dan perwakilan elemen sipil yang tergabung dalam KPBA. Dalam aksinya massa berorasi dan membawa spandu mempertanyakan kinerja Bawaslu yang dinilai belum mampu menindaklanjuti berbagai kasus pelanggaran yang terjadi selama pemilu di Aceh. “Bawaslu hanya sibuk mempertahankan status quo paska sengketa kewenangan antara Bawaslu pusat dan pemerintah Aceh. Hingga kini ada 164 kasus yang dicatat kawan-kawan LBH namun tidak ada satupun yang direkomendasisebagaipelanggaranolehBawaslu,”teriak

Askhalani. PantuanWaspada,aksiyangberlangsungtertib tersebut dikawal puluhan personil kepolisian dari Mapolresta Banda Aceh. Massa yang tidak diperkenankan masuk ke pekarangan akhirnya ditemui Kasi Penindakan dan Pelanggaran Bawaslu Aceh, Zuraida. Kepada Massa KPBA, Zuraida menyatakan Bawaslu tengah memverifikasi berbagai pelanggaranyangtelahditerima.Bawaslulanjutdiamembutuhkan waktu untuk menindaklanjut laporan tersebut. Aksiyangberlangsungsekitarsatujamtersebut berakhir setelah massa KPBA membacakan empat peryataan sikap diantaranya mendesak Bawaslu menyelesaikan berbagai pelanggaran yang telah diterimannya. KPBA meminta Bawaslu mengungkapsecaratransparanjumlahsuarayangterpantau Petugas Pengawas Lapangan (PPL) untuk mencegah penggelembungan suara terhadap caleg dan partai tertentu. Bawaslu juga diminta mengumumkan surat suara yang tidak digunakan pemilih untuk mencegah penyalahgunaannya. Selanjutnya, KPBA memberi batas waktu bagi Bawaslu hingga 5 Mei untuk mengungkap berbagai pelanggaran dan transparan data-data pemilu secara tuntas. “Jika ini tidak ditindaklanjuti akan merusak sistem demorasi dan pembangunan Aceh lima tahun kedepan,”pungkas juru bicara KPBA, Agusta Muhtar.(cb06)

Waspada/Yusri

HAMPIR RAMPUNG: Perumahan translok Seumanah Jaya, Kec, Ranto Peureulak, Aceh Timur yang hampir rampung pembangunannya, Senin (14/4)


Aceh

WASPADA Rabu 16 April 2014

Heboh, Kotak Suara Dari Karo Melintas Di Agara KUTACANE (Waspada): Kapolres AKBP H.Trisno Riyanto membantah kotak suara yang ditemukan dibawa pengendera sepeda motor di kawasan Kecamatan Babul Makmur pada hari pencoblosan berasal dari KIP Agara. Penegasan itu disampaikan Kapolres kepada Waspada, Senin (14/4) terkait ditemukannya be-

berapa kotak suara pemilu yang dibawa dua pengendera sepeda motor yang sempat menjadi buah bibir di Kabupaten setempat. “Benar petugas kita menemukan dan menghentikan dan menanyakan langsung kepada pengendera sepmot yang membawa kotak suara, namun kotak suara itu bukan dari KIP maupun PPK Agara, tapi kotak sara dari salah satu TPS dari Karo yang berbatasan dengan Agara,” Kapolres,

Berdasarkana keterangan petugas kepolisian di Babul Makmur, kotak suara itu hanya melintassajadariAcehTenggara,karena untuk membawa kotak suara ke TPS di Kecamatan Mardingding itu lebih dekat dari AcehTenggara ketimbang harus lewat Tanah Karo. Kecilkemungkinandansama sekali tak ada peluang untuk menyelewengkan kotak suara dari KIP Agara, tandas Trisno, karena pendistribusiankotaksuaramulai dari KIP ke PPK sampai ke TPS

dan sebaliknya, terus mendapat kawalan aparat kepolisian. Jadi jelas, 4 kotak suara yang ditemukan dibawa pengendera kenderaanrodaduadikecamatan Babul Makmur itu, bukan milik Aceh Tenggara, namun dipastikanberasaldariKabupatenKaro dan hanya melintas dari Aceh Tenggara. Di tempat terpisah, Ketua Panwas Kabupaten, Surya Diansyah membenarkan ditemukannya empat kota suara yang dibawa dua pengendera sepeda mo-

Warga Abdya Berharap Anggota Dewan Baru Bermental Kritis

tor, “ kotak tearsebut bukan dari Aceh Tenggara tapi berasal dari Kabupaten Karo dan hanya melintasdariKecamatanBabulMakmur Agara,” ujar Surya. Pun demikian, laporan dari masyarakat pada Panwas Kecamatan kepada Panwas Kabupaten itu akan ditelusri lagi kebenarannya agar tidak timbul salah paham tentang informasi yang beredar di lapangan dan ditengah-tengah masyarakat,” pungkas Ketua Panwas Kabupaten Surya Diansyah.(b26)

Soal Pileg Ulang Belum Diagendakan

IDI (Waspada):Wakil Sekretaris Umum DPP Partai Nasional Aceh (PNA), Mohd. Jully Fuady menegaskan, dari hasil penghitungan cepat dan pantauan tim PNA di seluruh AcehTimur, partai lokal tersebut akan memperoleh sedikitnya empat kursi di DPRK Aceh Timur dan 1 kursi untuk DPRA dari Dapil 6 Aceh Timur. “Kitatidakmengklaim4kursi, tetapi dari hasil perolehan suara PNA di Aceh Timur, InsyaAllah PNA akan mendapat empat kursi di DPRK Aceh Timur dan satu kursi DPRA dari wilayah ini,” tegas Mohd Jully Fuady, Senin (14/4). Dikatakannya, seluruh pengurus Partai Nasional Aceh mengucapkan terimakasih kepada kaderPartai,simpatisandanseluruh masyarakatAcehyangtelahmempercayai PNA untuk menduduki kursi parlemen kali ini. (cri)

BANDA ACEH (Waspada): Perhitungan suara pemilih yang dilakukan penyelenggara pemilu legislatif hampir final. Gambaran partai yang berhasil meraih kursi di Senayan pun sudah semakin kelihatan. Data yang diperoleh Waspada dari sumber pemerintah kabupaten Kota di Aceh, Untuk DPR RI Dapil Aceh 1, Partai demokrat sebagai peraih 4 kursi pada pileg 2009 silam masih berjaya pada perolehan suara pileg 2014 ini, dengan meraup 112.378 suara, di susul partai Nasdem 90.854, berikutnya PAN, 84.642 Gerindra 81.056 Golkar 66.261, PKS 65.256 dan PKB 55.311 serta PPP 42.761 Dibayangi oleh Partai PKPI dan PBB dan PDIP dan Hanura yang meraih sangat sedikit suara. Totalsuarayangterhimpunhinggadatainidiperoleh 670.811 dari jumlah DPT 1.734.072. Pileg 2009 lalu, partisipasi pemilih di dapil Aceh satu yang meliputi Kota Banda Aceh, Aceh Besar, Pidie, Pidie Jaya, Aceh Jaya, Aceh Barat,

Waspada/T.Zakaria Al Bahri

MASYARAKAT Sabang saat demo ke kantor KIP minta Pemilu ulang.

Ratusan Massa Demo Ke Kantor KIP Sabang SABANG (WASPADA): Ratusan massa dari Partai Politik Lokal dan Nasional melakukan demo ke kantor KIP Sabang, Senin (14/ 4) siang. Massa tetap menuntut agar KIPSabangmelakukanpemilihan umum ulang karena banyak dugaan pelanggaran pemilu baik yang dilakukan partai tertentu maupun oleh salah seorang komisioner KIP. Massamulaiberkumpulsejak pagiharidisekitarkantorKIP,begitupunpihakaparatkepolisiandari Satuan Brigadir Mobil Polda Aceh juga mulai siaga dan mempersiapkan dengan peralatan pengendalian massa. Massa yang dipimpin oleh masing-masing pimpinan partai seperti Izil Azhar alias Ayah Miren

MANGGENG RAYA (Waspada) : Dari tiga daerah pemilihan (Dapil), Partai Aceh (PA) diprediksi memperoleh 6 kursi untuk DPRK, dari total 25 kursi di Kabupaten Aceh Barat Daya. Sesuai dengan data, Senin (14/4), dari 3 Dapil, yaitu Dapil 1 (Kuala Batee dan Babahrot) kuota 7 kursi masih unggul suara PA sebanyak 4926 suara, sementara Dapil 2 (Blangpidie, Susoh dan Jeumpa) kuota 10 kursi juga unggul PA dengan 6869 suara dan Dapil 3 (Lembah Sabil, Manggeng, Tangan-Tangan dan Setia) kuota 8 kursi, tetap unggup PA dengan 3892 suara. Sementara itu, untuk DPRA di Abdya masih juga unggul PA dengan 21.367 suara dan DPR-RI ditempati NasDem dengan 14.143 suara. (cza)

Panwaslu Terima Pengaduan Kecurangan Pileg SUBULUSSALAM (Waspada): Hingga, Selasa (15/4), Panitia Pengawas Pemilu (Panwaslu) Kota Subulussalam menerima empat pengaduan dugaan kecurangan pada Pemilu Legislatif dari Partai Gerindra, PDA, Hanura dan PAN. Edi Suhendri, Ketua Divisi Hukum Penanganan dan Pelanggaran Panwas setempat mengatakan itu, kemarin. Syahril Tinambunan, Caleg dan Ketua DPD PAN setempat mengatakan, pengaduan PAN diterima Julianda Boang Manalu, staf Sekretariat Panwas, Senin (14/4). Dilaporkan, sembilan pemilih di TPS 1 dan 2 Desa Lae Motong Kec. Penanggalan, Subulussalam, juga terdaftar dalam DPT Pakpak Bharat,SumutdanAcehSingkil,Aceh.SyahrildidampingisaksiPAN, KardiCibrodansejumlahpendukungberharapPilegulangdikedua TPS itu. (b28)

Berangkat (light, tujuan, waktu)

Garuda Indonesia GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

Lion Air JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air SJ 010 Jakarta/Medan

Air Asia QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

pemerintah, padahal mereka memiliki peran fungsi kontrol. Jadi bukan hanya ketok palu belaka,” sebut Hendrix MS, koordinator JKMA Abdya. Selain itu, Julius, 25, seorang warga Abdya yang saat ini mengaku baru saja menyelesaikan pendidikannya, juga menyampaikan harapannya agar anggota dewan tidak lagi mengedepankan kepentingan pribadi serta kelompoknya saat sudah menduduki kursi ‘empuk’ di DPRK, namun dapat memiliki tingkat sensitivitas yang tinggi terhadap kesulitan yang kini sedang dialami oleh rakyat. “Jangansampaimereka(anggotadewan)cuma memikirkan nasib sendiri dan kelompok nya, tapi jugamelihatnasibrakyatyangmerekawakili,seperti kami yang muda-muda ini, agar bisa dipikirkan supaya dapat memiliki peluang kerja, agar jangan lagi rakyat tidak mempunyai harapan apapun terhadap wakil mereka di dewan, karena terlalu sibuk dengan hal-hal yang menurut kami jauh dari harapansertaberhubungandengankepentinganrakyat, bek disinan ka lage top tat (jangan sudah disitu merasa sudah terlalu hebat),” cetus Julius. (cb05)

Nagan Raya, Gayo Lues, Aceh Tenggara, Aceh Singkil Sulbulussalam, Aceh Barat Daya, Aceh Selatan, dan Simelue sebanyak 982.914 dengan jumlah DPT sebanyak 1.137.755 Sementara di dapil Aceh II meliputi Aceh Tengah, Bener meriah Lhokseumawe, Aceh Utara, AcehTimur langsa, dan AcehTamiang serta Bireun, Partai Gerindra meraih suara sementara 125.004 disusul Partai Demokrat 94.314 dan Partai Nasdem 81.590 dibayangi PPP yang meraih 77.661 dan PDIP 76.215 dan Partai PAN yang meraih 67.732 suara. Sementara suara PKS, PKB, Hanura, PKPI meraih dukungan yang sangat minim yakni kurang dari 5 persen dari jumlah suara masuk pada Senin (14/4) yakni sebanyak 716.790. Jumlah DPT Dapil II DPR RI sebanyak 1,593,029. Pada Pileg lalu di wilayah dapil ini partisipasi pemilih sebanyak 856.001 dari jumlah DPT saat itu sebanyak 1.128.958.(b08)

Golput Aceh Diperkirakan Capai 49 Persen

Di Abdya, PA Diprediksi Unggul 6 Kursi

Tiba (light, asal, waktu)

BLANGPIDIE (Waspada) : Banyak suara dan harapan disampaikan oleh masyarakat paska bergulirnya pemilu yang baru saja usai dan melahirkan sejumlah wakil mereka yang akan duduk di kursi dewan. Salahsatu harapan yang sangat diharapkan oleh masyarakat terhadap anggota dewan yang baru mendatang adalah perubahan perilaku dan mental, dimana mereka berharap agar anggota dewan yang baru nanti bermental kritis, dan tidak penakut serta tunduk dibawah ‘ketiak’ eksekutif atau pemerintah. Harapan tersebut dikemukakan oleh Jaringan komunitas Masyarakat Adat (JkMA) Aceh Barat Daya (Abdya) dalam siaran persnya melalui surat elektronik yang diterimaWaspada, Selasa (15/4). “Kita memiliki harapan agar kiranya anggota dewanyangbarunantinyabenar-benarmenjalankanfungsinyasebagaiwakilrakyat,sebagaianggota legislatif serta mencerminkan sosok wakil yang aspiratif. Jadi jangan lagi sampai kita melihat anggota dewan memiliki perilaku dan mental yang penakut, tunduk dibawah kendali dan ketiak

Perhitungan Suara Hampir Final

SUBULUSSALAM (Waspada):Terkaitdesakansejumlahcalon anggota legislatif (caleg) Dapil 4 Kecamatan Sultan Daulat, Subulussalam, untuk digelar PemilihanLegislatif(Pileg)ulang,Komisi Independen Pemilihan (KIP) setempatbelummenga-gendakan, apakah digelar atau tidak. DemikiandikatakanKetuaKIP KotaSubulussalam,SyarkawiNur dikonfirmasi,Senin(14/4).Dikatakan,meskimengetahuipersoalan disana,pihaknyabe-lummendapat laporan resmi dari PPK terkait. Namun dipastikan, untuk Dapil 1 Kec. Simpang Kiri, Dapil 2 Kec. Penanggalan dan Dapil 3 Kec. Rundeng/Longkib, mulai dilaksanakan rekapitulasi tingkat Panitia Pemilihan Kecamatan (PPK) terkait. Seperti disampaikan Mukmin, caleg Partai Hanura Dapil 4, pihaknya dan sejumlah caleg di sana menuntut digelar pileg ulang karena diindikasi terjadi kecurangan. (b28)

PNA Akan Peroleh 4 Kursi DPRK Aceh Timur

B11

ketua Partai Nasional Aceh (PNA) Sabang, Juanda dari Partai Keadilan Sejahtera (PKS), Drg Marwan (Nasdem), Amar Hidayat (PDIP), Irman Yusuf Sekretaris Hanura Sabang dan beberapa pimpinan partai lainya. Sejumlah massa meneriaki agar para komisioner KIP menemui mereka. Perundinganpun sempat alot, sehingga akhirnya 12 pimpinan parpol masuk ke Aula KIP untuk membicarakan solusi. Tak lama, akhirnya pimpinan parpol dan Ketua KIP Sabang Marzuki Harun dan Ketua Panwaslu Mualim Hasibuan keluar dari ruangan kantor KIP untuk menemui massa yang dikawal ketat polisi huru-hara. Saat menemu massa, Ketua

KIPyangberadadiatasmobilPolisi mengatakan, bahwa komisioner Kota sabang, Tris Kurniawan diberhentikandantidakdilibatkan dalam kegiatan tahapan pemilu berikutnya. “ Menawarkan opsi kepada parpol untuk perhitungan ulang, atau rekapitulasi terhadap surat suara TPS Gampong Bateshok serta TPS 1 Gampong Berawang. Sedangkan tuntutan lain, bukan menjadi wewenang KIP Kota Sabang.NamunKIPSabangakan menindaklanjuti rekomendasi yang akan dikeluarkan Panwaslu, Bawaslu maupun penyelanggara pemilu ditingkat atas,” kata Ketua KIP Marzuki Harun saat menemui massa. Padakesempatanyangsama, Ketua Panwaslu Mualim Hasibu-

an menyampaikan bahwa pihaknya menunggu surat hasil pleno KIPKotaSabangdanPanwasjuga menunggu laporan dari parpol semua supaya bisa/dapat ditindaklanjuti. Diakhir penjelasan tersebut, Izil Azhar mengatakan, bahwa KIPhanyamemberikanopsi-opsi danbelumdapatmemenuhituntutan parpol. Kalau memang diperlukan bukti akan dikasih ke Panwaslu, sebagai bahan pengambil keputusan,” tegasnya. Selain itu, kepada penegak hukum dirinya meminta agar segera memproses pelanggaranpelanggaran hukum yang telah terjadi. Selanjutnya Ayah Miren minta massa bubar dan menunggukeputusandariPanwaslu. (b31)

Banyak Caleg Telusuri Suara Yang Diduga Hilang BANDA ACEH (Waspada) : Hingga, Selasa (15/4), banyak calon anggota legislatif (caleg) baik tingkat DPRK maupun DPRA bahkan DPR RI maupun DPD RI, masihbergerilyakelilingkampung dan kecamatan untuk mengetahui jumlah perolehan suara di KPPS dan PPK. Para caleg itu melakukan penelusuran rekapitulasi hasil penghitungan suara sementara di tingkat desa dan kecamatan. Ini mereka lakukan karena ada kecurigaan terhadap hasil rekap suara baik yang dilakukan di tingkat KPPS maupun PPK. Seorang caleg dari Partai Golkar yang minta namanya tidak dipublikasikan pernah meneleponsalahseorangpendukungnya untuk memastikan berapa orang keluarga di rumah itu yang

memberikansuaraataumencoblos nama caleg tersebut. Kader Golkar dimaksud adalah Maryam di kawasan Lamlagang, Selasa (15/4) mengaku pernah dihubungi seorang caleg melalui ponsel menanyakan berapa jumlah keluarganya yang menjatuhkanpilihankepadacaleg tersebut. “Saya jawab ada empat orang, “kata Maryam. Saat ditanya untuk apa, sang caleg itu menyatakan ada kecurigaan tentang suara untuk hilang saat direkap, tidak sesuai dengan di TPS,” jelas Maryam. Calon DPRA dari Partai Gerindra M Amin Affan, Selasa (15/ 4) mengakui, pihaknya masih terus melakukan pengumpulan data perolehan suara dengan cara turun ke kecamatan-kecamatan untuk mencari tahu hasil

rekapitulasi penghitungan suara sementara secara cepat dan akurat. Dikatakan, Amin Affan, pihaknya telah turun ke hampir seluruh kecamatan (23 kecamatan) di Kabupaten Pidie dan 8 kecamatan di Pidie Jaya untuk mengetahui secara pasti rekapitulasi hasil penghitungan suara sementara. Menurut M Amin Affan, hampir di semua TPS dan desa di Dapil 2 (Kabupaten Pidie dan PidieJaya)diamemilikiperolehan suara sementara. Namun belum tahu persis berapa jumlahnya karena belum direkap secara totalnya. Ditanya tentang apa ada peluang untuk lolos ke lembaga dewan, Amin Afan menyatakan belum tahu persis. (b09)

LHOKSEUMAWE (Waspada): Al Chaidar, pengamat politik mengatakan, angka golput pada Pemilu Legislatif 2014 di Aceh meningkat dari tahun sebelumnya. “Jika tahun sebelumnya mencapai 41,2 persen, diperkirakan tahun ini mencapai 49 persen. Ada juga daerah di Aceh yang mencapai angka golput 50 persen,” katanya, Selasa (15/4). Menurutnya, meningkatnya jumlah golput ini terjadi disebabkan oleh rasa percaya rakyat terhadap pemerintah semakin buruk. Kasus-kasus koruptor yang dilakukan orang- orang partai semakin banyak, yang membuat rakyat sakit hati.

Katanya, ada semacam perasaan jera yang dialami penduduk Aceh terhadap pemimpin yang selalu memandang mereka dengan sebelah mata. Tak jarang pula pemerintah kerap balik badan kala berhadapan dengan berbagai persoalan yang menimpa rakyat Aceh. Khusus di Aceh, tambah Chaidar, golput dipicu pula oleh perasaan tidak nyaman tatkala warga hendak menuju ke TPS. Beberapa daerah bahkan warganya merasa terancam, tertekan, dan sangat tidak nyaman. Akhirnya mereka lebih memilih tetap bekerja, ke ladang, turun ke sawah, dan juga melaut saat hari pencoblosan. (b14)

Azhari Usman Bersaing Ketat Dengan Fachrur Razi BIREUEN (Waspada): Drs H Azhari Usman M Si nampak masih bersaing ketat dengan Fachrur Razi dalam perolehan suara sementara untuk DPD-RI di Bireuen. Ketua Desk Pemilu Kabupaten Bireuen Drs Murdani dalam keterangannya kepadaWaspada mengatakan hingga Senin (14/4) perolehan suara sementara dari 40 Celeg DPD, 11 Caleg DPDRI diantaranya nampak masih bersaing ketat. Perolehan suara sementara urutan teratas

masih dominasi Fachrur Razi MIP 13.1116 (16,26 persen) disusul Dr Azhari Usman M Si 11.459 (14,21 persen), Sudirman 7.513 (9,32 persen), Dr Ahmad Farhan Hamid, MS 6.510 (8,97 persen). H Ghazali Abbas Adan 6.352 (7,88 persen), Rafli 4.521 (5,61 persen), H Asyari S Pdi 2.508 (3,11 persen), Teuku Eddy Faisal Rusdy, SHI, M Sc 1.906 (2,36 persen), Saifuudin A Gani,SH 1.873 (2,32 persen) Adnan NS 1.801 (2,24 perse3n) dan Teuku Kamaruzzaman,SH 1.762 (2,18 persen). (b12).

Polisi Tangkap Pencuri Kabel Telkomsel LANGSA (Waspada): Polsek Langsa Barat l membekuk seorang tersangka dari lima kawanan pencuri kabel fiderTelkomsel yang berada di Desa Alur Dua, Bakaran Batu, Kecamatan Langsa Barat saat melakukan aksinya. Demikian dikatakan Kapolres Langsa AKBP Hariadi melalui Kapolsek Langsa Barat, Iptu Budi NasuhaWaruru kepada wartawan, Selasa (15/4). Kronologis kejadiannya bermula, pada Sabtu (12/4) sekira pukul 03:00 petugas mendapat informasi terjadi pencurian kabel feder 1 1/4 milik Telkomsel yang dilaporkan seorang pekerja. Selanjutnya, oleh petugas didatangi ke TKP di Desa Alur Dua, Bakaran Batu, Langsa Barat yang memergoki lima kawanan pencuri kabel sedang melakukan pencurian. Mengetahui itu, kawanan spesialis pencuri kabel langsung kabur. Kemudian, petugas melakukan olah TKP dan menemukan jaket, sandal dan dompet yang berisikan identintas salah satu tersangka. Barang

bukti itulah menjadi dasar penangkapan dan penyelidikan sehingga menangkap salah seorang tersangka berinisial NS, 19, warga Desa Alur Dua, Bakaran Batu, Langsa Barat. “NS ditangkap, Minggu (13/4) saat berada di DesaSeulalah,LangsaLamadirumahsalahseorang kerabatnya. Sebelum penangkapan NS, petugas juga mengamankan gulungan kabel seberat 500 kg yang sudah dipotong sekitar 100 meter dari TKP yg sudah disembunyikan,” paparnya. Lanjut Budi, dari NS ini kemudian terbongkar empat nama tersangka lainnya yang sudah lari dan menjadi DPO Polres Langsa. Keempat tersangka, Og, 19, Re, 20, Iw, 28, Su, 20, semuanya warga Desa Alur Dua, Bakaran Batu, Langsa Barat. Supervisor Radio Transport Power (RTP) 6 Area Telkomsel Langsa, Herman mengaku akibat pencurianiniTelkomselmengalamikerugiansenilai Rp87 juta. (m43)

Proyek Jembatan Pange Beraroma Korupsi LHOKSUKON (Waspada): Proyek pembangunan jembatan rangka baja yang menghubungkan Desa Rayeuk Pange, Kec. Pirak Timu dengan Desa Teupin Keubeu, Kec. Matangkuli, Aceh Utara, diklaim beraroma korupsi. “Proyek ini didanai APBK Aceh Utara Tahun 2010 senilai Rp2,8 Milyar. Pembayarannya sudah 100 persen. Tapi, sejauh ini belum bisa dimanfaatkan oleh masyarakat,” kata Kajari Lhoksukon, Teuku Rahmatsyah SH (foto), di kantor Kejari Lhoksukon, Senin (14/4). Didampingi Kasi Intel, M Kadafi SH dan Kasi Pidsus Oktalian SH, Teuku Rahmatsyah menambahkan, tim Kejari sudah menemukan bukti awal yang cukup untuk

menduga proyek itu terindikasi korupsi. Bahkan, statusnya sudah ditingkatkan dari tahap penyelidikan ke tahap penyidikan. “Tim menemukan banyak

penyimpangan dalam proyek ini. Antara lain; proyek di sub secara melawan hukum, perpanjangan kontrak atau addindum menyalahi Keppres Nomor 80 tahun 2003 tentang pengadaan barang dan jasa serta terkesan asal jadi,” imbuh Kajari. Teuku Rahmatsyah juga menyebut, kasus dugaan korupsi dalam proyek pembangunan jembatan rangka baja Rayeuk Pange, diselidilki sejak Desember 2013. Tim sudah memeriksa 11 saksi. Sementara kerugian negara yang ditimbulkan ditaksir di atas Rp 500 juta. “Untuk tersangkanya masih kita dalami. Sabar saja. Nanti kalau sudah kita tetapkan, pasti kita kabari lagi,” janji Teuku Rahmatsyah.(b19)

Waspada/Dede

KAPOLSEK Langsa Barat Iptu Budi Nasuha Waruru bersama tersangka NS dan barang bukti kabel fider Telkomsel yang dicuri para tersangka di depan Mapolsek Langsa Barat, Selasa (15/4)


Otomotif

B12

WASPADA RABU 16 April 2014

Penjualan Mobil Kembali Naik

Tampil Unggul Daihatsu Luxio NAMA Daihatsu Luxio sengaja dipilih untuk memberi kesan ‘mewah’. Daihatsu mengeksploitasi semua kemewahan yang ada pada minivan berhitung pesek ini. Begitu melihat dari dekat, mulai dari eksterior sampai ke interior dari salah satu tipe yang panjang dengan transmisi otomatik, Daihatsu Luxio memang mewah. Interiornya tampil dengan warna beige, yaitu jok, langit-langit, dan door trim. Hanya dashboard yang menggunakan two tone atau dua warna, beige dan hitam. Dibandingkan dengan saudaranya, Gran Max minibus, Luxio memang mewah dan lebih lengkap. Kualitas material interior jauh lebih halus. Begitu juga dengan door trim. Kedua pintu depan dilengkapi dengan bezel tombol power window dan door lock. Hal ini membuat pengemudi dan penumpang lebih nyaman dan aman. Daihatsu menargetkan produknya ini untuk keluarga yang lebih mapan serta membutuhkan kemewahan dan bukan sekadar fungsional. Strategi yang dilakukan Daihatsu menjajakan Luxio agar bisa dijangkau kalangan lebih luas, memasarkannya dalam tiga varian dasar. Versi paling standar, D, kemudian ada tipe M dan X dengan transmisi manual. Daihatsu Luxio memiliki beberapa bagian dari mobil misalnya, lampu depan multireflektor dengan HID atau xenon. Gril yang diberi lapisan krom hanya untuk varian X. Begitu juga dengan lampu kabut, kaca spion luar yang bisa disetel dari dalam dengan menekan tombol (electric-retracgtable mirror) yang dilengkapi dengan lampu LED sebagai sinyal untuk berbelok.

Spoiler belakang dengan lampu rem, juga hanya buat tipe X. Begitu juga denga seluruh jok yang dilengkapi dengan penahan kepala. Bahkan, two tone dashboard dengan ornamen pada kluster tengah juga hanya buat varian X. Bahkan, transmisi otomatik dengan tuas berada di dashboard ditawarkan hanya buat tipe X. Hal yang sama juga diberlakukan buat audio Double DIN R/T+CD dengan MP3. Fitur standar pada tipe M dan X adalah AC double blower, jok deret kedua yang bisa digeser dan sabuk pengaman untuk jok deret kedua dan ketiga. Beberapa perlengkapan lain adalah cargo tray dan cargo net, sedangkan ABS hanya opsional untuk tipe M dan X. Perbedaan lain antara Luxio dibandingkan dengan Gran Max selain wajahnya, terutama gril, bumper dan lampu, di bagian belakang, lampu kombinasi tidak sama. Pada Luxio, lampu belakang desainnya terdiri dari dua segmen dengan posisi horizontal. Sebagian lampu belakang berada pada pintu belakang. Untuk ban digunakan ukuran 195/65R15. Peningkatan lain yang dilakukan Daihatsu terhadap Luxio dibandingkan Gran Max adalah karakteristik suspensi yang lebih empuk. Sumber tenaga yang digunakan sama dengan Daihatsu Terios, 1,5 liter VVT-i yang mampu menghasilkan tenaga 97PS dan torsi 13,5 kgm. Dibandingkan dengan kompetitornya sesama hidung pesek, mengandalkan interior yang lebih lega. Pasalnya, selain menganut bodi monokok, lantainya lebih rendah. Begitu juga dengan posisi mesin. Hasilnya, selain interior lebih lega, tentu saja lebih stabil untuk diajak bermanuver.(arblog/m07)

Pasar mobil Nasional kembali mengalami kenaikan penjualan pada Maret 2014. Di bulan ketiga itu total penjualan mencapai 113.079 unit, atau naik dibanding penjualan Februari yang hanya mencapai 111.880 unit. Berdasarkan data Gabungan Industri Kendaraan Bermotor Indonesia (Gaikindo), Toyota masih berada di posisi pertama sebagai perusahaan mobil terlaris dengan total penjualan mencapai 38.961 unit. Namun yang paling mencolok dari peningkatan penjualan mobil terjadi pada Honda, yang merangsek naik di posisi ketiga dengan total penjualan mencapai 14.529 unit. Sebelumnya, Honda hanya mampu berada di posisi ke lima. Sedangkan yang turun dari tahtanya adalah Suzuki dan Mitsubishi, yang hanya terjual 14.013 unit dan 13.668 unit. Adapun untuk mobil terlaris pada Maret 2014 masih di tempati Toyota Avanza, yang mencapai 16.315 unit. Sementara

Jajaran sepeda motor matik kini menjadi idola para pengendara roda dua Tanah Air. Pertumbuhan motor tanpa gigi ini setiap tahun terus tumbuh, dan di lain pihak, pabrikan terus melakukan inovasi untuk meningkatkan peforma dan juga kenyamanan serta tingkat keiritan penggunaan bahan bakar. Salah satunya adalah pabrikan Suzuki, yang memiliki varian Suzuki Nex dalam jajaran produksi motor matik mereka. Suzuki Nex dibekali mesin

dengan kondisi jalan beragam, termasuk adanya macet di beberapa titik, pada ruas jalan yang dilalui. Pengujian di lakukan di jalan-jalan dalam kota, dengan memakai BBM bensin beroktan 92 atau Pertamax, dengan metode menuangkan satu liter BBM dan dibawa berjalan sejauh mungkin hingga sepeda motor berhenti karena bahan bakar yang ada di dalam tangki habis, sehingga didapat angka 60,3 km/per liter dari hasil pengujian pada Suzuki Nex. Suzuki Nex sangat irit, karena mengusung konsep teknologi mesin ‘LEaP TECH’ alias Light, Efficient and Powerfull (LEaP) yang merupakan konsep yang digunakan untuk men-desain mesin dan body Suzuki Nex secara keseluruhan. Suzuki, Nex Fi dibekali sejumlah kecang-gihan dan keunggulan fitur di kelasnya seperti Tip-Over Sensor, Throttle Position Sensor, Intake

di urutan kedua kini di tempati Honda Mobilio yang laku 10.592 unit. Sementara itu, di posisi ketiga di tempati mobil murah ramah lingkungan atau Low Cost Green Car (LCGC) dari Toyota yaitu Agya, yang mencapai

6.648 unit. Namun, untuk penjualan LCGC, kali ini menurun dibandingkan Februari 2014. Berdasarkan data Gaikindo, total wholesales (penjualan pabrik ke dealer) segmen LCGC turun dari 16.270 unit (Februari) menjadi 13.443 unit (Maret).

Penurunan penjualan ini juga terjadi pada empat perusahaan mobil yang turut menghadirkan mobil murah, yaitu Toyota Agya, Daihatsu Ayla, Honda Brio Satya dan juga Suzuki Karimun Wagon R. Adapun mobil murah yang

Mobil terlaris Maret: 1. Toyota Avanza 16.315 unit 2. Honda Mobilio 10.592 3. Toyota Agya 6.648 4 Toyota Innova 5.428 5. Suzuki Carry MT PU diesel 4.362 6. Daihatsu Ayla 4.333 7. Gran Max Pikap 4.093 8. Daihatsu Xenia 3.640 9. Suzuki Ertiga 3.475 10. Toyota Rush 2.962 11. Mitsubishi T-120 SS mini PU 2.603 12. Mitsubishi L-300 PU diesel 2.514 13. Nissan Grand Livina 2.041 14. Suzuki Wagon R 2.037 15. Daihatsu Terios 1.912 16. Suzuki APV MT PU 1.898 17. Honda Jazz 1.632 18. Toyota Fortuner 1.409 19. Toyota Etios 1.305 20. Suzuki APV 1.104 (vci/m47)

Honda Raih Contact Center Service Excellence Award PT Astra Honda Motor (AHM) menorehkan prestasi sebagai perusahaan otomotif roda dua dengan layanan contact center terbaik seiring keberhasilannya meraih penghargaan Contact Center Service Excellence Award 2014. Penghargaan ini semakin membuktikan kualitas dan komitmen Honda dalam memberikan layanan terbaik untuk konsumen. Contact Center Service Excellence Award 2014 diselenggarakan majalah Service Excellence (SE) bekerjasama dengan Care-Center for Customer Satisfaction and Loyalty (CCSL). Pada kategori perusahaan otomotif roda dua, Contact center Honda berhasil meraih penilaian kinerja terbaik dengan nilai call center service excellence index tertinggi. GM Honda Customer Care

Suzuki Nex Teruji Paling Irit 110 cc yang menghasilkan tenaga paling besar di kelasnya yakni 9,4 PS dan torsi 8,7 N-m dan dipadu dengan rangka paling kompak, sehingga membuat bobot motor menjadi ringat, yakni 87 kg. Satu diantara bukti keiritan Suzuki Nex, karena berhasil meraih rekor MURI sebagai motor matik paling irit dengan konsumsi bahan bakar mencapai 79,6 km untuk setiap liter yang digunakan. Sementara dalam satu pengujian untuk pemakaian sehari-hari, yang dilakukan di Jakarta Maret lalu, Suzuki Nex juga terbukti menjadi motor matik di kelas 110 cc paling irit dengan konsumsi bbm 60,3 km/liter. Pemakaian sehari-hari di sini, artinya, pengujian dilakukan

paling laris masih ditempati Agya yang mencapai 6.648 unit, disusul Ayla (4.333 unit), Karimun Wagon R (2.037 unit) dan Brio Satya hanya 425 unit.

Air Pressure Sensor, Intake Air Pressure Sensor, Crankshaft Position Sensor, Engine Temperature Sensor, dan Oxygen Sensor (O2S),. Kelebihan lain dari pabrikan berlogo S ini menciptakan matik teririt, berupa desain body yang compact, semen-tara berat kosong di angka 87 Kg memungkinkan minimnya putaran gas pada tarikan awal, karena lebih ringan saat berakselerasi. Eksplorasi sisi sporty dari pabrikan yang dikenal berlambang S ini juga dihadirkan pada sektor kaki-kaki, di mana kehadiran velg racing berkelir abu-abu dengan label Enkei masih dianggap mumpuni memenuhi kebutuhan stylishnya. Sementara itu berkaitan dengan segmen pasar yang dibidik yakni remaja dan mahasiswa, maka desain panel speedometer turut dihadirkan dengan tema yang lebih sport dan gaya, namun mudah dimengerti pengendara. (rel/m47)

Center AHM Istiyani Susriyati menyatakan, contact center Honda yang lahir sejak 2004 ini telah menjadi jembatan penghubung efektif antara konsumen dengan Honda. Melalui contact center, konsumen bisa memperoleh informasi maupun solusi penanganan masalah produk dengan lebih cepat dan tepat. “Penghargaan ini semakin memotivasi kami untuk selalu memberikan pelayanan terbaik bagi masyarakat pecinta Honda di seluruh Indonesia”, ujar Istiyani Susriyati sesaat setelah menerima penghargaan di Hotel Mulia, Jakarta 3 April lalu. Yudi A. Yani, HC3 Manager Indako Trading Co, selaku main dealer Honda di Sumut mengungkapkan, pihaknya turut berbangga dengan prestasi yang diraih Honda dan kami juga ingin mengucapkan terima kasih yang sebesar-besarnya kepada

seluruh konsumen Honda atas kepecayaan dan kesetiaannya. Melalui penghargaan ini, semakin membuktikan bahwa Honda selalu mengutamakan kualitas pelayanan terbaik untuk pelanggannya. “Sebagai main dealer Honda di Sumut, kami juga akan terus berupaya memberikan pelayanan terbaik kepada pelanggan, karena kepercayaan yang telah di berikan oleh pelanggan setia Honda akan menjadi semangat bagi kami untuk mewujudkan senyum kepuasan pelanggan yang selalu menjadi hal utama bagi kami”, ujar Yudi A.Yani Contact Center Service Excellence Award 2014 dilakukan dengan metode mystery calling pada periode Juli sampai Desember 2013. Dalam menentukan contact center terbaik, dilakukan penilaian terhadap tiga unsur utama contact center, yaitu: Akses (accessibility, avail-

Waspada/Ist

General Manager Honda Customer Care Center AHM Istiyani Susriyati (kiri), menerima penghargaan Contact Center Service Excellence Award 2014 yang diserahkan CEO Carre CCSL Yuliana Agung di Hotel Mulia, Jakarta (3/4). ability, dan connection speed), lalu, dalam kompetisi Contact Sistem dan Prosedur (system, Center World Top World Rankenjoying, dan service standard ing Performance dengan meconsistency), serta Sumber Daya raih penghargaan kategori Best Manusia (soft dan hard skill). Technology Innovation (GOLD), Penghargaan untuk contact dan Best Operational Contact center Honda ini sekaligus me- Center (SILVER) November lengkapi prestasi yang sebelum- 2013 di Las Vegas, Nevada. nya dicetak Honda akhir tahun (adv/m47)

Teknologi Injeksi Tidak Rentan Baterai Soak Pengalihan dari system karburator menjadi injeksi ternyata menimbulkan banyak kekhawatiran bagi pengguna sepeda motor, terutama saat mengalami batre soak yang mengakibatkan sepeda motor tidak bias dihidupkan dengan cara apapun. Hal ini dijumpai pada teknologi injeksi beberapa type sepeda motor, bahkan sepeda motor bahkan sering tak disadari oleh penggunanya sehingga berakibat buruk saat baterai soak. Namun, LeoWijaya, General Manager Indako Trading Co, main dealer Honda di Sumut mengungkapkan, teknologi injeksi Honda PGM FI telah mengantisipasi segala kemungkinan terburuk tersebut agar para pecinta setianya tetap aman dan tidak mengalami kesulitan harus mendorong sepeda motornya untuk mencari bengkel terdekat. Honda sangat

memperhatikan kenyamanan penggunanya, tidak hanya menghadirkan sepeda motor dengan desain yang modern, namun Honda juga melengkapi dengan berbagai fitur teknologi yang memberi kenyamanan bagi konsumennya. “Salah satu keunggulan teknologi PGM FI Honda adalah terdapatnya kapasitor yang merupakan sebuah perangkat penyelamat yang akan menyimpan energy listrik untuk

kebutuhan menghidupkan kendaraan dengan hanya mengengkol/kick starter ketika batere soak. Hal ini membuktikan teknologi Injeksi Honda tidak perlu diragukan kecanggihannya karena khusus dirancang untuk memberikan kemudahan bagi penggunanya,” ungkap Leo Sementara itu Armayadie, selaku Technical Training Sub Dept Head Indako Trading Co, mengungkapkan Honda

menjadi solusi berkendara di era injeksi ini, kondisi batre soak tidak akan menyebabkan motor mati total, karena semua injeksi Honda sudah dilengkapi dengan kapasitor yang berfungsi menyimpan energy listrik. “Dengan teknologi injeksi PGM FI, pengguna Honda tidak perlu khawatir mendorong motor mencari bengkel karena kick starternya tidak berfungsi untuk menghidupkan motor seperti yang sering dijumpai pada beberapa type motor lain,” imbuh Armayadie “Misi Injeksi untuk menciptakan “Langit Biru untuk Indonesia” juga telah dituntaskan Honda dengan meluncurkan dua produk terbarunya New Honda Blade 125 FI dan New HondaVario FI. Untuk wilayah Sumut, misi ini tuntas pada 13 April di PRSU,” ujar Gunarko, Corporate & Marketing Communication Manager CV Indako. (adv/m47)

Keberhasilan Menyelesaikan Misi Honda Injeksi Launching New Blade 125 FI Dan New Vario FI Astra Honda Motor (AHM) sudah melengkapi semua model sepeda motor Honda dengan sistem injeksi PGM-FI, ditandai dengan peluncuran dua varian terbaru, yakni Honda Blade 125 cc dan New Honda Vario. Di Medan, peluncuran berlangsung Minggu (13/4) di Pekan Raya Sumatera Utara. Ini juga berarti, dalam kurun empat bulan pertama di 2014 ini saja, Honda meluncurkan enam model baru yang mengusung teknologi injeksi.

Enam varian tersebut adalah yaitu Honda Revo FI, Honda Ve r z a 1 5 0 , N e w H o n d a MegaPro FI, New Honda Supra X 125 FI. Dan yang lahir bersamaan Minggu kemarin, New Honda Blade 125 FI dan New Honda Vario FI sebagai puncak pemenuhan misi injeksi. Honda menyebut launching New Honda Blade 125FI dan New Honda Vario FI sebagai mission accomplished atau keberhasilan menyelesaikan misi injeksi, dalam mewujudkan

Waspada/Armansyah Th

Kehadiran varian Blade 125 dan New Vario (atas), merampungkan jajaran produk Honda yang kini semuanya telah memakai teknologi injeksi.

cita-cita “Langit Biru Untuk Indonesia”. Itu artinya, Honda telah juga menerapkan teknologi injeksi pada semua (total) 13 model lainnya, yakni CBR250R, CBR150R, CB150R Streetfire, PCX150, Verza 150, Supra X Helm In PGM FI,Vario 125 PGM FI, Spacy FI, All New BeAT FI, New Scoopy FI, New Revo FI, New MegaPro FI, dan New Supra X 125 FI. D i Ta n a h A i r, Ho n d a memulai misi penerapan injeksi

pada system bahan bakar pada akhir 2005, yakni pada varian Supra X 125 PGM FI, yang diperkenalkan pada Mei 2005. Selanjutnya, komitmen tersebut diperkuat dengan deklarasi yang dilakukan pada pada November 2011. Pada 2012, baru 30 persen produk Honda yang memakai injeksi. Namun di 2013, jumlah produk yang sudah memakai injeksi meningkat signifikan menjadi 70 persen, dan akhirnya dirampungkan di awal 2014.

Sebagai mana diutarakan Presdir AHM Toshiyuki Inuma, teknologi PGM-FI memberikan banyak keuntungan untuk konsumen. Pengeluaran konsumen dapat lebih dihemat karena konsumsi BBM motor Honda menjadi lebih hemat dan perawatan komponen PGM-FI Honda yang mudah dengan garansi 5 tahun. Hal ini, selain semakin meringankan beban konsumen, yang terpenting, konsumsi BBM yang lebih hemat ini juga mampu semakin menekan kadar CO2. Kadar emisi yang lebih rendah ini akan berkontribusi terhadap lingkungan yang lebih baik untuk

masyarakat Indonesia. “Dan dua produk baru berteknologi injeksi, New Honda Vario FI dan New Honda Blade 125 FI, bukan hanya sebagai penutup misi kami, tapi modelmodel ini juga memiliki daya tarik tersendiri. Kami sangat bangga dapat melengkapi misi kami melalui kedua model ini. Kami optimis model-model ini akan menjadi pilihan favorit konsumen Indonesia.” ujar Inuma Leo Wijaya, General Manager Indako Trading Co mengatakan, pihaknya sangat berbangga dapat turut menyelesaikan misi injeksi di Sumut. Misi

Honda tidak hanya dilakukan dengan mengembangkan produk baru saja, namun juga menyiapkan infrastruktur pendukung dan melatih para mekanik di jaringan bengkel resmi Honda atau AHASS dan mensosialisasikan secara aktif manfaat teknologi injeksi Honda terhadap masyarakat. ”Dengan sepeda motor teknologi PGM-FI, Honda ingin dapat menemani masyarakat beraktivitas dalam mewujudkan mimpinya, sekaligus bersamasama berkontribusi terhadap lingkungan yang lebih bersih. Terima kasih kepada masyarakat yang mempercayai produk

injeksi Honda. Kami akan melanjutkan komitmen untuk senantiasa memberikan produk dan layanan terbaik kami kepada masyarakat,” ujar LeoWijaya. Penerimaan positif masyarakat terhadap produkproduk injeksi Honda terus meningkat hingga saat ini. Sejak 2005 hingga Februari 2014, total penjualan sepeda motor injeksi Honda tercatat 5.648.700 unit atau 55% dari total pasar sepeda motor injeksi Nasional. Sementara, pada dua bulan pertama tahun ini, sepeda motor injeksi Honda telah terjual 666.072 unit atau memimpin 66,5% pasar sepeda motor injeksi 2014. Namun, Leo Wijaya, juga menambahkan, komitmen Honda tidak hanya menjual sepeda motor injeksi, karena AHM juga menata keseriusan dalam memberikan layanan purna jual. Honda siap melayani seluruh Indonesia. Karena, hingga Januari 2014, Honda telah siap melayani konsumen di seluruh Indonesia untuk produk-produk berteknologi injeksi melalui lebih dari 3.600 AHASS dan lebih dari 20.000 mekanik terlatih dan berpengalaman serta dukungan lebih dari 10.000 bengkel umum yang telah mendapat pelatihan khusus dari Honda. Selain itu, Honda juga telah memiliki lebihtujuh ribu toko suku cadang. (Arman Th)

Waspada,rabu 16 april 2014  
Read more
Read more
Similar to
Popular now
Just for you