Issuu on Google+

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

RABU, Pon, 11 September 2013/6 Zulqaidah 1434 H

No: 24337 Tahun Ke-67

Terbit 24 Halaman

Waspada/Surya Efendi

GUBSU Gatot Pujo Nugroho didampingi Wagubsu Erry Nuradi dan Plt Wali Kota Medan Dzulmi Eldin melepas keberangkatan jamaah calon haji Kloter I di KNIA, Selasa (10/9).

Bus Angkut Jamaah Haji Mogok

Doakan Sumut Kondusif MEDAN (Waspada): Gubsu H Gatot Pujo Nugroho melepas secara resmi pemberangkatan 440 Calhaj Kloter 1 Embarkasi Medan, Selasa (10/9) dari Aula Madinatul Hajj Asrama Haji Medan. Acara dihadiri Kepala Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara Drs H Abd Rahim MHum, Kepala Kantor Kementerian Agama Kota Medan Iwan Zulhami, Ketua MUI Sumut Prof Abdullah Syah, MA, anggota DPDRI Prof Darmayanti Lubis dan anggota DPD Parlindungan Purba, Komisi VIII DPRRI Plt Wali Kota Medan Dzulmi Eldin, serta stakeholder yang mendukung pelaksanaan pemberangkatan haji Embarkasi Medan. Lanjut ke hal A2 kol. 4

MEDAN (Waspada): Satu unit bus yang mengangkut jamaah calon haji Kloter I embarkasi Medan mogok di tengah jalan, Selasa (10/9). Akibatnya jamaah calon haji yang berada di dalam bus mogok tersebut panik dan terpisah dari iring-iringan. Pantauan Wapada, satu unit bus yang mengangkut jamaah calon haji tersebut mogok persis di jalan lintas Medan – Tanjung Morawa. Satu persatu jamaah turun dengan menjinjing tas masing-masing untuk kemudian berjalan menaiki bus cadangan. Iring-iringan bus ini berangkat dari Asrama Haji Pangkalan Masyhur Medan menuju KNIA). Belum diketahui secara persis penyebab mogoknya bus tersebut dan peristiwa itu tidak sampai meng-ganggu jadwal keberang-katan jamaah calon haji Kloter I Waspada/Surya Efendi ini.(m46)

SEJUMLAH calon jamaah haji Kloter I turun dari bus yang mogok di tengah jalan lintas Medan – Tanjung Morawa, Selasa (10/9).

Pesawat Haji Kloter I Medan Alami Gangguan

40 Menit Terbang Kembali Ke KNIA MEDAN (Waspada): Pesawat haji Kloter I asal Medan, yang sempat mengudara dari Kualanamu International Airport (KNIA) sekira 40 menit, Selasa (10/9) terpaksa kembali mendarat (return to base) pukul 15:17, akibat gangguan pada kran air.

Pesawat Garuda yang membawa 455 jamaah calon

haji Medan, Embarkasi Medan terbang sesuai jadwal dari

KNIA, yakni pukul 13:45. Namun, 40 menit mengudara, pesawat mengalami gangguan, air dari kran di pesawat tidak mengucur. Setelah berkoordinasi dengan pihak Garuda, akhirnya pilot kembali mendaratkan pesawat di KNIA sekira

pukul 15:17. ‘’Air tidak bisa keluar dari kran yang ada di pesawat, bukan karena air tidak tersedia di pesawat,’’ kata Pujobroto, VP Coorporate Comunication PT Garuda Indonesia di Jakarta saat dikonfirmasi via telepon selular, Selasa (10/9) malam.

Dia membenarkan, pesawat Boeing 777-300 ER Garuda Indonesia yang dicharter dari penerbangan Austral Air Perancis berangkat lebih awal yaitu pukul 13:49. Pesawat sudah sempat mengudara 40 menit, balik lagi ke apron KNIA, karena ada gangguan

pada kran air. Tapi, kata Pujobroto, karena pesawat sempat mengudara lebih kurang 40 menit, terpaksa ganti Kapt. Pilot. Peraturannya Kapten Pilot yang melebihi jam terbang dari 8 jam dari Medan tujuan Jeddah, tidak boleh terbang, harus

dicari Kapt. Pilot Pengganti. Namun, saat dikonfirmasi berikutnya pukul 18:15, Pujobroto mengatakan, Kapt. Pilot pengganti sudah stand by di KNIA. “Sebentar lagi pesawat haji Kloter I akan berangkat ke tanah suci,” ujarnya dan memastikan, jamaah Kloter

berikutnya dari Embarkasi Medan tidak bakal terganggu berangkat. Koordinasi Salah seorang Co Pilot pesawat maskapai dalam negeri dan luar negeri, Eko Septiadi

Lanjut ke hal A2 kol. 3

Akhirnya Take Off Lepas Maghrib

Antara

WORLD MUSLIMAH 2013: Sejumlah finalis World Muslimah meghadiri konferensi pers jelang grand final penganugerahan 3rd Annual Award World Muslimah 2013 di Jakarta, Selasa, (10/9). Ajang World Muslimah 2013 yang di ikuti perempuan muslim dari Indonesia, Malasyia, Brunei Darussalam, Bangladesh, Nigeria, dan Iran tersebut akan diselenggarakan di Balai Sarbini pada 18 September 2013.

KUALANAMU, Deliserdang (Waspada): Pesawat Garuda yang membawa 455 jamaah calon haji Kloter I dan sempat kembali ke Bandara setelah terbang selama 40 menit, akhirnya terbang (take off) kembali pukul 18:47 (selepas maghrib). Informasi Waspada peroleh di KNIA, peristiwa tak terduga itu diketahui sekira pukul 14:30 usai pesawat Boeing 777-300ER milik Air Austrar Reunion Island Perancis, yang dicarter maskapai Garuda Indonesia Airways, take off dari KNIA pukul 13:45. Namun, 40 menit kemudian pilot pesawat mendaratkan kembali pesawat buatan tahun 2009, itu tepat pukul 15:17. “ Informasi dari operator, pesawat kembali mendarat karena ada kerusakan pada kran air. Dikhawatirkan mampetnya air akan mengganggu kenyamanan 455 jamaah. Bayangkan 8 jam penerbangan jika air tidak ada, ini bisa berakibat fatal.Pilot memutuskan untuk kembali ke pangkalan ,” ujar Airport Service Manager Ali Shopian kepada Waspada di Apron KNIA. Pantauan Waspada, proses awal keberangkatan haji Kloter I berlangsung lancar.Para jamaah masuk dari terminal kargo menggunakan beberapa bus pariwisata. Sementara, Gubsu H Gatot Pudjo Nugroho didampingi Pangdam I Bukit Barisan Mayjen Burhanuddin Siagian dan Kajatisu memberikan pengarahan kepada 440 Calhaj di dalam pesawat menjelang take off sesuai jadwal 13:45. (m16)

Senat Tunda Pemungutan Suara Serang Syria Sampai Hari Ini

Kasus Dugaan Korupsi

Kejari Stabat Periksa 6 Anggota DPRD Dan 2 Mantan Manager PTPN II

Syria Serahkan Senjata Kimia Ke PBB WASHINGTON, DC (Waspada): Ketua Mayoritas Senat Harry Reid, Senin waktu AS atau Selasa (10/9) pagi WIB, mengungkapkan, dia menunda pemungutan suara untuk mengesahkan penggunaan kekuatan militer di Syria hingga Rabu ini. Obama bertemu dengan para senator Selasa waktu AS, dan menyampaikan pidato nasional Selasa malam. Namun, Reid menyatakan sebe-

lumnya, pemungutan suara untuk serangan ke Mesir itu dilangsungkan Rabu ini. Sementara itu, masyarakat Amerika sangat menentang campur tangan tentara negara itu terhadap Syria, meskipun sebagian besar percaya, Presiden Bashar Assad menyerang rakyatnya dengan gas, demikian kesimpulan sebuah survei yang diumumkan Senin. Jejak pendapat CNN/ORC Internasional menemukan 59

Al Bayan

Miss Akhirat Oleh Tgk. H. Ameer Hamzah

Dan di dalam Surga itu ada bidadari-bidadari yang bermata jeli. Sesungguhnya Kami ciptakan mereka (bidadari-bidadari) dengan langsung. (QS.56:22 dan 35). MERAIH prediket Miss World adalah mudah kalau dibandingkan dengan meraih predikat Miss Akhirat. Miss World jurinya manusia yang sering bisa memilih mana yang mereka sukai. Mungkin faktor, kecantikan, kecerdasan dan moral sangat diutamakan, faktor hawa nafsu sang juri juga tak terlepas dari penilaian. Sedangkan juri Miss Akhirat hanya Allah SWT. Almarhum Prof Dr. Syeikh Mutawalli Asy-Syakrawi, ulama Mesir menyebutkan, Miss World adalah manifestasi dari keberhasilan iblis menggoda anak Adam.

Lanjut ke hal A2 kol. 6

persen dari 1.022 petanggap dewasa mengatakan Kongres seharusnya tidak meluluskan resolusi kewenangan, bahkan aksi militer terbatas terhadap Syria. Sementara itu jajak pendapat terpisah terhadap anggota parlemen oleh USA Today menemukan, Obama berhadapan tugas sulit dari Gedung Parlemen. Hanya sebagian

Lanjut ke hal A2 kol. 3

Longsor Di Dairi, Seorang Tewas, Puluhan Luka SIDIKALANG (Waspada): Satu orang tewas dan puluhan orang lainnya menderita luka berat dan ringan ketika longsor akibat hujan deras melanda Dusun Laemariah, Desa Laeluhung, Kec. Siempat Nempu Hilir , Kab. Dairi, Senin (9/9) sore. Korban tewas, Rosmin Br Lumbangaol,60. Korban tertimbun material tanah.Selain itu, puluhan orang warga mengalami luka-luka berat ringan, kini mendapat perawatan di Puskesmas setempat. Dalam kasus itu, empat rumah tertimbun longsor.

Lanjut ke hal A2 kol. 1

Waspada/Rizaldi Anwar

PESAWAT B 777-300ER yang membawa 440 haji Kloter I Embarkasi Medan sedang diperiksa oleh petugas terkait kelaikan terbang (take off ) kemarin.

Waspada/Anum Purba

Puluhan Tahun Menabung Akhirnya Kak Yus Berhaji MENGUMPULKAN uang dari usaha berjualan nasi selama puluhan tahun, akhirnya bisa mengantarkan pasangan Yusnida Tanjung, 53, dan Edi Sandi, 61, yang membuka warung nasi di pinggiran rel Jl. Ani Idrus (Jl. Pandu) Medan berangkat haji. Warung Kak Yus di pinggiran rel, memang menjadi tempat makan favorit warga Medan. Selain harga terjangkau, menunya juga akrab di lidah, sehingga setiap siang tempat itu selalu ramai dibanjiri konsumen. Bersama rombongan Calhaj Kloter 1 yang berangkat Selasa (10/9), Yusnida nampak sangat bahagia.Apalagi bisa berangkat bersama suaminya. “Alhamdulillah. Impian saya dan suami untuk menunaikan rukun Islam kelima akhirnya tercapai, bahkan bisa berangkat berdua. Sejak kecil saya mendambakan bisa melaksanakan ibadah haji, dan baru kini tercapai,”kata Yus yang warung nasinya dikenal karena kepala ikan gulai dan ikan bakar. Dia menambahkan, berniat melaksanakan ibadah haji harus diimbangi dengan kesungguhan untuk menabung dari penghasilan berjualan setiap hari. Awalnya hanya seribu dua ribu, tapi semakin hari terus ditingkatkan. Setiap hari harus ada celengan khusus untuk haji. Dengan kewajiban menabung itulah, terkumpul sampai cukup untuk membayar setoran awal. Lanjut ke hal A2 kol. 6 7

STABAT (Waspada): Kejari Stabat memeriksa enam anggota dewan terkait kasus dugaan korupsi dana perjalanan dinas anggota DPRD Langkat tahun anggaran 2012-2013 senilai Rp27 miliar. Kajari Stabat Hendri, SH, melalui Kasi Pidsus Ricardo Marpaung, Selasa (10/9) menyebutkan, enam anggota DPRD yang memiliki jadwal diperiksa yakni Tarsan Naibaho (PDK), Edi Bahagia (Fraksi

Golkar), dua politisi Partai Demokrat Ade Khairina Syahputri dan Neddy S, Hasan Basri (PAN) dan Riska Purnawan (Hanura). Dari nama-nama tersebut, dua diantaranya sudah diperiksa Senin (9/9), dua kemarin, dan selebihnya diperiksa Rabu (11/9) sebagai saksi. “Jadi satu hari ada dua orang yang diperiksa untuk jadwal saat ini,” kata Ricardo. Dalam kasus tersebut penyidik masih menetapkan dua ter-

Kasus Dul, KPAI Minta Aparat Gunakan UU PA JAKARTA (Waspada): Komisi Nasional Perlindungan Anak Indonesia (KPAI) menyatakan penting bagi aparat hukum untuk mengacu pada Undang-Undang Perlindungan Anak (UU PA) dalam menangani kasus tabrakan maut yang menjadikan Abdul Qadir Jaelani alias Dul, putra bungsu musikus Ahmad Dhani, sebagai tersangka. Dul yang masih berusia 13 tahun dapat dipidana tapi tetap mengedepankan hak-haknya sebagai anak. Di sisi lain, KPAI juga menyayangkan pernyataan anggota Komisi Kepolisian Nasional (Kompolnas), Adrianus Meliala yang menyatakan penanganan hukum Dul tidak te-

pat bila menggunakan Undang-Undang Perlindungan Anak (UU PA) Nomor 23/2002. “Pernyataan yang disampaikan oleh anggota Kompolnas ini cenderung menyesatkan publik. Diharapkan aparat penegak hukum tidak terpengaruh karena UU Perlindungan Anak dapat diterapkan untuk seluruh kasus yang terkait dengan anak yang berhadapan dengan hukum baik pelanggaran ringan maupun pelanggaran berat seperi pembunuhan, narkoba, perkosaan, pidana lalu lintas dan sebagainya,” kata Kepala Divisi Pengawasan KPAI, M Ihsan di Jakarta, Selasa (10/9). Lanjut ke hal A2 kol. 7

sangka yakni Sekwan SL , dan mantan Sekwan SU. Sekwan telah mengembalikan uang Rp400 juta kepada penyidik dalam dua tahap sebelumnya. Diperoleh informasi penyidik sangat teliti memeriksa para anggota dewan dalam kasus tersebut karena banyak item-item seputar perjalanan dinas yang harus ditanyakan disesuaikan dengan data keberangkatannya. Lanjut ke hal A2 kol. 3

Ada-ada Saja Ingin Mirip Superman INGIN terlihat seperti Superman, pria ini melakukan 19 kali operasi plastik agar bisa mirip dengan tokoh superhero itu.

Lanjut ke hal A2 kol. 2

Serampang - Sabar ya wak? - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) RABU, Pon, 11 September 2013/6 Zulqaidah 1434 H

z zNo: 24337 * Tahun Ke-67

Terbit 24 Halaman

Waspada/Surya Efendi

GUBSU Gatot Pujo Nugroho didampingi Wagubsu Erry Nuradi dan Plt Wali Kota Medan Dzulmi Eldin melepas keberangkatan jamaah calon haji Kloter I di Kualanamu International Airport, Selasa (10/9).

Bus Angkut Jamaah Haji Mogok

Gubsu Lepas Calhaj Kloter 1

MEDAN ( Waspada): Satu unit bus yang mengangkut jamaah calon haji Kloter I embarkasi Medan mogok di tengah jalan, Selasa (10/9). Akibatnya jamaah calon haji yang berada di dalam bus mogok tersebut panik dan terpisah dari iring-iringan. Pantauan Wapada, satu unit bus yang mengangkut jamaah calon haji tersebut mogok persis di jalan lintas Medan – Tanjung Morawa. Satu persatu jamaah turun dengan menjinjing tas masing-masing untuk kemudian berjalan menaiki bus cadangan. Iring-iringan bus ini berangkat dari Asrama Haji Pangkalan Masyhur Medan menuju Kualanamu International Airport (KNIA). Belum diketahui secara persis penyebab mogoknya bus tersebut dan peristiwa itu tidak sampai mengganggu jadwal keberangkatan jamaah calon haji Kloter I ini. (m46)

MEDAN ( Waspada): Gubsu H Gatot Pujo Nugroho melepas secara resmi pemberangkatan 440 calon jamaah haji (Calhaj) Kloter 1 Embarkasi Medan, Selasa (10/9) dari Aula Madinatul Hajj Asrama Haji Medan. Acara dihadiri Kepala Kantor Kementerian Agama Wilayah Provinsi Sumatera Utara Drs H Abd Rahim MHum, Kepala Kantor Kementerian Agama Kota Medan Iwan Zulhami, Ketua MUI Sumut Prof Abdulah Syah MA, anggota DPDRI Prof Darmayanti Lubis dan anggota DPD Parlindungan Purba, Komisi VIII DPRRI Plt Wali Kota Medan Dzulmi Eldin, Lanjut ke hal A2 kol 6

Waspada/Surya Efendi

SEJUMLAH calon jamaah haji Kloter I turun dari bus yang mogok di tengah jalan lintas Medan – Tanjung Morawa, Selasa (10/9).

40 Menit Terbang Kembali Ke KNIA MEDAN (Waspada) : Pesawat Garuda Indonesia yang membawa 455 jamaah haji kelompok terbang (Kloter) I asal Medan, balik lagi atau return to base (RTB) ke Kualanamu International Airpot akibat gangguan teknis, yakni kran air di pesawat tidak dapat dibuka. “Air tidak bisa keluar dari kran yang ada di pesawat, bukan karena air tidak tersedia di pesawat,’’ kata Pujobroto, VP Coorporate Comunication PT Garuda Indonesia di Jakarta saat

Pesawat Haji Kloter 1 Medan Alami Gangguan dikonfirmasi via telepon selular, Selasa (10/9) malam. Pesawat akhirnya kembali take off pukul 18:47. Dia membenarkan, pesawat Boeing 777-300 ER Garuda

Indonesia yang dicharter dari penerbangan Austral Air Perancis berangkat lebih awal yaitu pukul 13.49. Pesawat sudah sempat mengudara 40 menit, balik lagi ke apron

KNIA, karena ada gangguan pada kran air. “Sudah diperbaiki dan mudah-mudahan jamaah Kloter berikutnya juga tidak bakal terganggu,” kata Pujo-

broto. Tapi, kata Pujobroto, karena pesawat sempat mengudara lebih kurang 40 menit, terpaksa ganti Kapt. Pilot. Peraturannya Kapten Pilot

yang melebihi jam terbang dari 8 jam tujuan Jeddah, tidak boleh terbang, harus dicari Kapt. Pilot Pengganti. Namun, saat dikonfirmasi ber ikutnya pukul 18:15, Pujobroto mengatakan, Kapt. Pilot pengganti sudah stand by di KNIA. “Sebentar lagi pesawat haji Kloter I akan be-

rangkat ke tanah suci,” ujarnya dan memastikan, jamaah Kloter berikutnya dari Embarkasi Medan tidak bakal terganggu berangkat. “Mudah-mudahan tidak terganggu, pesawat Kloter I sudah siap-siap berangkat Lanjut ke hal A2 kol 6

Pembahasan KUA-PPAS Ricuh, Meja Dijungkirbalikkan KUALASIMPANG (Waspada): Pembahasan Kebijakan Umum Anggaran Pendapatan dan Belanja Kabupaten (APBK) Aceh Tamiang-Prioritas Plafon Anggaran Sementara (PPAS) tentang bantuan sosial dan hibah yang dibahas Tim Anggaran Pemerintah Daerah bersama Tim Badan Anggaran (Banggar) DPRK, di gedung DPRK Aceh Tamiang, ricuh. Akibatnya meja jungkir balik dan gelas-gelas berpecahan. Informasi dihimpun Waspada, Selasa (10/9), puncak kericuhan terjadi di ruang Banggar DPRK Aceh Tamiang , ketika pihak legislatif duduk bareng membahas bantuan sosial (Bansos) dan hibah TA 2013 yang sempat dipending Pemkab Aceh Tamiang. Selanjutnya soal Bansos dan Belanja Hibah tersebut dibahas pada KUA-PPAS untuk APBK-Perubahan 2013. Dari pihak eksekutif dihadiri Wakil Bupati Aceh Tamiang Iskandar Zulkarnain, Kabag Kesra Setdakab Aceh Tamiang Patria Kelana, Kadis Sosial,Tenaga Kerja dan Transmigrasi Aceh Tamiang Basyaruddin, Ka.Bappeda Aceh Tamiang T Hayatul Lanjut ke hal A2 kol 6

Kasus Dul, KPAI Minta Wagubsu Serahkan Jenazah Terakhir Aparat Gunakan UU PA Longsor Di Dairi, 1 Orang Musibah Kapal Karam Di Pulau Telo Tewas Dan Puluhan Luka-luka Waspada/Surya Efendi

Waspada/Natar Manalu

WAGUBSU HT Erry Nuradi didampingi Sekda H Nurdin Lubis menyerahkan jenazah Sutrisno kepada pihak keluarga di Pangkalan Udara Lanud Suwondo, Selasa (10/9).

MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara menyerahkan jenazah terakhir Pegawai Negeri Sipil (PNS), korban karamnya kapal Tim Penilai Kecamatan Terbaik di perairan Nias Selatan. Jenazah atas nama Sutrisno, 55, diserahkan Wagubsu HT Erry Nuradi, kepada keluarganya saat tiba di Pangkalan Udara Lanud Suwondo Medan, Selasa (10/9) sore. Tangis duka para keluarga mewarnai prosesi serah terima

yang berlangsung dalam sebuah upacara yang penuh hikmad. Wagubsu HT Erry Nuradi, yang memimpin upacara penyerahan juga menyerahkan salinan kenaikan pangkat satu tingkat secara anumerta kepada almarhum, seperti tiga jenazah PNS Pemprovsu sebelumnya. Jenazah PNS Pemprovsu yang dibawa helikopter Basarnas tiba di Pangkalan Lanud Suwendo sekitar pukul 14:50,

Al Bayan

Miss Akhirat Oleh: H Ameer Hamsah Dan di dalam Surga itu ada Bidadari-bidadari yang bermata jeli. Sesungguhnya Kami ciptakan mereka (bidadari-bidadari) dengan langsung. (QS.56:22 dan 35) MERAIH prediket Miss Word adalah mudah kalau dibandingkan dengan meraih predikat Miss Akhirat. Miss Word Jurinya manusia yang sering bias memilih mana yang mereka sukai. Mungkjin faktor, kecantikan, kecerdasan dan moral sangat diutamakan, faktor hawa nafsu sang juri juga tak terlepas dari penilaian. Sedangkan juri Miss Akhirat hanya Allah SWT. Almarhum Prof Dr. Syeikh Mutawalli Asy-Syakrawi, ulama Mesir menyebutkan; Miss Word adalah manifestasi dari keberhasilan iblis menggoda anak Adam. Dalam ajaran Islam event itu sangat diharamkan. Dalam Islam perempuan mendapat tempat yang

Lanjut ke hal A2 kol 2

SALAH satu titik akses jalan menuju Dusun Laemeriah,Desa Laeluhung tertimbun tanah longsor bercampur batubatuan dan pohon sepanjang lebih kurang 40 meter,membuat desa itu terisolasi.

disambut Sekdaprovsu H Nurdin Lubsi, SH, MM, keluarga dan beberapa pejabat Eselon II, Eselon III dan PNS Pemprovsu. Wagubsu mengatakan Pemprovsu sangat berduka dengan kepergian almarhum Sutrisno, PNS Biro Pemerintahan Setdaprovsu. Almarhum adalah salah satu korban dari empat orang PNS Pemprovsu yang mengalami musibah saat

JAKARTA (Waspada): Komisi Nasional Perlindungan Anak Indonesia (KPAI) menyatakan penting bagi aparat hukum untuk mengacu pada Undang-Undang Perlindungan Anak (UU PA) dalam menangani kasus tabrakan maut yang menjadikan Abdul Qadir Jaelani alias Dul, putra bungsu musikus Ahmad Dhani, sebagai tersangka. Dul yang masih berusia 13 tahun dapat dipidana tapi tetap mengedepankan hak-haknya sebagai anak. Di sisi lain, KPAI juga menyayangkan pernyataan Angota Komisi Kepolisian Nasional (Kompolnas), Adrianus Meliala yang menyatakan penanganan hukum Dul tidak tepat bila menggunakan Undang-Undang Perlindungan Anak (UU PA) Nomor 23/2002. “Pernyataan yang disampaikan oleh anggota Kompolnas ini cenderung menyesatkan publik. Diharapkan aparat penegak hukum tidak terpengaruh karena UU Perlindungan Anak dapat diterapkan untuk seluruh kasus yang terkait dengan anak yang berhadapan dengan hukum baik pelanggaran ringan maupun

Lanjut ke hal A2 kol 5

Lanjut ke hal A2 kol 2

SIDIKALANG (Waspada): Satu orang tewas dan puluhan orang lainnya menderita luka berat dan ringan ketika longsor akibat hujan deras melanda Dusun Laemar iah, Desa Laeluhung, Kec. Siempat Nempu Hilir , Kab.Dairi,Senin (9/9) sore. Korban tewas, Rosmin Br Lumbangaol,60. Korban tertimbun material tanah.Selain itu, puluhan orang warga mengalami luka-luka berat ringan, kini mendapat pera-

watan di Puskesmas setempat. Dalam kasus itu, empat rumah tertimbun longsor. Rosdiawan Br Bako, kerabat korban kepada wartawan, Selasa (10/9) di lokasi mengatakan, saat banjir bandang terjadi , korban bersama suaminya Rajumin Simaremare berada didalam rumah bersama seorang cucu mereka yang masih kelas IV SD. Tibatiba tumpukan material tanah serta bebatuan dan kayu besar menghantam rumah korban

Akhirnya Tabungan Kak Yus Cukup Untuk Berhaji

Diserang Anak Punk, 1 Tewas 1 Luka Berat

MENGUMPULKAN uang dari usaha berjualan nasi selama puluhan tahun, akhirnya bisa mengantarkan pasangan Yusnida Tanjung, 53 dan Edi Sandi, 61 (foto) yang sehari-hari berjualan nasi di Jln Ani Idrus/Pandu Medan atau yang lebih dikenal dengan Warung Kak Yus pinggir rel berangkat haji. Warung Kak Yus di pinggiran rel, memang menjadi tempat makan favorit warga Medan, setiap siang tempat itu selalu ramai yang menyediakan aneka makanan seperti ikan gulai dan ikan panggang. Rasanya yang enak, menjadikan warung Kak Yus seolah tempat makan yang jadi idola. Bersama rombongan Calhaj kloter 1 yang berangkat, Selasa (10/9), Yusnida nampak sangat bahagia, apalagi bisa berangkat dengan suaminya. “Alhamdulillah impian saya dan suami untuk menunaikan rukun Islam kelima akhirnya tercapai, bahkan bisa bersama dengan suami.

PEMATANGSIANTAR (Waspada): Dua pemuda asal Kab. Nias diserang tujuh anak punk, mengakibatkan satu tewas dan satu lainnya luka berat. Informasi dihimpun Waspada, Selasa (10/9), korban tewas Joni Gea, 21, pekerja ru-mah makan, kos di Jl. Diponegoro, Gang Kopral, Kel. Simalungun, Kec. Siantar Barat, Kota Pematangsiantar.Satu luka berat, Jepri Zebua, 20, pekerja rumah makan, kos di Jl. Cipto, Kel. Simalungun. Pantauan Waspada, peristiwa yang sempat membuat macat Jl. Sutomo, Kel. Dwikora, Kec. Siantar Barat terjadi di depan toko kain Serba Indah, Senin (9/ 9) pukul 17:30. Teman korban, Vicky Dachi, 20, menyebut-kan, penyerangan berawal di lantai III Pasar Horas ketika keduanya sedang berjalan-jalan dan bertemu

Lanjut ke hal A2 kol 6

Lanjut ke hal A2 kol 2

yang tepat berada di kaki bukit di dusun tersebut. Korban bersama suami terseret longsor sejauh 50 meter dari lokasi kejadian. Namun, Korban ditemukan tewas pada pukul 20.00. Sedangkan suami dan cucu korban serta tetangga mereka mengalami luka –luka. Pantauan Waspada di lapangan, terdapat sekitar 30 titik tumpukan tanah longsor Lanjut ke hal A2 kol 5

Ada-ada Saja

Ingin Mirip Superman

INGIN terlihat seperti Superman, pria ini melakukan 19 kali operasi plastik agar bisa mirip dengan tokoh superhero itu. Pria asal Filipina bernama Herbert Chavez rela menghabiskan uang sebesar 4.400 Lanjut ke hal A2 kol 5

Waspada/Edoard Sinaga

SEORANG anak punk, An, 25, warga Jl. Mangga, Kel. Pardamean, Kec. Siantar Timur, yang ditangkap dalam kasus dugaan pembunuhan dan penganiayaan terhadap dua pemuda asal Nias saat dibawa ke SPKT Mapolres Senin (9/9).

Serampang - Perbanyak sabar .... - He.... he....he....


Berita Utama

A2 Angkot Kontra Kereta, Satu Tewas P.SIDIMPUAN (Waspada): Tabrakan mobil angkutan umum (Angkot) 02 BB 1451 FA trayek Pasar SidimpuanPijorkoling dengan kereta Astrea Grand BB 4722 FD di Jalinsum Kel.Sihitang, Kec. Padangsidimpuan Teng-gara, Selasa (10/9) pagi, mengakibatkan satu orang tewas. Korban tewas, Dede Hotmartua Tamba,21. Polresta Padangsidimpuan yang dikonfir masi Waspada/Ahmad Cerem Meha SATU mobil angkutan umum melalui Kanit Laka Aiptu TM Sitepu, membenarkan adanya (Angkot) 02 BB 1451 FA trayek Pasar Sidimpuan-Pijorkaling kejadian tersebut. “Setelah mendapat lata bra k a n d en g a n kereta menyebabkan satu orang poran dari warga, kami langsung menuju lokasi kejadian tewas Selasa(10/9). untuk cek TKP, membawa bukti satu kenderaan roda empat (Angkot) milik Hendri,35, dan kereta Honda Astrea Grand’’ujarnya. (c13)

Maling Sikat Uang Jamaah Sedang Shalat STABAT ( Waspada): FS, 27, warga Tanjung Jati, Kota Binjai babakbelur diamuk massa setelah tertangkap tangan mengambil tas jamaah yang sedang shalat di Masjid Nurul Huda Kel. Perdamaian Stabat, Langkat,Senin (9/9) malam. Informasi dihimpun Waspada, saat itu pelaku berpurapura shalat di belakang korban. Pada rakaat kedua saat sujud, FS beraksi dengan membawa kabur tas berisi uang Rp26 juta yang diletakkan di samping korban. Arianto, 27, warga Karang Gading , Kec. Secanggang Kab. Langkat. Sadar tasnya hilang, korban membatalkan shalatnya dan mengejar pelaku. Saat itu FS berusaha menghidupkan mesin Honda Legenda BK 4512 GE untuk kabur , namun tidak berhasil. Korban langsung berteriak maling dan mengundang perhatian massa.Tanpa dikomando, massa membabakbelurkan tersangka. Aparat Polsek Stabat yang tiba di lokasi segera membawa tersangka ke komando. Kapolsek Stabat AKP Zulkarnen , yang dikonfirmasi menuturkan pelaku masih di sel untuk pengembangan lebih lanjut. (a03)

Menag: Hati-hati Saat Tawaf JAKARTA (Waspada): Menteri Agama Suryadharma Ali berpesan kepada jamaah calon haji agar berhati-hati saat menjalankan ibadah tawaf karena sedang ada perbaikan di sekitar Kabah. “Tawaf akan terkonsentrasi di lantai satu. Jamaah harus hati-hati karena akan jauh lebih padat dari tahun-tahun sebelumnya,” kata Menag saat melepas jamaah kloter pertama embarkasi Jakarta di Asrama Haji Pondok Gede, Jakarta, Selasa (10/90 pagi. Ia mengatakan, akibat perbaikan, area tawaf yang biasanya mampu menampung jamaah sekitar 48.000 orang per jam berkurang sekitar 60 persen menjadi hanya 22.000 per jam. “Pimpinan Kelompok Bimbingan Ibadah Haji (KBIH) termasuk jamaah supaya

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bf8+, GxB. 2. Gg5+, Ge7. 3. GxG+, RxG. 4. Mf7+, Rd8. 5. Mf8+mat. Jawaban TTS: TTS

Kesehatan

disiplin dalam melaksanakan tawaf, karena akan berdesakdesakan sekali. Khawatir ada apa-apa,” katanya. Menag mengingatkan agar jamaah haji mewaspadai tindak kejahatan di Tanah Suci, dan tidak terlalu mengkhawatirkan virus Corona.

Kasus Dul ....

pelanggaran berat seperi pembunuhan, narkoba, perkosaan, pidana lalu lintas dan sebagainya,” kata Kepala Divisi Pengawasan KPAI, M Ihsan di Jakarta, Selasa (10/9). Sebelumnya, kriminolog dan anggota Kompolnas, Adrianus Meliala mengatakan bahwa UU Perlindungan anak lebih tepat digunakan kepada anak yang berbuat suatu tindak pidana karena dijerumuskan seperti mencuri, menjual minuman keras, dan sebagainya. Oleh karena itu, perbuatan Dul yang mengemudi tanpa SIM dan menewaskan banyak orang tidaklah berkaitan dengan UU Perlindungan Anak melainkan hukum pidana terkait lalu lintas. Dikatakan Ihsan, dalam kasus kecelakaan maut

Diserang Anak Punk ....

Mendapat serangan dari tujuh anak punk, kedua korban melarikan diri hingga ke Jl. Sutomo.Namun, mereka berhasil mencegat kedua korban di tempat kejadian. Dan, salah seorang anak punk menusuk perut Jepri Zebua dua kali menggunakan pisau lipat besi putih.Setelah itu, pelaku menikam perut Joni Gea tiga kali. Korban sempat melakukan perlawanan dengan mengayun-ayunkan broti di tangannya. Namun, tubuh korban semakin lemah.Darah mengucur dari lukanya. Dan, Joni Gea rebah di atas genangan darahnya di depan

Al Bayan ....

Jawaban Sudoku:

1 8 7 5 6 9 2 3 4

4 5 3 2 7 8 9 1 6

9 6 2 4 1 3 7 5 8

3 4 6 7 9 5 1 8 2

5 7 9 8 2 1 4 6 3

8 2 1 3 4 6 5 7 9

7 3 4 6 5 2 8 9 1

6 1 5 9 8 4 3 2 7

2 9 8 1 3 7 6 4 5

sangat terhormat. Allah telah mewjibkan suami membayar mahar, mencari nafkah, dan tinggal di rumah sebagai makhluk terhormat. Dalam Islam Haram bagi perempuan berbicara yang menggoda, melenggak-lenggok di depan umum, juga haram membuka aurat. Barang siapa yang melanggar ketentuan ini akan bedosa besar. Muslimah sejati tidak mau membuka auratnya. Negaranegara Islam melarang Miss Word, sebaliknya negaranegara sekuler bahkan turut membiayainya. Dari Alquran dan hadis kita temukan ada Miss Akhirat (Hurrun Aini) yang dalam bahasa Indonesia disebut bidadari. Dara-dara cantik akhirat ini disediakan Allah SWT untuk para syuhada, mukmin sejati dari pemeluk agama

24 Calon DPD Sumut, Nomor Urut Dihapus MEDAN (Waspada): Komisi Pemilihan Umum (KPU) RI menetapkan 24 nama calon Dewan Perwakilan Daerah (DPD) utusan Sumatera Utara. Penetapan 24 nama tersebut tertuang dalam Surat Keputusan KPU No: 679/KPS/ KPU/Tahun 2013. Hal itu dibenarkan Kabag Hukum dan Perundang-undangan KPU Sumut Maruli Pasaribu, SH, yang dihubungi di ruang

kerjanya, Selasa, (10/9). Na m u n , k a t a M ar u l i , sesuai surat yang mereka terima, untuk Pemilu 2014 khusus DPD tidak ada lagi nomor urut melainkan nama dan foto calon dan disusun sesuai abjad. Sedangkan penetapan daftar calon tetap (DCT) DPD merupakan kewenangan KPU RI berdasarkan abjad sesuai PKPU No. 14 perubahan atas

PKPU No. 8/2013. “Ke 24 calon anggota DPD itu dinyatakan lulus dan masuk dalam DCT. Namun, dalam pengumuman itu, KPU tidak menyebutkan nomor urut calon melainkan disusun sesuai abjad,”kata Maruli dan menambahkan, KPU Sumut sudah menyerahkan dan membagikan hasil putusan itu ke masing-masing calon DPD. (m34)

Senat Tunda Pemungutan Suara Damaskus Siap Serahkan Senjata Kimia Kepada PBB WA S H I N G T O N , D C (Waspada): Ketua Mayoritas Senat Harry Reid, Senin waktu AS atau Selasa (10/9) pagi WIB, mengungkapkan, dia menunda pemungutan suara untuk mengesahkan penggunaan kekuatan militer di Syria sampai Presiden Barack Obama menyampaikan soal ini langsung ke publik. Berbagai perkembangan di AS, Syria dan dunia internasional tidak ada yang mendukung rencana serangan militer AS ke Syria. Perkembangan itu membuat Presiden Obama ‘loyo’ dan tak dapat membela rencananya itu. Obama bertemu dengan para senator Selasa waktu AS, dan menyampaikan pidato nasional Selasa malam. Namun, Reid menyatakan sebelumnya, pemungutan suara untuk serangan ke Mesir itu dilangsungkan Rabu nanti. Sementara itu, masyarakat Amerika sangat menentang campur tangan tentara negara itu terhadap Syria, meskipun sebagian besar percaya, Presiden Bashar Assad menyerang rakyatnya dengan gas, demikian kesimpulan sebuah sur vei yang diumumkan Senin. Jejak pendapat CNN/ORC Internasional menemukan 59 persen dari 1.022 petanggap dewasa mengatakan Kongres seharusnya tidak meluluskan resolusi kewenangan, bahkan aksi militer terbatas terhadap Syria.

Sementara itu jajak pendapat terpisah terhadap anggota parlemen oleh USA Today menemukan, Obama berhadapan tugas sulit dari Gedung Parlemen. Hanya sebagian kecil dari 533 anggota parlemen AS, yaitu 22 senator dan 22 legislator, mengatakan mereka akan mendukung penggunaan kekuatan militer terhadap rezim Assad. Secara keseluruhan, 19 senator dan 130 anggota DPR mengatakan mereka akan menentang tindakan militer terhadap Syria. Namun mayoritas parlemen di dua mejelis Kongres mengatakan bahwa mereka masih ragu. Opsi baru muncul setelah Rusia memberikan usulan agar Syria menyerahkan senjata kimianya agar AS menghentikan rencana serangan. Menurut The Guardian, Selasa, Obama menganggap tawaran Rusia ini sebagai salah satu terobosan yang mungkin saja dilakukan. Selain itu, jika dapat direalisasikan, maka akan berpotensi memberikan perkembangan positif pada konflik yang telah berlangsung 2,5 tahun di Syria. Usulan Rusia ini diberikan setelah Menteri Luar Negeri John Kerry menawarkan solusi diplomatis pada Syria. Berbicara di London, Inggris, Kerry mengatakan untuk menghindari serangan AS adalah Syria menyerahkan seluruh senjata kimianya dalam waktu sepekan. “Kami menyerukan pe-

dimana Dul sudah ditetapkan sebagai tersangka, pasal yang digunakan boleh menggunakan pasal pidana lalu lintas dimana ancamannya 6 tahun penjara. Tapi dalam prosesnya tetap menggunakan UU No. 3 tahun 1997 tentang pengadilan anak dan UU 23/2002 tentang perlindungan anak. “Karena Dul masih anakanak, ancamannya separuh orang dewasa atau maksimal dituntut 3 tahun. Ini juga harus ditangani polisi anak, jaksa anak dan hakim anak. Proses pengadilan juga tertutup, dilindungi identitas, didampingi orang tua dan penasehat hukum,” imbuh Ihsan. UU PA juga memungkinkan adanya diversi atau keluar dari proses hukum dengan memberikan rehabilitasi, intervensi kepada anak pelaku

tindak kriminal yang difasilitasi oleh pekerja sosial. “UU PA juga mengedepankan hak anak untuk belajar, istirahat dan sebagainya dipenuhi. Jadi koridornya tetap pada kepentingan terbaik bagi anak. Kalau anak disamakan dengan orang dewasa, hukumannya nanti malah tidak efektif,” kata Ihsan. Dalam hal ini, Ihsan berharap proses hukum terhadap AQL tidak dikaitkan dengan pengaruh orang tuanya, tapi sepenuhnya mengacu pada amanat UU Perlindungan Anak sebagai upaya melindungi anak dar i dampak pemidanaan. “UU PA juga menyatakan ketegasan tentang peran orang tua sebagai pihak yang ikut bertanggung jawab secara hukum,” tandas Ihsan. (dianw)

ruko. Melihat itu, anak-anak punk tersebut kabur. Seorang lagi, teman korban kritis, kini dirawat di rumah sakit. Pihak kepolisian yang menerima informasi segera melakukan penyelidikan dan menangkap empat anak punk yang diduga sebagai pelaku dan membawa mereka ke Mapolres Pematangsiantar. Satu anak punk yang ditangkap, An, 25, warga Jl. Mangga, Kel. Pardamean, Kec. Siantar Timur, adalah seorang residivis yang keluar masuk penjara akibat menjambret. Dari An, polisi menyita satu pisau lipat besi putih dan HP. Sedangkan satu tersangka, SP, 21, warga Jl. Mangga,

Kel. Pardamean, mengaku tidak mengenal An, padahal mereka tinggal di satu jalan. SP mengaku turut lari dari Pasar Horas bersama F, 21, warga yang sama dengan SP, karena menduga ada razia polisi.Dua lagi anak punk yang ditangkap belum diketahui identitasnya. Kapolres Pematangsiantar AKBP Albert TB Sianipar, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP Efendi Tarigan, SH dan Kasat Reskrim AKP Daniel SM, S.Ik menyebutkan, kasusnya masih dalam penyelidikan.Empat orang yang ditangkap masih dalam proses pemeriksaan. (a30)

Tauhid. Siapa yang ingin memiliki Miss Akhirat hendaklah ia menjadi hamba Allah yang shaleh. Misss Akhirat jauh lebih cantik dari Miss Word (Miss Dunia). Miss Akhirat diciptakan Allah sangat rupawan, bahkan menurut Mufassirin (Ahli Tafsir), kecantikan mereka 99 (Sembilan puluh Sembilan) persen dari kecantikan Miss Dunia yang cuma satu persen. Bidadari itu diciptakan dari cahaya, campur yakut dan zamrut, luluk dan marjan. Subhanallah cantiknya. Jika dibandingkan dengan para ratu dunia, apakah miss word atau miss kopi, miss universal, miss wortel ibarat intan dan batu biasa. Kecantikan miss-miss dunia dapat dilhat oleh siapa saja lewat gambar mereka yang disiarkan televisi tetapi kecantikan Miss Akhiarat

hanya dapat dinikmati oleh pemiliknya yakni penghunipenghuni surga, yakni para syuhada dan shalihin. “Bidadari-bidadari yang jelita, putih bersih di pingit dalam kamar rumah (55:72). Seakan-akan bidadari itu permata yakut dan marjan . Para bidadari itu sangat santun, menunduk pandangannya, tidak liar (55:56) Cerita bidadari bukan dongeng, tetapi janji Allah SWT kepada penghuni surga. Kisah kecantikan mereka itulah yang mengilhami iblis dan khannas menggoda manusia tertentu untuk memperlombakan para gadis dari berbagai bangsa dan Negara. Mereka boleh saja menikmati cantik molek gadisgadis dunia, tetapi mereka tidak bakal dapat menikmati gadis-gadis akhirat yang sangat jelita.

mimpin Syria untuk tidak hanya setuju senjata kimianya diawasi internasional, tapi juga bergabung dengan traktat yang melarang penggunaan senjata kimia,” kata Menlu Rusia, Sergey Lavrov. Dari Moskow, pemerintah Syr ia siap meny erahkan pasokan senjata kimia yang dimilikinya ke PBB. Proposal untuk menyerahkan senjata kimia Syria ke PBB pertama kali diajukan oleh Rusia. Syria menerima proposal tersebut setelah melakukan komunikasi dengan Rusia. “Kami menerima proposal Rusia atas dasar kepedulian kami terhadap rakyat dan keamanan negeri,” ujar Menlu Syr ia Walid al Moualem, seperti dikutip The Washington Post, Selasa. (ap/vn/ant/m10)

Longsor DiDairi ....

mulai dari desa Sopobutar hingga ke Dusun Meriah. Hal itu mengakibatkan lokasi sulit ditembus untuk memberikan bantuan. Kepala Badan Penanggulangan B encana D aer ah (BPBD) Dairi, Ir Maruli Barasa, yang dikonfirmasi mengatakan, pihaknya masih mendata berapa banyak rumah dan kerugian yang dialami warga terkait bencana itu. Maruli menambahkan, Dinas PU Bina Marga Dairi sudah menurunkan satu unit alat berat untuk membuka akses jalan yang tertutup material longsor agar bisa dilalui kendaraan. (a20)

Wagubsu Serahkan ....

melakukan tugas di Pulau Telo Kab. Nias Selatan. ‘’ Kepada keluarga, kami harapkan tetap bersabar dan tabah dan kita mendoakan agar almarhum diterima Yang Maha Kuasa,” kata Wagubsu dan mengucapkan terimakasih atas jasa-jasa almarhum yang sudah menunjukkan dedikasi kepada negara. Sebelumnya Kepala Badan Kepegawaian Daerah Provinsi Sumatera Utara Pandapotan Siregar membacakan riwayat hidup dan keputusan sementara Gubsu tentang pemberian pangkat anumerta kepada alamarhum Sutrisno yang lahir tahun 16 Januari 1958. Mulai bertugas di Biro Pemerintahan Setdaprovsu 1 Juni 1982 dengan pangkat juru muda (I/a) dan pangkat terakhir pengatur muda (II/ a).Almarhum meninggalkan seorang istri dan 5 orang putra dan putri. (m28)

Ada-ada Saja ....

poudsterling atau sekira Rp 76 juta untuk obsesinya tersebut. Uang tersebut untuk biaya operasi merubah hidung, bibir, operasi rahang, operasi bokong, dan memutihkan kulitnya selama 16 tahun terakhir. Tak itu saja, ia juga melakukan pemutihan bibir agar lebih mirip dengan tokoh idolanya itu. Seperti dilansir dari Daily Mail, Selasa (10/9), Herbert Chavez mengaku telah jatuh cinta pada sosok Superman sejak usianya lima tahun. Ia juga menggilai lakon Clarke Kent di dunia nyata. Ia kerap berjalan di sekitar rumah dengan gaya bak Supermen atau Clarke Kent dan secara berkala menggunakan kosum lengkap Superman plus rambutnya jambulnya yang khas mirip huruf S. Herbert juga dikenal sebagai kolektor pernak-pernik Superman terbanyak sedunia. Koleksinya mencapai 5.000 buah. Pria pria berusia 35 tahun ini mengaku ingin mengajarkan moral yang baik pada anak-anak. (net/rzl)

Warga Haloban Tewas Dalam Ferry PULAU BANYAK (Waspada): Seorang penumpang KMP Teluk Singkil, Idawati, 39, warga Haloban, Kec. Pulau Banyak Barat, Kab. Aceh Singkil, Selasa (10/9) tewas di kapal ferry dalam perjalanan dari Singkil menuju Pulau Banyak. “Almarhumah mengembuskan nafas terakhir sekira pukul 13:47 saat kapal berada hampir satu mil dari bibir pantai Pulau Banyak atau sekira 85 menit perjalanan,” ujar Dedi, ABK KMP Teluk Singkil . Informasi diperoleh dari keluarga, sebelum meninggal almarhumah baru pulang berobat dari RSUP Adam Malik Medan, karena penyakit tumor ganas yang menyerang lehernya. “Rencana mau dibawa pulang ke Haloban setelah dirawat di RSUP Adam Malik, namun Allah SWT berkehendak lain.Dia mengembuskan nafas terakhir di dalam kapal menuju Pulau Banyak,” kata Anhar, suami almarhumah. (cdin)

WASPADA Rabu 11 September 2013

Dugaan Korupsi Perjalanan Dinas Rp27 M Enam Anggota DPRD Langkat Diperiksa Dua Mantan Manager PTPN 2 Diperiksa STABAT (Waspada): Lanjutan penyidikan kasus dugaan korupsi perjalanan dinas para wakil rakyat di DPRD Langkat tahun 2012/2013 senilai Rp27 miliar, Kejari Stabat memeriksa enam anggota dewan. Kajari Stabat Hendri, SH, melalui Kasi Pidsus Ricardo Marpaung, Selasa (10/9) menyebutkan, enam anggota DPRD yang memiliki jadwal diperiksa yakni Tarsan Naibaho (PDK), Edi Bahagia (Fraksi Golkar), dua politisi Partai Demokrat Ade Khairina Syahputri dan Neddy S, Hasan Basri (PAN) dan Riska Purnawan (Hanura). Dari nama-nama tersebut dua diantaranya sudah diperiksa Senin (9/9), dua lainnya kemarin dan sisanya hari ini, Rabu (11/9). “Jadi satu hari ada dua orang yang diperiksa untuk jadwal saat ini,” kata Ricardo. Dalam kasus tersebut penyidik masih menetapkan dua tersangka yakni Sekwan SL dan mantan Sekwan SU. Sementara tersangka Sekwan telah mengembalikan uang Rp400 juta kepada penyidik dalam dua tahap sebelumnya. Mantan Manager PTPN 2 Kebun Sawit Seberang Kab. Langkat, DS bersama mantan Manager Distrik Rayon Utara PTPN2, AS, diperiksa penyidik Kejari Stabat sebagai tersangka, Selasa (10/9). Keduanya memenuhi panggilan penyidik setelah panggilan pertama sebelumnya tidak hadir. Pantauan Waspada, keduanya terlihat diperiksa di Ruang Intelijen dan kemudian di Ruang Pidana Khusus Kejari. Salah seorang tersangka menolak memberi keterangan kepada wartawan. (a03)

40 Menit Terbang ....

gu sistem lainnya,” katanya. Menurut Eko, setelah kembali ke bandara, pesawat akan dicek ulang kondisinya. Biasanya tersumbatnya air itu banyak faktor, bisa jadi tersumbat karena tisu dan pempers. Kondisi ini juga sudah pernah dialaminya. Namun, setelah dilakukan pengecekan dan perbaikan, pesawat sudah bisa kembali berangkat setelah kondisi mesin diperiksa secara menyeluruh. Disinggung tentang mengapa pilot harus diganti, Eko menjelaskan, dalam kondisi ini sang pilot bisa saja tidak diganti jika jam terbangnya masih bisa untuk melanjutkannya. ‘’ Tapi, jika jam terbang pilotnya sudah lewat, akan diganti dengan pilot lainnya untuk menerbangkanpesawat tersebut,’’ katanya. Furqonis, seorang Calhaj Kloter 1 sekira pukul 15.40 mengabarkan kepada Waspada, pesawat GA 3101 yang membawa mereka menuju Arab Saudi, tiba-tiba memberikan pengumuman, pesawat akan kembali lagi ke KNIA, karena ada gangguan teknis. “Ganggaun yang disebutkan oleh petugas itu karena

persediaan air di pesawat ada masalah, jika perjalanan diteruskan selama 7 jam mendatang, khawatir persediaan air akan habis. Akhirnya kami kembali lagi ke KNIA, dengan menaruh prasangka baik saja,” kata Furqanis melalui telepon selulernya yang menyebutkan pesawat take of pukul 14.00, dan kembali mendarat pukul 14.55. Hingga pukul 17:30, dia bersama rombongan masih berada dalam pesawat.Pukul 18.30 , telepon selulernya sudah tidak aktif. Calhaj lainnya Ibrahim Daulay, membenarkan jika peristiwa mendaratnya lagi pesawat mereka kemarin siang. “Janji pihak penerbangan hanya satu jam sejak kami mendarat kembali pesawat akan selesai perbaikannya, tapi sudah lebih satu jam,” kata Ibrahim yang menyebutkan pihak penerbangan memberikan perhatian serius kepada Calhaj. Terkait hal ini, Sekretaris Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan, Hasful berharap tidak ada masalah terkait hal itu. (m32/m43)

Gubsu Lepas ....

bisa berpartisipasi dalam pembangunan di daerah ini,’’ kata Gubsu dan mengimbau, semua jamaah waspada cuaca ekstrim di tanah suci Makkah. ‘’ Suhu di Madinah sekitar 42 derjat Celcius, dan dikhawatirkan suhu cuaca di Makkah akan lebih tinggi.Namun, memasuki bulan haji,wajahwajah kerinduan terhadap Rasulullah, wajah-wajah kerinduan hadir ke rumah Allah SWT tentunya tidak menyurutkan langkah jamaah meski cuaca di sana ekstrim,” kata Gubsu. Sementara itu, anggota Komisi VIII DPR RI, Hasrul Azwar mengatakan, pihaknya mengawasi 13 titik embarkasi di Indonesia, diantaranya

Medan, Palembang, Jakarta, Aceh dan lainnya. “Pemantauan kami juga bukan hanya saat jamaah berangkat tetapi saat di tanah suci. Kami berharap, petugas yang melayani jamaah haji dapat secara maksimal dalam bertugas,” kata politisi PPP itu. Ketua PPIH Embarkasi Medan Drs H Abd Rahim, M.Hum menjelaskan, jamaah kloter pertama asal Medan yang diberangkatkan berjumlah 440 orang. Jumlah jamaah laki-laki sebanyak 185 orang dan 255 jamaah perempuan. “Keseluruhan jamaah Embarkasi Medan hingga Kloter 16 sebanyak 6.663 jamaah, “ ujarnya. (m37/m50/m40/h02)

Akhirnya Tabungan ....

lalu, kami berdua seolah belum percaya bisa berangkat tahun 2013 ini. Pasalnya, sejak itu keuangan saat berjualan ada mengalami penurunan. Tapi suami saya meyakinkan saya bahwa keuangan akan baik-baik saja dan Allah akan memberikan jalan terbaik pada kami yang sudah bercitacita menunaikan ibadah haji. Alhamdulillah saat waktu pembayaran pelunasan, kami bisa membayarnya lagi sehingga positif untuk berangkat,”katanya yang sempat waswas namanya termasuk Calhaj yang terpangkas karena quota haji dikurangi. Penduduk Jln Brigjen Katamso Gg Pandu ini berharap keberangkatannya ini mendapatkan berkah dan mampu

melaksanakan serangkaian ibadah haji hingga tuntas. “Kalau untuk kesehatan alhamdulillah hasil tesnya baik, tapi semua kehendak Allah SWT, seperti jamaah lainnya kami akan pasrah dan ikhlas untuk melaksanakan rukun Islam kelima ini. Semoga di tahun berikutnya banyak para pedagang seperti kami yang melaksanakan ibadah haji, berkat rajin menabung dan niat untuk menunaikan ibadah haji. Hal yang pokok, niat dan usaha serta meningkatkan amalan wajib dan sunnat,” kata Yusnida Tanjung sesaat sebelum memasuki ruangan Madinatul Hajj Asrama Haji sebelum ber tolak ke Kuala Namu Internasional Airport bersama rombongan. (m37)

Pembahasan ....

Ketua DPRK Aceh Tamiang Rusman yang memimpin siding, begitu melihat situasi sudah memanas langsung menutup sidang. Seharusnya pembahasan dilanjutkan, Selasa (10/9), namun tidak bisa dilanjutkan, walaupun Sekdakab Aceh Tamiang Razuardi sudah hadir, karena untuk memutuskan layak atau tidak layak harus menunggu Bupati Aceh Tamiang Hamdan Sati pulang dari Jakarta untuk urusan dinas. Sebenarnya gelagat kurang “harmonis” sudah nampak pada sidang paripurna, Jumat (6/9) pekan lalu.Ketika itu hanya 12 anggota DPRK Aceh Tamiang dan Ketua DPRK setempat Rusman yang hadir pada sidang tersebut. Sedangkan pihak eksekutif yang hadir Wakil Bupati Aceh Tamiang Iskandar Zulkarnain dan sejumlah SKPK. Ketika itu, anggota DPRK

Aceh Tamiang, Mansur Arbi, T Insyafuddin, Saiful Sofyan dan Juanda meminta Ketua DPRK menunda sidang dan pihak Banggar DPRK Aceh Tamiang harus duduk kembali dengan pihak eksekutif untuk menunjukkan data-data tentang belanja langsung dan belanja tidak langsung. Pada sidang tersebut disepakati antara DPRK dan eksekutif duduk kembali pada Senin (9/9) dan Selasa (10/9) untuk menyelesaikan KUA-PPAS. Namun pada pertemuan, Senin (9/9), eksekutif tidak bisa menunjukkan data-data hasil verifikasi yang diminta pihak DPRK Aceh Tamiang, sehingga muncul kericuhan. Ketua DPRK Aceh Tamiang Rusman dan Sekdakab Aceh Tamiang Razuardi menyatakan untuk menuntaskan persoalan bantuan sosial ini tentu saja harus menunggu keputusan dari Bupati Aceh Tamiang. (b23)

ke tanah suci dari KNIA,” ujarnya. Koordinasi Salah seorang Co Pilot pesawat maskapai dalam negeri dan luar negeri, Eko Septiadi ketika dimintai komentarnya via telefon selula menjelaskan, secara prosedur jika terjadi kerusakan apapun di dalam sistem di pesawat seorang pilot tetap harus berkoordinasi terlebih dahulu dengan pihak bandara, apakah dilanjutkan atau tidak penerbangan tersebut. Apalagi, dalam hal ini terjadi kerusakan yang mengakibatkan tersendatnya aliran air di dalam pesawat. Pada kondisi ini, kita juga harus melihat, jika untuk penerbangan pendek kemungkinan akan dilanjutkan penerbangan. Tetapi, jika penerbangan jauh seperti keberangkatan haji yang memakan waktu 9 jam lebih, sudah bisa dipastikan pilot harus kembali untuk melakukan perbaikan dan pengecekan pesawat. “Ka n t i d a k m u n g k i n selama perjalanan yang jauh ini penumpang tidak menggunakan air, selain itu apakah kerusakan itu ada menggang-

serta stakeholder yang mendukung pelaksanaan pemberangkatan haji Embarkasi Medan. Gubsu dalam sambutannya mengingatkan petugas Kloter agar melaksanakan tanggungjawabnya dengan baik, memberikan perhatian pada jamaah yang memerlukan bantuan khususnya kepada paramedis. ‘’ Berangkat ke tanah suci dengan niat yang ikhlas, jangan lupa turut mendoakan agar Provinsi Sumatera Utara tetap kondusif, di mana saat ini adanya keinginan Sumut menjadi sentra ekonomi bagian utara, dan semoga menjadi haji yang mabrur dan

Sejak kecil saya mendambakan bisa melaksanakan ibadah haji baru kini tercapai,”kata Yus yang dikenal masakannya enak terutama kepala ikan gulai. Dia menambahkan, berniat melaksanakan ibadah haji harus diimbangi dengan kesungguhan untuk menabung uang dari penghasilan berjualan setiap harinya. Awalnya hanya seribu dua ribu, tapi semakin hari terus ditingkatkan. Setiap hari harus ada celengan khusus untuk haji. Dengan kewajiban menabung itulah, akhirnya bisa terkumpul sampai cukup untuk membayar setoran awal. “Itupun saat membayarkan setoran awal tahun 2009

Kamal.Rapat dipimpin Ketua DPRK Aceh Tamiang Rusman. Kericuhan memuncak ketika pihak eksekutif menyatakan dari 3.000-an proposal yang masuk untuk mendapat bantuan sosial dan hibah tahun anggaran 2013, hanya 587 proposal yang layak diberikan bantuan sosial. Anggota Banggar DPRK Aceh Tamiang Mansur Arbi menanyakan data hasil verifikasi tersebut ,siapa yang layak dan siapa yang tidak layak.Namun tidak bisa ditunjukkan pihak eksekutif. Akibatnya Mansur Arbi “naik darah”.Eksesnya Mansur Arbi menjungkirbalikkan meja di ruang Banggar DPRK Aceh Tamiang. Bukan Mansur Arbi saja yang emosi melihat kinerja pihak eksekutif, anggota dewan lain juga “mengamuk” dengan memecahkan gelasgelas di atas meja.


Berita Utama

A2

Maling Sikat Uang Jamaah Sedang Shalat STABAT (Waspada): FS, 27, warga Tanjung Jati, Kota Binjai babakbelur diamuk massa setelah tertangkap tangan mengambil tas jamaah milik Arianto, 27, warga Karang Gading , Kec. Secanggang Kab. Langkat yang sedang shalat di Masjid Nurul Huda Kel. Perdamaian Stabat, Langkat,Senin (9/9) malam. Informasi dihimpun Waspada, saat itu pelaku berpura-pura shalat di belakang korban. Pada rakaat kedua saat sujud, FS beraksi dengan membawa kabur tas berisi uang Rp26 juta yang diletakkan di samping korban. Sadar tasnya hilang, korban membatalkan shalatnya dan mengejar pelaku. Saat itu FS berusaha menghidupkan mesin Honda Legenda BK 4512 GE untuk kabur , namun tidak berhasil. Korban langsung berteriak maling dan mengundang perhatian massa.Tanpa dikomando, massa membabakbelurkan tersangka. Aparat Polsek Stabat yang tiba di lokasi segera membawa tersangka ke komando. Kapolsek Stabat AKP Zulkarnen , yang dikonfirmasi menuturkan pelaku masih di sel untuk pengembangan lebih lanjut. (a03)

Waspada/Natar Manalu

SALAH satu titik akses jalan menuju Dusun Laemeriah,Desa Laeluhung tertimbun tanah longsor bercampur batu-batuan.

Longsor Di Dairi, ... Rosdiawan Br Bak, kerabat korban kepada wartawan, Selasa (10/9) di lokasi mengatakan, saat banjir bandang terjadi , korban bersama suaminya Rajumin Simaremare berada didalam rumah bersama seorang cucu mereka yang masih kelas IV SD. TibaJawaban Problem Catur, tiba tumpukan material tanah serta bebatuan dan kayu besar TTS Dan Sudoku menghantam rumah korban yang tepat berada di kaki bukit Dari Halaman Sport. di dusun tersebut. Korban bersama suami terseret longsor sejauh 50 meter Jawaban Problem Catur: dari lokasi kejadian. Namun, korban ditemukan tewas pada 1. Bf8+, GxB. pukul 20:00. Sedangkan suami dan cucu korban serta tetangga 2. Gg5+, Ge7. mereka mengalami luka –luka. PantauanWaspada di lapa3. GxG+, RxG. ngan, terdapat sekitar 30 titik tumpukan tanah longsor mulai 4. Mf7+, Rd8. dari desa Sopobutar hingga ke 5. Mf8+mat. Dusun Meriah. Hal itu mengakibatkan lokasi sulit ditembus untuk memberikan bantuan. Jawaban TTS: Kepala Badan Penanggulangan Bencana Daerah (BPBD) TTS Kesehatan Dairi, Ir Maruli Barasa, yang dikonfirmasi mengatakan, pihaknya masih mendata berapa banyak rumah dan kerugian yang dialami warga. (a20)

Ada-ada Saja ...

Jawaban Sudoku:

1 8 7 5 6 9 2 3 4

4 5 3 2 7 8 9 1 6

9 6 2 4 1 3 7 5 8

3 4 6 7 9 5 1 8 2

5 7 9 8 2 1 4 6 3

8 2 1 3 4 6 5 7 9

7 3 4 6 5 2 8 9 1

6 1 5 9 8 4 3 2 7

2 9 8 1 3 7 6 4 5

Pria asal Filipina bernama Herbert Chavez rela menghabiskan uang sebesar 4.400 poudsterling atau sekira Rp 76 juta untuk obsesinya tersebut. Uang tersebut untuk biaya operasi merubah hidung, bibir, operasi rahang, operasi bokong, dan memutihkan kulitnya selama 16 tahun terakhir. Tak itu saja, ia juga melakukan pemutihan bibir agar lebih mirip dengan tokoh idolanya itu. SepertidilansirdariDailyMail, Selasa (10/9), Herbert Chavez mengaku telah jatuh cinta pada sosok Superman sejak usianya lima tahun. Ia juga menggilai lakon Clarke Kent di dunia nyata. Ia kerap berjalan di sekitar rumah dengan gaya bak Supermen atau Clarke Kent dan secara berkala menggunakan kosum lengkap Superman plus rambutnya jambulnya yang khas mirip huruf S. Herbert juga dikenal sebagai kolektor pernak-pernik Superman terbanyak sedunia. Koleksinya mencapai 5.000 buah. (net/rzl)

Rabu 11 September 2013

Menag: Hati-hati Saat Tawaf

Diserang Anak Punk, 1 Tewas 1 Luka Berat P E M ATA N G S I A N TA R (Waspada): Dua pemuda asal Kab. Nias diserang tujuh anak punk, mengakibatkan satu tewas dan satu lainnya luka berat. Informasi dihimpun Waspada, Selasa (10/9), korban tewas Joni Gea, 21, pekerja rumah makan, kos di Jl. Diponegoro, Gang Kopral, Kel. Simalungun, Kec. Siantar Barat, Kota Pematangsiantar.Satu luka berat, Jepri Zebua, 20, pekerja rumah maTesangka, An. kan, kos di Jl. Cipto, Kel. SimaWaspada/Edoard Sinaga lungun. Pantauan Waspada, peristiwa yang sempat membuat macat Jl. Sutomo, Kel. Dwikora, Kec. Siantar Barat terjadi di depan toko kain Serba Indah, Senin (9/9) pukul 17:30. Teman korban, Vicky Dachi, 20, menyebutkan, penyerangan berawal di lantai III Pasar Horas ketika keduanya sedang berjalanjalan dan bertemu dengan para anak-anak punk tersebut. Lalu, ketujuh orang itu langsung menyerang keduanya.Sebelumnya Jepri Zebua pernah diserang kawanan anak punk itu. Mendapat serangan dari tujuh anak punk, kedua korban melarikan diri hingga ke Jl. Sutomo.Namun, mereka berhasil mencegat kedua korban di tempat kejadian. Dan, salah seorang anak punk menusuk perut Jepri Zebua dua kali menggunakan pisau lipat besi putih. Setelah itu, pelaku menikam perut Joni Gea tiga kali. Korban sempat melakukan perlawanan dengan mengayunayunkan broti di tangannya. Namun, tubuh korban semakin lemah. Darah mengucur dari lukanya. Dan, Joni Gea rebah di atas genangan darahnya di depan ruko. Melihat itu, anak-anak punk tersebut kabur. Seorang lagi, teman korban kritis, kini dirawat di rumah sakit. Pihak kepolisian yang menerima informasi segera melakukan penyelidikan dan menangkap empat anak punk yang diduga sebagai pelaku dan membawa mereka ke Mapolres Pematangsiantar. Satu anak punk yang ditangkap, An, 25, warga Jl. Mangga, Kel. Pardamean, Kec. Siantar Timur, adalah seorang residivis yang keluar masuk penjara akibat menjambret. Dari An, polisi menyita satu pisau lipat besi putih dan HP. Sedangkan satu tersangka, SP, 21, warga Jl. Mangga, Kel. Pardamean, mengaku tidak mengenal An, padahal mereka tinggal di satu jalan. SP mengaku turut lari dari Pasar Horas bersama F, 21, warga yang sama dengan SP, karena menduga ada razia polisi. Dua lagi anak punk yang ditangkap belum diketahui identitasnya. Kapolres Pematangsiantar AKBP Albert TB Sianipar, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP Efendi Tarigan, SH dan Kasat Reskrim AKP Daniel SM, S.Ik menyebutkan, kasusnya masih dalam penyelidikan.Empat orang yang ditangkap masih dalam proses pemeriksaan. (a30)

WASPADA

Waspada/ Surya Efendi

WAGUBSU HT Erry Nuradi didampingi Sekda H Nurdin Lubis menyerahkan jenazah Sutrisno kepada pihak keluarga di Pangkalan Udara Lanud Suwondo, Selasa (10/9).

Wagubsu Serahkan Jenazah Terakhir Musibah Kapal Karam Di Pulau Telo MEDAN (Waspada): Pemerintah Provinsi Sumatera Utara menyerahkan jenazah terakhir Pegawai Negeri Sipil (PNS), korban karamnya kapal Tim Penilai Kecamatan Terbaik di perairan Nias Selatan. Jenazah atas nama Sutrisno, 55, diserahkanWagubsu HT Erry Nuradi, kepada keluarganya saat tiba di Pangkalan Udara Lanud Suwondo Medan, Selasa (10/9) sore. Tangis duka para keluarga mewarnai prosesi serah terima jenazah. Wagubsu HT Erry Nuradi, yang memimpin upacara

penyerahan juga menyerahkan salinan kenaikan pangkat satu tingkat secara anumerta kepada almarhum, seperti tiga jenazah PNS Pemprovsu sebelumnya. Jenazah PNS Pemprovsu yang dibawa helikopter Basarnas tiba di Pangkalan Lanud Suwendo sekitar pukul 14:50, disambut Sekdaprovsu H Nurdin Lubis, SH, MM, keluarga dan beberapa pejabat Eselon II, Eselon III dan PNS Pemprovsu. Wagubsu mengatakan Pemprovsu sangat berduka dengan kepergian almarhum Sutrisno,

PNS Biro Pemerintahan Setdaprovsu. Almarhum adalah salah satu korban dari empat orang PNS Pemprovsu yang mengalami musibah saat melakukan tugas di Pulau Telo Kab. Nias Selatan. ‘’ Kepada keluarga, kami harapkan tetap bersabar dan tabah dan kita mendoakan agar almarhum diterima Yang Maha Kuasa,” kata Wagubsu dan mengucapkan terimakasih atas jasa-jasa almarhum yang sudah menunjukkan dedikasi kepada negara. (m28)

2 Jenazah PNS Korban Kapal Pecah Tertahan Di RS MEDAN (Waspada): Dua jenazah korban musibah kapal pecah di Perairan Pulau Telo Nias Selatan (Nisel), Jiren Manulang dan Anjas Bulolo dari Pemkab Nisel, hingga Selasa(10/ 9) masih tertahan di Pulau Telo. Kepala Kantor Basarnas Medan Dianta Bangun, didampingi Kadis Kominfo Sumut Jumsadi Damanik dan Kasubag Humas Pemprovsu Harvina Zuhra dalam keterangan pers di Kantor Gubsu, Selasa (10/9) mengatakan, kedua jenazah akan dievakuasi secepatnya. “ Faktor teknis dan cuaca menjadi kendala sehingga kedua jenazah belum bisa dievakuasi. Namun kami akan berupaya secepatnya jika faktor teknis dan cuaca mendukung,” ujar Dianta Bangun. Untuk jenazah Jiren Manullang, menurut Dianta, seyogianya dievakuasi Selasa (10/ 9), bersama jenazah Sutrisno, PNS Biro Pemerintahan Umum Pemprovsu. Namun hanya Sut-

risno yang bisa dievakuasi ke Medan. “Mulanya direncanakan dua jenazah, tetapi karena jenazah Jiren Manullang sudah bengkak dan tidak muat di heli, akhirnya hanya jenazah Sutrisno yang bisa dievakuasi ke Medan,” jelas Dianta. Dianta menyebutkan, evakuasi untuk Jiren kemungkinan baru bisa dilakukan Kamis (12/9). Hal ini disebabkan heli milik Basarnas tidak memungkinkan beroperasi Rabu (11/9) karena harus mengalami perbaikan beberapa komponen yang rusak dalam penerbangan pengangkutan jenazah Sutrisno. “Baru besok (hari ini-red) datang sparepart dan teknisi dari Jakarta. Perbaikan mungkin hingga sore.Artinya kalaupun siap sore tetap tidak bisa meluncur ke Pulau Telo karena kendala cuaca. Dalam hal ini kami minta maaf dan minta keluarga bersabar. Kami tidak ada pilih-pilih kasih,” katanya.

Kejari Stabat Periksa ...

24 Calon DPD Sumut, Nomor Urut Dihapus

Sebagai contoh apakah yang bersangkutan ikut kunjungan kerja, apakah menginap di hotel yang ditentukan, apakah jadwal pergi dan pulang tidak berbeda hingga mengenai penerimaan uang saku, uang penginapan dan hal-hal lainnya. Sebelumnya, penyidik telah memeriksa dua anggota dewan dari Partai Demokrat dan PKB, yakni Faisal Haq dan H. Sunarto. Kasus PTPN II Mantan Manager PTPN II Kebun Sawit Seberang Kab. Langkat, DS bersama mantan Manager Distrik Rayon Utara PTPN II, AS, diperiksa penyidik Kejari Stabat sebagai tersangka, Selasa (10/9). Keduanya memenuhi panggilan penyidik setelah panggilan pertama tidak hadir. Pantauan Waspada, keduanya terlihat diperiksa di Ruang Intelijen, kemudian di Ruang PidanaKhususKejari.Salahseorang tersangka menolak memberi keterangan kepada wartawan. Kajari Stabat Hendri, SH mengatakan, dalam kasus tersebut sudah terselamatkan uang negara Rp1,2 miliar. Uang tunai Rp1,2 miliar dimaksud sebelumnya dikembalikan tersangka AEK yang sudah ditahan terlebih dahulu di LP Tanjungpura. Dalam kasus itu, kejaksaan sudah menetapkan empat tersangka, dua dari pihak rekanan dan dua dari mantan manager yang berperan sebagai pengawas proyek. (a03)

Senat Tunda ... kecil dari 533 anggota parlemen AS, yaitu 22 senator dan 22 legislator, mengatakan mereka akan mendukung penggunaan kekuatan militer terhadap rezim Assad. Secara keseluruhan, 19 senator dan 130 anggota DPR mengatakan mereka akan menentang tindakan militer terhadap Syria. Namun mayoritas parlemen di dua mejelis Kongres mengatakan bahwa mereka masih ragu. (ap/vn/ant/m10)

40 Menit ... ketika dimintai komentarnya via telefon selular menjelaskan, secara prosedur jika terjadi kerusakan apapun di dalam sistem di pesawat seorang pilot tetap harus berkoordinasi terlebih dahulu dengan pihak bandara, apakah dilanjutkan atau tidak penerbangan tersebut. Apalagi, dalam hal ini terjadi kerusakan yang mengakibatkan tersendatnya aliran air di dalam pesawat. Pada kondisi ini, kita juga harus melihat, jika untuk penerbangan pendek kemungkinan akan dilanjutkan penerbangan.

Sementara kalau dievakuasi melalui jalur laut, kondisi cuaca juga tidak memungkinkan. “Dan jenazah Anjas Bulolo pun sudah dicoba melalui laut ke Teluk Dalam, tapi tak lama kemudian kembali ke Pulau Telo karena cuaca dan ombak cukup besar. Evakuasi jenazah Anjas tetap diupayakan melalui jalur laut,” ujarnya. “ Kami berupaya secepat mungkin mengevakuasinya selagi cuaca dan faktor teknis mendukung. Sekali lagi, kami paham perasaan keluarga korban, tapi kami mohon untuk bersabar,” ujarnya. Saat ini kedua jenazah disemayamkan di salah satu rumahsakit di Pulau Telo dengan penjagaan Pemkab Nisel. Keluarga almarhum Jiren Manullang meminta jenazah dievakuasi ke Siborongborong Tapanuli Utara.Keluarga almarhum Bulolo meminta jenazah dievakuasi ke Teluk Dalam ibukota Nisel,” tukasnya. (m28)

MEDAN (Waspada): Komisi Pemilihan Umum (KPU) RI menetapkan 24 nama calon Dewan Perwakilan Daerah (DPD) utusan Sumatera Utara. Penetapan 24 nama tersebut tertuang dalam Surat Keputusan KPU No: 679/KPS/KPU/Tahun 2013. Hal itu dibenarkan Kabag Hukum dan Perundang-undangan KPU Sumut Maruli Pasaribu, SH, yang dihubungi di ruang kerjanya, Selasa, (10/9). Namun, kata Maruli, sesuai surat yang mereka terima, untuk Pemilu 2014 khusus DPD tidak ada lagi nomor urut melainkan nama dan foto calon dan disusun sesuai abjad. Sedangkan penetapan daftar calon tetap (DCT) DPD merupakan kewenangan KPU RI berdasarkan abjad sesuai PKPU No. 14 perubahan atas PKPU No. 8/2013. “Ke 24 calon anggota DPD itu dinyatakan lulus dan masuk dalam DCT. Namun, dalam pengumuman itu, KPU tidak menyebutkan nomor urut calon melainkan disusun sesuai abjad,”kata Maruli dan menambahkan, KPU Sumut sudah menyerahkan dan membagikan hasil putusan itu ke masing-masing calon DPD. (m34)

Doakan Sumut ... Gubsu dalam sambutannya mengingatkan petugas Kloter agar melaksanakan tanggungjawabnya dengan baik, memberikan perhatian pada jamaah yang memerlukan bantuan khususnya kepada paramedis. ‘’ Berangkat ke tanah suci dengan niat yang ikhlas, jangan lupa turut mendoakan agar Provinsi Sumatera Utara tetap kondusif, di mana saat ini adanya keinginan Sumut menjadi sentra ekonomi bagian utara, dan semoga menjadi haji yang mabrur dan bisa berpartisipasi dalam pembangunan di daerah ini,’’ kata Gubsu dan mengimbau, semua jamaah waspada cuaca ekstrim di tanah suci Makkah. ‘’ Suhu di Madinah sekitar 42 derajat Celcius, dan dikhawatirkan suhu cuaca di Makkah akan lebih tinggi.Namun, memasuki bulan haji,wajah-wajah kerinduan terhadap Rasulullah, wajah-wajah kerinduan hadir ke rumah Allah SWT tentunya tidak menyurutkan langkah jamaah meski cuaca di sana ekstrim,” kata Gubsu. Sementara itu, anggota Komisi VIII DPR Hasrul Azwar mengatakan, pihaknya mengawasi 13 titik embarkasi di Indonesia, diantaranya Medan, Palembang, Jakarta, Aceh dan lainnya. “Pemantauan kami juga bukan hanya saat jamaah berangkat tetapi saat di tanah suci. Kami berharap, petugas yang melayani jamaah haji dapat secara maksimal dalam bertugas,” kata politisi PPP itu. Ketua PPIH Embarkasi Medan Drs H Abd Rahim, M.Hum menjelaskan, jamaah kloter pertama asal Medan yang diberangkatkan berjumlah 440 orang. Jumlah jamaah laki-laki sebanyak 185 orang dan 255 jamaah perempuan. “Keseluruhan jamaah Embarkasi Medan hingga Kloter 16 sebanyak 6.663 jamaah, “ ujarnya.(m37/m50/m40/h02) Tetapi, jika penerbangan jauh seperti keberangkatan haji yang memakan waktu 9 jam lebih, sudah bisa dipastikan pilot harus kembali untuk melakukan perbaikan dan pengecekan pesawat. “Kan tidak mungkin selama perjalanan yang jauh ini penumpang tidak menggunakan air, selain itu apakah kerusakan itu ada mengganggu sistem lainnya,” katanya. Menurut Eko, setelah kembali ke bandara, pesawat akan dicek ulang kondisinya. Biasanya tersumbatnya air itu banyak faktor, bisa jadi tersumbat karena tisu dan pempers.

Kondisi ini juga sudah pernah dialaminya. Namun, setelah dilakukan pengecekan dan perbaikan, pesawat sudah bisa kembali berangkat setelah kondisi mesin diperiksa secara menyeluruh. Disinggung tentang mengapa pilot harus diganti, Eko menjelaskan, dalam kondisi ini sang pilot bisa saja tidak diganti jika jam terbangnya masih bisa untuk melanjutkannya. ‘’ Tapi, jika jam terbang pilotnya sudah lewat, akan diganti dengan pilot lainnya untuk menerbangkan pesawat tersebut,’’ katanya. (m32/m43/m37/m50/ m40/h02/m46)

JAKARTA (Waspada): Menteri Agama Suryadharma Ali berpesan kepada jamaah calon haji agar berhati-hati saat menjalankan ibadah tawaf karena sedang ada perbaikan di sekitar Kabah. “Tawaf akan terkonsentrasi di lantai satu. Jamaah harus hati-hati karena akan jauh lebih padat dari tahun-tahun sebelumnya,” kata Menag saat melepas jamaah kloter pertama embarkasi Jakarta di Asrama Haji Pondok Gede, Jakarta, Selasa (10/90 pagi. Ia mengatakan, akibat perbaikan, area tawaf yang biasanya mampu menampung jamaah sekitar 48.000 orang per jam berkurang sekitar 60 persen menjadi hanya 22.000 per jam. “Pimpinan Kelompok Bimbingan Ibadah Haji (KBIH) termasuk jamaah supaya disiplin dalam melaksanakan tawaf, karena akan berdesak-desakan sekali. Khawatir ada apa-apa,” katanya. Menag mengingatkan agar jamaah haji mewaspadai tindak kejahatan di Tanah Suci, dan tidak terlalu mengkhawatirkan virus Corona. Seluruh kloter pertama yang berangkat Selasa (10/9), secara simbolis dilepas Menteri Agama (Menag) H. Suryadharma Ali di asrama Haji Pondok Gede, Jakarta Timur. Pelepasan kloter pertama secara serentak terebut dihadiri Komisi VIII DPR RI, DPD RI, wakil Kementerian Kesehatan, Kementerian Perhubungan, Kementerian

Kesejahteraan Rakyat, jajaran Lanud Halim Perdanakusuma, wakil Menteri Agama H. Nasaruddin Umar, Dirjen Perjalanan Haji dan Umrah Anggito Abimanyu serta jajaran esselon satu dan dua Kemenag. Menag mengimbau kepada seluruh calon jamaah haji Indonesia selama berada di Arab Saudi agar berhati-hati dengan orang yang baru dikenal dengan awalnya bertujuan memberikan pertolongan, namun akhir melakukan tipu muslihat. “ Bapak-bapak, ibu-ibu, hendaknya berhati-hati dengan orang yang baru dikenal selama berada di Arab Saudi. Biasa orang-orang tersebut yang semula menawarkan itikad baik, tapi ujung-ujungnya melakukan penipuan,” pesannya. Me-

nag juga mengingat kepada seluruh calhaj untuk tetap menjaga kesehatan dan jangan pelitpelit kepada diri sendiri untuk membeli buah-buah. Sementara Direktur Operasional perjalanan haji dan umroh Garuda Indonesia, Hadi Syahrean mengatakan, bahwa dalam pelaksanaan haji tahun 2013/1434 H, Garuda Indonesia memulai phase (gelombang) keberangkatan pertama tanggal 10 September hingga 9 Oktober. Gelombang kedua tanggal 20 Oktober sampai 19 November. Penerbangan langsung menuju Madinah akan dilakukan oleh embarkasi Jakarta dan Medan dengan periode keberangkatan 10-24 Oktober dan periode kepulangan tanggal 4-19 November. (ant/j06)

Embarkasi Haji Batam Dinilai Terbaik JAKARTA (Waspada): Wakil Ketua Komisi VIII Ledia Hanifah melepas jamaah calon haji kloter pertama embarkasi Batam, Selasa (10/9). Menurutnya, embarkasi haji Batam merupakan embarkasi terbaik di Indonesia. Hal itu dilontarkannya setelah melihat penataan penerimaan hingga pelepasan jamaah haji sangat baik. Termasuk pengecekan ulang kesehatan calon jamaah, pemeriksaan obat-obatan, pemberian gelang identitas, hingga kepada pemberian uang riyal untuk biaya hidup selama di Arab Saudi. Dia menjelaskan dari total jamaah yang diberangkatkan dari embarkasi haji Batam sebanyak 460 orang, namun empat orang tertunda karena sakit dan hamil. Selain pembekalan berupa materi dan teknik di tanah suci, panitia pelaksana ibadah haji juga membagikan masker kepada para jamaah. Semua jamaah dibekali dan membawa masker untuk menghindari penularan virus atau kuman berbahaya dari jamaah haji negara lain,”ujar Ledia Hanifah. Saat melepas kloter pertama jamaah calon haji asal Batam, Ledia Hanifah didampingi anggota Komisi VIII Hidayat Nurwahid. (aya)

Calhaj Wajib Gunakan Masker MEDAN (Waspada): Kepala Dinas Kesehatan Sumut dr. Sri Hartati Surjantini, MKes menekankan penggunaan masker kepada jamaah selama berada di Makkah untuk meminimalisir peluang terinfeksi virus seperti virus Corona yang sekarang sedang mewabah. “Masker wajib digunakan terutama dekat jamaah yang kena flu, bersin dan sebagainya. Apalagi di sana ada puluhan ribu orang dari seluruh dunia. Selain menggunakan masker, kondisi tubuh juga harus fit. Jika tidak, virus bisa dengan mudah menyerang kapanpun jika kondisi tubuh tidak fit,” kata Surjantini, Selasa (10/9), saat pemberangkatan Kloter 1 Embarkasi Medan. Selain itu, Surjantini mengimbau agar Calhaj memperbanyak minum air mineral, mengurangi aktivitas ibadah yang berlebihan serta

istirahat yang cukup. “Terlebih lagi, cuaca di Arab Saudi jauh lebih panas dari Indonesia,” katanya dan menyarankan, apabila Calhaj mengalami panas atau demam segera melapor kepada petugas kesehatan haji. “Tiap kloter didampingi satu orang dokter dan 2 perawat. Jika mengalami keluhan segera melaporkannya,” pintanya. Sementara itu Kabid Kesehatan Haji di Asrama Haji Medan dr.WiendraWaworuntu, Mkes mengatakan, mengantisipasi virus Corona di Arab Saudi, pihaknya melakukan penyuluhan kepada para jamaah haji. “Kita juga mengimbau kepada jamaah untuk memakai masker, apalagi dengan adanya perbaikan di Arab Saudi yang menyebabkan banyaknya abu,” imbaunya. (h02/m37)

Indonesia Berencana Beli Pesawat Untuk Jamaah Haji JEDDAH, Arab Saudi (Waspada): Konsul Haji Indonesia Syairozi Dimyathi mengungkapkan, Indonesia mempertimbangkan pembelian pesawat eksklusif untuk mengangkut para jamaah haji. Dia mengungkapkan hal itu saat berbicara dengan Arab News , ketika menyatakan Indonesia mengalami kerugian sebesar 200 juta Riyal Saudi dalam pelaksanaan haji tahun ini karena penurunan 20 persen kuota. Sebelumnya, 211,000 jamaah terdaftar, namun hanya 168.000 orang yang bisa menunaikan ibadah haji. Kerugian finansial karena untuk memajukan pembayaran yang dibuat untuk akomodasi dan jasa logistik lainnya untuk jumlah jamaah sebelum dilakukan pengubrangan kuota. Dimyathi mengatakan kepada Arab

Puluhan Tahun ... “Itupun saat membayarkan setoran awal tahun 2009, kami berdua seolah belum percaya bisa berangkat tahun 2013. Pasalnya, keuangan hasil jualan mengalami penurunan. Tapi suami saya meyakinkan, keuangan akan baikbaik saja. Allah akan memberikan jalan terbaik pada kami yang sudah bercita-cita menunaikan ibadah haji,’’ katanya. ‘’ Alhamdulillah.Waktu pelunasan, kami bisa membayarnya lagi sehingga positif untuk berangkat,’’ kata Yus yang mengaku sempat waswas namanya termasuk Calhaj yang terpangkas karena quota haji dikurangi.’’ Namun, Allah memberikan ridhaNya,’’ lanjut Yus. Warga Jl. Brigjen Katamso, Gg Pandu, Medan, ini berharap keberangkatannya mendapatkan berkah dan mampu melaksanakan serangkaian ibadah haji hingga tuntas. “Kalau untuk kesehatan, Alhamdulillah hasil tesnya baik, tapi semua kehendak Allah SWT, seperti jamaah lainnya kami akan pasrah dan ikhlas untuk melaksanakan rukun Islam kelima ini.

News Minggu dan diterbitkannya Senin (9/9), Pemerin-tah Indonesia sepenuhnya terlibat dalam operasi haji bagi para jamaahnya, yang dijadwalkan tiba di Jeddah dan Madinah Selasa (10/9). Dia mengatakan, penerbangan pertama jemaah haji Indonesia akan tiba dari Jakarta ke Jeddah Selasa. Penerbangan dari Medan akan tiba di Madinah pada hari yang sama. Penerbangan haji diangkut Garuda, selebihnya oleh Saudi Arabian Airlines. Garuda akan mengoperasikan 295 penerbangan dari 10 titik embarkasi di seluruh Indonesia. Dia mengatakan, 14 pesawat Garuda yang mengangkut para jamaah, termasuk 10 pesawat Airbus, tiga Boeing 747 dan satu Boeing 777. (an/m10)

Semoga di tahun berikutnya banyak para pedagang seperti kami yang melaksanakan ibadah haji, “ ka-

ta Yusnida Tanjung sesaat sebelum memasuki ruangan Madinatul Hajj Asrama Haji Medan. (m37)

Kasus Dul, KPAI Minta ... Sebelumnya, kriminolog dan anggota Kompolnas, Adrianus Meliala mengatakan bahwa UU Perlindungan anak lebih tepat digunakan kepada anak yang berbuat suatu tindak pidana karena dijerumuskan seperti mencuri, menjual minuman keras, dan sebagainya. Oleh karena itu, perbuatan Dul yang mengemudi tanpa SIM dan menewaskan banyak orang tidaklah berkaitan dengan UU Perlindungan Anak melainkan hukum pidana terkait lalu lintas. Dikatakan Ihsan, dalam kasus kecelakaan maut dimana Dul sudah ditetapkan sebagai tersangka, pasal yang digunakan boleh menggunakan pasal pidana lalu lintas dimana ancamannya 6 tahun penjara. Tapi dalam prosesnya tetap menggunakan UU No. 3 tahun 1997 tentang pengadilan anak dan UU 23/2002 tentang perlindungan anak. “Karena Dul masih anak-anak, ancamannya separuh orang dewasa atau maksimal dituntut 3 tahun. Ini juga harus ditangani polisi anak, jaksa anak dan hakim anak. Proses pengadilan juga tertutup, dilindungi identitas, didampingi orang tua dan penasehat hukum,” imbuh Ihsan. UU PA juga memungkinkan adanya diversi atau keluar dari proses hukum dengan memberikan rehabilitasi, intervensi kepada anak pelaku tindak kriminal yang difasilitasi oleh pekerja sosial. “UU PA juga mengedepankan hak anak untuk belajar, istirahat dan sebagainya dipenuhi. Jadi koridornya tetap pada kepentingan terbaik bagi anak. Kalau anak disamakan dengan orang dewasa, hukumannya nanti malah tidak efektif,” kata Ihsan. Dalam hal ini, Ihsan berharap proses hukum terhadap AQL tidak dikaitkan dengan pengaruh orang tuanya, tapi sepenuhnya mengacu pada amanat UU Perlindungan Anak sebagai upaya melindungi anak dari dampak pemidanaan. “UU PA juga menyatakan ketegasan tentang peran orang tua sebagai pihak yang ikut bertanggung jawab secara hukum,” tandas Ihsan. (dianw)

Al Bayan ... Dalam ajaran Islam event itu sangat diharamkan. Dalam Islam perempuan mendapat tempat yang sangat terhormat. Allah telah mewjibkan suami membayar mahar, mencari nafkah, dan tinggal di rumah sebagai makhluk terhormat. Dalam Islam Haram bagi perempuan berbicara yang menggoda, melenggak-lenggok di depan umum, juga haram membuka aurat. Barang siapa yang melanggar ketentuan ini akan berdosa besar. Muslimah sejati tidak mau membuka auratnya. Negara-negara Islam melarang Miss World, sebaliknya negara-negara sekuler bahkan turut membiayainya. Dari Alquran dan hadis kita temukan ada Miss Akhirat (Hurrun Aini) yang dalam bahasa Indonesia disebut bidadari. Dara-dara cantik akhirat ini disediakan Allah SWT untuk para syuhada, mukmin sejati dari pemeluk agama Tauhid. Siapa yang ingin memiliki Miss Akhirat hendaklah ia menjadi hamba Allah yang shaleh. Misss Akhirat jauh lebih cantik dari MissWorld (Miss Dunia). Miss Akhirat diciptakan Allah sangat rupawan, bahkan menurut Mufassirin (Ahli Tafsir), kecantikan mereka 99 (sembilan puluh

Sembilan) persen dari kecantikan Miss Dunia yang cuma satu persen. Bidadari itu diciptakan dari cahaya, campur yakut dan zamrut, luluk dan marjan. Subhanallah cantiknya. Jika dibandingkan dengan para ratu dunia, apakah miss word atau miss kopi, miss universal, miss wortel ibarat intan dan batu biasa. Kecantikan miss-miss dunia dapat dilihat oleh siapa saja lewat gambar mereka yang disiarkan televisi tetapi kecantikan Miss Akhirat hanya dapat dinikmati oleh pemiliknya yakni penghuni-penghuni surga, yakni para syuhada dan shalihin. “Bidadari-bidadari yang jelita, putih bersih dipingit dalam kamar rumah (55:72). Seakan-akan bidadari itu permata yakut dan marjan. Para bidadari itu sangat santun, menunduk pandangannya, tidak liar (55:56) Cerita bidadari bukan dongeng, tetapi janji Allah SWT kepada penghuni surga. Kisah kecantikan mereka itulah yang mengilhami iblis dan khannas menggoda manusia tertentu untuk memperlombakan para gadis dari berbagai bangsa dan negara. Mereka boleh saja menikmati cantik molek gadis-gadis dunia, tetapi mereka tidak bakal dapat menikmati gadis-gadis akhirat yang sangat jelita.


WASPADA Rabu 11 September 2013

Medan Metropolitan A3 Penyulingan Gas Oplosan Digerebek MEDAN (Waspada): Reskrim Unit Ekonomi Polresta Medan menggerebek rumah yang dijadikan lokasi oplosan gas bersubsidi ke non subsidi di Jln. Melati, Sari Rejo Medan, Kamis (5/9). Selain mengamankan pemiliknya W alias Apoy dan pekerjanya D, polisi juga menyita barang bukti puluhan tabung gas isi 3 kg dan isi 12 kg, 64 segel tabung gas warna putih, 5 segel tabug gas warna merah, tang, selang gas, besi kuningan penyambung oplosan, dan obeng. Kasat Reskrim Kompol Jean Waspada/Rudi Arman

KASAT Reskrim Kompol Jean Calvijn Simanjuntak (tiga kiri) saat ekspos penggerebekan gas oplosan di Jln. Melati Sarirejo Medan, Selasa (10/9).

Calvijn Simanjuntak saat ekspos dilokasi penggerebekan, Selasa (10/9) mengatakan, terungkapnya kasus itu berdasarkan informasi masyarakat. “Polisi kemudian menuju ke lokasi dan mencurigai salah satu rumah yang setelah dilakukan pemeriksaan banyak tersimpan tabung gas 12 kg dan 3 kg diduga hasil penyulingan,” sebutnya. Menurut Calvijn, dari rumah itu diamankan W alias Apoy dan L. Ketika ditanya tentang dokumen dan keberadaan tabung gas tersebut tidak bisa menjelaskan atau memperlihatkan dokumennya.”Saat

dilakukan pemeriksaan kedua mengaku telah melakukan penyulingan gas subsidi ke non subsidi menggunakan alat besi penyulingan,” katanya. Ditanya siapa pemilik usaha ini, kedua tersangka mengaku milik Kodri. “Saat ini yang bersangkutan masih kita buron. Sedangkan kedua tersangka kita boyong ke Polresta Medan,” tuturnya. Dalam kasus ini, pihaknya akan memintai keterangan saksi ahli dari BPH Migas dan mengamankan lokasi yang dijadikan penyulingan gas oplosan. Sedangkan tersangka dikenakan pasal 53 UU RI No. 22

tahun 2001 tentang minyak dan gas bumi dengan ancaman 6 tahun penjara atau denda Rp60 miliar atau pasal 62 UU RI No. 8 tahun 1999 tentang perlindungan konsumem dengan ancaman 5 tahun penjara atau denda Rp2 miliar. Sedangkan tersangka Apoy mengaku sudah melakukan kegiatan ini empat bulan yang lalu. “Sudah empat bulan beroperasi dengan sistem tabung gas 12 kg diisi 3 atau 4 tabung gas isi 3 kg,” ujarnya. Tabung gas 3 kg bersubsi dibeli Rp13 ribu dan disuling ke tabung gas 12 kg dan dijual ke pengecer Rp65 ribu.(m39)

Polisi Jangan Bergaul Dengan Bandar Narkoba MEDAN (Waspada): Kasat Reserse Narkoba Polresta Medan Kompol Dony Alexander meminta seluruh personel di jajarannya tidak bergaul dengan bandar narkoba. “Jangan sekali-kali bergaul dengan bandar narkoba. Sebab, kita yang bermaksud membuat kebenaran, bisa diisukan negatif. Bahkan mendapat tudingan yang tidak benar,” kata Kompol Dony usai memberi penghargaan kepada empat anggota yang berprestasi di restoran Wong Solo, Senin (9/9). Saat ini, kata Dony, pihaknya sedang mengincar bandar narkoba guna memutus mata rantai peredarannya dan melindungi masyarakat . “Diharapkan semua personel Sat Reserse Narkoba bisa lebih baik dalam mengungkap berbagai kasus penyalahgunaan narkoba,” ujarnya. Dony juga mengingatkan, banyak orang yang mengawasi kinerja polisi. Terkadang, polisi sudah bekerja baik, tetapi masih mendapat fitnah. Apalagi jika polisi tidak bekerja dengan baik. Karenanya, seluruh anggota ha-

rus mampu menjalankan tugas dengan baik dan bisa bersaing dalam meraih prestasi. Nama anggota yang mendapat penghargaan, yakni ter-

baik hasil tangkapan Aipda R Situmorang. Ungkap kasus dinilai dari laporan polisi Aiptu Herman. Penyidik terbanyak selesaikan P22 Aiptu J Sembiring.

Anggota terajin dan terbaik Aiptu Dison Barus. Sedangkan personel yang kurang berprestasi Bripka JR Simanungkalit dan Briptu D Simangunsong. (m39)

Waspada/Rudi Arman

KASAT Reserse Narkoba Polresta Medan Kompol Dony Alexander memberikan penghargaan kepada anggota yang berprestasi di restoran Wong Solo, Senin (9/9).


Medan Metropolitan

A4

Perampok Rampas Sepedamotor MEDAN (Waspada): Sepedamotor Destiyansah alias Dian, 20, warga Jln. Pasar VII Helvetia, Kec. Medan Helvetia, dirampas empat perampok di Jln. William Iskandar depan Sekolah Perkebunan LPP. Korban melaporkan kejadian itu ke Polsek Percut Seituan, Selasa (10/ 9) siang.

Kepada petugas Polsek Percut Seituan, korban mengatakan, perampokan tersebut terjadi Minggu (8/9) dinihari sekira pukul 01:00. Saat itu, korban bersama kekasihnya, Nanda, 20, warga Jln. Karya, Kec. Medan Helvetia mengendarai sepedamotor Satria FU BK 6207 NAZ. Saat melintas di Jln. William Iskandar depan kampus LPP, tiba-tiba empat pelaku me-

Ikalima 88 Gelar Nge-Blog Di SMAN 5 Medan MEDAN (Waspada): Kegiatan acara “Nge-Blog” bersama guru dan siswa dan ‘Tanding Futsal Persahabatan di SMAN 5 Jln. Pelajar Medan, yang digelar Ikatan Alumni SMAN 5 Medan angkatan 88 (Ikalima 88) dalam rangka HUT Perak, berjalan lancar dan sukses, Sabtu (7/9). Pelatihan “Nge-Blog” yang diikuti puluhan siswa dan guru dipandu Pieter Silitonga dan Saurma MGP Siahaan berjalan lancar. Selain itu, juga diadakan pertandingan futsal persahabatan Ikalima 88 dan Siswa SMAN 5 Medan. Pieter Silitonga didampingi Saurma MGP Siahaan dan Nadra Ideyani Vita mengatakan, kegiatan tersebut untuk meningkatkan minat dan kemampuan guru dan siswa dalam menyikapi kemajuan jaman, khususnya dalam profesionalitas di dunia Blogger. “Para guru yang sudah mengajar di kelas akan dapat lebih mendekatkan diri dengan berkomunikasi lanjutan di Blog bersama para siswanya. Khususnya untuk mendapat penjelasan lebih lanjut terkait pelajaran yang sudah mereka terima, ataupun membahas perkembangan pengetahuan dan sebagainya,” ujarnya. Menurut Pieter, kegiatan tersebut akan memberikan pengalaman tersendiri bagi siswa dan guru, bagaimana cara membuat Blog sesuai keinginan dan desain sendiri serta dapat dimanfaatkan positip untuk menambah pengetahuan. Sementara itu, Saurma mengatakan, kegiatan yang digelar Ikalima 88 ini dimeriahkan dengan pemberian hadiah modem kepada guru dan siswa yang dipersembahkan Esia lewat permainan di akhir pelatihan. Selain itu, kata dia, dilakukan tanding futsal persahabatan Ikalima 88 dan Siswa SMAN 5 Medan. Dalam akhir pertandingan Ikalima 88 memberikan dana pembinaan sebesar Rp1 juta yang diserahkan langsung oleh Fatimah Nasar dari 3G Coffee yang diterima oleh Kepala SMAN 5 Medan Drs H Haris H Simamora MSi. Saurma menjelaskan, acara puncak HUT Perak 25 tahun alumni angkatan tahun 88 atau Ikalima 88 akan digelar, Sabtu (14/9) mulai pukul 16:00, di Garuda Plaza Hotel (GPH) Jln. Sisingamangaraja Medan. “Reuni Ikalima 88 untuk yang pertama kali digelar ini, diharapkan akan menjalin tali silaturahmi dalam menyatukan seluruh alumni 88. Diharapkan seluruh alumni SMAN 5 angkatan 88 agar datang ke Hotel Garuda Plaza Hotel Medan,” katanya. (cwan)

Pembinaan Generasi Melalui Upacara Bendera MEDAN (Waspada): Guna meningkatkan pembinaan generasi muda, Koramil Sunggal dan SMP Negeri 1 Sunggal melaksanakan upacara pengibaran bendera pada Senin (9/9). Danramil 01 Sunggal Kapten Imam Karmani dalam sambutannya mengajak seluruh siswa/i agar senantiasa menjaga kedisiplinan sosial, baik di lingkungan tempat tinggal, sekolah maupun tempat umum. Di era teknologi serba canggih ini, para peserta didik harus mewaspadai segala bentuk pengaruh yang masuk. Apalagi peredaran narkoba dan pornografi sudah sangat mengkhawatirkan. “Melalui upacara ini, saya harapkan siswa/i SMPN 1 Sunggal terus mewaspadai gejala-gejala yang akan timbul dengan tetap menjaga ketahanan nasional dan semangat bela Negara,” ujarnya. Upacara yang diprakarsai Dandim 0204/Deliserdang Letkol Arh Syaepul MG, SIP ini, berlangsung hikmad. Hadir dalam upacara ini Koramil 01 Sunggal, Wakil Kepala Sekolah SMPN 1 Sunggal Armon, SH, dan seluruh guru serta para pelajar.(m36)

Waspada/ist

DANRAMIL 01 Sunggal Kapten Imam Karmani memberikan sambutan pada upacara pengibaran bendera di SMPN 1 Sunggal, Senin (9/9).

ngendarai dua sepedamotor Ninja Warior warna hijau dan Mio Soul tanpa plat menghampiri korban. Dua pelaku yang mengendarai Ninja Warior mencabut kunci kontak sepedamotor korban, sehingga seketika kendaraan korban berhenti. Kemudian korban ditendang hingga terjatuh dari sepedamotor bersama kekasihnya. Korban tak dapat melawan karena ditodong pisau. Takut ancaman pelaku, korban hanya pasrah saat sepedamotornya dirampas dan dibawa kabur oleh para pelaku. Walau korban sempat berteriak minta tolong, namun tak ada warga yang menolongnya.

“Aku sama cewekku habis jalan-jalan, rencana mau lihat balapan liar. Pas lewat di Jln.William Iskandar, aku dihampiri sama orang itu. Yang naik Ninja Warior langsung ngambil kunci terus nendang hingga kami berdua jatuh,” ujar Dian. Menurut dia, dirinya tak dapat berteriak lantaran perutnya ditodong pisau. “Aku nggak bisa teriak, takut ditikamnya. Soalnya pisau udah nempel di perutku, cewekku juga ditodong pisau. Aku Cuma bias pasrah. Setelah orang itu jalan bawa keretaku, disitulah aku teriak.Tapi tidak ada yang mau nolong,” katanya. Akibat kejadian itu, korban kehilangan sepedamotor Satria FU miliknya yang baru tiga

Waspada/Rizky Rayanda

RATUSAN buruh menggelar unjukrasa di depan kantor Wali Kota Medan, Selasa (10/9).

Buruh PT ASWF Unjuk Rasa Di Kantor Wali Kota Medan bulan lunas dibeli. Namun, timbul kecurigaan terhadap kekasihnya. Sebab, dia baru dua hari berkenalandengankekasihnyatersebut.Pascakejadianitu,kekasihnya itu tidak bisa lagi dihubungi. “Aku ada curiga juga bang sama cewekku itu. Soalnya, aku baru kenal dua hari dengan dia, itu pun dikenali sama kawan. Sampai sekarang HPnya udah gak aktif lagi, padahal mau dijadikan saksi,” sebut Dian. Terpisah Kapolsek Percut Seituan AKP Ronald Sipayung saat dikonfirmasi mengatakan, pihaknya telah menerima laporan korban. “Sudah kita terima pengaduan korban dan kasusnya masih dalam penyelidikan,” tuturnya. (h04)

Gaung FDT Belum Semarak MEDAN (Waspada): Tahun pertama perubahan antara Pesta Danau Toba menjadi Fertival Danau Toba (FDT) 2013, gaungnya belum semarak ke manca negara, mengingat panitia masih terburu waktu. “Waktu tiga bulan tidak cukup mempersiapkan event nasional yang gaungnya bersifat internasional. Panitia membutuhkan waktu lama untuk meyakinkan wisatawan termasuk pemangku kepentingan (stake holder),” kata Ketua DPD Association of the Indonesian Tour & Travel Agencies (Asita) Sumatera Utara Solahuddin Nasution SE, MSP, saat dikonfirmasi di kantornya Cipta Tour Jln. Juanda Medan, Selasa (10/9). Menurut dia, event tersebut waktunya harus tepat setiap tahun. FDT tahun depan harus lebih baik dari tahun ini. Nasution mengimbau semua pihak harus mendukung event yang tergolong penting di Sumatera Utara, agar ke depan benar-benar menjadi event yang gaungnya mendapat sambutan wisatawan manca negara dari Eropa. Dari pelaksanaannya FDT

ke-10 sudah baik, terbukti Kementerian Pariwisata dan Ekonomi Kreatif bersama panitia pusat, provinsi, dan panitia tujuh kabupaten disekitar Danau Toba ikut berperan penting dalam event tersebut. Sementara biaya pelaksanaan juga meningkat dari Rp1,5 miliar hingga Rp2 miliar menjadi Rp10 miliar. “Kalau memang event melibatkan wisatawan Eropa, dana sebesar itu masih tergolong sedikit,” kata Solahuddin. Begitupun, kata dia, panitia nantinya harus mengevaluasi pelaksanaan FDT tersebut, agar masing-masing pemangku ke-

pentingan mengetahui dimana kekurangan-kekurangan yang dapat diperbaiki untuk keberhasilan acara berikutnya. Sebelumnya, Ketua Panitia FDT 2013 Mangindar Simbolon kepada wartawan di Medan membenarkan, Festival Danau Toba yang dibuka Menko Perekonomian Hatta Rajasa, Minggu 8 September, diyakini gaungnya bersifat internasional. Event tersebut akan berlangsung setiap bulan September sejak 2013 hingga 2017, bahkan panitia nasional ditantang dapat menghadirkan sebanyak mungkin wisatawan ke Sumut. Kata Simbolon, melalui kunjungan mereka dapat meningkatkan devisa negara dan kesejahteraan masyarakat daerah disekitar Danau Toba maupun Sumut pada umumnya. “Contohnya, hotel-hotel seminggu sebelumnya sudah penuh dibooking wisatawan, diperkirakan selama event tersebut berlangsung, datang sekitar 50 ribu wisatawan. “Jadi, kalau setiap wisatawan menghabiskan rata-rata Rp1 juta, sudah terserap lebih kurang Rp50 miliar,” tuturnya. (m32)

Tahanan Polsek Delitua Tewas MEDAN (Waspada): Tahanan Polsek Delitua berinisial KG, 27, warga Jln Letjen Jamin Ginting, terlibat kasus pencurian HP dan tabung gas, meninggal dunia, Selasa (10/9) pagi. Informasi diterima wartawan, tersangka KG sebelumnya babak belur dihajar massa di Pasar Kwala Bekala karena kepergok korban A Sembiring mencuri HP dan tabung gas miliknya. Tersangka KG sebelumnya dibawa petugas dari sel tahanan Polsek Delitua ke RS Bhayangkara untuk menjalani perawatan sekira pukul 05:00. “Tersangka meninggal dunia sekira pukul 06:00 di RS Bhayangkara Poldasu Medan setelah sempat menjalani perawatan medis,” kata Kapolsek Delitua AKP Wahyudi SiK, saat dikonfirmasi. Menurut Kapolsek, tersangka KG ditahan mulai, Senin (19/ 8) sore, akibat ketahuan melakukan pencurian HP dan tabung gas milik A Sembiringg, 40, warga Pasar Kwala Bekala, Kel.

Kwala Bekala, Kec. Medan Johor. “Dia ditangkap setelah babak belur dipukuli massa, sehingga dijebloskan ke tahanan Polsek Delitua untuk mempertanggungjawabkan perbuatannya. Sedangkan berkas perkaranya telah dilengkapi menunggu dilimpahkan ke rumah tahanan kejaksaan,” ujar Wahyudi. Sebelumnya, Senin (9/9), seorang kakek jompo diperkirakan berusia 70 an tahun ditemukan tewas di teras rumah kontrakan milik warga yang tidak ada penghuninya di Kel. Baru Ladang Bambu, Medan Tuntungan. Dari saku korban, ditemukan kartu identitas atas nama Zubir R, kelahiran Medan, 31 Desember 1943, beralamat di Kampung Lalang, Sunggal. Menurut informasi, sekitar tiga minggu yang lalu, korban diantar oleh seorang penarik becak bermotor (betor) ke lokasi kejadian yang merupakan em-

WASPADA Rabu 11 September 2013

peran rumah kontrakan tidak berpenghuni. Usai mengantar korban, penarik betor itu pergi. Saat itu, keadaan korban dan pakaiannya masih bersih. Korban juga sering terdengar menyebutnyebut nama Sabaruddin. Belum diketahui apakah Sabaruddin itu merupakan anaknya atau orang lain, masih dalam penyelidikan polisi. Termasuk menghubungi nomor HP yang ada di kartu nama yang ditemukan di saku celana korban. Mayat korban kemudian dievakuasi polisi ke RSUP H Adam Malik Medan untuk divisum. Kasus tersebut masih dalam penyelidikan Polsek Delitua. Kapolsek Delitua AKP Wahyudi SIk, yang dikonfrimasi membenarkan peristiwa tersebut. “Petugas masih menghubungi keluarga korban dengan menggunakan alamat yang terdapat di saku celananya,” tuturnya. (m40)

MEDAN (Waspada): Ratusan buruh yang tergabung dalam Pimpinan Unit Kerja Serikat Pekerja Aneka Industri Federasi Serikat Pekerja Metal Indonesia (PUK SPAI-FSPMI) PT. Asia Sakti Wahid Food (ASWF) mendatangi KantorWali Kota Medan, Selasa (10/9). Kehadiran para buruh itu langsung disambut personel Polresta Medan dan anggota Satpol PP Kota Medan. Lalu, perwakilan buruh diterima Sekda Syaiful Bahri. Per wakilan bur uh Minggu Saragih mengatakan kepada Sekda Kota Medan Syaiful Bahri, PT ASWF melakukan PHK terhadap 600 buruh kontrak lama dan buruh meminta agar mereka dipekerjakan kembali. Mereka juga meminta agar pekerja dari biro jasa diangkat menjadi karyawan tetap yang telah bekerja bertahun-tahun di bagian produksi. Sekda Kota Medan Syaiful Bahri mengatakan, pihaknya akan menindaklanjuti laporan para

buruh serta menurunkan tim dari Dinas Sosial dan Tenaga Kerja (Dinsosnaker) Kota Medan. Dia juga meminta kepada Kepala Dinsosnaker Medan Armansyah Lubis untuk mengawasi hakhak buruh. Syaiful sangat menyesalkan kinerja Dinsosnaker yang dinilainya sangat lemah dalam melakukan pengawasan terhadap pengusaha di Kota Medan. “Bila perlu harus ditinjau seluruh perusahaan di Medan ini dan dilakukan pengawasan. Buat aturan dan pengawa-san. Jangan hanya ini saja kerja kita setiap bulan,” tegas Syaiful. Sementara itu, Kadinsosnaker Armansyah mengatakan, pihaknya telah membentuk tim pengawas dan tim tersebut sudah berjalan. Dia berjanji akan menindaklanjuti keluhan para buruh PT. ASWF. “Saya segera turun ke perusahaan tersebut untuk menin-daklanjuti persoalan buruh,” ujarnya.(m50)

Pencurian Sepedamotor Terekam CCTV MEDAN ( Waspada): Aksi pencurian sepedamotor Honda Supra X 125 BK 6725 LO milik Syamsuri, 34, di lokasi parkir toko tempatnya bekerja di Jln. Abdul Haris Nasution, Selasa (10/ 9), terekam CCTV. Saksi mata mengatakan, peristiwa itu terjadi pukul 06:30, berawal saat korban Syamsuri, warga Dusun Krani Lama, Desa Bulu Cina, Kec. Hamparanperak, Deliserdang, memakirkan kendaraannya di samping sepedamotor Honda Supra X 125 BK 6985 PAH milik temannya Syafrizal, 23, warga Telaga Jernih, Blok N, Kec. Sicanggang, Langkat, dalam kondisi stang terkunci. Korban bersama sejumlah temannya bekerja di toko itu sebagaimana biasanya, tiba-tiba muncul dua pelaku mengendarai sepedamotor Yamaha RX King dan berhenti di dekat sejumlah kendaraan parkir. Pelaku berlindung di salah satu pohon bunga. Kemudian satu di antaranya berjalan menuju ke parkir sepedamotor memegang handphone seperti orang lagi bertelepon sambil merogoh saku celana. Sementara satu lagi pelaku standby

di atas sepedamotor Yamaha RX King keadaan mesin hidup. Selanjutnya, pelaku duduk di sepedamotor Honda Supra X BK 6985 PAH lalu merusak kunci kontak dengan kunci letter T. Melihat situasi aman, pelaku mengeser sepedamotor karena tidak bisa mesinnya dihidupkan, kendaraan itu ditinggalkan di lokasi tersebut. Seterusnya pelaku mendekati sepedamotor Honda Supra X BK 6725 LO dan merusak kunci kontaknya dengan kunci letter T, lalu kendaraan itu digeser dan ketika distater mesinnya hidup dan langsung dibawa kabur. Korban Syamsuri baru mengetahui sepedamotornya hilang ketika keluar hendak membeli sesuatu. Ketika dilihat di CCTV, tenyata pelakunya dua orang. Secara terpisah, Waspada memberitahukan kepada Panit Reskrim Polsek Delitua Aiptu M Tanjung SH, bahwa terjadi pencurian sepedamotor dan pelakunya terekam di CCTV. “Kita akan menurunkan personel ke lokasi hilangnya sepedamotor itu,” sebutnya. (m36)

Alumni IPB Bantu Perjuangkan Dana Bagi Hasil Perkebunan MEDAN (Waspada):- Gubernur Sumatera Utara H Gatot Pujo Nugroho menyambut baik niat Ikatan Alumni Institut Pertanian Bogor (IPB) memperjuangkan perolehan Dana Bagi Hasil Perkebunan. Para alumni akan ambil peran dalam proses pengajuan uji materi (judicial review) terhadap UU No. 33/2004 tentang Perimbangan Keuangan Antara Pemerintah Pusat dan Pemerintah Daerah yang akan diajukan ke Mahkamah Konstitusi oleh 10 Provinsi se Sumatera. “Mudah-mudahan ini akan menjadi energi baru bagi kita untuk bersama-sama memperjuangkan dana bagi hasil perkebunan,” ujar Gubsu saat menerima Ikatan Alumni IPB di Kantor Gubsu, Selasa (10/9). Hadir dalam kesempatan itu Ketua Ikatan Alumni IPB Chaidir Ritonga beserta jajaran pengurus, Kepala Dinas Perkebunan Sumatera Utara Aspan Sopyan serta Kadis Kominfo Sumut Jumsadi Damanik. Seperti diketahui Sumatera Utara menjadi inisiator untuk mengusulkan kepada pemerintah pusat pembagian dana bagi hasil sektor perkebunan yang didukung oleh 18 provinsi penghasil perkebunan. Namun usulan tersebut belum dapat diloloskan karena UU No. 33/ 2004 tentang Perimbangan Keuangan Antara Pemerintah Pusat dan Pemerintah Daerah tidak memasukkan perkebunan sebagai objek bagi hasil antara

pemerintah pusat dan daerah penghasil perkebunan. Gatot mengungkapkan, pada 2011 Pemerintah mendapatkan devisa sebesar Rp220 triliun dari ekspor sektor perkebunan Sumut yang didominasi produk kelapa sawit serta Bea Keluar (BK) produk CPO senilai Rp28,3 triliun. Namun devisa tersebut tidak menetes ke daerah penghasil produk perkebunan. “Kalau saja dari Rp28,3 triliun dari penerimaan pajak ekspor CPO tersebut dikembalikan 5 persen saja ke daerah, maka ada Rp1,4 triliun yang bisa dimanfaatkan untuk memuluskan infrastruktur jalan hingga ke perkebunan,” kata Gubsu. Chaidir Ritonga dalam kesempatan tersebut mengungkapkan, Alumni IPB Sumatera

Utara akan mendukung usaha Pemerintah Provinsi Sumut dan DPRD Sumatera Utara untuk memperjuangkan Dana Bagi Hasil Perkebunan khususnya dalam proses uji materil UU No 33/2004. Kata Chaidir, pimpinan DPRD 10 provinsi se Sumatera sudah sepakat untuk mengajukan uji materi terhadap UU tersebut. Selanjutnya, akan dilakukan MoU antara Pimpinan DPRD se Sumatera dan Gubernur se Sumatera untuk mengajukan judicial review ke MK. Sebelum itu pada akhir September ini pihaknya akan menggelar Focus Group Discussion (FGD) yang akan menghadirkan para pengusaha perkebunan, ahli hukum tata negara Yusril Ihza Mahendra dan Gubsu.(m28)

Waspada/Amir Syarifuddin

GUBERNUR Sumatera Utara Gatot Pujo Nugroho menerima audiensi Ikatan Alumni IPB di Kantor Gubsu, Selasa (10/9).


Medan Metropolitan

WASPADA Rabu 11 September 2013

A5

Jadwal Penerbangan Di Bandara KNIA No. Penerbangan Ke Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-143 6 Jakarta GA-189 7 Jakarta GA-191 8 Jakarta GA-193 9 Jakarta GA-195 10 Banda Aceh GA-278 11 Banda Aceh GA-142 12 Banda Aceh GA-280 14 Palembang GA-266 15. Palembang GA-268 16. Batam GA-270 17. Batam GA-272 18. Padang GA-260 19. Penang GA-802 20. Penang GA-804

Tiba Dari

Flight

CITILINK 1. Jakarta 2. Jakarta 3. Jakarta 4. Jakarta 5. Batam

Pukul

05.15 08.55 11.00 12.10 13.20 13.55 16.45 18.30 20.30 06.10 09.40 17.10 06.00 17.1 09.30 13.20 10.35 06.20 13.55

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh Banda Aceh Palembang Palembang Batam Batam Padang Penang Penang

GA-180 GA-142 GA-182 GA-184 GA-186 GA-188 GA-190 GA-192 GA-196 GA-279 GA-143 GA-281 GA-267 GA-269 GA-271 GA-273 GA-261 GA-803 GA-805

08.10 08.55 10.15 11.25 13.10 16.00 17.30 19.30 22.10 08.45 12.35 19.45 09.55 21.15 12.50 19.45 16.25 08.55 16.20

QG-831 QG-837 QG-833 QG-835 QG-882

08:40 09:30 18:50 20:10 14:55

Jakarta Jakarta Jakarta Jakarta Batam

QG-830 QG-832 QG-836 QG-834 QG-883

05:55 06:55 12:15 17:25 16:40

AIR ASIA 1 Kuala Lumpur 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur 5 Penang 6 Penang 7 Kuala Lumpur 8 Baangkook 9 Bandung 10 Surabaya 11 Bandung 12 Banda Aceh 13 Pekanbaru 14 Singapura 15 Singapura

QZ-8050 QZ- 8054 AK- 1351 AK-1355 QZ-8072 AK-5837 AK-1357 QZ-8084 QZ-7987 QZ-7611 QZ-7981 QZ-8022 QZ-8028 QZ-664 QZ-668

06.05 11.20 08.00 17.25 10.40 18.30 21.25 17.00 08.25 11.35 17.10 11.00 07.00 09.20 18.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Bangkok (2,4,6) Bandung Surabaya Bandung Banda Aceh Pekanbaru Singapura Singapura

QZ-8051 QZ-8055 AK-1350 AK-1354 QZ-8073 AK-5836 AK-1356 QZ-8085 QZ-7986 QZ-7610 QZ-7980 QZ-8023 QZ-8029 QZ-665 QZ-669

08.30 10.55 07.35 17.00 16.30 18.15 21.05 29.55 05.35 11.10 19.55 13.20 10.30 12.35 21.15

LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8. Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Jakarta

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 215 JT-201 JT- 387 JT-399 JT-383 JT-385 JT-1282 JT-1288 JT-205 JT-203 JT-219 JT-309 JT-209 JT-0970 JT-972 JT-396 JT-305

0545 06.45 07.50 08.40 10.00 11.00 11.50 12.25 12.50 13.50 15.20 15.50 17.00 08.05 13.35 2010 18.00 20.40 19.10 21.00 07.00 12.55 12.15 18.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabaya Surabaya Banda Aceh Jakarta

JT-380 JT-300 JT-394 JT-302 JT-214 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT-1283 JT-1289 JT-206 JT-208 JT-386 JT-308 JT-218 JT-971 JT-973 JT-397 JT-210

08.20 09.20 10.20 11.10 11.40 12.10 13.10 14.40 15.10 16.20 17.20 17.50 19.45 10.25 15.55 9.20 18.25. 21.05 22.20 23.20 12.15 16.00 07.05 07.20

MALAYSIA 1 Kuala Lumpur 2 Kuala Lumpur

MH-861 MH-865

09.40 15.45

Kuala Lumpur Kuala Lumpur

MH-860 MH-864

08.50 15.00

SILK AIR 1 Singapura 2 Singapura

MI-233 MI-237

08.40 20.35

Singapura Singapura

MI-232 MI-238

07.50 19.50

VALUAIR 1 Singapura (2.4,7) VF-282 2 Singapura (1,3,6) VF-284 3 Singapura (Jumat)VF-282

10.35 18.30 09.45

Singapura (2.4.7) VF-281 Singapura (1,3,6) VF-283 Singapura (Jumat)VF-281

09.55 17.40 09.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.55 16.50 10.20 17.20 12.50 07.20 16.00

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.00 16.20 14.55 11.50 15.45 14.20 09.50 14.10

FIRE FLY 1 Subang 2 Penang 3. Penang

FY -3413 FY- 3403 FY- 3407

14.35 10.55 18.20

Subang Penang Penang

FY-3412 FY-3402 FY-3406

14.05 10.35 17.55

07.30 11.45 18.50

Singapura Jakarta Jakarta

RI-862 RI-093 RI-097

08.00 12.00 19.30

MANDALA AIRLINE 1 Jakarta RI-092 2 Singapura RI-861 3. Jakarta RI-096

Jadwal Perjalanan Kereta Api No KA

Nama KA

Kelas

Dari

Tujuan

Berangkat

U.28 Sri Bilah Eks/Bisnis Medan RantauPrapat U30 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.32 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.34 Sri Bilah Eks/Bisnis Medan Rantau Prapat U.27 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.29 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.31 Sri Bilah Eks/Bisnis Rantau Prapat Medan U.33 Sri Bilah Eks/Bisnis Rantau Prapat Medan U35 Sri Lelawangsa Ekonomi Tebing Tinggi Medan U36 Sri Lelawangsa Ekonomi Medan Tebing Tinggi U37 Sireks Ekonomi Siantar Medan U38 Sireks Ekonomi Medan Siantar U.39 Putri Deli Ekonomi Tanjung Balai Medan U.40 Putri Deli Ekonomi Medan Tanjung Balai U.41 Putri Deli Ekonomi Tanjung Balai Medan U.42 Putri Deli Ekonomi Medan Tanjung Balai U.43 Putri Deli Ekonomi Tanjung Balai Medan U.44 Putri Deli Ekonomi Medan Tanjung Balai U45 Sri Lelawangsa Ekonomi Binjai Medan U46 Sri Lelawangsa Ekonomi Medan Binjai U47 Sri Lelawangsa Ekonomi Binjai Medan U48 Sri Lelawangsa Ekonomi Medan Binjai U49 Sri Lelawangsa Ekonomi Binjai Medan U50 Sri Lelawangsa Ekonomi Medan Binjai U51 Sri Lelawangsa Ekonomi Binjai Medan U52 Sri Lelawangsa Ekonomi Medan Binjai U53 Sri Lelawangsa Ekonomi Binjai Medan U54 Sri Lelawangsa Ekonomi Medan Binjai U55 Sri Lelawangsa Ekonomi Binjai Medan U56 Sri Lelawangsa Ekonom Binjai Medan U57 Sri Lelawangsa Ekonomi Medan Binjai U58 SriLelawangsa Ekonomi Binjai Medan U59 Sri Lelawangsa Ekonomi Medan Binjai Reservasi Tiket KA Medan (061-4248666)

08.17 10.47 15.46 22.50 08.45 15.20 17.10 23.55 05.36 18.17 06.25 14.27 07.55 06.57 13.20 13.12 19.00 16.57 05.45 05.00. 07.15 06.30 09.15 08.30 11.35 10.00 14.30 12.30 16.15 17.45 17.00 21.30 20.10

Datang

13.57 16.00 21.16 03.52 14.04 20.43 22.11 05.09 07.53 20.38 10.22 18.15 12.52 11.28 17.55 17.36 23.20 21.35 06.14 05.29 07.44 06.59 09.44 08.59 12.04 10.29 14.59 12.59 16.44 18.14 17.29 21.59 20.39

Jadwal Keberangkatan KA Bandara Medan –Kuala Namu No. KA

Berangkat

Tiba KNIA

Kuala Namu- Medan

No. KA

Berangkat KNIA Tiba Medan

U62 04:00 04:37 U63 05:55 06:42 U4A 06:15 06:52 U71 08:35 09:19 U8A 08:20 08:57 U5A 09:25 10:02 U14A 11:10 11:47 U11A 12:25 13:02 U18A 13:45 14:22 U15A 14:55 15:42 U22A 15:15 15:52 U19A 16:25 17:02 U26A 17:15 17:52 U23A 18:30 19:07 U26 19:10 19:47 U73 20:15 20:59 U70 20:00 20:37 U75 22:15 22:59 U72 22:00 22:37 U69 00:15 00:52 NB: Tiket dapat dibeli di stasiun KA Bandara Medan dan Kuala Namu. Pembayaran dapat menggunakan Kartu Prabayar, Debit dan Kredit Card. Tiket dapat dipesan 7 hari sebelum berangkat. (m32)

KASAT Lantas Polresta Medan Kompol M. Budi Hendrawan saat melakukan razia terhadap pelajar yang membawa mobil, Selasa (10/9).

Waspada/Rudi Arman

Kendarai Mobil Dan Sepedamotor Tanpa SIM

Sat Lantas Tilang 24 Pelajar MEDAN (Waspada): Sat Lantas Polresta Medan meningkatkan razia terhadap para pelajar yang mengendarai mobil dan sepedamotor. Hal ini bertujuan mengantisipasi adanya anak di bawah umur atau belum memiliki Surat Izin Mengemudi (SIM), namun diizinkan orangtuanya mengemudikan kendaraan bermotor. Dalam razia yang digelar Jln. Cik Ditiro dan Jln. Gajah Mada, Selasa (10/9), petugas Sat Lantas Polresta Medan memberi tindakan langsung (tilang) kepada 24 pelajar SMA yang mengendarai mobil dan sepedamotor tanpa SIM. “Sasaran razia ini adalah anak di bawah umur atau pela-

jar yang mengemudikan mobil dan sepedamotor tanpa dilengkapi SIM,” kata Kasat Lantas Polresta Medan Kompol M. Budi Hendrawan. Razia dilaksanakan di depan SMA Negeri 1 Jln. Cik Ditiro dan SMA Raksana Jln. Gajah Mada Medan. Dari dua lokasi ini terjaring 45 pelajar yang membawa mobil dan sepedamotor. Rincian pelanggaran, lanjut Budi, tidak memiliki SIM 24 kasus, tidak menggunakan helm 10 kasus dan pelanggaran lainnya 11 kasus. ”Bagi siswa yang tidak memiliki SIM, maka petugas menahan kendaraannya di lokasi razia. Kendaraan tersebut bisa diambil oleh anggota keluarga yang memiliki SIM,” ujarnya. Data di Sat Lantas, jumlah penindakan terhadap pelajar

yang mengemudikan sepedamotor dan mobil periode Januari - September 2013 sebanyak 4.179 tilang. “Mereka yang ditilang rata-rata berusia 16 tahun dan belum memenuhi syarat untuk memiliki SIM,” jelas Budi. Dijelaskannya, transportasi merupakan salah satu sarana penting dalam kehidupan. Setiap pergerakan manusia yang berjarak agak jauh, membutuhkan sarana transportasi. Sarana transportasi bisa berupa transportasi umum dan pribadi. Di Kota Medan, menurut Budi, sarana transportasi umum diantaranya angkutan kota, taksi, becak bermotor dan ojek. Selain menggunakan transportasi umum, masyarakat juga banyak menggunakan kendaraan pribadi. ”Kendaraan pribadi yang digunakan adalah mobil

dan sepedamotor. Kendaraan pribadi juga banyak digunakan pelajar SMA dan SMP,” katanya. Sebagian dari siswa yang menggunakan kendaraan tersebut disinyalir belum mempunyai SIM. Menurut undangundang No 22 tahun 2009 tentang lalulintas dan angkutan jalan pasal 81 ayat (2), (3), (4) dan (5) usia untuk SIM A, C dan D adalah 17 tahun. Dengan batasan usia dalam kepemilikan SIM hanya yang berusia di atas 17 tahun yang boleh mengunakan SIM. Hal ini bertujuan agar psikologi pengendara dianggap layak pada usia tersebut. Ada beberapa kejadian kecelakaan lalulintas yang korban atau tersangkanya masih anak-anak dibawah umur. Dalam rangka pencegahan

penggunaan kendaraan oleh anak-anak dibawah umur, maka Sat Lantas Polresta Medan melakukan beberapa kegiatan, di antaranya sosialisai dalam bentuk police go to school dan penegakan hukum. “Program kerja Sat Lantas Polresta Medan untuk kegiatan sosialisasi dalam bentuk police go to school dilakukan tiga kali setiap minggunya. Untuk kegiatan minggu ke 2 di bulan September 2013 tepatnya hari Senin, 8 September 2013, yakni sekolahan yang dikunjungi antara lain SMU Budi Satria, Harapan Mandiri, dan Yayasan Harapan,” tuturnya. Lebih dari 700 murid di tiga sekolah tersebut diberikan pendidikan berlalulintas, di antaranya pentingnya penggunaan helm, pentingnya uji kompeten-

si SIM, dan tata cara berlalulintas di jalan. Hal ini bertujuan untuk menciptakan keselamatan di jalan. Kasat Lantas Kompol M Budi Hendrawan mengharapkan peran orangtua dan guru dalam pendidikan berlaulintas. “Orangtua agar tidak memberikan sarana kendaraaan bermotor bagi anak-anak yang belum berhak untuk mengunakan kendaraan bermotor,” ujarnya. Pihak sekolah diharapkan turut berperan aktif untuk mengecek anak didiknya yang menggunakan kendaraan bermotor ke sokalah apakah sudah memiliki SIM atau belum, sehingga guru-guru ikut mengawasi dan melakukan peneguran terhadap siswasiswanya yang melakukan pelanggaran. (m39)

Sejumlah Pejabat Poldasu Dimutasi MEDAN (Waspada): Sejumlah pejabat di Mapoldasu dimutasi sebagai bentuk penyegaran untuk meningkatkan kinerja Kepolisian Daerah Sumut. Mereka yang dimutasi yakni Direktur Direktorat Reserse Kriminal Khusus (Krimsus) Kombes Pol Sadono Budi Nugroho menjadi Kepala Biro Operasional (Karo Ops) Poldasu menggantikan Kombes Iwan Hari Sugiarto yang dipromosikan sebagai Wakapolda Maluku Utara. Sedangkan posisi Kombes Sadono Budi Nugroho selanjutnya digantikan Kombes Dono Indarto yang sebelumnya Direktur Reskrimsus Polda Lampung.

Mutasi dan promosi jabatan itu, kata Kasubbid Pengelola Informasi dan Dokumentasi (PID) Bid Humas Polda Sumut AKBP Nainggolan, berdasarkan surat telegram (ST) Kapolri ST/ 1772/IX/2013 tanggal 9 September 2013. Kepada wartawan di Mapoldasu, Selasa (10/9), Nainggolan menyebutkan, selain jabatan Karo Ops dan Direktur Reskrimsus Poldasu, Kapolri juga melakukan mutasi sejumlah Kapolres. Yakni, Kapolres Langkat AKBP Erik Bismo dipromosikan menjadi Wadir Pamobvit Polda Metro Jaya. Sedangkan jabatan Erik Bismo selanjutnya diemban AKBP Yusmar yang sebe-

lumnya Kasubid Paminal Bid Propam Poldasu. Lalu, Kapolres Pakpak Bharat AKBP Guisepe Gultom dipromosikan menjadi Wadir Polair Poldasu menggantikan AKBP Alisman Nainggolan yang ditempatkan sebagai Wadir Binmas Poldasu. Jabatan yang ditinggalkan Guisepe Gultom kemudian diemban AKBP Dwi Asmoro, sebelumnya Kasubdit Regident Dit Lantas Poldasu. “Untuk pelantikan dan serah terima jabatan pejabat utama Poldasu paling lama dua minggu setelah TR turun,” kata Nainggolan. Sementara, Selasa (10/9) pagi, Kapoldasu Irjen Syarief

Gunawan menyerahterimakan jabatan kepada 12 pejabat utama dan Kapolres sejajaran Polda Sumut di Aula Kamtibmas Poldasu. Mereka yang dilantik, Kombes Kasmudi sebagai Karo Rena Poldasu yang sebelumnya Karo Rena Polda Aceh dan mengukuhkan AKBP Japerson P Sinaga sebagai Kapolres Batubara yang sebelumnya pejabat sementara. Kemudian Direktur Intelkam Poldasu dari Kombes Moh. Abdul Kadir dimutasi menjadi Analis Kebijakan Madya Bidang Ditkamneg Baintelkam Polri. Posisinya digantikan Kombes AriesWahyu Sutikno yang sebelumnya Kasubdit III Ditkamneg

Remaja Yatim Piatu Tiga Kali Diperkosa MEDAN (Waspada): Remaja putri berinisial H, 18, asal Kabupaten Toba Samosir mengaku tiga kali menjadi korban pemerkosaan oleh tiga pria di salah satu SMP Negeri di Pasar VIII Tembung, Kec Percut Seituan. Didampingi keluarganya, korban H melaporkan peristiwa tersebut ke Polsek Percut Seituan, Selasa (10/9). Kepada petugas kepolisian, korban mengaku diperkosa oleh tiga pria berinisial A, Ar dan seorang lagi pria bertato yang tidak diketahui namanya. Korban mengetahui ciri-ciri ketiga pelaku tersebut. Informasi yang diperoleh di kepolisian, korban yang berasal dari Toba Samosir tersebut baru beberapa bulan tinggal di rumah kerabat keluarganya di Pasar 8 Tembung. Dia ditampung sanak saudaranya karena tidak memiliki kedua orangtua lagi (yatim piatu). Diduga pemerkosaan yang dialami korban terjadi sebanyak tiga kali. Menurut korban, pria pertama yang melakukan pemerkosaan terhadap korban berinisial A, Sabtu (31/8). Saat itu

korban berjalan di depan rumah sanak keluarganya. Tiba-tiba datang A menghampiri korban dan menariknya ke sekolah tersebut. Meski sudah berteriak minta tolong, namun tidak ada warga yang datang menolongnya. Usai melakukan aksi bejatnya, pelaku mengancam korban agar tidak memberitahukan kejadian tersebut kepada siapapun. Jika korban melaporkannya, maka korban akan dibunuh. Setelah diperkosa, korban kembali ke rumah keluarganya. Dia tidak berani melaporkan peristiwa itu karena telah diancam akan dibunuh. Pada Senin (2/9), korban pergi ke warung yang tidak jauh dari rumah keluarganya. Tibatiba Ar, teman A datang dan menarik korban ke sekolah yang sama. Pelaku langsung memperkosa korban. Pelaku Ar juga mengancam korban agar tidak melaporkan peristiwa itu. Akibat pemerkosaan yang kedua tersebut, korban tidak pulang ke rumah, karena merasa takut. Pada, Rabu (4/9) korban

berjalan di depan sebuah bengkel di Pasar 8. Tiba-tiba seorang pria bertato yang diduga teman A dan Ar, menghampiri korban. Korban ditarik paksa oleh pelaku dan dibawa ke sekolah yang sama. Korban kembali diperkosa untuk ketiga kalinya. Akibat pemerkosaan tersebut, korban menjadi trauma. “Aku takut bang. Sementara aku baru tinggal di sini,” ujar korban dengan kepala tertunduk. Iros, 36, yang merupakan keluarga korban mengatakan, sudah satu minggu korban tidak pulang ke rumah. “Sudah satu minggu kami mencari korban. Pada Senin (9/9) sekira pukul 21:00, saya melintas di Jln. Aksara, Medan Tembung. Saya lihat, korban sedang duduk di warung kopi seperti orang linglung,” ujarnya. Iros langsung menghampiri korban dan menanyakan apa yang terjadi. Korban langsung menceritakan bahwa dirinya telah diperkosa oleh tiga pelaku. “Saya terkejut mendengar pengakuan korban. Langsung saya bawa pulang dan mengumpulkan sanak saudara untuk be-

rembuk. Setelah ada keputusan, barulah kami bawa korban ke Polsek Percut Seituan, untuk melaporkan kejadian pemerkosaan yang dialaminya,” ujar Iros. Iros menjelaskan, korban baru beberapa bulan tinggal di Pasar 8 Tembung. “Korban anak yatim piatu, makanya kami jemput dia dari Samosir dan tinggal bersama kami di sini. Kasihan korban, kenapa para pelaku tega berbuat seperti itu kepadanya. Para pelaku memang dikenal sebagai preman kampung dan sering memakai narkoba jenis sabu. Mereka memakai sabu sering di sekolah itu,” sebut Iros. Kapolsek Percut Seituan, AKP Ronald Sipayung SH SIK ketika dikonfirmasi mengatakan, pihaknya sudah meminta keterangan korban. “Sudah kita minta keterangan korban. Tetapi untuk melengkapi laporan korban, kita mengarahkan keluarganya untuk melengkapi berkas-berkasnya, termasuk identitas korban. Setelah semuanya lengkap, akan kita minta kembali keterangannya lebih lanjut,” ujar Ronald.(h04)

Baintelkam Polri. Direktur Lalu Lintas Poldasu Kombes Arkam Hamzah dimutasi menjadi Analis Kebijakan Madya Bidang Dikmas Korlantas Polri (Diksespimti), kemudian posisinya digantikan Kombes Agus Sukamso yang sebelumnya Analis Kebijakan Madya Bidang Gakkum Korlantas Polri. Kabid Propam Poldasu Kombes Pol Iwan Prasodjo dimutasi menjadi Widyaiswara Sepimmen Sespim Polri Lemdikpol. Posisinya digantikan Kombes Makmur Ginting sebelumnyaWidyaiswara Muda Sespim Polri. Kapolres Serdang Bedagai AKBP Arief Budiman dimutasi sebagai Wakasat Brimob Polda Sumatera Selatan, kemudian jabatannya diserahkan kepada AKBP Benedictus Anies Purnama sebelumnya pendidik Madya SPN Polda Jawa Timur (Jatim). Kapolres Binjai AKBP Musa

Tampubolon dimutasi menjadi Waka Polres Metro Jakarta Selatan. Dia digantikan AKBP Marcelino Sampouw sebelumnya Kapolres Tanah Karo. Selain itu, Kapolres Pematangsiantar AKBP Alberd Sianipar dimutasi menjadi Kapolres Tanah Karo. Jabatannya diserahterimakan kepada AKBP Slamet Loesiono sebelumnya Kasubbag Bagrenmin Akpol Lemdikpol. Kapolres Tebingtinggi AKBP Andi Rian dimutasi menjadi Wadir Reskrimsus Poldasu, sedangkan jabatanya diserahkan kepada AKBP Anggar Pareanom sebelumnya Kapolres Dairi. Jabatan Kapolres Dairi kemudian diserahkan kepada AKBP Donny Damanik, sedangkan jabatan Donnny Damanik diserahkan kepada AKBP Andry Setiawan yang sebelumnya Kasubdit III Dit Reskrimum Poldasu.(m27)


Medan Metropolitan A6 Mahasiswa UISU Al Munawwarah Unjukrasa

WASPADA

Rabu 11 September 2013

Dosen Dan Pegawai Datangi DPRDSU MEDAN (Waspada): Puluhan mahasiswa Universitas Islam Sumatera Utara (UISU) Al Munawwarah Jln. Sisingamangaraja Medan menggelar aksi unjukrasa di depan kampus mereka, Selasa (10/9). Mereka menuntut agar konflik UISU segera dituntaskan. “Kami tidak mau persoalan yayasan mengakibatkan proses akademik terganggu. Artinya, jangan gara-gara persoalan internal, mahasiswa jadi korban. Bagi kami, siapa yayasan atau rektor tidak jadi masalah yang penting proses akademik berja-

lan baik,” teriak mahasiswa berulangkali. Selain menyampaikan orasi, mahasiswa juga membentangkan spanduk di badan jalan dan membakar ban bekas persis di depan gerbang kampus mereka. Akibatnya, aparat kepolisian dari Polsek Medan Kota mengalihkan arus lalulitas guna menghindari kemacatan. Mahasiswa juga menutut legalitas kampus UISU segera dituntaskan. Mereka menilai akibat konflik unsur yayasan, kepentingan mahasiswa menjadi korban. Bahkan, saat ini mahasiswa UISU terpecah menjadi dua kubu. Mahasiswa meminta se-

mua pihak yang berwenang menuntaskan persoalan UISU secara arif dan bijaksana. Artinya, tidak diskriminatif. Jika persoalan ini tidak segera dituntaskan, mahasiswa mengancam kembali menggelar unjukrasa.”Kepentingan akademis mahasiswa harus diselamatkan,” teriak mereka. Menanggapi aksi mahasiswa, Sekretaris Yayasan UISU Al Munawwarah Arfis Amiruddin mengatakan, pihaknya berjanji segera menuntaskan persoalan UISU dengan bijaksana. Selain itu, rektorat dan yayasan sudah menempuh langkah-langkah, seperti mengirim alumni ke Dikti guna mempertayakan

Umat Islam Terperangkap Pemahaman Normatif MEDAN (Waspada): Umat Islam tidak akan pernah bersatu karena terperangkap dalam pemahaman agama yang normatif dan sempit, sehinga tidak memberi ruang untuk berani melakukan perubahan. “Umat Islam harus berani melakukan perubahan dari pemahaman yang normatif,” kata Dr Ansari Yamamah MA, dengan moderator M Iqbal dalam ceramah ilmiahnya pada kuliah umum Fakultas Syariah dan Ekonomi Islam IAIN SU Tahun Akademi 2013, di Aula IAIN SU Jln. William Iskandar, Medan Estate, Sabtu (7/9). Dalam ceramahnya berjudul Rekonstruksi Pemikiran Kajian Hukum Islam Kontemporer, Dr Ansari ingin mengaloborasikan peradaban Barat dan Timur untuk kemaslahatan umat manusia, meskipun banyak kalangan pemikir Islam hal itu sesuatu yang tidak mungkin. Ceramah dihadiri Dekan Fakultas Syariah Dr Syadur-

rahman, PD I Dr Azhar Tarigan, para dosen antara lain Dr Zainul Fuad. Menurut dia, yang tidak mungkin dilakukan adalah integrasi atau menyatukan, karena dalam hal ini Barat dan Timur masing-masing sudah memiliki ideologi tersendiri atau pandangan tersendiri. Oleh karena itu, yang mungkin dilakukan adalah kolaborasi yang bertujuan untuk kemaslahatan umat manusia. Ansari menegaskan jangan ada dikotomi antara Barat dan Timur, karena itu mempersempit ruang gerak untuk mencapai kemaslahatan umat manusia. Tetapi, yang harus dilakukan adalah bagaimana mengalaborasi keduanya dan memanfaatkannya untuk kemajuan dan kemaslahatan umat. Kata dia, bahwa mahasiswa adalah merupakan agen perbuahan, oleh karena itu mahasiswa jangan takut melakukan perubahan untuk mendapat ke-

majuan masa depan. Mahasiswa juga harus melakukan perubahan cara berfikir, tidak lagi bertanya apakah hukumnya akan tetapi apa manfaatnya. Islam tidak akan pernah maju jika para penganut dan pemikirnya tidak berani atau mau membuka diri untuk melakukan rekonstruksi hukum-hukum Islam yang ada sesuai kemajuan. Jika masih menutup diri, pada gilirannya Islam sebagai suatu sistem akan ditingal para pengikutnya. Sejarah mencatat, banyak agama yang sudah hilang ditinggalkan pengikutnya karena tidak dapat mengikuti tuntutan perkembangan kemajuan. Ansari menilai bahwa rekonstruksi hukum Islam sangat mendesak untuk dilakukan, mengingat semakin majunya ilmupengetahuandantekno-logi. Selain itu, hukum-hukum Islam tentu tidak sama dengan satu negara, karena keadaan dan kepentingan yang berbeda.(m26)

surat dari kopertis dan keabsahan ijazah mahasiswa UISU Al Munawwarah. “Artinya, kita tidak tinggal diam terhadap persoalan ini. Insya Allah, hari ini atau besok unsur yayasan dan rektorat menggelar rapat dengan agenda mencari solusi terbaik dalam penyelesain UISU, “ tegasnya. Selain itu, dia berharap agar semua pihak tidak diskriminatif dalam menangani konflik UISU, tetapi harus netral. Hal ini demi kebaikan mahasiswa sebagai generasi penerus bangsa. Datangi DPRD Sebelumnya, sejumlah dosen, pegawai dan staf masingmasing perwakilan Fakultas di UISU Al Munawwarah mendatangi gedung DPRDSU. Mereka diterima Edi Rangkuti dari komisi E DPRDSU serta sejumlah Anggota Komisi E dan C. Usai menemui anggota dewan, ketua delegasi UISU Pembantu Rektor (PR ) II Hj. Habsyah Lubis, SH, MH dan

Pembantu Rektor (PR) I UISU Dr. Srie Faizah Lisnasari, MSi mengatakan, mereka datang ke dewan untuk menyampaikan keberatan atas surat Kopertis No 215//K.1.2.1/PS/2013 tanggal 13 Juli 2013. Surat edaran kopertis itu berisikan, tidak akan menerima lulusan UISU Al-Munawwarah yang kampusnya berada di Jln. Sisingamangaraja Medan sejak tahun 2010. Surat edaran itu menimbulkan interpretasi yang berbeda sehingga terkesan diskriminasi. Menurut mereka, sejak surat edaran Kopertis itu keluar, suasana di kampus UISU Al Munawwarah menjadi tidak kondusif. “Kami sebagai dosen keberatan, karena dampak dari surat tersebut mengakibatkan proses akademik di UISU Al Munawwarah terusik, “ tegasnya. Alhamdulillah, kata Hj. Habsyah,tuntutan merekaditanggapi serius oleh anggota dewan yang membidangipendidikan.Bahkan para anggota dewan itu menilai sangat ceroboh kalau ada lembaga mengeluarkan kebijakan yang menimbulkan gejolak.

Gugat Rp 127 Miliar Sementara itu, Rektor Universitas Islam Sumatera Utara (UISU) Al Munawwarah Prof. Ir. H. Zulkarnain Lubis, MS, PhD menggugat Koordinator Koordinasi Perguruan Tinggi Swasta (Kopertis) Wilayah I SumutAceh Prof. Dian Armanto MPd, MA, MSc, PhD ke Pengadilan Negeri (PN) Medan. Zulkarnain menilai, Dian bersikap tidak netral dalam menjalankan tugas sebagai Koordinator Kopertis dan menyalahgunakan jabatannya untuk kepentingan pribadi. “Gugatan telah kami ajukan ke PN Medan tanggal 4 September 2013. Prof Dian Armanto sebagai tergugat I dan lembaga KopertisWilayah I sebagai tergugat II kami gugat untuk membayar kerugian material yang dialami UISU senilai Rp27 miliar dan kerugian immaterial Rp100 miliar,” kataadvokatOKIskandar,SH,MH selaku kuasa hukum Rektor UISU kepada wartawan di Kampus AlMunawwarah, Sabtu (7/9). Iskandar menjelaskan, ada dua substansi pokok gugatan yang diajukan. Pertama, atas ter-

bitnya Surat Kopertis Nomor 176/K1.2.1/PS/2013 tanggal 3 Juli 2013 perihal larangan wisuda sarjana UISU Al Munawwarah Jln. Sisingamangaraja Medan yang disampaikan kepada Rektor UISU Prof Zulkarnain Lubis. Kemudian, larangan penerimaan mahasiswa baru tahun akademik 2012/2013, sehingga berakibat menurunnya jumlah calon mahasiswa. Lalu, adanya statemen di media massa dan elektronik yang diskriminatif dan menyatakan kampus UISU Al Munawwarah Jln. Sisingamangaraja tidak legal sehingga menghilangkan kepercayaan masyarakat Sumut, khususnya di Kota Medan. Selanjutnya Kopertis kembali mengeluarkan surat edaran No. 215/K1.2.1/PS/2013 tanggal 23 Juli 2013 kepada 17 perguruan tinggi di Sumut yang melarang menerima mahasiswa baru jenjang Magister bagi lulusan S1 UISU Jln. Sisingamangaraja mulai tamatan 2010 dengan alasan ijazahnya tidak legal. “Kopertis Wilayah I di bawah kepemimpinan Prof Dian

Armanto telah bertindak di luar kewenangannya. Kopertis tidak berhak menyatakan mana UISU legal dan mana yang tidak legal. Sebab, sampai saat ini belum ada keputusan pengadilan siapa yang berhak memakai nama UISU,” tandas OK Iskandar. Penyatuan UISU Sementara itu, Koordinator Kopertis Wilayah I Prof Dian Armanto saat dikonfirmasi Waspada, Selasa (10/9), menyampaikan tanggapannya melalui pesan singkat. Dia mengingatkan, Rektor UISU Al Munawwarah Prof Zulkarnain Lubis agar kembali ke jalan yang benar. Integrasi penyatuan UISU adalah yang terbaik. Sebelumnya, Armanto menegaskan Kopertis siap digugat. Sebab, dirinya hanya melakukan apa yang telah menjadi kebijakan dari Direktorat Pendidikan Tinggi (Dikti). “Apa yang dilakukan Kopertis, ibarat seorang ayah mengingatkan anak yang sudah kenyang makan permen agar menguranginyakarenabisamerusak gigi dan lambungnya,” demikian pesan singkat Armanto.(m49)

Waspada/M.Ferdinan Sembiring

PULUHAN mahasiswa UISU Al Munawwarah berunjukrasa di depan kampus mereka dan menuntut agar konflik UISU segera dituntaskan.

Nama Calon Jamaah Haji Kloter 03 Asal Padanglawas, Tapanuli Selatan Dan Medan Masuk Asrama Haji Kamis (12/9) Berangkat Sabtu (14/9) Melalui Bandara KNIA 1. Makrup Baginda Malim Siregar Bin Bagi, 2. Achmad Fauzan Nasution Bin Burhanuddin, 3. Haslina Efridawati Siregar Binti Asry, 4. Saiful Bahri Halomoan Bin H.Tongku Sa,5. Atika Hafni Nasution Binti Alimuddin, 6. Mhd Ali Hasbi Hasibuan Bin H Rahmad H, 7. Fahruddin Hasibuan Bin H Aliaman Hsb, 8. Gorgor Hasibuan Binti Tk Abd Rahman H, 9. HennyYusida Binti H Burhan Hasibuan, 10. Nuryati Harahap Binti LobeYakub, 11. Pakkal Pohan Bin Porada Pohan, 12. Aslamiah Binti Mgr Hasayangan, 13. Erni Nst Binti Mgr Soaduon Nst, 14. Juanda Nasution Bin Lembang Nasution, 15. Tiurma Hutasuhut Binti Oloan Hutasuhut, 16. Yusliana Siregar Binti Baginda Nauli, 17. Tiesa Harahap Binti Manan Harahap, 18. Muhammad Irpan Drs Spd Bin Abdul Azis, 19. Teti Iriani Binti Sabri, 20. A Tajuddin Hasibuan Bin Kari Sulaiman. 21. Nisma Harahap Binti H Abd Karim, 22. Muhammad Fahmi Ali Bin Pangeran Harah, 23. Eva Susanti Binti Azwar, 24. Sabirin Lubis Bin Kari Sati, 25 . Saibah Hasibuan Binti Jabarumun, 26 . Ali Umar Bin Tongku Said, 27. Faigah Hani Binti H Faqih Mahmud, 28. Farida Hanum Daulay Binti Farih Daud, 29. Munawar Nasution Bin H Mustafa Nasution, 30. Kholilah Hasibuan Binti H Salam Hasib, 31. Saidah Hasibuan Binti H Marali Hasibuan, 32. Juliaty Harahap Binti Ali Tiop Harahap, 33. Dahrum Hasibuan Bin Adam Hasibuan, 34. Rosmawar Nasution Binti Lobe Zakaria, 35. Masnelan Siregar Binti Mayasin Siregar, 36. Sangkot Nasution Bin Lobe Zakaria Nas, 37. Bistur Hasibuan Binti Mgr Bogor Hasibuan, 38. Siti Hasanah Nasution Binti Jahasian, 39. Zainidar Binti Zainuddin, 40. Mhd Ali Imron Lubis Bin H Agus Salim. 41. Nur Aisyah Tanjung Binti Syahrul Tanjung, 42. Dali Hasni Pohan Binti M. Adil Pohan, 43. Ellida Mahyar Hasibuan Binti Kari Har, 44. Anna Lely Nasution Binti Nur Halim Nasution, 45. Basyaruddin Harahap Bin H Bgd Amir Harahap, 46. Ratna Sari Tanjung Binti Sulaiman Mus, 47. Siti Mour Hasibuan Binti Syekh Nur Ha, 48. Kholijah Tambunan Binti Amir Tambunan, 49. Muhammad Ridwan Hasibuan Bin Tongku S, 50. Masturi Pulungan Binti Mgr Ali Pulung, 51. Gamel Natser Bin Abdul Hamid Sikumbang, 52. Faridah Sa’diyah Hasibuan Binti Muham, 53. M Ali Perkasa Lubis St Bin H Abu Amin, 54. Syawalidah Lilariani Siregar Binti H, 55. Mastiara Nasution Binti Rosyib Nasution, 56. Abidan Hasibuan Bin Jatimbar Hasibuan, 57. Nurkiah Binti Jatodung Pulungan, 58. Abdullah Hamid Panggabean Bin Kari Su, 59. Rosmawati Siregar Binti Saliman Siregar, 60. Amir Soleh Nasution Bin H Sutan Muda. 61. Halimatussyaadiah Hasibuan Binti Amas, 62. Lindawati Harahap Binti A Ridwan,63. Ahmad Sallim Harahap Bin H Aminuddin, 64. MusafranYunus Nasution Bin A Idris N, 65. Tukma Sari Tanjung Binti Tampung Tanj, 66. Indra Wati Binti Marzuki Sikumbang, 67. Sabirin Daulay Bin Jasoriman Daulay, 68. Purnama Nasution Binti Sutan Kali Jun, 69. Mahmud Hutasuhut Bin Japarlaungan, 70. Amnah Nasution Binti Stn Kali Jungjun,71. Lahotna Sari Hsb Binti Abdul Manik Hs, 72. Tinur Mardiah Binti Jaomsa, 73. Muhammad Ali Mardan Hsb Bin Salamat H, 74. M Kholid Daulay Bin H. Ibrahim Daulay, 75. Farida Nasution Binti Incat Nasution, 76. Ruslim Bin Abu Hasim, 77. Masdar Batubara Binti Basyaruddin Bat, 78. Nuroloan Hasibuan Binti Mgr Malim Has, 79. Rosdewi Hasibuan Binti Abdul Rahman H, 80. Makmur Hasibuan Bin Dolla Hasibuan. 81. Siti Rahma Rangkuti Binti Syeh Ibrahi, 82. Abd Halim Dly Ba Bin Malim Badullah, 83. Rosidah Hutasuhut Ba Binti H Kari Uhu, 84. M Toha Hasibuan Bin Endah Hasibuan, 85. Aswan Harahap Bin Mara Hadi Harahap, 86. Intan Susiani Binti Dame Parsaulian R, 87. Syamsul Bachri Harahap Bin Mhd Yusuf, 88. Gustina Nasution Binti Panjang Nasution, 89. Siti Aisah Nasution Binti Maramat Nas, 90. Nurselan Hasibuan Binti Sutan Kali Ju, 91. Iskandar Muda Nasution Bin Kariusman, 92. Seri Erlina Daulay Binti Salohot Daul, 93. Mardongan Hasibuan Bin Japoso Hasibua, 94. Husni Harahap Binti Lobe Abdul Halim, 95. Abdul Wahid Siregar Bin Sutan Paindoa, 96. Ali Kahar Hasibuan Bin Ahmad Hasibuan, 97. Juita Br Bangun Binti Jendangena Bang, 98. Udin Sarwanto Bin Saryono, 99. Zamzuma Hsb Binti Tongku Ibrahim, 100. Alitonang Hasibuan Bin Johor Hasibuan. 101. Nias Juni Daulay Binti Mangaraja Daulay, 102. Muhammad Syarifuddin Rambe Bin Mahdan, 103. Nuraini Tanjung Binti Sutan Sukandir 104. Nur Jani Pulungan Binti Datuk Panabar, 105. Siti Ropa Binti Kari Musa, 106. Siti Ajir Pasaribu Binti Andan Pasaribu, 107.

Rahmadiani Binti M. Daim, 108. Yusup Bin Agus Ruslan, 109. Suriyati Binti Daud, 110. Nurgianto Bin Ruslan, 111. Nursyamsia Binti Jumali, 112. Nurhasana Binti Dul Rasid, 113. Parwito Bin Joyo Pawiro, 114. Sulasmi Binti Rahmad, 115. Wakidi Bin Sikun, 116. Satupah Binti Ponimin, 117. Baginda Soripada Hasibuan Bin Tongku, 118. Sahniar Harahap Binti Mara Saidun, 119. Pamusuk Hasibuan Bin Muhammad Ali Has, 120. Dermawati Daulay Binti Umar Daulay. 121. Mgr Purba Sori Siregar Bin Umar Siregar, 122. Ratna Hasibuan Binti Malim Marajo, 123. Pangeran Hasibuan Bin Rohim Hasibuan, 124. Mas Kana Nasution Binti H Abdul Halim, 125. Lukman Hasibuan Bin Zakaria Hasibuan, 126. Siti Aisyah Lubis Binti H Abdul Majid, 127. Tongku Humala Siregar Bin Lobe Mustaf, 128. Sapiah Nasution Binti Mangaraja Hamon, 129. Muhamamad Jamil Siregar Bin Lobe Must, 130. Paisar Lubis Bin Pautan Lubis, 131. Nurbaiti Harahap Binti Mhd Lelo Harah, 132. Masri Nasution Binti Mat Jalil, 133. Ainuddin Nasution Bin Abdul Muin Nasution, 134. Nafsah Nasution Binti Mahmuddin Nasution, 135. Kasam Bin Taryadi, 136. Efrida Simatupang Binti Dekata Simatupang, 137. Lahidir Nasution Bin Mgr Uhum Nasution, 138. Rohani Hasibuan Binti Imam Kari Hasibuan, 139. Asni Binti Ahmad Sahir. 140. Sartini Binti Muhammad Said, 141. Bahrum Hasibuan Bin Pandito Sutan, 142. Nur Ainun Lubis Binti H Abd Hamid Lubis, 143. M.Tohar Batubara Bin M. Yunus Batubar, 144. Karim Siregar Bin Khalifah Hasan, 145. Lantera Binti Jararangan, 146. Sahrun Harahap Bin Japidoli Harahap, 147. Leli Asni Nasution Binti Ali Yusuf Nasution, 148. Naja Muddin Hasibuan Bin Nanti Hasibuan, 149. Masro Hasibuan Binti Sutan Sodogoran, 150. Juraida Hasibuan Binti Diris Hasibuan, 151. Mhd Alimin Daulay Bin Bgd Bidaralom D, 152. Misrah Binti Langkotan Rangkuti Alm, 153. Zulfahmi Hasibuan Bin Pangihutan Hasibuan, 154. Asmari Lubis Binti Palit Lubis, 155. Indra Somba Hasibuan Bin Mgr Asal Hsb, 156. Nurleli Hamdah Binti H.Mhd Ridwan Hrp, 157. Ali Togu Hasibuan Bin Baginda Ali Hasibuan, 158. Masbulan Binti Tongku Aman, 159. Farida Hanum Batubara Binti Ibrahim B, 160. Matnauli Siregar Bin Jasayangan. 161. Holizah Matondang Binti Jaginanten, 162. Sutan Parlaungan Nasution Bin Mangara, 163. Siti Holi Hasibuan Binti Mara Halim, 164. Ishak Hasibuan Bin Bgd Dunia Hasibuan, 165. Abdul Wahid Harahap Bin Mangkuto Raj, 166. Rido Batubara Bin Johan Batubara, 167. Nelmin Sari Nasution Binti Katur Nasution, 168. Siti Lamia Pulungan Binti Maramin Pulungan, 169. Paruhum Hasibuan Bin Tk Mhd Nur Hasibuan, 170. Deliana Siregar Binti H Tongku Syarif, 171. Ali Nurdin Lubis Bin Zuhari Lubis, 172. Siti Abri Nasution Binti Katur Nasution, 173. Tagor Mulia Hasibuan Bin H.Muhammad D, 174. Tetti Herawati Pasaribu Binti Tampun, 175. Paman Hasibuan Bin Abdul Jalil Hasibuan, 176. Hartawan Daulay Binti Riddan Daulay, 177. Syayumbiro Pasaribu Bin Sutan Dunia, 178. Robiani Hasibuan Binti Kamaruddin Hasibuan, 179. Pimpinan Samosir Bin Sutan Malelo Samosir, 180. Rosminar Nasution Binti Kuddin Nasution. 181. Yusuf Rakiman Hasibuan Bin Mgr Alam H, 182. Nilam Sari Nasution Binti Lobe Zainal, 183. Saharti Nasution Binti Jalis Nasution, 184. Masnia Siregar Binti Marap Siregar, 185. Samsiah Hsb Binti Mangarajo, 186. Jailab Lubis Bin Sahdan Lubis, 187. Pangadilan Hasibuan Bin Kari Adanan, 188. Khairuddin Pulungan Bin Jabosar Pulungan, 189. Maslaung Siregar Binti Musomman Siregar, 190. Khotna Ida Hasibuan Binti Bgd Mahodum, 191. Abdul Hadi Hasibuan Bin Tongku Sri Al, 192. Nurjelita Binti Ali Napia Hasibuan H, 193. Impun Nasution Bin Panangaran Nasution, 194. Tetti Nirwana Lubis Binti Sayur Mulia, 195. Siti Rahma Pulungan Binti Padang Pulungan, 196. Massaima Binti Pala Raja, 197. Mangaraja Linggoman Nasution Bin Jago, 198. Pinayungan Hasibuan Bin Raidin Hasibuan, 199. Satiorajo Siregar Bin Jahatimbulan, 200. Nur Elmi Lubis Binti Soripada Lubis. 201. Dewana Pulungan Binti Jasati Pulungan, 202. Siti Maryam Hasibuan Binti Mgr Naposo, 203. Ahmad Hasibuan Bin Bgd Nalobi Hasibuan, 204. Nur Lohot Binti Batara Suten, 205. Abdullah Bin H Amran Nasution, 206. Irma Suryani Binti Marahamat, 207. Deli Pulungan Binti Jasati Pulungan, 208. Rosmalam Pohan Binti H. Bangsawan, 209. Supanggih Bin Trolegiman, 210. Marmi Binti Rono Marjo, 211. Muhammad Sujai Bin Parimin, 212. Siti Mutmainnah Binti Asari, 213. Sukimin Bin Ronopin, 214. Mes Yem Binti Darmo Wiyono, 215. Syamsul Bahri Simamora Bin

Marasia Si, 216. Agus Kaliungan Bin Umar Abd Khahar, 217. Afni Rasiana Sirait Binti Abdul Rasyid, 218. Tajuddin Nasution Bin Mgr Lobi Nasution, 219. Dermi Lubis Binti Pangihutan Lubis, 220. Ali Akbar Lubis Bin H. Luton Lubis. 221. Hotmaida Siregar Binti Aminuddin Siregar, 222. Rahma Nasution Binti Stn Pandalian Ns, 223. Budianto Bin Saimin, 224. Darsiah Binti Nyamin, 225. Pariyem Binti Satiman, 226. Tongku Regen Hrp Bin Stn Nasinok Hrp, 227. Tongku Alom Hasibuan Bin Mgr Hamonang, 228. Masro Lubis Binti Janaguru Lubis, 229. Tk. Ahmad Daulay Bin Bgd. Pakih, 230. Nur Amima Harahap Binti H. Sutan Parl, 231. Haji Ahmad Harun Siregar Bin Jaimbang, 232. Fatimah Hasibuan Binti Ahmad Arifin H, 233. Baginda Baringin Hsb Bin Mgr Hotip Hs, 234. Siti Aisah Daulay Binti Mgr Soleman D, 235. Yahya Siregar Bin Tk Fakih Siregar, 236. Erlinaros Tanjung Binti Bgd Umar Tanjung, 237. Anisa Tanjung Binti H Umar Tanjung, 238. Hodijah Siregar Binti Lobe Nonga, 239. Tongku Malim Harahap Bin H.M.Arif Harahap, 240. Nur Minta Siregar Binti Jaoaran Batu. 241. Martua Harahap Bin Juang Harahap, 242. Tiamana Pohan Binti Ismail Pohan, 243. Kaslin Hasibuan Bin H.Syarip Hasibuan, 244. Mastika Siregar Binti Bgd Gunung Siregar, 245. Sofyan Ependi Siregar Bin Pajar Siregar, 246. Hodni Binti Bgd Sojuangon Harahap, 247. Tigokkon Dalimunthe Binti Mara Hasan, 248. Hormat Hsb Bin Mgr Hatimbulan Hsb, 249. Baginda Raja Harahap Bin Marasali Harahap, 250. Jariah Siregar Binti Marakutcm Siregar, 251. Tongku Humala Harahap Bin Sutan Harahap, 252. Tialom Siregar Binti Sutan Sojuangon, 253. Tihotna Simamora Binti Bahal Simamora, 254. Rajab Harahap Bin Raja Muda Harahap, 255. Masnun Siregar Binti Jamil Siregar, 256. Mastira Siregar Binti Addul Siregar, 257. Nuronti Hasibuan Binti Jasojuangon, 258. Ratna Siregar Binti Tk Soleh Siregar, 259. Siti Aguna Siregar Binti Baginda Sori, 260. Kalsum Siregar Binti Abdul Maulub Siregar. 261. Tianur Hasibuan Binti Tongku Hasibuan, 262. Nambota Hrp Binti Mgr Muda Hrp, 263. Suasa Lubis Binti Imom Raja, 264. Tiasri Daulay Binti Sutan Mulia Daulay, 265. Manohong Siregar Bin Musa Siregar, 266. Fakih Ahmat Harahap Bin Baginda Parla, 267. Anikum Pangaribuan Bin Saruddin Pangaribuan, 268. Berliana Pasaribu Binti H Abu Bokar S, 269. Ruslan Pohan Bin Johor Pohan, 270. Halimah Pane Binti Soripada, 271. Halimah Nasution Binti M.Arifin Nasution, 272. Dahniar Lubis Binti Muhammad Taib, 273. Ulong Marpaung Bin Muda Marpaung, 274. Pitta Ritonga Binti Sali Ritonga, 275. Mawar Ritonga Binti Jasokondar, 276. Halimah Siregar Binti Humala, 277. Nurhaida Pasaribu Binti Zainal, 278. Upik Supriyadi Bin Rupiyo, 279. Letty Piliang Binti H Muktar Piliang, 280. Asrul Hanip Bin Zuki Batubara. 281. Silfiani Binti H.Mukhtar Piliang, 282. Pulohot Lubis Bin Saleh Lubis H, 283. Rosmawan Hutasuhut Binti Marausin Hutasuhut, 284. Syafaruddin Siregar Bin Sinar Siregar, 285. Sahani Siregar Binti Manawiyah Siregar, 286. Syaibatusaddiah Ritonga Binti Huttal, 287. Tamba Butar Butar Bin Japanaehan, 288. Ompu Seri Ratnasari Binti Jasori Amin, 289. Martini Simatupang Binti Bismar Simat, 290. Syahruddin Harahap Bin Ms Harahap, 291. Datuk Pane Bin Mara Pane, 292. Dermi Sawati Siregar Binti Samsudin S, 293. Nurwani Pane Binti Todung Pane, 294. Rosma Nilis Guci Binti Darwis, 295. Kamsaria Siregar Binti Badu Wahab Siregar, 296. Masturo Siregar Binti MuhammadYusuf, 297. Samsinar Siregar Binti Abdul Gani, 298. Minar Pohan Binti Doktor Pohan, 299. Nukman Harahap Ba Bin Bgd Sibarnud, 300. Deliana Siregar Binti Japarlindungan. 301. Agussalim Sormin Bin Mhd Jasad Saleh, 302. Zaleha Ritonga Binti Latif Ritonga, 303. Roslian Rambe Binti Janiale Rambe, 304. Nur Kiam Sinaga Binti Kamar Sinaga, 305. Tiorom Hutasuhut Binti Simopir Ht Suh, 306. Kholija Sormin Binti Sua Sormin, 307. Maimuna Pohan Binti Joman Pohan, 308. Jogiah Siregar Binti Bgd Aman Siregar, 309. Asroni Sihombing Binti Maliaki, 310. Nur Diyar Siregar Binti Ahmad Mukhtar, 311. Duma Sari Hutasuhut Binti Samma Hutasuhut, 312. Zainal Rambe Bin H Sahbudin Rambe, 313. Hotma Siregar Binti Stn Muara Hombang, 314. Dalkot Batubara Bin H Ali Ahman Batubara, 315. Mahrani Siregar Binti H Abdullah Siregar, 316. Dahlia Tambunan Binti Jaman Tambunan, 317. Nurma Dalimunthe Binti Malim Kari, 318. Satia Hutasuhut Binti Hadis Hutasuhut, 319. Dori Alam Rambe Binti Ali Suman Rambe, 320. Panindoan Ritonga Bin Jaginaud Ritonga. 321. Tirahma Pohan Binti Mara Pohan, 322. Akhirul Pane Bin Abdul Rivai Pane, 323. Irwan Efendi Nasution Bin H Maskut

Nasution, 324. Rabiatun Adawiyah Harahap Binti H Agu, 325. Deby Lulfi Hanum Nasution Binti H Irw, 326. Syarif Rachman Hakim Nst Bin H Irwan, 327. Mhd Syakdan Hamidi Nasution Bin H Irw, 328. Ahmad Amri Nasution Binti Muhammad Yu, 329. Nuranna Harahap Binti Dalum Harahap, 330. Abd Rahim Aritonang Bin Marzuki, 331. Lanna Sari Pulungan Binti Matja Pulungan, 332. Rosmina Daulay Binti H Soleh, 333. Zulfan Efendi Harahap Bin Abdul Rahma, 334. Masniari Dalimunthe Binti Abdul Azis, 335. Rapotan.Drs Bin Jairingan, 336. Darlina Tanjung,Spd Binti Abdul Rahma, 337. Siti Hafsah Rangkuti Binti Mara Hamin, 338. Nanggul Harahap Binti Sutan Dilaut, 339. Zulkifli Bin Martua Raja, 340. Kimlan Nasution Bin Amaron Nasution. 341. Tetty Khairani Siregar Binti Kasibun, 342. Raja Asrul Azis Bin Amran Lubis, 343. Nur Hayani Hasibuan Binti Rahmat Hasibuan, 344. Parlagutan Matondang Bin Samsudin Matondang, 345. Puli Harepah Binti Kamis Harepah, 346. Drs.Sunnun Lubis Bin Awaluddin Lubis, 347. Irpanuddin Damanik Bin Kasmir Damanik, 348. Gabena Wati Binti Kodir, 349. Asma Binti Modu, 350. Ratna Binti Saddin, 351. Nursailam Rangkuti Binti H Siddik Rangkuti, 352. Nursaidah Rangkuti Binti H Siddik Rangkuti, 353. Rostina Siregar Binti Harun Siregar, 354. Samsinur Simamora Binti Jakuning, 355. Masniari Lubis Binti Dulasim Lubis, 356. Siti Aminah Simamora Binti Lukman Simamora, 357. Nurhayani Hasibuan Binti Pinayungan, 358. A Husyin Siregar Bin Gitan Siregar, 359. Ernawati Lubis Binti Binuajar Lubis, 360. Hotma Warni Binti H Mhd Kasim. 361. Sauna Nasution Binti Kotib Nasution, 362. Kholidah Matondang Binti Najamuddin M, 363. Hawa Siregar Binti Mulkan Siregar, 364. Masrani Panggabean Binti Ali Akbar Panggabean, 365. Murni Dalimunthe Binti Durohom Dalimunthe, 366. Nur Bayani Pulungan Binti Matnasim Pulungan, 367. Muda Lubis Bin Jamanaon Lubis, 368. Asdima Batubara Binti Jasudin Batubara, 369. Khoiruddin Harianja Bin H.Sahbuddin H, 370. Nurhasanah Harianja Binti Duramat Har, 371. SaringWdianto Bin Misdi Sumarto, 372. Rusyiah Binti Entong, 373. Rosdewati Hasibuan Binti Halim Hasibuan, 374. Nurmaija Hasibuan Binti Jawaren Hasibuan, 375. Puddin Sihombing Bin Japarimpunan, 376. Ngatini Binti Gemblong, 377. Ahmad Akbar Bin Hasan Basri Tanjung, 378. Kartini Tarihoran Binti Makmur Tariho, 379. Salbia Batubara Binti Bidun Batubara. 380........ 381. .............., 382. ........., 383. Rizal Dongoran Bin H Abd Nalik Dongor, 384. Syamsuri, Drs Bin Karno.Alm, 385. Sanna Helena Gultom Se Binti H.Tonggi, 386. Rusijanto Bin Soegito, 387. Buyung Kenar, Drs Bin St. Dahlan, 388. Abubakar Simbolon Bin Walter Simbolon, 389. Nurmida Sihotang Binti Jamilim Sihotang, 390. Srinisma Binti Sujono, 391. Suryadi Bin Sukardi, 392. Zulkarnaini Bin Syukur, 393. Yulita Fatmi Binti Adin, 394. Fitri Ani Binti Ali Akbar, 395. Muhammad Ali Bin Abdurrahman, 396. Harmyn Tanjung,Drs Bin H. Burhanuddin, 397. Yuliehanna Harmaini, S.Ag Binti H. Ha, 398. Juli Arisnawati, Se Binti H. Kino Dju, 399. Arief Fadillah, Se Bin Amir Djas, 400. Yarnis Binti Kamaruddin. 401. Fatimah Br Hutagalung Binti Badurahim, 402. Rahil Umar Binti Umar, 403. Fahmi Binti Mhd. Nurdin, 404. Siti Zaleha Br. Tarigan Binti H. Mahm, 405. Agit Nina Br Tarigan Binti Rajin Tarigan, 406. Juslida Sidik Binti Ali Umar Sidik, 407. Bustami Bin Kadurudin, 408. Ahmad Sayuthi Bin Abdul Hamid, 409. Fauzi Ahmad Bin Imran Hasibuan, 410. Suhasni Binti Abdul Rahman, 411. Hajarul Aswad Binti Abdullah, 412. MilaVaria Sari Binti Mansur Ms, 413. Nurhayati, Ba Binti Adinar Adami, 414. Anis Binti Ali Asin, 415. Anas Bin Tayib, 416. Syahrul B Harahap Bin Johan Harahap, 417. Naimah Nasution Binti H.Abdullah Nasution, 418. Zahara Binti Ok Panji Anwar, 419. Mhd.Salman Sh. Bin H.Madyan Abd.Jalil, 420. Soemiaty Sh. Binti H.Baharuddin. 421. Nurizal Laila Binti M Syarif, 422. Helmiyana Hasibuan Binti Lobe Somma H, 423. Berlian Binti Djuaren, 424. Deliana Harahap Binti Abdul Rahman Ha, 425. Riaman Br Pohan Binti Jaliang Pohan, 426. Suryati Binti Agusman, 427. Nilam Sari Pane Binti Abdurrahman, 428. Saodah Binti Sari, 429. Syahrida Bin Mukhtar Yahya, 430. Roni Akbar Bin Abujar Jambak, 431. Susanti Binti Abdullah Musi, 432. Yusniati As Binti H.Ali Sumar, 433. Ulfia Amdi Binti Abdul Muis, 434. Nurlin Binti Sintin, 435. Rohanna Harahap Binti Muhammad Harahap, 436. Nur Betty Nasution Binti Abaran Nasution, 437. Aida R. Binti M.Yahya Jamil Nst, 438. Asniar Binti Pangeran, 439. Diah Wiati Binti Pawiro Taruno, 440. Ismail Bin Ponijo. (h02/m37/m50/m40)


Luar Negeri

WASPADA Rabu 11 September 2013

A7

Bus Masuk Jurang, Sedikitnya 43 Orang Tewas Di Guatemala GUATEMALA CITY, Guatemala (Reuters): Sedikitnya 43 orang tewas dan puluhan lainnya cidera Senin (9/9) ketika satu bus terjun kejurangdikawasanpedesaanGuatemala,menyebabkanbustersebut terceburkesungaisedalam200meterdidasarjurang,kataparapejabat. Petugas penyelamat mengatakan, bus itu, yang terjun dari jalan raya di baratlaut Guatemala City, dalam kondisi hancur dan lebih 40orangdibawakerumahsakituntukmendapatkanpengobatan.Pihak penyelidik belum mengetahui apa yang menyebabkan kecelakaan ituataudaerahmanayangditujubustersebut,yangmelakukanperjalanan dari kawasan selatan Guatemala. Petugas penyelamat mengatakan cuaca cerah dan bus sepertinya kelebihan penumpang. “Bus tersebut kelebihan penumpang,” kata Sergio Vasquez, seorang sukarelawan di tempat kejadian. Dia mengatakan, 38 orang tewas di tempat kejadian, termasuk enam anak-anak dan 12 wanita. Lima lagi meninggal di rumahsakit, katanya. Televisi lokal mengatakan banyak di antara penumpang adalah pedagang yang membawa hasil pertanian menuju pasar. Pemerintah mengumumkan tiga hari berkabung nasional.(m23)

Dua Warga Thai Ditahan Malaysia Atas Tuduhan Perdagangan Senjata BANGKOK, Thailand (Antara/TNA-OANA): Thailand menyerahkan kepada pihak berwenang Malaysia untuk menangani kasus dua pria warganya yang ditangkap di Negara Bagian Kedah dengan satu gudang besar senjata, kata seorang pejabat senior keamanan Thailand Selasa (10/9). Paradorn Pattanatabut, sekretaris jenderal Dewan Keamanan Nasional (NSC), mengatakan pihak berwenang MalaysiatelahberkoordinasidenganDivisiCabangKhususThailand untukmenyelidikikasusitu.DuawargaThai,yangdiidentifikasisebagai pelakukekerasan,MohamadbinMatDauddanAhmadbinJamanan, dilaporkan dari provinsi selatan ThailandYala. Mereka ditangkap disebuahrestorandiKedah.Diamengatakan,paratersangkaterlibat dalaminsidenkekerasantertentudiThailandSelatan,danmenegaskan bahwapemerintahThailandtidakakanmenggangguMalaysiadalam penyidikan kasus ini.

Usaha Gagalkan Usaha Amankan Irak,14 Orang Tewas Akibat Bom BAGHDAD, Irak (AP): Satu gelombang baru pengeboman di Irak menewaskan sekurang-kurangnya 14 orang dan mencederai puluhan lainnya Selasa (10/9), ketika para pemberontak berusaha memanfaatkan ketidakstabilan politik dan menggoyahkan usaha pemerintah untuk memelihara perdamaian. Serangan paling mematikan terjadi dekat Baqouba ketika tiga bom mobil yang ditujukan pada pasar terbuka, yang menewaskan sekurang-kurangnya 10 warga sipil dan mencederai 34 lainnya, kata seorang petugas kepolisian. Baqouba, satu kota bekas kubu al-Qaida, berada 60 km di timurlaut Baghdad. Petugas kepolisian lainnya mengatakan satu bom yang disembunyikan di dalam satu kedai kopi di kota Latifiyah menewaskan empat orang dan mencederai 14. Kota tersebut berlokasi kirakira 30 km selatan of Baghdad. Tiga pejabat medis membenarkan angka korban. Semua pejabat yang berbicara tentang pengeboman dan korban tersebut tidak ingin disebutkan namanya karena mereka tidak berhak memberikan informasi. Pasar,restoran,kedaikopidanhalamanparkirmerupakantempattempat favorit bagi kelompok militan untuk melakukan gangguannya.Lebih dari 4.000 orang tewas selama lima bulan terakhir saja, angka itu meliputi 804 warga Irak yang tewas bulan lalu, demikian menurut angka PBB yang disiarkan awap pekan ini.(m10)

IAEA Terpecah Tentang Risiko Atom Dari Potensi Serangan AS WINA, Austria (Antara/RIA Novosti-OANA): Kepala pengawas energi nuklir PBB, Badan Energi Atom Internasional (IAEA) mengatakan bahwa pihaknya terpecah mengenai risiko nuklir dari potensi serangan udara Amerika Serikat di Syria. Yukiya Amano mengatakan bahwa perwakilan AS dan Kuba tidak setuju tentang risiko tersebut, namun pendapat mereka yang tepat tidak bisa diungkapkan karena mereka berbicara pada pertemuan pribadi badan dewan gubernur. Dia mengatakan, pihaknya tidak akan mampu untuk memenuhi permintaan Rusia untuk melakukan penilaian tersebut dalam sepekan. Iniadalahmasalahyangsangatrumityangmembutuhkanwaktu,” katanya.Dia menambahkan bahwa penting bagi lembaga untuk mendengarkan pendapat negara-negara anggota lainnya, sehingga diatidakdapatmemberitahu“teman-temanRusiakita”kapan balasan akan disediakan. VladimirVoronkov, utusan permanen Rusia untuk lembaga internasional diWina itu, mengatakan Senin (9/9) bahwa diamengharapkanbalasanterhadappermohonanpadaakhirpekan.

Ledakan Kedua Dalam Dua Hari Di China, 4 Orang Tewas BEIJING, China (AP): Empat orang tewas dan 14 lainnya cedera Selasa (10/9), hari kedua terjadinya ledakan di selatan China dalam dua hari terakhir, demikian menurut polisi. Ledakan itu mengeluarkan asap tebal dari satu kebakaran di satu garasi di satu taman industri di kota komersial Guangzhou. Polisi mengatakan, kasus itu saat ini masih dalam penyelidikan, meski laporan media mengatakan tampaknya ledakan tersebut berasal dari bahan peledak yang disimpan di situ. Ledakan itu menyusul kejadian yang sama Senin di jalan yang sibukdiluarsebuahsekolahdiselatanresorkotaGuilinyangmenewaskan dua orang dan melukai 17, termasuk 10 siswa. Ledakan itu diyakini disebabkanolehbahanpeledakyangdiangkutkendaraanrodatigadan pihak berwenang kota memerintahkan tindakan pengamanan.(m10)

Pesawat Hilang Di Filipina Tengah

The Associated Press

SEORANG anggota Pasukan Kepolisian Khusus Nasional Filipina (kiri) menggunakan satu teropong untuk mengetahui situasi di kawasan bangunan yang dikuasai pemberontak selama penyanderaan hari kedua Selasa (10/9) di kota pelabuhan selatan Zamboanga, di Filipina Selatan. Sekitar 200 gerilyawan Muslim, marah oleh kesepakatan damai yang dirusak pemerintah Filipina.Mereka menyandera puluhan sandera sebagai tameng manusia Selasa dalam krisis itu.

MNLF Jadikan Ratusan Sandera Sebagai Tameng ZAMBOANGA, Filipina (AP): Kira-kira 200 pemberontak Muslim, yang marah karena gagalnya perdamaian dengan pemerintah Filipina, telah menyandera sejumlah warga dan menjadikannya sebagai tameng manusia Selasa (10/9) dalam pertikaian dengan pasukan pemerintah untuk hari kedua dengan tidak ada solusi yang terlihat. Makin banyak pasukan siap tempur dan polisi diterbangkan ke kota pelabuhan selatan Zamboanga dalam upaya mengakhiri krisis penyanderaan tersebut. Pasukan pemerintah mengepung para gerilyawan Front Pembebasan Nasional Moro (MNLF) dengan sandera mereka di empat desa pesisir sejak krisis meletus

Pengadilan India Putuskan Nasib 4 Orang Pelaku Perkosaan Maut NEW DELHI, India (AP): Satu pengadilanIndiaSelasa(10/9)segera putuskannasibempatpelakuperkosaan massal terhadap seorang wanitamudadidalamsatubusyang bergerak di New Delhi. Tindakan brutalparapelaku perkosaanbrutal itumemicugelombangprotesyang menyuarakankemarahanatasperlakuan terhadap seorang wanita. Para terdakwa divonis atas semua tuduhan diajukan pada mereka,termasukperkosaandanpembunuhan dan sekarang mereka menghadapikemungkinandigantung.Hukumanmerekadiperkirakan dijatuhkan Rabu (11/9). Hakim Yogesh Khanna mengatakandalamputusannyabahwa mereka, yang menipu wanita korban perkosaan 23 tahun dan seorangtemanlaki-lakinyanaikke dalam bus miliknya dan melakukan“perkosaandanpembunuhan terhadaporangyangtakberdaya.” Orangtuawanitakorban,yang tidakdapatdiidentifikasidibawah

hukumIndia,meneteskanairmata mereka saat vonis dibacakan. Sangibu,mengenakansarimerah muda, duduk hanya beberapa meter dari terpidana di ruang sidang kecil penuh sesak dengan pengacara, polisi dan wartawan. Di luar sidang, puluhan pemrotes berkumpul dan mulai berteriak-teriak dengan cepat setelah pembacaan keputusan itu. “Gantung mereka! Gantung mereka! Gantung mereka!” Keputusanitumenjadipenutup bagi sebuah kasus kejahatan yang memicu demonstrasi luas dan seruan perlindungan perempuan di seluruh India beberapa bulan lalu. Pembacaan vonis hukuman akan dilakukan Rabu dan keempatnya terancam dihukum gantung atas tuduhan pembunuhan, kata V. K. Anand, pengacara salah seorang terdakwa. Keempat terdakwa telah menyatakan tidak bersalah. “Keempatnya dituduh bertanggungja-

wabuntuksemuadakwaan,”kata AnandsepertidikutipReuters.HukumIndiamelarangmenyebutkan nama korban pemerkosaan, namunmediamassaIndiamenyebut korban dengan “Nirbhaya” yang berarti “si tanpa takut”. Gadis ini adalah calon ahli fisioterapis dari sebuah keluarga kelas menengah India yang bekerja di satu call centre. Vonis ini menutup peradilan selama tujuh bulan yang kadang diselenggarakan secara tertutup. Terdakwa kelima kemudian bunuh diri di dalam bui. Kasus tersebut menandai reputasi buruk Indiasebagaitempatyangtakaman untuk kaum perempuan, bahkan setelahparlemenmeluluskanUU anti kejahatan seksual. Kasus Nirbhaya beresonansi kepada ribuan kaum urban India yang turun ke jalan menyampaikan protes menyusul serangan seksual itu. (m10)

Senin. Kelompokpemberontakmenandatangani perjanjian perdamaian dengan pemerintah pada 1996,namunratusanpejuangnya memegang senjata mereka dan baru-baruinimenuduhparapejabat mengingkari perjanjian untuk mengembangkandaerahotonom bagimasyarakatminoritasMuslim diselatanwilayahMindanao.Merekajugamerasaditinggalkansetelah faksipecahanterlibatdalampembicaraanperdamaianyangberhasil denganpemerintah,ditengahioleh Malaysia. Bulanlalu,MNLFmengeluarkan ancaman baru untuk memisahkan diri dengan mendirikan republik sendiri. Namun, pemimpinnya, Nur Misuari belum muncul juga mengeluarkan pernyataan apapun karena diperkirakan 180-200 dari pengikutnya menerobos ke Zamboanga Senin pagi dan bentrok dengan pasukan tentara dan polisi. Pertempuran menewaskan sedikitnya delapan pejuang dan warga sipil tewas dan 24 terluka. Selama pertempuran, para

pemberontak mengambil puluhan warga sandera, menahan mereka di beberapa rumah dan sebuah masjid yang telah dikelilingi oleh pasukan. Tidak ada indikasi apakah pemberontak bersedia melakukan pembicaraan atau apa yang akan mereka lakukan selanjutnya.Presiden Benigno Aquino III mengatakan prioritas utama adalah untuk menjamin keamanan para sandera dan penduduk kota dagang utama, di mana penerbangan dan feri telah ditangguhkan. Dia mengerahkan para pejabat Kabinetdankepalastafmiliternya untuk mengawasi krisis keamanan terbaru di selatan negara itu. Menteri Dalam Negeri Mar Roxas mengatakan komite krisis yangdipimpinolehWalikotaZamboanga Maria Isabelle Climaco terbuka untuk bernegosiasi dengan para gerilyawan untuk rilis aman dan tanpa syarat dari para sandera. “Misi utama pemerintah saat ini adalah jelas: lakukan segala kemungkinanuntukmeyakinkan kelompok MNLF bersenjata un-

tuk membebaskan semua warga tawanan mereka gunakan sebagai‘perisaimanusia’terhadapoperasi militer dan polisi,” kata Roxas. Kelompok saingan Misuari, 11.000-kuat Front Pembebasan Islam Moro (MILF), telah membuat kemajuan substansial menuju otonomi kesepakatan baru bagi umat Islam di Malaysia yang ditengahi pembicaraan damai dengan pemerintah. Ronde terakhir dari perundingan dilanjutkan Selasa di Kuala Lumpur, Malaysia. Terlibat tembak menembak ParagerilyawanMuslimyang menyandera ratusan orang dan terlibat baku tembak dengan tentara Filipina, Selasa di hari kedua perseteruanmenyusulbentrokan berdarah di wilayah selatan, kata pejabat pemerintah. Rentetan tembakan terdengar dinihari di kawasan pesisir Zamboanga, dalambentrokanantarapemerintah danlebihdari300pendukungbersenjata Front Pembebasan Bangsa Moro (MNLF) yang bertujuan mengacaukan pembicaraan damai.(m10)

MANILA, Filipina (Antara/Xinhua-OANA): Sebuah pesawat pribadi hilangdiFilipinatengahSelasa(10/9)pagidanpihakberwenang berusaha mengonfirmasi kecelakaan tersebut, kata laporan media lokal. Dilaporkan bahwa pesawat tersebut jatuh di sebuah desa pegunungan di Provinsi Biliran di bagian tengah negara itu.Pesawat yang masih belum diketahui itu terlihat jatuh di Desa Imelda pada sekitarpukul07:00waktusetempat,kataInquirermengutippernyataan kantor informasi Bilirian. Pihak berwenang sedang mencari dan menyelidikikeberadaanpesawatnaasitu.Pesawathilangjugaterjadi diTaiwanTimurpada30Agustuslalu.Pesawatitusedangmelakukan survei udara di Taiwan Timur dan hilang Kamis 29 Agustus, kata pihak berwenang setempat. Ada tiga orang di dalam pesawat itu dan operasi pencarian dan penyelamatan dilakukan di daerah pegunungan dekat Hualien County.

Mantan Menteri Thai Terbukti Menerima Suap BANGKOK,Filipina(AP):PengadilanTinggiThailandmenjatuhkan hukuman penjara atas seorang mantan deputi menteri dan seorang mantankepaladepartemenkebakaransehubungandenganpembelian sejumlahtrukdanboatpemadamkebakaranuntukibukotaBangkok. Pengadilan mengatakan Selasa (10/9) bahwa mantan deputi menteri dalam negeri Pracha Maleenont telah terbukti bersalah karena penyimpangan di kantor publik dan penetapan harga atas pembelian 2004. Dia dijatuhi hukuman 12 tahun penjara. Mantan kepala departemen kebakaran Bangkok AtilakTanchukiat dijatuhi hukuman penjara 10 tahun. Lima pejabat telah didakwa dalam kasus yang melibatkan pembelian 315 truk dan 30 boat pemadam kebakaran dari perusahaan Austria Steyr-DaimlerPuch sebesar 6.690.000.000 baht (kira-kira AS$207 juta). Pengadilan menolak tuduhan terhadap dua mantan menteri dan mantan gubernur Bangkok karena kurangnya bukti.(m10)

Dua Korea Rundingkan Pembukaan Kembali Zona Industri Kaesong SEOUL, Korea Selatan (Antara/AFP): Korea Utara (Korut) dan Korea Selatan (Korsel) Selasa (10/9) mengadakan putaran kedua pembicaraan mengenai pembukaan kembali zona industri gabungan Kaesong - lima bulan setelah ditutup selama mencuatnya ketegangan militer. Komite bersama Kaesong yang baru dibentuk pertama kali bertemu pekan lalu, tetapi tidak mampu mencapai kesepakatan mengenai waktu bagi pelanjutan operasi di kompleks itu. Satu batu sandungan adalah permintaan Korsel kepada Korut agar memberikan kompensasi kepada perusahaan-perusahaan yang merugi oleh penutupan kawasan industri itu. Pembicaraan putaran kedua Selasa dimulai pada pukul 10:00 waktu setempat di Kaesong, yang terletak 10 kilometer (enam mil) di perbatasan Korut. Didirikan pada tahun 2004 sebagai simbol kerja sama antarKorea ang langka, Kaesong telah melalui sejumlah krisis di semenanjung Korea tanpa cedera. Tetapi pada April, ketika ketegangan meningkat menyusul uji coba ketiga nuklir Korut, Pyongyang secara efektif menutup operasi Kaesong dengan cara menarik 53.000 pekerja Korut yang dipekerjakan di 123 pabrik Korsel.

Gema Internasional

Mesir, Kembalinya Pemimpin Orla MENJADIpertanyaanumum: Apakah Mesir akan kembali pada rezim orde lama Hosni Mubarak? Masih perlu memperhatikan perkembangan lebih lanjut setelah militer Mesir di bawah pemimpin AD Jend. Abdel Fattah el-Sisi mengambil alih kekuasaan Presiden Mesirpertamayangterpilihsecara demokratis, Mohamed Moursi. PresidenMoursiterpilihtahunlalu yang diusung oleh Freedom and JusticeParty(sayappolitikMuslim Brotherhood). Selama lebih dari dua tahun dalam penjara, mantan Presiden HosniMubaraktelahdibebaskan. Sejatinya menurut pandangan Hisham Kassem seorang jurnalis senior suratkabar Al-Masry ALYoum, Mubaraksudahharusdibebaskan empat bulan yang lalu denganalasanpolitikberdasarkan kurangnya pemahaman atas hukum Mesir di mana seseorang untuk sementara waktu tidak dapat ditahan seraya menantikan si-

dang pengadilan lebih dari 24 bulan. Mubarak tidak lagi jadi tahanan dalam penjara tapi diberlakukan tahanan rumah. SebagaimanadiberitakanpulaolehmediaMesir,jaksapenuntut umum tidak memiliki bukti yang lengkapuntukmemperkuattuduhanterhadapMubarak.Memang semenjak awal bukti yang disajikan dalam pengadilan ini lemah. Namun di balik pandangan ini ada pendapat yang menyatakan adanya sinyal yang sangat kuat kembalinya orde lama, dalamhalinirezimMubarak.Pendapatlainjugaberpandanganbahwa pelepasan Mubarak adalah masalah yang menyangkut hukum tidak akan berakhir artinya akan berlanjut sembari pengadilan mempelajari undang-undang yang berlaku. Pembebasan Mubarak dari penjara dan diberlakukan tahanan rumah bagi dirinya telah memunculkan kegemparan dalam

beberapa minggu ini di Mesir.Hal ini menimbulkan keragu-raguan apakahpemerintahansementara memiliki kemauan untuk meneruskan kasus ini berujung di pengadilan. Ketika rakyat Mesir memberontak terhadap Mubarak tahun 2011, hal ini merefleksikan ketidakbahagiaan mereka terhadap pemerintahan yang korup dan sikappolisiyangbrutal. Sekarang, pembebasanMubarak(walaupun dalam tahanan rumah) terlihat sebagai adanya petunjuk kelompokmiliterberpura-puramelakukanperubahanyangingindicapai. Jend. Abdel Fattah el-Sisi mengakuipemerintahansipilsementara itu militer akan mengawasi roadmap menuju pemilihan umum baru. Para pengamat meyakini bahwa Jend el-Sisi adalah orangyangmenentukanataumemutuskan segala sesuatunya. ProfesorAbdullahal-Ariandari School of Foreign Service, George-

town Univerfsity, Doha, berpendapat bahwa terlihat telah terjadi politisaasi secara lengkap walaupunsecarayudisialprosesinicacat hukum. Sebenarnya siapa memeganguntaiankekuatandankekuasaandiMesir,kelihatannyakembali padasikapuntukke-amanannegara danpolisisudahkembaliberoperasi dijalan-jalan.Pemerintahansementara telah melancarkan tindakan kerassecarabesar-besaranterhadap Muslim Brotherhood pendukung utamaPresidenMesirtergusurMohamedMoursi. Pemerintahsedang mempertimbangkanuntukmembubarkankelompokini. Jadi,adaduapertanyaanyang muncul: Pertama, “bagaimana signifikansinya ‘timing’ pembebasanMubarakdaripenjara?”Kedua, “apakahberartiadanyatanda-tanda bahwaMesirakankembalikeorde lama?”Menjawabpertanyaanpertama, Sarah el-Tantawi seorang mahasiswatugasbelajardiUniversity of California berpendapat bahwa

sangat jelas muncul sebuah tanda ;’kontrarevolusi”.Kontrarevolusiini bukan terhadap Muslim Brotherhood tetapi terhadap revolusi itu sendiri. Inilah keruwetan penting yangsedangterjadidiMesir. Pertanyaan kedua mengikuti perjalanansejarahkepemimpinan pemerintahan Mesir setelah tersingkirnya Raja Farouk pada awaltahun1950-anolehJend.Najib bersama Gamal Abdul Nasser seorangkolonelyangmasihmuda waktu itu. Dengan demikian era pemerintahanmiliterdiMesirselama lebih kurang 60 tahun sampai berakhirnyapemerintahanMarsekal Hosni Mubarak. Sangat besar kemungkinan rasa ‘setia kawan’ sesamakorpsmiliterjugamenyentuh hati Jend. Abdel Fattah el-Sisi yang memegang peranan penting menggusur Moursi. Rakyat Mesir yang akan menentukan perjalanan sejarah pemerintahan negeri ‘gudang pyramid’ itu. (Kosky)


Pentas Pilkada

A8

WASPADA Rabu 11 September 2013

Masyarakat Palas Hari Ini Ke TPS

Agusdiansyah Hasibuan

CALON bupati dan wakil bupati Batubara Zahir - Suryono menyerahkan bantuan buku pada sekolah - sekolah Al Washliyah di Kab. Batubara yang diterima masing - masing kepala sekolah.

Al Washliyah Batubara Komit Zahir-Suryono SEISUKA(Waspada): Pasangan calon bupati dan wakil bupati putra asli daerah Batubara Zahir - Suryono yang mendapat dukungan dari Ormas Al Washliyah saat melakukan kunjungan ke pengurus cabang, ranting dan madrasah-madrasah di Kab. Batubara, Selasa (10/9), sekaligus memberikan bantuan buku. Kunjungan Zahir dan Suryono ini disertai oleh Pengurus Wilayah (PW) Al Jami’yyatul Washliyah Sumatera Utara yang dipimpin oleh Ketua Majelis Siasah H Aidil Hadi, Ketua Tim Pemenangan AlWashliyah Zahir Suryono Akmal Samosir, Ketua PD Al Washliyah Batubara Ir Kusmayadi, Ketua Muslimat PD Al Washliyah Batubara Hj Bariyah, Ketua tim Pemenangan Al Washliyah Zahir - Suryono HA.Hasibuan. Dalam sambutannya Ir Kusmayadi menyatakan, keputusan PW Al Washliyah Sumatera

Utara yang mendukung Zahir dan Suryono pada pilkada merupakan keputusan institusi yang harus diperhatikan seluruh warga AlWashliyah di Batubara, melalui surat instruksi PW Al Washliyah nomor INT.278/PWAW-B/XI/VIII/2013. “Sebagai warga AlWashliyah PD Al Washliyah Batubara bersikap sami’na wa ato’na dan siap memenangkan Zahir Suryono,” tegas Kusmayadi. Keputusan PW ini juga menurutnya tidak serta merta dilakukan oleh wilayah, namun melalui mekanisme dan menerima laporan perkembangan dari PD Al Washliyah Batubara. Kunjungan Zahir dan Suryono yang hadir dalam silaturahim dengan warga Al Washliyah di Kab. Batubara ini mendapat sambutan antusias dari pengurus ranting, pengurus cabang dan guru - guru. Zahir menyampaikan keprihatinannya atas sebagian kondisi ba-

ngunan sekolah Al Washliyyah yang jauh dari perawatan. “ Secara umum kita ketahui salah satu cabang amal usaha Al Washiyah adalah pendidikan dan tentu ada guru - gurunya. Kita akan upayakan guru - guru sekolah swasta ini dapat menjalankan profesinya dengan penghasilan layak,” kata Zahir. Di tempat yang sama Akmal Samosir mengharapkan agar seluruh komponen Al Washliyah Batubara mengamankan keputusan PW Al Washliyah Sumut. Sebab keputusan yang diambil oleh wilayah setelah melalui proses panjang dan ditetapkan dalam rapat pleno. “ Al Washliyah mendukung calon bupati yang siap berkomitmen membangun umat melalui Al Washliyah. Hari ini yang siap melakukan itu adalah pasangan Zahir dan Suryono dan kita siap menang bersama pasangan putra asli Batubara ini,” kata Akmal.(c05)

PALAS (Waspada): Masyarakat di Kabupaten Padanglawas hari ini, Rabu (11/9), mendatangi tempat pemungutan suara (TPS) untuk memilihi bupati dan wakil bupati di masing-masing kecamatan. Sementara gubernur telah mengeluarkan SK libur untuk semua aktivitas di Palas. “Hari Rabu atau 11 September ini hari pemungutan suara. Jadi, diliburkan, dan masyarakat akan mencoblos di masingmasing TPS,” kata Ketua KPU Padanglawas Atas Siregar melalui pesan singkat yang diterima di Medan, kemarin. Dengan demikian, diharapkan partisipasi masyarakat Padang Lawas semakin tinggi untuk menggunakan hak pilihnya dalam pilkada. Pilkada ini diikuti enam pasangan cabup dan cawabup yakni Sarmadan Hasibuan-Faisal Hasibuan (no urut 1) dari partai politik. Kemudian, pasangan Alwi Mujahid Hasibuan-Suprantiardi (nomor urut 2) yang mendaftar sebagai peserta pilkada dari jalur perseorangan. Setelah itu, pasangan Rahmad Pardamean HasibuanAndri Ismail Putra Nasution (no. urut 3) dari partai politik. Selanjutnya, pasanganTondi Ronitua-Idham Hasibuan (no. urut 4) dari partai politik. Pasangan no. urut 5 adalah Rustam Efendi Hasibuan-Tongku Khalik dari jalur perseorangan. Sedangkan no. urut 6 adalah pasangan Ali Sutan HarahapAhmad Zarnawi Pasaribu yang merupakan calon “incumbent” dari partai politik. (m13))

Waspada/Idaham butar butar

BUPATI Padanglawas Ali Sutan Harahap melepas pendistribusian logistik Pilkada Palas ke kecamatan se-Kabupaten Palas, disaksikan ketua Panwaslu dan ketua KPUD Palas, Senin (8/9). Hari ini masyarakat Palas memilih pemimpinnya untuk lima tahun ke depan.

Timsel Tunggu Kritik 17 Calon Komisioner KPUD Madina Diumumkan PANYABUNGAN (Waspada): Tim seleksi (Timsel) KPUD Madina menunggu masukan dan kritik masyarakat terkait keputusan Timsel yang menetapkan 17 calon anggota komisioner KPUD itu. “Masukan dan kritikan ter-

Ribuan Spanduk Akan Dibongkar KISARAN (Waspada): KPUD Asahan akan menertibkan spanduk terkait Peraturan Komisi Pemilihan Umum (KPU) No.15/ 2013 yang mengatur tentang aturan main kampanye. “Ribuan spanduk dan baliho yang tidak sesuai peraturan akan dibongkar,” kata Ketua KPUD Asahan Linda Sari Agustina melalui Ketua Divisi Sosialisasi Ibnu Azar Saragih, kemarin, terkait terbitnya peraturan peraturan KPU itu yang mengatur setiap baliho hanya dibolehkan terpasang satu di setiap desa/kelurahan. Kemudian baliho dan spanduk caleg, harus didampingi foto pengurus Parpol yang bersangkutan yang bukan Caleg. Sedangkan untuk tim kampanye berasal dari sayap partai atau organisasi penyelenggara kegiatan yang mempunyai badan hukum dan tim kampanye harus didaftarkan ke KPU. Tim kampanye harus bertanggung jawab dengan ketertiban dan keamanan. “Untuk pemasangan alat peraga (baliho dan spanduk) tidak dibenarkan di tempat ibadah, rumah sakit, pelayanan kesehatan, gedung milik pemerintah, lembaga pendidikan serta jalan protokol, jalan bebas hambatan, sarana dan prasarana publik,” kata Ibnu. Ibnu mengatakan peraturan itu terbit pada 22 Agustus 2013 dan akan berlaku sebulan setelah diterbitkan tepatnya pada 22 September ini. (a15)

Calon Anggota KPUD Pertanyakan Hasil Tes

Waspada/Iwan Has

JURKAM Hidayat Bhaktiar ketika menyampaikan pidato politiknya di tengah-tengah massa pendukung OK Arya-Harry Nugroho memadati lapangan Desa Pakam, Kec Medang Deras.

OK Arya: Sekali Putaran LIMAPULUH (Waspada): Juru kampanye Hidayat Bhaktiar menegaskan alasan pilih OK Arya sebagai Bupati Batubara periode 2013-2018 telah teruji dan terbukti memperjuangkan perbaikan nasib masyarakat mewujudkan Kab. Batubara. “Dia (OK Arya) selama enam tahun bersama rakyat berjuang mewujudkan Kab. Batubara yang didambakan sejak Tahun 1950,” tukasnya dalam kampanye pasangan OK Arya-Harry Nugroho, di lapangan Desa Pakam, Kec. Medang Derasa, Minggu (8/9). OK Arya, lanjutnya, putra daerah yang cerdas dan berkemampuan, baik menata pemerintahan selama memimpin bupati. Kemampuan lobi dan komunikasi dengan Provsu dan pusat dibuktikan meningkatnya APBD Batubara kini mencapai Rp 1 T. Sedangkan awal pemekaran hanya sekitar Rp200 miliar. Selain meletakan pondasi

pembangunan di segala bidang, khususnya pendidikan, kesehatan, perekonomian, sarana dan prasarana infrastruktur yang harus berkelanjutan. Lebih penting lagi rencana pembangunan pelabuhan global hub internasional membuka peluang lapangan kerja sehingga meningkatkan taraf hidup dan perekonomian masyarakat. Sosok OK Arya merakyat semua kalangan khususnya wong cilik dan tidak pernah membedakan satu sama lain. Kesederhanaan dan kepedulian mengunjungi masyarakat ke pelosok desa. Mencalon sebagai Cabup Batubara melalui jalur independen membuktikan besarnya dukungan masyarakat terhadap dirinya. OK Arya dalam kampanyenya menyatakan terima kasih atas dukungan diberikan masyarakat, sehingga dirinya kembali mencalonkan sebagai bupati melalui jalur independen. Dan

bertekad memenangkannya sekali putaran dalam Pilkada dengan mencoblos pasangan nomor 6. Kesulitan warga itu dibuktikan tingginya antusias mereka mengikuti kampanye sehinggamemenuhitanahlapang. “Ini mencerminkan antusias masyarakat tetap seperti dulu masa perjuangan pemekaran hingga masa sekarang menuju Batubara gemilang sebagaimana harapan,”ujarnya. Sebelumnya OK Arya memperkenalkan satu persatu Caleg DPRD Sumut dan kabupaten dari Partai Golkar mengikuti kampanye terdiri Dhody Thahir, Selamat Arifin yang juga Ketua DPRD Batubara, Zainal Alwi, SPd, Rizky Aryetta, SST, Ali Hata S.Sos,Parlin Panjaitan, Ismar Khomri dan sesepuh Golkar yang hadir. Partai berlambangkan pohon beringin itu berkomitmen memenangkan OK AryaHarry Nugroho dalam Pilkada 19 September 2013. (a13)

Bupati Milik Semua Golongan SEISUKA, Batubara (Waspada): Silakan Parpol berjalan sendiri asalkan anggotanya bergabung dan memenangkan jalur independen,” kata Cabup dan Cawabup Batubara OK Arya-Harry Nugroho saat berpidato dalam kampanye dialogis menjelang pilkada 19 September, di Dusun Kandis KM 100, Desa Tanjung Gading, Kec. Seisuka, Senin (9/9). “Di sini saya merasa istimewa sekali sebab anggota Parpol sendiri menyampaikan pidato maupun mengadakan kampanye,” kata OK Arya. Bupati ke depan, lanjutnya,

milik semua golongan maupun etnis sehingga dirinya menempuh jalur independen dalam upaya membangun menuju Batubara gemilang. “Ini tak terlepas upaya kita bersama meraih mega proyek berupa pembangunan pelabuhan internasional Kuala Tanjung-Perupuk semula merupakan jatah Cilegon,” ujar OK akrab di sapa. OK menyebutkan sejarah satu kali putaran dalam pemilihan bupati jalur indepen den periode lalu yang diraihnya. Untuk itu, lanjutnya, dia bertekad mengulang sejarah itu lagi pada

pilkada 19 September nanti dengan mengajak masyarakat mencoblos nomor 6. “Mudahmudahan tekad dan kebersamaan membangun Batubara ke depan dapat terwujud agar generasi muda kita dapat lebih baik,” ujarnya. Selain itu dirinya juga berupaya untuk mendirikan sejumlah Perguruan Tinggi apakah itu Akademi Kebidanan maupun Keperawatan. Dalam kesempatan itu, keluarga besar Ikatan Pemuda Karya (IPK) Kec. Air Putih menyatakan sikap siap sebagai garda terdepan memenangkan OK Arya-Harry Nugroho.(a13)

MEDAN (Waspada): Calon anggota Komisi Pemilihan Umum Provinsi Sumatera Utara Rajin Sitepu mendatangi sekretariat tim seleksi di Jalan Maulana Lubis Medan, kema-rin, untuk mempertanyakan hasil seluruh tes yang telah dijalaninya. Dalam kedatangan tersebut, Rajin Sitepu hanya berhasil menemui staf tim seleksi Komisi Pemilihan Umum (KPU) Sudarsono. Sedangkan lima anggota tim seleksi tidak berada di tempat. Menurut Rajin, pihaknya sengaja mempertanyakan hasil seluruh tes yang dilalui setelah dinyatakan tidak lolos dalam 20 besar calon komisioner yang berhak mengikuti tahapan wawancara. Padahal, sebagai calon yang masih duduk sebagai anggota KPU Sumut, pihaknya telah mampu menjawab seluruh soal yang ditujukan. Berdasarkan pemeriksaan lebih lanjut di RS Adam Malik, pihaknya juga dinyatakan sehat dan tidak mengalami gangguan kesehatan sedikit pun. Pihaknya memiliki prasangka yang baik jika tim seleksi yang terdiri dari kalangan akademisi itu akan memberikan penjelasan karena memahami aturan yang berlaku. ” Itu hak kandidat. Kami percaya kalau tim seleksi secara sukarela akan menjelaskan hasil ujian tertulis, kesehatan, dan psikotes yang dilalui,” katanya. Ia mengatakan, keinginta-huan terhadap hasil seleksi calon anggota KPU Sumut tersebut merupakan hak yang dilindungi UU Keterbukaan Informasi Publik. Upaya untuk mendapatkan hasil ujian dan tes tersebut juga dimaksudkan guna mengetahui penyebab kegagalannya masuk dalam 20 besar. “Nanti, kalau orang bertanya kenapa tidak lolos, saya tidak bisa menjelaskan,” ujarnya. Sebelumnya, tim seleksi anggota KPU menjalankan ujian dan tes, mulai tertulis, kesehatan, hingga psikotes terdapat 73 kandidat. Dari proses dilalui, tim seleksi menetapkan 20 nama yang lolos dan berhak mengikuti tahapan wawancara. (m34/ant)

Polisi Jaga 1.768 TPS Pilkada Langkat STABAT (Waspada): Jajaran kepolisian resor Kabupaten Langkat Sumatera Utara, akan mengamankan 1.768 tempat pemungutan suara (TPS), pada pelaksanaan pemilihan kepala daerah bupatiwakil bupati untuk periode 2014-2019, yang akan digelar 23 Oktober mendatang. “Kita akan amankan 1.768 TPS pada pilkada Langkat,” kata Kepala Bahagian Operasional Polisi Resor Kabupaten Langkat Komisaris Polisi Suyadi di Stabat, Jumat (7/9). Dari jumlah 1.768 TPS tersebut, sebanyak 1.504 TPS berada di wilayah hukum Polres Langkat yang membawahi 20 kecamatan, katanya. Sedangkan sisanya sebanyak 264 TPS lagi berada di wilayah hukum Polres Binjai yang membawahi tiga kecamatan yaitu kecamatan Binjai, Sei Bingei dan kecamatan Selesai. Suyadi juga menjelaskan koordinasi antar lintas instansi juga sudah dilakukan melalui berbagai rapat dan evaluasi, yang nantinya diharapkan pada pelaksanaannya akan berlangsung aman, tertib dan lancar. Untuk personil polisi dari jajaran Polres Langkat yang akan terlibat sebanyak 639 polisi seperti dari shabara, lantas, intel, reserse, katanya. Selain itu aparat kepolisian dari jajaran Polres Binjai sebanyak 170 personil, dibantu 76 aparat dari brimob, sedangkan aparat TNI yang diharapkan untuk ikut dalam pengamanan ini berasal dari marinir yang ada di Tangkah Lagan Babalan sebanyak 39 personil dan Kodim 0203 Langkat sebanyak 33 personil. Suyadi berharap nantinya pilkada Langkat dapat berjalan kondusif, sehingga masyarakat bisa mempergunakan hak pilihnya dengan baik. (a01/ant)

hadap calon anggota komisioner KPUD Madina yang telah diumumkan diberikan waktu kepada masyarakat selambat lambatnya hingga hari Jumat tanggal 13 September 2013,” kata Ketua Timsel KPUD Madina M. Yusuf Nasution, kemarin. Menurut Yusuf, tanggapan terhadap nama-nama calon anggota komisioner KPUD Madina dapat disampaikan secara tertulis disertai dengan identitas yang jelas kepada timsel KPUD Madina yang beralamat di Jalan Williem Iskandar No 66 Kelurahan Dalan Lidang, Panyabungan. Sebelumnya, Timsel KPUD Madina mengumumkan 17 calon anggota komisioner. Pengumuman tertuang dalam

SK nomor : 17/TIMSEL-KABMADINA/IX/2013 adalah calon Komisioner KPUD yang lulus dalam hasil seleksi tertulis, tes Kesehatan, dan tes psikologi yang telah dilaksanakan di Kota Panyabungan dan Medan. Berikut nama-nama calon komisioner KPUD Madina yang diumumkan yakni Agus salam (wiraswasta), Ainun Fadhilah (wiraswasta), Akhir Mada (guru honorer), Arifin Syarif (petani). Kemudian, Asrizal Lubis (wiraswasta), Budi Aryansyah (wiraswasta), Burhanuddin Nasution (wiraswasta), Drs. Arif Adnan (PNS), Drs. Sakti Fadjar Lubis (pensiunan PNS), Fadhillah Syarif (wiraswasta). Imbalo (wiraswasta), Joko Arief Budiono (tenaga ahli Fraksi Sekreta-

riat DPRD Kabupaten Madina), Mas Khairani, SS (wiraswasta), Miswaruddin Daulay (PNS), Muhammad Bahmid Effendi (PNS), Rizaluddin(PNS) dan Syukron (wiraswasta). Yusuf yang dikonfirmasi melalui seluler mengatakan, ke17 nama calon komisioner KPUD Madina periode 2013-2018 yang baru diumumkan didapat berdasarkan hasil tahap ujian seleksi yang telah dilaksa-nakan di beberapa tempat, sedangkan untuk pelaksanaan tes wawancara, timsel KPUD Madina akan melaksanakannya tanggal 14-15 september 2013 mendatang di Kompleks Sekolah Tinggi Agama Islam Mandailing Natal (STAIM).(c14)

DKPP Akan Sidangkan KPU Sumut MEDAN (Waspada): Dewan Kehormatan Penyelenggara Pemilu (DKPP) akan menyidangkan KPU Provinsi Sumatera Utara, Kamis (12/9) di Jakarta, terkait dugaan pelanggaran kode etik. Demikian siaran pers DKPP diterima Waspada, di Medan, Selasa (10/9). Selaku majelis adalah Nur Hidayat Sardini, Ida Budhiati dan Nelson Simanjuntak. Teradu I Ketua KPU Provinsi Sumatera Utara dan Teradu II Surya Perdana dan Nurlela Djohan. Sedangkan Pengadu yaitu Tahan Manahan Panggabean. Pokok pengaduan, Teradu I diduga melakukan kecurangan dengan mengubah nomor urut. Sedangkan Teradu II, diduga melanggar batas keterbukaan dalam Pemilu dengan membuat pernyataan di media massa yang dinilai merugikan Pengadu. Menurut Nur Hidayat Sardini, juru bicara sekaligus anggota DKPP, sidang terbuka untuk umum termasuk media massa. Secara terpisah, Ketua KPU Sumut, Surya

Perdana yang dikonfirmasi di Medan, menyebutkan, pihaknya telah mengajukan surat ke DKPP meminta penundaan waktu seminggu, sebab sedang mengikuti seleksi. ‘’KPU Sumut kan kolektif kolegial, tapi kenapa cuma kami berdua saja,’’ katanya Soal adanya dugaan pelanggaran kode etik, Surya Perdana menyebutkan, kode etik mana yang dilanggar. Sesuai undang-undang dan peraturan yang berlaku, jika dalam daftar calon ada kosong, maka nomor urut yang bawah naik ke atas. ‘’Tegasnya kami tidak ada melakukan kezaliman terhadap Caleg bersangkutan. Namun, demikian KPU Sumut tetap akan hadir di di DKPP nant,’’ujar Surya. Dia mengemukakan, sebelumnya pihaknya hanya mengetahui persoalannya masih di Bawaslu Sumut, dan belum ada pemanggilan oleh Bawaslu Sumut kepada KPUD Sumut. Dia menambahkan, ketika memutuskan untuk menaikkan nomor urut caleg di bawah daftar yang kosong, juga sudah mengundang Tim Teknis Bawaslu Sumut.(m34)

Tokoh Masyarakat Percut Rakhmadsyah:

Hanya Satu Pilihan Untuk Masyarakat Deliserdang Membangun PERCUT SEITUAN (Waspada): Hanya satu pilihan untuk masyarakat Deliserdang agar daerahnya terus melanjutkan pembangunan. Untuk ke arah itu, masyarakat harus pandai memilih dan memilah calon pemimpin yang akan bertarung pada pilkada Deliserdang 23 Oktober 2013, karena masa depan Deliserdang lima tahun mendatang berada di tangan masyarakat dengan partisipasinya. Tokoh masyarakat Kecamatan Percut Seituan Rakhmadsyah, SH, yang juga Ketua Himpunan Nelayan Indonesia (HNSI) Deliserdang Rakhmadsyah mengatakan hal itu, (foto), Selasa (10/9). Rakhmatsyah mengatakan dalam pilkada diikuti 11 pasangan calon yang beragam dan merupakan kader terbaik. Rakhmatsyah mengaku menghormati pilihan masyarakat. Namun, Rakhmatsyah menilai hendaknya masyarakat sebagai pemilih dapat membedakan mana pasangan yang pantas dipilih dan paling anyar, mengerti serta berpengalaman dalam membangun daerah ini seperti sosok cabup Ashari Tambunan yang berpasangan dengan cawabup Zainuddin Mars nomor urut 1. Rakhmadsyah mengatakan ada beberapa hal yang membuat kita menjatuhkan pilihan kepada pasangan AZAN menjadi bupati dan wakil bupati Deliserdang 2014-2019. Pertama, Ashari Tambunan seorang pimpinan organisasi Islam ternama dengan basis umat dan keulamaannya. Untuk itu dia (Ashari Tambunan) akan punya rasa takut berbuat kesalahan yang mengakibatkan kekecewaan masyarakat yang bakal dipimpinnya nantinya. Selain itu, AshariTambunan juga merupakan putra seorang seorang pemimpin yang sangat kental sekaligus sebagai pejuang, dimana ayahandanya Alm Jamalauddin Tambunan merupakan sosok pemimpin yang terkenal dan sudah tidak asing lagi di Sumatera Utara serta pernah menduduki berbagai jabatan yang bergengsi di berbagai wilayah seperti menjadi Wali Kota Pematang Siantar, Asisten Wedana di Tanjung Balai, Bupati di Asahan Labuhan batu (Aslab), menjadiWakil Gubernur Sumatera Utara (Gubernur Muda) dan pernah menjadi

Gubernur di Jambi. Sedangkan pasangannya Zainuddin Mars adalah sosok berkepribadian muslim yang kuat. Selain itu, kinerjanya selama lima tahun mendampingi Bupati Deliserdang Amri Tambunan tidak ditemukan satu kesalahan yang berarti. Rakhmatsyah menilai dalam membangun kabupaten Deliserdang selama 5 tahun belakangan ini tidak terlepas dari seorang Zainuddin Mars sebagai Wakil Bupati Deliserdang bersama Amri Tambunan, sehingga berbagai program pembangunan kemasyarakatan di Kabupaten Deliserdang dapat terlaksana Waspada/Khairul Siregar dan berhasil dengan baik. Pada bagian lain, Rakhmadsyah juga menjelaskan saat ini masih ada 13 orang nelayan yang masih ditahan oleh Pemerintah Kerajaan Malaysia dengan tuduhan melanggar wilayah perbatasan.Ternyata perjanjian atau MoU yang dilakukan antara pemerintah RI dengan Kerajaan Malaysia tidak berlaku. Dan pihaknya sebagai Ketua HNSI Deliserdang saat ini telah melakukan langkah-langkah dan pembicaraan dengan pihak pemerintah setempat dan Konjen RI di Pulau Penang Malaysia agar masyarakat nelayan yang ditahan itu dapat segera dibebaskan. Dari informasi terakhir yang berhasil diperolehnya dari Konjen RI di Pulau Penang Malaysia menyebutkan pada 19 September yang akan datang, ke-13 nelayan tersebut akan menjalani persidangan. Jika dalam persidangan nanti para nelayan tidak terbukti melakukan kesalahan maka nelayan itu akan dikembalikan. Semua usaha yang dilakukannya untuk membebaskan para nelayan itu tidak terlepas dari campur tangan dari Ashari Tambunan sebagai calon Bupati Deliserdang. “Untuk itu, mari kita bersatu dan satukan langkah serta tekadkan dihati untuk memenangkan pasangan nomor 1 Ashari Tambunan bersama H Zainuddin Mars sebagai Bupati dan Wakil Bupati Deliserdang priode 2014-2019 mendatang” kata Rakhmadsyah yang juga Ketua Komisi A DPRD Deliserdang mengakhiri. (crul)


Nusantara

WASPADA Rabu 11 September 2013

PROFIL HAJI

Penjara Bukan Solusi Bagi Anak JAKARTA (Waspada): Perlindungan dan rehabilitasi anak merupakan hak normatif yang mesti diterima anak, sesuai amanat UU No 11 Tahun 2012 Tentang Sistem Peradilan Pidana Anak.

Waspada/Hursal AI

Painah binti Rusdi (kiri) dan Midi bin Karmudi.

Jeruk Dan Kakao Antarkan Pasutri Ke Tanah Suci MENANAM diwaktu muda, menuai dikala tua. Inilah prinsip hidup yang dilakoni Midi bin Karmudi, 79, dan istrinya Painah binti Rusdi, 75. Keduanya tak menyangka, jeruk, kakao yang ditanam serta sapi yang diternak diwaktu muda bias mengantarkan warga Desa Sukaraya Pancurbatu Deliserdang ini ke Baitullah. Puluhan tahun Midi menjadi peternak dan petani. Sedikit demi sedikit, hasil panennya mereka kumpulkan demi menjadi tamu Allah SWT di Tanah Suci. “Sejak tahun 2000 niat saya semakin kuat untuk naik haji, tapi saat itu uang belum cukup untuk bias berangkat. Kami terus menabung, hingga 2009 uang sudah cukup dan kami baru mendaftar,” tutur Midi sebelum keberangkatannya ke Bandara KNIA untuk ke Tanah Suci, Selasa (10/9). Bergabung dengan 435 jamaah di Kloter I Embar kasi Medan, Midi dan istri tampak berbeda dengan kebanyakan jamaah lainnya. Pasutri ini menggunakan kursi roda karena usia keduanya yang sudah tua renta. Meskipun begitu, suami istri ini tetap tampa bersemangat seperti jamaah lainnya. “Semuanya diawali dengan niat, dan niat kami untuk naik haji sudah kuat. Dan anak cucu kami mendukung sepenuhnya,” kata kakek yang memiliki 25 cucu dan 10 cicit ini. Dia mengaku ikhlas dengan apa yang terjadi dengan dirinya saat berada di Tanah Suci. “Sebenarnya saya masih bisa jalan, tapi memang kalau udah cuaca dingin susah jalan, kaki terasa ngilu. Itupun, saya tidak terlalu khawatir saat di sana (Arab Saudi-red). Semuanya sudah saya serahkan pada Allah SWT,” imbuh Midi. Namun, Midi berharap bias mengerjakan seluruh rukun haji. “Kami berdoa untuk bisa menunaikan seluruh rukun haji, karena ini impian kami sejak puluhan tahun. Doakan kami juga ya,” pintanya. Painah menambahkan, naik haji ini adalah cita-cita umat Islam. Untuk itu, perlu perjuangan tanpa letih dan lelah untuk menunaikan ibadah haji. “Kalau bisa haji waktu muda, segerakanlah. Jangan ditunda kalau sudah ada rezeki. Yang penting ada niat Allah pasti membantu kita,” demikian Painah. (h02)

Para Pemimpin Jangan Bicara Capres Melulu JAKARTA (Waspada): Ketua DPR Marzuki Alie mengimbau agar para pemimpin tidak cuma fokus pada persoalan calon presiden di Pemilu 2014, kendati tahun ini adalah tahun politik. “Yang paling penting dila-kukan pemimpin sekarang ini adalah bagaimana mengatasi persoalan di masyarakat. Kalau kita bicara capres melulu rakyat pasti bakal marah,” ujar Marzuki Alie di Gedung DPR, Jakarta Jumat (6/9). Menurut Marzuki, persoa-lan di masyarakat, harus diperhatikan oleh para pemimpin di negeri ini dan semua punya kewajiban untuk bekerja keras bagi kepentingan rakyat. “Jangan sampai masyarakat marah karena perutnya lapar, sementara kita sibuk memi-kirkan pencapresan. Waktu kita masih panjang untuk mem-persiapkan itu,” tegasnya. SebelumnyaWakil Ketua DPR Pramono AnungWibowo melontarkan pernyataan bahwa kondisi ekonomi makin memprihatinkan ketika inflasi telah melampaui patokan 8,2 pada APBN-P 2013. Kondisi buruk itu terjadi karena pemerintah tidak cepat mengambil tindakan antisipasi. Paket kebijakan ekonomi yang ditawarkan pemerintah pun tidak memberikan rasa nyaman bagi masyarakat. Pemerintah terkesan ragu sehingga pasar jadi was-was.(aya)

A9

“UU tersebut akan memberi penguatan perlindungan dan rehabilitasi terhadap anak yang berkonflik atau sedang berhadapan dengan hukum, baik sebagai korban, saksi, ataupun pelaku, ” kata Menteri Sosial Salim Segaf Al Jufri disela sosialisasi pelimpahan kasus narkoba dari lapas ke Kementerian Sosial di Jakarta, Selasa (10/9). Dalam kondisi tersangkut hukum, kata Mensos, setiap anak harus dipenuhi hak-hak normatifnya, seperti pendidikan, kesehatan, tumbuh kembang. Faktanya anak yang dipenjara menjadi korban tindak kekerasan, seperti kekerasan seksual, disodomi dan tekanan lainnya. “Penjara bukan solusi bagi anak. Sebab, seharusnya mere-

ka tetap bisa mengenyam pendidikan, mendapatkan kesehatan serta tumbuh-kembang secara normal, ”katanya. Oleh karena itu, anak tidak boleh lagi dipenjara, kecuali anak yang melakukan kejahatan dengan tuntutan hukum lebih dari 7 tahun penjara terkait kasus, misalnya pembunuhan, terorisme serta perdagangan narkoba. “Bagi anak di bawah 12 tahun apapun kasus hukumnya, tidak boleh dipenjara. Namun, cukup direhabilitasi di panti Kemensos, ”ujarnya. Terkait kasus penyelesaian hukum dari Anak Berhadapan Hukum (ABH), diupayakan dengan cara diversi alias penyelesaian masalah hukum di luar jalur hukum. Artinya, dalam kaitan dengan diversi, Kemensos telah menyiapkan tenaga pekerja sosial dan pekerja sosial masyarakat. “Jika tidak memungkinkan diselesaikan di masyarakat, maka ditempuh melalui panti, ” tandasnya. Saat ini, fenomena kasus hukum anak memang sangat

mengkhawatirkan. Betapa tidak, ada anak berumur 8 tahun melakukan tindak pembunuhan, di kasus lainnya melakukan tindak pelecehan seksual, tawuran, pencurian, serta narkoba. Terkait kebijakan pelimpahan napi narkoba ke wilayah kerja Kemensos dikatakan Salim akan dipersiapkan terlebih dahulu infrastruktur, Sumber Daya Manusia (SDM) serta segala aspek pendukung yang dibutuhkan. Menurut dia, hal itu berdasarkan kondisi terbaru dalam pengelolaan napi narkoba yang tidak mudah. Fakta membuktikan, di lapas narkoba terdapat pabrik narkoba, bahkan terjadi lalulintas dan pengendalian dari dalam lapas untuk bisnis narkoba di luar lapas. “Kondisi di atas, membuktikan mengelola lapas narkoba tidak mudah. Membutuhkan keseriusan, kesiapan SDM dan infrastruktur, komitmen serta sinergitas semua pihak terkait,” pungkas Salim. (dianw)

Melukis, Terapi Bagi Anak JAKARTA (Waspada): Rumah Amalia, penyantun anakanak yatim piatu dan tidak mampu, kembali menggelar berbagai acara yang menggali potensi dan kreativitas anak dan remaja korban perceraian, yatim piatu dan anak kurang mampu. Dilaksanakan di bilangan Cileduk, Kota Tangerang, Banten, pimpinan Rumah Amalia, Agus Syafii mengajak anak-anak melakukan kegiatan berbagi kisah, bertutur apa yang dirasakan, menulis cerita dan melukis di atas kaos. “Tema kegiatan kali ini adalah Bahagia di Rumah Amalia. Kita berupaya bersama-sama merasakan kebahagiaan di tengah kesulitan yang mendera di sekeliling kita,” kata Agus Syafii, di tengah kegiatan Rumah Amalia, Minggu (8/9). Agus yang juga konsultan keluarga mengatakan, saat ini anak-anak korban perceraian di Indonesia semakin meningkat jumlahnya. Hal itu sebanding dengan tingginya angka perceraian. Data terbaru menyebutkan, sedikitnya 200 ribu pasangan bercerai setiap tahunnya di Indonesia. Dari segi psikis, anak-anak korban perceraian di Indonesia banyak yang lebih rentan ketimbang anak-anak yang orang tuanya meninggal. Mereka menghadapi kebingungan luar biasa, karena melihat ayah dan ibunya sudah tidak saling menyayangi. “Anak-anak korban perceraian ini jadi lebvih sensitif, lebih mudah emosi dan kadang perlu penanganan tersendiri. Pengalaman saya, justru lebih sulit menangani anak korban perceraian ketimbang anak yatim atau anak

Waspada/ist

M.JULIAN Manurung berfoto bersama stah ahli Kemenpora Drs.Sakhyan Asmara, staf ahli Pemprovsu Drs Robertson Simaptupang, Marihot Tampubolon staf mewakili Plt Walikota Medan, Pengusaha Mujianto yang diwakili Direkturnya Syamsul Sianturi,SH dan Bishop Pdt. Dr.JH. Manurung, Pdt Drs.J.Baringbing, M.Th dan istri serta Ketua panitia Drs.Monang Simorangkir dan lainnya usai menerima ulos dari tokoh masyarakat dan pimpinan GPP pada Pesta Gedung Pemuda GPP Di Jalan Sempurna Ujung Medan, Minggu (8/9).

Antara

KETERANGAN PERS AHMAD DHANI: Musikus Ahmad Dhani melakukan konfrensi pers perihal kondisi putra bungsunya Ahmad Abdul Qodir Jaelani (Dul) pasca operasi besar akibat kecelakaan yang dialaminya di Tol Jagorawi Km8 di RS Pondok Indah, Jakarta, Selasa (10/9). Dalam penjelasannya Ahmad dhani menyebutkan kemungkinan pengobatan Dul akan dilakukan di Singapura karena adanya pendarahan di bagian usus.

MS Kaban: Jangan Diskriminasi Tangani Kasus Dul Ahmad Dhani JAKARTA (Waspada): Kasus Abdul Qadir Jaelani (Dul), anak musisi Ahmad Dhani yang tabrakan di Tol Jagorawi, sekarang ini menjadi pembicaraan hangat di seluruh Indonesia. Pro dan kontra bermunculan, dari masyarakat bawah hingga para pengambil kebijakan di negeri ini, kata Ketua Umum DPP Partai Bulan Bintang (PBB) MS Kaban dilansirnya dalam website Markas Besar (Mabes) PBB di Jakarta, kemarin, MS Kaban melihat hal ini dari kacamata seorang ayah, kacamata keadilan dan dari kacamata hukum. Kalau bicara keadilan, pada kasus Abdul Qadir Jaelani, MS Kaban mengatakan Kapolda Metro Jaya jangan

sampai melakukan diskriminasi. ”Kasus Abdul Qadir Jaelani anak musisi Ahmad Dhani sama halnya dengan kasus Abdul Rasyid anak Hatta Radjasa. Sama-sama membawa mobil dan sama-sama mengalami kecelakaan di Tol Jagorawi. Sama-sama merenggut korban nyawa. Yang membedakan adalah Abdul Qadir Jaelani anak di bawah umur dan anak seorang musisi, sedangkan Abdul Rasyid orang dewasa, anak seorang menteri,” katanya. Munculnya berbagai pernyataan agar Abdul Qadir Jaelani ditahan walaupun masih di bawah umur makin merebak, akhirnya timbul pro dan kontra. “Kasus berulang tidak hanya

pada Dul Dhani, ada Dul Hatta yang merenggut nyawa orang lain. Proses hukum berjalan dan Dul Hatta tidak ditahan. Jangan sampai ada yang mengatakan tidak ditahan karena bapaknya orang yang berkuasa,” tutur MS Kaban. Bagi MS Kaban, tidak ada yang menginginkan hal ini terjadi, baik dari pihak Dul Dhani maupun dari pihak yang meninggal. MS Kaban atas nama keluarga dan kelurga besar PBB menyatakan turut berduka cita terhadap keluarga korban. Karena bagaimanapun keluarga yang ditinggalkan pasti merasa kehilangan. Apalagi korban adalah tulang punggung keluarga. (j02)

Kemendikbud Diingatkan Jangan Hanya Fokus Kejar Opini BPK Waspada/Dianw

RUMAH Amalia menggelar berbagai acara yang menggali potensi dan kreativitas anak dan remaja korban perceraian, yatim piatu dan anak kurang mampu. kurang mampu,” kata Agus. Rumah Amalia sendiri kini menyantuni sedikitnya 80-an anak-anak dan remaja kurang mampu yang berasal dari berbagai wilayah. Semua anak-anak inimendapatkanpendidikandan penghidupan yang layak guna meraih masa depan lebih baik. “Mereka bisa dibilang anakanak kurang beruntung. Tapi bersama-sama para sukarelawan di Rumah Amalia, anakanak ini merasa bahagia dengan berbagai kegiatan menghibur dan memotivasi keinginan mereka untuk maju,” kata Agus. Agus menyayangkan jika orang tua tidak memikirkan kebutuhan anak akan hiburan dan rekreasi menarik seperti

menulis, bercerita dan berbagi bersama dalam keluarga. Menurutnya, tidak perlu rekreasi yang menelan biaya mahal, tapi cukup dengan berkumpul bersama keluarga dan melakukan hal-hal positif. “Melukis di atas kaos ini misalnya, dapat dijadikan terapi bagi anak-anak supaya mampu menumbuhkan rasa nyaman, percaya diri dan bertanggung jawab untuk masa depan mereka sendiri,” kata Agus. Dengan aktifitas melukis, anak-anak juga dapat memberikan pemaknaan ulang bahwa betapapun sulit dan tidak mudahnya kehidupan ini, mereka bisa memahami bahwa hidup ini adalah anugerah. (dianw)

JAKARTA (Waspada): Anggota Komisi X DPR RI Ferdiansyah mengingatkan kepada Kementerian Pendidikan dan Kebudayaan (Kemendikbud) agar tidak terlalu fokus mengejar opini baik dari Badan Pemeriksa Keuangan (BPK), tetapi penyerapan anggarannya tak sesuai dengan aturan main. “Tidak apa-apa jika memang hanya sanggup menyerap 60 persen, asal tidak melanggar undang-undang. Daripada penyerapan bagus, tapi menyalahi aturan dan hasilnya di lapangan tak optimal,” ujar Ferdiansyah dalam rapat kerja dengan Mendikbud Mohammad Nuh

di Gedung DPR RI, Jakarta, Senin (9/9). Menurutnya, seandainya tahun 2013 daya serap Kemendikbud hanya 70 persen, itu lebih baik ketimbang menanggung beban moral ketika terjadi masalah pelanggaran, dikemudian hari. Politisi Partai Golkar itu menyinggung soal opini yang dikeluarkan BPK. Ia menyayangkan jika mitra kerja yang membidangi pendidikan, kebudayaan dan olahraga, hanya mementingkan opini tersebut. “Apakah penilaian Wajar Tanpa Pengecualian atau Wajar Dengan Pengecualian adalah motivasi

utama dalam penyerapan anggaran. Kalau memang begitu, sungguh sangat menyedihkan,” tegasnya. Karena itu, Komisi X mendesak Kemendikbud segera mengambil langkah-langkah strategis untuk melakukan percepatan penyerapan anggaran agar realisasi anggaran Kemendikbud tahun 2013 bisa optimal. Komisi X juga mendesak Kemendikbud agar mengevaluasi pelaksanaan Bantuan Siswa Miskin (BSM), kebijakan pembayaran tunjangan profesi guru dan program beasiswa agar tepat sasaran, tepat waktu maupun jumlahnya.(aya)

Rizal: Jika Rp12.000-Rp 13.000/Dolar Sejumlah Perusahaan Bangkrut

JAKARTA (Waspada): Komisi IX DPR menolak rencana Pemutusan Hubungan Kerja (PHK) para pekerja di lingkungan Badan Usahan Milik Negara (BUMN) sampai ada rekomendasi dari Panitia Kerja (Panja) outsourcing Komisi IX. Komisi IX DPR juga meminta semua pekerja outsourcing (kontrak) yang masa perjanjian kerjanya akan berakhir, untuk tetap dipekerjakan sampai ada rekomendasi Panja Komisi IX DPR. Demikian kesimpulan rapat kerja Komisi IX DPR yang dipimpin Wakil Ketua Irgan Chairul Mahfiz dengan Menteri Tenaga Kerja dan Transmigrasi (Menakertrans) Muhaimin Iskandar dan Menteri Negara Badan Usaha Milik Negara ( BUMN) Dahlan Iskan dengan 15 Direktur Utama BUMN, Senin (9/9) di Gedung DPR, Jakarta. Disamping itu, juga disepakati penyelesaian masalah ketenagakerjaan di lingkungan BUMN diselesaikan berdasarkan UU No. 13 Tahun 2003 tentang Ketenagakerjaan, sebelum akhir September 2013. Menteri BUMN, juga harus membayar hak normatif pekerja yang mengalami PHK sesuai dengan ketentuan yang berlaku, dan mengangkat pekerja outsourcing BUMN menjadi karyawan tetap apabila telah memenuhi kriteria ketentuan peraturan perundang-undangan. Komisi IX juga menekankan, Dirut BUMN tetap membayar hak normatif pekerja yang sedang dalam penyelesaian kasus sampai memiliki kekuatan hukum tetap. (aya)

JAKARTA (Waspada): Menko Perekonomian era Gus Dur, DR. Rizal Ramli memprediksi, jika rupiah sampai bertengger 15 ribu terhadap dolar AS sedikitnya lima perusahaan besar di Indonesia akan bangkrut. Prediksi itu disampaikannya dalam diskusi “Ketahanan Ekonomi Dalam Konteks 4 Pilar,” bersama Wakil Ketua MPR Ahmad Farhan Hamid dan Direktur eksekutif Megawati Institut Arif Budimanta di Jakarta, Senin (9/9). Rizal Ramli yang juga Direktur Econit, Lembaga Analisis Ekonomi itu, enggan menyebut nama ke lima perusahaan itu. Tetapi dengan situasi bertenggernya rupiah pada level Rp11.600 membuat pusing para konglomerat yang memiliki utang dalam bentuk dolar. “Bahkan sejumlah perusahaan grup besar diprediksi akan bangkrut (collaps). Apalagi tidak lama lagi rupiah bisa menyentuh sekitar Rp13.000,”kata Rizal Ramli. Rizal yang juga calon presiden yang diunggulkan sejumlah lembaga survei itu mengatakan, tidak ada yang aneh, jika rupiah mulai bergerak ke level

Rp12.000 hingga Rp13.000. Karena fundamental ekonomi Indonesia ini sebenarnya sangat rapuh. “Lihat saja, defisit neraca perdagangan sudah minus 6 miliar dolar AS, lalu defisit transaksi berjalan minus 9,8 miliar dolar AS, ditambah lagi dengan utang swasta yang jauh tempo sekitar 27 miliar dolar AS,” ungkpanya. Lebih jauh pendiri Econit itu mengatakan, utang perusahaan swasta memang bukan menjadi tanggungan pemerintah. Oleh karena itu, yang sangat dibutuhkan sekarang ini adalah paket jangka menengah. “Solusi yang paling baik, adalah pemerintah menceritakan saja apa adanya soal kondisi ekonomi yang sebenarnya,” tambahnya. Rizal mempertanyakan mengapa 4 pilar yang ideal ini berbeda dengan realitas di lapangan. “Ini karena ada mising link, terputusnya rantai dengan citacita indah 4 Pilar. Disisi lain, Indonesia sudah tidak ada lagi yang nasionalis. Malah beberapa menteri menyebut soal nasionalis tidak lagi penting,”ujar Rizal. Sementara itu, Direktur

eksekutif Megawati Institut, Arif Budimanta juga berpendapat yang sama, dan memperkirakan 55 persen lebih dari cadangan devisa nasional, jumlahnya sama dengan utang swasta yang jatuh tempo. “Utang luar negeri swasta ini, semakin besar dan bisa sulit dikendalikan,” tegasnya. Langkah yang mendesak diperlukan saat ini, sambung Arif, menstabilkan pasar keuangan dalam negeri. Namun tetap mengedepankan aspek kehati-hatian dan mencegah moral hazard. “Juga melakukan kebijakan pencegahan dan pengurangan terhadap kegiatankegiatan spekulatif di pasar. Pendekatan moral suasion kepada pelaku pasar agar tidak melakukan sesuatu yang dapat menambah gejolak,” paparnya. SedangkanWakil Ketua MPR RI Ahmad Farhan Hamid menegaskan perekonomian negara saat ini secara umum pertumbuhannya baik. “Hanya saja utang luar negeri terus bertambah besar, dan sumber daya alam negara ini pengelolaannya makin jauh dari amanat konstitusi,” pungkasnya.(J07)

galangan kapal seperti PT Dok dan Perkapalan Surabaya (DPS), masa antrian kapal bisa mencapai 3 bulan. “Artinya kalau ada pemilik kapal yang hari ini mendaftar untuk melakukan docking, baru bisa kita kerjakan 3 bulan kemudian,” kata Tjahjono yang juga Direktur Utama DPS. Tjohjono menambahkan, jumlah pertumbuhan galangan kapal di Indonesia tidak secepat pertumbuhan jumlah kapalnya. IPERINDO mencatat jumlah kapal yang beroperasi di Indonesia saat ini mencapai 12.000 unit dengan kebutuhan docking untuk kapal rata-rata 3 minggu untuk tiap kali docking. “Sesuai peraturan, kapal niaga yang mengangkut barang harus melakukan docking minimal dua tahun sekali sedangkan kapal pengangkut penumpang harus docking setiap 1 tahun sekali, ini tentunya banyak sekali, sedangkan galangannya masih minim,” paparya.

Mengantisipasi shortage ini sejumlah perusahaan galangan kapal gencar meningkatkan kapasitas dan kapabilitasnya. Contonya PT PAL yang melakukan revitalisasi fasilitas produksi dan pendukung. Ia menambahkan, Indonesia juga belum memiliki pabrik yang mampu membuat komponen untuk membuat kapal. Selama ini hampir seluruh komponen pembuatan kapal harus impor dari luar. “Dengan jumlah kapal berbendera Indonesia yang mencapai 12 ribu unit, seharusnya juga disokong oleh industri komponen kapal yang memadai. Namun saat ini hal itu belum bisa dicapai,” jelasnya. Sebagai negara kelautan, Indonesia juga masih kekurangan kapal. Ketua Indonesia National Shipowners’ Association (INSA) Carmelita Hartoto mengatakan dalam tiga tahun ke depan industri maritim

membutuhkan 325 unit kapal offshore, 80 kapal pengeboran dengan investasi rata-rata US$20 juta per unit. “Dalam setahun Indonesia butuh penambahan 1.000kapaluntukmelayaniangkutanbarangdanmanusia,”jelasnya pada kesempatan yang sama. Bukti bahwa industri perkapalan dan pendukungnya di negara kelautan ini tertinggal dengan negara lain bahkan negara tetangga, dapat dilihat dari peserta pameran maritim, Indonesia Maritme Expo (IME) yang berlangsung pada tanggal 5-7 September 2013 di Jakarta Convention Center. IME ke 4, yang dihadiri Direktur Jendral Industri Unggulan Berbasis Teknologi Tinggi Kementerian Perindustrian Republik Indonesia Dr. Ir. Budi Darmadi, M.Sc., Kepala Badan Penelitian dan Pengembangan Perhubungan, Kementerian Perhubunga DR. Wendy Aritenang, Tjahjono Roesdianto, dan

Carmelita Hartoto ini diikuti lebih dari 170 peserta pameran dari 25 negara. Pesertanya didominasi terutama perusahaan dari China, kemudian disusul Singapura, Jepang, Norwegia, Belanda, dan Inggris. Pameran bertema ”The Gateway to Indonesia’s Rising Maritime Market” yang diselenggarakan PT.Reed Panorama Exhibitions didukung Kementerian Perindustrian, Kementerian Perhubungan, ASCOATINDO (Indonesian Coating Association), BIMCO (Baltic and International Maritime Council), HINABI (Heavy Equipment Manufacturer Association of Indonesia), INSA, dan IPERINDO ini juga diselenggarakan bersamaan dengan Konferensi Indonesia Supply Chain & Logistics yang ke-8 dengan harapan dapat mendorong sinergi serta potensi membangun jejaring bagi peserta dan pengunjung kedua pameran. (adji k.)

Komisi IX DPR Tolak Rencana PHK Pekerja BUMN

M.Julian Manurung: Putra Batak Di Perantauan Mulai Kehilangan Jatidiri Ironis, Negara Kelautan Kekurangan Kapal Dan Galangan

MEDAN (Waspada): Putra Batak yang berada diberbagai daerah atau kota perantauan di Indonesia ataupun luar negeri sudah mulai kehilangan jatidiri yang dibuktikan sudah banyak yang tidak kenal dengan asalusul marga, tanah leluhur ataupun adat istiadat. Akibatnya, pembangunan di kampung halaman tanah Pasogit terabaikan. Demikian sambutan M. Julian Manurung, pendiriYayasan Raja I Sombaon (Yaris) yang berpusat di Jakarta pada acara Pesta Pembangunan Gedung Pemuda Gereja Protestan Persekutuan (GPP) Minggu (8/9) di Jl.Sempurna Ujung Medan. Hadir dalam acara itu Kemenpora yang diwakili staf ahli Drs. Sakhyan Asmara, staf ahli Pemprovsu Drs Robertson Simatupang, Marihot Tampubolon staf mewakili Plt walik ota Medan, pengusaha Mujianto (pimpinan Budha Tzu Chi Perwakilan Medan) yang diwakili

Direkturnya, Syamsul Sianturi,SH dan Bishop Pdt. Dr.JH. Manurung, Pdt Drs.J.Baringbing M.Th, dan lainnya. Menurut M.Julian, sebagai orang Batak atau Karo, Nias dan etnis lain yang menyandang marga harus mengenal asal-usul marga yang menempel pada nama. Namun nampaknya tidak demikian sebagian kalangan putra Batak di perantauan. “Ini bisa dibuktikan dalam menyepakati nama tokoh/pahlawan menjadi nama bandara saja sulit diwujudkan, apalagi menyepakati sebuah kebijakan untuk mensejahterakan diri kita,” katanya. “Saya termasuk yang terlambat mengenal jatidiri sebagai putra suku , tetapi sejak 2000 saya mengenail Desa Sibisa Porsea Tobasa, yakni desa leluhur marga manurung yang saya sandang, maka saya baru merasa benar-benar generasi atau keturunan Batak sesuai darah

yang mengalir di tubuh saya dan marga yang tercantum di belakang nama saya. Ini, menurut Manurung, harus mulai ditanamkan agar pemuda Batak mendatang memiliki jatidiri yang lengkap dalam berbangsa dan bernegara. Sementara Menpora RI yang diwakili staf ahli Drs. Sakhyan Asmara, M.AP dalam sambutannya mengharapkan agar pembangunan gedung GPP itu sebagai pelopor untuk kalangan generasi muda, khususnya umat Kristen. Sementara Pdt Drs.J. Baringbing, M.Th sebagai ketua pelaksana pembangunan Gedung Pemuda itu dalam kesempatan terpisah menyatakan akan serius menyelesaikan pembangunan gedung pemuda GPP itu maksimal mesti tuntas dalam tiga tahun ini. “Saya yakin karena dalam acara pesta pembangunan minggu lalu itu berhasil terkumpul Rp538 juta. (m22)

JAKARTA (Waspada): Sebagai negara kelautan, Indonesia masih kekurangan kapasitas galangan kapal atau dok untuk perbaikan dan perawatan kapal. Kebutuhan reparasi dan perawatan kapal tidak sebanding dengan jumlah dok sehingga terjadi antrian panjang. Ketua Umum Ikatan Perusahaan Industri Kapal dan Lepas Pantai Indonesia (IPERINDO), Tjahjono Roesdianto, mengatakan saat ini kebutuhan reparasi dan perawatan kapal di Indonesia mencapai 7,58 juta gross ton kapal per bulan, sedangkan kapasitas seluruh galangan kapal di Indonesia hanya berkisar 6-7 juta gross ton kapal. “Kalau di rata-rata ada shortage sekitar 1,5 juta gross ton kapal tiap bulannya. Kondisi ini mengakibatkan lamanya masa antri kapal untuk melakukan docking,” ujarnya di Jakarta baru-baru ini. Di beberapa perusahaan


Sport

A10

WASPADA Rabu 11 September 2013

Mudah-mudahan Emas Harapan Prabudi Kepada 10 Atlet Waspada MEDAN (Waspada): Pemimpin Redaksi Harian Waspada, H Prabudi Said, resmi melepas keberangkatan 10 wartawan Waspada Grup yang akan memperkuat kontingen PWI Cabang Sumut pada Pekan Olahraga Wartawan Nasional (Porwanas) 2013 di Banjarmasin, Kalsel, 12-20 September. Acara penglepasan yang berlangsung di Lantai 2 Gedung Bumi Warta Harian Waspada, Jl Letjen Suprapto/Brigjen Katamso No 1 Medan, Selasa (10/9), berlangsung penuh kekeluargaan yang dirangkai makan siang bersama Pemimpin Umum Harian Waspada, dr Hj Rayati Syafrin. Prabudi Said berharap 10 wartawan Waspada Grup (Waspada dan Berita Sore) dapat tampil maksimal, menjunjung sportivitas dan nama baik Waspada. Hendra DS cs juga diharapkannya turut menyumbangkan prestasi membanggakan bagi kontingen PWI Sumut. “Harapan saya, dari 10 wartawan Waspada Grup ini, ada yang meraih medali. Ya, minimal medali peraklah, mudahmudahan emas,” ujar Prabudi, memberi tantangan kepada para awak media Waspada. Prabudi juga berharap keseluruhan kontingen PWI Cabang Sumatera Utara dapat memenuhi target diusung. Menjadi satu kebanggaan, karena Harian Waspada selalu mampu menyumbangkan atlet bagi PWI Sumut di ajang Porwanas.

Ke-10 wartawan Waspada Grup yang akan memperkuat PWI Cabang Sumut adalah Hendra DS yang juga Redaktur Berita akan bertanding di cabang futsal, selanjutnya Armin R Nasution (Redpel Berita/Bulutangkis), Jonny R Silalahi (Redaktur Olahraga/Futsal), Edwar Thahir (Koordinator Promosi/Biliar), Zulkifli Harahap (Redaktur Ekonomi/Futsal). Selanjutnya, Rudi Arman (Wartawan Kepolisian/Futsal), Setia Budi Siregar (Wartawan Olahraga/Tenis Meja), Zulfi Azmi (Wartawan Berita Sore/Futsal), Robinson Simbolon (Wartawan Berita Sore/Futsal), dan Edwin Dhani (Wartawan Berita Sore/ Futsal). Selain itu, lima wartawan Waspada perwakilan Aceh juga memperkuat tim Porwanas PWI Cabang Aceh, yakni T Mansursyah (tenis meja), T Ardiansyah (catur), Bahtiar Gayo (catur), Jaka Rasyid (bola voli), dan Rusli Ismail (bola voli). (m42) WARTAWAN Waspada yang akan memperkuat kontingen PWI Sumut di Porwanas, diabadikan bersama Pemimpin Redaksi H Prabudi Said dan Pemimpin Umum dr Hj Rayati Syafrin, seusai acara penglepasan di Lantai 2 Gedung Bumi Warta Waspada, Selasa (10/9). -Waspada/Arianda Tanjung-

Sombrero Semrawut WASHINGTON (Waspada): Timnas Mexico tiba di Ohio dengan suasana semrawut, Selasa (10/9), padahal mereka akan menjajal tim kuat Amerika Serikat pada laga lanjutan PPD 2014 zona Concacaf.

AP

PENYERANG Paolo Guerrero (kanan) dihadang rekannya Alberto Rodriguez dalam sesi latihan tim Peru di Puerto La Cruz, Venezuela, Selasa (10/9) pagi WIB.

Pelatih anyar Luis Fernando Tena ditugaskan membawa Sombrero kembali ke jalur benar menuju putaran final Brazil 2014. “Ini merupakan tanggung jawab hebat untuk diambil,” tutur Tena, Dia mewarisi kursi panas Jose Manuel “Chepo” de la Torre, yang dipecat hanya beberapa jam setelah Javier ‘Chicharito’ Hernandez (foto) dan kawan-kawan kalah memalukan 1-2 dari tamunya Honduras di Stadion Azteca. Akibat kekalahan itu, Mexico merosot ke posisi keempat dan hanya tiga tim teratas yang mendapat tiket otomatis lolos

Persaingan Masih Seru MONTEVIDEO (Waspada): Persaingan memerebutkan empat tiket ke putaran final Piala Dunia 2014 dari zona Amerika Selatan masih seru, bahkan belum ada satu tim pun yang sudah memastikan lolos. Argentina dan Kolombia paling berpeluang di puncak klasemen dengan 26 angka dari 13 laga. Chile dan Ekuador menempati empat besar, tetapi Uruguay, Venezuela dan Peru, bisa saja menyikut saat babak kualifikasi tinggal menyisakan dua sampai tiga laga lagi. Di Estadio Defensores del Chaco, Asuncion, Rabu (11/9) pagi WIB, tuan rumah Paraguay akan diuji kesiapannya oleh Argentina. Kans Paraguay bisa dikatakan hampir habis, tapi laga ini tetap sangat panas. Nama besar Argentina sebagai lawan, membuat Paraguay bisa memiliki motivasi

ekstra untuk mengalahkan sang pemuncak klasemen. Padahal Argentina sama seperti halnya Kolombia, butuh kemenangan untuk segera memastikan tempatnya di Brazil. Di Puerto La Cruz, pertempuran antara Venezuela dan Peru bisa jadi sebagai pelengkap pada matchday tengah pekan ini. Venezuela masih memiliki kans, meski pun kecil. Butuh keajaiban dengan kekalahan beruntun dari Ekuador dan Uruguay agar Venezuela mendapatkan jatah. Tapi fokus mereka di Estadio Olimpico General Jose Antonio Anzoategui, tentu saja untuk mengalahkan Peru. Di Estadio Centenario, Montevideo, Uruguay bisa membuka peluang masuk empat besar apabila mampu menundukkan tamunya. Namun absennya bek Diego Lugano dan

ke Negeri Samba. Tim posisi keempat akan melakoni playoff dua leg melawan Selandia Baru untuk mendapatkan jatah tersisa. Tena merupakan asisten de la Torre yang sarat pengalaman, memahami benar betapa seriusnya situasi ini. Dia menyuarakan keyakinan kepada para pemainnya bahwa Chicharito cs merupakan pemenang medali emas Olimpiade 2012. Sombrero juga telah berpartisipasi di Piala Dunia sebanyak 13 kali, bahkan belum pernah absen di putaran final sejak 1990. “Tentu saja ini bukan kondisi terbaik untuk mengambil alih tim,” jelas Tena. Namun AS asuhan Jurgen Klinsmann juga baru saja menelan kekecewaan. Paman Sam

kalah 1-3 di Kosta Rika, yang mengakhiri laju 12 kemenangan berturut-turut mereka. Pasukan Klinsmann akan berusaha bangkit meski tidak diperkuat para pencetak gol Jozy Altidore, Matt Besler, Geoff Cameron, dan Michael Bradley. Altidore, Besler, dan Cameron mendapatkan kartu kuning kedua di San Jose, Jumat lalu, sehingga menjalani skorsing satu pertandingan. Gelandang kunci Bradley harus absen karena terkilir pada pergelangan kakinya saat pemanasan jelang laga kontra Kosta Rika. Klinsmann sudah menambah empat pemain di timnya, yakni gelandang Club Tijuana Joe Corona, gelandang Houston Dynamo Brad Davis, bek San Jose Earthquakes Clarence Goodson, dan gelandang Tigre Jose Torres. Tapi mantan pelatih Jerman itu mengaku, kekalahan di Kosta Rika tidak mengubah pendekatannya terhadap laga melawan musuh bebuyutan Mexico. “Kami tahu jika kalah pada laga

PPD Zona Concacaf Kamis, 11 Sept (WIB) Jamaika v Kosta Rika 05:00 AS v Mexico 07:00 Honduras v Panama 08:00

Klasemen Sementara Kosta Rika AS Honduras Mexico Panama Jamaika

7 7 7 7 7 7

4 4 3 1 1 0

2 1 1 5 4 3

1 2 3 1 2 4

10-4 8-6 8-8 4-4 5-7 2-8

14 13 10 8 7 3

ini, maka Kosta Rika akan berada di peringkat pertama,” kata Klinsmann. “Kami tahu ini akan sangat ketat sampai partai-partai terakhir. Kami memerlukan setidaknya empat angka lagi untuk lolos. Kami akan mendapatkan empat angka itu,” optimisme mantan striker Inter Milan dan Tottenham Hotspur tersebut. Pada laga lainnya, Kosta Rika akan berusaha mengokohkan posisinya saat melawat ke markas Jamaika, yang belum memenangi satu pertandingan pun. (m15/ant/rtr/ap)

Bukti Brazil Berikutnya

PPD Zona Conmebol Kamis, 11 Sept (WIB) Bolivia v Ekuador Uruguay v Kolombia Venezuela v Peru Paraguay v Argentina

03:00 04:00 07:00 08:40

Klasemen Sementara Argentina Kolombia Chile Ekuador Uruguay Venezuela Peru Paraguay Bolivia

13 13 14 13 13 14 13 13 13

7 8 8 6 5 4 4 3 2

5 2 0 3 4 4 2 2 4

1 3 6 4 4 6 7 8 7

25-9 22-7 24-21 17-13 20-22 10-17 13-19 13-23 15-24

26 26 24 21 19 16 14 11 10

Martin Caceres, membuat La Celeste harus ekstra waspada dengan ketajaman Radamel Falcao, yang siap menggempur pertahanan mereka di sepanjang 90 menit laga. (m15/goal/fifa)

AP

PELATIH Luiz Felipe Scolari (tengah) memberikan pengarahan kepada skuadnya dalam sesi latihan Timnas Brazil di Foxborough, Boston, AS, Rabu (10/9) pagi WIB.

Mou Masih Ganggu Barca

AP

MANAJER Chelsea Jose Mourinho (kanan) diisukan ingin merekrut musuhnya Victor Valdes (kiri) dari Barcelona.

LONDON ( Waspada): Jose Mourinho masih berusaha mengganggu Barcelona, musuh lamanya ketika membesut Real Madrid, lewat rumor perekrutan Victor Valdes . Spekulasi Mou akan memboyong Valdes ke Chelsea pada bursa transfer Januari mendatang, telah menjadi headline mediamedia Spanyol. Sport mengklaim, The Blues sudah siap menawarkan gaji 10 juta euro permusim untuk kiper utama El Barca tersebut. Valdes selama ini justru dikenal sebagai salah satu musuh akut Mou. Keduanya pernah hampir berkelahi di Spanyol, juga sempat terlibat perseteruan saat Inter Milan asuhan Mou menyingkirkan El Catalan di Liga Champions 2010 silam. Kontrak Valdes di Camp Nou akan habis, Juni 2014. Di sisi lain Chelsea juga tak kunjung menyodorkan perpanjangan kontrak bagi Petr Cech, yang kini masih menjadi kiper utamanya. “Saya terus mencoba meyakinkannya untuk bertahan. Saya tidak akan memberitahukan Anda bahwa kami telah melakukan pertemuan dengan Valdes,” ujar Sandro Rosell, Presiden Barcelona, Selasa (10/9). ‘Saya telah mencoba dan belum berhasil, tapi saya pasti akan mencoba lagi. Kami masih memiliki satu tahun tersisa dan itu waktu yang cukup lama (untuk membujuknya),” tambahnya.

Marchisio Minta Maaf Absen Lawan Inter R O M A ( Wa s p a d a ) : Claudio Marchisio minta maaf kepada tifosi Juventus, karena absen melawan Inter Milan pada giornata 3 Liga Seri A di Stadion Giuseppe Meazza, Sabtu (14/9) mendatang. Gelandang Italia itu masih bergelut dengan cedera, padahal laga ini selalu didambakannya. “Saya minta maaf, karena tidak akan berada di sana. Tapi tim akan melakukan hal bagus dan saya sangat yakin dengan tim saya,” jelas Marchisio melalui Soccerway, Selasa (10/9). “Tetapi Inter selalu membuat sulit kami. Mereka mengalahkan kami tahun lalu dan juga punya pelatih baru,” ujar-

nya lagi. Dia bahkan menilai, I Nerazzurri musim ini semakin kuat dengan kedatangan allenatore anyar Walter Mazzarri. Mantan pelatih Napoli itu, menurutnya, mampu membuat permainan La Beneamata lebih bagus dibanding musim lalu. “Bagi kami mengalahkan sebuah tim kuat seperti Inter di pekan ketiga musim ini tentu akan menjadi pendongkrak rasa percaya diri,” tegas Marchisio. Duel musuh bebuyutan bertajuk Derby d’Italia itu memang selalu menghadirkan ketegangan bagi masing-masing klub, juga para pendukungnya. Demikian dengan Javier Zanetti, kapten Nerazzurri yang sudah berusia 40 tahun. Meskipun dipastikan absen seperti

halnya Marchisio, Zanetti mengaku ikut gugup. “Ketegangan selalu hadir jelang pertandingan penting. Sayangnya saya tidak bisa tampil,” ucap Zanetti kepada Football Italia. “Juventus tim hebat, tapi saya yakin Inter akan berusaha keras mengalahkan mereka, apalagi sekarang ada Walter Mazzarri di kursi pelatih. Dia selalu berusaha keras dan menginginkan yang terbaik,” tambahnya. Zanetti cedera tendon achilles sejak April lalu. Winger veteran Argentina itu membutuhkan waktu sekitar delapan bulan untuk memulihkan kondisinya, sehingga baru bisa tampil lagi Januari mendatang. (m15/okz/sw/fi)

AP

Rosell pun melontarkan pernyataan mengejutkan tentang Mou, yang dinilainya sangat lucu. Padahal selama tiga musim membesut Madrid, komentar-komentar pedas Mou tentang Barca terus menghiasi halaman depan media di Negeri Matador. Persaingan di atas lapanan hijau pun menjurus jadi permusuhan di luar lapangan hijau. Bahkan konflik itu sempat mengganggu internasl Timnas Spanyol, yang didominasi para pemain Barca dan El Real. “Kepergiannya mengurangi tensi panas (Madrid - Barca) yang telah dia bangun. Namun bagaimanapun juga, dia sosok lucu bersama komentar-komentarnya yang kini pergi bersamanya,” tutur Rosell kepada Marca. Karenanya dia menganggap, rumor Mou mau memboyong Valdes ke London, hanya lelucon lanjutan dari pelatih asal Portugal tersebut. Tingkat kebenarannya sama dengan spekulasi El Blaugrana mau memindahkan kiper terbuang Iker Casillas dari Madrid ke Camp Nou. “Tidak ada peluang untuk itu. Beberapa pemain merupakan ikon bagi sebuah klub. Madrid tidak akan pernah berpikir untuk mendatangkan Xavi (bintang Barca) dan saya juga tidak pernah berniat melihat Casillas mengenakan badge Barcelona,” pungkas Rosell. (m15/vvn/sport/marca)

BOSTON, AS (Waspada): Brazil mencapai bentuk penampilan terbaiknya, persis seperti saat menjuarai Piala Konfederasi 2013, saat menjajal Portugal pada laga eksibisi di Boston, Amerika Serikat. Pelatih Luiz Felipe Scolari mengklaim, pesta gol menggasak Australia 6-0 pada laga persahabatan di Brasilia, Sabtu lalu, menjadi bukti kesiapan Selecao. Portugal akan menjadi pembuktian berikutnya bagi Brazil, Rabu (11/9) pagi ini mulai pkl 08:00 WIB. “Kemenangan 6-0 itu amat meyakinkan. Kami bemain dengan irama amat bagus. Dalam keadaan performa terbaik seperti ini, kami berangkat ke Boston untuk melawan Portugal,” klaim Scolari, seperti dikutip Reuters, Selasa (10/9). “Kelihatannya bukan seperti laga persahabatan, karena penampilan kami tak ubahnya seperti saat menang di Piala Konfederasi,” tambah Scolari dalam laman resmi Konfederasi Sepakbola Brazil (www.cbf.com.br). Pelatih yang membawa Samba menjuarai Piala Dunia 2002 di Jepang-Korsel itu tak khawatir, kendati didera beberapa pemainnya cedera. Dia merasa terbiasa, sebagaimana saat menggunduli Australia. Saat itu striker Jo tampil menggantikan Fred. Jo kembali diandalkan The Big Phil, selain beberapa pemain cadangan lain yang akan turun. Dia terkesan dengan penampilan gelandang Ramires, yang terlewatkan ketika Brazil menjadi tuan rumah dan menang 3-0 atas Spanyol pada final Piala Konfederasi di negeri sendiri. “Dia (Ramires) pemain hebat. Dia berada di depan dan terus menyerang dan 10 detik kemudian dia sudah berada di posisi bertahan,” puji Scolari. “Dia pemain serba bisa dan amat berguna dalam tim,” tambahnya, yang mengindikasikan gelandang Chelsea itu bakal masuk skuad Selecao untuk Piala Dunia mendatang. Bomber belia Bernard, yang akan berusia 21 tahun akhir pekan nanti, pun menunjukkan permainan mengesankan dan akan mendapat kesempatan turun lapangan lawan Portugal. Sedangkan bek kiri Real Madrid Marcelo, terpaksa keluar dari tim karena mengalami kejang otot pada laga ketika melawan Australia. Posisinya kemungkinan akan digantikan Maxwell, mantan bek Barcelona. Scolari mengharapkan Oscar, gelandang Chelsea lainnya, bisa prima dari cedera pergelangan kaki kanannya, agar dia dapat mentas di Negeri Paman Sam. (m15/ant/rtr/cbf)

Ozil Refleksi Tekad Juara The Gunners

AP

LONDON (Waspada): Bek Kieran Gibbs mengklaim, usaha klubnya mendatangkan Mesut Ozil dari Real Madrid, telah merefleksikan tekad Arsenal untuk menjuarai Liga Premier. “Itu gambaran apa yang klub ingin lakukan dan apa yang ingin klub capai. Ini untuk mencapai yang setiap orang telah lama menunggunya,” jelas Gibbs, seperti dilansir Sport BT, Selasa (10/9). Meriam London asuhan ArseneWenger memang sedang mempersiapkan skuad terbaik untuk mengatasi puasa gelar, yang sudah berlangsung delapan musim. “Dia (Ozil) punya teknis ke-

las dunia. Saya yakin dia bisa melakukan seperti apa yang telah dia lakukan ketika masih memperkuat Real Madrid,” tambah bek sayap berusia 23 tahun tersebut. Seperti halnya Gibbs, bek sentral Per Mertesacker asal Jerman, juga menilai Ozil punya kemampuan mengangkat derajat The Gunners, sehingga layak dibanderol 42,5 juta pounds. “Saya pikir dia pantas dibayar dengan nominal tersebut. Dia merupakan pemain fenomenal dan saya pikir saat ini dia belum mencapai yang terbaik,” beber Mertesacker dalam Daily Mail. Menurut Mertesacker, bin-

Mirror

BEK Per Mertesacker yakin Mesut Ozil (kanan) mampu mengangkat derajat Arsenal. tang berusia 24 tahun itu bakal cocok dengan gaya permainan Arsenal. “Saya pikir kontribusinya untuk klub akan besar. Dia pemain luar biasa dan kami senang memilikinya di Arsenal,” puji Mertesacker. Selain sama-sama punggawa Der Panzer, Ozil dan Mertesacker pernah bersama menjadi pilar Werder Bremen. Chief Commercial Arsenal, Tom Fox, menambahkan bahwa mengangkat trofi akan terasa

sangat manis tanpa peran ‘sugar daddy’. Fox sepertinya menyindir Chelsea, Manchester City dan Manchester United, yang kini telah dikuasai investor kaya dari luar Inggris. “Ketika kami menang, kami akan meraihnya dengan hasil keringat dari usaha keras kami sendiri. Kami tidak akan menang di balik sugar daddy yang merogoh dalam dari sakunya,” sentil Fox. (m15/okz/sbt/dm)


Sport

WASPADA Rabu 11 September 2013

A11

Atlet Popnas Aceh Jangan Terbebani Target

Waspada/Zafrullah

KADISPOA Aceh, Bukhari AKs MM (memegang mikrofon), didampingi Sekretaris Dispora Asnawi SPd MSi (kanan), dan Kabid Keolahragaan Musri Idris SE MSi (kiri), memberi wejangan kepada para atlet, pelatih, dan ofisial Popnas Aceh.

BANDA ACEH (Waspada): Kepala Dinas Pemuda dan Olahraga (Kadispora) Aceh, Bukhari AKs MM, meminta para duta olahraga pelajar Aceh yang akan ber-laga di Popnas XII/2013 tetap bertanding serius dan jangan terbebani target. “Jangan jadikan target sebagai beban, tapi jadikan sebagai pemicu semangat dan motivasi untuk memberikan yang terbaik,” kata Bukhari pada acara temu ramah dengan atlet dan pelatih Popnas XII Aceh di Hall Serbaguna SHB Lhong Raya, Senin (9/9) malam. Menurut dia, keberangkatan para atlet ke Jakarta bukan untuk rekreasi, tapi membawa misi bertanding untuk meraih prestasi terbaik, baik untuk diri sendiri, masyarakat, maupun Pemerintah Aceh. “Kalian adalah atlet-atlet pelajar terbaik yang dimiliki Aceh saat ini dan telah dipercayakan untuk mewakili Aceh di pentas nasional. Karena itu, jagalah kepercayaan yang telah diberikan masyarakat dan Pemerintah Aceh ini,” tegas Bukhari. Meski tidak dibebani target, Bukhari merasa yakin di dalam hati setiap atlet pasti ingin mengukir prestasi yang terbaik. Begitu juga dengan masyarakat dan Pemerintah Aceh, juga menginginkan yang sama. “Tapi seperti kata saya tadi, jangan sampai kalian merasa terbebani dengan semua itu. Tetaplah bertanding dengan santai, tapi serius,” ucapnya.

Persiraja Target Poin Penuh BANDA ACEH (Waspada): Persiraja Banda Aceh mengusung misi revans saat menantang tamunya, Arema IPL, dalam laga perdana putaran kedua Indonesian Premier League (IPL), Rabu (11/9) sore nanti. Asisten Pelatih Laskar Rencong, Wahyu AW, kepada Waspada, Selasa (10/9), mengatakan skuadnya sudah siap turun lapangan. “Insya Allah, anak-anak sudah siap tampil, mereka ingin revans atas kekalahan 1-2 di putaran pertama,” ujar dia. Wahyu menuturkan, timnya tak ingin jumawa saat menantang Arema IPL yang dilatih Abdurrahman Gurning. “Kita akan berusaha dan bekerja keras untuk mengamankan poin penuh, kami berharap dukungan dan doa masyarakat,” papar dia. Bicara skema permainan, Wahyu mengatakan tidak ada perubahan yang mendasar dalam komposisi tim. “Masih materi yang lama, cuma ada perubahan dengan kembalinya Andrea di wing back kanan,” sebut Wahyu. Kembalinya Andrea disambut baik kubu tuan rumah, meski

dalam laga itu, Erik Saputra dkk tak didampingi pelatih kepala Maman Suryaman serta dua pemain muda, Hendra Sandi Gunawan dan Miftahul Hamdi yang bergabung di Timnas U-19. Kubu Arema mengaku menolak meremehkan kekuatan tim Tanah Rencong yang bakal dihadapi pada Rabu hari ini dan PSLS Lhokseumawe Sabtu (14/ 9) nanti. Tim Singo Edan menyadari sudah ada bahaya di depan mata dalam lawatannya ke Aceh. Pihak Arema sudah memperkirakan kedua tim asal Aceh dipastikan memburu tiga poin pertama. Pasalnya, mereka yang di sepanjang putaran pertama lalu tertahan di posisi 10 dan 11 di papan klasemen sementara IPL. “Motivasi tinggi duo Aceh membuat Arema berhati-hati. Kita sudah dengar keadaan ka-

batkan publik pecinta sepakbola di tanah air. Terutama dalam pemilihan pemain. Mekanisme pemilihan melalui short message service (SMS) diganti dengan pemilihan langsung oleh regulator kompetisi ISL. “Kami ingin beda saja musim ini karena bosan dengan mekanisme lama. Untuk pemilihan pemain yang biasanya memakai model SMS, kini pemain-pemain tim lawan klub juara dipilih langsung PT Liga,” kata Tigor di Jakarta, Selasa (10/9). Ditambahkan, pihaknya menyerahkan pemilihan pemain kepada tim Technical Study Group (TSG). Tim ini dipimpin olehYopie Lepel. Semen-

tara mantan pemain timnas,Yeyen Tumena, Tommy Welly dari unsur jurnalis, dan Demis Djamaoedin yang merupakan mantan manajer tim SAD Indonesia, terpilih sebagai anggotanya. Untuk pilihan pemain, PT Liga membebaskan semua pemain dari 18 klub untuk dipilih dan memastikan tidak ada pilih kasih, meski pemain tersebut bermain di klub calon degradasi. Sebab, penilaian dilakukan atas penampilanpemainsecaraindividu. “Untuk pemilihan pelatih juga kami serahkan kepada tim TSG. Kami belum bisa umumkan nominasinya siapa saja. Minggu depan baru semua diumumkan,” pungkasnya. (yuslan)

Semarak Haornas Di Paluta GUNUNGTUA (Waspada): Peringatan Hari Olahraga Nasional (Haornas) ke-XXX tahun 2013 tingkat Kabupaten Padanglawas Utara (Paluta), dimeriahkan dengan olahraga senam sehat dan jalan santai di Lapangan Merdeka, Kelurahan Pasar

Gunungtua, Senin (9/9). “Kegiatan bekerjasama PT Askes ini, dalam rangka menyemarakkan Haornas, sekaligus mengajak masyarakat untuk gemar melakukan olahraga sebagai bagian dari pola hidup sehat,” ujar Plt Sekdakab Paluta,

Atlet Paralayang Jatuh Saat Atraksi FDT 2013 SAMOSIR (Waspada): Hari kedua FDT 2013, kemarin, seorang atlet paralayang mesin, Bambang, berasal dari Jember, dirawat di Puskesmas Tuktuk Siadong akibat terjatuh dari ketinggian 20 meter di atas perairan Hotel Duma Sari. ‘’Bambang mengalami sesak nafas, sehingga langsung dilarikan ke Puskesmas Tuktuk,’’ ujar Kapuskesmas Tuktuk Berman Situmorang, kepada Waspada, Selasa (10/9). Pihak Puskesmas langsung melakukan tindakan pengobatan khusus, kemudian dirujuk ke RSU dr Hadrianus Sinaga, Pangururan, untuk dilakukan rontgen dan pengobatan intensif. (c11)

Problem Catur

Drs Hailullah Harahap. Kepala Dinas Pemuda dan Olahraga Budaya dan Pariwisata Paluta, H Al Ikhsan Nasution, memberikan apresiasi kepada PT Askes atas partisipasinya mendukung kegiatan dalam menyemarakkan Haornas di Paluta tersebut. Kepala PT Askes (Persero) CabangPadangsidimpuan,drNur Eva Parinduri, melalui Kepala PT Askes Tapsel, Endang Sunarti, mengaku gembira kegiatan tersebut mendapat antusiasme yang tinggi dari masyarakat. Sebelumnya, juga digelar upacara Haornas dan penyerahan piagam penghargaan dan tali asih kepada para atlet dan pelatih berprestasi. Acara juga dimeriahkan dengan pengundian kupon lucky draw yang menyediakan berbagai hadiah menarik. (a35)

TTS TOPIK

Misi Balas Dendam PSLS Sore Ini Jamu Persiba LHOKSEUMAWE (Waspada): PSLS Lhokseumawe siap menjamu Persiba Bantul dalam laga lanjutan putaran kedua Indonesian Premier League (IPL) 2013 di Stadion Tunas Bangsa, Lhokseumawe, Rabu (11/9) sore ini. “Misi kita membalas kekalahan di laga putaran pertama sebelumnya. Semoga target ini bisa terwujud dengan perjuangan maksimal seluruh pemain,” ujar Pelatih PSLS, Nasrul Koto, kepada Waspada, Selasa (10/9). Dikatakan, PSLS menelan kekalahan telak 1-4 dari Persiba saat bertanding di Stadion Sultan Agung, Bantul. Kekalahan juga harus diterima PSLS saat bertanding di markas Persijap di Stadion Gelora Bumi Kartini, Jepara, tiga hari lalu, dengan skor 1-3. “Tim akan bermain habis-habisan besok (hari ini). Selama kompetisi IPL 2013, kita belum pernah kalah di kandang dan tren positif tersebut harus mampu dipertahankan. Minimal kita bermain imbang,” ujar Koto. Disinggung kondisi pemain, Koto mengaku sedikit memiliki masalah. Pasalnya, selain bek

lau tim-tim main di Aceh susah menang,” ujar Direktur Operasional Arema, Haris Fambudy, seperti dilansir situs klub. Kata Haris, karena kondisi itulah yang membuat timnya tak gegabah memasang target menang di laga tandang pertama di putaran kedua ini. “Arema menolak untuk mematok target muluk jelang perteman mereka dengan tim asal Aceh,” sebut dia. Dia menolak tak ingin memberikan target tinggi yang justru bisa menjadi beban berat bagi para pemain, baik saat dijamu Persiraja ataupun saat menantang PSLS. Haris menyadari pasukan Singo Edan akan menghadapi lawan berat yang diperkuat materi pemain serta tampil di depan pendukungnya sendiri. “Jadi target kita main seri sudah bagus,” ucapnya. Guna mewujudkan harapan untuk bisa mencuri poin di partai away pertama putaran kedua ini, sebanyak 16 pemain diboyong pelatih Abdurahman Gurning ke Aceh. Skuad Singo Edan bertolak ke Aceh pada Selasa (10/9) pagi. (b07)

Waspada/Munawardi Ismail

NURUL Zikra diharapkan mampu membawa timnya mengatasi Arema IPL, Rabu (11/9) sore ini.

Aceh Tamiang Roadrace Digelar 14-15 September KUALASIMPANG (Waspada): Setelah sukses menggelar Grandfinal Yamaha Centra Motorprix tahun lalu, Kabupaten Aceh Tamiang kembali diberi kesempatan menggelar seri pembuka event yang sama tahun 2013. Kegiatan ini didukung Pemerintah Aceh Tamiang, PT Alfa Scorpii, NHK, FDR, dan lain-lain. Kejuaraan tersebut akan digelar tiga seri, dimulai dari Aceh Tamiang pada 14-15 September 2013 di sirkuit buatan Kompleks Perkantoran Pemerintah Aceh Tamiang. Ketua Panpel, Awal, kepada Waspada, Selasa (10/9), mengatakan Kejuaraan Yamaha Centra Motorprix Seri I 2013 bertajuk “Aceh Tamiang Roadrace Championship 2013 Trofi Bupati Aceh Tamiang”. Kejuaraan ini mempertandingkan sembilan kelas dan dibagi dalam dua kategori, yakni kelas OMR Yamaha dan All Merk. Kelas OMR Yamaha terdiri atas MP1 Seeded, MP2 Seeded, MP3 pemula, MP4 pemula, Jupiter MX MP5 pemula, dan MP5/ MP6 non kategori. Sedangkan All Merk, kelas yang diperlombakan MP5/MP6 non kategori, bebek standart showroom s/d 125cc non kategori dan matic standart s/d 130cc MP7 non kategori (lokal Aceh). Menurut Awal, kejuaraan yang akan dipandu MC Aling P, memperebutkan total hadiah Rp65 juta dan dua unit sepeda motor Yamaha pada akhir kejuaraan. Gelar juara umum akan diberikan kepada peraih poin tertinggi pada ketegori seeded (MP1 & MP2) dan pemula (MP3, MP4 & Jupiter MX). Pendaftaran peserta dipusatkan di Kantor Korwil IMI Aceh Tamiang, Jl Ir Juanda Karang Baru (depan Kantor Bupati Aceh Tamiang) yang dibuka sejak 11 September atau dapat menghubungi Wira (0852 6091 9784), Putra (0852 6000 6114), dan Awal (0812 6998 8390). Ketua Korwil IMI Aceh Tamiang, Elpian Raden, mengaku pihaknya akan terus mendukung kegiatan-kegiatan positif yang digelar dalam membangun dan memperkenalkan Kabupaten Aceh Tamiang kepada peserta yang berasal dari daerah lain. “Kegiatan ini juga tepat sebagai sarana try out para atlet IMI Aceh Tamiang sebagai persiapan menghadapi Pra Pora yang akan berlangsung November mendatang di Banda Aceh,” ujar Elpian. (b23)

REDELONG (Waspada): Pengurus KONI Kabupaten Bener Meriah, Selasa (10/9), menggelar rapat koordinasi dengan Pengurus Cabang Olahraga (Pengcabor). Hasil rapat tersebut, memutuskan jika Bener Meriah siap tampil di ajang Pra Pekan Olahraga Aceh (Pra Pora) 2013. Namun, tampilnya kontingen asal ‘Lumbung Kopi’ ini tidak dengan kekuatan penuh. Hanya sebagian cabor saja diikuti, mengingat terbatasnya anggaran dana. Selanjutnya, disesuaikan dengan prestasi dan target yang akan disampaikan masing-masing Pengcabor. “Belum ada kesimpulan cabang apa saja yang akan kita ikuti dalam Pra Pora. Yang pasti, akan ada pemangkasan, tidak semua cabor diberangkatkan,” ujar Ketua KONI Bener Meriah, Rusli M Saleh didampingi Sekretaris Sutrisno, seusai rapat, kemarin. Menurut Sutrisno, sesuai kesepakatan rapat, cabor-cabor yang diberangkatkan harus memiliki target dan data atlet berprestasi. Namun, di luar itu, pihaknya juga memberi kesempatan Pengcabor memberi masukan. “Sebelum KONI menyusun persiapan Pra Pora, kami berharap setiap Pengcabor telah memasukkan data prestasi dan target yang akan diraih. Itu nantinya akan menjadi bahan pertimbangan bagi kami,” ujarnya sembari menyebutkan

Jawaban di halaman A2.

Waspada/Rusli Ismail

KESEHA TAN KESEHAT

Sudoku MENDATAR

1. Tumbuhan dari Asia Timur, dijadikan ramuan obat-obatan dan berkhasiat membangkitkan nafsu syahwat. 6. Klinik ____ Medistra, satu-satunya lembaga pengobatan tradisional China untuk mengobati kanker, diabetes dan uremia, seperti sering diiklankan di Waspada. 8. Keadaan hilang atau berkurangnya kekuatan; Keloyoan. 10. Singkatan Spesialis Kedokteran Jiwa. 11. Pencegahan dan penyembuhan penyakit dengan memasukkan bahan kimia ke dalam tubuh. 13. Rentan. 14. Spesialis Bedah Ortopedi dan Traumatologi. 15. Ilmu tentang penyakit saluran kemih. 17. Rumah Sakit Islam. 18. Orang sakit yang dirawat dokter. 20. Pembuahan; Penghamilan. 22. Alat pembayar dokter dan obat. 24. Air Susu Ibu. 26. Panggilan singkat dokter. 27. Penyakit takut kecurian.

7

6

5

4

3

2

1 A

B

C

D

E

F

G

H

pihak KONI akan kembali melakukan rapat internal guna membahas persiapan menghadapi Pra Pora. Pantauan Waspada, sebelumnya dalam rapat koordinasi yang dihadiri 32 Pengcabor se Bener Meriah itu, seorang pengurus mempertanyakan boleh tidaknya Pengcabor mengirim atlet, meski menggunakan dana pribadi pengurus atau donatur. “Karena dana daerah terbatas untuk Pra Pora, apakah kami bisa mengirimkan atlet dengan dana Pengcab ke Pra Pora? Apalagi Pra Pora merupakan sarana atlet menuju PON. Artinya, kami berharap kebijakan KONI membatasi atlet tampil, tidak menghambat prestasi atlet yang ada,” tanya Zulkifli, Sekretaris Perkemi Bener Meriah. Pertanyaan tersebut ditanggapi langsung Ketua KONI Bener Meriah, Rusli M Saleh. Menurut dia, bila hal itu memungkinkan, pihaknya akan membuka ‘jendela’ bagi Pengcabor. “Bila Pengcabor atau ada donatur yang mau membantu memberangkatkan atletnya, kami kira tidak jadi persoalan. Namun demikian, segala sesuatunya harus terlebih dahulu dimusyawarahkan. Apalagi di ajang Pra Pora kita bukan membawa misi bagi Pengcabor, tapi nama daerah,” ucap Rusli. (cb09)

LATIHAN BRIDGE: Atlet bridge PWI Cabang Aceh, Tarmilin Usman (Ketua PWI Aceh) dan Asnawi Ismail, mendengar bimbingan pelatih Husni Ibrahim (kanan), di sela-sela latihan di Gedung PWI Aceh, Selasa (10/9) sore. Menurut Ketua PWI Cabang Aceh, Tarmillin Usman, cabang bridge ditargetkan meraih medali emas Porwanas XI di Banjarmasin, 12-21 September.

Putih melangkah, mematikan lawannya lima langkah.

8

adalannya, Indra Gunawan, tidak bisa tampil dan digantikan Rusdian, pemain asingnya Sergey Litimov juga mengalami masalah dengan otot paha kirinya saat bertanding di Jepara, sehingga masih diragukan Sergey bisa diturunkan. Hal ini membuat barisan pertahanan PSLS akan menghadapi tekanan berat dua striker andalan Persiba, yakni Slamet Nurcahyo dan Roberto Kwateh. “Nurcahyo dan Roberto itu penyerang berbahaya dan mereka harus selalu diantisipasi,” ujar Koto. Koto sendiri mengakui jika Persiba tim bagus yang saat ini menduduki posisi ketiga klasemen sementara dengan mengemas 31 poin. Kondisi berbeda dengan PSLS yang masih terpuruk di posisi 11 klasemen sementara dengan 21 poin. “Makanya kita sangat berharap tim tampil maksimal untuk mengamankan poin penuh. Ini laga yang sangat penting dan kami tampil di harapan pendukung sendiri, sudah menjadi keharusan seluruh pemain memberikan penampilan terbaik,” pungkasnya. (cmk)

Bener Meriah Pastikan Ikut Pra Pora

Perang Bintang ISL Di Papua JAKARTA (Waspada): Indonesian Super Legue (ISL) musim 2012/2013 sudah memasuki penghujung kompetisi. Seperti biasa, seusai kompetisi, PT Liga Indonesia atau PT Liga selaku pelaksana regulasi kompetisi selalu menggelar partai Perang Bintang. Pertandingan yang mempertemukan tim juara kasta tertinggi kompetisi di Indonesia melawan tim yang diisi pemain pilihan tersebut, bakal dilaksanakan pada 21 September di Stadion Mandala Jayapura, Papua. Sekretaris PT Liga Indonesia, Tigorshalom Boboy, mengatakan palaksanaan Perang Bintang kali ini berbeda dengan konsep sebelumnya, karena tidak meli-

Sebagai atlet pemula, Kadispora juga mengharapkan agar para duta olahraga pelajar Aceh dapat menjadikan ajang ini sebagai batu loncatan untuk melangkah ke jenjang yang lebih tinggi . “Kalian jangan pernah ragu, karena saat ini olahraga sudah menjadi sebuah industri yang sangat menjanjikan dalam hal materil,” ungkap Bukhari. Selanjutnya, Bukhari yang didampingi para Kabid, Kasie, dan Ka UPTD meminta seluruh kontingen Popnas Aceh untuk selalu menjaga kekompakan sesama tim, serta menjaga nama baik daerah. “Saya juga berharap kalian semua bisa pulang ke Aceh nanti dengan membawa medali sebanyak-banyaknya,” kata Bukhari yang disambut tepukan gemuruh dari para atlet, pelatih maupun ofisial kontingen Popnas Aceh. Dalam kesempatan itu, Kadispora juga member kesempatan kepada atlet masing-masing cabang olahraga untuk menyampaikan keluhan maupun keinginan, serta meminta mereka untuk memperagakan jurus-jurus yang akan mereka tampilkan di Popnas nanti. Dalam Popnas yang akan dipentaskan di Jakarta, 12-20 September, Aceh mengirimkan 55 atlet yang akan bertanding di cabang angkat besi, atletik, dayung, karate, panahan, pencak silat, sepakbola, taekwondo, tenis lapangan, dan tinju. (b04)

MENURUN

1. Pilih: Gonokobun, Gonokokus atau Gonokubus adalah bakteri bundar penyebab penyakit kencing nanah. 2. Singkatan Spesialis Anak. 3. Kekuatan dan energi fisik yang membuat orang dapat bekerja dan berolahraga. 4. Mati rasa disebabkan oleh pengaruh obat bius. 5. Obat anti flu produksi Konimex. 7. Injeksi (Inggris). 9. Ilmu tentang susunan dan fungsi sel. 12. Pemeriksaan kelenjar payudara dengan menggunakan sinar X untuk mendeteksi awal kanker payudara. 13. Tablet. 16. ——Farma, perusahaan farmasi besar selain Kalbe Farma. 18. Panci bertangkai untuk tempat urine atau kotoran pasien rumah sakit. 19. Bintil pada kulit berisi nanah. 21. Kepanjangan huruf “E” dari KODEKI (Kode ——Kedokteran Indonesia). 23. Unit Gawat Darurat. 25. Spesialis Bedah.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawabannya di halaman A2 kolom 1.

3 5 5 7 3 2 4 7 8 6 3 5 1 2 9 7 1 2 3

8

1 4 5 8 3 6 3 6 2 8 3 6 2 9 ***412


Sport

WASPADA Rabu 11 September 2013

A11

52 Pegiat Olahraga Sumut Terima Penghargaan SERGAI (Waspada): Meski diguyur hujan gerimis, peringatan Hari Olahraga Nasional (Haornas) Provinsi Sumatera Utara di Lapangan Replika/MTQ, Perbaungan, Serdang Bedagai, Selasa (10/9), berlangsung semarak. Acara dipimpin Wakil Gubernur Sumut (Wagubsu) HT Erry Nuradi dan dimeriahkan gerak jalan, senam massal serta pemberian penghargaan bagi 52 insan penggiat olahraga. Sekira 3.000-an peserta gerak jalan dilepas Pangdam I/BB Mayjen TNI Burhanuddin Siagian dan Bupati Sergai Ir H Soekirman. Atraksi senam aerobik massal dan perlombaan olahraga masyarakat (tradisional) serta ratusan lucky draw mulai dari sepeda dan barang elektronik turut meramaikan. Turut hadir Wakil Ketua DPRD Sumut Chaidir Ritonga, Ketua DPRD Sergai H Azmi Yuli Sitorus SH MSP, unsur SKPD, Sekdakab Drs H Haris Fadillah MSi, para pejabat setempat serta ribuan pelajar. “Haornas yang diperingati pada 9 September setiap tahun-

nya merupakan moment berharga bagi insan olahraga. Tanggal tersebut dipilih sesuai PON pertama pada 9 September 1948. PON pertama adalah pesta olahraga perjuangan yang diikuti 600 atlet serta digelar dalam rangka menunjukkan eksistensi Indonesia yang baru merdeka,” kata Wagubsu membaca sambutan tertulis Menpora Roy Suryo. Olahraga memang dijadikan alat menunjukkan pada dunia bahwa Indonesia adalah negara yang memiliki jati diri. Indonesia pun menjadi perhatian dunia ketika menjadi tuan rumah Asian Games 1962 dan meraih peringkat kedua terbaik di Asia. Prestasi itu berlanjut di ajang Ganefo 1963. Dijelaskan, sejak pertama kali diperingati pada 9 Septem-

ber 1983 seiring lahirnya Keppres pada tahun itu, sudah 30 kali Haornas diperingati. Lalu urgensi olahraga kian menguat dengan lahirnya UU No 3 tahun 2005 tentang Sistem Keolahragaan Nasional. Dalam kesempatan itu, Soekirman berterimakasih kepada Pemprovsu yang pertama kalinya memberi kepercayaan pada Sergai sebagai tuan rumah peringatan Haornas. Kegiatan seperti ini bisa memacu semangat di daerah mengembangkan olahraga prestasi. “Dengan adanya penyelenggaraan ini kan masyarakat jadi tahu, lalu termotivasi dan kemudian dia belajar bagaimana atlet berprestasi. Jadi kegiatan ini memang sangat positif sekali,” tegas Soekirman didampingi Kadirporabudpar Sergai Johny W Manik. Ke-52 penerima penghargaan terdiri atas 40 atlet, 2 wasit, 4 pelatih, 2 pembina olahraga, 1 penggerak olahraga, 1 guru, 1 jurnalis olahraga, dan 1 tayangan olahraga. Namun tidak se-

Penerima Penghargaan Haornas Sumut 2013 Olahragawan Berprestasi

Waspada/ist

WAGUBSU HT Erry Nuradi memberi ucapan selamat kepada penerima penghargaan insan penggiat olahraga Sumatera Utara pada puncak peringatan Haornas XXX di Lapangan Replika/ MTQ, Perbaungan, Serdang Bedagai, Selasa (10/9). mua penerima penghargaan menerima langsung. Ketua Harian KONI Sumut, John Ismadi Lubis, mengatakan sebagian be-

sar atlet sedang fokus mengikuti Pemusatan Latihan Nasional (Pelatnas) di Jakarta, bahkan ada yang sedang berada di luar negeri.

DIREKTUR Eksekutif Pertamina Foundation, Nina Nurlina Pramono, bersama peserta dan pelatih Pertamina Soccer Camp 2013 di Kompleks Pusdiklat Infantri TNI AD, Cipatat, Bandung, Selasa (10/9).

Timnas U-19 Unggul Segalanya

-Waspada/Yuslan Kisra-

Pertamina Soccer Stars Bidik Medan BANDUNG ( Waspada): Ajang pencarian pemain berbakat, kamp pelatihan, dan scholarship yang diluncurkan PT Pertamina Persero Tbk bertajuk ‘Pertamina Soccer Stars’ direncanakan bakal digelar di Kota Medan pada 2014 mendatang. Tentunya, dengan catatan, ibu kota Sumatera Utara ini memenuhi persyaratan yang ditetapkan pihak penyelenggara, yakni mendapat dukungan penuh pemerintah setempat serta terdapat pesepakbola U-13, U14, U-15, dan U-16 sebanyak 500 anak atau lebih.

Demikian dikatakan Nina Nurlina Pramono selaku Direktur Eksekutif Pertamina Foundation kepada Waspada di selasela mengunjungi peserta Pertamina Soccer Camp 2013 di Kompleks Pusdiklat Infantri TNI AD, Cipatat, Bandung, Selasa (10/9). “Medan memang sudah masuk dalam daftar area tempat pelaksanaan Pertamina Soccer Star pada tahun ini. Hanya saja karena kalah bersaing dengan kota lain,” jelas Nina. “Tapi mudah-mudah pada pelaksanaan tahun depan bisa

kita gelar di sana (Kota Medan). Kami memang sangat ingin menggelarnya di Medan,” sambung wanita berjilbab ini menambahkan tidak terpilihnya Kota Medan tidak lantas mematikan proses pencarian pemain berbakat di kota tersebut. “Setahu saya, klub-klub asal Medan tetap ikut bertanding di Palembang dan Jakarta. Hal sama bagi kota lain yang juga belum sempat menjadi tuan rumah tetap ikut di daerah terdekat,” beber Nina. Mengenai pelaksanaan Pertamina Soccer Camp di kom-

pleks tentara yang berlangsung 9-15 September 2013, Nina mengatakan kali ini diikuti 48 anak hasil pelaksanaan di delapan kota, yakni Balikpapan, Malang, Palembang, Makassar, Sorong, dan Jakarta serta 23 siswa Pertamina Soccer School yang selama ini telah dibina. “Total ada 71 anak kami ikutkan pada kamp kali ini di bawah arahan pelatih dari Akademi Sepakbola AC Milan, Mauro Ardizzona, untuk masalah teknik. Untuk masalah fisik dan disiplin langsung ditangani instruktur pusdiklat,” tandas Nina. (yuslan)

OC RALB Tidak Kenal Dualisme PSMS MEDAN (Waspada): Ketua Organizing Committee (OC) Rapat Anggota Luar Biasa (RALB) PSMS, Idris SE, menegaskan klub anggota yang berhak ikut RALB adalah mereka yang telah diverifikasi kepengurusannya dan tidak mengenal dualisme klub. Menurut Idris, usai memimpin rapat OC dan SC yang dihadiri Ketua Umum KONI Medan sebagai jembatan digelarnya RALB untuk penyatuan PSMS, Selasa (10/9), klub-klub tersebut sudah harus menyerahkan susunan kepengurusannya paling lambat 28 September nanti. “Dikatakan, bagi yang tidak menyerahkannya, maka diang-

gap tidak berhak mengikuti RALB yang direncanakan bergulir akhir Oktober mendatang. Hal ini perlu dilakukan karena banyak oknum-oknum yang mengaku-ngaku sebagai pengurus klub, padahal sama sekali tidak tercantum di komposisi kepengurusannya sendiri,” ujar Idris kepada wartawan, Selasa (10/9). Menanggapi keberadaan dua Ketua Umum PSMS, Benny Sihotang (LPIS) dan Indra Sakti Harahap (PT LI), sesuai kesepakatan 36 dari 40 klub anggota PSMS telah mencabut mandat keduanya yang telah diberikan pada Musda beberapa waktu lalu. “Mandat mereka berdua

sudah dicabut, makanya pihaknya menggelar RALB untuk mencari ketua umum yang baru,” sambung Idris menambahkan klub yang menganut dualisme akan dipanggil untuk bersatu. Dalam memimpin OC, Idris akan dibantu Wakil Ketua I Hengki Ahmad (PS Gumarang), dan Alexander Gho (Linud 100). Sekretaris dijabat Suryadi SE (Deliputra) didampingi Iwan Fauzi Hasbalah (Kesawan Putra), Zulkifli (Gumarang), Marzuki (Kurnia), sedangkan bendahara dipercayakan kepada H Sumantraji (Kurnia) bersama Julius Raja SE (Perisai Pajak), H Freddy Hutabarat (Medan Putra), dan Fajar SH (Pratama).

Indonesia Sabet Perak, Perunggu Asian Youth Tenpin Bowling Championship JAKARTA (Waspada): Kontingen atlet boling Indonesia berhasil menyabet satu medali perak dan perunggu di ajang 17th Asian Youth Tenpin Bowling Championship 2013 di Hongkong, Selasa (10/9). Medali perak Indonesia dipersembahkan Billy MI pada nomor single putra setelah membukukan 1322 poin. Gelar juara nomor ini diraih Chong

JF (Malaysia) yang membukukan 1361 poin. Tempat ketiga diduduki Lee Ik Kyu (Korea/ 1305). Pada nomor tersebut, peboling junior masa depan Sumut, Imam Wiguna, belum tampil maksimal sehingga masih tercecer dengan koleksi 1083 poin. Hasil ini masih jauh dari harapan untuk bisa menduduki posisi 10 Besar.

Problem Catur

Indonesia meraih medali perak dari nomor single putri yang dipersembahkan Cheya C setelah membukukan 1211 poin. Medali emas disabet Choi AR (Korea) mengemas 1246 poin dan perak oleh Shinobu (Jepang/1220). Peboling junior putri Sumut, Aldila Indryati, baru mampu menduduki posisi ke-23 dengan kumpulan 1113 poin. (yuslan)

TTS TOPIK

Walaupun diguyur hujan upacara peringatan Haornas Sumut berjalan lancar,” pungkas Kadispora Sumut, Ir Khairul Anwar MSi. (m18/a08)

Drs Azam Nasution MAP (Deli Putra) menjadi ketua tim penjaringan didampingi Indra SH (Deli Putra), Lukman Hakim (Medan Putra), Sari Azhar Tanjung (Bintang Utara), dan Amorta Amran YS (Simphoni). Sementara itu, SC diketuai Ir Rahmadsyah (Bintang Selatan) dibantu Wakil Ketua Drs Anshoruddin (Gumarang), Sunardi A (Dinamo), Fadilah Hutri Lubis SH (Deli Putra), Beldi Dimardi Abbas (Echo), Bahrial (Pratama), dan beberapa seksi seperti keamanan dari Polresta Medan, humas, dan sekretariat. (m17)

SIDOARJO (Waspada): Timnas U-19 berhasil mengalahkan Brunei Darussalam lima gol tanpa balas dalam laga perdana penyisihan Grup B Piala AFF U19 di Stadion Gelora Delta, Sidoarjo, Selasa (10/9). Gol pertama Indonesia diciptakan oleh Ilham Udin pada menit 12. Pemain bernomor punggung 20 tersebut berhasil menjaringkan bola hasil umpan

Maldini. Selanjutnya, Evan Dimas cs tetap konsisten menyerang. Perjuangan tim besutan Indra Sjafri tersebut kembali membuahkan hasil pada menit 27. Kali ini, tembakan keras yang dilepaskan Hargianto dari luar kotak penalti membuat bola bersarang ke pojok kanan gawang Brunei. Indonesia hanya butuh waktu tiga menit untuk mencipta-

PERINGATAN Haornas 2013 menjagi sangat berkesan bagi Kisharyanto Pasaribu (foto), setelah Kabid Olahraga Pengprov IMI (Ikatan Motor Indonesia) Sumut ini mendapat penghargaan dari Pemprovsu untuk kategori wasit berprestasi. “Saya bangga karena pemerintah memperhatikan kami selaku pelaku olahraga,” kata Kisharyanto, seusai menerima pengalungan medali dari Pangdam I BB Mayjen TNI Burhanuddin Siagian bersama Wagubsu HT Erry Nuradi di Lapangan Kompleks MTQ Sergai, Selasa (10/9). Penganugerahan yang dilakukan setiap tahun ini, menurut Kisharyanto, sangat positif karena bisa memacu semangat teman-teman pelaku olahraga untuk lebih berprestasi. Karena itu, dirinya mendukung program ini untuk terus dilaksanakan pada peringatan Haornas selanjutnya. Kisharyanto sendiri terpilih sebagai wasit berprestasi dengan kriteria yang cukup mumpuni. Dedikasinya selama sekitar dua dekade terakhir di pentas otomotif Sumut dan nasional tidak diragukan.

Sebagai steward (wasit dalam istilah balapan), dia telah mengabdi, memimpin lomba di event reli nasional dan internasional. Ajang bergengsi yang dilakoninya adalah kejuaraan dunia (WRC) Sumut pada 1997. Sebelum itu, steward di kejuaraan Asia Pasifik (APRC) 1996 dan ikut memantauWRC di Australia pada 1994-1995. “Kenapa ke Australia? Karena penyelenggara reli dunia terbaik waktu itu di sana. Setelah itu kita pulang ke Indonesia dan menerapkan pengetahuan yang ada di sana dan ternyata kita juga berhasil menjadi penyelenggara reli dunia,” tutur Kisharyanto.

Jawaban di halaman A2.

dang Dana Yuni Hasibuan Selasa (10/9). Dikatakan, kejuaraan ini terbagi dalam dua kelompok, yakni peserta non klub dan klub. Peserta non klub (pemula dan belum pernah mengikuti pelatihan klub) terdiri atas kategori A (TK), B (SD kelas 1-2), C (SD kelas 3-4), D (SD kelas 5-6), dan E (SLTP). Kategori peserta klub (pemula dan sudah pernah/masih mengikuti pelatihan) adalah A (TK), B (SD kelas 1-2), C (SD kelas 3-4), D (SD kelas 5-6), dan E (SLTP). Pendaftaran peserta

MEDAN (Waspada): Tim U15 Asosiasi Sekolah Sepakbola Indonesia (ASSBI) Komda Sumatera Utara berhasil melaju ke babak delapan besar kejuaraan internasional bertajuk ‘Bali Island Inter Cup 2013’ di Jimbaran, Bali, Selasa (10/9). Kepastian tim ASSBI Sumut yang dimanajeri H Akbar Himawan Buchori SH dan pelatih

dapat dilakukan di sekolah-sekolah dengan mengisi formulir dan menyertakan fotokopi rapor, mulai 13 Agustus hingga 3 Oktober mendatang. Untuk Porkot MedanV 2013, peserta yang sudah terdaftar 42 atlet dari 12 kecamatan di Kota Medan. Sejauh ini, peserta kejuaraan antar-pelajar sudah mencapai 80 orang. Ketua Pengkot Porserosi Kota Medan, Doli M Jafar Dalimunthe, berharap kejuaraan pelajar tersebut dapat meningkatkan animo masyarakat terhadap olahraga sepatu roda di Kota Medan. (m42)

KESEHA TAN KESEHAT

6

5

4

3

2

1 A

B

C

D

E

F

G

H

Sayangnya, setelah WRC 1997, Indonesia ‘diserang’ krisis moneter sehingga agenda reli dunia di Sumut dibatalkan. “Harapan kami tentu saja reli dunia bisa kembali ke Medan karena di Medan sudah punya banyak profesional andal untuk menggelar reli nasional hingga internasional,” tegasnya. Pria Batak yang selalu kalem ini sudah menjadi pengurus sejak IMI Sumut masih bernama IMSU dipimpin Amiruddin pada 1991. Dia juga ikut dalam kepengurusan pimpinan Suwandi (1996-2000), AWahab Dalimunthe (2000-2004), dan dua periode selanjutnya yang dipimpin Ijeck pada 2004-2008 dan 2008-2012.

Waspada/Ist

Sebelum aktif sebagai pengurus IMI dan steward, Yanto merupakan atlet slalom, sprint reli, dan karting. (m47)

Zul Khoiri Lubis melangkah ke perempatfinal, setelah menahan tim ASSBI Pusat 1-1 dan kalah dari SSB Mabar Putra Medan 1-3. Pada laga penyisihan Senin (9/9), tim ASSBI Sumut meraih kemenangan atas SSB Putra Sumbul Bali 1-0 dan menahan imbang MCB Bali. Dengan hasil tersebut, total ASSBI Sumut mengemas lima poin dan tampil sebagai runner-up Grup A. “Pada babak delapan besar, kita akan menantang juara Grup C yang akan ditentukan

pada pertandingan hari ini,” ujar Ketua Komda ASSBI Sumut, H Sumantraji SH, saat dihubungi Waspada, Selasa (10/9). Dikatakan, sukses tim ASSBI Sumut melaju ke perempatfinal sudah sesuai target, mengingat pihaknya hanya ingin menambah jam tanding para pemain dan tidak mematok target muluk-muluk. “Begitupun, kami berharap anak-anak bisa kembali meraih kemenangan untuk tampil di semifinal,” ujar Sumantraji. (m42)

Atlet Paralayang Jatuh Saat Atraksi FDT 2013 SAMOSIR (Waspada): Hari kedua Festival Danau Toba (FDT) 2013, Selasa (10/9), ditandai jatuhnya seorang atlet paralayang mesin asal Jember, Bambang. Akibatnya, Bambang dirawat di Puskesmas Tuktuk Siadong, setelah terjatuh dari ketinggian 20 meter di atas perairan Hotel Duma Sari. “Bambang mengalami sesak nafas, sehingga langsung dilarikan ke Puskesmas Tuktuk,” ujar Kapuskesmas Tuktuk, Berman Situmorang, kepada Waspada, Selasa (10/9). Pihak Puskesmas langsung melakukan tindakan pengobatan khusus, kemudian dirujuk ke RSU dr Hadrianus Sinaga, Pangururan, untuk dilakukan rontgen dan pengobatan intensif. (c11)

Sudoku MENDATAR

1. Tumbuhan dari Asia Timur, dijadikan ramuan obat-obatan dan berkhasiat membangkitkan nafsu syahwat. 6. Klinik ____ Medistra, satu-satunya lembaga pengobatan tradisional China untuk mengobati kanker, diabetes dan uremia, seperti sering diiklankan di Waspada. 8. Keadaan hilang atau berkurangnya kekuatan; Keloyoan. 10. Singkatan Spesialis Kedokteran Jiwa. 11. Pencegahan dan penyembuhan penyakit dengan memasukkan bahan kimia ke dalam tubuh. 13. Rentan. 14. Spesialis Bedah Ortopedi dan Traumatologi. 15. Ilmu tentang penyakit saluran kemih. 17. Rumah Sakit Islam. 18. Orang sakit yang dirawat dokter. 20. Pembuahan; Penghamilan. 22. Alat pembayar dokter dan obat. 24. Air Susu Ibu. 26. Panggilan singkat dokter. 27. Penyakit takut kecurian.

7

dalam area penalti lawan. Begitu menguasai bola, Muchlis melepaskan tendangan yang menaklukkan kiper Brunei. Jelang laga berakhir, Muchlis kembali mencetak gol. Begitu menerima bola, pemain bernomor 10 tersebut melepaskan tembakan mendatar tanpa dapat diantisipasi penjaga gawang Brunei, Abdul Hafiz bin Abd Rahim. (m33/ant)

Tim U-15 ASSBI Sumut 8 Besar

Perserosi Medan Lirik Bakat Pelajar MEDAN (Waspada): Persatuan Olahraga Sepatu Roda Seluruh Indonesia (Porserosi) Kota Medan siap menggelar turnamen antar-pelajar tingkat TK, SD, dan SLTP di Sirkuit Apron Lanud Soewondo Medan, 5-6 Oktober 2013. “Kejuaraan memperebutkan piala bergilir Pengkot Porserosi Medan ini, untuk melirik bakat pelajar bermain sepatu roda sekaligus memeriahkan Pekan Olahraga Kota (Porkot) Medan V,” ujar Ketua Panpel, Fadli SE MSi didampingi Bendahara Gusnelly Harmi dan Bi-

kan gol ketiga lewat aksi Ilham. Dengan aksi individu, Ilham berhasil melewati tiga pemain lawan sebelum menceploskan bola ke gawang Brunei. Selepas turun minum, Indonesia kembali menguasai permainan. Usaha keras skuad Garuda Muda pun membuahkan hasil pada menit 60. Di sini, Evan Dimas jeli mengumpan Muchlis yang merangsek ke

Dedikasi Antar Kisharyanto Raih Penghargaan Haornas

Putih melangkah, mematikan lawannya lima langkah.

8

Karate: Dony Dharmawan (Tobasa), Jintar Simanjuntak, Indah Mogia Angkat, Tantri Widyasari (Medan), Srunita Sari (Langkat), Novita Sinaga (Deliserdang), Halimah (Sergai) Pencak Silat: Apriansyah (Deiserdang) Wushu: Hendri Tarigan (Karo), Hotma Dearma Purba (Medan), Aldy Lukman, Johannes Bie, Harba Sibuea, Charles Susanto, Eric Losardi, Heryanto (Medan) Taekwondo: Basuki Nugroho (Deliserdang) Tinju: Nurmala Deli (Medan) Renang: Indra Gunawan (Pematangsiantar) Catur: Pitra Andika (Medan) Atletik NPC: Zainul Kahfi Lubis, Suriyani, Rebecca Cecilia, Praja Hermawan (Medan), Alan Sastra Ginting, Nurmala (Deliserdang), Harjono Tarihoran (Sibolga), Yudiana, Riyadi Saputra (Binjai), Buala Zebua (Nias) Angkat Berat NPC: Sapura, Ayu Rahayu, Nurtani, Anto Boy (Medan) Renang NPC: Yunita (Medan) Tenis Meja NPC: Roslinda (Medan) Catur NPC: Katerina Haloho, Azhar Panjaitan, Ismayuddin, Nasib F Simanja (Medan) Wasit Berprestasi: Dr Novita MPd (wushu/Medan), Kisharyanto Pasaribu (IMI/Medan) Pelatih Berprestasi: Delfinus Rumahorbo (karate), Yosef Lumi (atletik), Erhan Tarmizi (catur/Medan), Salwi Parningotan Simbolon (wushu/Karo) Guru: Adi Wijaya (futsal/SMAN 3 Medan) Pembina Olahraga: Supandi Kusuma (wushu), Rahmad Shah (karate/ Medan) Penggerak Olahraga: Musa Idishah (Perbakin/Medan) Jurnalis Olahraga: Setia Budi Siregar SSos (Harian Waspada/Medan) Tayangan Olahraga: LPP TVRI (Program Lensa Olahraga)

MENURUN

1. Pilih: Gonokobun, Gonokokus atau Gonokubus adalah bakteri bundar penyebab penyakit kencing nanah. 2. Singkatan Spesialis Anak. 3. Kekuatan dan energi fisik yang membuat orang dapat bekerja dan berolahraga. 4. Mati rasa disebabkan oleh pengaruh obat bius. 5. Obat anti flu produksi Konimex. 7. Injeksi (Inggris). 9. Ilmu tentang susunan dan fungsi sel. 12. Pemeriksaan kelenjar payudara dengan menggunakan sinar X untuk mendeteksi awal kanker payudara. 13. Tablet. 16. ——Farma, perusahaan farmasi besar selain Kalbe Farma. 18. Panci bertangkai untuk tempat urine atau kotoran pasien rumah sakit. 19. Bintil pada kulit berisi nanah. 21. Kepanjangan huruf “E” dari KODEKI (Kode ——Kedokteran Indonesia). 23. Unit Gawat Darurat. 25. Spesialis Bedah.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sedang (***), bisa diselesaikan kurang dari sepuluh menit. Jawabannya di halaman A2 kolom 1.

3 5 5 7 3 2 4 7 8 6 3 5 1 2 9 7 1 2 3

8

1 4 5 8 3 6 3 6 2 8 3 6 2 9 ***412


Sport

A12

WASPADA Rabu 11September 2013

Gelar Spesial Nadal NEW YORK, AS (Waspada): Grand slam terakhir tahun ini, AS Terbuka, menjadi moment sarat emosi bagi Rafael Nadal (foto). Di final tunggal putra, petenis Spanyol itu menang atas unggulan utama Novak Djokovic, Selasa (10/9).

Dalam duelnya menghadapi Djokovic, Nadal butuh empat set untuk menundukkan raja tenis dunia saat ini. Titel grand slam kedua tahun ini atau ke13 dalam kariernya digenggam Nadal berkat kemenangan 6-2, 3-6, 6-4, 6-1. Sebelumnya, petenis kidal itu menjuarai Prancis Terbu-

AP

MANTAN Presiden AS Bill Clinton memberi ucapan selamat kepada Serena Williams atas keberhasilannya menjuarai AS Terbuka, Senin (9/9).

Clinton Ikut Puji Serena NEW YORK, AS (Waspada): Keberhasilan Serena Williams tampil sebagai juara AS Terbuka berbuah pujian dari mantan Presiden AS, Bill Clinton. Bertanding di Arthur Ashe Stadium, Senin (9/9),Serena

harus berjuang keras mengalahkan Victoria Azarenka 7-5, 6-8, 6-1 dalam waktu 2 jam 45 menit. Pertandingan final tahun ini merupakan ulangan dari tahun lalu. Saat itu Serena me-

Muscab KONI Aceh Tamiang Mendesak KUALASIMPANG (Waspada): Pengurus Cabang Olahraga (Pengcabor) menggelar pertemuan dengan Ketua KONI Aceh Tamiang, H Syafriel Antony SE MBA, terkait berakhirnya masa kepengurusan KONI setempat dan membahas masalah pencairan dana cabang olahraga di Disbudparpora Aceh Tamiang, Senin (9/9). Ketua KONI Aceh Tamiang, H Syafriel Antony SE MBA, didampingi Sekretaris Yetno, mengatakan perlunya segera digelar Muscab KONI Aceh Tamiang setelah berakhirnya masa bakti kepengurusan KONI kabupaten tersebut. “Muscab KONI merupakan proses persiapan administrasi bagi Pengcabor menghadapi Pra Pora dan Pora,” kata Syafriel yang juga mantan Kapolres Aceh Tamiang di hadapan Pengcabor yang hadir di Sekretariat KONI setempat. Menurut Syafriel, jika kepengurusan KONI Aceh Tamiang tidak segera dibentuk melalui Muscab, tentu akan membawa ekses terkendalannya penyusunan RKA untuk kegiatan tahun anggaran 2014. “Selain untuk dana Pra Pora dan Pora, cabor-cabor juga perlu dana mengikuti berbagai kegiatan, baik yang bersifat lokal di Aceh Tamiang, tingkat provinsi dan tingkat nasional,” ucap Syafriel. Karena itu, tegasnya, Muscab KONI Aceh Tamiang harus segera dilaksanakan untuk memilih ketua umum dan menyusun kepengurusan baru periode selanjutnya demi lancarnya roda organisasi KONI dan cabor-cabor. Pada pertemuan tersebut, juga disepakati pihak KONI bersama pengurus cabor akan beraudensi dengan Bupati Aceh Tamiang, H Hamdan Sati ST, untuk menuntaskan persoalan yang menyangkut Muscab KONI dan hal-hal yang terkait pencairan dana bagi cabor dan hal-hal lain yang ada relevansinya dengan kelancaran roda organisasi KONI dan cabor. (b23)

Elang Sakti Ungguli Angsana KRUENG GEUKUEH (Waspada): Elang Sakti (Bireuen) mengungguli Angsana (Lhokseumawe) 3-0 dalam partai pembuka turnamen bola voli Sity Ramadani Cup II di Lapangan Siwah Blang, Krueng Geukueh, Dewantara, Aceh Utara, Selasa (10/9) sore. Kemenangan Elang Sakti dalam tiga set ini, diraih dengan susah payah. Set pertama, anak-anak Bireuen meraih kemenangan 27-25 dan unggul 31-29 di set kedua. Set ketiga, Elang Sakti yang diperkuat Tala, Manok, Ari, Nasir dkk kembali memimpin 25-17. Atas kemenangan itu, Elang Sakti berhak melaju ke babak delapan besar. Panpel Turnamen, Firman Saputra, mengatakan pertandingan Rabu (11/9) ini, Putra Rencong VC (Aceh Utara) akan bertemu Garuda VC (Aceh Tengah). (cmk)

Pasang Iklan Telp. 4528431 HP. 081370328259

Email: iklan_waspada@yahoo.co.id

raih gelar juara keempat juga dengan mengalahkan Azarenka di final. Ini merupakan final tunggal putri AS Terbuka terpanjang sejak 1980. Serena menjadi petenis putri tertua yang menjadi juara dalam usia 31 tahun 11 bulan. “Serena selalu menjadi seseorang yang membuka jalan baru bagi para gadis dan wanita,” puji Clinton, Selasa (10/9). “Dia mampu bermain secara kompetitif, dengan konsentrasi tinggi, dan menang. Dia selalu khawatir tentang segala sesuatu yang ia lakukan,” sambung salah satu pemimpin Negeri Paman Sam nan populer itu. Dengan hasil ini, Serena meraih total hadiah uang 3,6 juta dolar AS yang juga hadiah terbesar tunggal putri sepanjang sejarah. Hadiah uang itu termasuk bonus 1 juta dolar AS yang diperoleh dari Emirates Airline AS Terbuka Series Bonus Challenge. (m33/rtr)

ka. Hebatnya, tahun 2013 ini telah dilalui Nadal dengan merebut 10 gelar juara. Selain Prancis dan AS Terbuka, Nadal yang diplot sebagai unggulan kedua di Flushing Meadows telah memenangi Cincinnati, Montreal, Roma, dan Madrid Masters, lalu Barcelona, Indian Wells, Mexico, dan Brazil Terbuka. Atas prestasinya di Arthur Ashe Stadium, Nadal memperpanjang rekor kemenangannya atas Djokovic menjadi 22-15. Namun Nadal lebih memilih bersuka cita setelah berada di urutan ketiga peraih gelar grand slam terbanyak sepanjang masa di bawah Pete Sampras (AS) dan Roger Federer (Swiss). Nadal mengaku titel grand slam ke-13 tersebut terasa luar biasa. “Semua ini di luar bayangan saya. Saya tak pernah bermimpi meraih semua ini,” kata Nadal yang berpeluang melewati 14 trofi milik Sampras. “Meski merasa sukses sepanjang tahun ini, saya tetap akan bekerja keras dan ingin terus kompetitif agar bisa menjuarai turnamen demi turnamen di masa depan. Selanjutnya, saya ingin merebut predikat raja tenis dunia,” ujar Nadal. Selain benar-benar puas akan kemenangan tersebut, Nadal juga memuji penampilan Djokovic yang dinilainya begitu menyulitkan. Bahkan, petenis berusia 27 tahun tersebut mengatakan The Joker akan dikenang sebagai salah satu atlet terhebat yang pernah ada dalam dunia tenis. “Itu (adalah kemenangan) yang sangat emosional. Seluruh tim saya tahu apa artinya (trofi) ini bagi saya. Novak (Djokovic) selalu membuat pertandingan hingga mencapai batas. Dia merupakan pemain yang mengagumkan dan akan menjadi salah satu petenis terhebat,” puji Nadal. “Saya harus menjadikan kegagalan ini sebagai motivasi. Ini adalah bagian dari kehidupan. Sebagai atlet, Anda sering gagal tapi juga harus tetap belajar dan melaju, bertarung sekaligus meningkatkan (performa). Untuk itulah, kami ada di sini,” ujar Djokovic. “Saya masih berusia 26 tahun dan yakin kalau hal terbaik dalam karier saya akan segera tiba. Sepanjang saya meyakininya, rasa cinta terhadap tenis akan selalu ada,” sambung petenis Serbia tersebut. (m33/ap)

AP


Sport Gelar Spesial Nadal A12

NEW YORK, AS (Waspada): Grand slam terakhir tahun ini, AS Terbuka, menjadi moment sarat emosi bagi Rafael Nadal (foto). Di final tunggal putra, petenis Spanyol itu menang atas unggulan utama Novak Djokovic, Selasa (10/9). Dalam duelnya menghadapi Djokovic, Nadal butuh empat set untuk menundukkan raja tenis dunia saat ini. Titel grand slam kedua tahun ini atau ke13 dalam kariernya digenggam Nadal berkat kemenangan 6-2, 3-6, 6-4, 6-1. Sebelumnya, petenis kidal itu menjuarai Prancis Terbuka. Hebatnya, tahun 2013 ini telah dilalui Nadal dengan merebut 10 gelar juara. Selain Prancis dan AS Terbuka, Nadal yang diplot sebagai unggulan kedua di Flushing Meadows telah meme-

nangi Cincinnati, Montreal, Roma, dan Madrid Masters, lalu Barcelona, Indian Wells, Mexico, dan Brazil Terbuka. Atas prestasinya di Arthur Ashe Stadium, Nadal memperpanjang rekor kemenangannya atas Djokovic menjadi 22-15. Namun Nadal lebih memilih bersuka cita setelah berada di urutan ketiga peraih gelar grand slam terbanyak sepanjang masa di bawah Pete Sampras (AS) dan Roger Federer (Swiss). Nadal mengaku titel grand slam ke13 tersebut terasa luar biasa.

“Semua ini di luar bayangan saya. Saya tak pernah bermimpi meraih semua ini,” kata Nadal yang berpeluang melewati 14 trofi milik Sampras. “Meski merasa sukses sepanjang tahun ini, saya tetap akan bekerja keras dan ingin terus kompetitif agar bisa menjuarai turnamen demi turnamen di masa depan. Selanjutnya, saya ingin merebut predikat raja tenis dunia,” ujar Nadal. Selain benar-benar puas akan kemenangan tersebut, Nadal juga memuji penampilan Djokovic yang dinilainya begitu menyulitkan. Bahkan, petenis berusia 27 tahun tersebut mengatakan Djokovic akan dikenang sebagai salah satu atlet terhebat yang pernah ada dalam dunia tenis. “Itu (adalah kemenangan)

WASPADA Rabu 11 September 2013

yang sangat emosional. Seluruh tim saya tahu apa artinya (trofi) ini bagi saya. Novak (Djokovic) selalu membuat pertandingan hingga mencapai batas. Dia merupakan pemain yang mengagumkan dan akan menjadi salah satu petenis terhebat,” puji Nadal. “Saya harus menjadikan kegagalan ini sebagai motivasi. Ini adalah bagian dari kehidupan. Sebagai atlet, Anda sering gagal tapi juga harus tetap belajar dan melaju, bertarung sekaligus meningkatkan (performa). Untuk itulah, kami ada di sini,” ujar Djokovic. “Saya masih berusia 26 tahun dan yakin kalau hal terbaik dalam karier saya akan segera tiba. Sepanjang saya meyakininya, rasa cinta terhadap tenis akan selalu ada,” sambung petenis Serbia tersebut. (m33/ap)

Clinton Puji Prestasi Serena

AP

MANTAN Presiden AS Bill Clinton memberi ucapan selamat kepada Serena Williams atas keberhasilannya menjuarai AS Terbuka, Senin (9/9).

NEW YORK, AS (Waspada): Keberhasilan Serena Williams tampil sebagai juara AS Terbuka berbuah pujian dari mantan Presiden AS, Bill Clinton. Bertanding di Arthur Ashe Stadium, Senin (9/9),Serena harus berjuang keras mengalahkan Victoria Azarenka 7-5, 6-8, 6-1 dalam waktu 2 jam 45 menit. Pertandingan final tahun ini merupakan ulangan dari tahun lalu. Saat itu Serena meraih gelar juara keempat juga dengan mengalahkan Azarenka di final. Ini merupakan final tunggal putri AS Terbuka terpanjang sejak 1980. Serena menjadi petenis putri tertua yang menjadi juara dalam usia 31 tahun 11 bulan. “Serena selalu menjadi se-

seorang yang membuka jalan baru bagi para gadis dan wanita,” puji Clinton, Selasa (10/9). “Dia mampu bermain secara kompetitif, dengan konsentrasi tinggi, dan menang. Dia selalu khawatir tentang segala sesuatu yang ia lakukan,” sambung salah satu pemimpin Negeri Paman Sam nan populer itu. Dengan hasil ini, Serena meraih total hadiah uang 3,6 juta dolar AS yang juga hadiah terbesar tunggal putri sepanjang sejarah. Hadiah uang itu termasuk bonus 1 juta dolar AS yang diperoleh dari Emirates Airline AS Terbuka Series Bonus Challenge. (m33/rtr)

Waspada/ist

KONTINGEN PWI Sumut yang tampil di Porwanas 2013 diabadikan bersama Gubsu Gatot Pujo Nugroho, Selasa (10/9).

Gubsu: Raihlah Prestasi Terbaik Kontingen Porwanas PWI Sumut Resmi Dilepas MEDAN (Waspada): Gubsu, H Gatot Pujo Nugroho ST MSi, resmi melepas keberangkatan kontingen Porwanas PWI Cabang Sumut menuju Banjarmasin dalam upacara pemberangkatan di halaman Kantor Gubsu, Selasa (10/9). Acara penglepasan ditandai penyerahan pataka dari Gubsu kepada Ketua PWI Cabang Sumut, Drs Muhammad Syahrir. Gubsu berharap kontingen Porwanas PWI Sumut mampu meraih prestasi terbaik dengan tetap menjaga sportivitas. “Momentum Porwanas hendaknya dapat menumbuh-

kan rasa kebersamaan, menjaga semangat persatuan dan kesatuan. Sumut yang berbudaya tinggi harus dikedepankan, jangan sampai nama baik Sumut tercoreng,” ujar Gubsu. Gubsu berharap kontingen Porwanas Sumut ikut mempromosikan potensi pariwisata Danau Toba sebagai warisan dunia sebagai berkah yang diberikan Allah. Apalagi Festival Danau Toba (FDT) sedang berlangsung setelah dibuka Menko Perekonomian, Hatta Rajasa. “Keunggulan pariwisata dan budaya yang kita miliki perlu dijaga dan rawat dengan baik.

AP

Rossi Akui Kalah Nyali GERNO DI LESMO, Italia (Waspada): PebalapYamaha,Valentino Rossi (foto kanan), kembali mengungkapkan pujian kepada Marc Marquez (foto kiri). Rossi mengaku tidak seberani rider muda Repsol Honda asal Spanyol itu di musim debutnya pada ajang MotoGP. Marquez berpeluang besar menciptakan rekor di MotoGP 2013. Pria berusia 20 tahun itu bisa menjadi rookie pertama yang mampu menjadi juara dunia kelas premier Grand Prix di era MotoGP. Marquez juga akan menyamai rekor Kenny Roberts yang menjadi juara dunia 1978 di musim debutnya. Dengan menyisakan enam seri, Marquez masih memuncaki klasemen dengan 233 poin. Juara dunia Moto2 2012 itu unggul 30 poin atas rekan setimnya di Repsol Honda, Dani Pedrosa, dan 39 poin atas juara bertahan Jorge Lorenzo (Yamaha). Rossi mengaku tidak pernah melihat rookie di kelas premier Grand Prix memiliki keberanian seperti Marquez. Bahkan, ketika The Doctor melakoni debutnya di kelas 500cc pada 2000 silam, pebalap Italia itu hanya mampu menduduki runner-up dengan meraih dua kemenangan.

“Apa yang dilakukan Marquez tahun ini sangat impresif. Bagi saya, dia sangat berani. Saya tidak pernah melihat rookie seperti dia,” sambung Rossi, Selasa (10/9). (m33/mgp)

Dengan keberkahan alam yang diberikan itu, diharapkan dapat mengantarkan Sumut yang berdaya saing dengan masyarakatnya yang sejahtera,” ujarnya. Ketua PWI Sumut, Drs Muhammad Syahrir, melaporkan keberangkatan kontingen PWI Sumut mengikuti Porwanas XI di Banjarmasin yang berlangsung pada 12-20 September 2013, tidak terlepas berkat dukungan Gubsu, KONI Sumut, Dispora Sumut, dan mitra kerja lainnya.

“Dengan dukungan tersebut, diharapkan kontingen Sumut meningkatkan prestasi lebih baik dari Porwanas X di Palembang,” kata Syahrir menambahkan Porwanas XI sekaligus dirangkai Kongres PWI XXIII pada 19-20 September 2013. Syahrir juga melaporkan, kontingen PWI Sumut akan mengikuti cabang olahraga futsal usia 40 tahun ke atas dan usia 40 tahun ke bawah, tenis meja, badminton, catur, biliar, dan atletik. (m42)

AP


Sumatera Utara

WASPADA Rabu 11 September 2013

Kota

Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:24 12:37 12:25 12:32 12:31 12:28 12:25 12:20 12:27 12:27

15:27 15:39 15:28 15:33 15:32 15:35 15:28 15:24 15:30 15:28

Magrib 18:29 18:43 18:30 18:38 18:37 18:33 18:30 18:25 18:32 18:32

‘Isya

Imsak

Shubuh Syuruq

Kota

19:38 19:52 19:38 19:46 19:46 19:41 19:38 19:34 19:41 19:41

04:52 05:04 04:53 04:59 04:59 04:57 04:53 04:49 04:55 04:54

05:02 05:14 05:03 05:09 05:09 05:07 05:03 04:59 05:05 05:04

L.Seumawe 12:30 L. Pakam 12:23 Sei Rampah12:22 Meulaboh 12:34 P.Sidimpuan12:22 P. Siantar 12:22 Balige 12:22 R. Prapat 12:19 Sabang 12:37 Pandan 12:24

06:16 06:29 06:17 06:24 06:23 06:21 06:17 06:13 06:20 06:19

Zhuhur ‘Ashar 15:32 15:26 15:25 15:36 15:28 15:26 15:27 15:25 15:40 15:29

B1

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur

‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:36 18:28 18:28 18:40 18:26 18:27 18:27 18:24 18:43 18:28

19:45 19:37 19:36 19:48 19:34 19:36 19:36 19:32 19:52 19:36

04:57 04:51 04:50 05:02 04:50 04:51 04:51 04:48 05:04 04:52

05:07 05:01 05:00 05:12 05:00 05:01 05:01 04:58 05:14 05:02

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:23 12:25 12:35 12:28 12:25 12:31 12:20 12:30 12:23 12:22

18:28 18:30 18:41 18:32 18:30 18:37 18:25 18:35 18:28 18:27

19:36 19:38 19:49 19:41 19:38 19:45 19:33 19:43 19:36 19:36

04:52 04:53 05:02 04:56 04:52 04:59 04:48 04:58 04:52 04:50

05:02 05:03 05:12 05:06 05:02 05:09 04:58 05:08 05:02 05:00

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:20 12:27 12:25 12:21 12:23 12:20 12:20 12:29 12:24 12:18 12:20

15:28 15:35 15:30 15:24 15:27 15:26 15:27 15:31 15:29 15:24 15:25

18:25 18:32 18:30 18:26 18:28 18:25 18:24 18:35 18:28 18:23 18:25

19:33 19:40 19:39 19:35 19:36 19:33 19:32 19:44 19:37 19:31 19:33

04:49 04:57 04:54 04:49 04:51 04:49 04:49 04:57 04:52 04:47 04:48

04:59 05:07 05:04 04:59 05:01 04:59 04:59 05:07 05:02 04:57 04:58

06:22 06:16 06:15 06:26 06:15 06:15 06:15 06:12 06:29 06:17

15:29 15:29 15:37 15:33 15:27 15:32 15:24 15:33 15:28 15:25

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:17 06:18 06:27 06:20 06:17 06:23 06:12 06:22 06:16 06:15

06:14 06:21 06:18 06:14 06:16 06:13 06:13 06:21 06:17 06:11 06:13

Wabup DS H. Zainuddin Mars:

Pejabat Eselon II Harus Profesional LUBUKPAKAM (Waspada): Wakil Bupati Deliserdang, H. Zainuddin Mars menegaskan pejabat eselon II jajaran pemerintah daerah harus memiliki kemampuan manajerial komprehensif dan profesional untuk dapat mengemban tugas dan tanggungjawab yang dipercayakan kepala daerah di satuan kerjanya. Karenanya semua pejabat harus memiliki kemampuanmembanguninovasidankreativitas yang tinggi khususnya menghadapi arus perubahan yang terjadi dengan berbagai macam tantangan, sejalan tuntutan masyarakat yang berkembang sesuai tingkat kemajuan pembangunan yang dicapai. “Selain itu pejabat eselon II harus memiliki dedikasikerjayangtinggidankesungguhandalam menyelesaikan berbagai permasalahan, sekaligus memiliki program kerja nyata dan realistis,” tegas Wabup H. Zainuddin Mars pada pelantikan sembilan pejabat eselon II jajaran Pemkab Deliserdang, di Balairung Pemkab Deliserdang di Lubukpakam, kemarin. Sembilan pejabat eselon II yang dilantik, Drs AgusGinting,M.SiKadisPKD(sebelumnyaAsisten II Setdakab), Dr Hj. Aida Harahap MARS Kadis Kesehatan (sebelumnya Direktur RSUD/Pl Kadis Waspada/Abdul Hakim

MASSA berunjukrasa di kantor Bupati Langkat terkait TNGL.

Massa Desak TNGL Diukur Ulang STABAT (Waspada): Ratusan warga menamakan dirinya aliansi mahasiswa dan masyarakat adat Teluk Aru Besitang berunjukrasa di Kantor Bupati Langkat, Selasa (10/9), menuntut wilayah TNGL diukur ulang. Mereka menilai lahan yang dikelola selama ini dan sebagian hunian mereka di sana tidak termasuk kawasan hutan taman nasional. Selain itu massa menuntut peraturan daerah tentang tanah adat, minta para pengusaha yang menjual aset kedatukan Besitang diproses serta menolak reboisasi kawasan hutan sebelum rekonstruksi tapal batas lahan yang ada di wilayah Sekundur Besitang. Massa juga minta pembebasan tiga warga Besitang yang ditangkap beberapa hari lalu terkait penyanderaan Polhut. Aksi massa dikawal aparat Polres Langkat dan Polsek Stabat serta dari Satpol PP. Perwakilan massa berdialog dengan Plt. Sekda Langkat Indra Salahuddin, Asisten 1 Administrasi pemerintahan Abdul Karim dan Kabag

Tapem, Rajanami. Aparatur Pemkab Langkat intinya mengatakan tidak berhak mengukur ulang kawasan TNGL karenabukanwewenangmereka, melainkan tugas Balai Pemantapan Kawasan Hutan (BPKH). Dalam dialog terungkap pihak BKPH hingga kini belum menjawab surat Bupati Langkat mengenaiaspirasimassasebelumnya terkait tuntutan serupa. Usai berunjukrasa di Kantor Bupati Langkat, massa menyampaikan hal serupa di DPRD. Sebelumnya Humas BBTNGL, Rahmad Simbolon mengatakan terkait tuntutan pendemo melakukan pengukuran ulang tapal batas TNGL, enggan berkomentar. “Hubungi saja langsung KepalaBBTNGL,”ujarnyasingkat. Kepala Balai Besar Taman

Tahanan LP Tj. Pura Kabur STABAT (Waspada): Tahanan narkotika jenis ganja kabur dari depan pintu LPTanjungpura saat diturunkan dari mobil usai menjalani persidangan di Pengadilan Negeri Stabat, Senin (9/9) jelang magrib. ZU, 24, warga Dusun Karang Dera Desa Lukcuk Kec. Sawah Kab. Aceh Utara, hingga kini belum berhasil diamankan kembali. Berbagaiketerangandihimpun,kejadianberawaldaripengamanan beberapa petugas Polres Langkat, Kejari Stabat dan petugas LP Tanjungpura seperti biasa menurunkan 21 tahanan dari mobil usai persidangan. Entah bagaimana ZU yang berada di urutan 14 tiba-tiba lari menerobos pengawalan beberapa petugas dan kabur ke semaksemak sekitar LP, kemudian melompat ke sungai tak jauh dari lokasi. Meski petugas sempat meletuskan senjata api, namun ZU tak terkejar. Kasi Pidum Kejari Stabat, Sulisyadi membenarkan ZU belum ditemukan.“Kita masih lacak,” katanya sambil menambahkan, tidak ada anggotanya yang diberi sanksi karena dinilai bukan kesalahan mereka. SecaraterpisahKepalaPengamananLPTanjungpura,Kamaruddin Manik kepada Waspada, Selasa (10/9), juga mengatakan kejadian itu bukan kesalahan anggotanya karena posisi kaburnya masih di luar Lapas. Dari 21 tahanan yang diturunkan dari mobil, tak seorang pun diborgol, termasuk tahanan yang kabur hingga leluasa melompat ke sungai.(a03)

Penderes Getah Tewas Korban Tabrak Lari BESITANG (Waspada): Darmin, 56, warga Lk. Bukit Tangga, Kel. Bukitkubu, Kec. Besitang tewas akibat tabrak lari di Jalinsum Km 99-98, Kel. Kampunglama, Selasa (10/9). Tubuh korban sempat terseret sejauh 300 meter lebih. Menurut keterangan, penderes getah rambung ini pagi itu berangkat mengendarai sepeda menuju kebun. Di tengah jalan, korban ditabrak mobil dan tewas di tempat. Jasadnya dievakuasi ke Puskesmas, kemudian dirujuk ke Rumah Sakit Umum Daerah (RSUD) Tanjungpura. Kanit Lantas Besitang, Ipda D. Bangun, dikonfirmasi Waspada mengatakan, kasus tabrak lari ini masih dalam proses lidik. “Kita belum mengetahui mobil yang menabrak korban, sebab tidak ada seorang saksi pun yang melihat kejadian ini,” ujarnya.(a02)

Nasional Gunung Leuser (BBTNGL) Andi Basrul yang sedang berada di Jakarta mengikuti rapat koordinasi bersama Menteri Kehutan (Menhut) tidak berhasil dikonfirmasi. Beberapa kali dihubungitelefonselularnyatidakaktif. Sementara itu Kepala Seksi Pemolaan Taman Nasional (SPTN) Wilayah VI Besitang, TR Tariganmengatakan,permintaan untukmerekonstruksiulangtapal batas kawasan TNGL dari Sei Lepan Kab. Langkat hingga ke Provinsi Aceh sangat tidak berdasar, sebab pemerintah melalui Menhut pada 1980 telah menetapkankawasanhutaninimenjadi

Taman Nasional (TN). “Ironis kalau belakangan ada pihakmengklaimkawasanTNGL adalah tanah ulayat,” ujarnya. Tarigan menegaskan, apa pun alasannya aksi perambahan di dalamkawasanTNGLmelanggar UU No. 41/1999 tentang Kehutanan dan UU No. 5/1990 tentang Konservasi Sumber Daya Alam. Dibelahanduniaini,jelasnya, hanya ada tiga negara yang memilikihutanhujantropis,yakni Brazil,ZairedanIndonesia.Fungsi hutan sangat strategis karena jika hutaninirusak,makadampaknya bukan saja dirasakan masyarakat lokal, tapi juga warga dunia.

Untuk menekan laju kerusakan hutan, ia berharap dukungan kuat dari Bupati Langkat termasuk seluruh lapisan masyarakat serta para stakeholder.“Mari kita selamatkan hutan ini,” ajaknya seraya mengimbau masyarakat menghentikan aktivitas ilegal jika tidak ingin berhadapan dengan hukum. Ketua Lembaga Datuk Aru Besitang,AbdulHapiz,padaacara deklarasi Lembaga Masyarakat Hukum Adat Teluk Aru Besitang beberapa waktu lalu minta pihak TNGLmerekonstruksiulangtapal batasdenganalasansebagiankawasantermasuktanahadat.(a03/a02)

Timsel KPU T. Tinggi Diminta Tidak Pilih Anggota KPU Lama TEBINGTINGGI (Waspada): TimSeleksiKPUkotaTebingtinggi diminta tidak memilih kembali anggotaKPUlama.Merekadinilai gagal menjalankan tugas, akibat Pilkada Ulang kota Tebingtinggi sehingga merugikan keuangan negara. Bahkan mereka mendapat peringatan keras dari Dewan Kehormatan KPU provinsi, karena dinilai tak jujur. Wakil Ketua DPC PPP kota Tebingtinggi Arham, Selasa (10/ 9), menegaskan hal itu terkait adanyaindikasiTimselKPUbakal meluluskan anggota KPU lama, dalam proses seleksi yang tengah berlangsung. Pantauan, tiga anggota KPU kota Tebingtinggi lama, terdaftar sebagai peserta seleksi KPU kota Tebingtinggi. Menurut Arham, ketiga anggota KPU lama itu secara moral

dan politik serta hukum, tak layak lagi diluluskan sebagai anggota. “Secara moral mereka tak punya integritas, secara politik kinerja merekagagal.Secarahukumjuga, seharusnya dipidana,” ungkap mantan aktivis HMI Sumut itu. Ditambahkan, harusnya Timsel KPU Tebingtinggi menyontoh TimselKPUSumutyang tidak meluluskan salah seorang anggota KPU Tebingtinggi yang mendaftar ke KPU Sumut. “Meskinya mereka sudah end (tamat),” tegas dia. Perkembangan lain, Timsel KPU kota Tebingtinggi kembali menuai masalah. Kali ini Kepala SMPN 7 Doanta Surbakti, S.Pd mengeluarkan surat keterangan pembatalan rekomendasi atas seorang guru. Surat pembatalan itu, No. 800/168/SMPN.07/2013

tanggal 5 September 2013. Oknum guru berstatus PNS fungsional itu mendaftar sebagai calon anggota KPU dengan ijin rekomendasikepalasekolahyang seharusnya kepala dinas. Anehnya,TimselKPUkotaTebingtinggi meluluskannya dalam seleksi administrasi. Selain itu salah seorang calon anggota KPU yang digagalkan dalam seleksi administrasi, mengadukan Timsel KPU Tebingtinggi ke KPU Sumut. Surat pengaduan 9 September 2013 itu dikirim kepada Ketua KPU Sumut di Medan. Inti surat itu minta KPU Sumut melakukan penelitianataskinerjaTimselKPU kota Tebingtinggi. Jika terbukti salah menjalankan tugas agar dicopot dan diambil alih KPU Sumut.(a09)

Salah Ketik, Penetapan Penahanan Ir Faisal Berubah LUBUK PAKAM (Waspada): Akibat isi surat penetapan penahanan salah ketik, status penahanan terdakwa Kadis PU Deliserdang, Ir Faisal berubah, dari penahanan di LapasTanjung Gusta menjadi Tahanan Rumah. Kepala Seksi Intelijen Kejaksaan Negeri (Kasi IntelKejari)Lubukpakam,ChairulFadli,SHkepada Waspada di ruang kerjanya, Selasa (10/9) mengungkapkan, usai Ir Faisal divonis dengan hukuman 1 tahun dan 6 bulan penjara, denda Rp50 juta dan subsidair 1 bulan kurungan penjara oleh majelis hakim Tindak Pidana Korupsi (Tipikor) PN Medan beberapa waktu, maka untuk melakukan eksekusi hakim tinggi pada PengadilanTinggi(PT)MedanRidwanSDamanik, SH dalam surat penetapan No. 399/Pen.Pid. Sus.K/2013/PT MDN yang ditetapkan 26 Agustus 2013 memerintahkan menahan Ir Faisal dalam rumah tahanan negara (Rutan) Tanjung Gusta, paling lama 30 hari sejak tanggal 26 Agustus 2013 s/d24September2013.“Suratpenetapanitukami terima Kamis (5/9) sekira pukul 15:00,” ujar Fadli. Namun keesokannya atau Jumat (6/9) sekira pukul15:00,lanjutFadli,pihaknyadidatangikuasa hukum Ir Faisal yang membawa salinan surat dari PT Medan No : W2-U/4934/HN.01.10/IX/ 2013, ditandatangani Panitera/Sekretaris PT MedanTjaturWahjoe B.SP, SH, M.Hum ditujukan kepada Panitera/Sekretaris Pengadilan Negeri

(PN) Medan, perihal salinan penetapan/ perpanjangan Hakim PT Medan. Surat tertanggal 5 September 2013 itu sebagai ralat/perbaikan untuk mengganti penetapan yang dikirimsebelumnyayangterdapatkesalahandalam pengetikan pada amar penetapan yang tertulis di mana ‘Memerintahkan untuk melakukan penahanan terdakwa Ir Faisal dalam rumah tahanan negara, yang seharusnya memerintahkan untuk melakukan penahanan terdakwa Ir Faisal dalam rumah mulai dari tanggal 26 Agustus 2013 s/d 24 Sepetember 2013. Meski dalam waktu sekejap itu mendadak adanya perubahan surat penetapan dari Pengadilan Tinggi, namun mau tidak mau pihak Kejari Lubukpakam harus melaksanakannya. Sehingga pada Selasa (10/9) sekira pukul 09:30, surat penetapan itu telah dilaksanakan, dan Ir Faisal menjadi tahanan rumah. Terkait kebenaran kedua surat yang sangat bertolak belakang isinya itu, lanjut Fadli, pihaknya sudah melakukan pengecekan ke PT Medan pada Senin (9/9), yang hasilnya bahwa surat penetapan yang kedua itu memang benar dikeluarkan PT Medan. “Kita sudah cek ke PT Medan, salinan surat yang dibawa salah seorang kuasa hukum terdakwa Ir Faisal kepada kami itu sama dengan arsip yang ada di PT Medan dan Ir Faisal telah ditetapkan menjadi tahanan rumah.(c02)

Tim Orientasi Ke Langkat STABAT(Waspada):Sejumlah kepala daerah didampingi beberapa pejabat Badan Diklat Kementerian Dalam Negeri RI berkunjung ke kantor Pemkab Langkat di Stabat. Mereka yakni Bupati Buleleng (Bali) Putu Agus Suradnyana, Bupati Buru Selatan (Maluku) Tagop Sudarsono Soulisa, Bupati Pegunungan Bintang (Papua) WellingtonLodWenda,WakilBupati TimorTengahUtara(NTT)Aloysius Kobes,WakilBupatiBaritoSelatan (KalimantanTengah) SatyaTitiek Atyani Djoedir danWakil Bupati Yahukimo, Provinsi Papua. Kunjungan tergabung dalam Tim Orientasi Kepemimpinan Penyelenggaraan Pemerintah Daerah AngkatanV, disambut Plt.

Sekda H. Indra Salahuddin mewakili Bupati H. Ngogesa, didampingi Asisten I Bidang Pemerintahan Abdul Karim dan sejumlah SKPD di rumah dinas bupati di Stabat, Senin (9/9). Pemandu tim M. Yusuf dari Badan Diklat Kemendagri mengatakantimakanmelakukan Observasi Lapangan selama tiga hari guna mengamati pelaksanaan penyelenggaraan pemerintahan daerah sesuai amanat UU no. 32Tahun 2004 tentang pemerintahan daerah, dan berbagai peraturan dan undang-undang terkait isu aktual yang mencakup aspek pemerintahan, pembangunan, politik dan kemasyarakatan serta keuangan daerah. “Pesertaorientasidiharapkan

memahami berbagai permasalahan yang komprehensif antara teori, konsep dan prinsip kepemimpinan dan penyelenggaraan pemerintahan daerah bersama para kepala daerah yang telah memiliki masa jabatan lebih dari satu tahun,” kata M. Yusuf. Sebelumnya Plt. Sekda Langkat, H. Indra Salahuddin memaparkan penyelenggaraan pemerintahan, geografis, topografi dan berbagai potensi Langkat serta keberhasilan yang diraih. Dalam sesi diskusi di ruang pola kantor bupati, peserta memfokuskan pembahasan tentang keberhasilan Langkat dalam menjaga kelestarian lingkungan hidup di tengah gencarnya explorasi alam oleh para investor.(a01)

8 Pelaku Bentrok Dilepas LUBUK PAKAM (Waspada): Delapan dari 13 tersangka penyerangan terhadap petani di lahan garapan Dusun III, Desa Sena, Kec. Batangkuis, Deliserdang, yang terjadi Jumat (6/9) sore, setelah menjalani pemeriksaan di Mapolres Deliserdang dilepas lagi dan hanya dikenakan wajib lapor. Ke delapan orang yang sudah ditetapkan sebagai tersangka itu PT, 40, warga Durin Simbelang, Kec. Pancurbatu, DS, 26, warga Desa Sena, Kec. Batangkuis, HPS, warga Durin Simbelang, Kec. Pancurbatu, HPB, 28, warga Lau Bacem, Kec. Pancurbatu, IS, 28, warga Lau Bacem, Kec. Pancurbatu, IK, 30, warga Durin Simbelang, Kec. Pancurbatu, FP, 35, warga Dusun IV, Desa Sugau, Kec. Pancurbatu dan CB, 25, warga Durin Simbelang, Kec. Pancurbatu. Sedangkan lima tersangka yang ditahan M, 45, warga Dusun III, Desa Sena, Kec. Batangkuis, J, 50, warga Dusun III, Desa Sena, JPB, 28, warga Dusun II, Desa Rambung Baru, Kec. Sibolangit, S, 25, warga Dusun II, Desa Sena dan I, 30, warga Durin Simbelang, Kecamatan Pancurbatu. KapolresAKBPDickyPatrianegaramelaluiselularnyakepadawartawan, Senin (9/9), mengatakan para tersangka dikenakan status wajib lapor namun berkasnya tetap berlanjut ke kejaksaan.(c02/a07)

Kesehatan), Ahmad Tarmiji, SH Kadis Perindag (sebelumnya Sekretaris Dinas Perindag) menggantikan DrsVuko RedwardWilson Bakkara, M.Si. Selanjutnya Dra Hj. Rabiatul Adawiyah Lubis Kaban KB dan PP, H. Redwin, SH Asisten II (sebelumnya Asisten III Setdakab), Drs H. Rahmad Nasution, MAP Asisten III (sebelumnya Kadis Kebudayaan & Pariwisata), Drs H. Hasbi Nasution staf Ahli Bupati bidang Ekonomi dan Keuangan (sebelumnya Kaban Kesbang/Linmas) menggantikan Rusdi Ritonga, SH, Drs HM Ali Yusuf Siregar, MAP Kepala Badan Kesbang/Linmas (sebelumnya Kadis Dukcapil) dan DraWastiana Harahap sebagai Kadis Dukcapil (sebelumnya Sekretaris Dinas Dukcapil). Wabup mengatakan sebagai abdi negara dan abdi masyarakat kita memiliki obsesi cukup besar bagi penyempurnaan berbagai kemajuan yang sudah kita raih guna mencapai visi-misi pembangunan, yaitu Deliserdang yang maju dengan masyarakat yang sejahtera, religus dan bersatu dalam kebhinekaan. Hadir unsur Muspida, Wakil Ketua DPRD H Dwi Andi Syahputra Lubis, Lc, Sekdakab Drs H. Asrin Naim, MM serta seluruh pimpinan SKPD se jajaran Pemkab Deliserdang.(a06)

Waspada/Ibnu Kasir

TIM Orientasi Kepemimpinan Penyelenggaraan Pemerintah Daerah Angkatan V terdiri dari 6 Bupati/Wakil Bupati bersama Plt. Sekda Langkat, H. Indra Salahuddin dan Asisten I Bidang Pemerintahan Abdul Karim, di depan rumah dinas bupati di Stabat.

Waspada/Ist

BUPATI Sergai Ir. H. Soekirman didampingi Sekdakab Sergai Drs H. Haris Fadillah, M.Si usai rakor meninjau pabrik pengolahan tepung tapioka di Desa Cempedak Lobang Kec. Sei Rampah dengan peserta orientasi Bupati/Wali Kota dan Wabup/Wawakot Angkatan V tahun 2013.

Tim Orientasi Angkatan V Ke Sergai SEIRAMPAH (Waspada): Keberagaman potensi sumber daya alam yang dimiliki Kab. Serdang Bedagai (Sergai) salah satunya bidang pertanian menjadi daya tarik bagi kepala daerah dari beberapa pemerintahan kabupaten di IndonesiayangmengadakanObservasiLapangan (OL) di tanah bertuah negeri beradat ini. Selain itu, juga untuk mempelajari praktek kepemimpinan dan pencapaian kinerja guna mewujudkan grand desain daerah otonom, mencakupbidangpemerintahan,pembangunan, politik dan kemasyarakatan serta keuangan daerah. Kepala daerah yang melaksanakan OL di Kab. Sergai merupakan peserta yang mengikuti Orientasi Kepemimpinan dan Penyelenggaraan Pemerintahan Daerah (KPPD) Bupati/Wali Kota sertaWabup/Wawakot AngkatanV tahun 2013, terdiri dari Bupati Bekasi Provinsi Jabar dr. Neneng Hasanah Yasin, Bupati Kotawaringin Barat ProvinsiKalimantanTengahDr.H.UjangIskandar, ST, M.Si, Bupati Buru Provinsi Maluku Ramly Umasugi, SP, MM, Wabup Serang Banten Hj. Ratu Tatu Chasanah, SE, M.Ak,Wabup Malinau Provinsi Kalimantan Utara Topan Amrullah, S.Pd dan Wabup Boalemo Provinsi Gorontalo serta Pendamping Koordinator Widyaiswara dari Badan Diklat Kemendagri Istiarto Suryo. Mereka diterima Bupati Sergai Ir. H. Soekirman didampingi Sekdakab Drs. H. Haris Fadillah, M.Si, para kepala SKPD dan seluruh

Camatse-Sergaipadaacararapatkoordinasi(rakor) di aula Sultan Serdang kompleks Kantor Bupati di Sei Rampah, Senin (9/9). OL berlangsung 3 hari, 9 sampai 11 September 2013. Bupati Sergai Ir. H. Soekirman mengucapkan terimakasih kepada pihak Kemendagri yang menetapkan Sergai salah satu lokasi OL dari 3 Kab/Kota di Provinsi Sumatera Utara (Provsu). Dipaparkan Soekirman, Kab. Sergai dengan potensi utama SDA di sektor pertanian merupakan sektor yang punya peranan strategis dalam struktur pembangunan perekonomian, dimana pada 2012 mencatat 231.866 ton beras sekaligus salah satu lumbung beras di Sumut dengan menyumbang surplus 149.095 ton. Selain sektor pertanian diikuti bidang perkebunan serta bidang peternakan dan perikanan juga turut penyumbang Pendapatan Daerah Regional Bruto (PDRB). Menyikapi proses alih fungsi lahan pertanian padi yang cenderung makin meluas menjadi sarana pelayanan publik seperti perumahan, perkantoran mau pun lahan pertanian non padi menyebabkan areal pertanian semakin sempit sejalantingkatkonsumsiberasyangsemakintinggi, ini tidak hanya terjadi di Kab. Sergai tetapi sudah menjadiisunasional,agarmasalahinitidakmenjadi berkelanjutan dan ketahanan pangan dapat dipertahankan, Bupati mengungkapkan perlu adanya kesepahaman dan sinergi antara Pemkab Sergai dan para kepala daerah sekaligus menjadi tinjauan untuk memecahkan masalah ini.(a08)


Sumatera Utara

B2 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi); Hang Tuah Jasa Said (Potret). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

TANJUNGBALAI (Waspada): Sejumlah ruas jalan dan pemukiman terendam banjir setelah hujan mengguyur Kota Tanjungbalai, Selasa (10/9) sore. Banjir terjadi diduga akibat saluran pembuangan yang tak mampu mengalirkan air hujan ke sungai karena ukuran tidak memadai. Selain itu banyaknya sampah yang menyumbat parit turut andil menghambat kelancaran aliran air. Fitri, 30, karyawan salah satu toko buku di Jl. SM Raja, Kota Tanjungbalai mengaku tokonya tergenangairyangmelimpahdari parit depan rumah. Akibatnya, dia dan beberapa karyawan lainnya terpaksa kerja keras menguras agar barang-barang tidak tersentuh air. “Takberhentikamimenguras sampai hujan reda bang, supaya barang-barang di sini tidak terkena air, capek juga, sakit pinggang,” ungkap rekannya Sheila Sonia. Sementara, anggota DPRD Kota Tanjungbalai, Hakim Tjoa Kian Lie mengatakan, kebijakan

pembersihan riol yang dilakukan Pemko selama ini terbukti belum mampu mengatasi masalah banjir. Sekretaris Fraksi PDI P ini meminta agar Wali Kota perlu mengambil kebijakan dan langkah baru untuk mengatasi persoalan banjir. Menurut Hakim, solusi harus segera dilakukan yakni mengaktifkan kembali sejumlah anak sungai yang telah berubah menjadi pemukiman. Jika anak sungai itu difungsikan, ungkap Hakim, tentu air akan dengan lancar mengalir hingga ke sungai dan masalah banjir bisa diselesaikan. Beberapaanaksungaiyangtelah ‘mati’itudiantaranyadiJl.Jenderal Sudirmanyangmenghubungkan dua kelurahan yakni Kel. BungatanjungKec.Datukbandar,danKel. Sirantau,Kec.DatukbandarTimur. Kemudian saluran pembuangan diJl.ListriktepatdisampingMasjid Saksi,kinitelahditumpatdanberdiri

bangunan di atasnya. “Selain itu sejumlah riol di Jl. Lingkar Utara juga tidak berfungsi menambah buruknya sistem drainasediTanjungbalai.Inimasih hujanlho,belumlaginantipasang air laut (banjir rob), lama-kelamaan Tanjungbalai bisa seperti Kota Jakarta,” pungkas Hakim. Amatan Waspada, beberapa titik banjir terpantau di Jl. Sisingamangaraja, Jl. Hos Cokroaminoto, Jl.Teuku Umar, Jl. Pahlawan, Jl. M Abbas, Jl. Imam Bonjol, Jl. Listrik, Sutomo, Mesjid, pemukiman dan perkantoran yang ada inti kota.Terparah banjir di Jl. Jend Sudirman bundaran PLN, Kantor Samsat, seputar tugu Adipura depan SMP 1, hingga Kantor DPRD Kota Tanjungbalai. Di tengah genangan, banyak kendaraan terutama sepeda motor mogok akibat mesin terkena air. Mereka terpaksa mendorong sampai menemukan bengkel terdekat. “Inti kota saja begini keadaannya, apalagi di kawasan pinggiran. Sekali lagi, Pemko harusberanimengambilterobosan,” kata Hakim mengakhiri. (a32)

Bocah Lima Tahun Korban Pencabulan Sepupu RANTAUPRAPAT (Waspada): Bocah lima tahun, Melati, nama samaran, warga Kec. Pangkatan, Kab. Labuhanbatu, menjadi korban pencabulan abang sepupunya,HK,19,wargaPamingke, Kec. Aek Natas, Kab Labura, Jumat (6/9), saat kedua orangtua korban tidak berada di rumah. Informasi yang diperoleh di Mapolres L.Batu, Senin (9/9), anak ketiga dari pasangan RH, 38 dan S, 34, diketahui menjadi korban pencabulan setelah ibunya melihat Bunga menangis kesakitan saat buang air kecil. Luka robek di bagian kemaluannya diduga menjadi penyebab rasa sakit yang dialami Bunga saat buang air kecil.

Kepadaibunya,Melatikemudianmenceritakanapayangtelah diperbuat oleh abang sepupunya yang sudah hampir seminggu menginap di rumah salah satu pamannya yang berdekatan dengan rumah korban. “Pencabulan itu dilakukan saat saya dan suami sedang tidak berada di rumah pada, Jumat (6/ 9) siang. Kami baru mengetahuinya pada malam harinya, saat anakkamiitumenangiskesakitan saat buang air kecil,” terang S, ibu Bunga, Senin (9/9), di ruang SPK Polres L.Batu. MendapatpengakuanMelati, S dan suaminya langsung membawa Melati ke salah satu klinik umum di daerahnya. Salah se-

orang dokter di klinik itu menyebutkan, terdapat luka robek pada bagian kemaluan korban. Sepulangnyadariklinik,Sdan suaminya langsung melakukan pencarian terhadap HK. Namun, pemuda pengangguran itu telah kabur entah kemana. Suami istri itu lalu membuat pengaduan ke Mapolres L.Batu. Kapolres L.Batu AKBP Achmad Fauzi Dalimunthe SIK melalui Kasubag Humas Polres L.Batu AKP MT Aritonang membenarkan adanya laporan terkait pencabulan anak di bawah umur. “Laporannya masih dalam penanganan unit pelayanan perempuan dan anak Polres L.Batu,” tandas Aritonang. (a18)

TANJUNGBALAI (Waspada): Petugas Polsek Tanjungbalai Selatan bekerjasama dengan Sat Narkoba Polres Tanjungbalai berhasil menyita narkoba jenis ganja dan sabu dalam sebuah penangkapan, Selasa (10/9). Ganja diduga milik tersangka Za alias Buyung alias Burek, 23, ini dikemas dalam 23 amplop, totalnya 39,61 gram. Sementara sabudibagimenjadi23paketdengan berat keseluruhan 6,22 gram. Selain mengamankan tersangka dan narkoba, polisi juga

membawa satu unit telefon genggam dan 100 lembar plastik klip transparan kosong diduga akan dijadikan tempat sabu. Saat akan ditangkap, tersangka warga M. Abbas, Gg Amanah, Lingk. II, Kel. Pantaiburung, Kec. TBS, yang sehari-hari bekerja sebagai buruh itu sempat membung barang bukti untuk menghilangkan jejak. Meski demikian, dia tetap dibawa ke kantor polisi karena sejumlah orang menyaksikan dia melempar ganja dan sabu.

Waspada/Helmy Has

Pembayaran BLSM Di Talawi Ramai LABUHANRUKU (Waspada): Pembayaran dana Bantuan Langsung Sementara Masyarakat (BLSM) tahap II di kantor Pos LabuhanrukuTalawi ramai, Selasa (10/9). Menurut warga, pada hari itu yang dilayani berasal dari Kelurahan Labuhanruku dan Desa Petatal lebih 700 orang, masing-masing dapat Rp300.000. Saat pembayaran warga antri namun ada juga yang tak sabar hendak langsung mengambil kartu nomor giliran. Mbah Inah, 65,

wargaPetataldatangnaiksepedamotordibonceng anaknya menyatakan terima kasih atas bantuan tersebut. Selain ramai oleh warga kategori miskin, ternyata halaman kantor juga dipenuhi sepedamotor, tak jelas apakah milik penerima BLSM atau ojek sewaan. Untuk Kec.Talawi jumlah penerima BLSM 20 desa/kelurahan sebanyak 3.357 orang dengan jadwal sudah ditentukan selama seminggu. (a12)

Kemenkeu Sosialisasi Pengalihan PBB-P2 Menjadi PAD

� Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385.

KOTAPINANG (Waspada): Sebanyak 17 pemuda putus sekolah dari sejumlah daerah di Kec. Kotapinang, Kab. Labusel mendapat pelatihan keterampilan teknisi komputer yang digelar Dinas Sosial, Tenaga Kerja, dan Transmigrasi (Dinsosnakertrans) Pemkab Labusel selama 10 (9 sampai 19 September 2013) di Hotel Royal Permata, Torgamba. PengamatanWaspada,ke17pesertadilatiholehsejumlahinstruktur profesional untuk mengetahui cara memperbaiki komputer. Tidak hanyaitu,pesertajugadibekalidenganketerampilanmenjalankanaplikasi, membuat program, dan perakitan komputer. “Peserta diberi modul, perkakasdansertifikat.Seluruhnyagratis,”kataKepalaDinsosnakertrans SMB Harahap ketika membuka kegiatan itu, Selasa (10/9). SMB mengatakan, pelatihan ini merupakan langkah Pemkab Labusel untuk menekan jumlah pencari kerja. Dengan pelatihan tersebut kata dia, masyarakat diharapkan terdorong untuk berwira usaha dengan modal keterampilan yang diberikan. “Pelatihan ini menjadimodalbagiwargasehinggamerekabisabekerjaataumembuka usaha sendiri,” kata SMB. Salah seorang peserta, Syahfitri mengatakan, pelatihan tersebut sangat berguna bagi dirinya khususnya untuk menambah keterampilannya dalam bidang komputer. Apa lagi, kata dia, untuk mendapatkan pelatihan secara mandiri saat ini biayanya mahal. “Ke depannya kita harapkan kegiatannya lebih ditingkatkan dan pesertanya lebih besar,” katanya. (c18)

hasil tangkapan kepada toke nya di Batubara. Yang tak masuk akal, menurut Cholilul setiap mengadukepihakpenguasadilautsepertiDiskanla, Pos AL, Polair, mereka minta/mengimbau jangan terjadi tindakan anarkis, kalau jumpa pukat grandong melaut lagi atau sedang melabuh pukat laporkan dengan barang bukti berupa foto garandong menarik pukatnya. “Seakan-akandalampenertibanpukatdilarang KepmenNo.2/2011itudiBatubarasebagai‘lelucon’ saja. Disesalkan petugas keamanan di laut diduga melakukan pembiaran terhadap pukat grandong bebas beroperasi,” ujarnya kesal. Ketua HNSI Kec.Tanjungtiram, Ganti melalui ponsel, Selasa (10/9) mengakui ada satu-satu pukat grandong yang melaut secara mencuri-curi. Mereka mencari ikan di laut Silau Asahan kemudianmembawaikantangkapankepadapemilik grandong di Batubara.(a12)

WARGA antri saat pembayaran dana BLSM tahap II di kantor Pos Labuhanruku.

KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874.

Pemuda Putus Sekolah Dilatih Komputer

BATUBARA (Waspada): Pukat grandong tarik dua kembali beroperasi mengancam kondusifitas jelang berlangsungnya Pilbup Batubara yang tinggal 10 hari lagi. Kekhawatiran terancamnya rasa aman mencari nafkah di laut perairan Kuala Tanjungtiram itu diungkap Chililul, tokoh nelayan tradisional di Batubara, Selasa (10/9). “Kita khawatir adanya kegiatan pukat garandong tarik dua melaut kembali bisa mengancam kondusifitas dalam menghadapi Pilbup Kab. Batubara hanya beberapa hari lagi. Disangsikan nantinya ada di antara nelayan kecil tak dapat menahan emosi memicu keributan sesama nelayan,” tukas Cholilul mengaku mendapat laporan dari nelayan jaring pukat grandong melaut lagi. Ada juga melaporkan bahwa kawanan grandong sudah mandah di Silau Asahan, tetapi meraup ikan di laut Batubara kemudian menjual

“Sebenarnya mereka ini berdua, satu lagi lari dan saat ini masih buron,” kata Kapolres Tanjungbalai AKBP ML Hutagaol melalui Kasubbag Humas AKP Y Sinulingga. Untuk mempertanggungjawabkan perbuatannya, kata Sinulingga, tersangka dijerat UU No 35 Tahun 2009 tentang narkotika dengan ancaman di atas lima tahun penjara. Sinulingga berharap agar masyarakat turut berpartisipasi dan bekerjasama memberantas narkoba. (a32)

KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com

Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Pukat Grandong Melaut Lagi

39,61 Gram Ganja , 6,22 Gram Sabu Disita

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com

Waspada/Rasudin Sihotang

SEBUAH sepeda motor mati mendadak di tengah banjir di Jl. Jend Sudirman karena mesinnya terkena air.

Ancam Kondusifitas Pilbup

Penerbit: PT Penerbitan Harian Waspada

� Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412.

Rabu 11 September 2013

Tanjungbalai Banjir

Hubungi kami

� Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109.

WASPADA

Waspada/Rasudin Sihotang

TERSANGKA Za (dua kanan) berikut barang bukti ganja dan sabu diamankan di kantor polisi.

Mapaka STMIK-AMIK Royal Kisaran KISARAN (Waspada): Masa Perkenalan Kampus (Mapaka) mahasiswa baru STMIK-AMIK Royal Kisaran, pendidikan bagi generasi penerus harus berkarakter demi menuju kehidupan yang lebih baik. Ketua Yayasan Pendidikan RoyalTeladan, Anda Putra Lubis, SE, MMA saat memberikan materi kepada mahasiswa mengatakan hal itu, Selasa (10/9). Menurutnya, bahwa pendidikan itu sangat penting, dalam meng-

hadapi tantangan, sehingga pendidikan yang berkarakter sangat dibutuhkan. “Oleh sebab itu, AMIK-STMIK Royal terus melakukan pembenahan, sehingga mutu pendidikan perguruan tinggi di Asahan terus dapat meningkat,” jelas Anda. Senada dengan Direktur AMIK Royal Kisaran Drs Saleh Malawat, MMA mengatakan, bahwa mahasiswa baru itu ibaratkan sebagai kertas kosong yang belum berwarna, sehingga

pendidikan dan pembinaan yang akan memberikan warna, dan memiliki karakter. “Dengan demikian pembinaan dan pendidikan yang tepat, akan menciptakan generasi siap pakai dan membantu pemerintah dalam membangun,” jelas Saleh. Kegiatan Mapaka sedikitnya diikuti1.006mahasiswabaru,dan hadir dalam kegiatan itu, Ketua STMIKRoyalAmrizal,danbeserta dosenyangberlangsungdiKampus IJalanImamBonjolKisaran (a15)

Waspada/Sapriadi

KETUA Yayasan Pendidikan Royal Teladan Anda Putra Lubis, SE, MMA memberikan materi di Mapaka STMIK-AMIK Royal Kisaran.

KOTAPINANG (Waspada): Kementerian Keuangan RI, Selasa (10/9) menggelar sosialisasi pengalihan Pajak Bumi dan Bangunan Pedesaan dan Perkotaan (PBB-P2) menjadi Pajak Daerah di Hotel Royal Permata, Torgamba, Kab. Labusel. Hadir pada kegiatan yang dibuka oleh Asisten Administrasi Umum Naga Parlaungan Lubis itu, Sukarni Muhammad Amin dari Dirjen Perimbangan Keuangan Kementerian Keuangan, Eko Suarno Riyadi dan Heri Mardianto dari Kanwil Dirjen Pajak Sumut II, Ketua Komisi C DPRD Labusel Hasraruddin Nur Daulay beserta Anggota Harri Muktasar dan Rustam Efendi, serta Ketua MUI Labusel Maratamin Harahap. Pada sosialisasi yang diikuti camat dan kepala desa se Kab. Labusel serta pimpinan Perbankan, BPN, KPP Rantauprapat, dan tokoh masyarakat

itu, Naga Parlauangan mengatakan, pajak merupakan aset yang dapat digunakan untuk pembangunan suatu daerah sesuai UU No. 28 tahun 2009 tentang Pajak Daerah dan Retribusi. Menurutnya, dengan dialihkanya PBB-P2 menjadi Pajak Daerah sesuai Keputusan Bersama Menteri Keuangan No. 213/PMK.07/2010, diharapkan PBB-P2 dapat menopang laju pembangunan Kab. Labusel. “Ini merupakan kebijakan yang sangat penting demi kemajuan Labusel ke depan,” kata Naga Parlaungan. Dirjen Perimbangan Keuangan Kementerian RepublikIndonesiayangdiwakiliSukarniMuhammadAminmengatakan,sosialisasiinidilaksanakan sebagai upaya percepatan pembangunan daerah yang merupakan inisiatif dari Komisi XI DPR RI sesuai dengan UU No.28 tahun 2009 tentang Pajak dan Retribusi Daerah. (c18)

Honorer K-2 Diimbau Waspadai ‘Calo’ CPNS KOTAPINANG (Waspada): Komisi A DPRD Kab. Labusel mengimbau agar tenaga honorer yang masuk dalam Kategori Dua (K-2) dan akan mengikuti seleksi untuk menjadi Calon Pegawai Negeri Sipil (CPNS) yang akan dilakukan dalam waktu dekat ini, untuk waspada terhadap calo yang memberikan iming-iming kelulusan dengan jaminan sejumlah uang. Imbauan itu dikemukakan anggota Komisi A DPRD Kab. Labusel, Jappar Siddik Nasution kepada Waspada, Selasa (10/9). Politisi Partai Bulan Bintang (PBB) ini juga mengharapkan agar PemkabLabuseldanKementerianPemberdayaan Aparatur Negara (Kemenpan) melakukan seleksi tersebut secara jujur. Japparmengatakan,saatinidisinyalircalo-calo telahbergentayanganmenghubungiparahonorer

danmemintasejumlahuang.Menurutnya,Honorer K-2 tersebut tidak layak diperlakukan demikian, sebab para honorer itu telah mengabdi bertahuntahunbahkanadayangbekerjadengngajiseadanya. “Jangan lagi dimanfaatkan karena ada kesempatan mereka menjadi CPNS. Adanya info bahwa pengangkatan Honorer K-2 menjadi CPNS akan dilakukanpendaftarandantestingpadaSeptember ini. Kita minta Pemkab betul-betul melakukannya secara fair,” kata Jappar. Kepala Badan Kepegawaian Daerah (BKD) PemkabLabusel,ZainuddinHarahapyangdikonfirmasimengakuiakandigelarnyaseleksipenerimaan CPNS untuk Honorer K-2 di Kab. Labusel. Namun Zainuddin belum dapat memastikan kapan seleksi tersebut dilakukan karena belum ada jadwal dari Kemenpan.“Belum ada jadwalnya,” katanya. (c18)


Berita Utama

A2 Angkot Kontra Kereta, Satu Tewas P.SIDIMPUAN (Waspada): Tabrakan mobil angkutan umum (Angkot) 02 BB 1451 FA trayek Pasar SidimpuanPijorkoling dengan kereta Astrea Grand BB 4722 FD di Jalinsum Kel.Sihitang, Kec. Padangsidimpuan Teng-gara, Selasa (10/9) pagi, mengakibatkan satu orang tewas. Korban tewas, Dede Hotmartua Tamba,21. Polresta Padangsidimpuan yang dikonfir masi Waspada/Ahmad Cerem Meha SATU mobil angkutan umum melalui Kanit Laka Aiptu TM Sitepu, membenarkan adanya (Angkot) 02 BB 1451 FA trayek Pasar Sidimpuan-Pijorkaling kejadian tersebut. “Setelah mendapat lata bra k a n d en g a n kereta menyebabkan satu orang poran dari warga, kami langsung menuju lokasi kejadian tewas Selasa(10/9). untuk cek TKP, membawa bukti satu kenderaan roda empat (Angkot) milik Hendri,35, dan kereta Honda Astrea Grand’’ujarnya. (c13)

Maling Sikat Uang Jamaah Sedang Shalat STABAT ( Waspada): FS, 27, warga Tanjung Jati, Kota Binjai babakbelur diamuk massa setelah tertangkap tangan mengambil tas jamaah yang sedang shalat di Masjid Nurul Huda Kel. Perdamaian Stabat, Langkat,Senin (9/9) malam. Informasi dihimpun Waspada, saat itu pelaku berpurapura shalat di belakang korban. Pada rakaat kedua saat sujud, FS beraksi dengan membawa kabur tas berisi uang Rp26 juta yang diletakkan di samping korban. Arianto, 27, warga Karang Gading , Kec. Secanggang Kab. Langkat. Sadar tasnya hilang, korban membatalkan shalatnya dan mengejar pelaku. Saat itu FS berusaha menghidupkan mesin Honda Legenda BK 4512 GE untuk kabur , namun tidak berhasil. Korban langsung berteriak maling dan mengundang perhatian massa.Tanpa dikomando, massa membabakbelurkan tersangka. Aparat Polsek Stabat yang tiba di lokasi segera membawa tersangka ke komando. Kapolsek Stabat AKP Zulkarnen , yang dikonfirmasi menuturkan pelaku masih di sel untuk pengembangan lebih lanjut. (a03)

Menag: Hati-hati Saat Tawaf JAKARTA (Waspada): Menteri Agama Suryadharma Ali berpesan kepada jamaah calon haji agar berhati-hati saat menjalankan ibadah tawaf karena sedang ada perbaikan di sekitar Kabah. “Tawaf akan terkonsentrasi di lantai satu. Jamaah harus hati-hati karena akan jauh lebih padat dari tahun-tahun sebelumnya,” kata Menag saat melepas jamaah kloter pertama embarkasi Jakarta di Asrama Haji Pondok Gede, Jakarta, Selasa (10/90 pagi. Ia mengatakan, akibat perbaikan, area tawaf yang biasanya mampu menampung jamaah sekitar 48.000 orang per jam berkurang sekitar 60 persen menjadi hanya 22.000 per jam. “Pimpinan Kelompok Bimbingan Ibadah Haji (KBIH) termasuk jamaah supaya

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Bf8+, GxB. 2. Gg5+, Ge7. 3. GxG+, RxG. 4. Mf7+, Rd8. 5. Mf8+mat. Jawaban TTS: TTS

Kesehatan

disiplin dalam melaksanakan tawaf, karena akan berdesakdesakan sekali. Khawatir ada apa-apa,” katanya. Menag mengingatkan agar jamaah haji mewaspadai tindak kejahatan di Tanah Suci, dan tidak terlalu mengkhawatirkan virus Corona.

Kasus Dul ....

pelanggaran berat seperi pembunuhan, narkoba, perkosaan, pidana lalu lintas dan sebagainya,” kata Kepala Divisi Pengawasan KPAI, M Ihsan di Jakarta, Selasa (10/9). Sebelumnya, kriminolog dan anggota Kompolnas, Adrianus Meliala mengatakan bahwa UU Perlindungan anak lebih tepat digunakan kepada anak yang berbuat suatu tindak pidana karena dijerumuskan seperti mencuri, menjual minuman keras, dan sebagainya. Oleh karena itu, perbuatan Dul yang mengemudi tanpa SIM dan menewaskan banyak orang tidaklah berkaitan dengan UU Perlindungan Anak melainkan hukum pidana terkait lalu lintas. Dikatakan Ihsan, dalam kasus kecelakaan maut

Diserang Anak Punk ....

Mendapat serangan dari tujuh anak punk, kedua korban melarikan diri hingga ke Jl. Sutomo.Namun, mereka berhasil mencegat kedua korban di tempat kejadian. Dan, salah seorang anak punk menusuk perut Jepri Zebua dua kali menggunakan pisau lipat besi putih.Setelah itu, pelaku menikam perut Joni Gea tiga kali. Korban sempat melakukan perlawanan dengan mengayun-ayunkan broti di tangannya. Namun, tubuh korban semakin lemah.Darah mengucur dari lukanya. Dan, Joni Gea rebah di atas genangan darahnya di depan

Al Bayan ....

Jawaban Sudoku:

1 8 7 5 6 9 2 3 4

4 5 3 2 7 8 9 1 6

9 6 2 4 1 3 7 5 8

3 4 6 7 9 5 1 8 2

5 7 9 8 2 1 4 6 3

8 2 1 3 4 6 5 7 9

7 3 4 6 5 2 8 9 1

6 1 5 9 8 4 3 2 7

2 9 8 1 3 7 6 4 5

sangat terhormat. Allah telah mewjibkan suami membayar mahar, mencari nafkah, dan tinggal di rumah sebagai makhluk terhormat. Dalam Islam Haram bagi perempuan berbicara yang menggoda, melenggak-lenggok di depan umum, juga haram membuka aurat. Barang siapa yang melanggar ketentuan ini akan bedosa besar. Muslimah sejati tidak mau membuka auratnya. Negaranegara Islam melarang Miss Word, sebaliknya negaranegara sekuler bahkan turut membiayainya. Dari Alquran dan hadis kita temukan ada Miss Akhirat (Hurrun Aini) yang dalam bahasa Indonesia disebut bidadari. Dara-dara cantik akhirat ini disediakan Allah SWT untuk para syuhada, mukmin sejati dari pemeluk agama

24 Calon DPD Sumut, Nomor Urut Dihapus MEDAN (Waspada): Komisi Pemilihan Umum (KPU) RI menetapkan 24 nama calon Dewan Perwakilan Daerah (DPD) utusan Sumatera Utara. Penetapan 24 nama tersebut tertuang dalam Surat Keputusan KPU No: 679/KPS/ KPU/Tahun 2013. Hal itu dibenarkan Kabag Hukum dan Perundang-undangan KPU Sumut Maruli Pasaribu, SH, yang dihubungi di ruang

kerjanya, Selasa, (10/9). Na m u n , k a t a M ar u l i , sesuai surat yang mereka terima, untuk Pemilu 2014 khusus DPD tidak ada lagi nomor urut melainkan nama dan foto calon dan disusun sesuai abjad. Sedangkan penetapan daftar calon tetap (DCT) DPD merupakan kewenangan KPU RI berdasarkan abjad sesuai PKPU No. 14 perubahan atas

PKPU No. 8/2013. “Ke 24 calon anggota DPD itu dinyatakan lulus dan masuk dalam DCT. Namun, dalam pengumuman itu, KPU tidak menyebutkan nomor urut calon melainkan disusun sesuai abjad,”kata Maruli dan menambahkan, KPU Sumut sudah menyerahkan dan membagikan hasil putusan itu ke masing-masing calon DPD. (m34)

Senat Tunda Pemungutan Suara Damaskus Siap Serahkan Senjata Kimia Kepada PBB WA S H I N G T O N , D C (Waspada): Ketua Mayoritas Senat Harry Reid, Senin waktu AS atau Selasa (10/9) pagi WIB, mengungkapkan, dia menunda pemungutan suara untuk mengesahkan penggunaan kekuatan militer di Syria sampai Presiden Barack Obama menyampaikan soal ini langsung ke publik. Berbagai perkembangan di AS, Syria dan dunia internasional tidak ada yang mendukung rencana serangan militer AS ke Syria. Perkembangan itu membuat Presiden Obama ‘loyo’ dan tak dapat membela rencananya itu. Obama bertemu dengan para senator Selasa waktu AS, dan menyampaikan pidato nasional Selasa malam. Namun, Reid menyatakan sebelumnya, pemungutan suara untuk serangan ke Mesir itu dilangsungkan Rabu nanti. Sementara itu, masyarakat Amerika sangat menentang campur tangan tentara negara itu terhadap Syria, meskipun sebagian besar percaya, Presiden Bashar Assad menyerang rakyatnya dengan gas, demikian kesimpulan sebuah sur vei yang diumumkan Senin. Jejak pendapat CNN/ORC Internasional menemukan 59 persen dari 1.022 petanggap dewasa mengatakan Kongres seharusnya tidak meluluskan resolusi kewenangan, bahkan aksi militer terbatas terhadap Syria.

Sementara itu jajak pendapat terpisah terhadap anggota parlemen oleh USA Today menemukan, Obama berhadapan tugas sulit dari Gedung Parlemen. Hanya sebagian kecil dari 533 anggota parlemen AS, yaitu 22 senator dan 22 legislator, mengatakan mereka akan mendukung penggunaan kekuatan militer terhadap rezim Assad. Secara keseluruhan, 19 senator dan 130 anggota DPR mengatakan mereka akan menentang tindakan militer terhadap Syria. Namun mayoritas parlemen di dua mejelis Kongres mengatakan bahwa mereka masih ragu. Opsi baru muncul setelah Rusia memberikan usulan agar Syria menyerahkan senjata kimianya agar AS menghentikan rencana serangan. Menurut The Guardian, Selasa, Obama menganggap tawaran Rusia ini sebagai salah satu terobosan yang mungkin saja dilakukan. Selain itu, jika dapat direalisasikan, maka akan berpotensi memberikan perkembangan positif pada konflik yang telah berlangsung 2,5 tahun di Syria. Usulan Rusia ini diberikan setelah Menteri Luar Negeri John Kerry menawarkan solusi diplomatis pada Syria. Berbicara di London, Inggris, Kerry mengatakan untuk menghindari serangan AS adalah Syria menyerahkan seluruh senjata kimianya dalam waktu sepekan. “Kami menyerukan pe-

dimana Dul sudah ditetapkan sebagai tersangka, pasal yang digunakan boleh menggunakan pasal pidana lalu lintas dimana ancamannya 6 tahun penjara. Tapi dalam prosesnya tetap menggunakan UU No. 3 tahun 1997 tentang pengadilan anak dan UU 23/2002 tentang perlindungan anak. “Karena Dul masih anakanak, ancamannya separuh orang dewasa atau maksimal dituntut 3 tahun. Ini juga harus ditangani polisi anak, jaksa anak dan hakim anak. Proses pengadilan juga tertutup, dilindungi identitas, didampingi orang tua dan penasehat hukum,” imbuh Ihsan. UU PA juga memungkinkan adanya diversi atau keluar dari proses hukum dengan memberikan rehabilitasi, intervensi kepada anak pelaku

tindak kriminal yang difasilitasi oleh pekerja sosial. “UU PA juga mengedepankan hak anak untuk belajar, istirahat dan sebagainya dipenuhi. Jadi koridornya tetap pada kepentingan terbaik bagi anak. Kalau anak disamakan dengan orang dewasa, hukumannya nanti malah tidak efektif,” kata Ihsan. Dalam hal ini, Ihsan berharap proses hukum terhadap AQL tidak dikaitkan dengan pengaruh orang tuanya, tapi sepenuhnya mengacu pada amanat UU Perlindungan Anak sebagai upaya melindungi anak dar i dampak pemidanaan. “UU PA juga menyatakan ketegasan tentang peran orang tua sebagai pihak yang ikut bertanggung jawab secara hukum,” tandas Ihsan. (dianw)

ruko. Melihat itu, anak-anak punk tersebut kabur. Seorang lagi, teman korban kritis, kini dirawat di rumah sakit. Pihak kepolisian yang menerima informasi segera melakukan penyelidikan dan menangkap empat anak punk yang diduga sebagai pelaku dan membawa mereka ke Mapolres Pematangsiantar. Satu anak punk yang ditangkap, An, 25, warga Jl. Mangga, Kel. Pardamean, Kec. Siantar Timur, adalah seorang residivis yang keluar masuk penjara akibat menjambret. Dari An, polisi menyita satu pisau lipat besi putih dan HP. Sedangkan satu tersangka, SP, 21, warga Jl. Mangga,

Kel. Pardamean, mengaku tidak mengenal An, padahal mereka tinggal di satu jalan. SP mengaku turut lari dari Pasar Horas bersama F, 21, warga yang sama dengan SP, karena menduga ada razia polisi.Dua lagi anak punk yang ditangkap belum diketahui identitasnya. Kapolres Pematangsiantar AKBP Albert TB Sianipar, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP Efendi Tarigan, SH dan Kasat Reskrim AKP Daniel SM, S.Ik menyebutkan, kasusnya masih dalam penyelidikan.Empat orang yang ditangkap masih dalam proses pemeriksaan. (a30)

Tauhid. Siapa yang ingin memiliki Miss Akhirat hendaklah ia menjadi hamba Allah yang shaleh. Misss Akhirat jauh lebih cantik dari Miss Word (Miss Dunia). Miss Akhirat diciptakan Allah sangat rupawan, bahkan menurut Mufassirin (Ahli Tafsir), kecantikan mereka 99 (Sembilan puluh Sembilan) persen dari kecantikan Miss Dunia yang cuma satu persen. Bidadari itu diciptakan dari cahaya, campur yakut dan zamrut, luluk dan marjan. Subhanallah cantiknya. Jika dibandingkan dengan para ratu dunia, apakah miss word atau miss kopi, miss universal, miss wortel ibarat intan dan batu biasa. Kecantikan miss-miss dunia dapat dilhat oleh siapa saja lewat gambar mereka yang disiarkan televisi tetapi kecantikan Miss Akhiarat

hanya dapat dinikmati oleh pemiliknya yakni penghunipenghuni surga, yakni para syuhada dan shalihin. “Bidadari-bidadari yang jelita, putih bersih di pingit dalam kamar rumah (55:72). Seakan-akan bidadari itu permata yakut dan marjan . Para bidadari itu sangat santun, menunduk pandangannya, tidak liar (55:56) Cerita bidadari bukan dongeng, tetapi janji Allah SWT kepada penghuni surga. Kisah kecantikan mereka itulah yang mengilhami iblis dan khannas menggoda manusia tertentu untuk memperlombakan para gadis dari berbagai bangsa dan Negara. Mereka boleh saja menikmati cantik molek gadisgadis dunia, tetapi mereka tidak bakal dapat menikmati gadis-gadis akhirat yang sangat jelita.

mimpin Syria untuk tidak hanya setuju senjata kimianya diawasi internasional, tapi juga bergabung dengan traktat yang melarang penggunaan senjata kimia,” kata Menlu Rusia, Sergey Lavrov. Dari Moskow, pemerintah Syr ia siap meny erahkan pasokan senjata kimia yang dimilikinya ke PBB. Proposal untuk menyerahkan senjata kimia Syria ke PBB pertama kali diajukan oleh Rusia. Syria menerima proposal tersebut setelah melakukan komunikasi dengan Rusia. “Kami menerima proposal Rusia atas dasar kepedulian kami terhadap rakyat dan keamanan negeri,” ujar Menlu Syr ia Walid al Moualem, seperti dikutip The Washington Post, Selasa. (ap/vn/ant/m10)

Longsor DiDairi ....

mulai dari desa Sopobutar hingga ke Dusun Meriah. Hal itu mengakibatkan lokasi sulit ditembus untuk memberikan bantuan. Kepala Badan Penanggulangan B encana D aer ah (BPBD) Dairi, Ir Maruli Barasa, yang dikonfirmasi mengatakan, pihaknya masih mendata berapa banyak rumah dan kerugian yang dialami warga terkait bencana itu. Maruli menambahkan, Dinas PU Bina Marga Dairi sudah menurunkan satu unit alat berat untuk membuka akses jalan yang tertutup material longsor agar bisa dilalui kendaraan. (a20)

Wagubsu Serahkan ....

melakukan tugas di Pulau Telo Kab. Nias Selatan. ‘’ Kepada keluarga, kami harapkan tetap bersabar dan tabah dan kita mendoakan agar almarhum diterima Yang Maha Kuasa,” kata Wagubsu dan mengucapkan terimakasih atas jasa-jasa almarhum yang sudah menunjukkan dedikasi kepada negara. Sebelumnya Kepala Badan Kepegawaian Daerah Provinsi Sumatera Utara Pandapotan Siregar membacakan riwayat hidup dan keputusan sementara Gubsu tentang pemberian pangkat anumerta kepada alamarhum Sutrisno yang lahir tahun 16 Januari 1958. Mulai bertugas di Biro Pemerintahan Setdaprovsu 1 Juni 1982 dengan pangkat juru muda (I/a) dan pangkat terakhir pengatur muda (II/ a).Almarhum meninggalkan seorang istri dan 5 orang putra dan putri. (m28)

Ada-ada Saja ....

poudsterling atau sekira Rp 76 juta untuk obsesinya tersebut. Uang tersebut untuk biaya operasi merubah hidung, bibir, operasi rahang, operasi bokong, dan memutihkan kulitnya selama 16 tahun terakhir. Tak itu saja, ia juga melakukan pemutihan bibir agar lebih mirip dengan tokoh idolanya itu. Seperti dilansir dari Daily Mail, Selasa (10/9), Herbert Chavez mengaku telah jatuh cinta pada sosok Superman sejak usianya lima tahun. Ia juga menggilai lakon Clarke Kent di dunia nyata. Ia kerap berjalan di sekitar rumah dengan gaya bak Supermen atau Clarke Kent dan secara berkala menggunakan kosum lengkap Superman plus rambutnya jambulnya yang khas mirip huruf S. Herbert juga dikenal sebagai kolektor pernak-pernik Superman terbanyak sedunia. Koleksinya mencapai 5.000 buah. Pria pria berusia 35 tahun ini mengaku ingin mengajarkan moral yang baik pada anak-anak. (net/rzl)

Warga Haloban Tewas Dalam Ferry PULAU BANYAK (Waspada): Seorang penumpang KMP Teluk Singkil, Idawati, 39, warga Haloban, Kec. Pulau Banyak Barat, Kab. Aceh Singkil, Selasa (10/9) tewas di kapal ferry dalam perjalanan dari Singkil menuju Pulau Banyak. “Almarhumah mengembuskan nafas terakhir sekira pukul 13:47 saat kapal berada hampir satu mil dari bibir pantai Pulau Banyak atau sekira 85 menit perjalanan,” ujar Dedi, ABK KMP Teluk Singkil . Informasi diperoleh dari keluarga, sebelum meninggal almarhumah baru pulang berobat dari RSUP Adam Malik Medan, karena penyakit tumor ganas yang menyerang lehernya. “Rencana mau dibawa pulang ke Haloban setelah dirawat di RSUP Adam Malik, namun Allah SWT berkehendak lain.Dia mengembuskan nafas terakhir di dalam kapal menuju Pulau Banyak,” kata Anhar, suami almarhumah. (cdin)

WASPADA Rabu 11 September 2013

Dugaan Korupsi Perjalanan Dinas Rp27 M Enam Anggota DPRD Langkat Diperiksa Dua Mantan Manager PTPN 2 Diperiksa STABAT (Waspada): Lanjutan penyidikan kasus dugaan korupsi perjalanan dinas para wakil rakyat di DPRD Langkat tahun 2012/2013 senilai Rp27 miliar, Kejari Stabat memeriksa enam anggota dewan. Kajari Stabat Hendri, SH, melalui Kasi Pidsus Ricardo Marpaung, Selasa (10/9) menyebutkan, enam anggota DPRD yang memiliki jadwal diperiksa yakni Tarsan Naibaho (PDK), Edi Bahagia (Fraksi Golkar), dua politisi Partai Demokrat Ade Khairina Syahputri dan Neddy S, Hasan Basri (PAN) dan Riska Purnawan (Hanura). Dari nama-nama tersebut dua diantaranya sudah diperiksa Senin (9/9), dua lainnya kemarin dan sisanya hari ini, Rabu (11/9). “Jadi satu hari ada dua orang yang diperiksa untuk jadwal saat ini,” kata Ricardo. Dalam kasus tersebut penyidik masih menetapkan dua tersangka yakni Sekwan SL dan mantan Sekwan SU. Sementara tersangka Sekwan telah mengembalikan uang Rp400 juta kepada penyidik dalam dua tahap sebelumnya. Mantan Manager PTPN 2 Kebun Sawit Seberang Kab. Langkat, DS bersama mantan Manager Distrik Rayon Utara PTPN2, AS, diperiksa penyidik Kejari Stabat sebagai tersangka, Selasa (10/9). Keduanya memenuhi panggilan penyidik setelah panggilan pertama sebelumnya tidak hadir. Pantauan Waspada, keduanya terlihat diperiksa di Ruang Intelijen dan kemudian di Ruang Pidana Khusus Kejari. Salah seorang tersangka menolak memberi keterangan kepada wartawan. (a03)

40 Menit Terbang ....

gu sistem lainnya,” katanya. Menurut Eko, setelah kembali ke bandara, pesawat akan dicek ulang kondisinya. Biasanya tersumbatnya air itu banyak faktor, bisa jadi tersumbat karena tisu dan pempers. Kondisi ini juga sudah pernah dialaminya. Namun, setelah dilakukan pengecekan dan perbaikan, pesawat sudah bisa kembali berangkat setelah kondisi mesin diperiksa secara menyeluruh. Disinggung tentang mengapa pilot harus diganti, Eko menjelaskan, dalam kondisi ini sang pilot bisa saja tidak diganti jika jam terbangnya masih bisa untuk melanjutkannya. ‘’ Tapi, jika jam terbang pilotnya sudah lewat, akan diganti dengan pilot lainnya untuk menerbangkanpesawat tersebut,’’ katanya. Furqonis, seorang Calhaj Kloter 1 sekira pukul 15.40 mengabarkan kepada Waspada, pesawat GA 3101 yang membawa mereka menuju Arab Saudi, tiba-tiba memberikan pengumuman, pesawat akan kembali lagi ke KNIA, karena ada gangguan teknis. “Ganggaun yang disebutkan oleh petugas itu karena

persediaan air di pesawat ada masalah, jika perjalanan diteruskan selama 7 jam mendatang, khawatir persediaan air akan habis. Akhirnya kami kembali lagi ke KNIA, dengan menaruh prasangka baik saja,” kata Furqanis melalui telepon selulernya yang menyebutkan pesawat take of pukul 14.00, dan kembali mendarat pukul 14.55. Hingga pukul 17:30, dia bersama rombongan masih berada dalam pesawat.Pukul 18.30 , telepon selulernya sudah tidak aktif. Calhaj lainnya Ibrahim Daulay, membenarkan jika peristiwa mendaratnya lagi pesawat mereka kemarin siang. “Janji pihak penerbangan hanya satu jam sejak kami mendarat kembali pesawat akan selesai perbaikannya, tapi sudah lebih satu jam,” kata Ibrahim yang menyebutkan pihak penerbangan memberikan perhatian serius kepada Calhaj. Terkait hal ini, Sekretaris Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan, Hasful berharap tidak ada masalah terkait hal itu. (m32/m43)

Gubsu Lepas ....

bisa berpartisipasi dalam pembangunan di daerah ini,’’ kata Gubsu dan mengimbau, semua jamaah waspada cuaca ekstrim di tanah suci Makkah. ‘’ Suhu di Madinah sekitar 42 derjat Celcius, dan dikhawatirkan suhu cuaca di Makkah akan lebih tinggi.Namun, memasuki bulan haji,wajahwajah kerinduan terhadap Rasulullah, wajah-wajah kerinduan hadir ke rumah Allah SWT tentunya tidak menyurutkan langkah jamaah meski cuaca di sana ekstrim,” kata Gubsu. Sementara itu, anggota Komisi VIII DPR RI, Hasrul Azwar mengatakan, pihaknya mengawasi 13 titik embarkasi di Indonesia, diantaranya

Medan, Palembang, Jakarta, Aceh dan lainnya. “Pemantauan kami juga bukan hanya saat jamaah berangkat tetapi saat di tanah suci. Kami berharap, petugas yang melayani jamaah haji dapat secara maksimal dalam bertugas,” kata politisi PPP itu. Ketua PPIH Embarkasi Medan Drs H Abd Rahim, M.Hum menjelaskan, jamaah kloter pertama asal Medan yang diberangkatkan berjumlah 440 orang. Jumlah jamaah laki-laki sebanyak 185 orang dan 255 jamaah perempuan. “Keseluruhan jamaah Embarkasi Medan hingga Kloter 16 sebanyak 6.663 jamaah, “ ujarnya. (m37/m50/m40/h02)

Akhirnya Tabungan ....

lalu, kami berdua seolah belum percaya bisa berangkat tahun 2013 ini. Pasalnya, sejak itu keuangan saat berjualan ada mengalami penurunan. Tapi suami saya meyakinkan saya bahwa keuangan akan baik-baik saja dan Allah akan memberikan jalan terbaik pada kami yang sudah bercitacita menunaikan ibadah haji. Alhamdulillah saat waktu pembayaran pelunasan, kami bisa membayarnya lagi sehingga positif untuk berangkat,”katanya yang sempat waswas namanya termasuk Calhaj yang terpangkas karena quota haji dikurangi. Penduduk Jln Brigjen Katamso Gg Pandu ini berharap keberangkatannya ini mendapatkan berkah dan mampu

melaksanakan serangkaian ibadah haji hingga tuntas. “Kalau untuk kesehatan alhamdulillah hasil tesnya baik, tapi semua kehendak Allah SWT, seperti jamaah lainnya kami akan pasrah dan ikhlas untuk melaksanakan rukun Islam kelima ini. Semoga di tahun berikutnya banyak para pedagang seperti kami yang melaksanakan ibadah haji, berkat rajin menabung dan niat untuk menunaikan ibadah haji. Hal yang pokok, niat dan usaha serta meningkatkan amalan wajib dan sunnat,” kata Yusnida Tanjung sesaat sebelum memasuki ruangan Madinatul Hajj Asrama Haji sebelum ber tolak ke Kuala Namu Internasional Airport bersama rombongan. (m37)

Pembahasan ....

Ketua DPRK Aceh Tamiang Rusman yang memimpin siding, begitu melihat situasi sudah memanas langsung menutup sidang. Seharusnya pembahasan dilanjutkan, Selasa (10/9), namun tidak bisa dilanjutkan, walaupun Sekdakab Aceh Tamiang Razuardi sudah hadir, karena untuk memutuskan layak atau tidak layak harus menunggu Bupati Aceh Tamiang Hamdan Sati pulang dari Jakarta untuk urusan dinas. Sebenarnya gelagat kurang “harmonis” sudah nampak pada sidang paripurna, Jumat (6/9) pekan lalu.Ketika itu hanya 12 anggota DPRK Aceh Tamiang dan Ketua DPRK setempat Rusman yang hadir pada sidang tersebut. Sedangkan pihak eksekutif yang hadir Wakil Bupati Aceh Tamiang Iskandar Zulkarnain dan sejumlah SKPK. Ketika itu, anggota DPRK

Aceh Tamiang, Mansur Arbi, T Insyafuddin, Saiful Sofyan dan Juanda meminta Ketua DPRK menunda sidang dan pihak Banggar DPRK Aceh Tamiang harus duduk kembali dengan pihak eksekutif untuk menunjukkan data-data tentang belanja langsung dan belanja tidak langsung. Pada sidang tersebut disepakati antara DPRK dan eksekutif duduk kembali pada Senin (9/9) dan Selasa (10/9) untuk menyelesaikan KUA-PPAS. Namun pada pertemuan, Senin (9/9), eksekutif tidak bisa menunjukkan data-data hasil verifikasi yang diminta pihak DPRK Aceh Tamiang, sehingga muncul kericuhan. Ketua DPRK Aceh Tamiang Rusman dan Sekdakab Aceh Tamiang Razuardi menyatakan untuk menuntaskan persoalan bantuan sosial ini tentu saja harus menunggu keputusan dari Bupati Aceh Tamiang. (b23)

ke tanah suci dari KNIA,” ujarnya. Koordinasi Salah seorang Co Pilot pesawat maskapai dalam negeri dan luar negeri, Eko Septiadi ketika dimintai komentarnya via telefon selula menjelaskan, secara prosedur jika terjadi kerusakan apapun di dalam sistem di pesawat seorang pilot tetap harus berkoordinasi terlebih dahulu dengan pihak bandara, apakah dilanjutkan atau tidak penerbangan tersebut. Apalagi, dalam hal ini terjadi kerusakan yang mengakibatkan tersendatnya aliran air di dalam pesawat. Pada kondisi ini, kita juga harus melihat, jika untuk penerbangan pendek kemungkinan akan dilanjutkan penerbangan. Tetapi, jika penerbangan jauh seperti keberangkatan haji yang memakan waktu 9 jam lebih, sudah bisa dipastikan pilot harus kembali untuk melakukan perbaikan dan pengecekan pesawat. “Ka n t i d a k m u n g k i n selama perjalanan yang jauh ini penumpang tidak menggunakan air, selain itu apakah kerusakan itu ada menggang-

serta stakeholder yang mendukung pelaksanaan pemberangkatan haji Embarkasi Medan. Gubsu dalam sambutannya mengingatkan petugas Kloter agar melaksanakan tanggungjawabnya dengan baik, memberikan perhatian pada jamaah yang memerlukan bantuan khususnya kepada paramedis. ‘’ Berangkat ke tanah suci dengan niat yang ikhlas, jangan lupa turut mendoakan agar Provinsi Sumatera Utara tetap kondusif, di mana saat ini adanya keinginan Sumut menjadi sentra ekonomi bagian utara, dan semoga menjadi haji yang mabrur dan

Sejak kecil saya mendambakan bisa melaksanakan ibadah haji baru kini tercapai,”kata Yus yang dikenal masakannya enak terutama kepala ikan gulai. Dia menambahkan, berniat melaksanakan ibadah haji harus diimbangi dengan kesungguhan untuk menabung uang dari penghasilan berjualan setiap harinya. Awalnya hanya seribu dua ribu, tapi semakin hari terus ditingkatkan. Setiap hari harus ada celengan khusus untuk haji. Dengan kewajiban menabung itulah, akhirnya bisa terkumpul sampai cukup untuk membayar setoran awal. “Itupun saat membayarkan setoran awal tahun 2009

Kamal.Rapat dipimpin Ketua DPRK Aceh Tamiang Rusman. Kericuhan memuncak ketika pihak eksekutif menyatakan dari 3.000-an proposal yang masuk untuk mendapat bantuan sosial dan hibah tahun anggaran 2013, hanya 587 proposal yang layak diberikan bantuan sosial. Anggota Banggar DPRK Aceh Tamiang Mansur Arbi menanyakan data hasil verifikasi tersebut ,siapa yang layak dan siapa yang tidak layak.Namun tidak bisa ditunjukkan pihak eksekutif. Akibatnya Mansur Arbi “naik darah”.Eksesnya Mansur Arbi menjungkirbalikkan meja di ruang Banggar DPRK Aceh Tamiang. Bukan Mansur Arbi saja yang emosi melihat kinerja pihak eksekutif, anggota dewan lain juga “mengamuk” dengan memecahkan gelasgelas di atas meja.


Sumatera Utara

WASPADA Rabu 11 September 2013

B3

Lubang Menganga Tunggu Korban SIBOLGA (Waspada): Badan jalan Suprapto Kota Sibolga kondisinya saat ini sangat memprihatinkan, karena hampir seluruh badan jalan yang persis berada di dekat Makorem 023/ KS Kel. Pancuran Gerobak telah dipenuhi lubang. Lubang menganga ini dibiarkan dan kini terus menunggu korban. Menurut sejumlah warga sekitar kepada Waspada, Selasa (10/9), kondisi badan jalan itu sebelumnya beberapa waktu lalu hanya terdapat beberapa lubang kecil di tengah jalan.”Namun karena masih seringnya badan jalan ini dilintasi sejumlah kendaraan berat, maka lubang berubah menjadi besar. Bahkan, hampir seluruh badan jalan saat ini telah dipenuhi lubang,”kata warga. Selain itu, lanjutnya, karena banyaknya badan jalan yang berlubang saat musim hujan, selalu

digenangi air sehingga air yang berasal dari badan jalan itu muncrat dan terkena ke sejumlah rumah yang juga digunakan untuk berdagang.“Tentunya, akibatnya jualan kami menjadi terkena muncratnya air kotor,” keluh para warga. Ironisnya, sambung warga, sebelumnya Kadis PU kota Sibolga pernah berjanji akan menambal sulamsejumlahjalanyangberlobangdikotaSibolga termasuk Jalan Suprapto. “Namun, yang kami sayangkan badan jalan ini makin parah saja, tanpa ada-nyaperhatiandariDinas PU,”ujarparawarga. Untuk itu, mereka berharap kiranya pihak Dinas PU kota Sibolga dapat memberikan perhatiannya untuk memperbaiki badan jalan yang rusak itu. Dikuatirkan, badan jalan yang berlubang bisa mengakibatkan kecelakaan, terutama saat musim hujan. (cpol)

Afriya, Bangga Jadi Utusan Paskibraka Ke Istana Negara Waspada/Poltak Tarihoran

BADAN Jalan Suprapto Sibolga persis di depan Makorem 023/KS yang dipenuhi lubang.

Usut Penggunaan Anggaran DPRD Madina Rp84 Miliar PANYABUNGAN (Waspada): Sejumlah kalangan mendesak Kejaksaan Negeri Madina segera mengusut penggunaan anggaran anggota DPRD Madina 2011-2013 mencapai Rp84 miliar, sementara hasil kerja dinilai minim. Desakan ini antaralain disampaikanMPOMapacasSumut Jangga Siregar, SH, melalui sambungan telefon, Selasa (10/9), setelah membaca berita Waspada tentang oknum anggota de-

wan pemalas, sementara anggaran yang mereka gunakan tergolong besar. Diasangatmenyesalkankalau anggotadewanhanyabersenangsenang menghabiskan uang

Napi Di Madina Tidak Terprovokasi PANYABUNGAN (Waspada): Para napi di Lapas Kelas II-B Sipagapaga Panyabungan, Kabupaten Mandailing Natal (Madina) tidak terprovokasi adanya kerusuhan di lapas lain. ‘’Suasana di lapas sampai saat ini tetap terkendali penuh kekeluargaan,’’ujar Kalapas II-B Sipaga-paga Panyabungan, Arif Rahman kepada Waspada, Selasa (10/9), terkait adanya pemindahan tujuh tahananan asal lapas II-B Salambue Padangsidimpuan (tahanan asal LP Labuhanruku) yang bentrok baru-baru ini di Lapas Salambue. Arif menjelaskan, para napi asal Lapas Salambue sampai ke Lapas Panyabungan Minggu dinihari sekira pukul 01.30 dengan pengawalan ketat aparat kepolisian. Sebelum diantar ke kamar sel tahanan, para napi didata dulu di bagian registrasi, kemudian diberi pengarahan supaya napi pindahan tidak melakukan perbuatan melanggar hukum. Dengan bertambahnya 7 napi kiriman ini, jumlah warga binaan di Lapas Panyabungan saat ini menjadi 332 orang. Dengan demikian LP Kelas II-B Sipagapaga sudah over kapasitas, karena kapasitas Lapas Klas II-B Panyabungan ini hanya 300 orang. Terkait pengamanan lapas, Arif mengatakan, sudah semakin baik dengan dibantu aparat kepolisian dan TNI. (c14)

Satu Dari Tiga Tersangka Perampok Mobil Uang Diringkus TEBINGTINGGI (Waspada): Pelaku perampokan bersenjata api terhadap mobil perusahaan jasa pengangkutan uang, G4S (Gruop Four Securicor) yang membawa uang Rp141.733.500 saat melintas di Jalan Lintas Tebingtinggi - Pematangsiantar tepatnya Afdeling I, Perkebunan Gunung Para, Desa Sei Kelembak, Kec. Dolok Merawan, Kab. Sergai dua bulan lalu akhirnya tertangkap. Berdasarkan informasi, Selasa (10/9), satu dari empat pelaku ditangkap petugas Sat Reskrim dan Intelkam Polres Tebingtinggi, Kamis (29/8) malam, sementara tiga lainnya masih diburon. Tersangka RA, 32, warga DesaBambanDusun15,Kec.SeiRampah, Kab. Sergai diamankan petugas saat menonton televisi di rumah bersama tiga anaknya. Sedangkan istrinya Siti Asiyah, 34, sedang ke luar mengutip uang angsuran. Sebelumnya teman pelaku sempat menembaki mobil G4S dikemudikan Roni Simatupang, 34. Riki pengemudi sepedamotor sempat ditabrak dan terseret beberapa meter. Tersangka terjatuh dan terseret mobil, lalu kabur naik sepedamotor pelaku lainnya dengan berbonceng empat. Setelah mengalami luka akibat ditabrak mobil korban, beberapa kilometer dari TKP pelaku lainnya menghadang perjalanan Irawadi, 37, Kepala Desa Kalembak Kec. Dolok Merawan yang mengendarai sepedamotor dinas, Suzuki Thunder BK 2299 Z dan melarikannya untuk kabur. Pengakuan Riki, tiga orang rekannya yang sedang buron adalah warga Aceh Timur. Pertama Andi, 40, kedua Awi, 40, dan satu lagi aku tak tahu namanya. Ketiganya warga Aceh Timur,” sebut Riki. Hasil interogasi petugas kepolisian diketahui tersangka Riki pernah menjadi anggota TNI AD namun karena desersi (lari dari kesatuan), dia dipecat lewat sidang Mahmil (Mahkamah Militer) Medan.“Tahun 2005 saya disersi sepulang tugas operasi di Aceh,” kata tersangka.(a11)

ICMI Paluta Gelar Seminar Peran Ulama Memberantas KKN GUNUNGTUA (Waspada):IkatanCendikiawanMuslimIndonesia (ICMI) Kab. Padanglawas Utara (Paluta) akan menggelar seminar nasionaltentangperananulamadancendekiawanmuslimdalamupaya memberantas korupsi, kolusi dan nepotisme (KKN). Seminar tersebut dilaksanakan di aula Masjid Raya Gunungtua, Selasa (17/9). Menurut Ketua ICMI Paluta Ustad Hakim Muda Harahap didampingi Biro Humas TP Harahap SPd, seminar tersebut digelar gratis dengan menghadirkan pembicara yang kompeten untuk membicarakan tentang peranan ulama dan cendekiawan muslim dalam upaya memberantas KKN. “Seminar sehari ini mengundang berbagai pihak terkait baik aparatur penegak hukum maupun unsur pemerintahan, diharapkan bagaimana komitmen dan peran para ulama maupun cendikiawan turut andil dalam upaya mendukung menegakkan konstitusi dan gerakan anti KKN,” katanya. Dijelaskan, kegiatan ini diikuti sekira 200 ulama dan cendikiawan dan para pemerhati publik di wilayah Paluta. Bahkan, kegiatan ini merupakan pertama kalinya digelar di Kab. Paluta. (a35)

Rumah Kadis Tidak Ditempati STABAT (Waspada): Rumah Dinas Kadis Kesehatan Langkat di Jl. Palang Merah Stabat bertahun-tahun tak ditempati. Pantauan Waspada sepekan terakhir, setiap hari rumah itu kosong, padahal dilihat dari sisi bangunan sangat baik setelah direhab. Informasi diperoleh, meski rumah tersebut tidak ditempati, namun hampir setiap tahun dianggarkan untuk perbaikan dan rehab, tahun lalu lebih Rp300 juta. Masyarakat menilai anggaran besar yang dikeluarkan untuk rehab sia-sia karena tidak dihuni. Secara terpisah Kadis Kesehatan Langkat dr Gunawan, ketika dimintai tanggapannya, Selasa (10/9) siang mengatakan, jika ada acara rumah dinas tersebut sesekali ditempati.(a03)

rakyat, tanpa memiliki rasa tanggungjawab moral kepada rakyat yang memilihnya. Karena itu Jangga meminta supaya kejaksaan segera memeriksaanggotaDPRDMadinayang sudah lama bersantai tidak menjalankan tugas sebagai wakil rakyat. ‘’Terus terang, menurut saya, ini merupakan pengkhianatan kepada rakyat,’’ ujarnya. Dia mengaku kaget mengetahuianggaraaDPRD Madinasejak

2011-2013 yang mencapai Rp84 miliar,namunhanyamampumenyelesaikansatuperaturandaerah dari 14 yang diajukan Pemkab. Kepada Waspada, Jangga menyebut kan, akan mendorong Kejaksaan Tinggi Sumut memonitor kinerja Kejari Madina dengan harapan pengusutan penggunaan anggaran DPRD Madina ini dilakukan secara tuntas. Ketua Laskar Merah Putih Sumatra Utara Denny Nasution,

malah menyebutkan, hatinya miris membaca berita tentang kinerja DPRD Madina yang menghabiskan anggaran tidak sedikit tapi memiliki kontribusi yang sangat sedikit kepada rakyat. Malah dikatakan ada oknum anggota DPRD pemalas. “Kejari diminta mengusut penggunaan anggaran DPRD Madina Rp84 miliar yang digunakan kurun waktu 2011-2013,’’ ujar Denny Nasution. (a26)

Kemenkum HAM Diminta Evaluasi Pemindahan Napi PADANGSIDIMPUAN(Waspada): Kanwil Kemenkum HAM Provinsi Sumatera Utara diminta mengevaluasipemindahanNapi, mencegahkerusuhanyangmakin meluas di seluruh LP di Sumut, khususnyaLPKelasIIBSalambue Padangsidimpuan dan LP Kls II B Panyabungan. Permintaan sekaligus peringatanitudisampaikanKetua DPC Perhimpunan Advokat Indonesia (PERADI) Tabagsel H.Ridwan Rangkuti SH MH kepada Waspada, kemarin. Ridwan menyebut, kedua LP diWilayah Eks Tapsel sudah over kapasitas. ‘’Udah macam ikan

kaleng para Napi di dalam kedua itu,’’ katanya. Menurut advokat senior yang sering berkunjung ke dua LP Salambue dan LP Panyabungan,Napi berhimpitan di dalam kamar LP, belum lagi masalah sanitasi, air mandi, masalahmakanyangcukupmemprihatinkan. ‘’Napi lokal cukup bersabar menerima kondisi LP apaadanya.Janganditambahlagi dengan eks Napi luar yang dapat memicu kerusuhan kapan saja bisa terjadi,’’ ujarnya. Menurut advokat yang juga dosen Fak.Hukum UMTS Padangsidimpuan tersebut, tidak mungkin aparat kepolisian dan

PANYABUNGAN (Waspada): Afriya, siswa Madrasah Aliyah Negeri (MAN) Panyabungan Kab. Mandailing Natal, tentu saja sangat bangga bisa mewakili Provinsi Sumatera Utara menjadi Paskibraka ke tingkat nasional di istana negara Jakarta saat peringatan HUT ke-68 RI Agustus lalu. Kepulangan Afriya ke sekolahnya, kemarin, disambut hangat semua guru dan siswa MAN Panyabungan dengan acara pengalungan bunga. “Saya bangga bisa mewakili Sumut ke Paskibraka tingkat nasional. Alhamdulillah, mulai dari latihan sampai pengibaran bendera di istana negara berjalan dengan baik. Ini tentunya berkat doa semua warga Sumut, utamanya doa rekan-rekan siswa MAN Panyabungan dan guru-guru serta warga Madina,” ujar Afriya kepada Waspada di Panyabungan, Selasa (10/9). Dikatakan, dia bersama satu orang lagi yang mewakili Sumut, yaitu Opor Tunitas Hulu dari Nias berangkat ke Jakarta untuk mengikuti latihan 22 Juli lalu. Keduanya bergabung dengan 66 anggota Paskibraka dari seluruh Indonesia. “Kita dilatih di Cibubur empat hari lagi sebelum peringatan HUT ke-68 RI di istana. Kemudian 15 Agustus dilakukan upacara pengukuhan Paskibraka yang dihadiri Presiden RI Susilo Bambang Yudhoyono,” katanya. Terpilihnya menjadi Paskibraka ini juga sudah membawa Afriya dan semua anggota Paskibraka Nasional ke China, tepatnya di Beijing. “Iya, 24 Agustus lalu semua anggota Paskibraka berangkat ke Beijing, China. Kita di sana empat hari. Saya juga sempat membawakan tortor di hadapan masyarakat China mewakili Sumatera. Selain

itu, kita juga dibawa berkunjung ke universitas dan sekolah terkenal dan tempat-tempat olahraga di Beijing,” ucapnya. Sedangkan Kepala Sekolah MAN Panyabungan Irfansyah, S. Pd, MA mengaku bangga anak didiknya bisa berhasil menjadi Paskibraka Nasional. “Kita sangat bangga, siswa kita yang anak kampung dan berasal dari keluarga sederhanaberhasilmenjadiutusanProvinsiSumut Paskibraka Nasional. Keberhasilan ini patut kita syukuri, mudah-mudahan di tahun-tahun berikutnya ada siswa lain yang mengikuti jejak Afriya,” katanya Keberhasilan lain sekolah MAN Panyabungan adalah jumlah terbanyak siswa lulus ke perguruan tinggi negeri (PTN) se-Indonesia melalui jalur bebas testing (SNMPTN/Undangan) kalau dibandingkan dengan Sekolah Lanjutan Tingkat Atas (SLTA) di Kab. Mandailing Natal. Tahun 2013 ini, MAN Panyabungan berhasil mengantarkan 126 siswanya lulus di PTN seluruh Indonesia. Kemudian siswa MAN Panyabungan juga menjadi penggiring marching band saat HUT ke-68 RI di Kab. Mandailing Natal. Keberadaan marching band di sekolah ini memang sudah ada sejak 2011. Hal ini terlaksana berkat bantuan semua pihak, mulai dari orangtua, guru, Dispora sebagai pelatih dan instansi lainnya. Tahun ini MAN Panyabungan menerima 350 siswa dari 475 yang mendaftar. ‘’Mengingat daya tampung terbatas, tahun ini MAN Panyabungan dengan terpaksa tidak bisa menampung semua siswa yang mendaftar. Kita hanya menerima 350 orang, sedangkan yang mendaftar 475 lebih,” kata Irfan. (c15)

TNI ditempatlan selamanya di dalam LP tersebut. Diakuinya, selama ini kedua LP Salambue dan LP Panyabungan cukup kondusif, karena pada umumnya penghuni Napi dan tahanan titipan lokal, menghargai adat budaya dan saling menghargai sesama sebagai budaya turuntemurun di wilayah eks.Tapsel. Para Napi juga didalam kedua LP tersebut masih saling menghargai antara Napi senior dengan yang junior, Napi yang muda dengan yang tua, dan para Napi tersebut terjalin hubungan yang baik saling menghargai dengan sesama petugas LP. (a26) Waspada/Ist

Kemenag P.Sidimpuan Sosialisasikan Label Produk Halal Terkait Tuntutan Gantirugi Rp13 M AFRIYA, siswa MAN Panyabungan berjabat tangan dengan Presiden RI Susilo Bambang Yudhoyono saat upacara pengukuhan Paskibraka di istana Negara, belum lama ini.

P.SIDIMPUAN (Waspada): Kementerian Agama (Kemenag) Padangsidimpuan menggelar sosialisasi tentang kegunaan dan manfaat penting memperhatikan label halal pada produk yang dijual di pasaran atau pusat perbelanjaan. Sosialisasi digelar di Natama Hotel, Jalan SM Raja, Kel. Sitamiang, Kec. Sidimpuan Selatan, Minggu (8/9). Pesertanya terdiri dari para pengusaha, tokoh masyarakat, dan pengurus organisasi masyarakat (Ormas). Kasubag TU Kemenag Padangsidimpuan, Drs. Lukman Hakim Siregar, menyebut, label halal pada setiap produk makanan, minuman dan kosmetik, sangat penting untuk diperhatikan. Karena bisa mencegah konsumen dari benda-benda haram. “Jika sudah bersertifikat halal, secara agama kita sudah terhindar dari benda haram. Produk berlabel halal tersebut juga cukup baik bagi kesehatan,

karena bahan dan proses pembuatannya sudah memenuhi standar layak,” ujarnya. Lukman mengatakan, tema sosialisasi ini adalah mewujudkan mutu dan labelisasi produk halal, serta meningkatkan kesadaran masyarakat untuk mengonsumsi produk halal. “Masyarakat harus memperhatikan label halal dari produk makanan, minuman, dan kosmetik, atau yang berkaitan dengan pengkonsumsian untuk tubuh. Label halal akan menjamin kualitas positif produk tersebut terhadap kebutuhan tubuh kita,”katanya. Kepada seluruh peserta sosialisasi diharap dapat menyampaikan kepada masyarakat luas agar lebih memperhatikan label halal pada setiap produk yang akan dibeli. Sementara staf Seksi Produk Halal dan Pembinaan Syariah Kemenag Kanwil Sumut, Drs. Chairul Zen SAg, menyebutkan, memperhatikan label

halal pada suatu produk sangat banyak manfaatnya. Zen menyarankan kepada seluruh masyarakat, khususnya umat muslim, agar tidak mengkonsumsi produk yang tidak memiliki label halal. Tujuannya agar semua terhindar dari benda haram dan menyebabkan penyakit. “Cukup banyak produk tak berlabel halal di pasaran. Masyarakat kami minta agar lebih jeli, dan jangan mau membeli produk yang tidak ada label halalnya. Semua ini demi kebaikan kita bersama,” imbaunya. Ketua Panitia, Ali Sakti Dalimunte, menyebut peserta sosialisasi ini terdiri dari para pengusaha, tokoh masyarakat, dan Ormas Islam. “Semoga kita bisa mengambil hikmahnya. Pengusaha dan produsen, ke depannya setelah mengikuti sosialisasi ini diharap lebih memperhatikan dan mengutamakan produk berlabel halal,” harapnya. (a27)

Gota Ni Bayo Regar Madung Bontar HARGA karet di Kota Padangsidimpuan dalam sepekanbelakanganinimengalami kenaikan cukup signifikan dibanding sebelumnya. Namun, aroma pesimis dari celoteh warga di wilayah kebun karet Desa Pijorkoling, Pulo Bauk, Kec. Padangsidimpuan Selatan seolah hilang harapan. Para warga tak yakin harga getah tahun ini makin baik. “Gota ni Bayo Regar madung bontar (harga getah di tempat Bang Soleman Siregar mulai baik),” ujar Burhan Harahap kepada Waspada, Selasa (10/9). Untuk harga karet alam jenis harian saat ini Rp7 ribu per kg sampai Rp8 ribu per kg, naik dibandingkan sebelumnya berada di kisaran Rp6

ribu per kg. Sedangkan harga karet bulanan saat ini naik dari Rp10 ribu per kg menjadi Rp11 ribu per kg. “Paska lebaran ini harga karet mengalami kenaikan, jika dibandingkan dengan harga sebelumnya,” ujar Soleman Siregar, salah seorang pemilik penampungan karet rakyat yang ada di Kec. Padangsidimpuan Tenggara. Dijelaskan, adanya kenaikan harga karet tersebut membuat petani karet yang ada di daerah itu mulai bergairah, sebelumnya banyakpetanikaretyangmenunda penjualan karet menunggu membaiknya harga di pasaran. Setiap hari, Soleman mengaku mampu mengumpulkan hingga 10 ton, meningkat disbanding sepekan lalu hanya terkumpul 3-4 ton per hari. “Kemungkinanbeberapahari

ke depan akan lebih banyak lagi petani yang menjual hasil kebun mereka, karena harga saat ini kemungkinan untuk naik lagi sulit,” katanya. Sedangkan Paijo ,54, warga Desa Pulo Bauk saat ditemui mengaku sangat bersyukur dengan adanya kenaikan harga karet. Karena sebelumnya harga karet terpuruk di kisaran terendah terhitung setelah hari raya Idul Fitri. “Kalau dulu sampai Rp15 ribu per kg, kemudian jatuh di harga terendah sampai Rp2.800 per kg. Syukurlah harga karet saat ini sudah seimbangdenganhargaberas,”ujarnya, seraya berharap perkembangan harga komoditas tersebut akan lebih baik lagi. * Ahmad Cerem Meha

Kabag Tapem Tunggu Usulan PU

STABAT(Waspada):KabagTata Pemerintahan Kab. Langkat Rajanami mengemukakan pihaknya menunggu usulan dari Kadis PU, terkait adanya sejumlah warga yang menuntut gantirugi dari proyek pembangunan jembatan senilai Rp13 miliardiDesaPematangsentangKec.Tanjungpura. “Kita hanya bersifat menunggu permintaan dari pihak PU, bukan mutlak wewenang kita. Kemudian dikaji bersama untuk menentukan nominal uang yang wajar diberikan kepada warga penerima gantirugi,” katanya, Selasa (10/9). Kabag Tapem mengomentari masalah itu karena sebelumnya Kadis PU Langkat Bambang Irawadi terkesan‘buang badan’ dengan mengatakanmasihkordinasidenganpihakTapem.Padahal KabagTapem hanya menunggu usulan PU untuk

realisasi. Pembangunan jembatan tersebut disoal warga karena ada beberapa penduduk belum menerima gantirugi. Beberapa warga yang sudah menerima gantirugi di antaranya Syamsudin Rp38 juta karena beberapa bidang tanahnya terkena proyek pembangunan. Kemudian M. Nur Rp40 juta dan beberapa warga di seberang sungai dengan nominal bervariasi Rp5 juta hingga Rp20 juta. Sementara beberapa warga yang belum menerima uang ganti rugi dikarenakan terjadinya perubahan lokasi pembangunan jembatan beberapa meter. “Dampak berubahnya lokasi pembangunan, penerima ganti rugi juga tidak sesuai dengan nama-nama sebelumnya. Kami tetap minta ganti rugi,” kata Supra Yogi.(a03)

Empat Pelaku Curanmor Diamuk Massa DOLOKMASIHUL (Waspada): Empat motor dan mengotak-atik. Saya datangi tapi MS tersangka pelaku pencurian kendaraan lari dan stang sepedamotor sudah tak terkunci,” sepedamotor (Curanmor) babakbelur diamuk imbuh Hermanto. massa setelah kepergok mengotak-atik Selanjutnya korban bersama warga mengesepedamotor, Senin (9/9) malam sekira pukul jarnya dan setelah tertangkap langsung dihajar, 22:00 di Dusun II, Desa Pertambatan, Kec. Dolok termasuk tiga teman pelaku yang berada di sekitar Masihul, Kab. Serdang Bedagai. lokasi hiburan hajatan. Ke empat tersangka MS, 35, warga Dusun Tapi kepada Waspada MS di Mapolsek Dolok I, Desa Pertambatan, Kec. Dolok Masihul, MY, Masihul berkilah, dia bersama teman-temannya 22, warga Jati Sari III, Tanjung Sari, Kec. Padang hanya duduk di atas sepedamotor dan menonton Tualang, Kab. Langkat, RH, 25, warga Jl.Tempulik, hiburan keyboard. Binjai Barat, serta SH, 24, warga Jl. Pacul Serdang Kapolsek Dolok Masihul,AKP. Darwin Ketaren Rejo, Kab. Langkat. menyebutkan ke empat tersangka berikut barang Selain empat tersangka, personil Polsek Dolok buktidiamankandiMapolsekDolokMasihul.(c03) Masihul juga menyita dua sepedamotor pelaku yakni Suzuki Satria FU BK 6978 PAL, Yamaha Vixion BK 3576 RV, sepedamotor korban Suzuki Shogun BK 4489 OE, serta satu kunci leter T milik para tersangka. Korban Hermanto, 35, warga Dusun II, Desa Pertambatan kepada Waspada di Mapolsek Dolok Masihul, Selasa (10/9) menuturkan, malam itu dia dan istrinya menghadiri undangan pesta pernikahan, dan sepedamotornya diparkir di depan rumahmertuanyadenganposisi stang terkunci. “Usai undangan saat Waspada/Edi Saputra menuju pulang saya melihat KAPOLSEK Dolok Masihul, AKP Darwin Ketaren menginterogasi MS berada di atas sepedake empat tersangka yang sempat dihajar massa.


B4

WASPADA

1 CM Rp. 13.200 1,5 CM Rp. 19.800

2 CM 3 CM

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC BR CL ND DB

: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window

PROMO PALING MURAH !! XENIA, Pick Up 9Jt an, Terios Baru, Pasti Untung, Showroom Medan. Hady 0813 6033 3609

DAIHATSU INDAH

XENIA........................DP 29 Jt-an, Angs 2 Jt-an TERIOS... .... ......... ....DP 30 Jt-an, Angs 2 Jt-an GRANMAX PU........DP10 Jt-an, Angs 2 Jt-an Proses Cepat & Ready Stock 0852 9777 8255

REZEKI DAIHATSU BARU

XENIA DP 27 JT......Angs 2,7 Jt TERIOS DP 29 JT.....Angs 3.4 Jt PICK Up DP 10 JT...Angs 2 Jt-an Hub. 081 2643 9678 / 0812 6767 9555

DIJUAL

DAIHATSU FEROZA Special Edition Thn 1995. Hub : 0821 6070 0900, 085 6626 2662 DAIHATSU 100 % BARU

Xenia DP 30 Jtan Angs 3Jtan Gran Max Pu Dp 12 Jtan Angs 2,5 Jtan Terios All New. Hub. Alemmina.s ( 0821 6509 0004 )

DAIHATSU PROMO SEPTEMBER CERIA All New Xenia, New Terios, GM PU, Luxio, Sirion Angsuran Mulai Rp. 2 Jt-an. Hub. Jambak Astra 0853 2083 8585 D A I H A T S U PA K E T H E B O H Full Discount Granmax Pickup Dp 9Jtan, Xenia Dp 20 Jtan, Terios Dp 30Jtan, Proses Cepat dan mudah. Hub. Hasibuan ASTRA : 0 8 1 2 6 3 6 2 4 6 3 4

# PROMO ASTRA DAIHATSU #

- Granmax PU 1.3 Std DP 9 Jt-an Angs. 2,6 Jt (48 bln) - All New Xenia 1.0 D DP 26 Jt-an Angs. 2,7 Jt (36 bln) - All New Xenia 1.3 X DP 38 Jt-an Angs. 3,1 Jt (36 bln) Hub. ARIF NASUTION 0812 6005 2465 SALES SENIOR ASTRA DAIHATSU

DAIHATSU HILINE Pick Up Warna Hitam Thn 92. Body Mulus, Siap Pakai, Hub : 0852 6135 4779

Rp. 26.400 Rp. 39.600

4 CM 5 CM

Rp. 52.800 Rp. 71.500

HONDA CIVIC 2003. BK 5 QG. Satu tangan dari baru. Hub : 0821 6399 3022

DIJUAL TOYOTA KIJANG JANTAN Thn 91. Warna Hitam Metalik, Ac Double, Power Window, Bk Medan, Tinggal Pake, Tanpa Perantara, Harga Nego, Hub. 0813 6135 7361

ISUZU PANTHER Grand Deluxe Thn 1995. Terawat, Jok Kulit, Power Window, Hub : 0852 6132 0200

T OYO TA AVA N Z A M B T I P E G . W . H i t a m , Th 2008. TOYO TA HILUX Pick Up Warna Hitam, Th 2009. Mbl Sehat. Dijual Salah Satu. Hub Hp. 0 8 1 3 6 2 1 2 2 3 3 9

NISSAN FRONTIER Double Cabin Thn 2003 4x4. Solar, W. Hitam, Hrg 147 Jt Nego. Bk Mdn, Sangat Mulus, Siap pakai. Hub. 0852 9777 9004

NISSAN TERANO SPIRIT S2 M/T Thn 2005. Hitam. Plat BB. Rp. 115 Jt. Hub : 0853 7089 9893

NISSAN MARCH M/T Thn 2011. Silver, Bk Mdn, Rp. 115 Jt. Hub : 77471599 PROTON SAGA 1.3 M/T Thn 2009. Hijau Met, Bk Mdn, Rp. 81 Jt. Hub. 77863981 SUZUKI MOBIL BARU READY STOCK ERTIGA, SWIFT, APV, Pick Up, Splash, Hadiah Langsung, Satria FU, Diskon Mantap + Bonus Service s/d 70rb KM, Dp/Angsuran Ringan. Hub : MAHYU 0821 6323 5812 / 0812 6055 5700 SUZUKI 100 % BARU DEALER RESMI - CARRY PU FD DP 12 Jt / Angs 2,5 Jtan - APV Mega Carry DP 20 Jtan / Angs 2,6 Jtan - APV Arena Gl DP 28 Jtan / Angs 4,2 Jtan - Ertiga Dp 38 Jtan / Angs 5/4 Jtan Hub. Ridwan Siregar 0813 6143 7654

SUZUKI Karimun Thn. 2000 dijual. Harga 64Jt Nego. Hub. 0813 7676 7656 SUZUKI APV Type Gl Thn 09/10. W. Hitam, Ac, Tape, Vr, Br, Bk Asli Mdn, Sgt Mulus, Original, Tinggal Pakai, Pemakai 118 Jt/Damai. Hub. 0813 7618 8118

DAIHATSU TAFT ROCKY Thn 94. Bk Mdn Asli 4 x 4. Pajak Baru di bayar, Mobil Original, Warna Biru, Mobil Siap pakai dan Sangat Terawat, Jl. Gaperta Gg. Pembangunan No. 52 B. 0812 6049 2216

ERTIGA .......DP 40 Jtan / angs 3,5 Jtan APV PU........DP 20 Jtan / angs 2,5 Jtan CARRY PU ...DP 15 Jtan / angs 2,5 Jtan Hub : H E R I 0 8 1 3 7 6 4 5 1 5 6 7

Thn 1997. Hijau, Ac, Cd + Tv, Harga/Nego. Hub : 0853 6132 4294 / 0823 6342 3546

DIJUAL CEPAT

HONDA FREED Thn 2010 PSD. Putih Mutiara, Harga Nego. Hub. 0813 6223 9657

Rp. 85.800 Rp. 100.100

SUZUKI BALENO Thn 98. Hijau Met, Mobil Terawat, Mulus, Harga Nego. Hub : 081 2606 0435

DAIHATSU FEROZA Th 94. Merah Maroon Metalik, Lengkap, Terawat, Siap pakai, Hp. 0823 7006 7110

HONDA CIELO “VTEC”

6 CM 7 CM

HONDA JAZZ IDSi Matic Thn 2006. Abu - Abu Met, Bk Mdn, Rp. 115 Jt. Hub : 0812 6594 2789

# SUZUKI BARU TERMURAH #

SUZUKI KARIMUN Thn 99/2000. W. Silver, Lengkap, Siap Pakai, Bk Mdn. Hp. 0821 6080 2009

SUZUKI CARRY 1.0 Minibus Thn 2004. Biru Met, Plat BE (Boleh Terima Plat BK). Kondisi Istimewa, jarang pakai. Hub. 0812 6332 0389

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

8 CM Rp. 114.400 9 CM Rp. 138.000

DIJUAL

TOYOTA GREAT COROLLA Thn 95. W. Hitam, Bk Mdn, Siap Pakai, Lengkap. Hp. 0821 6080 2009 DIJUAL

TOYOTA COROLLA DX Thn 1983. Wrn Merah, Vr/Br, Ac, Tape, Bk (2 Angka), Medan, Baru Perpanjang, Kondisi Terawat, BU/Harga Nego. Peminat Serius Hub : 0813 7029 3924 0831 9764 9090

BURSA

RENTAL MOBIL PT. NAMIRAH RENT A CAR

Melayani Antar Jemput Medan<-> Bandara Kuala Namu. Nb. Tarif Murah. Hub. 0812 6410 0774

BURSA

SERVICE/ASSESORIES

DO RE MI JOK MOBIL KHUSUS AVANZA/INNOVA/ RUSH/TERIOS/XENIA Rp. 1.350.000,Jok (model press) + Alas

TOYOTA NEW AVANZA G Th’12. Wrn Putih, a/n Sendiri. Mobil Ctk, 1 Tangan dari baru, Rp. 156 Jt. Depan Kampus UISU No. 200. 0815 3373 3688 / 7851402

TOYOTA FORTUNER G DIESEL Th’08. Manual, Hitam Metalik, Pajak panjang, Rp. 269 Jt. Jl. Sm Raja No. 200. 0812 6038 5555 / 7851402 TOYOTA INNOVA G Bensin’08. Manual, Wrn Silver Metalik, Pakai Tv, Power, Subwofer, Ban Besar, Velg Racing, Ac Double Blower, Mbl Istimewa, Rp. 176 Jt. Depan Sekolah Eria No. 200. 0821 6767 7000 / 7851402

TOYOTA YARIS Type J Th’11. Manual, Wrn Merah, Pajak Panjang, Mobil Ctk Sekali, Rp. 147 Jt. Hub : 0812 64880389

Hubungi:

DO RE MI JOK MOBIL

JL. S. PARMAN BLOK DD No. 3-4 (DEPAN ST. THOMAS 2 MEDAN) Telp. 061-4522123, 0812 6550 123, 061-6639123 JL. MAKMUR No. 10 A, MEDAN (MASUK DARI JL. ADAM MALIK / JL. KARYA) TELP. 061-6639123, 6636123, 0812 6550123

TERCECER TERCECER

STUK. Bk 9355 BY. No uji : MDN 67141-A. A/N : PT. Sarana Baja Perkasa. Alamat : Jl. Kota II No. 20 Medan. Merk : Mitsubishi

BERITA HILANG

TOYOTA KIJANG NEW KRISTA DIESEL Th 2000. Biru Langit, Sehat, Cantik, Plat Mdn (Pjk 10-11). Ban Baru. Hrg 103 Jt/Ng. Hub. 0813 7031 7111

TOYOTA BARU 100 %

TERCECER

Dapatkan Special Harga dan Penawaran terbaik dari Kami Seputar Toyota anda. Telah hadir New Kijang Innova, Fortuner, Rush. Hub : Anwar Damanik 0823 7088 0815 TOYOTA 100 % BARU

Ready Stock Semua Tipe Toyota. Proses Cepat, Dalam & Luar Kota. Hub. Citra 0813 6144 3222

TOYOTA KIJANG G Thn 1996. Velg Racing, Warna Biru Metalik, Ac, Bk Mdn, Hrg 62 Juta Nego. 0823 6323 9955 DIJUAL TOYOTA STARLET 1,3 SEG CAPSUL 95/96. Biru Met, Body Original, Ac, Cd, Br, Vr, Alarm, Lengkap, Pjk Panjang, Hub : 0852 6162 2800 TOYOTA RUSH Thn 07/08. W. Silver, Jok Kulit, 3 Baris, Ac Double, tape, Vr, Br, Sehat, Sgt Mulus, Jarang pakai, Ass All Risk/pemakai, 153 Jt/damai. Hub. 0853 6182 2458

TIMOR DOHC Thn 98. W. Hijau, Bk Medan, Siap pakai. Hp. 0821 6080 2009

BUTUH DANA SPESIALIS DANA CEPAT Proses 3 Jam Cair, Tanpa USaha, Surat Terjamin, Jaminan : SHM, SK Camat, HGB, BPKB Mobil, Spd Mtr, Truk, Mobil Kredit/ Over Leasing, Bantu Pelunasan BPKB, UP : Family Finance : Bpk Ray 0813 7044 6633.0813 7044 6668

BPKB Bk. 6617 XF. a/n : Kusnadi. Lk. 07 Kel. Rengas Pulau Medan

TERCECER

BPKB Bk. 1739 JW. a/n : RITA RIFIN. Jl. Logam No. 20 Medan TERCECER

STUK. Bk 8828 CG. No uji :AB.01.000644. A/N : Cipta Boga Pratama. Alamat : Jl. Kl. Yos Sudarso No. 209 Medan. Merk : Mitsubishi

TERCECER

STUK. Bk 8478 BA. No uji : MDN 00348 C. A/N : Manjit kaur. Alamat : Jl. Jemadi No. 14/ 231 P.Brayan Darat. Merk : Mitsubishi

KEHILANGAN / TERCECER

Satu Asli Buku Sertifikat Hak Milik No. 442/ Medan Estate. AN. Sjariar Sandan, SH.

Bagi yang menemukan akan diberi hadiah HILANG / TERCECER

Asli Salinan Akte Hibah No. 38 Atas Nama Sutiyah Tanggal 23 Juni 2008. Dibuat Notaris Abidin S Panggabean. Asli Salinan Akte Hibah No. 41 Atas Nama Sukanto Tanggal 23 Juni 2008. Dibuat Di Hadapan Notaris Abidin S. Panggabean

LOWONGAN KERJA

STUK. Bk 9111 BI. No uji : MDN 55447 A. A/N :Cika Widjaja. Alamat : Jl. Timur No. 29/ 12 D Medan Timur. Merk : Mitsubishi

PERGURUAN ISLAM AS-SYAFI’IYAH INTERNASIONAL MEMBUTUHKAN :

1. KEPALA SEKOLAH - WAKIL KEPSEK - GURU (TAMAN KANAK - KANAK ) 2. PEGAWAI PERPUSTAKAAN (wanita)

TELAH TERCECER / HILANG

SYARAT : A. LULUSAN S1 B. MEMILIKI LAPTOP C. MAMPU BERBAHASA INGGRIS D. DAPAT MENGOPERASIKAN POWER POINT E. MEMILIKI KENDERAAN SENDIRI F. BERPENAMPILAN MENARIK G. LAMARAN DITULIS TANGAN H. PENGALAMAN 2 TAHUN I. USIA MAX 35 TAHUN J. SEHAT JASMANI DAN ROHANI K. PASPHOTO 3 X 4 = 2 LEMBAR KIRIMKAN LAMARAN LENGKAP KE JL. KARYA WISATA II NO. 1 MEDAN JOHOR

IJAZAH/TRANSKRIP S1 UMSU A/N MUHAMMAD DANDY PERMANA. Yang menemukan Hub. 0823 6284 9849. Tdk akan dituntut & Diberikan hadiah

TERCECER / HILANG Surat Tanah SK. Camat Medan Tuntungan No. 090/LEG/3/SKT/ MTT/1998 tgl 18 Mei 1998 an. MULIA BARUS. Hubungi Edward Sembiring, S.Sos 0813 9784 2930

DIBUTUHKAN Asisten Salon yang baik, jujur dan berpengalaman Bagi yg luar kota disediakan tempat Tinggal. Gaji + Persen + Makan Ditanggung, Lamaran di antar Langsung Ke Jl. Laksana No. 33 O, IC Salon 0813 7046 4074 LOWONGAN KERJA

Kami perusahaan yg sdg berkembang ,bergerakdi bdg Mechanical Electrical,membthkan karyawan/ti utk ditempatkan di posisi sbb : 1. Teknik jurusan Teknik Listrik (2 orang) 2. Teknik jurusan Pendingin/ Ac(2 orang) 3. Bagian lapangan (10 orang) Syarat : - Posisi 1 & 2 Lulusan SMK (diutamakan yang berpengalaman) - Posisi 3 min lulusan SMA/sederajat (pengalaman tdk diutamakan) Fasilitas : - Gaji pokok - Insentif - Tunjangan transportasi Lamaran ditujukan ke : CV NATURA AKARDUA Jln. Gagak Hitam / Ringroad, Depan Rs. Tere Margareth.Bagi yang berminat Hub Bp. Khairul No. Hp : 081260018511 Bp. Suwandi, ST No Hp : 081397842725

DIBUTUHKAN

2 orang Tukang pangkas yg berpengalaman, rajin, rapi, jujur, disiplin, jaminan 70 ribu. bagi yg lajang disediakan tempat tinggal. Hub Langsung pangkas pelangi depan BRI delitua. Hp. 0812 6968 1118

LOWONGAN KERJA

Kami Kontraktor Berskala Nasional sedang menangani proyek di Sumatera Utara Membutuhkan Segera : Project Manager (PM) Kualifikasi : 1. Minimal S1 T. Sipil 2. Berpengalaman minimal 6 Thn di Konstruksi jalan 3. Usia 35 - 50 thn 4. Mahir Komputer ( Ms Office dan Cad) 5. Menguasai Project Management 6. Ditempatkan di Lokasi Proyek 7. Mahir berbahasa Inggris 8. Bisa segera aktif di Lapangan (Lokasi Kerja) 9. Loyal dan berorientasi pada target 10. Kontrak Kerja Kirim CV Lengkap melalui email hrd@ptipp.com Sebelum tgl 21 September 2013 BURSA

PENDIDIKAN PROMO TAHUN AJARAN BARU (BELI 2 GRATIS 1) CARA BARU MAHIR KOMPUTER TANPA BUKU & TANPA KURSUS KOMPUTER

Office : Rp 55000 Membuat Toko Online : Rp 55000 Design Grafis : Rp 55000 3Dsmax : Rp 55000 Adobe Flash : Rp 55000 Membangun Jaringan : Rp 59000 AutoCad : Rp 60000 Visual Basic Net : Rp 60000 Menerima Pendaftaran Reseller/Agen di seluruh Indonesia Bagi Pihak Sekolah & Pihak Kampus ingin Kerjasamanya Bisa Hub Kami. Datang segera ketoko kami :

Jl. Marelan V Pasar II Barat Lingk III Terjun Gg Keluarga II No.10 Medan Jl. Pasar Nibung Perumahan Griya Indrapura Asri Blok C9 Kab Batu Bara HP : 0 8 1 3 6 1 4 0 1 0 1 8 / 0 8 7 7 4 4 7 5 5 9 3 7 w w w. e y h a n k o m p u t e r. n e t

KURSUS CEPAT MURAH LPK PAULINE

DAFTAR LANGSUNG BELAJAR WAKTU BEBAS Ms Word+Excel Rp 125(2minggu) Design Grafis Rp 500rb(1 bulan) Acad/3DMax Rp 300rb(10hari) Corel Draw/Photoshop Rp 100rb(2 minggu) TOEFL Rp 150rb JL. SEI BATANGHARI 170 Medan Telp 8442158

Info Pemesanan Iklan Hub. 0811 604 690

HARGA SUDAH TERMASUK PPN 10%

12 CM Rp. 198.000 6x6,6 kolom Rp. 132.000

TERCECER

BURSA LOWONGAN

Telah Hilang pada tgl 8 September 2013 Berupa : 1. 1 (Satu) buah BPKB Mobil Toyota Avanza No. Pol Bk 1829 Kw 2. 1 (Satu) buah BPKB Sepeda Motor Merk Honda No. Pol 4227 Es 3. 1 (Satu) buah BPKB Sepeda Motor Merk Honda No. Pol Bk 4621 UE. AN. Pemilik : Drs. Humala Pardede. Alamat Jl. Pelajar Timur Gg. Mawar Medan

TOYOTA AVANZA G M/T Thn 2011. Silver, Bk Mdn, Rp. 139 Jt. Hub : 0852 7538 3218

10 CM Rp. 154.000 11 CM Rp. 181.000

Rabu, 11 September 2013

FAX.4531010

UMROH DAN MANASIK HAJI 2014 MULTAZAM TRAVEL / KBIH

* Umroh Reguler 9 HR ( Pertengahan Dan Akhir Desember, Januari 2014) * Umroh Reguler 13 HR (Akhir Desember) * Umroh Plus Dubay (Februari 2014) * Umroh Plus Aqsha dan Jordania (Februari 2014) * Umroh Plus Turky 12 HR (Maret 2014) MANASIK HAJI MULTAZAM DI MULAI 12 JANUARI 2014

SETIAP HR SABTU : 14.00 - 16.00 WIB HR MINGGU : 09.00 - 11.00 WIB BERTEMPAT : MESJID AGUNG MEDAN JLN. PANGERAN DIPONEGORO SEGERA DAFTARKAN KE KANTOR PUSAT MULTAZAM JLN. TITI PAPAN / PERTAHANAN NO. 10 SEI SIKAMBING D MEDAN TELP. 061-4576116 FAX 061-4512319 HP. 0812.6495.8456 , 0813.6137.2321, 0852.0648.6301

BURSA

PROPERTY

Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

JUAL CEPAT

Rumah Di Jalan Letda Sujono Gg Sahlan. SHM, IMB, Model Minimalis, 310 Jt, Baru. Hub. 0812 6537 5666

RUMAH DIJUAL / OVER KREDIT

Komplek Mutiara Biru Blok I No. 1 Percut Sei Tuan / Kampung Kolam Deli Serdang +/- 30 Menit Ke KNIA. Balik Dp Rp. 63.000.000 Sisa 57 Bln x @Rp. 780.000. Hub. 081 2605 4080

KLINIK TERAPY/ ALAT VITAL

MAK EROT YANG TERUJI DAN TERBUKTI

Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ingin punya keturunan - Ejakulasi dini - Memperkencang & - Impotensi memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 - www.terapialatvitalmakerot.com

BURSA

MATERIAL

JUAL BATU PECAH & HOTMIX Sesuai Spesifikasi 1.Batu Pecah 3/4 : 1/2 : 3/8 : A. Batu 2.Hotmix : ACBC : ACWC. Hub : 0811 701 123, 68720764

BERTAHUN...BELUM SEMBUH...?

Tuntas Tak Kambuh Lagi...! Asam urat, Bengkak, Maag/asam lambung (akut), Syaraf terjepit, DM/Gula Basah (busuk)/ Kering, Stroke, Typhus, DBD, wasir, dll. Produk Kwalitas. Hub : Pak Ngadi Hp : 0813 7500 7177

BURSA

KESEHATAN

URAT SYAHWAT

RUMAH DIJUAL Komp. Villa Malina dipinggir Jl. Ringroad. Ukuran 8x15 Full Keramik SHM. Maaf TP. Hub. 0813 7560 6299 / 77880234

1. Impotent L. Syahwat (gula), kurang gairah/ keras, tambah besar & panjang 2-3-5 cm, ejakulasi dini, mani encer, telor turun, mandul, terbukti di tempat, permanen, aman, tanpa efek samping mahar 100 ribu 2.Urat terjepit, otot persendian kaku, mati rasa, angin duduk, mahar 50rb 3. Pagar badan, pelet, penglaris mahal 50rb 4.Pengobatan ghaib (ruqyah), membuang hasad dengki manusia, ilmu2 hitam, dll. 100rb 5. Buka aura, kewibawaan, penunduk, awet muda, murah jodoh/kerja, buang sial, dgn minyak panas, air raksa, samber lilin mahar 200rb 6. Ramuan “ Keperawanan agar rapat, legit, wangi, kesat, keputihan 300rb 7.Patah tulang, terkena guna, santet, narkoba, stress, siplis (raja singa), medis/ non medis, lainnya. 8.Memisahkan WI/PIL 9. Buka pintu ghaib, pandangan ghaib, silat ghaib, komunikasi dengan seluruh ghaib.

DIJUAL RUMAH BARU Jl. Tuba II Gg. Mesjid No. 10 b Medan Denai, Uk. 70 M2, Keramik, Sertf BPN, PLN, PAM, Harga Rp. 260 Jt Nego/ TP. Hp. 0821 6820 0775

DIJUAL RUMAH BESAR

Mewah Halaman, Super Luas, Tanah Uk. 30 x 50, Tembok Keliling ABCD di, Sertifikat. Uk. 30x36 M. Sertifikat Hak Milik, Bisa Buat Kantor, Tempat Manasik Haji dan Tempat Tinggal atau bangun Ruko Town House 13 Unit, 6 KT, 3 KM, 2 Garasi, 3 Teras, Listrik 2200 W, Air, Pam, dll. Di Jl. Purwosari No. 131 Mdn Dekat Cemara Asri dan Cemara Hijau. Harga 3,8 M Bayar. Hub : 0813 7748 9000

PA YONG SIKUMBANG

Jl. Pertahanan / Patumbak Taman Jasmin Mas No. A4 Amplas. Hp : 0812 604 1050 Flexy 061-7769 8634 Izin Kejatisu B-23/DSP 5/001/2008

RUMAH DIJUAL

JL. Flamboyan Raya Komplek Waikiki Blok E No. 7 Tanjung Selamat. Uk : 4 x 14 (SHM). Telp : 061 4533745, 06177577333

BURSA

KESEHATAN

BURSA

FOTO COPY

Siap pasang lebih hemat dari besi beton

TANAH

DIJUAL

LAHAN SAWIT BERPRODUKTIF Berumur 5 & 10 Tahun. Luas 42 Hektar. Surat Tanah SK Camat, Terletak Di Desa Sibito, Kecamatan Aek Natas Labura. Hubungi Hp : 0821 6272 2779

TANAH DIJUAL

LOKASI STRATEGIS Simpang Tiga Jl. Dahlia Raya No. 125 (Gudang Botot). Helvetia Tengah Uk. 16x30. SHM. 200 mtr dari polsek helvetia. Peminat Hubungi Langsung Tanpa Perantara. Hp. 0813 6038 3886 0852 7440 2333

KOLOM PRIMA ® Baja U-50 Siap pasang lebih hemat dari besi beton Produksi:

PT. HARI REZEKI KITA SEMUA Jl. B. Katamso No. 533 (Simp. Jl. Pelangi) Medan Tel. (061) 7878777-7878666 Fax. 7863433

BURSA

DIJUAL CEPAT

TANAH / RUMAH Uk 23,5 M x 59 M. L( 1.124 M2). Jl. Kota Pinang Aek Nabara Labusel. Harga Nego. Hub. 0831 9883 3450

PERABOT SPRING BED DIJUAL MURAH

BURSA

Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun

TRAVEL/ WISATA

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188 TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT F D C D

KIRIMKAN... DATA IKLAN MINI ANDA

DALAM B ENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243


Sumatera Utara

WASPADA Rabu 11 September 2013

B5

Sosialisasi FDT Minim, Warga Tuktuk Kecewa SAMOSIR (Waspada): Memasuki hari ketiga Festival Danau Toba (FDT) 2013, kalangan pedagangdiTuktukSiadongmengeluhkarenahasildaganganyangdiharapkanbisamemperolehlabalumayanternyatahanyaangan-angan,karenapengunjung FDT sepi pasca pembukaan FDT oleh Menko Perekonomian Hatta Rajasa, Minggu (8/9). Hal ini dikatakan pedagang marga Sidabutar kepada Waspada, Selasa (10/9) di warung makan miliknya sembari menambahkan, sudah biasa kalausetiapJumatsampaiMinggukawasanTuktuk memang tetap ramai, walau tanpa FDT. Pemuda Tuktuk Rikardo Sidabutar juga menumpahkankekecewaannyakarenadiamenilai kurangnya sosialisasi FDT. Dia mengaku ingin

mengikuti lomba pada FDT tapi tidak tahu kemana harus mendaftar, apa persyaratan. Dia mengaku tidak bisa memperoleh informasi. Demikian juga sejumlah jurnalis dari media elektronik mengaku kecewa atas kinerja even organisator(EO)yangdianggapkurangprofesional, termasuk dalam hal perubahan jadwal even yang dilakukan secara dadakan. Salah seorang jurnalis TV yang enggan ditulis namanya mengatakan, Senin (9/10), sekira pukul 13.00, Wamen Parekraf Sapta Nirwanda sempat marah kepada panitia atas adanya perubahan jadwal secara mendadak.Wamen marah setelah adanya laporan dari jurnalis terkait kinerja panitia FDT 2013. (c11)

Maling Kereta Dihajar Massa

Waspada/Edison Samosir

SALAHSEORANG peserta karnaval patung Sigale-gale ditampilkan untuk menghiasi acara FDT 2013. Peserta mulai bergerak dari Open Stage Tuktuk hingga Bukit Beta diikuti peserta dari Kab Karo, Samosir, Simalungun, Toba Samosir dan dibuka Wamen Parekref Sapta Nirwanda, anggota DPD RI Parlindungan Purba dan tamu lainnya.

Di P. Siantar, Simalungun Dan Asahan

Tiga Hari Listrik Padam PEMATANGSIANTAR (Waspada): Dengan dalih pekerjaan rutin tahunan di gardu induk dan pembangunan penyulang baru penguatan sistem jaringan distribusi dilakukan Unit Pelayanan Terpadu (UPT) PT PLN (Persero) Pematangsiantar, sejumlah daerah di Pematangsiantar, Simalungun dan Asahan mengalami pemadaman listrik delapan jam setiap hari mulai Rabu (11/9) sampai Jumat (13/9). Kepada Waspada, Selasa (10/ 9), Humas PT.PLN (Persero) Area Pematangsiantar, James Edwart Sirait di ruang kerjanya, mengatakan, pekerjaan rutin itu dilakukan di gardu induk Pematangsiantar pada Rabu (11/9) mulai pukul 09.00 sampai pukul 17.00. Akibatnya, lanjut dia, daerah-

Sedangkan pekerjaan di gardu induk Kisaran pada Rabu (11/9) menyebabkan kawasan Kisaran Timur, Kisaran Kota, Sei Dapdap, Pulo Bandring, Setia Janji, Rawang Panca Arga, Meranti, Tinggi Raja, Buntu Pane, Mandoge, Bosar Maligas, Ujung

Padang dan Air Joman di Kab. Asahanmengalamipemadaman. Sedangkan pekerjaan pada Kamis (12/9) dan Jumat (13/9), pemadamanaliranlistrikterpaksa dilakukan di daerah Kisaran Timur, Silo Laut dan daerah Air Joman.

“Manajemen PLN area Pematangsiantar menyadari, akibat pemadaman itu akan dirasakan ketidaknyamanan, untuk itu kami memohon maaf untuk seluruh masyarakat, instansi pemerintah, swasta, TNI dan Polri,” kata Sirait. (c16)

daerah Perdagangan dan sekitarnya, daerah Bangun Balata, daerah Rambung Merah, kawasan Jalan Medan, Jalan Asahan di Simalungun dan kawasan Kec. Siantar Timur, Kec. Siantar Barat dan Kec. Siantar Utara di Pematangsiantar akan mengalami pemadaman aliran listrik.

sepedamotor tetap hidup. Dengan menggunakan kunci T, HSS berhasil membukakuncistangkeretadanmenghidupkannya serta membawanya dari teras rumah. Namun, secara kebetulan ada warga yang melihat aksi HSS dan langsung berteriak maling. Sebentar saja, warga berdatangan dan mengejar HSS.Warga berhasil mengejar HSS yang berusaha lari ke arah Rambung Merah, sedang RJM sudah lebih dulu melarikandirihinggatidakberhasilditangkapwarga. Bogeman mentah dan tendangan melayang ke wajah serta tubuh HSS disertai caci maki. Akibatnya, seluruh wajah HSS bengkak akibat dipukuli massa dan kaki kanannya pincang.Warga akhirnya melaporkan HSS ke pihak kepolisian danberdasarkanketeranganHSS,pihakkepolisian melakukan pengejaran dan menangkap RJM di rumahnya serta menyita kereta yang digunakannya. HSS mengakui, sebelumnya sudah pernah melakukan pencurian dua unitYamaha Mio dari wilayah Simalungun. Dua unit sepedamotor itu dijualkepadapenadahnyadiMedandenganharga masing-masing Rp1.200.000. Kasat Reskrim Polres Pematangsiantar AKP Daniel SM, S.Ik melalui Kasubbag Humas AKP Efendi Tarigan, SH menyebutkan, dugaan pencurian kereta itu masih dalam proses pemeriksaan dan pengembangan, akan dilakukan penyelidikan terhadap pencurian sepedamotor yang belum terungkap selama ini. (a30)

Olah TKP Kapal Tabrakan Di Danau Toba Pencarian Korban Dilakukan Seminggu

Warga P. Siantar Ramai-ramai Gadaikan Emas PEMATANGSIANTAR (Waspada):Warga Kota Pematangsiantar ramai-ramai menggadaikan barang perhiasan emasnya di kantor Pegadaian. Warga memilih menggadaikan emas ketimbang menjualnya, karena mengharapkan harga logam mulia itu akan dapat naik nantinya. “Sekarang, kan, harga emas masih murah, daripada dijual, sayang, bagusan digadaikan saja dulu sambil menunggu kapan harga emas itu naik,” sebut seorang ibu guru, mengaku Nuraisyah Lubis,45, kepada Waspada di kantor Pegadaian kota di Pematangsiantar, Selasa (10/9). Menurutnya, harga jual emas di toko emas di kota itu, kisarannya Rp490.000sampaiRp510.000pergram.Sementara,adakemungkinan, harga emas akan mengalami kenaikan pada Oktober sampai November. Staf kantor Pegadaian, Situmorang, membenarkan, masyarakat masih ramai menggadaikan barang perhiasannya ke Penggadaian. Namun berapa besar peningkatan omset pegadaian sejak terjadinya penurunan pasaran emas beberapa bulan lalu sampai naiknya saat ini, staf tersebut tidak berani mengkomentarinya. “Kalau itu yang menjawabnya kepala (kantor), nanti salah,” sebut dia, sambil menambahkan kalau pimpinannya tidak berada di kantor saat itu. (c16)

PEMATANGSIANTAR (Waspada): Spesialis pencuri kereta (sepedamotor) antar daerah dan masih berstatus pelajar, HSS, 17, warga Jalan Sisingamangaraja, Gang Kasih, Kota Medan, tertangkap basah diduga melakukan pencurian sepedamotor hingga babak belur dihajar massa di Kota Pematangsiantar. Informasi dihimpun, HSS melakukan pencurian kereta itu bersama RJM, 23, alias Madi, juru parkir, warga Jalan Medan, Km 5,5, Kel. Tambun Nabolon, Kec. Siantar Martoba, Pematangsiantar di teras rumah pelapor, Prindo Erianja Purba, 23, mahasiswa, warga Jalan Sisingamangaraja, Kel. Asuhan, Kec. Siantar Utara, Pematangsiantar, Selasa (10/9) pukul 01:50. HSSmengaku,sebelumnyasudahmelakukan pencurian dua unit kereta dari wilayah Kab. Simalungun pada Senin (9/9) malam bersama abang kandungnya dan seorang teman mereka. Dua kereta itu sudah dibawa abang kandung HSS bersama temannya ke Medan. Sedangkan pencurian kereta itu dilakukan sesudah berputar-putar mencari sasaran dengan mengendarai Honda Supra X 125 BK 2810 ADU warna merah milik abang kandung HSS. Ketika mereka lewat dari depan rumah pelapor, terlihat satu unit Honda Supra X 125 BK 4107 TAI sedang diparkir di teras rumah pelapor. Sesudah melihat sekitar tidak ada orang, HSS segera turun dari kereta dan masuk ke teras rumah pelapor, sedang RJM menunggu dengan

Waspada/Mulia Siregar

GARDU induk PT PLN di Jalan Asahan Pematangsiantar terus mendapat pengawasan petugas pada sistem jaringan distribusi.

Siswa SMK Bunuh Abang BALIGE (Waspada): Seorang pelajar kelas III Sekolah Menegah Kejuruan (SMK) PP, 17, membunuh abang kandungnya Posman Panjaitan, 26, dengan sebuah balok kayu di rumahnya Dusun Janji Desa Pintu Batu Kecamatan Silaen Kabupaten Toba Samosir (Tobasa), Senin (9/9). Informasi dihimpun Waspada,Selasa(10/9),pembunuhan terjadi sekira pukul 13.30 wib saat adik kandung korban baru pulang dari sekolah dan melihat abangnya sedang asyik mendengarkan lagu melalui radio. Pada saat itu, tersangka merasa ter-

ganggu dengan suara radio yang keras sehingga spontan radio dimatikan dan akhirnya terjadi perdebatansengitdiantarakedua bersaudara ini. Tersangka langsung berlari keluar rumah dan mengambil balok kayu yang ada di dekat rumahnya dan mendatangi korban yang sedang tidur-tiduran di dalam rumah. Melihat hal itu, tersangka langsung memukul korban dengan kayu balok di bagian kepala.Korbanmeninggal duniasetelahsebelumnyadibawa ke Puskesmas. Kapolres Tobasa AKBP H Edi

SAMOSIR ( Waspada): Polres Samosir melakukan cek tempat kejadian perkara (TKP) tabrakan kapal ferry Tao Toba I dengan kapal motor (KM) penumpang bermerkYola di tengah perairan Danau Toba, Selasa (10/9). Cek TKP ini dilakukan untuk mengumpulkan informasi mengenai peristiwa tabrakan kapal, Minggu (8/9). Cek TKP dilakukan Kasat Pol Air Polres Samosir AKP J Sitopu, Kasat Reskrim AKP Andy Alfian, Kasat Narkoba IPTU B Manurung bersama nakhoda kapal ferry Jeremia Manurung, 64, nakhoda KM Yola Sandi Manurung, 23. Dalam rangka olah TKP, kedua nakhoda ferry Tao Toba I dan KMYola menceritakan kronologis saat terjadinya tabrakan kedua kapal tersebut kepada Kasat Pol Air dan Kasat Reskrim Polres Samosir. Kasat Pol Air Polres Samosir AKP J Sitopu bertanya kepada kedua nakhoda persis di atas perairan Danau Toba dengan kedalaman 125130 meter, di mana titik koordinat saat terjadi tabrakan, kemudian bagaimana posisi sewaktu tabrakan. Juga ditanya bagian mana dari kapal yang tabrakan. Nahkoda KM Yola Manurung menjelaskan kepada Waspada di atas Kapal Patroli KP 2018 milik Pol Air Polres Samosir, penumpang kapal yang dibawa merupakan penumpang wisata yang

berkunjung ke Samosir dan sesaat sebelum kejadian, mereka membawa penumpang kapal mengunjungi batu gantung kemudian keliling Danau Toba. Dia mengatakan, penumpang selamat 81 orang dan empat penumpang hilang tenggelam. Kasat Pol Air Polres mengungkapkan, pencarian korban hilang terus dilakukan tapi jika dalamseminggutidakditemukanakandihentikan. Dia mengakui, di dasar Danau Toba banyak tumbuhan lumut. Di sisi lain, demi kepentingan Festival Danau Toba, pemilik kapal ferry Tao Toba I sudah melakukan permohonan pinjam rawat kepada Kapolres Samosir yang dikuatkan dengan permohonan lisan dari Sekda Kab. Samosir Ir Hatorangan Simarmata agar kapal ferryTaoToba I bisa dioperasikan sampai 18 September, terang Sitopu. Kasat Serse AKP Andy Alpian mengatakan, kedua nakhoda kapal belum dijadikan tersangka karenakeempatkorbanhilangtenggelamdiDanau Toba belum ditemukan. Ditambahkan Sitopu, sesuai UU Pelayaran No 17 tahun 2007 , apabila kapal yang lebih kecil bertemu di tengah laut dengan kapal yang lebih besar, kapal yang kecil harus mengalah dan harus menghindar agar tidak terjadi tabrakan. (c11)

Fariady SH SIK MH yang dikonfirmasi wartawan melalui Kapolsek Silaen AKP Edi Suprianto melalui telepon selulernya membenarkan adanya peristiwa pembunuhan tersebut dan mengatakan motif pembunuhan hanya kesal saja melihat tingkah laku korban yang sering mengancam bahkan orangtuanya sendiri. Tersangka sudah berhasil ditangkap, karena kebetulan di lokasikejadianadaanggotaPolsek Silaenyangtinggal,sehinggabegitu mengetahuiadanyapembunuhan, langsungmelakukanpengamanan, kata Kapolsek. (a22)

PKK Harus Mampu Cegah KDRT Waspada/ Mulia Siregar

MASYARAKAT terlihat masih cukup ramai menggadaikan barang perhiasan emasnya di kantor Pegadaian kota, di Pematangsiantar, Selasa (10/9).

TANJUNGBALAI (Waspada): Keberadaan TP-PKK, khususnya di Kota Tanjungbalai, harus mampu meminimalisir kekerasan dalam rumah tangga (KDRT)

serta masalah ekonomi keluarga. “KasusKDRThinggaberakhir ke tingkat perceraian mengalami kenaikan. Penyebabnya, faktor diskriminasi terhadap perempu-

an, dan disharmonis antar anggota keluarga. Jadi, kita berharap, PKK mampu mencegah berbagai persoalan di keluarga,” kataWali KotaTanjungbalaiThamrinMunthe pada peringatan Hari Kesatuan Gerak (HKG) PKK ke 41 di pendopo rumah dinas kepala daerah Tanjungbalai, Selasa (10/9). MenurutWali Kota, meningkatnya angka KDRT ini, banyak dampaknya, terutama bagi perkembangan anak. “Kehadiran PKK di tengah masyarakat hendaknya memberi peran dalam meminimalisir KDRT, sehingga bisa mencegah gangguan perkembangan anak,” kata Wali Kota. Ketua TP-PKK Tanjungbalai Armaini Jannah menuturkan, dalam rangka peringatan HKG ke 41 ini, pihaknya menyelenggarakan berbagai perlombaan, seperti penangananKDRT,tertibadministrasi PKK, pemantapan pekarangan, UP2K, dan lomba pemanfaatan hasil tanaman obat keluarga. Kegiatanitujugadirangkaidengan tepung tawar 109 calon haji asal Kota Tanjungbalai. (a14)

Waspada/Ist

KASAT Pol Air Polres Samosir AKP J Sitopu, SH bersama Kasat Reskrim AKP Andy Alfian, Kasat Narkoba Iptu Manurung, wartawan Waspada Edison Samosir bersama nahkoda kapal ferry dan KM Yoga usai melakukan olah TKP ke tengah perairan Danau Toba, Selasa (10/9).

Dituding Salahi Penetapan Kapolres DS Diprapidkan LUBUK PAKAM (Waspada): Melalui kuasa hukumnya Budi Hartono Purba, SH, Ahamd Arpani, SH, Rohdalahi Subhi Purba, SH dan Feber Ando Sirait, SH, ketua kelompok tani (Koptan) Undian Bersatu, Kasirin, 42, warga Dusun IV, Desa Tadukan Raga, Kec. STM Hilir, Deliserdang mempraperadilankan (Prapid) Kapolres Deliserdang (DS) AKBP Dicky Patrianegara, S.Ik ke Pengadilan Negeri (PN) Lubukpakam, Senin (9/9). Sidang gugatan no: 04/Pra.Pid/2013/PN-LP dipimpin hakim tunggal Ahmad Samuar, SH. Sidang berlangsung tanpa dihadiri Kapolres mau pun kuasa hukumnya. Kasirin menggugat praperadilan Kapolri Cq. Kapoldasu Cq. Kapolres DS Cq. Kasat Reskrim Polres DS sebagai penyidik. Isi gugatan, Kamis (22/8) terjadi kerusuhan di lahan garapan Dusun IV, Desa Tadukan Raga, Kec. STM Hilir, di mana Koptan Undian Bersatu didatangi dan diserang Koptan Kerapatan mengakibatkan4lukadariKoptanUndianBersatu dansatutewasdariKoptanKerapatan,yaituJakson

Sitepu.Setelahperistiwaituermohonmenetapkan 4 tersangka dari Koptan Undian Bersatu, di antaranya Kasirin (pemohon praperadilan) dengan sangkaan melanggar pasal 170 ayat (2) ke-3 jo pasal 351 ayat (3), 55, 56 jo pasal 160 KUH Pidana. Kemudian Rahmat Tarigan alias Uces, Rugianto alias Heru dan Yudianto dengan sangkaan melanggar pasal 170 ayat (2) ke-3 jo pasal 351 ayat (3) jo 55, 56 dari KUH Pidana. Menurut Budi Hartono Purba, saat bentrok Kasirin sedang berada di rumah dan diberitahu Rahmat Tarigan alias Uces melalui telefon, yang mengatakan kelompok penyerang melakukan tindakan anarkis. Saat itu, Kasirin minta Rahmat Tarigan alias Uces segera meninggalkan lokasi. Akibat penangkapan dan penahanan yang tidak sah, maka pemohon dirugikan dengan tercemarnya nama baik pemohon serta tidak dapat bekerjanya pemohon untuk menghidupi keluarganya.(c02/a07)


Opini

B6 TAJUK RENCANA

Festival Danau Toba (Jangan) Jalan Sendiri

W

isata Danau Toba di Sumatera Utara berpotensi menyaingi ketenaran Bali dalam bidang kepariwisataan. Namun, harus ada penambahan pendukungnya agar Danau Toba mampu bersaing dengan Bali. Pidato Menteri Koordinator Perekonomian Hatta Rajasa usai membuka Festival Danau Toba 2013 di Open Stage, Samosir, Minggu lalu, sudah teramat sering didengar masyarakat. Namun dalam tataran implementasinya nol besar. Jangankan menyaingi Bali malah kondisinya semakin melorot dan sepi (memprihatinkan). Padahal, Pemprovsu juga sudah menjalin kerjasama lewat MoU dengan Pemprov Bali awal tahun lalu untuk saling membantu mengembangkan pariwisata di kedua daerah, namun tampaknya sampai saat ini tidak dirasakan oleh masyarakat di sekitar Danau Toba. Sebab, tingkat hunian hotel di Medan maupun di Danau Toba kelihatannya biasa-biasa saja, tidak terjadi peningkatan jumlah turis. Melihat data, turis yang datang ke Sumut, demikian diungkapkan Sekdaprovsu H. Nurdin Lubis, SH, rata-rata kunjungan wisman ke Sumut tiap tahunnya hanya berkisar 300 ribu orang, terpaut jauh dengan Bali yang tingkat kunjungan turis asingnya hingga 3 juta orang. Artinya, Sumut perlu kerja keras untuk menyaingi Bali di bidang pariwisata. Masalah atau kendala minimnya turis berkunjung ke Sumut atau Danau Toba sudah lama diketahui sehingga wajib diprioritaskan peningkatan infrastruktur, peningkatan sistem transportasi terutama penerbangan melalui Badara Silangit di Kabupaten Toba Samosir. Untuk Bandara sudah tak ada masalah lagi pasca perpindahan Ke Kuala Namu. Selanjutnya segerakan perbaikan sarana dan prasarana serta mengembangkan industri kreatif, sebagaimana diungkap Wamenparekraf Sapta Nirwandar, karena setiap wisatawan baik mancanegara maupun domestik akan mencari souvenir khas dari Danau Toba sebagai kenang-kenangan. Hemat kita, soal keindahan obyek wisata alam (Danau Toba), sejarah dan budaya Sumut unggul dari daerah-daerah lain. Namun semuanya itu tidak diberdayakan dengan optimal sehingga tidak begitu mendapat sambutan dari masyarakat internasional. Bahkan wisatawan lokal pun sudah malas ke Danau Toba. Kendalanya tidak pernah diselesaikan, sehingga tanpa kegiatan Pesta Intisari Danau Toba atau Festival Danau Toba kondisi Parapat dan sekitarnya sepi turis. Bahkan di beberapa kawasan bagaikan ‘’kawasan mati’’ Menu Festival Danau yang membuat industri wisata di sana bagaikan Toba 2013 perpaduan pepatah hidup segan mati tak mau. Jadi, tanpa keseriusan membenahi antara budaya dan olahkekurangan terkait wisata Danau Toba jangan raga sudah bagus hanya harap atau hanya mimpi di siang bolong Sumut bisa menyaingi Bali yang semakin kesohor di saja kurang dikemas, level internasional dengan pantainya, Kuta dan Sanur. kurang persiapan, kuBerulang-ulang diselenggarakan Pesta rang promosi Danau Toba dan sekarang menggunakan istilah Festival Danau Toba namun sambutan masyarakat dalam dan luar negeri biasa-biasa saja. Pada momentum hari pembukaan memang terlihat ramai namun kebanyakan para undangan, panitia, peserta opening ceremony berikut instansi terkait di kabupatenkota sekitar Danau Toba sehingga kelihatannya ramai pengunjung. Tapi, pada harihari berikutnya sepi penonton dan akan selesai begitu saja, seperti hari biasa di masa lalu. Kesan mendalamnya tidak dirasakan oleh masyarakat Sumut, khususnya para turis. Justru itu, mari kita belajar dari daerah-daerah yang sukses menggaet jutaan turis, seperti Bali, Penang, Kuala Lumpur, Singapura, Bangkok dll. Dari segi obyek wisata sebenarnya mereka biasa saja, namun dikemas secara profesional, sehingga para pendatang merasa senang dan terhibur selesai berwisata. Beda dengan mereka yang datang ke Sumut khususnya Danau Toba, sepulang dari sana yang membekas bukannya keindahan alamnya tapi hal-hal yang tidak mengenakkan, kelelahan karena jaraknya jauh, jalannya rusak, kebersihannya kurang, harga makanan mahal, sampai sambutan masyarakatnya kurang ramah. Sehingga yang diperlukan adalah manajemen pengelolaan Danau Toba sehingga mampu menampilkan kegiatan tahunan yang pasti jadwalnya, mampu menampilkan atraksi yang menyenangkan para turis dalam dan luar negeri, mampu menimbulkan kesan positif, sehingga tahun-tahun berikutnya mereka mau datang lagi alias tidak kapok, bahkan membawa rombongan yang jauh lebih banyak karena Danau Toba dikelola secara profesional. Bukan hanya ‘’syor sendiri’’ karena panitianya jalan sendiri, industri atau pelaku pariwisatanya jalan sendiri, masyarakat melihatnya amatiran walau biayanya mencapai Rp10 miliar. Menu Festival Danau Toba 2013 perpaduan antara budaya dan olahraga sudah bagus. Ada beberapa kegiatan yang dilakukan di antaranya festival Sigale-gale, World Drum Festival, permainan tradisional Marumpasa, paralayang tandem, renang mengelilingi danau dan lomba solu bolon.Hanya saja kurang dikemas, kurang persiapan, kurang promosi. Akibatnya kurang diminati masyarakat. Ke depan harus lebih profesional, teruji agar menjadi pesta rakyat yang diharapkan bisa mendukung dan menggairahkan industri pariwisata untuk meningkatkan kunjungan wisatawan ke Sumut, terutama kawasan Danau Toba.+

APA KOMENTAR ANDA SMS 08116141934

Faks 061 4510025

Facebook Smswaspada

+6285207752458 Wahai umat Islam di seluruh dunia ta’atlah kepada Allah dan mari kita berdo’a kepada Nya supaya Allah SWT mengutuk negara Amerika dan sekutunya yg menzalimi negara negara Islam spt Afganistan,Irak,Libya,Palestina,Mesir dan kini sudah mengancam Syria pula dgn alasan menggunakan senjata kimia,alasan yg sejak dulu dipakainya utk menghancurkan negara negara Islam, alasan yg tak pernah terbukti sampai sekarang.Ya Allah laknatlah pemerintahan Amerika dan sekutunya,amin.(mohon dimuat ya bp redaksi di “APA KOMENTAR ANDA”) Jazakumullah, Mawardi-KTP:1271110908520004. P.Masyhur-Medan Johor. +628197458978 Semoga Waspada tetap jaya. Semakin diurus pusat tunjangan propesi guru swasta semakin sembrawut.buktinya triwulan ke 2 sampai hari ini belum cair.katanya agar semakin lancar ditangani pusat.toh semakin sulit. +6283190544279 Waspada yth, membaca tulisan sdr SATIA NEGARA LBS tgl 23 08 2013 tentang JOKOWI, kayaknya bukan tulisan seorang intelektual/dosen pasca sarjana. Kami tdk tahu maksud dari tulisan tsb, begitu bencinya SNL pada JOKOWI, penampilan tukang bakso/by design lah dll. Apa ada maksud SNL jadi gubernur DKI berikutnya. Seorang intelektual/dosen janganlah bergaya preman/orang yg tdk terhormat. Heran kami anda bisa jadi dosen pasca sarjana lagi. Wass BGD MANATAR PALAS +6281397523453 CS nya. Apakah ini tidak cukup buat orang2 yg bermasalah segera sadar?.Mungkin hanya dagelan, tapi jika manusia tdk mampu mengambil pelajaran,alamat diri akan celaka” +6285361643055 Sipirok sampai SD Hole, koran waspada dulu tenar seperti berita yhuda. Tapi sekarang kalah oleh metro tabagsel. Kenapa ya, bisa begitu. = rahmad pane = +6283194817681 FARAO ‘S DEVIL==HA NTU FIR‘AUN , SEDANG MERASUKI TUBUH MILITER EGYPT== MESIR • INILAH BENCANATERBESAR PASCA NEGERIYANG DIS EBUT DIDALAM KITABUL QUR‘AN DENGAN ; MASHIR , TIDAK LAGI DIPEGAN G FARAO ‘S DINASTY== BANI FIR‘AUN • SETIAP MANUSIA , ADA PENGIKUT NYA DAN DI IKUTINYA HINGGA KE PINTU QUBUR • ITULAH HANTU • Kakanda-Adinda “memiliki” Hantu masing-masing • Hantu kita itu merupakan ; Sempalan dari unsur api di tubuh kita yang di sebut; Nafsu Angkara Murka (Berahi , Amarah , Ambisi) • Dan sa-at ini Hantu Fir‘aun sedang menggayuti Milite r + Polisi Negeri very-very old tersebut • Habissslah Ikhwanul-Muslimin disana !! YAA , MULKINAROBB MENGIDZIN KANNYA , SESUAI TAQDIR (Suratan Badan) !# all moslem solidarity ~ kr. sikameng # +6283194817681 SUDAHLAH BU KHOF (IFAH) ! LEGOWO SAJA LAH KITA ! PA‘ KUMIS KARWO ~ GUS “ANSHOR” IFOUL , memang masih di kehendaki oleh mayority Pemilih ! Bu Khof harus menguatkan asa , tetap opti mist hingga 5 tahun kedepan ! Kita coba lagi nanti untuk yang ke 3 kalinya • INSYA ALLAH , Bu Khof di idzienkan dan di ridhoi NYA ! Kita shobar kan diri kita • InnALLAHa ma‘ashshobirien ! TAWAKKALULLAH !”# all moslem solidari ty ~ kr. sikameng#

WASPADA Rabu 11 September 2013

Kecelakaan Lalin; Budaya & Hukum Oleh Dr Drs H.Ramli Lubis, SH, MM Ada anggapan di masyarakat kita, untuk merasa bangga sebagai orang tua ketika anak-anaknya bisa melakukan pekerjaan orang dewasa di usia dini,termasuk mengemudi kendaraan.

P

eristiwa kecelakaan lalu lintas (Lalin) maut yang seketika menewaskanenamorangdiJakarta seketika mengejutkan banyak orang. Khususnya orang yang menjadi tersangkaadalahAbdulQadirJadilani(Dul) anak di bawah umur (13 tahun) putra seorang artis kondang, Ahmad Dhani. Padahal sudah menjadi pemandangan biasa di negeri ini anak di bawah umur mengendarai kendaraan bermotor, baik sepedamotor maupun mobil. Ada semacam rasa bangga bagi para orang tua ketika melihat anaknya yang baru tumbuh itu sudah bisa mengemudikankendaraansendiri—suatu pekerjaan yang biasanya dilakukan hanya oleh orang dewasa. Tapi pada kenyataannya anak usia remaja yang belum cukup umur inilah faktorbahayadijalanraya.Merekaumumnya mengemudi dengan kecepatan tinggi tanpa perhitungan. Hal seperti ini tentu saja berbahaya tidak hanya bagi dirinya sendiri tetapi juga membahayakan orang lain. Tidak jarang kecelakaan terjadi karena kendaraan para remaja ini melaju dengan kecepatan tanpa perhitungan. Data dari Polda Metro Jaya menyebutkan bahwa angka kecelakaan lalu lintas yang melibatkan anak di bawah umur sejak tahun 2011 ke tahun 2012 naik sebesar 160 persen. Pada tahun 2011 terjadi 40 kasus, sedangkan pada tahun 2012 terjadi 104 kasus. Ini tentunya bukanlah hal yang bisa dianggap sambil lalu saja. Data ini harus dijadikan sebagai peringatan bagi semua orang tua agar tidak sembarangan membiarkan anak di bawah umur mengemudikan kendaraan. Baik bagi para orang tua, maupun aparat kepolisian yang bertugas di bagian lalu lintas untuk berlaku tegas terhadap para remaja pengemudi ini. Para remaja ini, meski secara fisik mungkin dianggap telah pantas, namun secara psikologis sebenarnya mereka

belum siap mengemudi di jalan raya. Dengan kondisi psikologis yang belum stabil, para remaja belum bisa mengendalikan emosi saat mengendarai kendaraan. Emosi seperti ini memungkinkan merekamengambilkeputusantidaktepat, karena perhitungan yang tidak matang. Masihminimnyapengalamanmereka berkendara menjadi faktor lainnya yang sangat menentukan di saat kondisi terancam kecelakaan. Pada detik-detik seperti ini, orang yang belum memiliki sikapmentalmatang akan cenderung keliru untuk mengambil keputusan. Mereka akan lebih banyak dipengaruhi oleh emosi daripada rasionalitas. Pada kondisigentingberkendara mereka sering bingung hingga banting setir seenaknya. Bagi para remaja, mengebut seringkali dianggap sebagai gengsi semata. Mereka akan merasa terangkat jati dirinya ketika bisa menarik perhatian orang lain. Mereka tidak menyadari kalau ada nyawa banyak orang yang harus dijaga selama berkendara. Apalagi bagi remaja yang postur fisik memang belum cukup kuat menanggung beban berkendara. Misalnya saja mengemudisepedamotor,makakakiyangmasih lemah dan belum cukup panjang akan menyulitkan untuk menahan beban saat motor dalam kondisi kurang stabil. Sama halnya ketika mereka mengendarai mobil, dengan tinggi badan yang

belum cukup, mereka belum bisa melihat jalan di depan dengan sempurna. Begitu juga dengan kondisi kaki yang apabila belum cukup panjang maka akan kesulitan menginjak pedal rem, gas, tombol, dan sebagainya. Budaya Dan Hukum Setidaknya ada dua hal yang ada di belakang masalah kecelakaan lalu lintas oleh anak remaja di bawah umur ini, yakni persoalan budaya dan supremasi hukum. Pertama, masalah budaya. Ada anggapan di masyarakat kita untuk merasa bangga sebagai orang tua ketika anak-anaknya bisa melakukan pekerjaan orang dewasa di usia dini, termasuk mengemudi kendaraan. Semakin muda usia si anak, semakin bangga orang tuanya. Hal tersebut entah sejak kapan menggejala,hinggacenderungdianggapsebagai budaya yang dianut di tengah masyarakat. Hal ini tentunya bukanlahsuatuyangbenar, karena semestinya para orang tua harus melarang anak-anaknya untuk berkendara sebelum usianya cukup. Namun tentunyainibukanlah hal yang sulit karena persoalantidakadanya kesadaran masyarakat dalam banyak hal adalah masalah yang sudah sejak lama membelit bangsa ini. Tapi bukan berarti hal ini tidak bisa dilakukan. Momen peristiwa seperti yang dialami Dul dan banyak peristiwa kecelakaan yang melibatkan anak di bawah yang terjadi secara sporadis di tanah air mesti bisa menjadi pelajaran. Karena peristiwa tersebut sejatinya adalah peristiwa yang mengancam kita sebagai pengguna jalan dan masyarakat pada umumnya. Harus timbul kesadaran bersama bahwa anak di bawah umur yang mengendarai kendaraan bermotor adalah pihak yang mesti “disudutkan”bersama,karenamerekaadalah “ancaman” bagi orang lain.

Kedua, supremasi hukum. Di dunia initidakadasatupunnegarayangmemberi izin pada anak usia 13 tahun untuk mengendarai mobil di jalan raya. Di Prancis, usia 16 tahun adalah usia termuda saat anak boleh mengemudikan kendaraan, dengan syarat ada orang yang menemani. Di Jerman malah, anak kecil yang menjadi penumpang mobil harus duduk di kursi khusus. Di Indonesia juga ada aturan untuk tidak memberikan izin berkendaraan bagi anakdibawahumur(remaja).Karenatidak memiliki izin maka semestinya mereka tidak boleh berkendaraan. Pasal 310 Undang-Undang (UU) No 22Tahun 2009 tentang Lalu Lintas dan Angkutan Jalan (LLAJ) serta peraturan yang tertulis dalam UU No 22/2009 tentang Surat Izin Mengemudi (SIM) di Pasal 281 adalah aturan yang memuat larangan anak di bawah umum berkendaraan. Tapi kenyataannya penegakkan hukum bagi pengendara ini masih sebatas insidental. Artinya kalau ada kecelakaan yang melibatkan anak di bawah umur seperti kasus Dul, maka baru kemudian polisimelakukanrazia.Padahalsemestinya, kalaupun tidak ada peristiwa kecelakaan seperti itu, sudah semestinya aparat keamananmenindak remajadibawahumur yang berani mengendarai kendaraan bermotor. Perlu penegakkan supremasi hukum dalam hal ini untuk melindungi para pengendara lainnya. Penutup Momentum kecelakaan maut Dul ini kiranya bisa menjadi perenungan semua pihak. Bahwa para orang tua tidak sepantasnya memanjakan anak-anaknya dengan membiarkannya berkendara sebelum cukup umurnya. Karena pada intinya perilaku itu adalah sesuatu yang menjerumuskan si anak sendiri dan berdampak pada orang lain. Pihak kepolisian lalu lintas sebagai pihak yang diberi amanah mengurus perlalulintasan, sudah semestinya bertindak lebih tegas terhadap anak di bawah umur yang mengendarai kendaraan bermotor. Agar banyak pihak yang bisa terhindar dari korban sia-sia karena kelalaian kita bersama. Penulis adalah MantanWakilWali Kota Medan.

Belajar Dari Kecelakaan Maut AQJ Oleh Mhd. Zahrin Piliang Ahmad Dhani hendaknya “dihukum” atas kelalaiannya mengasuh anak (pasal 30 dan 77 UU No.23 Tahun 2002 tentang Perlindungan Anak).Ahmad Dhani juga sudah menyepelekan putusan Pengadilan Agama karena “merampas” hak asuh

K

ita baru saja disuguhkan oleh sebuah kecelakaan maut yang menewaskan 6 orang di Jalan Tol Jakarta-Bogor-Ciawi. Kecelakaan itu melibatkan seorang anak berusia 13 tahun, AQJ, anak bungsu dari penyanyi pasangan Ahmad Dhani-Maia Estianty yang telah berpisah lebih dari 5 tahun. Peristiwa itu terjadi dini hari, sekitar jam 01.45, di mana AQJ baru kembali mengantar teman perempuannya dengan mengendarai mobil yang dikemudikan sendiri. Peristiwa kecelakaan yang mengerikan itu, patut menjadi pembelajaran bagi kita mengingat pelaku kecelakaan masih anak-anak, berasal dari keluarga kaya (musisi), kedua orangtuanya telah bercerai. Peristiwa itu terjadi di tengah malam atau dini hari, AQJ mengemudikan sendiri mobilnya—yang merupakan hadiah ulang tahun ke 13 dari Ahmad Dhani. Lebih dari itu, sang anak yang masih duduk di bangku kelas VII SMP tersebut sudah punya teman perempuan. Inilah sebuah gambaran anak metropolis kelas atas yang hidup dalam dunia glamour (life urban style); muda, kaya, dan punya pacar. Dan dtitonton oleh teman sebaya. Berangkat dari peristiwa kecelakaan maut itu, tulisan ini akan memusatkan perhatian pada pola pengasuhan anak di tengah arus kehidupan global yang cenderung hedonis-materialistik, dan “melupakan” dimensi tumbuh-kembang anak sesuai nilai-nilai etnisitas dan cultural yang tumbuh di masyarakat Indonesia. AQJ Adalah Korban Sekalipun AQJ adalah pelaku yang menyebabkan kecelakaan, tapi dari perspektif Perlindungan Anak AQJ sesungguhnya merupakan korban dari pola pengasuhan anak dan kebijakan negara yang tidak memertimbangkan kehadiran anak (dan masa tumbuhkembangnya)—dalam proses pembangunan dan dinamika global yang mengurung Indonesia. Dari sudut pola pengasuhan anak, AQJ terlahir dari situasi kultural kelas menengah-atas yang seluruh kenikmatan begitu mudah diraih, walau kenikmatan itu hanya pantas dirasakan orang dewasa. Perceraian orangtuanya, dan dampak sosial yang mengiringi hubungan anak dengan ibunya turut serta membentuk perilaku anak. Demikian pula pasca perpisahan kedua orangtua AQJ, ayahnya kemudian menjadi sorotan publik terkait lanjutan dari penyebab keretakan rumah tangga mereka—antara lain konon teman duet ibu AQJ telah melahirkan seorang anak yang ayahnya diduga adalah ayah AQJ sendiri. Pola kehidupan menengah-atas itu, tercermin juga dari tidak adanya kontrol dari sang ayah, ditandai peristiwa kecelakaan di tengah malam atau dini hari

itu. Peristiwa itu sekaligus menyatakan pada publik bahwa AQJ sudah biasa berada di luar rumah hingga larut malam, dan ayah AQJ tampaknya membiarkan keadaan itu beralngsung cukup lama. Kehidupan sebagai selebritis telah menyebabkan kehadiran orangtua tunggal dalam kehidupan anak-anak semakin berkurang kuantitas maupun kualitasnya. Arena bermain anak-anak tidak lagi sesuatu yang natural sebagaimana dirasakan anak sebaya mereka dari berbagai kalangan. Ruang publik atau fasilitas sosial untuk berinteraksi di tengah hutan beton Jakarta tak lagi menyediakan tempat-tempat bermain yang biasa ditemukan di tengah kaum menengah-bawah—seperti lapangan bola kampong, arena bersepeda, main layang-layang dan lain-lain. Ruang lingkup arena bermain AQJ sudah bergeser ke café, resto, dan mall. Jenis mainannya pun sudah berubah dari mobil-mobilan menjadi mobil sesungguhnya. Semua ini menjadi bagian yang tak terpisahkan dari proses tumbuh-kembang anak, seakan terlihat AQJ tumbuh lebih cepat dewasa dibanding teman-teman sebayanya. Selain itu, sesungguhnya Ahmad Dhani bukanlah orangtua yang memiliki hak asuh (hak hadhanah) sesuai putusan Pengadilan Agama. Hak hadhanah sebenarnya jatuh pada ibu AQJ, tetapi dengan berbagai alasan yang sulit diterima baik dari pertimbangan hukum, sosial, maupun agama, ayah AQJ menghalangi ibu AQJ untuk mengasuh ketiga anak-anak itu. Konon, baru setelah Ramadhan 1434 H ini AQJ bertemu dan mau menginap di rumah ibunya. Dengan demikian, AQJ adalah korban salah asuh orangtua tunggal. Karena itu, AQJ tidak sepenuhnya dapat disalahkan atas peristiwa ini. Negara Ikut Bertanggungjawab Negara ikut bertanggungjawab atas kecelakaan maut tersebut? Ya, karena negara lalai melindungi anak-anak Indonesia. Sekalipun UU No.23 Tahun 2002 tentang Perlindungan Anak telah berusia 11 tahun, tetapi apresiasi pemerintah pusat, terutama pemerintah daerah sangat minim. Kecelakaan yang dialami AQJ merupakan representasi dari sebagian besar anak-anak Indonesia yang hidup di perkotaan. Kebijakan ekonomi negara yang mengandalkan konsumsi domestik untuk mengejar pertumbuhan ekonomi secara langsung turut memberi pengaruh pada tumbuh-kembang anak. Usia SMP dan SMA adalah masa-masa pertumbuhan yang menimbulkan gerah dan gelisah di kalangan orang dewasa. Di hampir semua kota besar Indonesia -anak sekolah terpaksa menggunakan sepeda motor atau mobil untuk pergi ke sekolah, walau secara usia mereka belum diizinkan oleh Undang-undang.

Sementara pasar otomotif begitu gencar menawarkan pada konsumen berbagai kemudahan mendapatkan kendaraan bermotor, di lain pihak pemerintah lebih asik mengurus proyek untuk dikorupsi, dan abai akan perlunya transportasi publik, khususnya Bus Sekolah (school bus). Coba perhatikan, kota-kota mana di Indonesia ini yang tersedia Bus Sekolah yang memadai? Akhirnya, tidak ada pilihan lain, bertemulah rayuan pasar otomotif dengan kebutuhan rakyat akan transportasi di perkotaan. Persoalan tidak berhenti di situ saja. Pemerintah (dan orangtua) tidak sadar, pola mainan anak-anak sudah bergeser: Dari main layang-layang, bola, dan motor-motoran, ke arena balapan liar di tengah kerumunan banyak orang. Pemerintah lupa menyediakan fasilitas publik. Semua area kosong disunglap menjadi mall, pertokoan, dan hotel. Padahal dunia anak hanya ada di tiga tempat, yaitu rumah, sekolah, dan tempat bermain. Di saat anak-anak butuh perhatian, ternyata rumah tidak lagi surga yang diimpikan, sekolah tidak pula menawarkan tenaga pendidik yang ramah, dan lingkungan menyenangkan. Sedang tempat bermain telah dikapitalisasi menjadi pusat bisnis yang menyediakan kesenangan bagi orang dewasa. Tanggungjawab Hukum Hukum pidana kita tidak membenarkan pengalihan tanggungjawab. AQJ, suka atau tidak suka harus menjalani proses hukum dengan tuduhan pasal 310 ayat 3 UU No.22 Tahun 2009 tentang Lalu Lintas, dan terancam hukuman 6 tahun penjara. Walau AQJ berstatus anak, hukuman itu tidak bisa dialihkan pada orangtuanya. Hanya saja, itikad baik dari orangtua AQJ yang bertanggungjawab secara moril dan materiil terhadap korban kecelakaan itu turut menjadi pertimbangan bagi kemungkinan keringanan hukuman bagi AQJ— di samping, karena status AQJ adalah anak-anak, maka harus diberlakukan UU No.23 Tahun 2002 tentang Perlindungan Anak. Penjara bukan satu-satunya sanksi hukum yang dapat dijatuhkan pada AQJ. Bahkan, dari perspektif hukum sendiri, penjara bagi anak adalah pilihan terakhir. Masih banyak bentuk hukuman lainnya yang dipertimbangkan dapat memperbaiki AQJ ke depan. Kita berharap, apabila kelak kasus ini berujung di Pengadilan, Hakim hendaknya dapat menjatuhkan hukuman yang didasarkan pada kepentingan terbaik anak (the best interest of the child). Tetapi orangtua AQJ, Ahmad Dhani hendaknya juga “dihukum” oleh hakim atas kelalaiannya mengasuh anak (pasal 30 dan 77 UU No.23 Tahun 2002 tentang Perlindungan Anak). Selain itu, Ahmad Dhani juga sudah menyepelekan putusan Pengadilan Agama karena “merampas” hak hadhanah yang diberikan kepada Maia Estianty sebagai ibu AQJ. Selama “merampas” hak asuh dari Maia itu, ternyata pengasuhan anak itu telah menimbulkan kecelakaan yang tidak hanya menimpa diri AQJ, melainkan juga jiwa orang lain. Karena itu sangatlah pantas jika Ahmad Dhani juga “dihukum” oleh Pengadilan dengan memerintahkan pengasuhan semua anak diserahkan kepada ibu mereka. Apabila

perintah penyerahan pengasuhan itu tidak dilakukan, maka yang bersangkutan harus diberikan ancaman pidana sesuai ketentuan perundang-undangan yang berlaku. Penutup Kecelakaan maut yang dialami AQJ hanyalah salah satu potret buram dari anak-anak yang menjadi korban salah asuhan dari orangtuanya. Peristiwa ini harus menjadi pelajaran yang berarti baik bagi keluarga maupun negara, karena saat ini terdapat lebih 50 juta anak yang kelak akan menjadi orangtua baru dan sekaligus yang akan menjalankan pemerintahan di negeri ini. Orangtua harus menyadari, pola asuh zaman kita dulu, tidak bisa disamakan dengan pola asuh anak zaman sekarang. Tantangan dan peluang yang mereka hadapi jauh lebih kompleks dibanding 20-30 tahun lalu. Satu hal yang patut dicatat oleh orangtua, masa usia SMP dan SMA adalah kurun peralihan. Sebagaimana semua peralihan–transisi– pastilah menimbulkan gerah dan gelisah di kalangan orang dewasa. Anak seusia AQJ butuh pengakuan akan eksistensi dirinya. Di lain pihak, negara sebagai pemangku kewajiban harus menyediakan waktu mengurus pembangunan keluarga sakinah, mawaddah, wa rahmah; sekolah yang menyenangkan, dan tempat bermain bagi anak. Penulis adalah Ketua Komisi Perlindungan Anak Indonesia Daerah (KPAID) Sumatera Utara.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengandisertaiCDataumelaluiemail: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkandiMediamanapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Gubsu pantau apel pagi, banyak pejabat terlambat - Maklum pak, udara dingin! * Wagubsu: Sumut berdaya saing, jika didukung media - Yo lah Pak Wagub, he...he...he * Lahan pertanian di Sumut menurun - Menurun berganti perumahan

oel

D Wak


Opini

WASPADA Rabu 11 September 2013

B7

Larangan Kampanye Melibatkan Anak Namaku Terabaikan Guru? Sebenarnya, apa sih artinya menjadi guru? Beberapa orang mengatakan guru pejuang (pahlawan) tanpa tanda jasa. Sebagian orang mengibaratkan guru bak pelita, penerang insan dalam kegelapan.Yang lain menuturkan guru pembimbing manusia mewujudkan cita-cita atau impian. Dalam tafsirku, definisi guru demikian berbeda. Setidaknya, dalam kasus diriku, yang kualami dan kurasakan. Mengapa begitu? Jamak guru yang tidak mengenalku. Jangankan mengakrabiku, sekedar ingat namaku saja, tidak? Padahal, guruku beberapa kali mengabsen dan memanggil namaku di kelas. Guruku tetap saja alpa terhadap wajah dan namaku. Ini kusadari, terutama ketika ada ujian praktik misalnya, guruku menanyaiku lagi–siapa namamu nak? Pupus sudah keinginanku untuk disapa dengan nama panggilanku (nama kecilku), konon lagi nama lengkapku? Mungkin, itu semua gara-gara kekurangaktivanku dalam mengikuti pelajaran guru sehingga aku terlupakan? Barangkali juga lantaran ketidakpintaranku? Atau bisa jadi karena ketidakcantikanku? Sederetan tanda tanya lainnya bercokol di kepalaku? Namun, wajarkah guru mengabaikan nama murid, yang diajarnya selama setahun– bahkan lebih? Bagaimana mungkin bisa seorang guru sukses mengajar sedangkan mengabaikan nama murid yang diajarnya? Sungguh, saya prihatin dengan kondisi ini. Apakah nama mereka siswa pintar saja yang tertanam di benak guru? Jangan sampai yang pintar terus dipuja sehingga merasa kian besar kepala alias takabur, sebaliknya yang tak pintar dicela sampai kian tersudut. Apalagi, standar guru menilai kadang membingungkan siswa. “Saya tidak hanya sekedar menilai hasil ulangan kalian, tapi juga mengamati tingkah laku kalian sehari-hari. Sehebat apa pun lancarnya otak kalian bak Central Processing Unit/CPU komputer, perangai kalian sangat menentukan.” Petuah seorang guru pada awal tahun pelajaran. Nyatanya, beberapa siswa yang dalam persepsi rekan (siswa lain) termasuk tidak berbudi baik, tapi dalam pandangan guru nilai ujiannya selalu tuntas, melebihi Kriteria Ketuntasan Minimal (KKM), dia atas nilai 75. Sebaliknya, sebagian siswa yang nilainya rendah dalam ponten guru, di bawah KKM. Rupanya, di mata banyak siswa terkenal berakhlak baik. Jadi, di mana letak kebenaran wejangan guru seperti di atas? Apakah cara pandang guru dan siswa berbeda dalam menilai, pintar–bodoh, baik–buruk? Kurasa inilah di antara akibat kealpaan sebagian guru mengingat nama siswa. Kelalaian itu juga menyebabkan guru sulit memahami tabiat siswa. Dampaknya lagi, guru keliru dalam membubuhi nilai yang pantas buat siswa. Walhasil, para siswa pun mencap sebagian guru, sebagai guru yang pilih kasih–tidak adil? Meskipun begitu, tak ada niatku dalam tulisan ini hendak merendahkan harkat guru. Aku ingin selalu menghormati para guruku, baik mereka yang masih mengingat namaku maupun barangkali mereka yang telah melupakan namaku. Tanpa mengurangi rasa hormatku pada para guru, kiranya guru dapat memanggil nama siswa, tidak hanya namaku, tapi juga nama rekanku!

Oleh Yulhasni Sejak berakhirnya Orde Baru,kampanye selalu jadi wilayah paling krusial diperdebatkan.Tentu ini terkait tampilan luar kekuatan Parpol, sehebat apa mereka mampu memobilisasi massa

T

erobosan penting dibuat oleh KPU soal regulasi kampanye. Menjelang pesta demokrasi 2014 mendatang, tentu saja berbagai peraturan harus dibuat. Salah satu yang saya kira penting soal pelibatan anak-anak di dalam kampanye. Seperti diberitakan, KPU merevisi peraturan nomor 1/2013 tentang kampanye menjadi nomor 15/2013. Dalam aturan baru, KPU melarang Parpol dan Caleg berkampanye sambil bagi-bagi uang dan membawa anak kecil. Peraturan KPU nomor 15/2013 tentang Pedoman Pelaksanaan Kampanye Pemilu Anggota DPR, DPD, dan DPRD itu diundangkan oleh Menkum HAM Amir Syamsuddin 27 Agustus dan dipublikasikan KPU pada Rabu (4/9) lalu. Dalam pasal 32 ayat 1 peraturan KPU 15/2013, ada 11 poin yang dilarang dilakukan oleh pelaksana, peserta, dan petugas kampanye. Misal poin (a) dilarang memersoalkan dasar negara Pancasila, pembukaan UUD 1945, dan bentuk NKRI. KPU juga melarang (b) melakukan kegiatan yang membahayakan keutuhan NKRI, dan (c) menghina seseorang, agama, suku, ras, golongan, calon dan/atau peserta Pemilu yang lain; dan (d) menghasut dan mengadu domba perseorangan

Salam… Langsung saja, maaf jika terkesan buru-buru dalam menyikapi sesuatu hal. Tapi ini adalah fenomena yang terjadi di masyarakat Batubara akhir-akhir ini menjelang Pilkada 2013-2018. Tulisan ini ditujukan buat enam pasang calon terpilih yang merupakan putra-putri terbaik bangsa yang akan memimpin Batubara lima tahun mendatang. Tak perduli dari kalangan mana Anda berasal dan tempat Anda dilahirkan, namun yang wajib Anda peduli dan perhatikan adalah.., JANJI. Sebagai orang-orang yang akan bertarung memperebutkan kursi panas Batubara 1, tentu hal yang tak luput Anda lakukan adalah memberi janji, baik secara langsung atau tidak langsung. Dengan kata lain di wakili tim sukses yang mungkin saja “menyebar” di tiap pelosok negri bernama Batubara ini. Pertanyaannya sederhana, jika terpilih nanti sanggupkah Anda merealisasikan janji Anda tersebut? Sebagai mana kita ketahui, sebagai sebuah kabupaten, Batubara merupakan daerah yang cukup luas dengan beragam suku, agama, dan aneka pekerjaan? Dengan catatan tersebut sungguh ini bukan suatu pekerjaan mudah, apalagi jika ditambah sedikit permainan para tim sukses yang mengatasnamakan sang calon— mengumbar janji melebihi apa yang “diamanahkan” sang calon untuk disampaika. Dengan kata lain jika salah satu sang calon bupati dan pasangannya hanya memberi janji setinggi pohon kelapa, namun di tangan tim sukses bisa saja janji ini melebihi tingginya matahari. Sudahkah hal semacam ini diantisipasi oleh tiapp-tiap calon bupati dan wakilnya? Jika belum masih ada waktu untuk memperbaikinya, karena hal ini bisa saja terjadi mengingat tidak semua daerah di Batubara ini dapat dikunjungi oleh tiap-tiap calon bupati dan wakilnya. Ini sangat berguna agar masyarakat tidak merasa dibohongi nantinya dan sang calon bupati dan wakilnya pun tidak merasa keberatan janji dalam mengemban tugas sebagai bupati dan wakilnya jika terpilih kelak, Amin. Terima kasih harian WASPADA yang memuat surat pembaca ini, jaya selalu? Moga kepada seluruh calon bupati dan wakilnya dapat melihat, membaca dan melihat sisi positif tulisan sederhana ini? Serta kepada Tuhan saya mohon ampun. Wassalam… Nama dan alamat ada pada redaksi.

Tinggal Kelas Berbagai upaya telah dilakukan untuk meningkatkan kualitas pendidikan kita. Dari mulai anggaran pendidikan ditingkatkan, guru disertifikasi diberi besiswa S2. Siswa juga mendapat bantuan. Gedung dibangun atau diperbaiki, sarana perasarana diberikan, administrasi direvisi, tak sedikit dana dihabiskan. Namun kualitas pendidikan belum menunjukkan peningkatan. Seolah arang habis besi binasa?! Semua turut prihatin akan wajah pendidikan kita. Berbagai ahli sumbang saran pemikiran. Hampir sepuluh tahun Kementrian Pendidikan melakukan perbaikan. Namun kualitas pendidkan masih pada peringkat 186 di antara 214 negara. Terendah di Asia Tenggara dan nomor corot di Asean. Sungguh menyedihkan! Kita jangan putus asa. Tak satu jalan ke Roma. Kita coba kembali bernostalgia ke tahun 60-an pada masa keemasan pendidikan kita. Pada masa guru Umar Bakri memberikan pendidikan. Pada masa itu tak sedikit warga negara tetangga menuntut ilmu ke negara kita. Mari kita cari contoh apa yang dilakukan Umar Bakri mencerdaskan anak bangsa. Ternyata banyak cara mendidik Umar Bakri yang kita abaikan. Salah satunya memberikan pendidikan kejujuran. Tak ada rekayasa nilai raport. Jika memang anak tak pintar di nyatakan tinggal kelas. Tak peduli walau 4 orang tinggal kelas. Karena tinggal kelas bukan hina, tapi agar lebih matang. Zaman dulu tak ada guru yang memberikan kunci jawaban pada siswa. Tak ada pemaksaan beli buku dan baju di sekolah. Tak ada guru yang malas. Tak ada paksaan dari yayasan. Tak ada aturan harus naik kelas, harus lulus semua. Pokoknya, sesuai antara kepintaran siswa dengan nilai yang didapat. Sang guru malu memberikan nilai palsu. Sekarang ini jarang sekali kita mendengar siswa tinggal kelas. Dari 1200 siswa pada satu sekolah nyaris tak satupun tinggal kelas. Mereka semua naik kelas karena pesan ketua yayasan swasta atau permintaan kepala sekolah negeri. Bagi sekolah swasta, Jika ada yang tinggal kelas akan menurunkan minat masyarakat masuk ke sekolahnya. Akibatnya laba yayasan akan menurun. Di mata yayasan lebih penting ‘laba’ dari pada kualitas pendidikan. Karena mengejar laba semata, maka ketua yayasan meminta paksa kepala sekolah agar semua siswa naik kelas. Buat sekolah negeri, jika ada yang tinggal kelas akan menurunkan karir kepala sekolah. Agar karir hebat maka kepala sekolah berpesan agar semua anak yang bodoh dan malas harus naik kelas. Agar kepala sekolah dipromosikan jabatan yang lebih tinggi. Ternyata pesan ini diketahui siswa. Akibatnya mereka tak mau lagi belajar. Akibatnya guru tak dapat lagi digugu dan ditiru. Guru kencing berdiri-murid kencing berlari. Guru berbohong, guru palsu memberikan nilai palsu. Murid palsu menerima raport palsu. Orang tua bangga dengan nilai palsu. Semua bangga dengan pendidikan palsu! Sudahlah, berhentilah berbohong. Tahun depan tak ada lagi nilai palsu. Katakan yang benar walaupun pahit rasanya. Kalau memang tak mampu jawab soal ujian, nyatakan saja tinggal kelas. Jangan dibantu saat ujian UN. Biarkan tak lulus. Jangan ada lagi ujian susulan. “Pak Umar, kenapa zaman dulu anak yang tinggal kelas orang tuanya ikhlas…?” “Karena zaman dulu biaya sekolah murah”. “Tapi, anak tertunda dong, tamat-nya..?” “Tak apa, tapi berkualitas. Daripada sekarang semua pada naik kelas, tapi tak jelas!” Nada Sukri Pane Hamparan Perak

soalan kampanye selalu jadi wilayah yang paling krusial diperdebatkan. Tentu ini terkait dengan tampilan luar kekuatan sebuah Parpol, sehebat apakah mereka mampu memobilisasi massa untuk meramaikan kampanye. Tidak jarang media menjadi alat yang ampuh untuk mengotak-atik jumlah massa. Apalagi jika kemudian ada media yang menjadi alat atau juru bicara Parpol. Kondisi ini dalam iklim kebebasan pers yang tidak terkendali menjadi sah adanya. Jangan heran jika kampanye hanya dihadiri ratusan orang, tampilan di media bisa ribuan bahkan didongkrak sampai ratusan ribu massa. Barangkali cara seperti ini dianggap efektif mendongkrak popularitas partai di samping temuan berbagai lembaga survei di tanah air. Dalam rapat dengar pendapat antara KPU dan DPR mengemuka alasan dari legislatifbahwapelibatananak-anakdalam kampanye merupakan salah satu pendidikan politik. Saya kira inilah akal-akal Parpol untuk melegitimasi pelibatan anakanak dalam kampanye. Pendidikan politik seperti apa yang bisa diharapkan di tengah euforia orang berkampanye, ketika berbagai bentuk pelanggaran lalulintas terjadi di depan mata anak-anak? Model pendidikan politik seperti apa muncul di ranah kampanye di saat anak-anak hanya menyaksikanparaJurkamobraljanji?Akankah mereka mendapatkan pendidikan politik di pentas kampanye yang lebih banyak menghadirkan artis daripada juru kampanye berkualitas? Penulis adalah Dosen FKIP UMSU, Bergiat Di Komunitas Diskusi Sastra FOKUS UMSU.

Nama Jalan Soeharto

Siti Rahmadani Hutasuhut Siswi Kelas XI SMA Nurul ‘Ilmi Padangsidimpuan

Mengantisipasi Janji Cabup Cawabup Batubara

ataupun masyarakat. Selain itu dilarang juga berkampanye yang (e). mengganggu ketertiban umum, dan (f) mengancam untuk melakukan kekerasan atau menganjurkan penggunaan kekerasan kepada seseorang, sekelompok anggota masyarakat, dan atau peserta Pemilu yang lain. Regulasi baru ini setidaknya akan mempertegas amanah UU No 23 Tahun 2002 tentang Perlindungan Anak. UU tersebut mempertegas larangan anak-anak ikut terjun dalam kegiatan politik. Demikian juga larangan membawa anak-anak dalam kampanye tak boleh dianggap remeh, sebab hal itu dikhawatirkan berdampak bagi perkembangan fisik dan psikis bagi anak. Peraturan yang dikeluar KPU ini tentu saja mendapat apresiasi kalangan aktivis yang bergiat di perlindungan anak. Komisi Perlindugan Anak Indonesia (KPAI) meminta KPU dan Bawaslu bersikap tegas terhadap Parpol yang nyata-nyata membawa anak-anak dalam kampanye. Di sini maka regulasi itu menjadi sangat penting bagi tiap stakeholder di dalam proses Pemilu mendatang. Hanya saja seperti kebanyakan regulasi, selalu saja Parpol tidak mematuhinya. Kita memaklumi bahwa tujuan mereka mengerahkan anak-anak

di kampanye dengan berbagai macam alasan yang selalu sulit dijadikan pembenaran. Sayangnya alasan tersebut memaksa semua orang tidak ambil pusing. Istilahnya, urus partai masingmasing. Karena wilayah kampanye seolah menjadi batasan partai tertentu yang tidak bisa disentuh oleh siapa pun kecuali partai yang berkampanye. Regulasi yang baru dikeluarkan KPU tersebut perlu penjabaran yang lebih teknis. Artinya meski KPU sudah mengeluarkan peraturan, namun model larangan seperti apa yang konkretnya? Bagaimana seandainya alasan yang paling klasik dari orang tua adalah tidak ada anak yang menjaga di rumah sehingga terpaksa dibawa ke arena kampanye. Bahkan tidak jarang alasan partai politik yang paling gampang menghindar dari bentuk pelanggaran Pemilu karena anak-anak datang ke arena kampanye bukan diajak tapi datang sendiri. Berbagai model alasan yang kerap muncul jika anak-anak dilibatkan atau terlibat dalam kampanye tentu saja harus memaksa KPU mencari model yang tepat untuk mengategorikan partai politik, perorangan atau calan kepala daerah melanggar aturan kampanye. Saya menangkap perdebatan sengit antara KPU dan DPR soal aturan ini karena legislatif merasa pelarang tersebut akan mengurangi pengerah massa secara massif. Kita mengetahui bersama bahwa ukuran keberhasilan kampanye selalu berdasarkan kuantitas kehadiran massa meskipun sering dianggap sebagai massa mengambang. Dalam praktik penyelenggaran Pemilu sejak berakhirnya Orde Baru, per-

Oleh Tigor Damanik Patut mengapresiasi AM Fatwa,penentang radikal rezim Soeharto. Dirinya pernah direkayasa seolah aktor pemboman Bank BCA di Jakarta kala itu.Tapi sekarang ia justru ikut merekomendasikan nama jalan Soeharto

P

anitia 17 yang diketuai mantan Ketua MK Jimly Ashidique mengusulkan kepada Gubernur DKI Jakarta Joko Widodo untuk mengganti empat nama jalan “Medan Merdeka” menjadi nama para pahlawan/tokoh nasional. Medan Merdeka Utara menjadi Jalan Ir Soekarno, Medan Merdeka Selatan jadi Jalan Dr Mohammad Hatta, Medan Merdeka Barat jadi Jalan Jendral TNI Soeharto dan Medan Merdeka Timur menjadi Jalan Letjen TNI (Marinir) Ali Sadikin. Soekarno (Bung Karno), Presiden RI Pertama sekaligus Proklamator Kemerdekaan. Mohammad Hatta (Bung Hatta), Wakil Presiden RI Pertama Soeharto (Pak Harto), Presiden RI Kedua dan Ali Sadikin (Bang Ali) mantan Gubernur DKI Jakarta. Masalahnya, muncul pro dan kontra ketika nama Soeharto (dan Ali Sadikin) diajukan. Banyak yang setuju/pro namun tak sedikit pula yang kontra/ menolak. Yang setuju beralasan, Soeharto merupakan sosok putra bangsa yang pernah berkarya dan berjasa bagi Indonesia selama 32 tahun (19661998) dan menyandang predikat “Bapak Pembangunan Nasional”. Soeharto tidak hanya sosok negarawan, tapi juga sosok manajer handal yang memiliki skill (kemampuan/ keahlian) hampir di segala bidang. Technical skill (kemampuan teknis), managerial skill (kemampuan mengelola), conceptional skill (kemampuan melaksanakan visi dan misi) dan emotional skill (kemampuan mengendalikan diri). Sosoknya kerap mengharumkan nama bangsa dan negara, di tingkat nasional maupun internasional. Di nasional, kepemimpinannya lebih memegang filosofi njawani: tego loro ne, ora tego patine (tega menderitanya, tapi tidak tega matinya) dan mengedepankan tata krama (etika, sopan santun) serta budaya saling menghargai dan hormat-menghormati. Fokus dalam memerhatikan dan membantu kepentingan rakyat banyak, terutama masyarakat kurang mampu. Berbagai program pembangunan yang dilaksanakan (ekonomi, keuangan, politik, keamanan, budaya, dll) di pemerintahannya selalu berhasil, terutama program “primadona” lima tahunan GBHN (Garis-garis Besar Haluan Negara)-nya. Di internasional, pernah membawa Indonesia menjadi anggota tidak tetap Dewan Keamanan PBB. Disegani banyak negara dibelahan dunia. Maju di bidang ekonomi, sosial, keamanan maupun politik. Juga di bidang olah raga, terutama keberhasilan atlet bulutangkis yang sering meraih gelar juara dunia. Indonesia dibawah “komando” Soeharto merupakan salah satu pendiri dan terbentuknya GNB (Gerakan Negara-negara Non Blok) yang terkenal dengan politik bebas aktifnya. Juga pemrakarsa berdirinya ASEAN (Association South East Asia Nation) atau Perhimpunan Negara-negara Asia Tenggara yang berfokus kepada pengembangan dan kemajuan di bidang ekonomi dan keuangan. Sedangkan yang kontra/tidak setuju, menilai Soeharto tidak memiliki

esensi dan “belum” layak namanya untuk dapat diabadikan menjadi nama sebuah jalan, apalagi nama jalan sekelas kawasan Istana Presiden dan Monas. Juga menilai kepemimpinan Soeharto selama memimpin Indonesia lebih banyak memenderitakan dan menyakiti hati rakyat dengan berbagai pelanggaran HAM (Hak-hak Asasi Manusia) beratnya. Diktator dan kejam, apalagi terhadap seteru politik, penentang dan penghalang rencana/gagasannya. Bahkan kini masih banyak yang mengalami trauma atas keganasan rezimnya, terutama terhadap Peristiwa G 30 S PKI/1965 yang banyak menewaskan rakyat. Berikut praktik pengekangan kebebasan dan pembredelan pers/media, malah merupakan pekerjaan rutin rezim Soeharto kala itu. Menilai Sosok (Nama Jalan) Soeharto Pasal 28 UUD 1945 mengatakan bahwa: “Kemerdekaan berserikat dan berkumpul, mengeluarkan pikiran dengan lisan dan tulisan, dsb, ditetapkan dengan UU” . Mengeluarkan dan mengemukakan suatu pendapat adalah hak setiap WNI. Hanya saja makna kemerdekaan dan atau kebebasan diinterpretasikan secara kebablasan. Seolah bebas tanpa batas, hingga menjurus ke perilaku “suka-suka” yang kerap berimplikasi konflik, sosial (fisik/ tawuran) dan psikologis (saling iri, sirik dan dendam). Padahal jika mau menilai jujur tentang kualitas seseorang apalagi berpredikat mantan kepala negara tentu harus konsisten melihat dari dua sisi, kelebihan dan kekurangan, seraya memertimbangkan dan memperhatikan adegium dan abreviasi (singkatan kata) Jasmerah : “jangan sesekali melupakan sejarah!” Khususnya terhadap sosok Soeharto, selama ini sebagian masyarakat yang tidak suka dengan masa lalunya selalu mengopinikannya secara negatif. Lebih menonjolkan sisi-sisi “kelemahannya” dengan ngotot meniadakan (sedikitpun) kelebihannya. Padahal jika dirunut ke belakang, tidak berkelebihan kiranya jika menyatakan bahwa Soeharto memiliki cukup banyak sisi kelebihan. Antara lain, meski dinilai kejam dan keukeuh pada pendirian, namun terdapat sisi kelebihan yang mungkin perlu mendapat perhatian dan telaah mendalam. Saat Soeharto membuat sebuah keputusan penting dengan sangat bijaksana saat akhir kepemimpinannya. Ternyata Soeharto tidak pernah berpikir apalagi menginginkan terjadinya pertumpahan darah sehingga mengambil solusi terbaik untuk lebih baik mengundurkan diri, lalu menyerahkan (suksesi) kursi kepresidenannya kepada sang wakil BJ Habibie pada 21 Mei 1998. Tentu bisa dibayangkan apa yang akan terjadi jika Soeharto ngotot memertahankan kekuasaannya. Mengingat kekuatan ABRI (Angkatan Bersenjata RI) yang masih dalam garis komandonya masih “maha” loyal kepadanya. Bisa jadi situasi kondisi perpolitikan dan keamanan Indonesia tidak akan menentu dan dipastikan akan

jauh lebih buruk dari situasi kondisi perpolitikan dan keamanan yang dialami Mesir saat ini. Berbagai sifat dan perilaku egois, termasuk niat seolah meniadakan kelebihan seseorang. Bahayanya, jika sifat, watak dan perilaku buruk seperti ini selalu dipelihara, maka dikhawatirkan, kedepannya, akan terdapat taburan anak bangsa, terutama generasi mudanya yang selalu berpikiran negatif, menjadi (kader) pendedam dan munafik. Dimana tiada guna kita sering berbicara mengenai nasionalisme sejati, sementara hati selalu bersikukuh pada pendirian egoistis berpotensi konflik. Juga, tiada guna kita selalu berbicara berdemokrasi yang baik, namun tidak pernah mengaplikasikannya dalam perilaku hidup keseharian. Tidak mau menerima pendapat orang/pihak lain, apalagi kala dirinya sedang berkuasa dan merasa kuat sementara diucapan selalu berkata demokratis. Apalagi ditambah terdapatnya beberapa organisasi kemasyarakatan/lembaga swadaya masyarakat tertentu yang merasa diri kuat dan berpengaruh lalu merasa dumeh (mentang-mentang/ sombong). Kerap memilih jalan pintas melalui berbagai aksi unjuk rasa yang provokatif dan praktik anarkistis di dalam upaya menggolkan setiap kemauan/kehendak diri dan kelompoknya. Patut mengapresiasi sifat dan perilaku “mulia dan bijaksana” AM Fatwa, seorang tokoh “tua-kondang” nasional. Dia terkenal sebagai penentang radikal rezim Soeharto. Salah satunya, dirinya pernah direkayasa seolah merupakan aktor intelektual/otak di balik pemboman Bank BCA di Jakarta kala itu. Hanya saja yang namanya AM Fatwa, tidak pernah merasa takut dan gentar. Malah sebaliknya dia tidak pernah menyimpan rasa dendam. Merupakan sosok bijak dan manusia

pemaaf pelopor jiwa rekonsiliasi. Sifat dan perilaku mulia serta bijaksana mana sejatinya wajib diteladani, terutama oleh para generasi muda. Terbukti ketika dirinya duduk sebagai salah seorang anggota Tim 17 yang terdiri dari beberapa tokoh nasional itu, AM Fatwa justru ikut merekomendasikan nama Soeharto sebagai bakal pengganti nama salah satu jalan di kawasan medan merdeka. Tentu berharap, tidak akan terjadi serangan balik, berupa suara-suara sumbang, miring, negatif dan provokatif yang akan menuding, bahwa motif pengusulan nama jalan olehTim 17 merupakan sebuah manuver politik jelang Pemilu 2014. Harapan Mengapresiasi usulan Tim 17 yang mengusulkan empat nama tokoh “kondang” nasional untuk mengganti empat nama Jalan Medan Merdeka di seputaran Istana Presiden dan Monas (monumen nasional) Jakarta. Secara logika, dengan bermodalkan mantan presiden (dan mantan gubernur ibu kota) dan berbagai jasa serta ketokohan lainnya tentu sudah lebih dari cukup untuk dapat dijadikan dasar penganugerahan nama sebuah jalan di lokasi elit. Karena bagaimanapun, keberadaan, kemajuan dan berkembangnya Indonesia dan kota Jakarta saat ini tentu tidaklah terlepas dari bekas goresan, sentuhan dan atau polesan tangan dan hati kedua tokoh nasional tersebut. Tentu berharap tiada alasan lagi untuk tidak menyetujui nama Soeharto (dan nama Ali Sadikin) mendampingi nama jalan Ir Soekarno dan jalan Dr Mohammad Hatta, mengganti ke empat nama lama jalan di medan merdeka, sekaligus sebagai wujud rekonsiliasi (bathin) nasional. Penulis adalah Alumnus FHUI Jakarta 1982.


Ekonomi & Bisnis

B8 Emas Turun Rp3.000 Per Gram JAKARTA (Waspada): Harga emas berjangka berakhir flat atau tidak bergerak pada penutupan perdagangan Senin di bursa New York, Amerika Serikat. Investor masih menunggu sinyal dari pemerintah AS atas rencana serangan militer terhadap Suriah dan prospek untuk stimulus moneter Federal Reserve dalam program pembelian obligasi bulanan. Seperti diberitakan Marketwatch, Selasa (10/9), emas untuk pengiriman Desember hanya naik 20 sen dan menetap di level US$1.386,70 per ounce di divisi Comex New York Mercantile Exchange. Sebelumnya, harga emas mengalami kenaikan 1 persen pada penutupan Jumat pekan lalu. Dari dalam negeri dilaporkan, harga emas di Unit Bisnis Pengolahan dan Pemurnian Logam Mulia PT Antam Tbk, hari ini melemah dibandingkan harga perdagangan Senin kemarin. Harga emas batangan Antam dijual Rp558.000 untuk ukuran 1 gram, atau naik Rp3.000 dibandingkan Rp561.000 pada perdagangan Senin kemarin. Adapun emas ukuran 5 gram kini dilepas dengan harga Rp2.645.000, ukuran 10 gram (Rp5.240.000), ukuran 25 gram (Rp13.025.000), dan ukuran 50 gram (Rp26.000.000). Harga beli kembali (buy back) emas Antam hari ini dipatok Rp494.000 dari sebelumnya Rp496.000 per gram. (okz)

Pelabuhan Pelindo I Pintu Utama CPO Dunia MEDAN (Waspada): PT Pelabuhan Indonesia I (Pelindo) hingga saat masih menjadi BUMN pengelola pelabuhan yang menjadi pengekspor terbesar CPO di dunia. Humas Pelindo I Eriansyah menjelaskan Selasa (10/9), pelabuhan yang dibawah pengelolaan Pelindo I yang menjadi pintu gerbang ekspor dunia diantaranya Pelabuhan Belawan dan Pelabuhan Dumai. Pada tahun 2013, throughout CPO di Pelabuhan Belawan diprediksi mencapai 4,04 juta ton. Sampai dengan Juli 2013, Pelabuhan Belawan telah melakukan bongkar muat CPO sebanyak 2,4 juta ton. Pelabuhan Dumai hingga Juli 2013 telah meng-handle CPO sebanyak 3,35 juta. “Total Ekspor CPO Indonesia tahun 2012 mencapai 18 juta ton, 8,4 juta ton di-handle di Pelabuhan Belawan dan Dumai. Artinya, Pelindo I telah meng-handle hampir 47% total ekspor CPO Indonesia,” kata Eriansyah. Untuk melakukan bongkar muat CPO, saat ini Pelabuhan Belawan menyediakan dermaga sepanjang 500 m, 30 pipa, 7 loading point (kapasitas 150 ton/jam), dengan troughput tahun 2013 sebesar 4,04 juta ton. Menurut Eriansyah sampai tahun ini, Indonesia tetap menjadi negara produksi terbesar minyak sawit (crude palm oil/CPO) dunia dengan hasil 28 juta ton. Produksi CPO Indonesia hampir 50 persen dari total produksi dunia tahun ini yang diprediksi 54,527 juta ton. Setelah Indonesia, terbesar kedua adalah Malaysia sejumlah 19,7 juta ton, disusul Thailand 1,7 juta ton. Luas perkebunan kelapa sawit di Indonesia mencapai 8 juta hektare lebih dan tersebar di seluruh Indonesia. Perkebunan kelapa sawit terbesar yaitu di Sumatera, Kalimantan dan Sulawesi. Tiga pulau ini menjadi daerah penghasil kelapa sawit cukup besar dan juga penghasil CPO terbesar di Indonesia. Sebagai salah satu wilayah pengekspor CPO terbesar, keberadaan Pelabuhan Belawan di Sumatera Utara merupakan pintu utama (gateway) yang sangat penting untuk mengirim CPO dan turunannya ke Negara tujuan. “Dari Pelabuhan Belawan, CPO diekspor ke Negara tujuan seperti India, China, Singapura, Pasir Gudang dan pelabuhan besar seperti Port of Rotterdam, Port of India, dll,” kata M. Eriansyah, Humas PT Pelabuhan Indonesia I (Persero). Eriansyah menjelaskan, selain Pelabuhan Belawan dan Pelabuhan Dumai, Pelindo I akan membangun Terminal Curah Cair di Pelabuhan Kuala Tanjung untuk mendorong peningkatan ekspor CPO Indonesia. (m35)

Redam Gejolak Rupiah UU Devisa Direvisi JAKARTA (Waspada): Wakil Ketua Komisi XI DPR RI dari Fraksi Golkar, Harry Azhar Azis, Senin (9/9), menyatakan fraksinya mendukung perubahan atau revisi Undang-Undang Nomor 24 Tahun 1999 tentang Lalu Lintas Devisa dan Nilai Tukar. Harry menjelaskan, undang-undang ini dinilai terlalu liberal dan ditengarai membuat pasar valas dan pasar modal Indonesia mudah dirontokkan. “Regulasi devisa yang ada sekarang sudah merugikan perekonomian dan sangat mengganggu sektor riil, sehingga harus segera direvisi. Itu target

kami,” ujar Harry dalam keterangan tertulisnya. Menurut Harry, saat ini merupakan momentum yang tepat merevisi UU Lalu Lintas Devisa tersebut. “Pasar valas kita mudah kering. Orang asing seenaknya keluar-masuk, ekonomi kita yang terguncang oleh instabilitas pasar uang dan pasar modal. Ini tidak bisa dibiarkan terus,” kata Harry. Draf revisi tersebut masih di tingkat Deputi Sekjen Perundang-Undangan DPR. UU Devisa, Harry melanjutkan, saat ini memberi kelonggaran cukup luas kepada Bank Indonesia untuk mengatur lalu lintas devisa dan valuta asing melalui Peraturan Bank Indonesia (PBI). Namun, faktanya, PBI yang ada belum cukup ampuh meredam gejolak rupiah belakangan ini. Tak hanya itu, devisa Indonesia malah cenderung semakin

dinikmati oleh pihak luar. Harry memberi contoh, Thailand merupakan negara yang sukses memburu serta mengembalikan devisa hasil ekspornya melalui UU Devisa yang sangat ketat. “Dalam UU Devisa di Thailand tersebut ada kewajiban untuk menempatkan devisa hasil ekspor di bank lokal dalam periode tertentu atau disebut holding period. Saya kira ini bagus, supaya pasar valas kita tidak mudah dimainkan dan stabil, dunia usaha juga jadi tenang,” kata Harry. Harry menambahkan, terbukti Thailand berhasil menjaga nilai tukar mata uangnya atas dolar Amerika Serikat saat krisis politik “kaos merah” beberapa tahun silam. Oleh karena itu, menurut Harry, Golkar beranggapan sudah saatnya Indonesia memiliki UU Devisa yang dapat menga-

mankan perekonomian nasional. Menurut Harry, saat ini, Bank Indonesia memiliki PBI No.13/20/PBI/2011 dan Surat Gubernur BI no.14/3/GBI/SDM tanggal 30 Oktober 2012. Dalam aturan itu diwajibkan devisa hasil ekspor komoditas tambang, serta minyak dan gas yang diparkir di luar negeri ditarik ke dalam negeri paling lambat 90 hari setelah tanggal pemberitahuan ekspor barang (PEB). Namun, PBI tersebut terbukti tidak cukup kuat menarik dan menahan devisa hasil ekspor ke dalam negeri. “Salah satu penyebabnya, tidak ada kewajiban menaruh devisa di dalam negeri dalam waktu tertentu atau holding period, dalam enam bulan misalnya. Sebab, aturannya cuma melakukan pelaporan, ya kembali lagi ke luar negeri. Negara ini dapat apa?” kata Harry. (okz)

Rupiah Menguat Terhadap Dolar * Rp11.500 Per Dolar AS MEDAN (Waspada): Nilai tukar Rupiah mulai menguat terhadap Dolar AS pada perdagangan Selasa (10/9). Rupiah diperdagangkan menguat di level 11.500-11.600, dibandingkan posisi kemarin yang sempat bertahan di level 11.700-an. Berdasarkan pantauan kurs valas di beberapa perbankan, Rupiah diperdagangkan berbeda-beda seperti di BI kurs beli Rp11.124, kurs jual Rp11.236, BNI kurs beli Rp11.350, kurs jual Rp11.750, Mandiri kurs beli Rp11.383, kurs jual Rp11.697, BCA kurs beli Rp11.300, kurs jual Rp11.800, BRI kurs beli Rp11.350, kurs jual Rp11.800. Nilai tukar tersebut merupakan nilai indikasi yang dapat berubah sewaktu-waktu tanpa pemberitahuan terlebih dahulu. “Melemahnya Dolar AS di

pasar global menjadi pemicu membaiknya kinerja Rupiah dan Indeks Harga Saham Gabungan (IHSG) pada perdagangan Selasa,” kata Analis Ekonomi di salah satu Sekuritas BUMN di Medan Gunawan Benjamin, kemarin. Gunawan menyebutkan, China yang mengalami inflasi sesuai dengan ekspektasi menjadi salah satu pemicu menguatnya sejumlah bursa di Asia dan cukup menekan pergerakan Dolar AS. “Walau demikian sejumlah sentimen dalam waktu dekat bisa mengguncang kembali nilai tukar Rupiah. Salah satunya adalah rencana intervensi militer ke Suriah atau langkah Bank Sentral AS dalam mengurangi stimulus lebih besar dari ekspektasi pelaku pasar yang sejauh ini memperkirakan

stimulus akan dikurangi 50 persen,” sebut pengamat ekonomi dari IAIN ini. Terkait dengan nilai tukar Rupiah yang sejauh ini menguat, katanya, diperkirakan dalam jangka pendek penguatannya sulit untuk di bawah Rp10.800 per Dolar AS. Potensi tertekannya Rupiah tetap terbuka jika defisit neraca perdagangan masih melebar dan terjadi penurunan quantitative easing yang cukup signifikan oleh Bank Sentral AS. Menurutnya, untuk mengatasi pelemahan nilai tukar Rupiah belakangan ini memang tidak mudah. Tren pembalikan modal menjadi salah satu masalah yang mendasar. Intinya kebijakan pemerintah harus mampu menyediakan pasokan valas yang ada di pasar domestik serta secara meyakinkan mampu memberikan kebijakankebijakan yang lebih memberikan rasa aman khususnya sektor

keuangan. “Itu yang bisa dilakukan dalam jangka pendek, namun dalam jangka panjang memperkuat fundamental khususnya sektor riil menjadi fokus utama guna menciptakan kestabilan pasar keuangan,” ujarnya. Hal itu dikarenakan banyak industri yang mengandalkan barang-barang impor, maka penguatan Rupiah saat ini akan menjadi kabar baik bagi industri. Ekonomi nasional akan kembali bergairah. “Sektor-sektor ekonomi yang banyak mengandalkan ekspor komoditas primer memang tidak diuntungkan dengan kondisi membaiknya Rupiah. Karena secara ril pendapatan mereka akan menurun. Berbeda dengan sektorsektor yang banyak menggunakan kandungan barang impor, mereka akan sedikit tertolong dengan penguatan Rupiah saat ini,” ujarnya. (m41)

WASPADA Rabu, 11 September 2013

Konsumsi Energi Dan Air Butuh Penghematan BANDA ACEH (Waspada): Sekda Aceh T Setia Budi mengatakan keberadaan energi dan air sangat penting bagi aktivitas dan kelangsungan kehidupan manusia dimuka bumi ini, persediaannya sangat terbatas sehingga membutuhkan penghematan dalam mengkonsumsi energi dan air tersebut “Kalau menggunakan listrik berlebihan, sudah tentu bahan bakar yang dibutuhkan juga makin besar. Kondisi ini memaksa kita mengeksplorasi sumber daya alam secara berlebihan pula,” ujar T. Setia Budi, Sekda Aceh pada seminar seminar monitoring dan evaluasi penghematan energi dan air, Selasa (10/9) di Banda Aceh. Menurutnya, tindakan eksplorasi sumber daya alam berlebihan inilah yang bisa merusak alam sekaligus menghabiskan persediaan energi di masa depan. Apalagi kita tahu, energi batu bara atau energi fosil sangat terbatas dan tidak bisa diperbaharui. Airs juga demikia,” cetus Setia Budi. Karena itu, pinta Sekda Aceh ini, penghematan energi dan air itu harus dimulai dari lingkungan pemerintah. “Selanjutnya kita dorong menjadi semangat bersama bagi seluruh rakyat Indonesia. Dari sinilah kemudian lahir Instruksi Presiden Nomor 13 tahun 2011 tentang Penghematan Energi dan Air, dan peraturan lainnya.” Instruksi itu, tambahnya, merupakan bentuk peneladanan dari aparatur pemerintah kepada masyarakat dalam upaya mengubah perilaku pada pemakaian energi dan air yang selama ini dinilai boros dan jauh dari prinsip efisiensi. “Sejak berlakunya Instruksi Presiden soal penghematan energi dan air, Gubernur Aceh langsung melakukan himbauan untuk menerapkan kebijakan yang sama bagi seluruh apatur pemerintahan di daerah ini,” ungkapnya(b06)

Obyek Wisata Harus Mendorong Pertumbuhan Ekonomi TAKENGEN (Waspada): Anggota DPR RI, asal Provinsi Aceh, Raihan Iskandar, menganggap keberadaan Danau Lut Tawar, semestinya bisa membantu mendorong pertumbuhan ekonomi bagi masyarakat di Kota Takengen, Kabupaten Aceh Tengah. Apabila, pengelolaannya dilakukan dengan baik dan professional. Namun saat ini menurut Raihan, keindahan alam serta objekobjek pariwisata yang ada di seputaran Danau Lut Tawar, belum dipersiapkan secara maksimal termasuk keberadaan sarana yang masih sangat minim. “ Keberadaan Danau Lut Tawar, merupakan salah satu objek untuk bisa mengerakkan roda pertumbuhan ekonomi. Selain perkebunan kopi yang memang sudah menjadi sektor penting di kabupaten ini ,” kata Raihan Iskandar, saat melakukan kunjungan ke pasar sayur di Pasar Bawah Takengen dan berdialog dengan organisasi perhimpunan pedagang kaki lima, kemarin. Menurutnya, banyak tempat-tempat di Kabupaten Aceh Tengah, yang bisa digairahkan untuk membangkitkan pertumbuhan ekonomi. Salah satunya, kawasan wisata Danau Lut Tawar. Namun kondisi saat ini, di seputaran Danau Lut Tawar, tidak terlihat pertumbuhan ekonomi dengan menyajikan lokasi-lokasi wisata yang menarik. Dikatakan, Aceh sebagai daerah yang menerapkan Syariat Islam, harus bisa mengusung identitas dengan memperkuat kearifan lokal. Dia menganggap, Syariat Islam bukan penghambat bagi pertumbuhan wisata di daerah ini. “Harusnya wisata itu jangan dikaitkan dengan masalah maksiat. Pertumbuhan ekonominya dulu yang penting. Caranya dengan memperkuat kearifan lokal,” jelasnya. Ditambahkan Raihan, kawasan wisata Danau LutTawar, sampai dengan saat ini, belum memiliki sarana dan tempat berkunjung yang dikelola secara profesional. “Ini menjadi salah satu penyebab lambatnya pertumbuhan ekonomi di Kabupaten Aceh Tengah. Apabila pengelolaan dilakukan dengan baik, dimungkinkan akan mendorong pertumbuhan ekonomi bagi daerah ini ,” katanya. (b33)

18 Tahun Melayani Indonesia, Telkomsel Ekspansi Pasar Global DILIHAT dari struktur pertumbuhan ekonomi, maka sektor telekomunikasi selalu bertumbuh positif. Rata-rata pertumbuhan industri ini di atas pertumbuhan ekonomi nasional. Tingginya pertumbuhan industri selular diamini Menkominfo Tifatul Sembiring. Tahun ini kontribusinya terhadap pertumbuhan ekonomi 10 persen sampai 11 persen, kata Tifatul Sembiring usai menghadiri Indonesia Cellular Show 2013 beberapa waktu lalu. Angka ini tidak berbeda jauh dari dua tahun sebelumnya. Pada 2011 dengan pertumbuhan ekonomi sebesar 6,5 persen kontribusi sektor telekomunikasi sebesar 11,7 persen. Sementara 2012, di mana pertumbuhan ekonomi turun menjadi 6,2 persen, kontribusi sektor telekomunikasi menjadi sekitar 10 persen. Asosiasi Telekomunikasi Selular Indonesia (ATSI) juga punya data, dari segi pertumbuhan pendapatan industri telekomunikasi, angkanya tidak akan turun. Pergerakannya sama dengan periode 2012 yang ada di level 7 persen. Lembaga penelitian Frost & Sullivan mengurai pertumbuhan industri telekomunikasi 2013 ditopang peningkatan internet selular atau mobile internet. Lembaga itu menegaskan pendapatan penyedia jasa telekomunikasi di Indonesia Rp135 triliun, sebanyak 38 persennya merupakan pendapatan dari layanan data. Dari seluruh kontribusi telekomunikasi selular terhadap pertumbuhan ekonomi tentu tidak bisa dilepaskan dari Telkomsel yang sampai saat ini memiliki market share terbesar. Jumlah pelanggan mereka se-Indonesia sudah 125 juta. Kemudian di Sumatera ada 36 juta pelanggan dari penduduk Sumatera yang sampai akhir 2012 mencapai 52.420.320. Jumlah penduduk Sumatera ini 21 persen dari total penduduk Indonesia. Dengan eksistensi mengelola perusahaan, maka sepanjang 2012, Telkomsel berhasil meraup pendapatan Rp54 triliun dari semua layanan yang dimilikinya. Pada 2013, perusahaan penyedia layanan telekomunikasi itu menargetkan pertumbuhan pendapatan 10 persen dari tahun lalu atau sekira Rp60 triliun. Kondisi itu pula yang mendorong perusahaan ini menambah pelanggan baru 500 ribu orang hingga 1 juta setiap bulan. Kuncinya dengan inovasi berkelanjutan. Lewat berbagai inovasi itu pula, Telkomsel mendukung fase kehidupan masyarakat dari sisi ekonomi, teknologi, pendidikan, lingkungan, sosial dan gaya hidup. Patut dicermati kemana perusahaan ini setelah menjadi yang terbesar di tanah air. Di dalam negeri, mereka boleh diakui memiliki jaringan terluas dengan dukungan BTS 3G, network berkualitas, produk inovatif dan pelayanan berstandar internasional. Jika cermat melihat rencana bisnis ke depan, maka Telkomsel akan memandu industri selular di tanah air setara dengan negara-negara maju. Dan itu sudah dimulai. Telkomsel melakukan ekspansi layanan internasional di lima negara dan akan diperluas ke lima negara lainnya di Asia untuk mengakomodasi kebutuhan komunikasi. Sejak 2012, Telkomsel berkomitmen menjadi perusahaan berskala internasional, menggarap bisnis sektor telekomunikasi di sejumlah negara. Tahun lalu ekspansi ke Singapura, Malaysia, Hong Kong, Timor Leste, dan Australia. Ekspansi bisnis di luar negeri telah dilakukan dengan meluncurkan layanan kartu As 2 in 1. Dengan layanan ini, pelanggan dapat menggunakan kartu tersebut di luar negeri sebagai kartu lokal dan untuk menghubungi nomor Indonesia yang tersambung ke saluran Telkomsel sebagai nomor internasional. Layanan ini telah bisa diakses di Singapura, Malaysia, Hong Kong, Timor Leste, dan Australia. Ekspansi ini mengutamakan negara tujuan Tenaga Kerja Indonesia (TKI). Di Hong Kong, misalnya, saat ini ada 170 ribu

Waspada/Armin Nasution

SEORANG petugas customer service Telkomsel berdialog, melayani pelanggan yang ingin tahu lebih dekat produk perusahaan itu. Selain jaringan berstandar global, Telkomsel juga menyambut semua keluhan pelanggan dengan standar internasional. orang TKI bekerja. Dari angka tersebut, 30 ribu orang telah menjadi pelanggan As 2 in 1. Telkomsel juga menggenjot As 2 in 1 di Timor Leste, dengan 21 ribu calon pelanggan telah menunggu. Kartu As 2 in 1 ditargetkan mencapai 450 ribu pelanggan pada 2018 atau sekitar 43 persen dari pangsa pasar di Timor Leste. Rencananya, itu pula yang akan diperluas ke negara lainnya seperti Arab Saudi, Qatar, Korea Selatan, Jepang dan lainnya. Jadi ‘raja’ di negeri sendiri itu biasa. Maka standar internasional-lah yang harus digeber Telkomsel. Standar minimal jaringan Ekspansi sudah menjadi langkah nyata. Tapi kira-kira apa standar minimal agar operator ini setara dengan negara maju? Syaratnya minimal 3G (third-generation technology). Ini sebuah standar yang ditetapkan International Telecommunication Union (ITU) yang diadopsi dari IMT-2000 untuk diaplikasikan pada jaringan selular. Istilah ini umumnya digunakan mengacu kepada perkembangan teknologi telefon nirkabel versi ketiga. Melalui 3G, pengguna selular dapat memiliki akses cepat ke internet setiap detik ketika alat berada pada kondisi diam atau bergerak. Beberapa perusahaan selular dunia menjadikan 3G sebagai standar minimal jaringan nirkabel yang beredar di pasaran. Keberhasilan layanan 3G di Eropa dan Jepang disebabkan dukungan pemerintah. Jepang, misalnya, tidak mengenakan biaya dimuka (upfront fee) atas penggunaan lisensi spektrum 3G atas operator-operator di Jepang (ada tiga operator: NTT Docomo, KDDI dan Vodafone). Di Korea Selatan, walaupun mengenakan biaya di depan, memberikan insentif dan bantuan dalam pengembangan nirkabel pita lebar (Korea Selatan adalah negara yang menggunakan Cisco Gigabit Switch Router terbanyak di dunia) sebagai bagian dalam strategi pengembangan infrastruktur. Telkomsel pun pasti sudah merasakan perubahan trend telekomunikasi di Indonesia. Dari yang biasa SMS dan voice kini layanan data-lah cukup diminati. Hingga 2012 layanan data Telkomsel sudah mencapai 52 juta pelanggan. Tahun ini akan dikejar hingga 82 juta. Tentu layanan data ini tak berhenti di 3G karena sudah ada

3,5G bahkan 4G atau LTE. Telkomsel sudah melakukan uji coba Long Term Evolution (LTE) secara test lab atau di dalam ruangan. Semester kedua 2013 digelar uji coba layanan 4G di empat kota besar mewakili pulau-pulau di Indonesia. “Kalau bicara test lab itu sudah dilakukan lama oleh Telkomsel. Di kantor kami sudah ada LTE. Kami mau uji coba yang penuh tantangan tahun ini. Langsung ke pelanggan dengan trafik data yang luar biasa. Itu baru namanya uji nyali,” kata Direktur Jaringan Telkomsel, Abdus Somad Arief di Jakarta, baru-baru ini. Empat kota besar yang akan dipilih untuk uji coba LTETelkomsel adalah di pulau Jawa, Sumatera, Kalimantan, dan Sulawesi. “Kami mau mendapatkan langsung pengalaman dari pelanggan, perangkat, jaringan, dan aplikasi kala LTE dijalankan di satu kota yang trafik datanya tinggi. Risikonya, tentu akan banyak keluhan dan sebagainya, tetapi ini harus dilakukan agar pengalaman 2G tak terjadi,” jelasnya lebih lanjut. Bicara standar jaringan internasional berbasis 3G dengan pemeliharaan network yang berkelanjutan sangat diharapkan konsumen. Selain standar minimal jaringan, tentu perlu didukung standar pelayanan yang juga standar global. Dukungan Sebab keinginan Telkomsel menembus level internasional disambut sukacita setelah 18 tahun mereka melayani negeri. Anggota DPD RI pemilihan asal Sumut Parlindungan Purba ikut mengapresiasi. Dihubungi Jumat (6/9) sore, dia mengatakan ekspansi bisnis secara internasional itu patut diapresiasi. “Tapi saya fikir ada yang paling penting jaringan dan coverage area di dalam negeri harus sudah di level aman. Suara jernih dan tidak terputus-putus,” tuturnya. Standar internasional itu nantinya akan diseleksi oleh konsumen. “Semakin baik tentu pelanggan bertambah. Begitu sebaliknya. Layanan sesuai standar global dan melebarkan sayap ke luar negeri adalah bentuk kemajuan operator ini. Dengan bendera Indonesia mereka berani ekspansi,” kata dia. “Namun saya menangkap ada satu hal yang sekarang membelit operator selular dalam mengembangkan coverage di Indonesia. Ada keinginan mereka membangun tower di daerah-daerah namun

terkendala peraturan daerah,” katanya. Menurut Parlindungan Purba, harusnya ada kemudahan dari pemerintah daerah kalau operator selular mau membuka daerah terisolir dari sisi komunikasi. “Kenapa mereka di luar negeri dipermudah, di dalam negeri malah kita dipersulit. Jadi saya ingin kalau niatnya untuk membuka daerah terisolir dan memperkuat coverage area harusnya pemerintah daerah memudahkan dan menggratiskan izin itu,” jelasnya. Ke depan, Parlindungan yakin bahwa bisnis di Indonesia ini hanya aka nada 3T. “Dan pemerintah daerah harus menangkap peluang itu. 3T yang dimaksud adalah telecommunication, transportation, dan tourism,” jelasnya. Jadi tidak mungkin transportasi dan tourism berkembang di daerah kalau tidak didukung telekomunikasi, ujar Parlindungan. “Poin pentingnya saya kira siapa pun kita harus mendukung sektor telekomunikasi ini. Kemudian soal layanan kartu 2 in 1 tadi cukup bagus mendukung komunikasi tenaga kerja kita,” kata Parlindungan yang juga memiliki perusahaan jasa tenaga kerja Indonesia. “Itu menguntungkan TKI kita. Tapi maunya bisa juga kita isi pulsanya di sini dan di sana tanpa harus ganti kartu. Begitu juga nomornya harus aktif di sini dan di sana. Karena tahu sendirilah kadang orangtua TKI kita itu di kampung sulit menekan nomor negara lain yang pakai kode area. Jadi baiknya biar tidak bingung, nomor yang dipakai tak berubah-ubah sampai ke negara tujuan,” jelasnya. Sambutan serupa juga disampaikan Pjs. Ketua Kadin Sumut Tohar Suhartono. Menurutnya, bagi pengusaha sekarang sektor telekomunikasi itu sangat penting. “Kita perlu kepastian coverage dan jaringan yang baik. Karena pengusaha tidak lagi bisa bertemu setiap hari. Jadi tinggal memanfaatkan fasilitas komunikasi yang ada.” “Sekarang banyaknya operator selular tentu membuat pebisnis juga harus melakukan pilihan-pilihan bijak. Kalau memang operator selular seperti Telkomsel mau ekspansi ke luar negeri pasti sudah harus sangat siap dengan layanan di dalam negeri,” kata dia. Jangan sampai orientasi bisnis dan ekspansi itu malah mengabaikan kepentingan dalam negeri, tuturnya. “Saya berharap ketika kita berkendara pun tidak ada lagi jaringan blank. Semua terisi,” ujarnya. Seperti apa respon warga Indonesia yang tinggal di luar negeri mendegar ekspansi Telkomsel tersebut? Yulianis, salah satu TKI di Ipoh Malaysia yang dihubungi ikut menyambut hadirnya layanan kartu AS 2 in 1 Telkomsel. “Saya mau pakai itu. Soalnya selama ini saya pakai nomor di sini dan beberapa kali malah coba pakai telefon umum kartu Malaysia,” ujarnya. Padahal dia tak ingin ganti-ganti nomor dan kartu agar mudah dihubungi keluarga dari kampungnya di Pekan Baru. Menariknya, sambutan itu juga datang dari warga negara Indonesia yang tinggal di Dubai. Waspada yang menghubungi dua warga Indonesia yang tinggal di kawasan Karama Dubai, yaitu M Amin, pemilik restoran Java Café dan Jajang, pengerah jasa tenaga kerja asal Cianjur, ikut senang mendengar ekspansi perusahaan Indonesia itu. “Ya sebenarnya kalau di sini pasti belum akan ada kerjasama mungkin. Tapi kita berharap nanti mereka melebarkan sayap sampai di sini karena banyak juga orang Indonesia tinggal di Dubai ini,” tuturnya. Harapan mereka tentu bukan sekadar isapan jempol. Tim Waspada yang sempat melakukan perjalanan jurnalistik ke negara itu Mei lalu menemukan dari berbagai jenis operator selular Indonesia hanya Telkomsel yang memiliki kerjasama dengan operator setempat dan bisa aktif. Termasuk paket BlackBerry dan internet tanpa harus ganti kartu. Anggota tim yang menggunakan operator lain harus bongkarbongkar handset untuk menggantinya dengan simcard operator setempat semisal Etisalat. Jadi setelah 18 tahun Telkomsel melayani Indonesia, target selanjutnya pastilah ekspansi global. Tentu dengan tidak meninggalkan kualitas layanan terbaik untuk anak negeri. *Armin Nasution


Aceh

WASPADA Rabu 11 September 2013

Empat Calon Wali Kota Subulussalam Cabut Nomor

Baitul Mal Aceh Sosialisasi Kesadaran Zakat BLANGKEJEREN (Waspada) : Baitul Mal Provinsi Aceh bersama Baitul Mal Kabupaten Gayo Lues melakukan Sosialisasi Kesadaran Zakat Gayo Lues. Sosialisasi tersebut digelar di Balai Musara Pendopo Bupati Gayo Lues, Selasa (10/9). Sekretaris Baitul Mal Gayo Lues, Syamsul Bahri mengatakan, sosialisasi tersebut diikuti 100 peserta berasal dari unit kerja instansi dinas, lembaga teknis daerah, kantor kecamatan, TNI,Polri, pegawai BUMD serta instansi vertikal lainnya dan para pengusaha lokal di Gayo Lues. “Sosialisasi ini untuk mewujudkan profesionalisme pengelolaan di Kabupaten Gayo Lues, dengan tujuan untuk meningkatkan penerimaan zakat, infaq dan shadaqah dalam rangka pencapaian target Pendapat Asli Daerah (PAD) dari sektor zakat pegawai pada 2013,” ujarnya. Kata Syamsul, kegiatan sosialisasi bertujuan untuk meningkatkan pemahaman dan kesadaran para Muzakki khususnya kalangan profesi baik pemerintah maupun swasta untuk menunaikan Zakat melalui Baitul Mal agar dapat disalurkan kepada penerima Zakat dan untuk kemashlahatan umat. Sosialisasi dirangkai pemaparan makalah oleh Armiadi Musa, Kepala Baitul Mal Aceh dengan judul Zakat Dalam Ketentuan Fiqh dan Regulasi dan pemaparan sesi kedua oleh Almisriadi dan Samsul Bahri dari Baitul Mal Kabupaten Gayo Lues. (cjs)

SUBULUSSALAM (Waspada) : Empat pasangan cakal Wali Kota/Wakil Wali Kota Subulussalam melakukan pencabutan nomor urut. Jadwal yang direncanakan pukul 14:00, dibuka pukul 14:45 oleh Ketua KIP, Syarkawi Nur. Pasangan Asmauddin - Salihin Berutu (Asli) tiba di Sekretariat KIP pukul 14:15 disusul Affan Alfian Bintang-Pianti Mala (AMAL), dua menit kemudian, disusul Merah Sakti-Salmaza, menaiki mobil Kijang Innova BK 546 TY pukul 14:26 dan terakhir dari jalur independen Sarifuddin - Musmuliadi Jabat pukul 14:37. Membuka rapat pleno terbuka pengundian dan penetapan nomor urut pasangan calonWali Kota/WakilWali Kota Subulussalam 2013 di aula Komisi Independen Pemilihan (KIP), Selasa (10/ 9), Ketua KIP Syarkawi Nur mengajak masyarakat setempat menjaga kebersamaan dan senantiasa menjunjung tinggi nilai-nilai persatuan dan kesatuan. Proses pemilihan dipandu Devisi Teknis Pencalonan KIP, Sumardi P diawali pencabutan no-

KIP Pidie Lakukan Uji Petik SIGLI (Waspada): Komisi Independen Pemilihan (KIP) Pidie, Rabu (10/9) melakukan uji petik Daftar Pemilihan Sementara Hasil Perbaikan (DPSHP) Pemilu 2014. Kegiatan itu dilakukan untuk keakuratan data. Sebab, banyak pemilih datang dan keluar pada suatu daerah. Ketua pokja Panitia Pendaftaran Pemilih (Pantarlih) KIP Pidie T Samsul Bahri mengatakan, kegiatan itu dilakukan pada beberapa lokasi, antara lain, Kecamatan Kota Sigli, Grong-Grong dan Indrajaya. Ia mengungkapkan dari pendataan yang dilakukan, dengan mengambil sample pada beberapa titik lokasi tersebut sangat jelas terlihat masih ada warga yang namanya belum terdaftar sebagai pemilih. Padahal, sejak Maret 2013 mulai dari tahapan Coklit sudah dilakukan sosialisasi. Menurut Samsul, data yang dilakukan pihaknya itu dibuat secara online. KIP Pidie akan melakukan rapat pleno terbuka dalam waktu dekat guna melakukan penetapan daftar pemilih tetap pada 13 September 2013. (b10)

Nelayan Minta Kuala Krueng Beuracan Dikeruk MEUREUDU (Waspada) : Sejumlah nelayan Pangwa, Kec. Trienggadeng dan Rhieng Krueng, Kec. Meureudu, Kabupaten Pidie Jaya meminta kepada pemerintah daerah setempat segera mengeruk Kuala Krueng Beuracan, yang kondisinya sejak lama sudah dangkal. Sehingga mengakibatkan nelayan kewalahan saat pulang pergi mencari ikan dengan menggunakan boat. Menurut beberapa nelayan setempat, Selasa (10/9), kuala (muara) yang dijadikan nelayan tersebut untuk bersandar boat tradisional mereka sudah lama dangkal. Sehingga sangat sulit saat keluar dan masuk boat. “Sudah lama dangkal kuala tersebut, banyak kita melihat nelayan mengeluh. Kita meminta kepada pemerintah agar mengeruk kuala Krueng Beuracan, demi memudahkan para nelayan keluar masuk ke kuala,” pinta Ahmad, nelayan setempat. Hal itu diakui MYusuf, nelayan lain. Di saat sejumlah nelayan mengeluarkan boatnya untuk mencari ikan, mereka harus menunggu air pasang dulu, begitu juga saat para nelayan pulang, juga harus menunggu air pasang. (b09)

Jalan Geumpang-Beureunuen Longsor SIGLI (Waspada) : Hingga kini arus lalu lintas di kawasan Geumpang-Beureunuen masih terganggu dengan ancaman longsor di banyak titik seperti di kilometer 10,11 dan 6 di kawasan Geumpang, Kabupaten Pidie. Kondisi itu sangat riskan bagi pengguna jalan yang melintasi di jalur tengah tersebut. M Yacob Sabi, seorang tokoh masyarakat Geumpang, Selasa (10/9) mengatakan, kondisi jalan lintas provinsi yang pasca tsunami Aceh dijadikan jalur alternatif ke kawasan Barat-Selatan Aceh, hingga sekarang di banyak titik masih terjadi rawan lonsor yang belum tertanggulangi. Disebutkan MYacob, kondisi jalan provinsi di kawasan pegunungan penuh tanjakan dan penurunan, juga banyak terdapat tebing dan jurang yang sangat terjal membutuhkan kehati-hatian setiap pengguna jalan. Camat Geumpang, Saifullah mengatakan, di saat musim penghujan jalan Geumpang-Beureunuen terjadi longsor. (b09)

Satpol PP Nagan Raya Razia PNS NAGAN RAYA (Waspada) : Aparat Satuan Polisi Pamong Praja dan Wilayatul Hibah Kabupaten Nagan Raya melakukan razia para PNS dan tenaga kontrak saat berkeliaran pada jam kerja, Selasa (10/9). Selain itu dalam razia tersebut sejumlah siswa yang berkeliaran saat jam belajar juga dijaring aparat Satpol PP, namun razia gabungan Satpol PP dengan WH yang dilakukan sejumlah PNS kucar kacir saat razia itu dilakukan. Kepala Satpol dan WH Muhajir Hasballah mengatakan, razia ini dilakukan sesua qanun yang berlaku, untuk penertiban PNS dan kontrak serta memberi nasihat para pelanggar dan juga penertiban siswa supaya tidak berkeliaran pada saat jam belajar. Kadis Syariat Islam Abdul Kadir mengakui razia ini untuk memberikan simbol Syariat Islam yang sudah berlaku. (cb07)

Waspada/Muji Burrahman

Kepala Satpol PP Nagan Raya Muhajir Hasballah saat memberi pembinaan kepada salah satu PNS yang terjaring razia di Jeuram, Selasa (10/9)

Tertibkan Truk Kelapa Sawit NAGAN RAYA (Waspada) : Warga Seuneam di Kecamatan Darul Makmur, Kabupaten Nagan Raya meminta Pemkab Nagan Raya untuk menghentikan lalu lalang truk tronton di wilayah itu karena jalan tersebut membuat warga sekitar tidak menghidup udara segar. Aktivis ISMKMI (Ikatan Senat Mahasiswa Kesehatan Masyarakat Indonesia) Aceh Ari Saputra dan juga tokoh muda Alue Kuyun Tendra mengharapkan pada pemerintah Nagan Raya jalan tersebut untuk fasilitas umum khususnya untuk kepentingan masyarakat umum yang dibangun melalui uang rakyat dari dana oksus daerah bukan dana patungan dari pengusaha sawit “Seharusnya yang digunakan untuk kalangan masyarakat maka dari itu kami merespon dari aduan masyarakat sering masuknya alat berat seperti mobil tronton interkuler yang selalu meresahkan masyarakat dan kenyamanan pengguna jalan,” katanya. Anggota Dewan Fraksi Partai Aceh, Komisi B Hasanah mengatakan, jalan yang selama ini dikeluhkan warga Seuneam itu akan dilakukan koordinasi dengan dinas terkait. (cb07)

B9

Waspada/Khairul Boangmanalu

PASANGAN calon Wali Kota/Wakil Wali Kota Subulussalam foto bersama usai cabut nomor undian, Selasa (10/9) di aula KIP setempat.

Penerapan UUPA Tergantung Aceh BANDA ACEH (Waspada): Pakar hukum Universitas Gadjah Mada Yogyakarta Zainal Arifin Mochtar mengungkapkan, keberhasilan penerapan Undang-Undang Nomor 11 Tahun 2006 tentang Pemerintahan Aceh atau UUPA sangat tergantung pada orang Aceh itu sendiri. Zainal mengutarakan itu dalam seminar delapan tahun MoU Helsinki yang diselenggarakan Forum Demokrasi Aceh (FDA) di Hermes Hotel Banda Aceh, Senin (9/9). Dia mengakui, terlalu banyak dilema dalam proses implementasinya. Kata dia, yang membuat banyak poin dalam UUPA yang tidak bisa diselesaikan oleh Dewan Perwakilan Rakyat Aceh, karena persoalan kapasitas dan kemampuan. “Tahun 2011 lalu,

Aceh paling telat menyerahkan Qanun APBA sehingga kena penalti 30 persen,” ujar dia. Karena itu, dia mendesak elemen sipil untuk mengawal penggunaan anggaran di Aceh. “Komponen sipil di Aceh perlu mendorong untuk bagaimana membuat budget partisipatif,” ujar dia. Zainal memberi contoh, telatnya pengesahan anggaran itu, akibat masih dililit persoalan kapasitas dan kemampuan para anggota dewan di daerah itu. “Jadi, tidak mudah bagi Aceh untuk mengimplementasikan UUPA,” ujarnya. Menurut dia, persoalan korupsi juga menjadi dilema tersendiri, apalagi Aceh termasuk yang tertinggi sesuai data Komisi Pemberantasan Korupsi (KPK). Bahkan lebih tinggi dibandingkan kasus korupsi di Sumatera Utara. Katanya, dalam hal ini pemerintah pusat juga ikut punya andil. Zainal memberi contoh

permasalahan bendera Aceh yang hingga kini belum ada kejelasan. Pada sisi lain peme-rintah ibarat memberikan“cek kosong”. “Jika pusat melakukan kesalahan, masyarakat Aceh tak perlu takut untuk menegur,” papar dia. Selain Zainal, seminar mengusung tema “Kemana Arah Pembangunan dan Perdamaian Aceh” itu juga menghadirkan pengamat militer Jaleswari Pramodhawardani, Munawar Liza Zainal, anggota tim perundingan GAM di Helsinki dan Fachrul Razi, mantan juru bicara Partai Aceh. Anggota DPRA Abdullah Saleh menyebutkan, penerapan UUPA belum sempurna, karena itu masih memungkinkan untuk diperbaharui. Kata dia, ada beberapa substansi dalam UUPA bertabrakan dengan MoU Helsinki dan UU lainnyayangberlakusecaranasional. “Ada beberapa substansi dalam UUPA yang perlu ditambah dan disesuaikan,” ujar dia. (b07)

Satukan Sikap Tegakkan SI BANDA ACEH (Waspada): Kalangan ulama meminta pemuda muslim Aceh khususnya agar menyatukan sikap dalam menegakkan Syariat Islam yang sudah diberlakukan secara menyeluruh (kaffah) di provinsi ini. “Saya optimistis dengan satu sikap yang sama generasi muda, maka Syariat Islam di Aceh akan tegak seperti diharapkan mayoritas masyarakat,” kata Ketua Majelis Permusyawaratan Ulama (MPU) Aceh Ghazali Mohd. Syam usai membuka Muzakarah masalah Keagamaan yang digelar MPU Aceh, Selasa (10/9). Dikatakan, pemerintah pusat memberi kekhususan untuk Aceh dalam menjalankan Syariat Islam secara kaffah.

Karena itu, kata Ghazali, tujuan muzakarah tersebut adalah dalam upaya menyikapi Aceh ke depan di tangan generasi muda saat ini. “Kami mencoba menggugah semua komponen masyarakat akan pentingnya peran bersama terutama generasi muda yang memiliki tenaga lebih dibandingkan orang tua,” jelasnya. Menurutnya, muzakarah kali ini juga sebagai bentuk kaderisasi pemuda untuk meningkatkan kualitas keilmuan dan wawasan serta menyamakan visi dan misi sehingga tujuan mulia yang dicita-citakan bisa tercapai. Dia juga menyebutkan, peran pemuda saat ini penting untuk menghadapi problema-

tika Aceh ke depan yang sarat dengan tantangan disebabkan semakin berkurangnya jumlah ulama dan cendikiawan yang memiliki kemampuan. “Jadi, saya juga mengajak semua komponen masyarakat bersama-sama generasi muda untuk mencurahkan pikiran bagi kemajuan Aceh sebagai salah satu provinsi yang bersyariat Islam,” terang mantan Kakankemenag Aceh itu. Sekretaris MPU Aceh Saifuddin Puteh selaku ketua panita mengatakan, muzakarah masalah keagamaan II tahun 2013 ini diikuti 80 peserta, yakni dari unsur organisasi kepemudaan, ormas Islam, alim ulam dan santri dari berbagai kabupaten/kota di Aceh. (b02)

mor antrean, berdasarkan daftar kehadiran, diawali Asmauddin, Affan Alfian Bintang, Merah Sakti dan Syarifuddin. Secara berurut, pasangan Affan Alfian Bintang-Pianti Mala (AMAL) meraih nomor urut 1, disusul Syarifuddin-Musmuliadi Jabat nomor urut 2, Merah Sakti-Salmaza nomor urut 3 dan pasangan Asmauddin - Salihin Berutu (ASLI) nomor urut 4. Rapat pleno diakhiri penandatanganan berita acara pleno berdasarkan nomor urut kandidat dan tiga anggota dari lima anggota KIP Subulussalam yang hadir. Seperti SK KIP Subulussalam No.30 Tahun 2013 tentang Penetapan Pemasangan Calon, keempat pasangan dari lima pasangan calon yang mendaftar tersebut memenuhi persyaratan sebagai peserta PemilukadaWali Kota/Wakil Subulussalam 2014-2019. Sedangkan pasangan, Syahril Tinambunan dan Sutan Bagindo yang diusung Partai PAN dan PKPB dinyatakan gugur. (b28)

RPP Migas Aceh Dibahas Lagi BANDA ACEH (Waspada) : Rancangan Peraturan Pemerintah (RPP) tentang pengelolaan sumber daya alam minyak dan gas bumi Aceh yang masih belum ada kesepakatan antara pemerintah Aceh dengan pusat, akan dibahas kembali dalam pertemuan pada 13-14 September 2013 ini di Jakarta. “RPP migas masih dalam pembahasan antara pemerintah Aceh dan pusat. Jadi akan ada pertemuan 13-14 September di Jakarta,” ungkap T Setia Budi, Sekda Aceh usai membuka seminar monitoring dan evaluasi penghematan energi dan air di lingkungan pemerintah, Selasa (10/ 9) di Banda Aceh. Menurut Sekda, pembahasan RPP migas itu masih terus berlanjut karena ada pending isu yang belum ada kesepakatan antara pemerin-

tah Aceh dengan pusat. “Ada hal-hal yang belum ada persamaan persepsi dengan pemerintah pusat dan masih terus kita bicarakan,” tuturnya. Salah satu pending isu dalam Rancangan Peraturan Pemerintah (RPP) tentang pengelolaan sumber daya alam minyak dan gas bumi yang masih dibahas, kata Setia Budi, dalam hal mengelola sumber daya alam migas di lepas pantai. “Masalah pengelolaan di atas 12 mil atau 200 mil itu belum ada kesepakatan,” paparnya. Setia Budi sebagai Ketua Tim 6 Pemerintah Aceh ini berharap masalah pending isu RPP tersebut akan selesai dibahas pada pertemuan mendatang ini. “Kita berharap Oktober 2013 atau akhir tahun ini RPP pengelolaan SDA minyak dan gas bumi itu bisa terselesaikan agar tidak berlarut-larut,” harapnya. (b06)

Waiting List Calhaj Bener Meriah Hingga 2027 REDELONG (Waspada): Sebanyak 600 calon jamaah haji asal Bener Meriah yang masuk dalam daftar tunggu (waiting list) harus ngantre hingga 2027 mendatang. “Untuk haji 2013 hanya 49 calon yang akan diberangkatkan. Ini sesuai ketetapan kuota Aceh dan jatah untuk Kabupaten Bener Meriah. Sementara 600 jamaah lainnya masuk waiting list. Jumlah daftar tunggu ini juga baru habis diberangkatkan 14 tahun lagi (2027,” jelas Amrun Saleh, Kepala Kemenag Bener Meriah, Selasa (10/9) di kantornya. Jamaah haji 2013 yang berjumlah 49 orang itu akan deberangkatkan dari Bener Meriah menuju asrama haji Banda Aceh pada 3 Oktober mendatang. Selanjutnya para calon haji tersebut

diberangkatkan ke Jeddah, Arab Saudi, 5 Oktober 2013.”Jamaah haji kita masuk dalam kelompok terbang (kloter) 6,” ucap Amrun. Seharusnya jumlah calon jamaah haji dari ‘negeri merapi itu’ untuk tahun ini 50 orang. Namun dikurangi satu dan dibrangkatkan 49 orang, hal itu lantaran adanya kebijakan pemerintah Arab Saudi yang mengurangi daya tampung jamaah haji asal Indonesia hingga 20 persen. Disinggung soal ada sebagian jamaah waiting list yang telah berusia di atas 80 tahun, dia mengatakan, saat ini tidak ada yang diprioritaskan. Hal itu menyusul terbatasnya daya tampung jamaah haji oleh pemerintah Arab Saudi. (cb09)

Warga Bulohseuma Harus Lawan Perambah Trumon TAPAKTUAN ( Waspada) : Tembusnya pembangunan jalan Kedai Trumon-Bulohseuma di Kecamatan Trumon, Aceh Selatan telah menyebabkan rawannya aksi perambahan hutan dan pencurian kayu di kawasan Suaka Alam Rawa Trumon. “Karena itu, warga Bulohseuma diminta mengawal kelestarian hutan serta melawan oknum yang merambah rawa Trumon ini,” kata Bupati Aceh Selatan T Sama Indra, dalam pertemuan dengan masyarakat Kemukiman Bulohseuma, di Masjid Baitulhalim Gampong Rakit, Bulohseuma, Minggu (8/9). Menurut dia, orang yang merambah hutan di kawasan hutan lindung suaka alam ini, merupakan penjahat yang bakal menghancurkan sendi kehidupan masyarakat di sini. “Karena dia penjahat, harus kita lawan meski teman kita sendiri,” tambah TS, panggilan akrabnya. Selain merusak hutan, eksesnya juga berdampak terhadap buyarnya komitmen Pemkab Aceh Selatan dengan Menhut, tentang pelestarian hutan lindung. “Jika komitmen ini buyar,

maka pembangunan jalan lanjutan akan terkendala,” tambahnya. Bupati juga menyatakan penyesalannya terhadap oknum tertentu yang tega memotong tiang jembatan di kawasan Tepin Tinggi dengan dalih supaya tim Polhut tidak bisa mengangkut kayu tangkapan. “Coba bayangkan, jika jembatannya rusak akan berdampak terhadap putusnya transportasi darat ke Bulohseuma, meski jalannya sudah dibangun,” sebut bupati. Penjagaan ini, kata dia, wajib dilakukan masyarakat secara sadar dan kompak, mengusir para perambah kayu dan perusak hutan, sebab dengan lestarinya hutan, menjadikan Kemukiman Bulohseuma segera berkembang maju. Pernyataan bupati diamini anggota DPR Aceh Muslim Aiyub yang turut bersama rombongan. Menurutnya, tahun 2014 mendatang, alokasi dana pembangunan jalan Trumon-Bulohseuma sepanjang 30 kilometer melalui APBA akan diperbesar menjadi Rp40 miliar. (b30)

Pelanggan PLN Dapat Ajukan Keberatan BANDA ACEH (Waspada): Konsumen maupun bukan konsumen listrik dapat mengajukan keberatan kepada PT PLN (Persero) bila dikenakan sanksi dalam pelaksanaan penertiban pemakaian tenaga listrik (P2TL) sesuai Keputusan Direksi PT PLN (Persero) Nomor: 1486.K/ DIR/2011. “Pelanggan bisa menyampaikan keberatannya 14 hari hari kerja setelah kejadian P2TL,” ujar Albert Manurung, Kasubdit Hubungan Komersial Ketenagalistrikan pada Direktorat Pembinaan Pengusahaan Ketenagalistrikan Ditjen Ketenagalistrikan Kementerian ESDM, Selasa (10/9) di Banda Aceh. Usai pembukaan sosialisasi

peningkatan pemahaman masyarakat dalam pemanfaatan tenaga listrik, Albert mengatakan, keputusan Direksi PT PLN (Persero) tentang P2TL tersebut telah ditetapkan dan disahkan Direktorat Jenderal Ketenagalistrikan Kementerian ESDM. Menurut Peraturan Menteri ESDM Nomor 09 tahun 2011, konsumen maupun bukan konsumen yang melakukan pelanggaran pemakaian tenaga listrik dikenakan sanksi berupa tagihan susulan, pemutusan sementara dan/atau pembongkaran rampung. Berdasarkan pasal 13 Kepdir 1486.K/DIR/2011, ada empat golongan penyimpangan pemakaian tenaga listrik, yakni go-

longan I pelanggaran yang mempengaruhi batas daya, dan golongan II pelanggaran yang mempengaruhi pengukuran energi. Serta golongan III pelanggaran yang mempengaruhi batas daya dan pengukuran energi dan golongan IV pelanggaran yang dilakukan oleh bukan pelanggan. General Manajer PT PLN (Persero) Wilayah Aceh Sulaiman Daud menambahkan, pelanggan dapat langsung menyampaikan keberatan kepada kontak center PLN tanpa perantara atau calo yang dapat merugikan pelanggan itu sendiri. (b06)

Waspada/Zamzamy Surya

Bupati Aceh Selatan TSama Indra saat menerima laporan warga menyangkut kebutuhan pembangunan di Bulohseuma, meliputi jalan, listrik dan alat komunikasi

Kader PNA Jangan Kasar Dengan Rakyat

Rancangan Perubahan Anggaran APBK 2013 Sabang

SIGLI (Waspada): Kader Partai Nasional Aceh (PNA) diminta jangan berprilaku kasar dengan rakyat. Apalagi, mayoritas kader partai itu didominasi mantan kombatan Gerakan Aceh Merdeka (GAM). “Enggak usah gagahkan diri, gertak-gertak warga Aceh. Enggak usah bilang sama masyarakat, kalau kali ini tidak pilih kami, ini akan perang lagi di Aceh. Itu tidak usai disampaikan masyarakat, biar partai lain saja yang bilang begitu. “Tetapi kita kader PNA mari

SABANG (Waspada) : Wali Kota Sabang Zulkifli H Adam menyampaikan Rancangan Qanun Kota Sabang tentang Perubahan APBK Sabang Tahun Anggaran 2013 pada rapat paripurna ke6 masa sidang ke-2 DPRK Sabang di gedung dewan, Senin (9/9). Ketua DPRK Sabang Khamaruzzaman dalam pidatonya mengatakan, rapat masa sidang kedua akan berlangsung hingga 9 September. Diharapkan Tim Anggaran dan semua pimpinan SKPK dapat mengikuti acara sesuai jadwal. Wali Kota Sabang Zulkifli H Adam dalam sambutannya menginstruksikan kepada pimpinan SKPK untuk mengikuti setiap rapat pembahasan sesuai jadwal dan tidak diperkenankan keluar daerah kecuali atas seizinnya.

dekati rakyat secara baik-baik. Apalagi dalam waktu dekat ini, akan ada Satgas, jangan cobacoba takutin orang dengan baju Satgas untuk gertak-gertak orang,” kata Ketua BAPPILU PNA, Sofyan Dawod, pada acara pengukuhan BAPPILU dan rapat konsolidasi pemenangan Pemilu 2014 Dewan Perwakilan Wilayah (DPW) PNA Pidie, Rabu (10/9). Dalam kesempatan itu dia, mengingatkan Bappilu untuk bekerja dengan baik dan jangan sombong serta arogan. Tugas

Bappilu sangat besar dalam berusaha memenangkan para calon legislatif (Caleg) di Kabupaten Pidie. Target kursi yang dicapai harus lebih dari partai lain. Soyan Dawod juga menegaskan bahwa PNA merupakan partai lokal terbuka buat siapa saja yang ingin berkarir di bidang politik, namun yang terpenting setelah menjadi kader PNA moral harus baik, sebab PNA partainya masyarakat Aceh. (b10)

Wali Kota Sabang mengatakan, Anggaran Pendapatan sebelum perubahan sebesar Rp 392. 903.537.340.00 berubah menjadi Rp 422. 344.230.855.00 dan mengalami kenaikan sebesar Rp29.440.693.515.00 tau naik 7,49 persen. PAD sebelum perubahan Rp19.877.876.988.00 setelah perubahan Rp 25.353.377.653.00 dan meningkat sejumlah Rp5.475.665.500.00 atau naik 27,55 persen. Dana perimbangan sebesar Rp357. 033.707.699.00 setelah perubahan Rp357.079. 572.080.00 dan meningkat sejumlah Rp45.864. 381.00 atau 0,001 persen, PAD yang Syah sebelum perubahan Rp15.991.952.653.00 dan berubah menjadi Rp39.911.281.122.00 mengalami kenaikan sebesar Rp23.919.328.469.00 atau naik sebesar 149,57 persen. (b31)


Aceh

B10

Retribusi Parkir Langsa Tak Capai Target

SMAN 1 Babahrot Kurang Mobiler ABDYA (Waspada): Setelah melakukan pengecekan langsung berdasarkan hasil laporan komite sekolah terkait kekurangan mobiler sekolah, akhirnyaYayasan Advokasi Rakyat Aceh (YARA) melayangkan surat somasi ke Bupati Aceh Barat Daya. Somasi bernomor: 26/YARA/IX/2013 menekankan Bupati Aceh Barat Daya segera membuat pengadaan kursi dan meja untuk SMA 1 Babahrot. “Investigasi ini kita lakukan berdasarkan keluhan masyarakat di Kecamatan Babahrot, Aceh Barat Daya terhadap tidak adanya mobiler sekolah sebanyak empat kelas di SMA Negeri 1 Babahrot,” kata Direktur YARA, Safaruddin, Selasa (10/9). Dia mengaku juga mengingatkan Bupati Aceh Barat dalam surat somasi tersebut, di mana bupati diingatkan bahwa pendidikan merupakan hak dasar yang dijamin konstitusi seperti tersebut dalam pasal 28C ayat (1). Dia menambahkan, empat ruang belajar SMAN 1 Babahrot tidak mempunyai kursi dan meja. “Untuk itu pihaknya selaku lembaga yang bergerak di bidang hukum, kesehatan dan pendidikan itu telah melakukan somasi ke Bupati Aceh Barat Daya agar segera menyediakan kursi dan meja belajar terhadap empat kelas ruang belajar di SMAN 1 Babahrot,” kata Dafaruddin. (b24)

Gara-gara Main Bola, Sekolah Diserang BANDA ACEH (Waspada) : Puluhan pelajar sebuah SMA negeri menyerang sekolah MAN Model yang berlokasi di Jalan Syiah Kuala, Jambotape Banda Aceh, Selasa (10/9). Belum diketahui pemicu penyerangan, namun diduga dilatarbelakangi kekalahan SMAN dalam pertandingan bola yang digelar kedua sekolah. Akibatnya, satu pelajar luka ringan akibat terkena lembaran batu dan kaca jendela MAN pecah. Seorang pelajar MAN Model mengatakan, pelaku penyerangan merupakan pelajar SMA negeri di jalan T. Nyak Makam, Lampineung, Banda Aceh. Menurutnya, pelaku yang berjumlah sekitar 50 orang datang menggunakan sepeda motor dan langsung menyerang. “Mereka pakai seragam sekolah, kejadian sekitar pukul 12:00, kami sedang pergantian jam pelajaran,” kata pelajar itu kepada wartawan, Selasa (10/9). Menurutnya, sejumlah pelajar menyerang sekolah MAN menggunakan batu. Awalnya, sejumlah siswa sempat menduga jika lemparan tersebut ulah teman mereka yang bercanda.. Pasca penyerangan MAN Model dijaga ketat puluhan personel Polresta Banda Aceh. Petugas juga meminta keterangan sejumlah siswa tersebut. Sementar itu pasca penyerangan 18 pelajar SMA negeri diamankan ke Mapolresta Banda Aceh untuk dimintai keterangan. Polisi juga mengamankan sejumlah sepedamotor siswa yang digunakan untuk menyerangan MAN Model serta menemukan sebilah rencong. Kapolresta Banda Aceh Kombes Moffan MK melalui Kasatreskrim Kompol Erlin Tanjaya mengatakan, seluruh siswa yang terlibat hanya dimintai keterangan dan diberi pengarahan. (cb06)

WASPADA Rabu 11 September 2013

Waspada/Ist

DIREKTUR YARA Safaruddin bersama komite sekolah melihat ruang belajar di SMAN 1 Babahrot, Kabupaten Abdya yang kondisinya tanpa mobiler, baik kursi dan meja, Selasa (10/9)

Empat Tersangka Terlibat Korupsi Proyek Site Pile KUALASIMPANG (Waspada) : Aparat penyidik Polres Aceh Tamiang telah menetapkan empat tersangka yang diduga terlibat dalam kasus tindak pidana korupsi proyek pembuatan Site Pile tebing Sungai Tamiang di Kecamatan Kota Kualasimpang, Aceh Tamiang, Senin (9/9). Kapolres Aceh Tamiang AKBP Dicky Sondani melalui Kasat Reskrim Iptu .Benny

Cahyadi menyatakan, keempat tersangka yang diduga ikut terlibat dalam kasus dugaan korupsi Site Pile Tebing Sungai Tamiang adalah FWN, Direktris PT Kayu Mas Alam Indah selaku pihak pelaksana proyek tersebut, warga Kede Bage, Bandung-Jawa Barat. Ram ST (selaku PPTK), warga Desa Benua Raja, Kecamatan Rantau, Aceh Tamiang, MA (menjabat selaku pembantu PPTK), warga Kota Langsa dan Sug (menjabat pengawas lapangan), warga Kota Kualasimpang. Kasus itu berawal pada

LANGSA (Waspada): Retribusi parkir di Kota Langsa yang dibagi dalam dua area parkir yakni retribusi parkir khusus di RSUD Langsa dan parkir umum dinilai tidak akan mencapai target Pendapat Asli Daerah (PAD) 2013. Pasalnya setoran yang dibayarkan pihak ketiga ke pihak kas Dinas Perhubungan Kota Langsa tidak sesuai setoran yang diwajibkan setiap bulan, yakni parkir di RSUD Rp15 juta per bulan (Rp180 juta target PAD per tahun dan parkir umum Rp40 juta (Rp480 juta target PAD per tahun. Hasil penelusuran dan data yang diterima wartawan, Selasa (10/9), tidak tercapainya target PAD 2013 retribusi parkir ini sesuai tabulasi yang menyatakan retribusi parkir umum dari target PAD senilai Rp480 juta mulai Januari hingga Juli hanya masuk ke kas yakni Januari Rp16. 000. 000, Februari Rp16.000.000, Maret Rp20. 000.000, April Rp20.000.000, Mei Rp10.000.000, Juni kosong, Juli Rp10.000.000 (total Rp92. 000.000). Sementara, parkir khusus dari target PAD yang ingin dicapai senilai Rp180 juta, yang disetorkan ke kas Januari hingga Juli yakni, Januari Rp7.350.000, Februari Rp6.500.000, Maret Rp5. 400. 000, April Rp2.000.000, Mei Rp10.000.000, Juni kosong dan Juli Rp4.000.000 (total Rp44.250.000). Kabid Darat Dinas Perhubungan Yanis Prianto membenarkan tabulasi penyetoran retribusi parkir di RSUD dan Umum di Kota Lang-sa bulan Januari hingga Juli berfluktuasi

dan tidak sesuai yang diharapkan. Khusus di bulan Juni yang kosong disebabkan karena digunakan untuk transportasi saat kedatangan Mendiknas ke Kota Langsa untuk penegerian Unsam. Dana yang masuk pada Juni senilai Rp12.500.000 yang selanjutnya digunakan setelah telaah staf yang selanjutnya penggunakan dana itu akan diganti ke APBK perubahan. Kemudian, sebenarnya mekanisme penyetoran dari pihak ketiga langsung melakukan penyetoran ke kas melalui bank. Sementara pihak kami hanya menerima slip setoran saja. Lantas, menyikapi tidak penuhnya penyetoran retribusi parkir dua wilayah parkir itu ada kemungkinan pihak ketiga yang tidak penuh melakukan menyetorkannya. “Nilai kontrak yang kita berikan ke pihak ketiga oleh CV Zona di parkir khusus di RSUD Langsa senilai Rp15 juta per bulan, untuk taget PAD senilai Rp180 juta. Sementara di area parkir umum yang dikelola CV Smart Teknik kewajiban pihak ketiga senilai Rp40 juta per bulan dari target PAD per tahun senilai Rp480 juta,” katanya. Yanis kembali menjelaskan, mengenai kekurangan setoran per bulan yang dilakukan pihak ketiga ini kita telah melakukan peneguran, namun jika masih juga tidak diindahkan. Kemudian disinggung tentang PeraturanWali Kota (Perwal) yang menetapkan parkir senilai Rp2.000 yang mulai dijalankan bulan Juni, namun tidak juga memenuhi target retribusi bulanan. (m43)

2009 dilakukan proses lelang tender pada Dinas Pekerjaan Umum Aceh Tamiang dan untuk paket pekerjaan pembuatan Site Pile tebing Sungai Tamiang di Kota Kualasimpang, kode paket:PG/ATAM/003 masuk ke dalam paket yang dilelang dalam pelaksanaan lelang tender pada Dinas PU Aceh Tamiang untuk bidang pengairan. Aparat penyidik di Polres Aceh Tamiang itu menerangkan, perusahaan yang menang dalam proses lelang untuk paket pekerjaan adalah PT Kayu Mas Alam Indah dengan direkturnya FWN. (b23)

Yayasan Sheep Indonesia Latih Aparatur Kampung KUALASIMPANG ( Waspada): Para aparatur kampung dan kelompok masyarakat dari 6 desa di Kabupaten Aceh Tamiang dan Aceh Timur, mengikuti training (pelatihan) tentang tupoksi aparatur kampung. Pelatihan tersebut difasilitasi Yayasan Sheep Indonesia wilayah Aceh Timur dan Aceh Tamiang berlangsung 10 -11 September di Desa Tampur Bor, Kecamatan Simpang Jernih, Aceh Timur. Area Manager Yayasan Sheep Indonesia Wilayah Kabupaten Aceh Timur dan Aceh Tamiang, Heri Sasmito Wibowo kepada wartawan, Senin (9/9) menyatakan, dalam training terse-but sedikitnya ada 40 perwakilan dari enam gampog di dua kabupaten tersebut yaitu Aceh Timur dan Aceh Tamiang mengikuti pemahaman tentang tugas dan fungsi pemerintah gampong. Selain materi qanun kabupaten tentang tupoksi aparatur kampung, peserta juga diberikan materi tentang undang-undang Keterbukaan Informasi Publik dan berkaitan dangan siklus anggaran perencanaan kampung. Menurut Heri, perwakilan dari 6 desa tersebut yaitu Desa Tampor Bor, Desa Batu Sumbang, Desa Melidi, Desa Tampor Paloh dari Kabupaten Aceh Timur dan Desa Babo, Desa Baling Karang dari Kabupaten Aceh Tamiang. Heri Sasmito Wibowo mengatakan, latar belakang dilakukannya training tersebut karena pemerintahan gampong belum berjalan optimal karena banyak aparatur gampong yang belum faham tugas dan fungsinya. Selain itu partisipasi masyarakat dalam pembangunan gampong belum optimal. Hal ini diperparah dengan akses informasi yang terhambat karena tidak mengetahui bahwa ada payung hukum yang melin-dungi untuk mengakses informasi. (b23)

Kader PKNU Belum Juga Di-PAW TAKENGEN (Waspada): Ketua Dewan Pim-pinan Cabang Partai Kebangkitan Nasional Ulama (DPC-PKNU) Kabupaten Aceh Tengah, Akmal Khair, mempertanyakan sikap Pimpinan Dewan Aceh Tengah yang hingga kini belum memproses usulan PAW terhadap dua kader PKNU yang pindah partai. Menurut Akmal Khair, Selasa (10/9) di Takengen, PKNU sesuai surat kesepakatan dengan salah satu partai nasional yang lulus verifikasi yakni Partai Gerindra, bahwa kader PKNU yang saat ini masih duduk di dewan, apabila mencalonkan kembali, maka diwajibkan masuk melalui Partai Gerindra. “Namun mereka dua kader PKNU pindah ke PDI-P dan Golkar, saat ini mereka menjadi caleg di partai tersebut, secara resmi partai telah melayangkan surat kepada Ketua DPRK agar dua orang dewan yang duduk dari PKNU segera di-PAW. Tapi, hingga saat ini terkesan ketua DPRK memperlambat proses tersebut ,” ujar Akmal Khair. Ditambahkan, sesuai dengan kesepakatan, apabila titah partai dilanggar, maka partai akan mencabut hak yang bersangkutan selain menge-luarkannya dari PKNU, juga akan dilakukan PAW tehadap yang bersangkutan, hal ini sesuai nota kesepakatan nomor A-200/DPP-03/II/2013 tertanggal 19 Februari 2013. Adapun kedua anggota dewan yang duduk dari PKNU di DPRK Aceh Tengah adalah Muhsin Hasan saat ini pindah dan menjadi caleg di Partai Golkar, kemudian Syamsuddin yang pindah ke PDI-P dan menjadi caleg di partai tersebut. Ketua DPRK Zulkarnaen menyatakan bahwa semua usulan PAW sudah mereka proses dan telah diserahkan ke Komisi A. Ketua Komisi A Wajadalmuna mengakui belum menerima usulan tersebut dari pimpinan dewan, jika ada pasti segera diproses. (b33)

Waspada/Yusri

KADISDIK Aceh Timur A Munir saat memberikan sambutan pada acara mengenang setahun meninggalnya dua guru SM3T di SMPN-1 Simpang Jernih, Selasa (10/9)

Doa Bersama Peringati Meninggalnya Guru SM3T Waspada/Muhammad Hanafiah

Sisa tiang pancang proyek Site Pile Tebing Sungai Tamiang di Kota Kualasimpang tergeletak.

Polisi Temukan Kapal Malaysia IDI (Waspada): Pengungkapan kasus bajak laut sepertinya menjadi prioritas Polres Aceh Timur. Setelah menangkap empat perompak bersenjata api dalam dua lokasi yang berbeda di Desa teupin Panah, Kecamatan Idi Tunong kini polisi gabungan Polres Aceh Timur menemukan satu unit kapal nelayan asal Malaysia, Selasa (10/9) sekira pukul 12:00. Kapal berwarna kuning itu ditemukan persisnya 2 kilometer dari bibir muara Kuala Leuge, Desa Leuge, Kecamatan Peureulak Kota, Kabupaten Aceh Timur. Kapal yang ditemukan jenis KM PKSP (U2) 1575 dengan ukuran 15X3,5 meter. Menurut keterangan di kepolisian, kapal tersebut diduga keras milik nelayan asal Malaysia yang dibajak atau dirompak kelompok tersangka MY alias MD. Namun kondisi kapal hanya yang tersisa mesin induk, sementara yang lain diduga telah dijarah. Kapolres Aceh Timur AKBP Muhajir menjelaskan, penemuan kapal asal negara asing itu berdasarkan buku kapal yang disita atau ditemukan pada saat penggerebekan MY alias MD cs, Jumat (6/9) di sebuah rumah di Desa Teupin Panah.“Buku kapal tersebutdikeluarkanKementerian

Kelautan Malaysia,” ujar-nya. AKBP Muhajir menambahkan, sesuai dengan di buku kapal tertulis nama: Tan Tiang Eng, Nama Kapal PKFB (U2) 1575, Alamat P.93 Bagan Panchor, 34900 P. Remis Perak (Malaysia). “Kapal terbuat dari kayu dan dikeluarkan oleh Kementerian Pertanian dan Kelautan Negara Malasia,” ungkap Muhajir seraya menyebutkan, dalam penemuan kapal tersebut juga didukung informasi masyarakat Peureulak.

Kapolres Aceh Timur melanjutkan, setelah tim gabungan mendapatkan titik lokasi keberadaan kapal, lalu kapal tersebut ditarik dengan menelusuri ‘kuala tikus’ di Desa Leuge ke muara kuala dan selanjutkan diamankan di Pelabuhan Perikanan Pantai (PPP) Idi.“Untuk menarik ke muara agak sulit, karena harus menunggu air pasang. Tapi jika sudah dikeluarkan dari semak-semak, maka nantinya kita akan amankan di Pos Satuan Pol Air di Idi,” paparnya. (b24)

Kapal KM PKSP (U2) 1575 milik warga Malasyia yang dibajak atau dirompak komplotan bersenpi di perairan Selat Malaka, beberapa waktu lalu.

SIMPANG JERNIH (Waspada): Dinas Pendidikan Aceh Timur bersama guru SM3T yang bertugas di kabupaten ini menggelar doa bersama dalam rangka memperingati setahun meninggalnya dua guru SM3T yang menjadi korban terbaliknya boat di aliran sungai Simpang Jernih ketika melaksanakan pengabdian. Adapun kedua guru Sarjana Mendidik Terdepan Terpencil dan Terluar (SM3T) yaitu Winda, asal Ciamis dan Geget Bandung yang keduanya berasal dari Universitas Pendidikan Indonesia (UPI), dan kedua korban kecelakaan boat (perahu mesin) ini akan melaksanakan tugasnya di Desa Melidi, Kecamatan Simpang Jernih. “Kedua korban merupakan pahlawan tanpa jasa bagi anak-anak Simpang Jernih, karena Winda dan Geget rela mengorbankan nyawanya demi kemajuan pendidikan di Aceh Timur,” ungkap A Munir, Kadis Pendidikan Aceh Timur ketika memberikan sambutan usai melakukan doa bersama, Selasa (10/9) di ruang kelas

SMPN-1 Simpang Jernih. Menurutnya, bila hanya mengandalkan guruguru di Aceh Timur saat ini belum mampu bekerja semaksimal mungkin, tetapi dukungan dari guru SM3T sangat membantu dalam menunjang pertembuhan pendidikan bagi anak-anak Aceh Timur, terutama kawasan terpencil dan sangat terpencil. “Untuk kita ketahui bersama bahwa kehadiran guru SM3T di Aceh Timur tidak lain untuk memberikan ilmu pengetahuan bagi murid, pelajar dan siswa di daerah ini,” paparnya. Camat Simpang Jernih Ahmad mengatakan, ilmu yang telah diberikan guru SM3T kepada anak-anak di kecamatan ini merupakan sebuah penghargaan yang tidak mampu dibalas. “Kami mengharapkan ke depan daerah ini bisa maju dari sektor pendidikan dan Disdik tetap mengirimkan guru-guru, baik guru kontrak, PNS maupun guru SM3T, karena masih banyak dibutuhkan guru untuk daerah ini,” papar Ahmad. (cri)

FD Yudisium 77 Sarjana Komunikasi BANDA ACEH (Waspada): Fakultas Dakwah dan Komunikasi IAIN Ar-Raniry Banda Aceh meyudisiumkan 77 sarjana, Selasa (10/9) di aula utama kampus setempat. Para alumni diminta mampu mendeteksi geopolitik internasional. Hal itu diungkapkan Dekan Fakultas Dakwah dan Komunikasi A Rani dalam sambutan yudisium. Kata dia, sebagai alumni Fakultas Dakwah dan Komunikasi harus mampu membaca geopolitik internasional pada masa akan datang. “HarusmenguasaiIslamserayaberpe-doman pada Alquran dan Hadits. Juga harus mampu mendeteksi geopolitik dan geobisnis masa mendatang, ke depan dua hal itu yang akan memegang peranan penting,” sebut A Rani. Dia menambahkan, khusus di bidang

disiplin ilmu Dakwah dan Komunikasi, dalam mengem-bangkannya penting untuk menguasai budaya setempat, memahami karakter dan adat istiadat yang berlaku. Lebih lanjut disebutkan, pihak fakultas tersebut sudah mengirimkan enam alumni ke Cina dan satu orang ke Australia. Tahun ini juga telah mengirim satu orang lagi ke Cina bidang ilmu terkait dengan Fakultas Dakwah dan Komunikasi. Wakil Dekan I bidang Akademik Juhari Hasan dalam laporannya mengatakan, tahun ini Fakultas Dakwah dan Komunikasi terjadi peningkatan terutama secara kualitatif. “Prestasi kelulusan dengan predikat istimewa mengalami kenaikan. Semester lalu yang predikat istimewa berjumlah 14 dari 67 sarjana dan semester ini sebanyak 26 dari 77 sarjana, ini mengalami peningkatan 13,32 persen,” ujarnya. (b07)

Pos Kamling Jadi ‘Istana’ Nek Sop Sang MUHAMMAD YUSUF Bin Usman, 50, merupakan penderita cacat yang berdomisili di Gampong Keude, Kecamatan Peudawa,KabupatenAcehTimur. Lumpuh kaki sejak tahun 1993 itu hingga kini tak kunjung sembuh. Kondisinya sangat memprihatinkan, selain hidupnya sebatang karadiajugamenjadiPosKamling sebagai ‘istana’nya. Hasil wawancara Waspada dengan Nek Sop (panggilan akrap MuhammadYusuf) ternyata membuat iba. Usia yang lanjut ditambah penyakit yang dideritanya tak mampu untuk bergerak mencari nafkah sebagaimana manusia lain. Era perdamai-

an sepertinya tak berarti baginya, karena sudah 20 tahun lebih dia tidak bisa berjalan normal, kecuali hanya sebatas duduk di kursi roda, itu sejak 2 tahun yang lalu bantuan dari Dinas Sosial Aceh Timur. Nek Sop mengisahkan, kedua orangtuanya meninggal dunia di Buket Pala (Idi Rayeuk) ketika dirinya berusia 4 tahun. Setelah itu dia tinggal bersama nenek dan kakeknya di Gampong Keude (Peudawa). Saat usianya sudah 20 tahun kakek dan neneknya juga meninggal dunia. Sejak usia 20 tahun hingga sekarang Nek Sop melajang. Namun usia 30 tahun dia didera

penyakit aneh. Ketika itu dia mengira hanya panas dingin biasa, namun tak lama kemudian dia merasa kakinya tak bisa digerakkan dan terus mengecil. Para medis ketika Nek Sop hanya menderita penyakit biasa. Tapi sekitar 3 tahun yang lalu Nek Sop diputuskan menderita penyakit darah manis (DM). Bahkan, Nek Sop sekarang mengaku matanya sudah mulai kabur. “Pos Kamling di desa ini menjadi ‘istana’ buat saya, karena saya tak miliki rumah dan untuk berobat inap juga saya rasa tidak mungkin, karena tidak ada yang menjaga selama dirawat di rumah sakit, tapi saya mengi-

nginkan penyakit ini segera sembuh,” kata Nek Sop dengan bola matang yang berkaca-kaca. Selain kesembuhan yang paling diharapkan, Nek Sop juga menginginkan agar dirinya memiliki rumah sederhana sebagaimana masyarakat lain di Aceh Timur. “Saya sangat berterimakasih atas kunjungan bapak bupati kemarin—Senin 9 September 2013), karena secara pribadi bupati juga telah membantu modal usaha dan dana rehab Pos Kamling,” kata Nek Sop menambahkan. Ketika Bupati Aceh Timur Hasballah M. Thaib tiba, Nek Sop merasa bahagia sehingga

air mata kebahagiaannya keluar tanpa disadarinya. Selain bantuan uang tunai untuk modal usaha, durian yang menjadi dagangan Nek Sop juga dibeli habis oleh Bupati Aceh Timur, bahkan seluruh masyarakat disekitar Pos Kaling ikut menikmati durian Nek Sop yang diborong “Kita sangat prihatin dengan kondisi masyarakat yang hidupnya seperti ini, bahkan sang penderita cacat tersebut mengaku makan dan tidur tidak jelas di mana, bahkan dia sangat sering tidur di Pos Kamling di desa setempat,” kata bupati seraya menambahkan, penyakit yang dideranya harus disembuhkan. M Ishak

Waspada/Ist

BUPATI Aceh Timur Hasballah M Thaib ketika menjenguk Nek Sop (duduk pakai sarung) di sebuah Pos Kamling di Gampong Keude, Kecamatan Peudawa, Aceh Timur, Senin (9/9)


Aceh

WASPADA Rabu 11 September 2013

Pendidikan Dan Pertanian Prioritas APBK Bireuen

HMI Minta Hentikan Acara Miss World LHOKSEUMAWE (Waspada) : Himpunan Mahasiswa Islam (HMI) Cabang Lhokseumawe-Aceh Utara meminta pemerintah untuk segera menghentikan penyelenggaraan MissWorld 2013). Ketua HMI Lhokseumawe, Muhammad Nasrullah menyatakan, penyelenggara MissWorld di Indonesia ini sangat melukai hati rakyat di sini yang penduduknya mayoritas Muslim. Dengan anggaran yang cukup besar untuk menyelenggaran Miss World itu tentunya sangat membantu mereka. Hal itu lebih penting daripada untuk sesuatu yang tidak bermanfaat. Lagi pula umat Muslim saat ini sedang berduka, kenapa kita malah berpesta pora. Secara komersial, sebutnya, penyelenggaraan miss world hanya menguntungkan pihak penyelenggara, perusahaan kosmetik, dan para perancang busana yang sama sekali tidak memberikan manfaat ekonomi secara langsung kepada masyarakat Indonesia, dan hal ini hanya mengesankan untuk menghamburhamburkan uang belaka. (b14)

BIREUEN (Waspada): Upaya peningkatan kualitas pendidikan dan peningkatan kesejahteraan petani menjadi prioritas utama arah pembangunan Kabupaten Bireuen pada tahun 2014, namun bukan berarti mengesampingkan sektor lain. Demikian antara lain disampaikan Bupati Bireuen Ruslan M Daud kepada wartawan pada acara coffee morning dengan para jurnalis, Selasa (10/9) di Meuligoe setempat. Karenanya, dalam Kebijakan Umum Anggaran/Plafon Prioritas Anggaran Sementara (KUA/ PPAS) Kabupaten Bireuen tahun 2014, Pemkab Bireuen mengalokasikan sejumlah anggaran agar program tersebut dapat terealisasi. “Kita

Ngaku Polisi Bawa Kabur Sepedamotor LHOKSUKON (Waspada): Seorang pria muda mengaku anggota polisi dilaporkan membawa kabur sepedamotor milik Hamdani, 60, imam atau Teungku Imum Desa Rayeuk, Kec. Matangkuli, Aceh Utara, Senin (9/9) malam. Sepedamotor jenis vario BL 5131 QE itu dipinjam pelaku dengan dalih menjemput teman. Namun, hingga kemarin siang tidak dikembalikan dan korban pun akhirnya melapor ke Mapolsek Matangkuli. Kapolres Aceh Utara AKBP Gatot Sujono melalui Kapolsek Matangkuli Ipda Sugiono menjelaskan, pemuda berbadan tambun, berkulit hitam itu meminjam sepedamotor korban persis di depan Masjid Al Khalifah Ibrahim Keude Matangkuli. “Pelaku berdalih mau menjemput temannya yang sedang makan bakso. Korban diminta menunggu di masjid. Tapi sampai sekarangsepedamotoritubelumdikembalikan,”jelasIpdaSugiono. Kapolsek menambahkan, modus mencuri sepedamotor dengan modus mengaku anggota polisi juga pernah menimpa seorang warga di Desa Matang Peusangan, Matangkuli, beberapa waktu lalu. Warga diimbau hati-hati dan jangan mudah percaya dengan modus pelaku. (b19)

50 Persen Ambulans Puskesmas Tak Layak Pakai LHOKSUKON (Waspada): Dari 31 ambulans di Aceh Utara, hanya 10 unit yang dinilai masih bagus. Sehingga lebih 50 persen sarana angkutan pasien di kabupaten itu tidak layan pakai lagi. Kondisi itu menurut Kadis Kesehatan Aceh Utara, Nurdin dapat mempengaruhi penanganan pasien, terutama yang membutuhkan rujukan. “Namun secara bertahap seluruh ambulans tidak layak, akan kita ganti,” tegas Nurdin. Di antaranya, pada November mendatang akan diserahkan 10 unit ambulans dari bantuan APBN. Sementara tiga unit ambulans bantuan APBK Aceh Utara telah dibagikan kepada tiga puskesmas yang belum memiliki angkutan pasien tersebut.Yaitu, Puskesmas Pirak Timu, Puskesmas Lhokbeuringen (Kecamatan Jamboaye) dan Puskesmas Simpang Tiga (Kecamatan Langkahan). Selain itu untuk meningkatkan pelayanan kepada masyarakat, para bidan dari pegawai tidak tetap (PTT) agar harus tinggal di puskesmas. (b15)

Batu Akik Air Berbentuk Peta Aceh Ditemukan BIREUEN (Waspada): Zulkifli Hs, 38, warga Seuneubok Rawa, Peusangan, Bireuen, beberapa waktu lalu, menemukan satu batu akik air mirip peta Aceh, buaya dan naga. Batu aneh dan langka tersebut kini disimpan di rumahnya dan bila diminta pemerintah kabupaten setempat siap dipamerkan di stan PKA Bireuen di Banda Aceh dalam waktu dekat ini dan siap melelangnya kepada pemerintah. “Saya temukan batu aneh ini kira-kira baru dua hari saya kerja jadi Satpam di perusahaan H Saifannur 2007 lalu,” katanya, Selasa (10/9) saat datang ke Ruang Humas Sekdakab Bireuen. Menurut Khalid, dirinya datang ke kantor pemkab setempat untuk menjumpai dan menceritakan hal ihwal batu kalau dilihat sebelah kiri mirip buaya, bila dilihat sebelah kanan mirip naga dan bila dilihat sebelah atasnya mirip peta Aceh yang penuh dengan uratnya mirip jalan. (cb02)

Tanaman Coklat Terkena Penyakit Aneh LUENG PUTU (Waspada) : Ratusan hektare tanaman kakao di desa Blang Krueng, Kemukiman Jalan Rata, Lueng Putung, Kecamatan Bandar Baru, Kabupaten Pidie Jaya, terkena penyakit aneh. Daun tanaman dan buah itu berguguran dan tidak produktif lagi. Kondisi tanaman kakao itu sudah berlangsung sejak beberapa tahun terakhir. “Dulu tidak pernah terjadi seperti ini. Kami sudah lapor ke Dinas Perhutanan dan Perkebunan (Dishutbun) Pidie Jaya. Katanya, mereka juga tidak mengetahui persis penyakit apa yang sedang melanda tanaman kakao penduduk itu. Pihak dinas terkait sudah sering turun ke lapangan. Tapi sampai sekarang, belum bisa tertanggulangi,” kata Abd Gani, tokoh tani setempat, Minggu (8/9). Ratusan petani kakao (coklat-red) di Kecamatan Bandar Baru, Pidie Jaya mengaku resah dengan serangan hama buah terutama pada musim hujan. Buah coklat mereka sering mendapat gangguan hama sehingga membuat petani menderita kerugian. (b09)

Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Waspada/Zainal Abidin

LEMBAGA Swadaya Masyarakat (LSM) bersama warga kawasan bencana alam di Aceh Utara sedang mengikuti pelatihan dan simulasi di aula Setdakab, Selasa (10/9)

16 Kecamatan Rawan Bencana Alam LHOKSEUMAWE (Waspada): Sebanyak 16 kecamatan di Kabupaten Aceh Utara masuk dalam kawasan rawan bencana alam, terutama banjir. Untuk mengurangi risiko bencana, pemerintah daerah setempat meminta BPBD perlu berkomunikasi dengan pihak TNI yang memiliki peralatan lebih lengkap. Kecamatan yang masuk kawasan bencana alam, terutama sepanjang lintasan Sungai Krueng Pase dan Krueng Keureuto. Di antaranya, Kecamatan Matang Kuli, Pirak Timu, Meurah Mulia, Tanah Luas, Samudera, Lhoksukon, Cot Girek dan

beberapa kecamatan pedalaman lain. “Wilayah Kabupaten Aceh Utara merupakan salah satu daerah yang tergolong rawan terjadi bencana, seperti banjir bandang yang kerap menimpa beberapa kecamatan,” jelasWakil Bupati Aceh Utara Muhammad Jamil pada pelatihan simulasi bencana, kerjasama Badan Penanggulangan Bencana Daerah (BPBD) dengan Forum Pengurangan Risiko Bencana (PBR) setempat, Selasa (10/9). Peralatan pemerintah daerah di BPBD, masih terbatas untuk menghadapi bencana. Baik sebelum terjadi (pra-bencana) maupun setelah musibah (pasca-bencana). “Sehingga BPBD perlu selalu berkomunikasi dengan pihak TNI yang memiliki peralatan lebih canggih,” ungkapnya. Selain itu, dia juga meng-

harapkan para pemuda di kawasan bencana alam diberdayakan sebagai relawan. Para pemuda yang masih gesit akan sangat membantu dalam menghadapi bencana. Sekitar 100 peserta mendapat pengetahuan menghadapi bencana, pada pelatihan dan simulai bencana. Mereka berasal dari siswa, tokoh masyarakat dan Muspika dari kecamatan rawan bencana. Ikut juga perwakilan ORARI, RAPI dan unsur pers sebagai penyampai informasi akurat terhadap bencana alam. Kepala BPBD Aceh Utara Junaidi meminta peserta serius mengikuti simulasi agar bisa membantu korban ketika tibatiba terjadi bencana. BPBD juga akan selalu berkomunikasi dengan pihak-pihak yang selama ini banyak membantu ketika terjadi bencana, seperti BMKG dan pihak TNI. (b15)

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35

12:50

SJ 011 Medan/Jakarta

13:35

12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45

14:00

FY 3400 Penang*

14:20

PANTONLABU (Waspada): MS, 47, tersangka penganiaya Saimun, 45, Keuchik Seuneubok Pidie, Kec. Tanah Jambo Aye, dijerat dengan pasal 351 ayat 1 KUHP, dengan ancaman hukuman maksimal 2 tahun 8 bulan atau 32 bulan penjara. Mantan Keuchik Seuneubok Pidie ini diduga ikut memukul korban saat kisruh rapat evaluasi keuangan desa, di Meunasah Desa Seuneubok Pidie, Minggu, 1 September 2013. Sementara abang MS, Zkl, 50, dijerat dengan pasal 351 ayat 2 tentang penganiayaan berat, dengan ancaman hukuman 5 tahun penjara. “Tersangka Zkl, diduga orang yang menikam korban dengan pisau. Sedangkan tersangka MS diduga hanya memukul dengan tangan,” kata Kapolres Aceh Utara AKBP Gatot Sujono melalui

KapolsekTanah Jambo Aye Iptu Mukhtar ke-marin. Didampingi Kanit Reskrim, Bripka Jasman, Kapolsek menambahkan, penyidikan kasus tersebut sedikit tersendat karena saksi korban masih dirawat di Rumah Sakit TNI AD Lhokseumawe. Saimun belum bisa dimintai keterangan karena masih sulit diajak bicara. Sementara mengenai dugaan tersangka Zkl sakit jiwa, di mana tersangka dikabarkan pernah menggorok leher anaknya hingga tewas tahun 90-an, dugaan itu baru bisa dipastikan setelah tersangka Zkl dibawa dan diperiksa di Rumah Sakit Jiwa (RSJ) Banda Aceh. “Jadwal pemeriksaan tersebut belum ditentukan. Kita masih fokus memeriksa saksi-saksi untuk memperjelas duduk perkara sebenarnya,” tutur Iptu Mukhtar. (b19)

BRA Tagih Janji Pemerintah Aceh LHOKSEUMAWE (Waspada): LSM Banser Rakyat Aceh (BRA), organiasasi mantan kombatan GAM di 17 kabupaten/kota di Aceh menagih janji Pemerintah Aceh sesuai MoU Helsinki. Pasalnya, pasca damai mereka masih hidup dengan ekonomi morat marit. Hal ini disampaikan Juru Bicara BRA Provinsi Aceh Saifan alias Koramil dalam konferensi pers di Cafe Bahari Hagu Selatan, Lhokseumawe, Senin (9/9). Dihadiri Ketua BRA Provinsi Aceh Effendi M Ali serta pengurus dari provinsi dan dari cabang di Aceh Utara dan Kota Lhokseumawe. “Seharusnya kehidupan rakyat Aceh sudah lebih baik dari sektor ekonomi. Namun saat ini kondisi masyarakat jauh dari harapan dan janji

yang pernah diucapkan dulu. Bahkan banyak mantan kombatan yang dulu sama-sama mengangkat senjata dalam barisan GAM, tapi saat ini juga ikut terpuruk dari segi ekonomi,” tutur Saifan. Lanjutnya, padahal sesuai dengan MoU Helsinki delapan tahun silam dan pernah dijanjikan kepada mantan kombatan GAM akan diberikan lahan seluas 2 hektar untuk dikelola sebagai mata pencaharian. Namun, janji itu sampai sekarang katanya, tidak pernah terealisasi. Sementara mantan GAM yang dekat dengan kekuasaan, bisa hidup layak dari segi materi. “Seharusnya Pemerintah Aceh lebih fokus dalam mensejahterakan rakyat di bidang ekonomi. Jangan menghabiskan energi hanya masalah bendera dan lambang saja,” tegasnya. (cmk)

Waspadai Calo CPNS ACEH UTARA (Waspada): Jika tidak ada pergeseran waktu, pada 3 November 2013, 1.500 tenaga honorer yang masuk dalam kategori 2 di Kabupaten Aceh Utara akan diuji kompetensi dasar dan kompetensi bidang studi. Hal tersebut disampaikan Anwar Adlin, Kepala Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Aceh Utara, Selasa (10/9) di ruang kerjanya. Kata dia, tes CPNS untuk honorer kategori 2 langsung dilaksanakan panitia dari MenPAN. Soal ujian juga disiapkan di Jakarta. “Kita cuma menyiapkan tempat dan sekarang kita sedang mencari tempat cocok untuk dilaksanakan tes tersebut. Ada dua pilihan tempat yang sedang kita lirik, satu di Lhoksukon dan di Kota Lhokseu-

mawe. Sampai sekarang belum bisa kita tentukan lokasinya. InsyaAllah secara bertahap akan kita beritahukan,” kata Anwar Adlin. Jumlah honorer kategori 2 di Aceh Utara yang dibolehkan untuk mengikuti ujian 1.500 orang, itu artinya tidak ada penambahan dan pengurangan jumlah. Para honorer kategori dua diminta untuk tidak khawatir menyangkut kepesertaan mereka pada ujian tersebut. Bagi mereka juga diinformasikan tidak dibebankan untuk membuat permohonan. Kepada 1.500 orang itu nantinya diserahkan kartu ujian. Ditanya bagaimanan nasib 356 honorer kategori 1, Anwar Ad,lin mengatakan, sampai saat ini pihaknya belum mendapat informasi akurat dari MenPAN. 356 Honorer tersebut masuk

dalam daftar tidak memenuhi kriteria (TMT). Kalau memang mereka diduga tidak dapat diluluskan melalui kategori 1, maka diharapkan 356 orang tersebut dapat mengikuti uji kompetensi dalam kategori 2. Anwar Adlin mengimbau semua honorer kategori 2 untuk tidak tergiur dengan janji-janji para calo karena keputusan lulus tidaknya para peserta sangat bergantung pada panitia dari pusat. “Mohon pesan saya ini diindahkan, kalau tidak anda akan rugi besar. Kami juga tidak pernah menjanjikan siapapun akan lulus pada tes tersebut. Jika ada orang yang menjual nama BKPP, jangan dipercaya dan kami minta laporkan lansung kepada pihak berwajib,” papar Anwar Adlin. (b18)

Mahasiswa Jepang Berkunjung Ke Umuslim BIREEUEN (Waspada): Lima perwakilan mahasiswi dari Jepang berkunjung ke Universitas Almuslim (Umuslim), Peusangan, Bireuen, Selasa (10/9). Rektor Universitas Almuslim Amiruddin Idris melalui Kabag Humas Zulkifli, Selasa (10/9), mengatakan, kehadiran perwakilan mahasiswa Jepang tersebut dalam rangka kunjungan silaturahim dan juga menjajaki beberapa program dan dikembangkan.“Kehadiran mereka merupakan tindaklanjut

hasil pembicaraan waktu rombongan Umuslim berkunjung ke Jepang, beberapa waktu yang lalu,” katanya. Menurutnya, ada beberapa agenda yang akan dilakukan perwakilan mahasiswa tersebut, antara lain pertemuan dengan civitas akademika, dialog antar mahasiswa dan latihan bersama tari saman di sanggar Mirah Delima. “Mahasiswi Jepang yang datang itu, adalah, Adachi Kokoro (Ryukoko University, Kyoto), Gomori Kanako (Aoyama Ga-

kuin University, Tokyo), Mikami Maho (Aoyama gakuin Women’s Collage,Tokyo), Yonemori Rio (Aoyama Gakuin University, Tokyo) dan Saeki Natsuko (Lembaga Nindja Tokyo),” katanya. Kehadiran lima mahasiswa Jepang tersebut telah diterima Umuslim melalui faximile beberapa hari lalu. Kehadiran perwakilan mahasiswa tersebut difasilitasi sebuah lembaga NINDJA yang berkedudukan di Tokyo. (cb02)

Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

juga berupaya merealisasikannya, baik melalui APBN maupun APBA,” terang Ruslan. Salah satu cara peningkatan sektor pertanian secara global ini antara lain dilakukannya pembukaan jalan-jalan usaha tani yang telah dilaksanakan pada 2013 yang merata di kecamatan-kecamatan. “Dengan baiknya jalan akses di lokasilokasi perkebunan, para petani kita semakin mudah membawa hasil panen untuk dijual,” ucapnya. Begitupun, katanya, dengan tersedianya jalan yang baik sehingga menciptakan stimulus bagi masyarakat untuk memanfaatkan lahan perkebunan secara optimal yang sebelumnya dibiarkan tak terurus. (b17)

Kasus Penikaman, Mantan Keuchik Terancam Bui

Bupati Teken Surat Penegerian Umuslim BIREUEN (Waspada): Bupati Bireuen Ruslan HM Daud mengatakan dirinya telah menandatangani dan mengirim surat permohonan penegerian Universitas Almuslim (Umuslim) Peusangan, Bireuen. “Surat usulan penegerian Umuslim telah saya tandatangani dan telah dikirim ke Jakarta,” katanya di Meuligoe Bupati Bireuen, Selasa (10/9). Menurut bupati, bila Umuslim dinegerikan, sangat banyak keuntungan bagi masyarakat Bireuen, terutama dalam pertumbuhan ekonomi masyarakat di kawasan Peusangan. “Dosen atau pegawai Umuslim yang belum PNS juga kemungkinan besar bisa di PNS-kan juga,” katanya. Ditambahkan, Umuslim dinegerikan, rencana kawasan Peusangan dijadikan kawasan kota pendidikan akan bisa terwujud. Demikian juga kawasan barat akan dijadikan kawasan kota santri juga akan bisa direalisasikan. “Kita mohon dukungan semua pihak untuk penegerian Umuslim,” harapnya. (cb02)

B11

Waspada/Mustafa Kamal

JURU Bicara Banser Rakyat Aceh (BRA) Aceh Tgk Saifan (paling kanan) memberikan keterangan pers di Lhokseumawe, Senin (9/9)

Bireuen Akan Tampil Maksimal Di PKA BIREUEN (Waspada) : Kabupaten Bireuen akan tampil maksimal dalam Pekan Kebudayaan Aceh (PKAI) yang akan berlangsung 20-29 September. Penampilan Kabupaten Bireuen di PKA VI di bidang seni budaya, pameran kerajinan, pemutaran film dokumenter tentang potensi budaya, wisata Kabupaten Bireuen menyambut visit 2018 akan terus diupayakan agar Bireuen menjadi teladan bagi kabupaten/kota lain di Aceh. Lebih khusus lagi dalam pameran akan ditampilkan sekelumit sejarah tentang peranan “Kota Juang Bireuen “ Kemiliteran Tentara Republik Indonesia (TRI) Divisi X Komandemen Sumatera, Langkat dan Tanah Karo di bawah

pimpinan Penglima Kolonel Hussein Joesoef bermarkas di Bireuen. Bupati Bireuen Ruslan M Daud, Selasa (10/ 9) mengatakan, PKA merupakan suatu even terbaik untuk memperkenalkan kembali Kabupaten Bireuen, satu-satunya kabupaten yang letaknya sangat strategis di pertengahan Provinsi Aceh ujung paling barat Sumatera kepada generasi bangsa. Kabag Humas Farhan selaku Ketua Publikasi PKA Kabupaten Bireuen menjelaskan, grup kesenian yang akan tampil dalam lomba PKAVI yakni Rapa-I Geleng, Geuntuet Trieng, permainan rakyat Meuen Galah, tari Saman, seni Kaligrafi, seni theatre rakyat Aceh, Rebana, Seudati Tunang, tari Rabub Lamopuan, zikir maulid, Dalail Khairat.(b12)

Mendesak Pembangunan Jembatan Lampoh Lada MEUREUDU (Waspada) :Warga Desa Lampoh Lada dan desa tetangga sekitarnya di Kemukiman Beuracan, Kecamatan Meureudu, Kabupaten Pidie Jaya sejak lama menginginkan pembangunan jembatan permanen melintasi aliran sungai menghubungkan dengan kota kecamatan dan kabupaten hingga sekarang belum terwujud. Kawasan Lampoh Lada khususnya dan Beuracan pada umumnya merupakan daerah yang memiliki potensi besar bidang pertanian dan perdagangan yang setiap hari warganya mengangkut hasil usahanya ke pasar. Namun jembatan gantung satu-satu ambruk, masyarakat terpaksa mengarungi sungai untuk mengangkut hasi pertanian dan perkebunan mereka. Akibatnya, warga di kawasan itu terus mengeluhkan kondisi jembatan yang dibiarkan ambruk setelah dihantam banjir. Ironisnya lagi,

anak sekolah SD terpaksa harus masuk dan menyeberangi air sungai, ini sangat dikhawatirkan keselamatan anak-anak yang masih berusia 6 hingga 12 tahun menyeberangi sungai. Menurut beberapa warga setempat, Selasa (10/9), pembangunan kembali jembatan yang ambruk dihantam banjir dengan jembatan permanen yang sejak lama dinatikan, dinilai sengaja dibiarkan terbengkalai. Kadis Pekerjaan Umum Pidie Jaya Hanief Ibrahim mengakui kondisi warga di kawasan tersebut sangat sulit dalam memasarkan hasil usahanya sejak ambruknya jembatan, karena dihantam banjir. Kadis PU Pidie Jaya itu meminta masyarakat tetap bersabar, karena jembatan tersebut dalam waktu dekat akan dibangun kembali. Sehingga diharapkan masyarakat bisa mempergunakannya jembatan yang baru. (b09)

Mahasiswa Gelar Zikir

Waspada/abdul Mukthi Hasan

MAHASISWA Jepang foto bersama dan belajar menari bersama Grup Sanggar Mirah Delima di aula MA Jangka, kampus Umuslim, Peusangan, Bireuen, Selasa (10/9)

BANDA ACEH ( Waspada) : Ratusan mahasiswa UTU dan STAI, Selasa (10/9) menggelar zikir dan doa bersama di Masjid Agung Baitul Makmur agar kampus mereka segera dinegerikan oleh Kemendiknas. Zulbaidi, pelaksana kegiatan doa bersama itu menyebut terharu melihat kehadiran mahasiswa. “Semoga Allah SWT mengabulkan doa dan segera UTU dan STAI jadi negeri,” ungkap Zubaidi. Zikir dan doa tersebut dipimpin Ketua Majelis Pemusyawaratan Ulama (MPU) Kabupaten

Aceh Barat Abdul Rani. Tampak hadir para dosen dan karyawan dua lembaga pendidikan tersebut. Zulbaidi yang juga Dekan Fakultas Ekonomi UTU menyebutkan, UTU dan STAI secara administrasi sudah siap, malah seluruh permohonan sudah diserahkan kepada Kemenag, Kemendiknas, MenPAN, DPR RI, Gubernur Aceh, Bupati Aceh Barat, DPR Aceh, DPRK Aceh Barat dan para bupati di wilayah Barat Selatan.“Semuanya sudah siap administrasi sebagai syarat penegerian UTU dan STAI,” papar Zulbaidi. (b08)


Agenda

B12 07:00 Dahsyat 09:00 SINEMA PAGI 11:00 INTENS 12:00 S E P U TA R INDONESIA SIANG 12:30 SI DOEL ANAK SEKOLAHAN (RR) 14:30 Hafidz Indonesia 15:00 SILET 16:00 S E P U TA R INDONESIA 17:00 Tangan Tangan Mungil 18:00 Anak Anak Manusia 19.00 BERKAH 20:00 Layar Drama Indonesia : Tukang Bubur Naik Haji

07:00 SL Inbox 09:00 Halo Selebriti 10:00 SCTV FTV 11.00 Liputan 6 Terkini 12:00 SL Liputan 6 Siang 12:30 SCTV FTV Siang 14:30 SL Eat Bulaga Indonesia 16:00 SL Liputan 6 Petang 17.30 3 Semprul MEngejar Surga 19:15 Pesantren & Rock n Roll Season 3 21.30 Emak Ijah PEngin Ke Mekkah 22.00 Liputan 6 Terkini 22:30 SCTV FTV Utama

07:00 Upin & Ipin Dkk 07:30 Pose 08:00 Layar Unggulan 09:30 Kisah Unggulan 11:00 Di Antara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 13:30 I Drama 15:00 Top Pop 16:00 Lintas Petang 16:30 Tuntas 18:00 Bola Bolu 19:30 Gajah Mada 21.00 Raden Kian Santang 22:00 Hidayah 00:00 Premier Highlights

22.00 Sinema RCTI

CATATAN

07:30 Perempuan Hebat 08:00 Seleb @ Seleb 09:00 KLIK! 10:00 Ngobrol Asik 11:00 New Friends 11:30 Topik Siang 12:00 Seputar Obrolan Selebriti 13:00 Bulepotan 13:30 Chhota Bheem Aka Bima Sakti 14:00 Panda Fanfare Aka Kungfu Panda 14:30 Duckula 15:00 Tom & Jerry 15:30 Curious George 16:00 Mr. Bean 16:30 Topik Petang 17:00 Suka-Suka Nizam 17.30 Pesbukers 19:30 RT Sukowi 20:30 Mel’s Update 21:30 Sinema Spesial 23:30 Cakrawala

07:00 KISS Pagi 08:00 Sinema Tv Spesial 10:00 Pagi Pagi Bagi Bagi 11:30 Patroli 12:00 Sinema Pintu Taubat Siang 14:00 HOT KISS 15:00 Fokus 15:30 Surga Di Bawah Telapak Kaki Ibu 16:00 Drama Asia (Korea): 17:00 Drama Asia (Korea): 18:00 Drama Seri Indonesia: Setulus Kasih Ibu 19:00 Sinema Indonesia 21:00 Drama Seri Keluarga: Brama Kumbara 23:00 Sinema Unggulan

07:05 Bedah Editorial Media Indonesia 08:05 8 Eleven Show 09.05 8 Eleven Show 11:05 Sisi Berita 11:30 Metro Siang 13:05 Wideshot 17:05 Metro Hari Ini 18:05 Prime Time News 20:05 Suara Anda 21:05 Top News 21:30 Economic Challenges 22:30 Sentilan Sentilun 23:05 Politika 23:30 Metro Sports

WASPADA Rabu 11 September 2013

07:30 Mozaik Islam 08:00 Benu Buloe 08:30 Buah Hati 09:00 Ceriwis 09:30 Ala Chef 10:00 Sportvaganza 10:30 Ngulik 11:00 Insert 12:00 Bioskop Indonesia Premiere 14:00 Sketsa 15:00 DR OZ 17.15 Insert Investigasi 21:00 Bioskop TransTV 23:00 Bioskop TransTV

07:00 Live News Apa Kabar Indonesia Pagi 09:00 EnsikloTIVI 0 9 : 3 0 L i v e Ne w s Kabar Pasar Pagi 10:00 Coffee Break 1 1 : 3 0 L i v e Ne w s Kabar Siang 13:30 Ruang Kita 1 4 : 3 0 L i v e Ne w s Kabar Pasar 16.00 Bumi Dan Manusia 1 7 : 3 0 L i v e Ne w s Kabar Petang 19:30 Kabar Utama 2 1 : 3 0 L i v e Ne w s Kabar Malam 22:30 Menyingkap Tabir 23:00 Kabar Arena 2 3 : 3 0 L i v e Ne w s Kabar Hari Ini

07:30 The Penguins Of Madagascar 08:00 Auto B Good 08:30 Sketsa Tawa 09:30 Hot Spot 10:00 Obsesi 11:00 Buletin Indonesia Siang 12:00 Serasi 13:00 Dimas dan Raka 14:00 100% Ampuh 15:30 Fokus Selebriti 16:00 Arjuna 16:30 Si Kriwil Jadi 2 17:30 Spongebob Squarepants 18:00 Komeng Acak Adul 21:00 Box Office Movie 23:30 Box Office Movie

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:30 Selebrita Pagi 08:00 Makan Besar 08:30 Gak Nyangka 09:00 Ups Salah 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Dunia Binatang 14:00 Brownies 14:30 Tau Gak Sih 15:00 Fish N Chef 15:30 Jejak Petualang 16:00 Redaksi Sore 16:30 Indonesiaku 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 23:30 Jam Malam

**m31/G

Mobil James Bond Laku Rp9,5 miliar

Lotus Esprit Wet Nelly/rtr

Mobil kapal selam digunakan dalam film James Bond The SpyWho Loved Me terjual seharga 550 ribu pound atau setara dengan sekitar Rp9,510 miliar dalam sebuah lelang, Senin. Lotus Esprit bercat putih dapat berubah menjadi kapal selam saat digunakan agen rahasia 007 James Bond diperankan Roger Moore. Balai Lelang RM Auctions mengharapkan mobil itu laku hingga 950 ribu pound.

Penawaran dimulai pada harga 100 ribu pound dalam lelang yang ditayangkan langsung di internet. Kendaraan itu dikenal sebagai Wet Nellie dalam film tersebut dan diklaim bisa berfungsi sepenuhnya seperti dalam The Spy Who Loved Me. Wet Nelly merupakan salah satu isi dari suatu gudang di Long Island, New York yang dibeli sepasang suami istri dalam suatu pelelangan pada tahun 1989. Lelang dilakukan tanpa melihat

isi gudang. Ada enam mobil Esprit digunakan dalam pembuatan film itu namun hanya satu mobil yang diubah menjadi mobil kapal selam, kata balai lelang RM Auctions. Balai lelang itu sebe-lumnya menjual Aston Martin DB5 digunakan Sean Connery saat berperan sebagai James Bond dalam film Goldfinger dan Thunderball seharga 2,9 juta pound pada tahun 2010.(ant)

Shah Rukh Khan Mulai Syuting Happy New Year Shah Rukh Khan sedang mengerjakan film terbarunya Happy New Year. Sang aktor Bollywood itu memulai pengambilan gambar pertamanya di Dubai. Farah Khan, sutradara Happy New Year juga menulis hal serupa dalam akun Twitter. “Dimulai hari ini! Terima kasih semua atas semua doa-doanya.” Film Happy New Year juga dibintangi Abhishek Bachchan, Boman Irani, Sonu Sood dan Deepika Padukone. Musik untuk film tersebut dikomposisi Vishal-Shekhar sebelumnya bekerjasama dengan Farah dalam Om Shanti Om dan Tees Maar Khan. Happy New Year rencananya dirilis pada 2014, seperti dikutip dari laman Digital Spy.(ant)

Dion Idol

Jelang NSJF 2013 :

Dion Idol Siap MemberiWarna Baru Shah Rukh Khan/bollywoodworld.com

Lagu Katy Perry Paling Populer Di Inggris

Katy Perry/whitegadget.com

Penyanyi Amerika Katy Perry berhasil mempertahankan keempat kali tempat teratas dalam tangga lagu single Inggris dengan rekaman terbarunya Roar. Dengan telah menjadi nomor satu di Amerika Serikat dan seluruh dunia, lagu berjudul Burn penyanyipenulis lagu Inggris Ellie Goulding terpental dari tempat teratas dalam langkah perdananya pada pekan lalu. Perry yang hit sebelumnya termasuk Firework dan I Kissed a Girl, berhasil menjual 179.500 copy pada pekan lalu, menjadikannya sebagai single dengan penjualan tercepat ketiga dalam tahun ini, menurut Official Charts Company, mengkompilasi daftar mingguan. “Saya suka Inggris,” kata Perry dalam satu pernyataan, “Inggris sangat terkemuka dan bersemangat. Mereka bersemangat. Inggris adalah di mana banyak sekali tren musik dimulai.” Sebaliknya, hanya terdapat sedikit perubahan dalam top 10, yakni ketika penyanyi Swedia DJ Avicii tergelincir satu tempat ke tangga tiga dengan Wake Me Up. Band indie-rock Inggris The 1975 mengambil posisi nomor satu di chart album dengan rilis eponymous baru mereka. Mereka melihat adanya tantangan dari rocker Amerika Nine Inch Nails dan album terbaru mereka Hesitation Marks. Duo hip hop Inggris Rizzle Kicks ‘Roaring 20s’ adalah pendatang baru di nomor tiga.(ant)

Sepenggal Kisah Wanita Tetap Wanita Patah hati ditinggal calon suaminya, Shana (Zaskia Sungkar) memanfaatkan kemampuannya membuat kue untuk mendirikan toko cupcake. Kinan (Shireen Sungkar) bekerja keras untuk membiayai ibunya (Dewi Irawan) yang sakit-sakitan. Sambil membiayai pengobatan ibunya, Kinan juga menyisihkan pendapatannya untuk memberangkatkan haji ibu dan mendiang ayahnya. Ia pun bercita-cita menjadi pramugari di maskapai internasional agar keinginannya lekas tercapai. Nurma (Revalina S Temat) tidak menyangka dapat bertemu kembali dengan cinta remajanya, Andy (Teuku Wisnu). Usai meraih gelar sarjana hukum, ia bekerja di kantor advokat milik mantan guru lesnya. Andy telah beristri dan Nurma pun memiliki tunangan, Iko (Irwansyah). Vanya (Fahrani Empel) menjadi kepala keluarga bagi kedua adiknya, Lola dan Teddy. Lola

menyandang autis dan Vanya, model, berusaha agar adiknya mendapat terapi yang ternyata biayanya tidak sedikit. Adith (Renata Kusmanto) bingung karena penerbit memintanya membuat sebuah novel tentang hubungan asmara. Adith memiliki masa lalu yang tidak menyenangkan dengan laki-laki, memutuskan untuk melajang. “Lo tahu kan, kalau gue udah memutuskan untuk single terus,” kata Adith kepada temannya. Itulah sepenggal kisah dalam film Wanita Tetap Wanita. Menceritakan kisah perempuan dengan status sosial berbeda dan berbagai masalah yang mereka hadapi, film omnibusWanita TetapWanita memiliki benang merah toko cupcake milik Shana. Toko kue milik Shana rupanya menyajikan cupcake paling enak di kota sehingga menjadi tempat pilihan anak-anak muda untuk nongkrong. Sambil menulis, Adith biasa ditemani cupcake capuccino buatan Shana.

Belakangan, Adith mengganti tempat favoritnya menjadi di luar untuk menunggu kekasihnya Rangga (Marcell Domits). Cupcake buatan Shana juga menjadi kesukaan Lola. Vanya kerap membelikan beberapa cupcake untuk sang adik. Ketika Lola berulang tahun,Vanya merayakannya di toko kue Shana. Kinan pun sempat merasakan cupcake yang disebut Iko “cupcake terenak” saat mereka berkencan usai penerbangan Kinan. Sutradara baru Lima plot cerita dalam Wanita Tetap Wanita disutradarai empat sutradara berbeda, Reach The Star dan In Between oleh Irwansyah, First Crush- Teuku Wisnu, Cupcakes- Didi Riyadi, danWith orWithout- Reza Rahadian. Kecuali Reza Rahadian, sutradara juga turut bermain dalam masing-masing cerita. Didi, Irwansyah, danWisnu

mengaku ini pertama kalinya mereka bertindak sebagai sutradara. Para sutradara debutan ini menyajikan kisah ringan dan mudah diikuti. Seperti film Rectoverso diluncurkan awal tahun ini, Wanita Tetap Wanita menyajikan lima kisah dijalin menjadi satu. Bukan judul per judul yang disajikan terpisah seperti beberapa film omnibus. “Menjalin lima cerita jadi satu film itu susah,” kata Irwansyah yang kerap tampil di layar kaca. Irwansyah juga bertindak sebagai produser eksekutif mengatakan atas ide salah satu rekan produser, ia tertarik mengangkat kisah tentang perempuan ke dalam layar lebar. “Wanita itu dibalik kelemahan ada kekuatan,” kata Irwansyah. Didi menambahkan perempuan lebih kuat dari laki-laki ketika berada dalam tekanan. “Mungkin dia senyum, tapi mungkin dia juga menitikkan air mata yang kita nggak lihat,” kata Didi.

kabarindo.com Zaskia yang juga menjadi produser eksekutif bersama suaminya Irwansyah, berharap film ini bisa memotivasi perempuan, terutama yang sedang terlibat masalah. “Apa pun status sosial kita, saat perempuan bisa mempertahankan martabatnya, dia akan tetap anggun,”kata Zaskia.(ant)

PERHELATAN tahunan North Sumatra Jazz Festival (NSJF) untuk kali ketiga siap menyapa dan menghibur penikmat musik di kota medan dan sekitarnya. Untuk melanjutkan sukses dua penyelenggaran sebelumnya, Festival Jazz berskala nasional gelaran Waspada e Music (WEM) dimotori Erucakra Mahameru berkolaborasi dengan IndieJazz pada Jumat malam mendatang (13/9) di Ballroom Aston Hotel Medan bakal menampilkan artis tuan rumah : C-Man band dan Suarasama, , juga menampilkan artis ibukota yakni Key-boardis ajaib – Iwang Noorsaid, biduanita asal Bali – Sherly’O dan jebolan Indonesian Idol (2012) -Dionysius Agung Subagya (Dion Idol). Sebagai penampil baru, Dion Idol juara 4 Indonesian Idol tahun seri ketujuh, dipastikan bakal menambah greget dan warna baru panggung NSJF. Selain berwajah tampan dan bertubuh atletis plus penguasaan panggung diatas rata-rata pendatang baru, pria kelahiran Temanggung – Jawa Tengah, 30 April 1987 ini, memiliki vokal unik berkarakter yang cenderung bernuansa Swing dan Jazzy. Tak pelak walau sudah satu tahun pensiun dari panggung spektakuler Idol, hingga kini – Dion – penggemar penyanyi dan musisi Antonio Carlos Jobim ini tetap banyak penggemar, terutama kaum hawa. “Kelebihan dan daya tarik Dion adalah kemampuan nyanyinya sudah seperti mengobrol. Karena tingkat kesulitannya tinggi, di tanah air jarang solios pria yang sanggup melakukan aksi panggung seperti Dion, termasuk mereka yang sudah terkenal,” komentar Agnes Monica - salah satu juri Indonesian Idol 2012 pasca mencermati aksi Dion di panggung Spektakuler, Juni tahun silam.

Agnes memang benar. Hingga kini di blantika musik nasional masih langka solois berkarakter mirip Broadway - yakni bernyanyi seperti mengobrol ala Dion Idol yang dalam proses pematangan- hingga mampu memberi sesuatu kepada penonton. Uniknya dalam sejarah panjang industri musik, eksplorasi bernyanyi seperti mengobrol kerap mampu dilakukan penyanyi – musisi Jazz yang khatam dalam urusan teknis olah-vokal. Seperti yang biasa dilakukan sang legenda panggung Jazz nasional - mendiang Bill Saragih atau lebih senior lagi, Louis Amstrong. “Wah, kepiawaian saya berolah-vokal belum apaapa dibandingkan dua sosok legenda panggung tersebut.Yang jelas saya terus berupaya keras mematang gaya bernyanyi unik yang saya miliki agar setiap tampil menghibur mampu melibatkan emosi penonton. Hingga pada akhirnya, lewat gaya nyanyi seperti mengobrol bisa memberi kesan mendalam kepada penonton untuk dibawa pulang,” ujar Dion yang siap menggelontorkan beberapa lagu andalan yang bernuansa Swing Jazz dan pernah diusungnya di panggung Spektakuler Idol seperti nomor Yogyakarta (Kla Project), NoWoman, No Cry (Bob Marley), Cari Jodoh (Wali), Rahasia Perempuan (Ari Lasso), Aku Cinta Kau dan Dia (The Rock), Sik Asik (Ayu TingTing) Begadang (Rhoma Irama) hingga Nonton Bioskop (Bing Slamet) untuk memberi warna baru panggung NSJF 2013. “Untuk menghibur publik Medan, lagu-lagu andalan tersebut tengah saya seleksi ketat. Termasuk kemungkinan penambahan nomor baru yang lebih menarik,” tandas Dion yang sebelum ikut Idol dan terkenal sebagai penyanyi - bekerja sebagai supir rental mobil di Purwokerto. * *(AgusT)

Tata Andalkan Wisata Danau Toba

Tengku Nuranasmita Nasmit atau akrab disapa Tata di pemilihan Putri Pariwisata se-Indonesia digelar 20 September mendatang di Jakarta akan mengetengahkan objek wisata Danau Toba, Pulau Samosir serta Sorake Nias. Saat berbincang dengan media sebelum berangkat ke Jakarta Minggu (8/9) didampingi Amri dari Pro Managemen Model, dia menyebutkan kontes tersebut bakal diikuti 38 peserta karena Jakarta mengirim lima perwakilan. Para peserta akan mengikuti karantina mulai Senin (9/9) dan dibekali berbagai kemampuan di antaranya pengetahuan, koreografi dan sebagainya. “Nanti peserta diwajibkan membawa tarian budaya dari provinsi masing-masing”, ujarnya. Tata sendiri mengaku bakal menampilkan tarian Melayu lengkap dengan pakaian adat. Mantan Duta Pariwisata Indonesia 2011 se-Indonsia dan Jaka Dara 2011 ini, di sesi presentasi memaparkan adat Melayu serta kebudayaan delapan etnis Sumatera Utara. Tata menyatakan persiapan dilakukan terbilang cukup matang termasuk dukungan berbagai pihak, seperti Gubsu Gatot Pujonugroho, Wagubsu T. Erry Nuradi, Plt Wali Kota Medan Dzulmi Eldin termasuk desainer Sofyan Kwan dan Soraya, pimpinan Katalia Sumut. “Dukungan Sofyan Kwan, berupa tiga gaun, yakni untuk gaun malam, gala dinner dan cocktail, sementara Soraya menyiapkan busana daerah dan tarian”. Tata berharap siap melakukan yang terbaik demi mengharumkan nama Sumatera Utara di kancah nasional. Tentunya butuh dukungan berbagai pihak termasuk masyarakat saat penilaian lewat voting.(m19)

Tata


Waspada,rabu 11 september 2013