Page 1

Prakiraan Cuaca Rabu (22/7) Medan 24-33 C

Berastagi 18-28 C

R. Prapat 23-330C

Parapat 18-28 0C

P. Siantar 20-300C

Sibolga 21-32 0C

0

Berawan

0

Hujan guntur

BMKG Polonia

RABU, Legi, 22 Juli 2009/29 Rajab 1430 H

Presiden Ingatkan Protes Hasil Pemilu Sesuai Tatanan Berlaku JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono kembali mengingatkan pihak tertentu yang ingin melancarkan protes terhadap hasil pemilu presiden 2009 agar menyalurkannya melalui sistem dan tatanan yang berlaku. Dalam pidato pada peringatan Isra Miraj Nabi Muhammad SAW di Masjid Istiqlal, Jakarta, Selasa (21/7) malam, Presiden mengajak semua pihak untuk menghapuskan suasana persaingan dan kompetisi yang begitu keras terasa selama rangkaian kampanye pemilu 2009. “Pemilu lazim diwarnai ketegangan dan kampanye keras sehingga suhu politik meningkat. Bahkan, di antara anak bangsa bisa berjarak satu sama lain,” ujarnya. Pemilu 2009 yang telah berjalan aman, damai, dan lancar, lanjut Presiden, sudah seharusnya diikuti pula dengan rekonsiliasi semua pihak sehingga persatuan dan kesatuan bangsa yang dibutuhkan untuk membangun Indonesia dapat dipererat. Lanjut ke hal 2 kol. 4

WASPADA Demi Kebenaran Dan Keadilan

www.waspada.co.id

No: 22859 Tahun Ke-63

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman

Harga Eceran: Rp 2.500,-

Hari Ini Gerhana Matahari Di China Total, Di Kita Sebagian MEDAN (Waspada): Gerhana matahari total hari ini Rabu (22/7) akan melewati India, Nepal, Bangladesh dan China. Sementara di Indonesia akan dapat dilihat di utara Sumatera, Kalimantan, Sulawesi dan Maluku.

Penjual Bunga Di Ritz Diduga Pelaku Bom JAKARTA (Waspada): Keberadaan Ibrahim, seorang florist di Hotel The Ritz-Carlton, sempat menjadi misteri. Namun, kini bisa dipastikan Ibrahim tewas dalam ledakan bom itu. Yang mengejutkan, ada dugaan bahwa Ibrahim merupakan pelaku bom di Ritz-Carlton. Salah satu indikasinya, jenazah Ibrahim hancur saat ditemukan di Ritz. Memang polisi belum memastikan bahwa Ibrahim menjadi korban tewas. Saat ini, polisi masih menunggu hasil tes DNA keluarga Ibrahim. Kemungkinan hasil tes DNA keluarga Ibrahim akan bisa diketahui dua atau tiga hari mendatang. Sumber di kepolisian mengatakan polisi sudah menduga bahwa Ibrahim merupakan korban tewas yang jenazahnya mengalami kerusakan parah. Bahkan, batok kepalanya juga terkelupas, wajahnya tidak bisa dikenali. “Tinggal menunggu hasil DNA untuk kepastiannya. Tapi, diduga kuat dia pelaku bom bunuh diri,” kata sumber itu, Selasa (21/7). Keluarga Ibrahim telah datang ke RS Sukanto Polri Senin (20/7) kemarin. Mereka mencari Ibrahim yang tidak diketahui keberadaannya. Keluarga sudah mencari

Lanjut ke hal 2 kol. 7

Suami Istri Asal Belanda Teridentifikasi Dua Jenazah Lainnya Masih Test DNA JAKARTA (Waspada): Sepasang suami istri warga negara Belanda sudah teridentifikasi oleh tim dokter Forensik RS Polri Soekanto, Kramat Jati, Jakarta Timur, Selasa (21/7). Dengan demikian tim dokter Forensik Polri dipimpin Brigjen Pol. Dr. Edy Suparwoko telah berhasil mengidentifikasi 7 korban, dan masih akan mengidentifikasi dua jenazah korban bom Hotel JW Marriott dan Ritz Carlton lainnya. Kedua jenazah asal negara Belanda itu Mrs Ejc Ken Keaning, namun polisi belum mengetahui nama istri Ejc Ken Keaning. “Kedua korban diperkirakan pasangan

Lanjut ke hal 2 kol. 7

BACA DI HALAMAN DALAM Hari Ini DPRD Undang Walikota Sibolga Soal Kondisi Kesehatannya Dalam beberapa waktu terakhir ini DPRD Sibolga belum mengetahui secara pasti tentang kondisi kesehatan Walikota Sibolga Drs Sahat P Panggabean, maka direncanakan hari ini Rabu (22/7) akan diundang untuk datang langsung ke DPRD Sibolga. 19

Sumut Dilanda Asap Kotor Kawasan Sumut saat ini sedang dilanda asap kotor yang bersumber dari kebakaran hutan di Riau, ditambah asap kendaraan dan pabrik di kawasan Medan. 10

Gerindra Isyaratkan Oposisi Ketua Dewan Pembina Partai Gerakan Indonesia Raya (Gerindra) Prabowo Subianto mengatakan, partai berlambang kepala burung Garuda itu akan mengarah menjadi oposisi bagi pemerintahan mendatang. 16

Afifuddin Pamit, Rahudman Dituntut Lebih Berani

Pendemo Tuding Ruislag SMUN 4 Siantar Konspirasi Busuk Ruislag SMUN 4 dan SD 122350 di Kota P. Siantar dituding demonstran dari Pokja Poros Kota dalam aksi damai di Kantor Gubernur Sumatera Utara sebagai sebuah konspirasi busuk. 9 dan 20

Isu Kabinet SBY

DR. Drs. H. Ramli, MM

Opini 13

Tubrukan Maut Di Jalinsum Sei Rampah, 6 Tewas, 13 Luka-luka Jalan Lintas Sumatera kawasan Sei Rampah kembali menelan korban. Enam orang dilaporkan tewas sementara 13 orang lainnya luka-luka setelah Bus Sartika bertubrukan dengan truk colt diesel. 17

20 Balita Di T. Balai Terjangkit Gizi Buruk Sedikitnya 20 balita di Kota Tanjung Balai terjangkit gizi buruk. Para balita itu tersebar di Kec. Datuk Bandar, Datuk Bandar Timur dan Teluk Nibung. 18

Lanjut ke hal 2 kol. 7

Indonesia Mampu Hadapi Aksi Terorisme JAKARTA (Antara): Presiden Susilo Bambang Yudhoyono menyatakan bangsa Indonesia mampu menghadapi musibah peledakan bom di kawasan Mega Kuningan yang terjadi akhir pekan lalu dan siap untuk melakukan upaya pemulihan. “Bangsa Indonesia akan tetap

bangkit dan bangkit kembali, kita akan makin kuat dan bersatu serta semakin sadar bahwa negara kita akan bangkit bersama,” kata Presiden saat memberikan sambutan dalam peresmian Museum Bank Indonesia di Jakarta, Selasa (21/7)sore. Lebih lanjut Presiden mengatakan keamanan nasional itu penting,

10 Tersangka Perampok Uang Rp15 M Tertangkap Sopir Pengangkut Uang Mengkhianat JAKARTA (Antara): Direktorat Reserse Kriminal Umum Polda Metro Jaya berhasil menangkap 10 tersangka kasus perampokan uang Rp15 miliar milik bank BNI yang terjadi 13 Juli 2009, di jalan tol Jakarta Barat. Kepala Bidang Humas Polda Metro Jaya Kombes Pol Chryshnanda Dwi Laksono di Jakarta, Selasa (21/7), mengatakan, para tersangka tertangkap di Jakarta, Karawang, Serang dan Bandung. Para tersangka yang kini ditahan di Polda Metro Jaya itu adalah Mu-

hammad Abdul Mubalik, Suhendi, Ahmad Sofyan, Isya Putera, Siti Zulaiha, Muat, Dedi, Mista, Sukri dan Aceng Idrus. Tersangka Abdul tertangkap di salah satu vila di Bandung. Ia berperan sebagai sopir mobil pengangkut uang lalu memberikan kode ke kawan-kawannya selama perjalanan mengangkut uang. Tersangka Suhendi berperan sebagai perencana dan tertangkap di Bandung, Ahmad yang tertangkap

Lanjut ke hal 2 kol. 7

bukan hanya untuk mendorong kegiatan ekonomi tapi juga diperlukan oleh masyarakat agar bisa menjalankan kehidupan dengan baik. Menurut Yudhoyono, ketika 11 tahun lalu, keamanan Indonesia sempat buruk, maka memerlukan waktu bertahun-tahun untuk diperbaiki terutama empat tahun ini. “Tiba-tiba kemarin ada kenyataan pahit lagi. Yang ingin saya sampaikan, mari bangsa ini memahami dan menyadari, bersatu dalam komitmen bahwa keamanan adalah mutlak,” tegasnya. Dalam kesempatan itu, Kepala Negara mengajak semua pihak untuk kembali bersama-sama menciptakan keamanan, bukan hanya aparat keamanan namun juga semua lapisan masyarakat. “Kita sama-sama rasakan dampak negatifnya, karena itu disamping para aparat keamanan yang berdasarkan UU diberi amanah, kita harus juga peduli untuk menjaga ini,” katanya. Ia meminta, semua elemen mempunyai kesadaran dan kepedulian untuk menciptakan negara yang aman. “Masyarakat harus peduli pada keganjilan, kita tidak boleh lengah dan lalai karena itu bisa dimanfaatkan,” tegas Presiden.

TANJUNGBALAI (Waspada): Salah satu sindikat narkoba internasional diringkus petugas Bea Cukai saat turun dari feri penumpang di Pelabuhan Teluk Nibung Kota Tanjung Balai, Selasa (21/7) sekira pukul 18:00. Selain meringkus tersangka Muj, 32, warga Desa Beureudeup, Kel Indra Jaya, Kab Pidie, Provinsi Aceh, petugas Custom Narkotika Bea Cukai juga menyita barang bukti berupa shabu-shabu senilai ratusan juta rupiah dengan berat 102 gram, uang Rp 1.501.000 dan RM 161,20 sen

Lanjut ke hal 2 kol. 4

Ia mengingatkan, anggapan peristiwa bom di Mega Kuningan sebagai hal yang biasa-biasa saja adalah sebuah kekeliruan. “Jangan kita keliru bersikap seolah hal itu biasa-biasa saja. Ini mengganggu kepentingan semua warga. Semua hati harus bersatu dan juga pikiran, jangan dibelokkan ke

isu-isu lain yang bisa dimanfaatkan.” Presiden mengatakan pemerintah bertekad dalam waktu dekat mampu mengungkap sekaligus melakukan proses hukum terhadap siapapun yang bertanggung jawab atas aksi terorisme tersebut. “Kami bisa jamin keamanan dan bisa hadapi ini,” tegasnya.

Dalam Empat Tahun, 2.037 Kasus HIV/AIDS Ditemukan Di Sumut 50 Pengidap HIV/AIDS Menghilang MEDAN ( Waspada): Selama periode Juli 2005 – Juni 2009, tercatat sebanyak 2.037 kasus Human Immunodeficiency Virus/Aquired Immuno Deficiency Syndrome (HIV/ AIDS) ditemukan di Sumatera Utara. Seluruh kasus HIV/AIDS tersebut ditemukan di klinik Voluntary Counseling and Testing (VCT) yang telah beroperasi selama empat tahun di sejumlah rumah sakit Medan dan Deli Serdang. “Meski klinik VCT itu baru dibuka di Medan dan Deli Serdang, namun banyak pengidap HIV/AIDS

yang berasal dari daerah lain datang ke klinik tersebut,” kata Kadis Kesehatan Sumut dr. Chandra Syafei, SpOG melalui Project Officer Global Fund Dinas Kesehatan Sumut Andi Ilham Lubis pada Rapat Kordinasi Lintas Sektoral di Hotel Asean Medan, Selasa (21/7). Andi juga menyayangkan adanya sekitar 50 pengidap HIV/AIDS yang dilaporkan menghilang. Mereka tidak pernah datang lagi ke klinik VCT setelah terdeteksi mengidap

Lanjut ke hal 2 kol. 4

Mari Sambut Gerhana Matahari Dengan Shalat Sunnah

Penumpang Feri Dibekuk SS Senilai Ratusan Juta Disita

Penjabat Walikota Medan Drs H Afifuddin Lubis, MSi periode 2008-2009 pamit kepada seluruh Satuan Kerja Perangkat Daerah (SKPD). Jabatan Afifuddin diserahterimakan kepada Drs H Rahudman Harahap, yang diharapkan lebih berani dalam membuat kebijakan terhadap pembangunan Kota Medan. 9

Menyusul hasil quick count yang mengunggulkan pasangan SBY-Boediono yang sejalan dengan hasil sementara KPU, muncul berbagai spekulasi tentang susunan kabinet yang akan dibentuk SBY, isu ini sampai kalah popularitas ketika meledak bom di JW Marriott dan Ritz Carlton tapi tetap saja isu ini mengalir karena sifatnya yang strategis.

Antara

UANG PALSU: Kapoltabes Kota Yogyakarta, Kombespol Agus Sukamso memperlihatkan uang palsu di Poltabes Yogyakarta, Selasa (20/7). Poltabes Yogyakarta telah menangkap 5 tersangka sindikat pembuat uang palsu dengan barang bukti sebanyak Rp 246 juta uang palsu.

Menurut Kepala Stasiun Geofisika Tuntungan Rifwar Kamil, SSI, menjawab pertanyaan Waspada via telefon, Selasa (21/7), gerhana diperkirakan mulai pukul 06:58 menjadi total pukul 07:52 dan diperkirakan akan berakhir pukul 12:12. Kata Rifwar, warga Medan dapat menyaksikan secara langsung gerhana tersebut di daerah masingmasing. Disebutkannya, gerhana matahari total merupakan fenomena alam akibat sinar matahari tertutupi bayangan bulan. Hal tersebut disebabkan peredaran bumi terhadap matahari atau bulan terhadap bumi. Fenomena alam berupa gerhana matahari juga dapat disaksikan masyarakat Aceh. Di Banda Aceh, gerhana akan dimulai pukul 07:14 dan diperkirakan berakhir pada pukul 8:48.

Catatan H.Syarifuddin Elhayat Firman Allah: “Katakanlah adakah kamu lihat, jika Allah menjadikan malam terus menerus hingga sampai dunia dikiamatkan,siapakah Tuhan selain Allah yang sanggup mendatangkan sinar yang terang (siang) kepadamu, apakah (hal itu) tidak kamu mendengar.—Katakanlah,terangkanlah kepadaku, jika Allah menjadikan untukmu siang itu terus menerus sampai hari kiamat, siapakah Tuhan selain Allah yang akan mendatangkan malam kepadamu yang kamu beristirahat padanya, maka apakah kamu tidak memperhatikan.(QS Al Qoshosh ayat 71-72)

Antara

PENGAWETAN ORANGUTAN: Seorang pekerja melakukan proses pengawetan mayat Toni, Orang utan berusia 70 tahun di Solo, Selasa (21/7). Nantinya hasil pengawetan Toni, akan di kembalikan ke tempat ia di pelihara, Taman Satwa Taru Jurug (TSTJ), untuk dijadikan koleksi dan di pajang guna menarik pengunjung.

DI ATAS dunia ini ada dua planet yang mengalami gerhana, yakni gerhana matahari dan gerhana bulan.Hari ini, Rabu menurut ahli,— akan terjadi Gerhana Matahari total di India hingga China dan sebagian di Indonesia dari pagi hingga siang hari. Para ahli menyebut terjadinya gerhana hanya sebagai fenomena alam saja. Biasanya bulan dan bumi bahkan

Lanjut ke hal 2 kol. 4

Selingkuh, Putri Kerajaan Arab Saudi Minta Suaka Ke Inggris

Kartika Sari Soekarno Dihukum Lima Cambukan Di Malaysia

LONDON (Waspada): Seorang putri yang menjadi anggota keluarga Kerajaan Arab Saudi mendapati dirinya telah mengandung hasil hubungan gelapnya dengan seorang pria berkebangsaan Inggris. Sang putri pun meminta suaka (perlindungan) kepada negara sang pria. Putri tersebut beralasan apabila harus kembali ke tanah kelahirannya, maka dirinya dapat dikenakan hukuman mati. Pemerintah Inggris kemudian memberikan status pengungsi, kepada wanita yang telah menikah dengan anggota keluarga Arab Saudi tersebut. Demikian keterangan yang terdapat dalam situs news.com.au, Selasa (21/7). Wanita yang dirahasiakan namanya tersebut merupakan salah satu dari beberapa warga Arab Saudi yang telah mengajukan permintaan suaka kepada pemerintah Inggris. Meski demikian permintaan-permintaan tersebut tidak diungkapkan secara terbuka oleh kedua pemerintah. Sang putri dikabarkan bertemu dengan pria Inggris pujaan hatinya, yang bukan seorang muslim, saat melakukan perjalanan ke London. Usai bertemu dan terlibat affair dengan pria tersebut ia pun hamil dan kemudian kembali lagi ke Inggris untuk melahirkan bayinya secara rahasia. Sejak keluarganya tidak lagi menghubunginya, menantu keluarga kerajaan Arab Saudi ini meyakini pengadilan apabila ia harus kembali ke negara asalnya maka dirinya dan anaknya akan mendapat hukuman rajam sesuai hukum syariah.(dtc)

KUALA LUMPUR, Malaysia (AP): Satu pengadilan Islam di Malaysia menjatuhkan hukuman cambuk dengan rotan atas seorang wanita Muslim karena menenggak bir di satu klab malam, demikian menurut seorang pejabat pengadilan Selasa (21/7). Model Kartika Sari Dewi Soekarno dijatuhi hukuman enam cambukan Senin dan denda sebesar 5.000 ringgit karena minum bir di klab malam yang digerebek Agustus 2008, kata seorang pejabat Mahkamah Tinggi Syariah yang tak ingin menyebutkan namanya karena dia tidak berwenang beri keterangan. Kartika, 32, terbukti bersalah di pengadilan di timur negara bagian Pahang. Dia berencana untuk naik banding terhadap hukuman itu, kata New Straits Times. Hukuman itu ‘bertujuan membuat tertuduh jera,’ - Sekuriti H2TA kata suratkabar itu mengutip keterangan Hakim Abdul Rahman Yunus. bikin kita Kartika Sari Dewi Soekarno adalah putri mendiang kebobolan Presiden Soekarno dan Ratna Sari Dewi Soekarno yang - He...he...he... berdomisili dan melakukan kegiatan modeling di luar negeri. (m07)

erampang Seramp ang


Berita Utama

2 Interpol Terima Surat DPO Djoko Tjandra

Penelefon Teror Bom Ternyata Bocah 12 Tahun

JAKARTA (Antara): Interpol di Perancis sudah menerima Surat Daftar Pencarian Orang (DPO) terpidana pengalihan hak tagih (cessie) Bank Bali, Djoko Tjandara yang saat ini tengah berada di Singapura. “Surat DPO melalui interpol sudah sampai,” kata Jaksa Agung, Hendarman Supandji, di Jakarta, Selasa(21/7). Sebelumnya, kejaksaan sudah menetapkan Djoko Tjandra sebagai DPO karena tiga kali mangkir dari panggilan Kejaksaan Negeri (Kejari) Jakarta Selatan selaku eksekutor. Kejagung meminta kepada imigrasi agar mencabut paspor Djoko Tjandra, dan permintaan itu sudah dikabulkan. Djoko Tjandra oleh Mahkamah Agung (MA) divonis dua tahun penjara dan denda Rp15 juta terkait kasus pengalihan hak tagih (cessie) Bank Bali senilai Rp546,468 miliar. Jaksa Agung menyatakan pekan lalu, kejaksaan sudah melakukan pembicaraan dengan

BANDUNG (Antara): Jajaran Polwiltabes Bandung, Selasa (21/7) petang, mengamankan seorang bocah autis berusia 12 tahun warga Kompleks Griya Bandung Asri Kelurahan Ciganitri Kecamatan Bojongsoang Kabupaten Bandung yang diduga sebagai pelaku teror ancaman bom terhadap Hotel Sheraton Inn. Setelah dilakukan peme-

riksaan, bocah berinisial NDF, 12, ternyata menderita autis. Jajaran Reskrim Polwiltabes Bandung masih mencari seorang teman bocah itu yang disebut-sebut memberikan nomor telefon itu untuk selanjutnya melakukan teror bom. Peristiwa ancaman bom yang diterima operator telefon hotel bintang lima itu terjadi sekitar pukul 08:51, sehing-

ga petugas terpaksa mengerahkan tim Gegana untuk mengamankan lokasi itu. “Orang yang diduga pelaku sudah kami amankan, ternyata seorang anak kecil berusia 12 tahun. Kami masih mencari seorang temannya termasuk menyelidiki motif dari teror itu,” kata Kapolwiltabes Bandung, Kombes (Pol) Drs Imam Budi Sumpeno.

Dalam Empat Tahun, ...

paten/kota masih mengalami kendala,” tambahnya. 699 Korban Narkoba Sementara itu, Kepala VCT Rutan Kelas-I Tanjung Gusta Medan dr. M. Sakti Siregar menjelaskan, Rutan tersebut telah melebihi kapastitas. Sebab, Rutan yang memiliki daya tampung hanya 300 orang, saat ini dihuni 1.000 orang. “Dari data saya saja, Rutan Klas I Medan menampung 1.000 penghuni. Padahal, kapasitas daya tampung hanya 300 jiwa. Dari jumlah tersebut, 699 di antaranya merupakan korban narkoba yakni pemakai/pengedar 9 orang, pemakai 300 orang, pengedar 300 orang dan bandar 90 orang,” jelasnya. Menurut Sakti, tingginya jumlah korban narkoba terse-

but menunjukkan betapa besar faktor risiko penularan HIV/AIDS dari kelompok tersebut. “Banyak faktor, dari catatan ini saja sudah menunjukan betapa besar risiko penularan HIV/AIDS yang ditimbulkan oleh narkoba. Apalagi risiko kematiannya hampir sama dengan peningkatannya jika tidak disertai dengan pencegahan dan penanggulangan,” ujarnya. Rapat kordinasi yang digelar Komisi Penanggulangan AIDS (KPA) Sumut bersama LSM Peduli Pendampingan HIV Medan Plus itu, turut dihadiri Dinas Kebudayaan dan Pariwisata (Disbudpar) Sumut, Dinas Tenaga Kerja dan Transmigrasi (Disnakertrans) Sumut, Dinas Kesehatan Sumut dan lain-lain.(m26)

dan tersangka diperiksa, anggota CNT Bea Cukai Hery Supomo dan Edy Warman, melihat sesuatu yang mencurigakan disembunyikan di selangkangan tersangka. “Petugas curiga tersangka menyembunyikan sesuatu di selangkangannya, karena tersangka terus memegangi bagian itu,” ungkap Saragih. Jadi, berdasarkan kecurigaan itu, menurut Saragih, Hery Supomo dan Edy Warman lantas menggiring tersangka ke Hanggar Bea Cukai Pelabuhan Teluk Nibung untuk proses pemeriksaan seluruh badan. Hasilnya, kata Saragih, ditemukan 1 kemasan serbuk kristal putih dibungkus plastik putih dan dilapisi dengan plastik biru. “ Barang itu diduga psikotropika jenis sabu-sabu, sehingga dilakukan pemeriksaan lebih lanjut dengan

pengujian menggunakan Narkotest, dan hasilnya positif psikotropika jenis shabu-shabu,” jelas Saragih. Sementara, pengakuan tersangka, barang haram itu pesanan seorang pria di Kota Medan. Jadi, kata tersangka, begitu tiba di Pelabuhan Teluk Nibung, dia langsung berangkat ke Medan. “ Saya sudah hubungi pria itu, tapi telefon genggamnya tidak aktif,” ujar tersangka. Setelah pemeriksaan di kantor Bea Cukai Teluk Nibung, malam itu juga tersangka diserahkan ke Polresta Tanjung Balai untuk proses lebih lanjut. Penyerahan itu dilakukan antara Kasi P2 Bea Cukai Teluk Nibung dengan Kasat Narkoba Iptu Ahmad Rivai Adhi dan Kapolsek Teluk Nibung AKP Burhanuddin Sinulingga. (a37)

sia adalah negara berpenduduk Islam terbesar di dunia yang seharusnya memberi sumbangan yang membawa kebaikan dan rahmat kepada dunia seperti ajaran Nabi Muhammad SAW. Presiden menyatakan, demokrasi yang ingin dibangun oleh Indonesia adalah yang menjunjung tinggi martabat dan etika sehingga setelah usai pelaksanaan pemilu 2009, semua pihak seharusnya mampu untuk membangun kebersamaan demi masa depan yang lebih baik. “Ke depan, dengan selesai proses Pemilu, kita harus bisa bersama, kita hapus sejarah

selama kompetisi, dan bangun kembali harmoni kebersamaan di antara warga bangsa,” ujarnya. Sesuai dengan pembangunan masyarakat Islam yang dicontohkan oleh Nabi Muhammad SAW di Madinah, Presiden Yudhoyono mengingatkan, masa depan Indonesia harus bisa membangun kesejahteraan serta meningkatkan partisipasi politik dari masyarakat. Peringatan Isra Miraj 1430 Hijriah di Mesjid Istiqlal juga dihadiri oleh Wakil Presiden Jusuf Kalla beserta Ibu Mufidah beserta para menteri Kabinet Indonesia Bersatu.

Dirjen Multilateral Departemen Luar Negeri (Deplu) untuk meminta bantuan asosiasi internasional yang punya otoritas dalam penanganan korupsi, yakni IAACA. “Bagaimana tindak lanjut IAACA pada Kamis (16/7) sudah pembicaraan Dirjen Multilateral Deplu, maka akan dilakukan penanganan melalui saluran diplomatik,” katanya. Penanganan melalui saluran diplomatik itu, yakni Deplu minta ekstra vonis (putusan) untuk diterjemahkan dalam bahasa Inggris. Kemudian, kata dia, pihaknya meminta surat untuk DPO melalui interpol, dan selanjutnya meminta pencabutan paspor. “Setelah selesai akan berkoordinasi dengan Deplu di Singapura,” katanya. Ia menyatakan pihaknya akan terus berusaha untuk mendapatkan terpidana Djoko Tjandra tersebut. “Kalau hasilnya signifikan (melalui IAACA), maka akan digunakan kepada yang lain,” katanya.

Penderita TB Indonesia Terbanyak Ketiga Dunia JAKARTA (Antara): Praktisi kesehatan dari RSUP Persahabatan menyatakan bahwa Indonesia merupakan negara dengan jumlah penderita tuberkulosis (TB) terbesar ketiga di dunia setelah China dan India. Kepala Instalasi Pelayanan Pelanggan dan Humas RSUP Persahabatan Drg. Rani Dwiharjanti di Jakarta Selasa (21/7) mengatakan, berdasarkan data organisasi kesehatan dunia (WHO), setiap tahun di dunia diperkirakan terdapat 8,7 juta kasus baru TB dan 1,7 juta kematian karena penyakit itu. “Bila tidak diupayakan pengendalian yang memadai, maka 25 tahun kemudian diperkirakan angka kematian akan mencapai 40 juta orang dalam setahun,” ujarnya. Berdasarkan Survei Kesehatan Rumah Tangga 2004 menunjukkan, TB merupakan penyebab kematian nomor tiga setelah penyakit jantung dan saluran nafas dan nomor satu di antara penyakit infeksi. Sementara itu, jumlah kasus TB di Rumah Sakit Umum Pusat (RSUP) Persahabatan setiap tahunnya mengalami peningkatan yang sampai bulan Mei 2009 berjumlah 7.439 kasus untuk rawat jalan. Jumlah tersebut setiap tahun meningkat.

“Tahun lalu jumlah kasus TB yang rawat jalan mencapai 20.108 orang, rawat inap 621 orang, dan 63 orang meninggal dunia, kini hingga bulan Mei untuk rawat jalan mencapai 7.439 orang, rawat inap 142 orang, dan 19 orang meninggal dunia,” ujarnya. Ia menambahkan, gejala-gejala penyakit TB antara lain batuk berdahak selama tiga minggu, sesak nafas, batuk berdarah, rasa sakit di dada, berkurangnya berat badan, nafsu makan berkurang, demam lebih dari satu bulan, berkeringat dimalam hari meskipun tidak melakukan kegiatan serta lemas dan mudah lelah. Cara penanggulangan TB antara lain pengobatan minimal selama enam bulan, pengobatan TB tidak boleh terputusputus, tunjuklah Pengawas Menelan Obat (PMO), dan hubungi Puskesmas atau Rumah Sakit Pemerintah terdekat untuk pengobatan gratis. Untuk mengurangi jumlah kasus TB, RSUP Persahabatan selalu mengadakan penyuluhan TB ke sejumlah sekolah di Jakarta Timir, Talkshow TB, Seminar TB, Selasa klinik TB, dan Pelatihan Mikrobiologi yang diadakan setiap tahunnya di RSUP Persahabatan.

SBY-Boediono 61 Persen JAKARTA (Antara): Perolehan suara sementara pasangan capres dan cawapres Susilo Bambang Yudhoyono-Boediono yang diolah KPU melalui Sistem Informasi Perhitungan Suara (Situng) pilpres 2009 tercatat 61,16 persen dari total suara yang masuk yakni 80.529.391. Data yang ditampilkan di laman resmi KPU, di Jakarta, Selasa(21/7), memperlihatkan hingga sekitar pukul 18.00 WIB pasangan nomor urut dua tersebut memimpin dalam perolehan suara sementara yaitu 49.254.094 suara . Perolehan suara sementara tersebut tertinggi dibandingkan pasangan lainnya. Pasangan capres dan cawapres nomor urut satu Megawati Soekarnoputri-Prabowo Subianto tercatat

memperoleh suara sementara 22.619.541 atau 28,09 persen. Sedangkan pasangan nomor urut tiga Jusuf Kalla-Wiranto meraih suara sementara 8.655.756 atau 10,77 persen. Data resmi ini dikirimkan oleh KPU kabupaten/ kota seluruh Indonesia yang telah menyelesaikan rapat pleno rekapitulasi di tingkatannya dan ditayangkan pertama kali pada Jumat, 17 Juli 2009. Apabila terdapat data yang dinyatakan salah kirim oleh KPU kabupaten/kota melalui suatu berita acara, maka data tersebut akan dikoreksi dan akan mengakibatkan perubahan jumlah data.

Lima JPU Berkoordinasi Dengan Densus 88 JAKARTA (Antara): Jaksa Agung, Hendarman Supandji, mengakui lima jaksa penuntut umum (JPU) tergabung dalam Satuan Tugas (Satgas) Anti Teroris berkoordinasi dengan Detasemen Khusus (Densus) 88 pasca ledakan di Hotel JW Marriott dan Ritz Carlton. “Jampidum (Jaksa Agung Muda Pidana Umum) sudah memerintahkan lima JPU untuk merapat ke Densus 88,” katanya, di Jakarta, Selasa(21/7). Jaksa Agung menyatakan lima JPU itu untuk memberikan petunjuk dalam penanganan perkara ini. “Ini (JPU) akan menempel/tendem dengan Densus 88,” katanya. Nantinya, kata dia, kelima JPU itu akan memberikan petunjuk saat menerima Surat Pemberitahuan Dimulainya Penyidikan (SPDP). “Tentunya lima JPU akan memberikan petunjuk dari SPDP,” katanya. Sebelumnya dilaporkan, Kejagung me-

nurunkan satuan anti teror di bawah pidana umum (pidum) untuk membantu Detasemen Khusus (Densus) 88 pasca ledakan di Jakarta. “Iya saya suruh bergabung dengan Densus 88, anggotanya lima orang,” kata Jaksa Agung Muda Pidana Umum (Jampidum), Abdul Hakim Ritonga, di Jakarta, Jumat (17/7). Dikatakan, satuan teroris akan melihat keadaan di situ. “Anak buah saya satgas itu saya turunkan. Lihat keadaan disitu dan membandingkan dengan kejadian-kejadian yang lalu sehingga membantu analisa, arahnya kemana ini,” katanya. Ia mengharapkan agar kewaspadaan ditingkatkan selain kawasan lokasi terjadinya ledakan bom. “Misalnya seperti di bandara, gudang, dan tempat vital. Mudah-mudahan penyidik bisa membuka tabirnya,” katanya.

Ayah Badau Cabuli Tiga Putri Kandungnya Di Taput TARUTUNG(Waspada): HP, 50, warga Lumban Rihit, Desa Hutauruk, Kecamatan Sipoholon – Kabupaten Tapanuli Utara, tega mencabuli dua putri kandungnya sendiri. Bahkan seorang lagi diperkosa sebanyak dua kali. HP yang merupakan duda dan ayah tujuh orang anak (2 putra dan 5 putri) itu, kini ditahan di Mapolres Taput untuk proses hukum. Ketiga putrinya yaitu SP, 13, DP, 16, dan TP, 18. Informasi yang dihimpun di Mapolres Taput menyebut, peristiwa itu terungkap saat salah seorang dari korban tidak tahan lagi dengan kelakuan ayahnya yang semakin menggila. “ Para korban menceritakan perlakuan cabul ayahnya kepada kakak laki-laki mereka WTP, 27, di Balige,”ujar Kaurbin Ops Reskrim Polres Taput Ipda Muhammad Hasan, Selasa (21/7) Ipda Hasan menyebutkan, para korban dalam pengaduannya mengungkapkan perbuatan bejat itu, terungkap dan ternyata HP melakukan aksi serupa kepada dua orang putri kandungnya yang lain. HP melakukannya secara bergantian di waktu dan tempat yang berbeda namun masih di dalam rumahnya. Yang mengadu ke Polres, kata Ipda Hasan, Kakak korban (WTP). Atas laporan pengaduan

itu, petugas Reskrim diturunkan dan langsung melalukan penangkapan HP dari rumahnya di Sipoholon. Tersangka tidak melakukan perlawanan. Kaurbin Ops menyebut, dalam pemeriksaan tersangka HP tidak mengakui semua perbuatannya. Hanya mengakui ada mengurut putrinya di rumah mereka. “Aksi pencabulan dan percobaan perkosaan itu awalnya dilakukan HP kepada DP pada bulan Januari 2009 lalu sebanyak dua kali di kamar neneknya di rumah mereka. Saat itu mendiang ibunya,istri HP dalam keadaan sakit-sakitan sebelum kemudian meninggal dunia pada bulan Maret 2009 silam. Kemudian HP mengulangi kembali aksi serupa pada bulan Maret. Bahkan, kali ini bukan hanya kepada DP, tetapi juga kepada SP (adik DP). Pada tanggal 9 dan 17 Juli 2009 lalu, HP kembali mengulangi perbutannya serupa kepada putrinya”ujar Hasan. Untuk penyelidikan, lanjut Kaurbin Ops, telah dilakukan visum et revertum kepada ketiga korban di RSU Tarutung. Semua kejadiannya berlangsung di rumah tersangka dan ketiga putrinya itu tinggal serumah dengan tersangka, ujarnya. (a13)

Depkeu Buka Penerimaan CPNS Golongan II JAKARTA (Antara): Departemen Keuangan (Depkeu) membuka penerimaan calon pegawai negeri sipil (CPNS) golongan II tahun anggaran 2009 dengan sistem seleksi menggunakan sistem gugur. Sekjen Depkeu Mulia P. Nasution dalam Pengumuman di Jakarta, Selasa (21/7), menyebutkan, seleksi akan meliputi empat tahap yaitu seleksi administrasi, tes potensi akademik (TPA), psikotes, tes kemampuan khusus dan kebugaran. Seleksi akan dilaksanakan di enam kota yaitu Jakarta, Medan, Batam, Semarang, Surabaya, Bitung dan Makasar. Nama jabatan dan kualifikasi pendidikan yang dibuka adalah Juru Mudi Tingkat I lulusan D-III Pelayaran dan Ahli Nautika Tingkat (ANT) III, Juru Motor Tingkat I lulusan D-III Pelayaran dan ahli teknika tingkat (ATT III), Juru Mudi Tingkat II lulusan SMK Pelayaran atau SPM dan ANT IV, Juru Motor Tingkat II lulusan SMK Pelayaran atau SPM dan ATT IV, dan Anak Buah Kapal Tingkat II lulusan SMK Mesin, SMK Listrik, SMK Elektronika, dan SMK Bangunan Kapal. Persyaratan pendaftaran antara lain WNI, usia minimal 18 tahun dan maksimal 30 tahun untuk kelompok pertama dan kedua, mini-

mal 18 tahun dan maksimal 24 tahun untuk kelompok tiga hingga 8. Persyaratan lain antara lain berjenis kelamin laki-laki dengan tinggi badan minimal 165 cm, Tidak buta warna, tidak cacat badan dan tidak mengalami ketergantungan terhadap narkotika/sejenisnya, dan bersedia ditempatkan di seluruh wilayah NKRI. Peminat dapat menyampaikan lamaran kepada Panitia Pusat Penyaringan/Penerimaan Calon Pegawai Negeri Sipil Golongan II di Lingkungan Depkeu Tahun Anggaran 2009 mulai tanggal 18 Juli 2009 sampai dengan tanggal 7 Agustus 2009 (cap pos) melalui P.O. BOX 1001 Jakarta 10000. Pelamar yang lulus Seleksi Administrasi akan diumumkan pada hari Selasa tanggal 19 Agustus 2009 melalui website Departemen Keuangan dan Kantor Perwakilan Departemen Keuangan di daerah; Pelamar yang telah lulus Seleksi Administrasi akan diberikan Tanda Peserta Ujian (TPU). Pengambilan Tanda Peserta Ujian (TPU) dilaksanakan pada tanggal 24 dan 25 Agustus 2009 di Kantor Perwakilan Departemen Keuangan di daerah.

HIV/AIDS dan diharuskan mengkonsumsi obat ARV. “Ada beberapa alasan yang menyebabkan mereka menghilang, yakni rasa jenuh mengkonsumsi obat ARV secara terus menerus seumur hidup, pindah tempat tinggal dan lainlain. Bahkan mereka tidak memberitahukan dimana keberadaannya sekarang,” ujar Andi. Selain itu, lanjut Andi, sekitar 808 pengidap HIV/AIDS diharuskan mengkonsumsi obat Anti Retro Viral (ARV). Data ini dijadikan acuan dan evaluasi kinerja dalam menghadapi dampak penularan HIV/ AIDS pada masa mendatang. “808 Pengidap HIV/AIDS ini memerlukan obat ARV, namun jangkauannya di tingkat kabu-

Penumpang Feri ... serta dua unit telefon genggam. Barang haram itu, disembunyikan tersangka di celana dalam yang dipakainya. Kepala Kantor Bea Cukai Teluk Nibung Eko Darmanto melalui Kasi P2 Tuahman Saragih menjelaskan, penangkapan berawal ketika feri penumpang MV Boeing Sky King yang berlayar dari Port Klang Malaysia, tiba di terminal Pelabuhan Teluk Nibung dengan membawa 77 penumpang. “ Seperti biasanya, begitu feri tiba, maka seluruh penumpang diperiksa dengan menggunakan mesin X-Ray,” jelas Saragih. Dan, lanjut Saragih, saat barang-barang yang dibawa tersangka diperiksa, tidak ada ditemukan secuilpun benda yang mencurigakan. Akan tetapi, kata Saragih, begitu ba-

Presiden Ingatkan ... Untuk itu, ia meminta agar segala bentuk keberatan terhadap hasil pemilu 2009 disalurkan melalui sistem hukum dan tata cara yang telah diatur. “Jika ada pihak-pihak yang ingin melancarkan protes dan aduan, semua bisa dilancarkan sesuai tatanan yang berlaku,” ujarnya. Presiden mengajak semua komponen bangsa untuk menunjukkan kepada dunia bahwa demokrasi yang berkembang di Indonesia adalah demokrasi matang dan penuh keteduhan. Apalagi, lanjut dia, Indone-

Mari Sambut Gerhana ... planet yang lain bagaikan ‘tawaf’mengelilingi matahari secara terus menerus. Jika bumi atau juga bulan sejajar dengan matahari maka akan terjadilah gerhana matahari atau gerhana bulan. Namun, Islam sesungguhnya memandang gerhana bukanlah sekadar fenomena alam, akan tetapi merupakan peringatan dan tandatanda kebesaran Allah untuk direnungi dan dijadikan i’tibar dalam kehidupan. Lebih dari itu, Islam menjadikan gerhana matahari dan bulan menjadi sarana ibadah dan zikir untuk taqarrub kepada Allah dan dalam kajian fiqih disunnahkan orang-orang yang menemukan dua gerhana tersebut untuk melakukan solat sunnah. Rasul Muhammad saw ketika mendapati gerhana, berangkat ke lapangan dan memanggil jamaah agar berkumpul sekaligus melakukan solat gerhana, kemudian dilanjutkan dengan khutbah. Solat gerhana pelaksanaannya,— menurut saya.— sedikit ‘unik’ (beda) dibandingkan dengan solat-solat sunnah lainnya, karena hanya dalam solat gerhana yang dua rakaat satu salam itu sajalah terdapat dua kali ruku’ dalam satu rakaat. Baru kemudian setelah itu dilakukan khutbah untuk mengajak ummat bertobat, berzikir sambil berharap kepada Allah agar mengembalikan posisi bulan dan matahari pada rambunya semula.Wallahu A’lam bimurodihi,—hanya Allah sajalah yang tahu maksud dibalik itu semua. Dalam hadis yang agak panjang, Aisyah berkata,”Pada masa Rasulullah masih hidup, pernah terjadi gerhana matahari, lalu Rasul menyuruh orang-orang untuk memanggil yang lain melakukan solat berjamaah, setelah mereka berkumpul, rasulpun datang, lalu beliau maju dan bertakbir (solat) dan melakukan solat tersebut empat kali ruku’ dan empat kali sujud dalam dua rakaat. ….ketika usai melaksanakan solat (matahari sudah kelihatan kembali) lalu Rasul berkhutbah di hadapan kaum muslimin. Mulamula Rasul memuji Allah dan sesudah itu beliaupun bersabda,” Sesungguhnya matahari dan bulan adalah satu bukti dari sekian banyak bukti kebenaran Allah. Keduanya tidak mengalami gerhana karena kematian atau kelahiran seseorang. Karena itu jika kalian melihat gerhana matahari dan bulan, takbir dan mendoalah kepada Allah, solat dan bersedekahlah kamu banyak-banyak……. Kalaulah kamu tau apa yang ku ketahui, niscaya kamu akan banyak menangis, dan sedikit tertawa. Camkanlah itu wahai ummat Muhammad, bukankah aku telah menyampaikannya.- (dua hadis diatas diriwayatkan Imam Bukhori). Kenapa Rasul menyebut tidak ada kaitannya dengan kelahiran dan kematian, karena ketika Anak Rasul bernama Ibrahim meninggal dunia , kala itu terjadi gerhana matahari. Para sahabat menyebutkan, Ya Rasul gerhana ini terjadi barangkali karena Ibrahim meninggal dan alam (mataharipun) ikut berduka. Rasul menjawab,” gerhana matahari adalah salah

satu dari ayat-ayat (tanda-tanda peringatan) Allah, dan tidak ada kaitannya dengan musibah meninggalnya Ibrahim. Lantas apa hikmah kita melakukan solat itu,— pertama,-Rajak dan khauf,—harap dan takut, -kita berharap kepada Allah agar tidak menjadikan gerhana itu sebagai ‘kemurkaan’ Allah terhadap dosa dan kesalahan yang kita lakukan. Betapa banyak kita pergunakan cahaya matahari untuk memperbaiki ekosistem kehidupan kita, dalam keseharian kita -namun kadang kala kita lupa kalau itu adalah rahmat Allah buat kita,—dan kitapun ‘langka’ bersyukur, bahkan kita jadikan sebagai kedurhakaan kita kepada Allah. Robbana Ma Kholaqta Hadza Bathila,-Subhaanaka Fa Qinaa Adzaabannar (Ya Raobb tidak Engkau jadikan semua ini dengan percuma, Maha sucilah Engkau, dan hindarkanlah kami dari azab neraka) Andai saja Allah jadikan malam hingga dunia dikiamatkan, dan siang sepanjang zaman seperti yang dijelaskan pada Surat AlQoshosh 71-72 di atas, akan bagaimanalah kehidupan ini. Andai saja gerhana tidak berakhir sepanjang masa, maka akan gelaplah dunia ini, atau andai saja matahari tidak ‘terlindung’ malam, maka akan siang terangbenderanglah bumi, disitulah ‘maqom’ harap kita hadir kepada Allah. Takut,— andai saja hukum Allah akan berlaku buat alam,— bumi maupun bulan yang konon menurut para ahli mengelilingi matahari itu sangat cepat dan kencang, bahkan melebihi kekencangan perhitungan kecepatan terbangnya Buraq yang ditompangi Rasul menembus langit dunia saat berisra –mi’raj, bertabrak, akan bagaimanalah nasibnya dunia ini. Mobil yang kecepatannya 150 km perjam saja saling bertabrakan, kata Dr Marwah Daud,— tidak dapat dibayangkan, bagaimana remuknya jasad penumpang. Konon lagi kalau sudah bulan dan bumi yang kita huni ini tidak bisa saling mengelakkan.—Ya Allaaaah,— Karena itulah ketika terjadi gerhana, Rasul mengajak kita untuk bertakbir, mengagungkan kebesaran Allah dihadapan kekecilan diri kita, banyak berdoa dengan harap dan takut, memperbanyak sedekah dan berzikir mengingat kebesaran dan keagungan Allah bahkan kitapun dianjurkan untuk beristighfar sembari mengakui kesalahkhilafan kita dihadapan Allah. Marilah kita cermati Firman Allah ‘Apabila bulan telah hilang cahayanya dan matahari beserta bulan dikumpulkan (QS 75: 8-9), Apabila matahari digulung, dan apabila bintangbintang berjatuhan (QS 81: 1-2).—Apabila langit terpecah dan apabila bintang-bintang jatuh berserakan (bertabrakan) (QS 82 :1-2). Padahari itu manusia berkata,”Kemana tempat lari,sekali-kali tidak ada tempat berlindung, hanya kepada Tuhanmu sajalah pada hari itu tempat kembali.—Mari kita sambut Gerhana hari ini dengan solat Gerhana dan ‘kembali kepada rahman dan rahimnya Allah.- Inni Dzaahibun Ila Rabbi Sayahdiin,—Aku Akan kembali kepada Tuhanku yang memberi petunjuk padaku. Begitu kata Allah dalam firmanNya.

WASPADA Rabu 22 Juli 2009

10 Tersangka Perampok ... di Jakarta Utara berperan sebagai pengemudi mobil para tersangka dan Isya yang tertangkap di Bogor berperan sebagai membantu tersangka lain. Siti tertangkap di Jakarta Utara berperan sebagai menyediakan tempat perencanaan, Muat tertangkap di Jakarta Utara dan berperan sebagai menyediakan tempat perencanaan dan tersangka Dedi yang tertangkap di Jakarta Utara berperan sebagai orang yang mencari karung untuk menyimpan uang hasil kejahatan. Tersangka Mista tertangkap di Karawang dan berperan sebagai penyedia tempat membagi hasil kejahatan, Sukri yang tertangkap di Jakarta Utara berperan sebagai sopir mobil para tersangka dan Aceng yang tertangkap di Jakarta Utara berperan sebagai pembantu aksi para tersangka. Polisi juga menyita sejumlah uang dan barang sebagai alat bukti. Dari tersangka Abdul disita uang Rp933 juta dan vila di Bandung senilai Rp500 juta yang dibeli dari uang hasil kejahatan, dari Ahmad disita uang Rp300 juta dan dari tersangka Isya disita mobil F 1121 BQ. Sedangkan dari tersangka Siti disita uang Rp26,9 juta dan mobil B 2913 JW, dari tersangka Dedi disita Rp705 juta dan dari Mista disita Rp285 juta. Tersangka lain memang tidak ditemukan uang sebagai barang bukti namun ditemukan barang yang dipakai hasil kejahatan antara lain karung dan tas. Chryshnanda mengatakan, polisi masih memburu sejumlah tersangka sebagai buron yang diduga menjadi pelaku utama aksi perampokan itu. “Yang punya inisiatif melakukan aksi kejahatan itu tersangka Suhendi lalu ia mengajak rekan-rekannya,” katanya. Sebelum beraksi, mereka mengadakan pertemuan di rumah tersangka Aceng di Pandeglang, Banten. Mereka lalu merampok mobil uang Rp15 miliar milik bank BNI saat melintas di jalan tol yang masuk wilayah Tanjung Duren, Jakarta Barat. Aksi berjalan lancar karena sopir Abdul merupakan bagian dari komplotan mereka. Para tersangka juga melumpuhkan seorang polisi yang mengawal mobil itu lalu membuangnya di Bitung, Tangerang.

Hari Ini Gerhana ... Ketua Badan Hilal dan Rukyat (BHR) Aceh, Drs H A Rahman Tb kepada Waspada, Selasa (21/7) mengatakan pihaknya sudah mengetahui kabar tersebut. Apalagi informasi itu, kemudian disitir oleh Badan antariksa Amerika, National Aeronautics and Space Administration (NASA). “Gerhana matahari itu bersifat parsial, hanya menyentuh badan kanan matahari, atau sekitar 1/5 matahari saja, sehingga di Banda Aceh dan sekitarnya tidak terlihat total. Hanya di India dan sebagian China akan mengalami gerhana matahari total,” urai Rahman yang didampingi Kabag Humas Depag Aceh, Juniazi. Dia menyebutkan, berdasarkan data yang dirilis itu puncak gerhana pukul 7:59 dan berakhir 08:48. Di Indonesia, durasi terpanjang terjadi di Jayapura dan sekitarnya. Namun, tutupan cakram matahari (magnitude) terbesar terjadi di Banda Aceh, mencapai 29,7 persen. Gerhana dimulai dari India, melintasi Nepal, Banglades, Bhutan, Myanmar dan Cina. Setelah meninggalkan Asia Tengah, gerhana melintasi kepulauan Ryukyu (Jepang). Pusat gerhana matahari total, terjadi di Samudera Pasifik dengan durasi 6,39 menit. Gerhana matahari yang diperkirakan terjadi sejak awal hingga puncak dan berakhirnya fenomena alam selama satu jam 34 menit itu persentase ketertutupan piringan matahari yang ditutup piringan bulan hanya mencapai 29,7 persen. Dengan persentase ketertutupan itu, gerhana matahari yang disaksikan warga di Banda Aceh dan Sabang bukan merupakan gerhana matahari total tetapi hanya gerhana matahari sebagian. Gerhana matahari total itu secara maksimal akan terlihat di Kota Shanghai, China selama enam menit. Peredaran gerhana matahari dari barat hingga timur wilayah China akan menghilang di Samudra Pasifik selama lima jam. Gerhana nantinya akan dimulai saat bayangan penumbra bulan untuk pertama kalinya sampai ke permukaan bumi pada pukul 23.58 GMT atau pukul 06:58, dan berakhir saat terakhir kali penumbra bulan menyentuh bagian terluar piringan bumi pada pukul 05.12 GMT atau pukul 12:12. Katanya, BHR Aceh akan melakukan melakukan observasi gerhana matahari. Menurut dia, pemantauan gerhana secara teknis diperkirakan tidak menghadapi kendala. “Rencananya pemantauan dilakukan di gedung observasi di Lhok Nga, Aceh Besar, pada pukul 7:30,” sebut dia. Menurut Kakandepag Aceh itu, BHR Aceh memiliki fasilitas dan perlengkapan yang sangat memadai. “Ada petugas yang melakukan observer di sana,” sebut A Rahman Tb seraya menyerukan Umat Islam untuk melaksanakan shalat sunah gerhana. Hal serupa juga dianjurkan Sekretaris Himpunan Ulama Dayah Aceh (HUDA), Tgk H Faisal Ali yang dihubungi Waspada di tempat terpisah. “Peristiwa langka ini bukti kebesaran Allah SWT dan tak ada kaitan apa pun dengan kejadian itu. Itu peristiwa alam dan atas kehendak Allah SWT,” ujar dia. Untuk itu, dia menghimbau kepada umat Islam, khususnya di Banda Aceh dan Sabang, guna melaksanakan shalat sunnah gerhana matahari. “Kepada dayah-dayah dan masjid kita sarankan untuk menggelar shalat gerhana pada Rabu pagi,” seru Tgk Faisal Ali. (m32/b05)

Suami Istri Asal ... suami istri,” kata Kadiv Humas Polri Irjen Pol. Nanan Sukarna dalam keterangan persnya di Crisis Media Center, Ginger Cafe Belaggio, Jakarta, Selasa (21/7). Guna mengetahui lebih jelas identitas jenazah asal Belanda itu, Polri kata Nanan, masih menunggu data antemortem dari keluarga korban. “Sejauh ini belum ada data antemortem dari Kedubes Belanda,” ujarnya. Sedangkan perwakilan Kedubes Belanda kemarin mendatangi RS Polri sehubungan tiga warganya hilang dalam bom ‘Mega Kuningan’. Pasca pengeboman, Kedubes Belanda telah melapor ke Polri mengenai tiga warga negaranya yang hilang diduga kuat turut menjadi korban peledakan bom itu. “Dari tiga warga negara Belanda yang dilaporkan hilang, tim disaster crisis identification sudah berhasil mengenali dua orang,” kata mantan Kapolda Sumut itu. Sedangkan dua jenazah lainnya yang belum dapat diidentifikasi karena kondisi tubuhnya hancur, diperkirakan salah seorang diantaranya Ibrahim dan seorang warga negara Belanda yang dilaporkan Kedutaan Besar Belanda hilang. Tetapi tim dokter forensik masih mengambil sampel DNA keluarga dari dua jenazah itu. Sedangkan hasil test DNA baru dapat diketahui 3 sampai 4 hari kedepan. Empat korban yang nantinya dapat diidentifikasi itu menyusul lima yang sebelumnya telah berhasil diidentifikasi adalah seorang WNI bernama Evert Mokodomvis, seorang WN New Zealand bernama Timothy D Mackay. Sedangkan tiga jenazah lainnya, WNA Australia Craig Andrew Senger, Garth Rupert John McEvoy dan Nathan John Verity. (j02)

Penjual Bunga ... ke semua RS, namun tidak ada catatan korban luka bernama Ibrahim. Akhirnya, keluarga Ibrahim mendatangi RS Polri sebagai RS terakhir. Sebab, semua jenazah dibawa ke RS Polri. Keluarga Ibrahim diperbolehkan melihat jenazah yang belum teridentifikasi. Setelah itu, tim identifikasi juga meminta agar keluarga mengirimkan sikat gigi dan barang-barang lain untuk membantu identifikasi atau tes DNA. Di awal kedatangannya, keluarga Ibrahim sempat menjelaskan tentang identitas Ibrahim. Namun, setelah bertemu tim identifikasi, keluarga Ibrahim tidak mau bicara lagi kepada wartawan. Sebenarnya wartawan sudah mengendus kemungkinan Ibrahim sebagai pelaku bom sejak keluarga Ibrahim dilarang memberi pernyataan kepada wartawan. Apalagi, saat ditunggu wartawan hingga malam hari, keberadaan keluarga Ibrahim juga tak terlihat lagi. Hadyu Muhammad, salah seorang keluarga Ibrahim sempat menceritakan bahwa Ibrahim bekerja sebagai florist di RitzCarlton sejak empat tahun lalu. “Saat ledakan terjadi, dia masuk pagi,” ujar dia. Ibrahim yang asal Kuningan Jawa Barat itu selama di Jakarta ngekos di sebuah kos di belakang Ritz-Carlton. Apakah benar Ibrahim sebagai pelaku bom di Ritz-Carlton? Memang belum bisa dipastikan, meski dugaan kuat bahwa pelaku mengarah ke pria beranak empat itu. Untuk memastikan, tinggal menunggu penjelasan polisi. (dtc)


Luar Negeri

WASPADA Rabu, 22 Juli 2009

Serangan Di Dua Kota Afghanistan, 13 Tewas

PM Jepang Bubarkan Parlemen TOKYO, Jepang (AP): PM Jepang telah membubarkan parlemen dan menyerukan pemilihan nasional. Jubir parlemen mengumumkan tindakan itu Selasa (21/7), sehingga membuka peluang dilaksanakannya pemilihan yang bisa memicu perubahan yang jarang terjadi dalam politik kepemimpinan Jepang. Aso mengatakan dia akan mengimbau dilaksanakan pemungutan suara nasional tanggal 30 Agustus. Partai Demokratik Liberal berkuasa menguasai suara mayoritas di dewan rendah paling berkuasa di parlemen hampir selama 50 tahun. Namun oposisi utama, Partai Demokrat Jepang, telah memenangkan sejumlah pemilu lokal dan mendapat dukungan luas dalam poling baru-baru ini. Partaiyangmemenangkan suara mayoritas di dewan rendah berhak memilih PM dan menteri pemerintah di jajarannya.(m18)

The Associated Press

PARA WANITA KASHMIR MENADAHKAN TANGAN BERDOA

Para wanita Kashmir menadahkan tangan mereka ketika berdoa pada saat seorang ulama (tidak terlihat dalam gambar) mempertunjukkan satu peninggalan suci yang diyakini adalah rambut dan janggut Nabi Muhammad SAW dan ketika mereka menyelenggarakan doa khusus pada acara Isra’ dan Mikraj (Shab-e-Meraj ) di masjid Hazratbal di Srinagar, India, Selasa (21/7). Shab-e-Meraj adalah acara untuk memperingati perjalanan Nabi Muhammad SAW dari Masjidil Haram ke Masjidil Aqsa, kemudian naik ke syurga.

Irak Batasi Operasi Pasukan AS Di Baghdad BAGHDAD, Irak (AP): Militer Irak menolak permintaan pasukan Amerika untuk bergerak di sekitar Baghdad tanpa pengawalan dan melancarkan serangan sejak pengalihan tanggungjawab untuk keamanan wilayah perkotaan akhir bulan lalu, kata panglima militer Irak. Pasukan tempur AS mundur dari kawasan perkotaan 30 Juni lalu sesuai perjanjian keamanan dengan Irak yang menuntut semua pasukan AS keluar dari negara itu pada akhir 2011. Kol. Ali Fadhil, seorang panglima brigade di Baghdad, mengatakanSenin(20/7)pengalihan tanggungjawabtersebutdiwarnai friksi kecil di ibukota di mana kekerasan telah menurun secara dramatis sejak terjadinya pertikaiansektedanseranganpemberontak melanda hampir seluruh negara itu beberapa tahun terakhir.

Fadhil mengatakan kepada AP temtamg dia peristiwa di mana pasukan Irak menolak permintaan AS untuk beraktivitas di kawasan ibukota sampai merekadikawalpasukanIrak,dan menjalankan serangan, yang kewajiban pasukan Irak menjalankannya sendiri. “”Merekasekaranglebihpasif dari sebelumnya,” katanya tentang pasukan AS. “Saya juga merasa tentara-tentara Amerika itu frustasi karena mereka biasanya berpatroli, tapi sekarang tidak bisa. Sekarang, tentara Amerika tinggal di pangkalan seperti penjara seakan-akan mereka dikenai tahanan rumah.” Di luar kawasan perkotaan, di mana pasukan AS masih bebas bergerak tanpa meminta ijin Irak, tentara Amerika membantu operasi pencarian dan menangkap para pemberontak, menjaga pos-pos pemeriksaan dan terus membantu melatih pasukan Irak - dari mulai memberikan pelayanan medis sampai bagaimana menjalankan helikopter. Di Washington, Menteri Pertahanan Robert Gates dan Kepala Staf Gabungan Mike Mullen, membantah terjadi friksi. Keduanya mengatakan kerjasama berjalan baik, dan Gates

mengatakandiatidakmendengar berita yang mengisyaratkan seolah-olah pasukan AS dalam bahaya. Gatesmengatakandiamenerima laporan tentang masalah itu Senin dari panglima AS, Jenderal Ray Odierno. “Dia mengatakan tingkat kerjasama dan kolaborasi dengan pasukan keamanan Irak semakin baik dari apa yang digambarkan media,” kataGateskepadawartawanpada konferensi pers di Pentagon Apakah pasukan AS berada dalam ‘tahanan rumah’, Gates senyum simpul. “Mungkin itu menggambarkan keberhasilan kami di Irak dan politik telah berjalan di negara itu,” kata Gates. Enam polisi Irak tewas Delapan orang, termasuk enam polisi, tewas dalam serangan-serangan di kota Mosul dan Ramadi di Irak, Senin, kata sejumlah pejabat keamanan dan kesehatan. Dalam satu serangan, seorang polisi dan seorang warga sipil tewas dalam penembakan dengan kendaraan melaju yang ditujukan pada patroli polisi di pusat kota Mosul, ibukota provinsi Nineveh, Irak Utara. Dua polisi lalu-lintas juga tewas ditembak — satu orang di Mosul pusat dan satu lagi di luar

Gerilyawan Somalia Serbu Kantor PBB MOGADISHU, Somalia (Antara/AFP): Milisi garis keras Somalia Shebab menyerbu kantor-kantor tiga organisasi PBB beberapa jam setelah melarang operasi mereka atas tuduhan perwakilan badan dunia itu “musuh Islam dan muslim”. Kelompok bersenjata itu menyerbu kantor-kantor Progam Pembangunan PBB, Departemen Keselamatan dan Keamanan PBB, serta Kantor Politik PBB untuk Somalia, di dua kota wilayah selatan negara itu dan menyita peralatan kantor. “Badan-badan asing itu didapati melakukan pekerjaan yang bertentangan dengan manfaat penduduk muslim Somalia dan dengan pendirian sebuah negara Islam di Somalia,” kata Shebab dalam sebuah pernyataan Senin (20/7). Penyerbuan di kota-kota Wajid dan Baidoa yang dilakukan beberapa jam setelah pernyataan itu dikeluarkan hanya ditujukan pada tiga organisasi PBB, sementara kantor-kantor lain PBB di kompleks yang sama tidak diganggu, kata seorang pejabat PBB di Baidoa kepada AFP. “Mereka menyita peralatan di kantor-kantor itu dan meminta para pegawai tidak khawatir dan tidak ada orang yang akan melukai mereka,” kata pejabat yang tidak bersedia disebutkan namanya itu. “Mereka mengatakan bahwa penyerbuan itu hanya dilakukan pada perkantoran badan-badan PBB yang kegiatannya mereka

3

larang,” tambahnya. Kelompok gerilyawan yang terilhami Al-Qaeda itu telah menguasai sejumlah besar wilayah di Somalia selatan dan tengah dalam perang mereka melawan pemerintah dan pasukan Ethiopia sekutunya yang menghalau pemerintah Islamis dari Mogadishu beberapa waktu lalu. Shebab, yang berperang untuk mendongkel pemerintah Presiden Sharif Sheikh Ahmed yang mendapat dukungan internasional, memberlakukan hukum sharia yang ketat di daerahdaerah yang mereka kuasai. Gerilyawan Islamis itu pada awal Mei meluncurkan ofensif baru terhadap pemerintah. Tiga pejabat penting tewas dalam beberapa hari sejak itu, yang mencakup seorang anggota parlemen, seorang komandan kepolisian Mogadishu dan seorang menteri yang terbunuh dalam serangan bom bunuh diri. Lebih dari 200.000 orang terlantar dalam dua bulan terakhir, sementara ratusan warga sipil diyakini tewas atau cedera, menurut Kantor Komisi Tinggi PBB Urusan Hak Asasi Manusia. Somalia dilanda pergolakan kekuasaan dan anarkisme sejak panglima-panglima perang menggulingkan diktator militer Mohamed Siad Barre pada 1991. Penculikan,kekerasanmematikan dan perompakan melanda negara tersebut. Sejak awal 2007, gerilyawan menggunakantaktikbergayaIrak, termasuk serangan-serangan

bom dan pembunuhan pejabat, pekerja bantuan, intelektual dan prajurit Ethiopia. Ribuan orang tewas dan sekitar satu juta orang hidup di tempat-tempat pengungsian di dalam negeri akibat konflik tersebut. Pemerintah sementara telah menandatangani perjanjian perdamaian dengan sejumlah tokoh oposisi, namun kesepakatan itu ditolak oleh Shebab dan kelompok-kelompok lain oposisi yang berhaluan keras. Washington menyebut Shebabsebagaisebuahorganisasi teroris yang memiliki hubungan dekat dengan jaringan al-Qaeda pimpinan Osama bin Laden. Selain pemberontakan berdarah, pemerintah Somalia juga menghadapi rangkaian perompakan di lepas pantai negara itu. Pemerintah transisi lemah Somalia tidak mampu menghentikan aksi perompak yang membajak kapal-kapal dan menuntut uang tebusan bagi pembebasan kapal-kapal itu dan awak mereka. Perompak, yang bersenjatakan granat roket dan senapan otomatis, menggunakan kapalkapal cepat untuk memburu sasaran mereka. Perairan di lepas pantai Somalia merupakan tempat paling rawan pembajakan di dunia, dan Biro Maritim Internasionalmelaporkan24serangan di kawasan itu antara April dan Juni tahun lalu saja.

rumahnya. Seorang polisi keempat tewas ketika sebuah bom pinggir jalan yang dipasang di jalan utama di Mosul selatan meledak ketika ia berusaha menjinakkannya. Di kota Ramadi, Irak barat, tiga orang tewas, termasuk dua polisi, dalam ledakan bom mobil, yang merupakan serangan kedua di sana dalam waktu sepekan. Empat orang juga cedera, termasuk dua polisi, dalam pemboman di dekat kantor pusat pemerintah provinsi di jantung kota tersebut. Ramadi merupakan ibukota dari provinsi Anbar, Irak barat, yang dulu menjadi benteng pemberontakanSunni.Kekerasan menurun tajam di wilayah itu dalam 18 bulan terakhir ketika suku-suku setempat bersekutu dengan pasukan pimpinan AS untuk melawan kelompok gerilyawan. Pekan lalu enam orang tewas dalam serangan bom mobil bunuhdirididekatsebuahmasjid di Ramadi. Serangan Senin itu terjadi tiga pekan setelah pasukan

AS ditarik dari pusat-pusat perkotaan sesuai dengan perjanjian keamanan antara Baghdad dan Washington yang menetapkan penarikan penuh pasukan Amerika dari Irak pada akhir 2011. Kekerasan menurun secara berarti di Irak dalam beberapa bulan ini, namun seranganserangan meningkat menjelang penarikan militer AS, dan 437 orang Irak tewas pada Juni — jumlah kematian tertinggi dalam kurun waktu 11 bulan. PM Nuri al-Maliki memperingatkan pada Juni bahwa gerilyawan dan milisi mungkin meningkatkan serangan mereka dalam upaya merongrong kepercayaan masyarakat pada pasukan keamanan Irak. Sejumlah serangan bom besar dilancarkan sejak itu, dan yang paling mematikanadalahseranganbom truk pada 20 Juni di dekat kota wilayah utara, Kirkuk, yang menewaskan 72 orang dan mencederai lebih dari 200 lain dalam serangan paling mematikan dalam 16 bulan.(m18/m07)

KABUL, Afghanistan (AP): Para pejabat Afghanistan mengatakan 13 militan Taliban dan pasukan keamanan Afghanistan tewas dalam serangan pemberontak di dua kota bagian timur Afghanistan. Polisi Ghulam Dastagir mengatakan, lima pembom bunuh diri Taliban menyerang pusatpusat pemerintah di kota Gardez. Lima pembom Taliban dan lima pasukan keamanan Afghanistan tewasdalamseranganSelasa(21/7).Duapembom yang ditembak mengenakan pakaian wanita, burqa. Dalam serangan kedua yang dijalankan pada waktubersamaan,polisiMohammadAyubSalangi mengatakan dua pembom bunuh diri yang mengendarai sepedamotor dan seorang polisi tewasdikotaJalalabadsetelahpertempuranterjadi. Seorang jubir Taliban mengatakan 15 pembom bunuh diri menyerang Gardez. Jet tempur jatuh SebuahjettempurInggrisjatuhdiAfghanistan, Senin,mencederaiduapilotnyadanitumerupakan pesawat keempat Barat yang jatuh di negara yang dilanda perang itu dalam waktu sepekan. Kecelakaan itu dan pembunuhan seorang prajuritInggrisdalamseranganbomyangmenambah jumlah korban tewas menjadi 17 pada bulan ini diperkirakan akan menyulut debat politik baru di London menyangkut peranan Inggris dalam konflik Afghanistan.

Jumlah kematian prajurit Barat mencapai tingkat tertinggi di Afghanistan ketika sejumlah pemerintah asing berusaha mengirim pasukan tambahan ke negara itu dengan harapan meredakan pemberontakan Taliban yang semakin keras menjelang pemilihan umum 20 Agustus. Beberapa pejabat pemerintah setempat mengatakan, Senin, serangan-serangan terpisah menewaskan 12 warga sipil, sementara pangkalan udara Kandahar di Afghanistan selatan melaporkan kecelakaan penerbangan kedua dalam dua hari ini. Mohammad Aslam Yar, seorang jurubicara pangkalan itu, mengatakan, sebuah jet tempur Pasukan Bantuan Keamanan Internasional (ISAF) pimpinanNATOjatuhpadaSeninpagidilapangan terbang itu, yang merupakan pangkalan militer terbesar di wilayah selatan. “Ada dua pilot yang meloncat dan dibawa ke sebuah rumah sakit militer di pangkalan itu untuk dirawat. Selain mereka, tidak ada korban lain. Tidak ada tembakan musuh yang terlibat,” kata Yar. Seorang jurubicara kementerian pertahanan di London mengatakan, jet itu adalah sebuah Tornado GR4 Angkatan Udara Kerajaan Inggris, namundamengesampingkankegiatangerilyawan sebagai penyebab jatuhnya pesawat tersebut. Itu merupakan pesawat keempat Barat yang jatuh di negara itu dalam waktu sepekan.(m18/m07)

Lebih 50 Gerilyawan Tewas Di Pakistan BaratLaut KOTA, Pakistan (Antara/Reuters): Tentara Pakistantelahmenewaskanlebihdari50gerilyawan dalam dua hari pertempuran di kabupaten Lower Dir, kata militer. Pasukan keamanan melakukan operasi pencarian dan penutupan di beberapa desa di Lower Dir pada 19 dan 20 Juli terhadap gerilyawan yang telah menghindari operasi militer di lembah Swat, yang berdekatan, kata militer dalam satu pernyataan yang dikeluarkan Senin (20/7) larut malam. “Selama operasi itu, lebih 50 gerilyawan tewas dan beberapa orang lagi cedera,” demikian antara lainisipernyataanparamiliterPenjagaPerbatasan.

MiliterPakistanberadapadatahapterakhiroperasi yang dimulai sekitar dua bulan lalu di Swat. Militer menyatakan telah menewaskan lebih 1.700 gerilyawan, tetapi pengeritik mengatakan sedikit pemimpin gerilyawan yang telah disingkirkan. Perkiraan terpisah mengenai korban jiwa belum diperoleh. Kerusuhan di seluruh Pakistan barat-laut dan penyebaran pengaruhTaliban telah meningkatkan keprihatinan mengenai ketidak-amanan di negara bersenjata nuklir tersebut, sekutu penting dalam misi Barat guna menstabilkan Afghanistan dan menghancurkan al-Qaida.

Kubur Hidup Warga Muslim Dua Etnis Serbia Dipenjarakan DENHAAG, Belanda (Antara/Reuters): Dua saudara sepupu Serbia Bosnia, Milan Lukic dan Sredoje Lukic, dihukum oleh pengadilan kejahatan perangYugoslavia karena mengubur puluhan Muslim Bosnia hidup-hidup dalam perang 1992-1995 di negara itu. Milan Lukic, 41, yang menurut para penuntut memimpin sebuah kelompok paramiliter Serbia yang dikenal sebagai‘Garuda Putih’ atau‘Penuntut Balas,’ dijatuhi hukuman penjara seumur hidup oleh pengadilan di Den Haag itu Senin (20/7) karena pembunuhan sedikitnya 119 orang Bosnia dalam dua insiden pada Juni 1992. Sredoje Lukic, 48, yang para penuntut katakan juga angota unit itu, diganjar 30 tahun penjara. Pengadilan itu memutuskan mereka belum membuktikan bahwa dia hadir pada salah satu serangan tersebut. Kedua pria itu mengaku tidak bersalah terhadap semua tuduhan dan mengatakan mereka tidak hadir di kotaVisegrad di Bosnia Timur pada waktu kejahatan tersebut dilakukan. Pengacara mereka telah minta pembebasan mereka. “Tindakan kejahatan oleh Milan Lukic dan SredojeLukicdalamkasusinidigolongkandengan

sikap tak peduli pada kehidupan manusia dengan tak berperasaan dan keji,” hakim Patrick Robinson mengatakan. Pengadilan itu menemukan sekitar 59 orang Muslim Bosnia yang dikubur hidup di sebuah rumah yang dibakar dengan gas dan bahan peledak, sementara sedikitnya 60 orang tewas setelah dibarikade di dalam sebuah rumah lainnya sebelum granat dilemparkan ke bangunan itu. Hakim Robinson mengatakan pengadilan menemukan Milan Lukic bersalah dalam dua insiden itu, dan menambahkan dia memainkan perandominandalamserangandimanadiasendiri yang menutup pintu salah satu rumah tersebut, membakarnya dan menembak orang yang berusaha untuk lari. Pengadilan itu mendapati Sredoje Lukic tidak hadir pada insiden kedua, tetapi kehadirannya pada insiden yang pertama ‘telah menyumbang secara substansial pada kematian-kematian tersebut” meskipun faktanya dia tidak membakar rumah itu atau menembak korban. Bakira Hasecic, presiden kelompok bantuan ‘Wanita-Korban Perang,’ mengatakan dia mengharapkan kedua pria itu akan diadili.


Ekonomi & Bisnis

4 Harga Emas Di Medan Jenis

Kadar

Harga

London Murni London 24 Karat Emas Putih 22 Karat Suasa

99% 97% 90 s/d 93% 75 % 70% 20 s/d 35%

Rp310.000 Rp296.000 Rp260.000 Rp225.000 Rp165.000 Rp100.500

Valuta Asing Di Medan

Mata Uang Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

Jual 10.075 8.225 9.664 16.748 1.389 110,43 7.230 14.523 3.300

Beli 10.065 7.925 9.287 16.305 1.283 105,88 7.000 14.123 3.000

Pertamina Tolak Aspirasi Pangkalan MEDAN (Waspada): Pengusaha pangkalan minyak tanah bersikukuh dengan sikapnya menolak konversi minyak tanah ke elpiji, kata ketuanya. Sebab Pertamina Region I Sumut-NAD hingga saat ini tak mau menerima aspirasi mereka, sambungnya. Binsar Sianturi, ketuka Persatuan Pangkalan Minyak Tanah (PPMT) Medan, berbicara saat berdialog dengan praktisi bisnis Vincent Wijaya di Taipan Restoran Medan, Selasa (21/7). Dialog itu juga menyambut diskusi interaktif yang akan mereka gelar tentang dampak sosial, politik, dan ekonomi atas kebijakan pemerintah mengenai konversi minyak tanah ke elpiji. Menurutnya, mereka sudah meminta Pertamina region I mendengar aspirasi mereka namun sampai sekarang tak pernah ditanggapi. Padahal ada alasan-alasan yang mau disampaikan PPMT terkait penolakan terhadap konversi. Alasan itu, menurut Sianturi, meliputi usaha kecil serta masyarakat kebanyakan. Hadir bersamanya koordinator PPMT Medan Sunggal Agus, PPMT Medan Petisah A. Sibarani, PPMT Helvetia Sopian Hutabarat dan bendahara

PPMT Herni W. Siahaan. Binsar secara tegas menyatakan konversi merupakan keputusan pusat. Namun di berbagai wilayah pemerintah daerahnya secara tegas menolak, kata dia. “Kita pun berharap Pemko Medan dan Gubernur Sumut menolak konversi ini. Perlu juga digarisbawahi agar Pertamina pun tidak memaksakan kehendak,” jelasnya. Dia mengungkapkan dari sisi bisnis pengusaha pangkalan jika konversi dipaksakan akan mengurangi pendapatan 100 persen. “Itu baru dari sisi kita saja. Belum lagi pendapatan abang becak, pengecer serta usaha kecil yang menggunakan diantaranya penjual mie pansit, tukang gorengan, penjual bakso, warung kopi.” Hutabarat menambahkan dengan konversi itu potensi pengangguran yang akan muncul mencapai 5.500 orang. “Baru dari pangkalan saja belum usaha kecil,” tegasnya. Menurut dia, pemaksaan konvers juga menciderai kebutuhan masyarakat berpenghasilan rendah. “Kalau dihitung-hitung memang pemakaian elpiji sedikit lebih berhemat. Tapi orang yang berpenghasilan Rp30 ribu saja sehari akan sulit

membagi-bagi pendapatannya. Karena untuk minyak tanah biasanya mereka bisa beli setengah liter, satu liter tergantung kebutuhan. Kalau elpiji harus langsung 3 kg,” ucapnya. Binsar mengungkapkan di Jawa Timur dan Yogyakarta secara tegas melakukan penolakan namun Sumut dan Medan tidak memiliki sikap tegas. Selain menolak dengan argumentasi masuk akal, PPMT pun sudah melakukan survei di 18 kecamatan Medan. Intinya 95 persen responden dari 18.000 yang ditanya mengaku menolak konversi minyak tanah ke elpiji dengan berbagai alasan. Vincent Wijaya dalam kesempatan tersebut menyatakan tidak ingin masuk ke pro kontra tentang penolakan konversi. Hanya saja dia melihat memang belum saatnya pelaksanaan konversi dilanjutkan. “Selama lima tahun ini belum cocok. Mungkin setelahnya baru bisa. Semua melihat situasi,” tuturnya. Dia mengungkapkan dari sisi kualitas hidup penggunaan masyarakat terhadap energi terus berubah. Awalnya dari kayu bakar

berpindah ke minyak tanah selanjutnya adalah gas bumi namun di sini langsung loncat ke elpiji, kata dia. “Konversi ini merupakan salah satu upaya pemerintah untuk mengurangi subsidi dengan alasan terjadinya lonjakan minyak dunia.” Konversi elpiji pasti akan mempengaruhi pengusaha pangkalan dan masyarakat secara umum sehingga perlu kajian mendasar, tandasnya. Namun dia menegaskan PPMT harus melihat kalau itu kebijakan pusat. “Artinya apa pun yang dilakukan kalau pusat tetap menyatakan konversi harus jalan tidak bisa ditolak. Oke kalau mau menyatakan penolakan. Kelak kalau harga minyak tanah dinaikkan menjadi Rp7.000 per liter yang sudah tanpa subsidi masyarakat mau tidak mau harus pindah juga ke elpiji karena pasti lebih murah,” jelasnya. Memang banyak masalah termasuk nanti suplai elpiji dan kelaikan harga, tuturnya. Begitupun dia mengharapkan agar PPMT bisa melakukan kajian tuntutan agar sasarannya ke pemerintah pusat.(m13)

Tingkat Hunian Hotel Di Jakarta Turun Jadi 60 Persen JAKARTA (Waspada): Tingkat hunian hotel di Jakarta tercatat menurun pascaledakan bom di Hotel Ritz-Carlton dan JW Marriott. Menurut Gubernur DKI Jakarta Fauzie Bowo, dua pekan lalu tingkat hunia hotel di Jakarta masih berada di tingkat 70 persen. Namun angka tersebut hanya sedikit menurun setelah terjadinya ledakan bom menjadi 60-62 persen. “Selama akhir pekan kemarin memang hotel mengalami penurunan, padahal pada minggu sebelumnya sekitar

70 persen. Tapi minggu ini menurun sampai 60-62 persen, tapi yang jelas tidak ada eksodus besar-besaran di bandara, khususnya WNA di Jakarta,” katanya. Dia menambahkan, hingga tadi pagi, jumlah kedatangan dan kepergian di Jakarta belum menunjukkan perubahan signifikan, keduanya masih berimbang. “Cuma ada beberapa pembatalan, misalnya dari grup tour Jepang sekitar 150 orang gagal datang,” jelasnya. Pada kesempatan sama,

Ketua Umum Kamar Dagang Indonesia (Kadin) MS Hidayat mengatakan, pada empat hari terakhir pasca ledakan bom, terjadi pengalihan tingkat hunian dari hotel berbintang ke hotel domestik. Namun menurutnya, hal itu hanya berlaku di Jakarta, sementara di Bali pengaruhnya tidak terlalu besar. “Semakin cepat kepolisian mengungkap kasus ini, mungkin kepercayaan investor akan lebih cepat. Khusus untuk pariwisata dikuatirkan justru mereka (wisatawan) yang ingin datang ke Indonesia akan merubah jadwalnya jika 1 bulan belum ada pengungkapan,” katanya. Ledakan bom terjadi di hotel Ritz-Carlton dan JW Marriott di Mega Kuningan, Jumat (17/7), terjadi saat sejumlah top eksekutif perusahaan asing menggelar pertemuan bisnis. Namun Kadin menampik dugaan serangan bom tersebut memang ditujukan kepada

petinggi-petinggi perusahaan kelas kakap tersebut. “Kadin menyampaikan tidak benar kalau teror ditujukan pada investor dan pengusaha asing yang sedang berada di hotel internasional. Mereka sedang rapat dan hampir setiap hari rapat di hotel tersebut. Jadi siapaun bisa jadi korban, seluruh investor mendukung, mereka akan tetap berinvestasi di Indonesia,” kata Ketua Umum Kadin MS Hidayat dalam ketengan pers di Bellagio, Kuningan, Jakarta, Selasa (21/7). Seperti diketahui, sejumlah petinggi perusahaan asing memang menjadi korban serangan bom tersebut. Presdir PT Holcim Indonesia Tbk Timothy Mackay menjadi salah satu korban tewas, sedangkan GM Husky Oil North Sumbawa LT dan, Kevin S Moore dan GM Anadarko Indonesia Co, Gary Ford kini masih dirawat.(dtc)

DSP Bersihkan 60 Pasar Di Sumut

XL Tes Kecepatan Akses Data UNTUK pertama kalinya, XL melakukan tes kecepatan akses data di mana masyarakat dapat menyaksikan secara langsung masing – masing kecepatan seluruh akses data yang ada di kota Medan. Sehingga melalui tes kecepatan akses data yang dilaksanakan pada hari Selasa (22/07) di Sun Plaza Ground Floor ini, masyarakat dan pelanggan khususnya dapat menilai sarana komunikasi / akses data yang memang seharusnya menjadi pilihan atau keinginan dari masyarakat atau pelanggan tersebut. Adapun sarana yang digunakan untuk melakukan tes kecepatan akses data ini melalui beberapa perangkat yaitu laptop – modem, BlackBerry 2G, BlackBerry 3G dan iPhone “Tes kecepatan akses data ini merupakan salah satu sarana XL kepada masyarakat khususnya pelanggan untuk dapat membuktikan kecepatan akses data yang ditawarkan plus kesiapan kapasitas dan kualitas yang telah dipersiapkan sehingga sarana komunikasi dapat terlaksana dengan cepat, tepat dan berkualitas,” ujar Agus Simorangkir, VP West Region XL Untuk mendukung kebutuhan terhadap layanan data XL yang semakin meningkat di Sumatera, basis infrastruktur telah disiapkan jauh hari sebelumnya meliputi end to end koneksi, kapasitas BTS dengan saluran data dan voice yang terpisah, kapasitas transmisi, baik melalui fiber optic maupun microwave. Dengan telah dioperasikannya jalur fiber optic melalui kabel bawah laut yang baru dari Lampung ke Merak-Banten dan jalur internasional dari Batam-Dumai-Malaka, maka XL dapat menyalurkan lebih dari 150 juta saluran percakapan dan data dari Pulau Sumatera dan keluar Pulau Sumatera. Hal ini memungkinkan XL untuk mengantisipasi terjadinya kepadatan trafik percakapan, SMS dan data melalui GPRS, 3G bahkan HSDPA sehingga masyarakat dan pelanggan khususnya dapat menikmati sarana komunikasi terbaik dan tercepat. Tes kecepatan akses data ini terselenggara atas kerjasama XL dengan PT Alcatel - Lucent Indonesia (ALU)

MEDAN (Waspada): Sebagai wujud nyata komitmen Bank Danamon dalam mewujudkan pasar tradisional yang bersih, sehat dan sejahtera, Sabtu (18/7) diselenggarakan hari pasar bersih nasional kedua dengan membersihkan 750 pasar di 31 provinsi. Sedangkan di Danamon Simpan Pinjam (DSP) Region Medan, sebanyak 60 pasar dibersihkan dalam sehari oleh seluruh karyawan DSP. Total sumbangan yang diberikan DSP Region Medan senilai Rp344,4 juta dalam bentuk sumbangan alatalat kebersihan, pemeriksaan kesehatan gratis dan perbaikan infrastruktur skala kecil seperti kebersihan dan pengecatan. Regional Sales Head Regional Medan Juanto Padang mengatakan tahun mendatang akan lebih banyak lagi pasar tradisional yang dibersihkan, sejalan dengan berkembangnya jangkauan wilayah Danamon Simpan Pinjam di pasar-pasar tradisional di seluruh tanah air. Khusus di Medan Area 1 seperti DSP Simpang Limun, DSP Pringgan dan DSP lainnya di Medan Area 1, kegiatan dilaksanakan di 11 pasar tradisional dengan total

sumbangan senilai Rp57 juta. “Kegiatan pasarku bersih, sehat dan sejahtera merupakan komitmen DSP untuk merevitalisasi pasar tradisional di Indonesia. Program ini mendukung program Departemen Perdagangan dalam mewujudkan pasar yang bersih, aman, nyaman dan adil,” ujar Mardin Tarigan, Cluster Manager Medan Area 1. Antonius Aswan Suditio, Unit Manager DSP Unit Simpang Limun di sela-sela kegiatan pembersihan Pasar Inpres Titi Kuning Medan mengatakan, sejak pagi hari pihaknya dan seluruh karyawan DSP Simpang Limun sudah melakukan pembersihan pasar tersebut. Ditanya soal pembersihan pasar tersebut, ia mengatakan akan lebih senang orang berbelanja ke pasar tradisional kalau pasar tradisional itu bersih, kering atau tidak becek. “Kalau seluruh lapisan masyarakat belanja keperluan seharihari ke pasar tradisional, maka kegiatan bisnis akan tinggi, dan pembayaran pinjaman mereka ke DSP juga lancar. Jadi kita upayakan agar nasabah kita yang berbisnis di pasar tradisional tumbuh signifikan, sehingga keuangan mereka semakin sehat,”ujarnya.(rel)

WASPADA Rabu 22 Juli 2009

Omset Pedagang Buku Bekas Naik 50 Persen MEDAN (Waspada): Omset pedagang buku bekas di kawasan Titi Gantung dan Lapangan Merdeka di saat tahun ajaran baru meningkat hingga 50 persen dibanding hari biasa. Pembelian buku bekas di kawasan sudah menjadi tujuan masyarakat Medan selama bertahun-tahun tersebut didominasi para pelajar SMA hingga perguruan tinggi. Menurut Hendrik,33, pedagang buku pelajaran sekolah di Lapangan Merdeka kepada wartawan, Selasa (21//7), diperkirakan omset pedagang buku saat ini meningkat sebesar 50 persen di banding hari biasa. Sementara itu dibanding tahun lalu, omset tersebut mengalami kenaikan sebanyak 20 persen, karena disi-

nyalir akibat saat ini pihak sekolah tidak terlalu gencar menjual buku kepada siswa, katanya. Barometer penjualan buku pelajaran sekolah setiap tahunnya akan terlihat selama sepekan sejak dimulainya siswa baru masuk sekolah, karena setelah sepekan pertama tersebut biasanya omset akan turun perlahan hingga bulan September, ujarnya. Ramainya konsumen ke lokasi penjualan buku di Lapangan Merdeka mencari buku yang sama dipakai di sekolah namun tidak seluruhnya tersedia di kios, sehingga dari 10 buku yang dicari hanya bisa saja hanya lima yang terjual karena lima buku lagi tidak ada dijual, katanya. Harga mahal Sementara itu pedagang buku di Lapangan Merdeka

Rupiah Naik 75 Poin JAKARTA (Antara): Kurs rupiah terhadap dolar AS di pasar spot antarbank Jakarta, Selasa (21/7) sore naik 75 poin, namun posisi masih di atas Rp10.000 per dolar, karena Bank Indonesia (BI) belum menginginkan mata uang Indonesia ada dibawah angka Rp10.000 per dolar. Nilai tukar rupiah terhadap dolar naik menjadi Rp10. 065-Rp10.075 per dolar dibanding penutupan hari sebelumnya Rp10.140-Rp10.155 atau naik 75 poin. Pengamat pasar uang, Edwin Sinaga di Jakarta, Selasa mengatakan, rupiah berpeluang untuk terus menguat hingga dibawah angka Rp10.000 per dolar. Namun kenaikan rupiah diperkirakan akan dihambat oleh aksi intervensi BI ke pasar agar posisinya masih berada kisaran antara Rp10.050 sampai Rp10.100 per dolar, katanya. Peluang rupiah, lanjut dia sangat besar untuk bisa berada dibawah Rp10.000 per dolar, karena sentimen positif setelah pasca ledakan

bom cukup tinggi. Pelaku cenderung memburu mata uang Indonesia, karena mereka optimis pasar domestik masih dapat memberikan gain yang lebih baik ketimbang negara lain, ucapnya. Edwin Sinaga mengatakan, ekonomi Indonesia yang tetap tumbuh dan minat investasi asing yang masih besar merupakan faktor utama mendorong pelaku asing bermain di pasar Indonesia. Apalagi investasi asing diharapkan tumbuh sebesar tujuh persen untuk memicu pertumbuhan ekonomi sebesar 4,5 persen, katanya. Menurut dia, pasar saham yang terus bergairah juga merupakan indikasi pertumbuhan ekonomi Indonesia masih lebih baik ketimbang negara lain di kawasan Asia, karena minat asing untuk melakukan investasi akan tetap besar. Hal ini terutama imbas teros bom hanya sesaat saja, jauh dibanding sentimen positif dari pasca pemilihan umum yang sangat meyakinkan pasar, katanya.

tidak berani membeli buku baru pada saat ini karena harganya sangat mahal, namun seperti pengalaman tahun lalu sebulan setelah ini akan banyak penerbit memasok buku sisa, sebutnya. Buku tersebut dijual ke pedagang buku dengan harga dibawah standar yang tentu saja lebih murah dibanding saat dijual dalam kondisi baru seperti kini, lanjutnya. Buku yang tersedia di pihak pedagang hanya buku-buku bekas tahun lalu yang masih dipakai oleh siswa kelas II dan III untuk SMP dan SMA serta perguruan tinggi, selain

itu pedagang juga banyak menyediakan berbagai kamus TA 2007 hingga 2008. Dalam kondisi tersebut pedagang baru bisa memenuhi permintaan konsumen atas buku baru setelah sebulan setelah awal masuk sekolah saat ini, ujarnya. Suwardi,46, salah seorang wali siswa warga Jalan Perintis Kemerdekaan mengatakan buku-buku baru yang dijual pihak sekolah sangat mahal harganya, untuk siswa kelas satu saja bisa menghabiskan dana sebesar Rp600 ribu, sedangkan untuk kelas II dan III bisa lebih murah.(m40)

Thamrin Plaza Great Sale Meriahkan HUT Medan MEDAN (Waspada): Pusat bisnis dan perbelanjaan Thamrin Plaza menyelenggarakan event bertajuk Thamrin Plaza Great Sale 2009 yang digelar sejak Juli hingga 2 Agustus 2009 untuk memeriahkan HUT ke419 Kota Medan. Great sale tersebut didukung seluruh tenant (toko) dengan menyediakan diskon harga mencapai 70 persen. General Manager PT Supra Uniland Utama (GM PT SUU) Paulus Tamie didampingi Sosial Security & Legal Manager (SSL & Legal) Suryanty So SH dalam perbincangan dengan wartawan di d’Loft Foot Court, Rabu (15/7). Paulus Tamie menjelaskan, selain memeriahkan HUT Kota Medan, agenda great sale tersebut juga dimaksudkan sebagai bagian dari program pihaknya untuk memanjakan konsumen dan pengunjung setia yang berbelanja di pusat perbelanjaan tersebut. Selain menyediakan diskon harga secara regular, pihak PT SUU juga concern melakukan beragam kegiatan yang bermaksud meningkatkan daya tarik serta kenyamanan konsumen yang berbelanja. Program dimaksud antara

lain menambah outlet pusat jajanan, menghadirkan kembali bioskop Theatre 21, mengajak peritel untuk menempati space (ruang) yang ada. Paulus mengungkapkan, salah satu peritel yang dipastikan akan membuka outlet di Thamrin Plaza adalah Maxi Mart yang sudah terikat deal dengan manajemen PT SUU. “Paling lambat di akhir semester II-2009, peritel Mazi Mart akan membuka outlet di Lantai dasar pusat perbelanjaan Thamrin Plaza,” kata Paulus seraya menambahkan pihak Maxi Mart akan menempati space berkisar 1.400 meter. Mengenai perkembangkan tingkat hunian (occupancy rate) penggunaan ruangan di Thamrin Plaza, menurut Paulus, saat ini berkisar 97 persen. Pihak PT SUU, kata Paulus, berharap, hingga akhir tahun tingkat hunian akan meningkat hingga mencapai 9899 persen. Terkait ekses masa liburan terhadap jumlah pengunjung di pusat bisnis itu, menurut Paulus, meningkat sekitar 10 persen dan pelaksanaan great sale tersebut dapat menambah pengunjung mencapai 25 persen.(m13)

Medan Green And Clean

Hijau Dan Kreativitas Warga Sambut Juri MdGC ADA hal yang berbeda dari dari setiap daerah ketika tim dewan juri Medan Green and Clean (MdGC) melakukan penilaian di masing-masing lingkungan. Tidak hanya teduh yang disebabkan banyaknya pohon yang tinggi dan tanaman di setiap rumah melainkan responnya kelompok masyarakat sadar lingkungan (darling) dan kepala lingkungannya yang benar-benar menginginkan daerahnya hijau dan bersih. Adalah Kelurahan Tanjung Gusta, Medan Helvetia, Lingkungan 1 & 3 dan Kelurahan Banten, Medan Tembung, Lingkungan 13. Daerah ini tidak hanya menunjukkan wilayah yang bersih dan hijau melainkan kreativitas kerajinan tangan para masyarakatnya yang tergabung di kelompok darling dan semangat kebersamaannya. “Atas kesadaran warga yang menginginkan kampungnya menjadi tempat yang nyaman dan asri, maka kita bertekad untuk membuat kampung

menjadi hijau dan bersih,” ujar Lurah Tanjung Gusta Aminullah. Dia bertekad agar kampung ini berhasil menjadi hijau karena partisipasi masyarakatnya yang begitu antusias disamping mendapat dukungan dari aparat pemerintah Kota Medan, juga yayasan Bumi Hijau Lestari, Unilever dan Harian Waspada. Apa pun jenis tanaman, lanjut Aminullah, pihak pemerintah daerah akan mendukungnya apalagi untuk keindahan kota Medan. “Jenis tanaman yang ditanam beraneka ragam seperti mahkota dewa, jambu biji, melinjo, ubi jalar, jati mas, singkong, mangga, belimbing dan tanaman lainnya,” ujar warga. Di tengah-tengah acara nyanyi dan makan bersama sebagai bentuk solidaritas masyarakat yang tergabung di dalam kelompok darling. Aminullah berupaya menggalakkan aspek penghijauan warga kampung ini juga mengolah sampah secara mandiri dan terpadu. “Pemilahan sampah dilakukan mulai dari rumah tangga. Dalam kegiatan ini telah disediakan tempat sampah organik, anoganik dan

Kelompok darling Kelurahan Bantan sedang foto bersama mengenakan busana daur ulang sampah.

Foto bersama Sekretaris Badan Lingkungan Hidup Pemko Medan Lies Setyowati (duduk di tengah), Dewi Budiati TJ Said, Lurah Tj.Gusta, Aminullah beserta para darling. barang beracun berbahaya (B3). Dengan kegiatan warga ini, lingkungan 1 & 3, Tanjung Gusta sepertinya pantas dijadikan contoh ideal,” ujarnya kembali. Sementara di Kelurahan Banten, Lingkungan 13, Medan Tembung, para darlingnya menyambut tim dewan juri dengan melakukan kreasi penanaman pohon di pot yang diletakkan di atas gang rumah dengan pintu masuk lampu-lampu yang dihiasi . Sehingga langit-langit gang lingkungan 13 tampak hijau meski dikhawatirkan jatuh akibat anging kencang atau hujan lebat karena pemasangan pot memakai bambu. Namun, hal ini telah menunjukkan semangat mereka untuk menghijaukan lingkungan mereka. Ketua Darling, Dini Afridayani menyatakan ini adalah bentuk kreasi warga, namun hal ini akan diperbaiki untuk ke depannya dengan memakai jaringjaring sehingga hal ini tidak akan membuat bahaya terhadap pengguna jalan. “Namun kita tetap berupaya agar lingkungan kita benar-benar dapat menjadi contoh model lingkungan hijau dan bersih kota Medan,” ujarnya. Selain itu, ketua

darlingnya juga menunjukkan hasil kreativitas warganya dengan menampilkan kaligrafi, biola mini, tas hasil daur ulang, dinding dari kertas dan lain sebagainya. Sayangnya, ada beberapa daerah yang kelompok darlingnya kurang bersemangat sehingga hanya pada waktu penilaian saja daerahnya bersih dan hijau, namun ketika tidak penilaian seperti tidak tertata. Sekretaris Badan Lingkungan Hidup Lies Setyowati menyatakan degradasi lingkungan hidup semakin meningkat tahun demi tahun, khususnya permasalahan sampah yang semakin butuh untuk segera ditingkatkan penanganannya. Dengan volume sampah yang terus bertambah dalam deret ukur, sementara masih terbentur dengan penanganannya yang masih belum memadai untuk dapat menjangkau semuanya. “Partisipasi dari pihak masyarakat juga dituntut untuk lebih terlibat dalam prakteknya maupun inovasinya, salah satunya dengan mempopulerkan kegiatan recycle atau daur ulang dalam rangka pendidikan lingkungan,” ujarnya.


Nusantara

WASPADA Rabu 22 Juli 2009

5

Ponpes Ngruki Kecam Pencekalan Abu Bakar Ba’asyir

Antara

DITANGKAP: Sejumlah petugas Detasemen khusus 88 Polda Papua menangkap empat warga sipil di Jalan Baru, Distrik Mimika Baru, Timika, Selasa (21/7). Keempat warga itu ditangkap karena diduga terlibat serangkaian kasus yang terjadi diareal PT Freeport yang menyebabkan tiga orang tewas tertembak yakni Drew Nicolas Grant asal Australia dan Markusn Rante Allo (keduanya karyawan PT Freeport) dan Bripda Marsom Patipelohi, anggota Propam Polda Papua yang tergabung dalam satgas.

Penembakan Di Freeport

4 Warga Sipil Ditangkap TIMIKA (Antara): Detasemen Khusus 88 Anti Teror Polri, Selasa (21/7) menangkap empat orang warga sipil di kawasan Jalan Baru, Distrik Mimika Baru, Timika, Papua. Keempat warga itu diambil dari tiga rumah berbeda yang terletak berdekatan. Saat penangkapan, mereka tidak melakukan perlawanan. Tangan mereka diikat dan dibawa ke mobil patrol, selanjutnya dibawa ke Mapolres Mimika di Kuala Kencana. Keempat warga sipil itu ditangkap karena diduga terlibat dalam beberapa kasus kriminal yang terjadi di areal PT Freeport Indonesia. Di areal operasional PT Freeport itu sejak awal Juli

2009 terjadi serangkaian kasus antara lain pembakaran bus di mile 71 dan 74. Kasus penembakan di mile 51 dan 53 yang menewaskan tiga orang, dua diantarannya karyawan PT.Freeport. Namun belum ada keterangan resmi dari pejabat kepolisian soal penangkapan itu. Pangdam Bantah Sementara Panglima Kodam XVII Cenderawasih, Mayjen TNI AY Nasution membantah anggota TNI terlibat dalam kasus penembakan di kawasan operasional PT Freeport, khususnya di jalur TembagapuraTimika.

“Tidak ada anggota yang terlibat, termasuk anggota disersi,” tegas dia, seusai mendampingi Kapolda Papua Irjen Pol. Bagus Ekodanto saat memberikan keterangan pers di Mapolres Mimika di Timika, Selasa (21/7). Pangdam juga membantah ada anggota Kopassus yang ditangkap sesaat setelah insiden penembakan di mile 51. “Itu semua tidak benar,” tegasnya menambahkan, yang terjadi saat itu ada beberapa anggota kopassus yang turun ke Timika dari Tembagapura. Ditanya tentang peluru yang digunakan dan ditemukan dalam kasus itu buatan Pindad, Panglima Cenderawasih menga-

kui memang peluru-peluru itu dibuat di Pindad. Sementara Kapolda Papua Irjen Pol. Bagus Ekodanto mengakui hingga saat ini belum ada kelompok yang menyatakan bertanggung jawab terhadap insiden penembakan di ruas jalan Timika-Tembagapura. Para tersangka yang hingga saat ini masih diperiksa secara intensif belum mengaku berasal dari kelompok mana. “Hingga kini kami masih melakukan penyelidikan mengungkap kelompok mana yang melakukan aksi menewaskan tiga orang dan mencederai beberapa anggota Brimob dan security PT Freeport,” katanya.

Kerjasama Antiteror Terus Ditingkatkan JAKARTA (Antara): Menteri Pertahanan Juwono Sudarsono mengatakan, kerja sama antiteror antara Indonesia dan sejumlah negara terus ditingkatkan dalam berbagai bentuk. “Hanya saja untuk kasus teror yang berada di Indonesia, kerjasama antaraparat Indonesia dan negara lain tetap harus di bawah kendali otoritas keamanan Indonesia,” kata Juwono Sudarsono dalam pembukaan

program pasca-sarjana Universitas Pertahanan di Jakarta, Selasa (21/7). Dia mengatakan, untuk menghindari spekulasi tentang sebab-musabab ledakan di Mega Kuningan Jumat (17/7) pagi, semua pihak hendaknya bersabar menunggu hasil penyelidikan Polri. Sementara Kepala Desk Antiteror Kementerian Politik, Hukum dan Keamanan An-

Akses Internet Di Sekolah Minim JAKARTA (Waspada): Akses internet di sekolah masih rendah. Dari 250 ribu sekolah SDSMA di Indonesia, hanya 35 persen atau sekira 87.500 sekolah yang sudah memiliki jaringan internet. Padahal pada 2015 pemerintah menargetkan 75 persen sekolah sudah memiliki akses internet. “Itupun masih sebatas sekolah menengah pertama dan menengah atas. Sementara untuk tingkat SD jumlahnya sangat minim,” ujar Kepala Pusat Teknologi dan Komunikasi (Pustekkom) Depdiknas Dr Lilik Gani, saat sosialisasi penggunaan Teknologi Informasi Komunikasi (TIK) di kalangan pelajar SD, SMP dan SMA di Jakarta, Bogor, Tangerang dan Bekasi (Jabotabek), Selasa (22/7) di Musium Mandiri Jakarta. Padahal lanjut Lilik, kemampuan berinteraksi dengan dunia TIK sudah harus dimulai sejak dini. Tujuannya supaya anak-anak tidak ketinggalan informasi dan mampu menatap masa depan dengan lebih baik lagi. “Masalahnya ini abad persaingan teknologi. Anak-anak sudah harus bisa memanfaatkan internet dan komputer untuk

Kekeringan Di Pamekasan Meluas PAMEKASAN (Antara): Kekeringan melanda Kabupaten Pamekasan, Madura, Jawa Timur kian meluas hingga delapan kecamatan di wilayah itu. Warga di sembilan kecamatan, Selasa (21/7), mengaku kesulitan mendapatkan air bersih, termasuk mendapatkan pakan ternak mereka, karena semua rumput telah mengering. Sebagian warga terpaksa memberi makan ternaknya dengan pohon pisang dan daum bambu yang kering. Dia mengatakan belum ada bantuan pendistribusian air bersih dari perusahaan daerah air minum setempat (PDAM).

belajar lebih baik,” kata Lilik. Depdiknas kata dia, memiliki program jaringan pendidikan nasional (jardiknas) yang memudahkan instansi-intansi pendidikan, termasuk sekolah untuk mengakses internet secara gratis. Tapi kendala lain seperti distribusi listrik, jaringan operator atau perangkat komputernya sendiri masih merata di daerah-daerah terpencil. “Sangat sulit menjangkau sekolah-sekolah di pedesaan atau daerah terpencil dan kepulauan. Itu yang menjadi salah satu alasan mengapa penetrasi internet di sekolah-sekolah masih rendah,” kata Lilik. Joko Susilo, guru dari SMP swasta di wilayah Pamulang mengaku sekolahnya satu diantara sekolah yang punya jaringan internet lewat jardiknas. Dia mengatakan sangat terbantu dengan keberadaan internet, karena banyak pengetahuan baru yang bisa didiskusikan dengan sesama guru dan siswa. (dianw)

syaad Mbai mengatakan, Indonesia selama ini telah menjalin kerjasama antiteror dengan sejumlah negara seperti Arab Saudi, Pakistan, Kuwait, Afganistan dan Turki. Kerjasama antiteror dilakukan Indonesia dengan sejumlah negara itu memfokuskan pada penanganan teror secara soft power tanpa mengabaikan kerja sama bentuk hard power. Terkait itu kata Ansyaad, pihaknya juga akan merumuskan kerjasama de-radikalisasi pemahaman yang keliru mengenai Islam yang kerap dijadikan ‘landasan hukum’ para pelaku teror melakukan aksinya. “De-radikalisasi ini sudah kami jalankan, tidak saja dengan

Pakistan tetapi negara Islam moderat lainnya seperti Arab Saudi dan Turki. De-radikalisasi dapat dilakukan dengan mengundang para tokoh agama mereka ke Indonesia atau melalui buku-buku bacaan tentang Islam yang sesungguhnya,” tutur Ansyaad. Menurut dia, langkah-langkah soft power dalam penanganan terorisme seperti de-radikalisasi lebih baik untuk menangkal ‘epidemi’ ideologi kekerasan dalam aksi teror. Peran ini yang sepatutnya menjadi kepedulian intensif pemerintah. Apalagi sudah bukan zamannya lagi ideologi diharamkan dengan cara-cara represif.

Antara

BUNUH ANAK: Puryanto, 27, warga Dusun Robahan, Desa/ Kecamatan Mejayan, Kabupaten Madiun, Jatim di balik jeruji besi tergembok tahanan Polres Madiun, Selasa (21/7). Puryanto kabur ke Bangka Belitung dan akhirnya ditangkap polisi setelah berusaha membunuh anaknya dengan mencekik dan melemparnya ke rel kereta api.

SOLO (Antara): Pondok Pesantren Al Mukmin, Ngruki, Kabupaten Sukoharjo, Jawa Tengah mengecam pencekalan mantan pemimpin Majelis Mujahidin Indonesia Abu Bakar Ba’asyir di Kota Malang, Jawa Timur pada Senin (20/7). “Alasan pencekalan Abu Bakar Ba’asyir di Malang terlalu mengada-ada,” kata Direktur Ponpes Al Mukmin,Wahyuddin di Sukoharjo, Selasa (21/7). Ba’asyir dilarang tampil pada peringatan Isra Mikraj di Kelurahan Bumiayu, Kota Malang, dengan alasan ceramah agama disampaikan Ba’asyir cenderung provokatif dan dikhawatirkan memecah belah umat Islam. Menurutnya, apa yang disampaikan Abu Bakar Ba’asyir merupakan kebenaran menurut Al Quran dan Al Hadis. “Pencekalan dilakukan di Malang, menurut kami tindakan dilakukan oleh orang-orang yang tidak menyukai kebenaran yang diperjuangkan di dalam Islam,” katanya. Menurutnya, pencekalan itu merupakan salah satu konsekuensi yang memungkinkan

terjadi pada upaya umat Islam dalam memperjuangkan kebenaran. Akui Nur Said Santrinya Pondok pesantren ini juga mengakui dalam daftar santri ponpes terdapat alumnus bernama Nur Said yang disebutsebut sebagai pengebom Hotel JW Marriott dan Ritz-Carlton, Jakarta. “Berdasarkan data ponpes terdapat alumnus bernama Nur Said berasal dariTemanggung, Jawa Tengah,” kata Wahyuddin. Dia mengatakan, Nur Said merupakan santri ponpes yang masuk 1988 dan lulus 1994. “Dalam daftar tertulis orang tua Nur Said adalah Muhammad Nasir dan Tuminem,” katanya. Pemberitaan sebelumnya, ponpes membantah ada alumnus bernama Nur Hasbi alias Nur Said alias Nur Sahid. Dia beralasan, pihaknya belum menemukan nama itu pada data ponpes ketika membantah tuduhan mengenai Nur Said merupakan alumnus ponpes itu. “Meski kami akhirnya mengakui, saya berharap semua pihak jangan terlalu dini me-

nyimpulkan bahwa Nur Said pelaku peledakan sebelum hasil penyelidikan kepolisian diumumkan,” katanya. Jika dugaan mengenai pelaku peledakan itu benar, hal itu juga bukan tanggung jawab dari ponpes. “Selain mata pela-

jaran seperti yang ada di sekolah umum lainnya, hal khusus yang diajarkan di sekolah ini adalah mengenai Al Quran dan Al Hadis. Tidak ada materi kekerasan ataupun jihad dalam arti sempit yang diajarkan di dalam ponpes ini,” tandasnya.

Ratusan Warga Pekanbaru Terserang ISPA PEKANBARU (Antara): Dinas Kesehatan Pekanbaru menyatakan ratusan warga di ibukota Provinsi Riau itu terserang penyakit infeksi saluran pernapasan atas (ISPA) akibat kabut asap sisa kebakaran hutan dan lahan yang menyelimuti daerah itu dalam beberapa minggu terakhir ini. Plt. Kepala Dinas Kesehatan Kota Pekanbaru, Rini Hermiyati di Pekanbaru, Selasa (21/7) mengatakan, dalam dua pekan terakhir jumlah warga Pekanbaru yang terserang ISPA mencapai 784 orang. selain terserang ISPA, ratusan warga juga menderita berbagai macam penyakit akibat kabut asap sisa kebakaran hutan dan lahan yakni iritasi mata, iritasi kulit, asma, dan diare. “Total warga yang terserang penyakit akibat kabut asap 1.202 orang, dimana 784 diantaranya menderita ISPA dan sisanya penyakit lainnya seperti iritasi mata, kulit, asma dan diare.” Badan Meteorologi Klimatologi dan Geofisika (BMKG) Stasiun Bandara Sultan Syarif Kasim (SSK) II Kota Pekanbaru menyatakan, berdasarkan pantauan terakhir satelit NOAA 18 terpantau 80 titik api yang diduga sebagai bentuk kebakaran lahan dan hutan terdapat di Riau.

Terorisme Berkembang Akibat Kontrol Lemah YOGYAKARTA (Antara): Aksi terorisme berkembang akibat kontrol masyarakat lemah, kata dosen Fakultas Agama Islam Universitas Muhammadiyah Yogyakarta (UMY) Muhammad Azhar, MAg. “Masih adanya kelompok teroris di Indonesia salah satunya diakibatkan sikap diam masyarakat,” kata dia, Selasa (21/7). Meskipun menyatakan tidak setuju dengan tindakan terorisme, masyarakat cenderung bersikap apastis dan membiarkan keberadaan kelompok itu di lingkungan mereka. “Sikap diam masyarakat patut dise-

salkan.” Menurutnya, tindakan para teroris yang ‘membajak’ ajaran Islam untuk menghalalkan aksinya adalah tindakan yang tidak layak ditoleransi. “Kita jangan hanya diam,” katanya. Hal itu karena adanya kebimbangan di masyarakat mengenai pemahaman yang benar atas agama. Selain itu adanya ketidakpercayaan masyarakat pada figur pemimpin dan ulama, serta institusi umat juga ikut memperburuk masalah. “Untuk itu, para ulama harus lebih mengintensifkan dakwah. Kita harus membangun pemahaman yang benar tentang

makna jihad, kapan harus jihad fisik, kapan jihad budaya, kapan jihad intelektual,” tandasnya. Saat ini banyak buku cenderung memprovokasi dan membenarkan tindakan teror yang beredar luas di masyarakat, sehingga perlu wacana tandingan untuk menghadapi hal itu. “Kita tidak bisa melarang penerbitan buku, karena sudah bukan zamannya lagi mencekal buku. Yang bisa kita lakukan membuat ‘counter’ wacana dengan menulis buku tandingan,” katanya. Selain itu, secara struktural pemerintah harus bisa mengentaskan kemiskinan dan memba-

tasi hegemoni asing di dalam negeri. “Hal-hal yang bisa memicu orang untuk berbuat nekat, seperti persoalan kemiskinan, pengelolaan sumber daya alam yang tidak adil, intervensi asing dan hegemoni neoliberalisme harus diselesaikan oleh pemerintah.” Pemerintah juga harus menyusun data kependudukan secara lebih cermat, sehingga tidak ada lagi warga negara yang bisa memiliki kartu tanda penduduk (KTP) lebih dari satu. “Semua itu menjadi pekerjaan rumah bagi pemerintahan Susilo Bambang Yudhoyono,” katanya.

KPK Periksa Dirjen Farmasi Depkes JAKARTA (Antara): Komisi Pemberantasan Korupsi (KPK), Selasa (21/7) memeriksa Dirjen Farmasi dan Alat Kesehatan Departemen Kesehatan (Depkes), Richard Panjaitan terkait dugaan korupsi pengadaan alat kesehatan di sejumlah daerah di Indonesia. “Hari ini KPK meminta keterangan Richard Panjaitan,” kata Juru Bicara KPK Johan Budi di Jakarta, Selasa. Johan menjelaskan, Richard akan memberikan keterangan dalam kasus dugaan korupsi

pengadaan alat kesehatan yang terjadi pada 2007. “Yang bersangkutan dimintai keterangan sebagai saksi,” kata Johan. Saat ini KPK menyidik proyek pengadaan alat kesehatan di Departemen Kesehatan pada 2007 dengan tersangka Kepala Biro Perencanaan pada Sekretariat Jenderal Depkes Mardiono. Proyek pengadaan alat kesehatan senilai Rp15,7 miliar itu diduga merugikan negara Rp4,8 miliar. KPK menduga telah terjadi aliran uang dalam proyek pe-

ngadaan alat kesehatan di Depkes 2007. Pemberian uang itu diduga terkait proses pengadaan alat kesehatan yang didistribusikan ke sejumlah daerah di tanah air. Spesifikasi alat kesehatan dalam proyek itu tidak sesuai dengan kebutuhan daerah terpencil. Selain itu KPK menduga telah terjadi penunjukan rekanan secara langsung. Proyek tersebut menggandeng PT Kimia Farma Trading sebagai rekanan. Namun pada praktiknya, perusahaan itu me-

ngalihkan pengadaan kepada dua perusahaan lain. KPK juga telah menetapkan mantan Menteri Kesehatan Achmad Sujudi, mantan Dirut PT Kimia Farma Gunawan Pranoto dan Dirut PT Rifa Jaya Mulya RinaldiYusuf sebagai tersangka kasus dugaan korupsi pengadaan alat kesehatan di Departemen Kesehatan tahun 2003. Proyek itu adalah pengadaan alat kesehatan yang dibagikan ke sejumlahdaerahdikawasantimur Indonesiayangdidugamerugikan negara Rp71 miliar.

Pelaku Pembakar Hutan, Lahan Diancam Hukuman Berat PONTIANAK (Antara): Kepolisin Daerah Kalimantan Barat mengeluarkan instruksi berisi ancaman hukuman berat bagi pelaku pembakaran hutan dan lahan yang dilakukan secara sengaja, sehingga mengakibatkan kabut asap di provinsi itu. “Hari ini kita sudah mengirimkan instruksi itu ke Polres yang ada di Kalbar untuk menindak secara hukum bagi pelaku pembakaran hutan dan lahan,” kata Kabid Humas Polda Kalbar AKBP Suhadi SW di Pontianak, Selasa (21/7). Suhadi mengatakan, dikeluarkannya instruksi tersebut karena melihat perkembangan dampak kabut asap yang semakin tebal sejak sepekan terakhir akibat pembakaran hutan dan lahan, baik yang disengaja maupun tidak. Dampak kebakaran hutan dan lahan tidak hanya menimbulkan kabut asap, tetapi juga kerusakan lingkungan hidup beserta ekosistemnya, gangguan kesehatan seperti ISPA (inpeksi saluran pernapasan atas), serta merusak citra bangsa. Suhadi menjelaskan, dalam instruksi Polda Kalbar, pelaku

pembakaran hutan dan lahan dapat diancam karena kealpaan (kesalahan) pasal 187 dan 188 KUHP maksimal kurungan penjara 12 tahun. Apabila dengan sengaja atau karena kelalainnya membuka lahan dengan cara dibakar diancam pasal 48 dan 49 UU No. 18 tahun 2004 tentang Perkebunan dengan ancaman kurungan penjara maksimal 10 tahun denda Rp10 miliar. Selain itu, pelaku dapat

diancam pasal 41 dan 42 UU No. 23 tahun 1997 tentang Pengelolaan Lingkungan Hidup, dengan ancaman kurungan penjara maksimal 10 tahun dan denda Rp500 juta jika akibat kelalaiannya mengakibatkan kerusakan lingkungan. “Apabila akibat perbuatannya menyebabkan orang meninggal, diancam kurungan penjara maksimal 12 tahun dan denda 750 juta,” kata Suhadi.

Berdasarkan pemantauan Polda Kalbar, Sabtu (18/7) terdapat 98 titik api yang tersebar di kabupaten/kota. Data Badan Lingkungan Hidup (BLH) Kota Pontianak, ISPA di kota itu masuk kategoriberbahayadenganindeks di atas 300 part per mlilion (PPM). Sedangkan data Dinkes Kota Pontianak, mencatat 1.298 kasus ISPAdalamsepekanterakhiryang dipicu oleh kabut asap yang menyelimuti kota itu.

Antara

PEMUSNAHAN BARANG BUKTI: Dua petugas memotong barang bukti senjata api ketika memperingati Hari Bakti Adyaksa ke-49 di Kejaksaan Negeri Malang, Jawa Timur, Selasa (21/ 7). Pemusnahan ribuan barang bukti hasil kasus selama satu tahun itu terdiri dari senjata api, narkotika, psikotropika, vcd bajakan dan buku ilegal.


Sport

6

WASPADA Rabu 22 Juli 2009

Leonardo Buka Pintu Beckham LOS ANGELES, AS (Waspada): Pelatih asal Brazil yang menangani AC Milan Leonardo de Araujo, membuka pintu bagi David Beckham untuk kembali ke klubnya di Italia mulai musim mendatang. Beckham yang disewa I Rossoneri pada Januari hingga Juni lalu, tampil melawan mantan timnya pada laga eksibisi yang berakhir seri 2-2 di Home Depot Center, Carson, Kalifornia, Senin (20/7) pagi WIB. Leonardo yang menggantikan Carlo Ancelotti sebagai pelatih Milan menyatakan, klubnya terbuka bila Beckham ingin pindah. “David masih memiliki hubungan amat bagus dengan kami semua. Dia amat berguna ketika mengenakan kostum kami,” kata Leonardo dalam laman http://acmilan.com. “David tanpa dipungkiri merupakan pemain amat cerdas dan dia dapat memasuki apa yang saya rencanakan. Sebab dia dapat dengan cepat bermain dalam sistem apa pun,” pujinya lagi. Gelandang Inggris itu sebelumnya mengatakan, dirinya

berharap masih mendapat kesempatan sewa (loan) enam bulan berikutnya agar bisa meyakinkan pelatih Inggris Fabio Capello tentang kesiapannya ke Piala Dunia 2010 di Afrika Selatan. Beckham kembali bermain dalam aksi klub Major League Soccer (MLS) itu, Kamis lalu. Kendati waktu itu Galaxy menang 3-1 di New York Red Bulls, dia malah disoraki penonton. Dicemooh fan Penampilannya melawan Milan merupakan yang pertama di kandang sendiri sejak keputusan kontroversial memperpanjang sewanya dengan Si Merah Hitam hingga paruh waktu pertama musim kompeti MLS. Karenanya Beckham masih mendapat sambutan dingin di Home Depot Center. Fan mencemooh dan membentangkan spanduk anti-Beckham. Beberapa spanduk melontarkan kalimat seperti: “Pulang Saja Penipu”, “Hey Becks, Kami Di Sini Sebelum, Setelah, Maupun Tanpa Kehadiranmu”, serta “23 = Penyesalan”. Mantan bintang Manchester United dan Real Madrid itu bahkan sempat terlibat perdebatan dengan salah seorang fan yang coba

melompati pagar penga-man. Kendati demikian, Bec-kham berkeras tidak akan membiarkan hal tersebut mengganggu pikirannya. “Hal itu (cemooh fan) memang sudah bisa diduga. Terkadang melampaui batas, tapi mayoritas fan berlaku baik,” beber Beckham. “Salah satu fan mengucapAP kan kata-kata yang tidak baik dan kelewat batas. Saya menga- Playmaker AC Milan Clarence Seedorf (kiri) duel dengan gelandang LA Galaxy David Beckham takan kepadanya, “Anda harus dalam duel eksibisi di Home Depot Center, Carson, Kalifornia, Senin (20/7) pagi WIB. tenang” dan mengajaknya bersalaman. Kemudian dia mencoba melompati pagar,” tambah Galaxy yang dicetak Alan Gordon serta Bryan Jordan. Sedangkan suami Victoria Adams berusia 34 tahun tersebut. gol Il Diavolo Rosso dicetak gelandang anyar Thiago Silva dan Beckham sendiri memiliki andil penting dalam kedua gol striker veteran Filippo Inzaghi. (h01/ap/ant/rtr)

Eto’o Tolak Tawaran Gaji Inter MILAN (Waspada): Samuel Eto’o menolak tawaran nilai gaji yang diajukan Inter Milan untuk memindahkannya dari Nou Camp Barcelona ke Giuseppe Meazza Milan.

AP

Pelatih Barcelona Pep Guardiola (kanan) sumringah memandang keceriaan pasukannya dalam sesi latihan di San Joan Despi, Spanyol, Senin (Selasa WIB).

Guardiola: Eto’o Mesti Cabut!

2 1

1 6 9 7 4 8 6 9 1

4

5 2

7

5 3 6 1 2 1 4 6

8 3 7

yed Al Nahyan, yang menyatakan sangat bahagia bila klubnya diperkuat bek tangguh Inggris tersebut. Cole, Lampard Seperti halnya manajemen London Blues, bek kiri Ashley Cole pun ingin Terry tetap bertahan di Stamford Bridge. “Semua ingin dia bertahan. Dia kapten kami, pemimpin kami,” tegas Cole dalam Sunday Mirror. “Dia mengatakan akan terus bersama Chelsea. Namun sebagai pemain, tidak ada yang dapat kami lakukan. Saya belum membicarakan hal ini dengannya, saya tidak ingin terlibat di dalamnya,” beber mantan bek Arsenal itu. “Saya juga pernah menjalani pengalaman yang sama, jadi saya memilih tidak terlibat. Tapi saya jelas merasa simpati dengan situasi yang tengah dijalaninya,” katanya menambahkan. Pendapat berbeda dikemukakan gelandang Frank Lampard. Gelandang Inggris berusia 31 tahun itu mengaku tidak tahu mengenai keputusan Terry, tapi dia menegaskan sang kakpten berhak menentukan pilihan terbaik untuknya.

“Saya tidak tahu apa yang akan dilakukannya. Saya pernah berada dalam posisinya, tapi semua orang di klub menginginkan dia bertahan,” ucap Lampard. “Saya memiliki opsi meninggalkan klub tahun lalu untuk pergi dengan seorang pelatih ( Jose Mourinho) yang saya cintai. Tapi, saat itu waktunya tidak tepat. Itu bukanlah keputusan mudah, dan saya pikir orang-orang tidak berhak mengeritik John,” lanjut Lampaard. “Faktanya, Anda tidak akan

bisa melupakan apa yang telah dia berikan untuk Chelsea. Orang-orang harus menghormati haknya untuk memilih. “Ketika Anda merupakan pemain yang sukses, hal-hal seperti ini pasti terjadi dan Anda harus mengambil keputusan. John pria terhormat dan keputusannya tidak akan bergantung pada uang atau hal-hal seperti itu,” katanya. Selain Terry, City juga mengincar bintang Everton Joleon Lescott dan bek sentral Arsenal Habib Kolo Toure. Di bursa transfer musim panas ini, Citizens sebelumnya sudah membeli Roque Santa Cruz, Gareth Barry, Carlos Tevez dan Emmanuel Adebayor. (h01/bbc/okz/goal)

2 4 1 6 8 3 5 7 9

3

1 8

LONDON ( Waspada): Manchester City tak peduli ancaman undang-undang dari Chelsea tentang transfer pemain, sehingga tetap ngotot mengajukan tawaran resmi untuk memboyong John Terry. The Blues sempat mengancam akan mengadukan The City kepada ofisial Premier League karena terus menggoda kapten timnya tersebut. Namun menurut Daily Mail, kemarin, manajer City Mark Hughes siap memberikan tawaran se-besar 40 juta pound sebagai penawaran kedua setelah tawaran sebesar 32 pound ditolak Si Biru. “Dia jelas-jelas pemain berkaliber yang kami perlukan. Keberadaan Terry sangat krusial bila kami ingin maju dan bersaing di tingkat atas,” jelas Hughes kepada BBC Sportsweek, Senin (20/7). “Mungkin ada momentum kami harus mengakui kalah dalam mendapatkan Terry. Tapi kami tidak pernah berpikir mengalami kekalahan sampai sekarang,” ujarnya lagi. Kengototan The Citizens tak terlepas dari permintaan majikannya Sheik Mansour bin Za-

7 8 6 1 9 5 2 3 4

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: agak sulit (****). Jawaban di kolom 8.

Mantan penyerang Olympique Lyon itu berhasil memanfaatkan bola lambung sebelum melesakkannya ke gawang tim tuan rumah. CR9 sendiri beralasan bahwa dirinya terlalu lelah setelah berlatih keras. Kendati demikian, mantan winger Manchester United itu merasa sangat senang karena akhirnya bisa melakukan debut bersama Los Blancos. “Saya agak lelah pada pertandingan itu. Bisa anda bayangkan, saya harus berlatih sebanyak tiga kali setiap harinya,” dalih Ronaldo dalam Goal, Selasa (21/7). “Namun patut dicatat, saat ini saya bersama tim spektakuler. Saya yakin bisa kembali menemukan permainan terbaik dan tentunya meraih banyak kemenangan,” tambah bintang asal Portugal tersebut. (h01/goal/ bb/ap)

City Tetap Tawar Terry

9 5 3 4 7 2 1 6 8

Angka Tunggal Bersilang (Sudoku)

Hasil Eksibisi Lainnya: SSV Ulm vs Hertha Berlin 1-1 Hannover vs Wigan Ath 1-1 Malaysia XI vs Man United 0-2 FC Koeln vs Timisoara 2-0 Kartnen vs E Frankfurt 0-5 Lincoln vs Arsenal 2-3

8 2 5 9 3 1 7 4 6

AP

Superstar Real Madrid Cristiano Ronaldo berusaha menghindari tekel pemain Shamrock Rover dalam duel eksibisi di Tallagh Stadium, Dublin, Irlandia, Senin (Selasa WIB).

DUBLIN (Waspada): Pemain termahal dunia Cristiano Ronaldo belum menunjukkan kebolehannya bersama klub barunya Real Madrid saat menang tipis 1-0 atas Shamrock Rovers dalam duel eksibisi di Dublin, Irlandia, Senin (Selasa WIB). Ronaldo yang kini memiliki julukan CR9 masih mandul. Dia sama sekali tidak terlihat berkembang pada penampilan perdananya musim ini. Bintang berharga 80 juta pound itu sempat mengundang perhatian di lini pertahanan Shamrock Rovers, tetapi tidak ada satu pun aksinya yang membuahkan hasil. Peluang terbesar CR9 melalui tendangan bebas. Tapi tidak seperti biasanya, tendangan yang dilepaskannya masih melebar dari arah gawang lawan. Justru rekrutan anyar Madrid lainnya, striker Karim Benzema,yangmembuatpengaruh positif bagi Los Galacticos. Penyerang Perancis itu menjadi pencetakgoltunggalkemenangan El Real saat pertandingan tersisa tiga menit lagi.

1 9 7 5 4 6 3 8 2

CR9 Masih Mandul

Ibrahimovic, sang pelatih Guardiola menyatakan dirinya telah berbicara dengan penyerangValencia, DavidVilla, untuk membujuknya pindah ke Barca. Namun Guardiola menolak memberikan keterangan mengenai detail pembicaraan tersebut. Guardiola juga menyatakan pemain tengah Carles Puyol dan Rafael Marquez akan memperpanjang kontrak mereka dengan Barcelona. Saat ini, katanya, Marquez sedang memulihkan diri dari cedera lutut. (h01/ant/rtr)

3 6 4 8 2 7 9 1 5

akan diraih setelah dia menerima kenyataan bahwa Ibrahimovic menginginkan tantangan baru. “Negosiasi sedang berjalan, belumadayangpastinamunsaya cukup yakin akan hal ini. Kami berharap Eto’o dapat membantu Inter Milan meraih gelar juara. Ibrahimovic sendiri adalah seorang pemain profesional yang baik dan saya tidak akan melupakan jasanya mencetak gol-gol untuk Inter sehingga kami memenangkan Liga Italia,” katanya. Di sisi lain, Los Azulgranas rupanya tidak hanya mengincar

mengatakan apa yang ingin dikatakannya. Dengan Eto’o yang telah memenangkan segalanya di Barca, maka Guardiola membutuhkan seorang pemain yang memiliki motivasi tinggi. Jika Ibra hengkang ke Barca tanpa kami mendapatkan Eto’o? Saya sama sekali tak tahu tentang hal itu...,” katanya menambahkan. Ibra sebelumnya kembali menggodaBarcadenganmengatakan, dirinya ingin sekali berada satu tim dengan bintang muda ArgentinaLionelMessi.Hasratnya kemungkinan segera terwujud, sebab pada Selasa (21/7) media lokal Spanyol ramai-ramai memberitakan, Los Azulgranas telah menawari striker Swedia itu kontrak 5 tahun bernilai 6,5 juta pound. “Saya selalu memimpikan bermain satu tim dengan Lionel Messi. Saya akan terus berlari dengan Messi yang berada di samping saya. Barcelona merupakan kesempatan yang sangat baik dalam karir saya,” goda Ibra. (h01/okz/sky/chan)

4 1 9 7 5 8 6 2 3

Selasa (21/7). Pelatih Barcelona itu menyatakan rasa terima kasihnya pada Eto’o atas pengabdiannya membela klub selama lima tahun terakhir dan juga menjadi salah satu pemain yang ikut menyumbangkan tiga gelar bagi Barcelona musim lalu yaitu Liga Spanyol, Piala Spanyol dan Liga Champions Eropa. Saat ini agen Eto’o sedang berada di Milan untuk membicarakan masalah perpindahan kliennya ke Internazionale. Presiden Inter Massimo Moratti mengharapkan kesepakatan

dan saya masih yakin semua ini akan berakhir dengan manis. Pada akhirnya, saya yakin Eto’o akan menerima penawaran kami dan menjadi pemain Inter,” ungkap Moratti dalam Sky Sports. Saat dikonfirmasi mengenai rumor Eto’o merupakan kunci cabutnya Ibra ke Barca, Moratti masih enggan memberikan jawaban terbuka. “Ibrahimovic? Saya pastikan, dia pemain professional yang terkadang sukamengekspresikan opininya. Tapi bersama kami, meski berada di posisi yang sulit, dia selalu melakukan yang terbaik,” dalihnya. Taipan Italia itu juga melontarkan pernyataan terkait ucapan pelatih Barca Pep Guardiola beberapa waktu lalu yang menyatakansiapmendepakEto’o dari skuadnya. “Dia (Guardiolared) hanya mengatakan yang dipikirkannya,berdasarkansudut pandang taktik. Dia tak bermaksud membuang Eto’o,” jelas Morratti. “Menurut saya, dia hanya

5 7 2 3 6 4 8 9 1

Hal ini dilakukan sebagai syarat untuk menarik penyerang Inter Zlatan Ibrahimovic ke Nou Camp. Kelanjutan perundingan sendiri akan bergantung pada persyaratan yang diajukan masing-masingpemain,sehingga Eto’o mesti cabut. “Ini hanya berdasarkan insting. Saya rasa Barcelona harus mengubahbeberapahal.Initidak adahubungannyadenganstrategi permainan atau isu pribadi. Mungkin saja saya salah mengambil keputusan, tapi ini tanggung jawab saya,” tegas Guardiola seperti dilansir Reuters,

Wordpress.com

Barter Samuel Eto’o (kiri) dengan Zlatan Ibrahimovic (kanan) masih alot.

6 3 8 2 1 9 4 5 7

BARCELONA, Spanyol (Waspada): Pelatih Barcelona Pep Guardiola menegaskan keputusannyauntukmelepaspenyerang Samuel Eto’o, lebih dikarenakan pertimbangan untuk melakukan perubahan dalam susunan pemain, bukan karena alasan pribadi. ElBarcayangpernahmenjadi juara Liga Spanyol dan Liga Champions itu, Jumat (17/7), mengumumkan bahwa secara prinsip mereka telah menyetujui untuk melepas Eto’o ke Inter Milan ditambah dengan uang tunai.

Menurut Il Corriere dello Sport, Selasa (21/7), ide barter bomber Barca Eto’o dengan striker Inter Zlatan Ibrahimovic akibatnya masih gagal mendekati kenyataan, karena Eto’o melalui agennya Jose Mesalles, tidak puas dengan salary yang ditawarkan I Nerazzurri. Konon La Beneamata hanya bersedia membayar Eto’o gaji 9 juta euro per musim plus berbagaibonusyangtergantungpada performa sang pemain. Sedangkan Eto’o meminta gaji 12 juta euro per musim yang akan membuatnya tampil sebagai pemain dengan gaji termahal dalam sejarah sepakbola. Karena pembicaraan masih mentok, Mesalles pun terpaksa kembali melakukan pertemuan dengan Presiden Inter Massimo Moratti dan direktur Marco Branca di Milan. Jika masalah gaji itu selesai, maka kedua kubu segera merampungkan proses kepindahan bomber Kamerun itu ke Giuseppe Meazza. Kepindahan Eto’o sangat mendesak, mengingat itu merupakan kunci kedatangan Ibra ke Camp Nou. Striker 28 tahun itu kabarnya dijadikan Barca sebagai alat tukar untuk mendapatkan tanda tangan Ibra. Moratti sendiri mengaku optimis bisa mendaratkan Eto’o. “Negosiasi masih terus berjalan


Sport

WASPADA Rabu 22 Juli 2009

7

Langkah PIMNAD Terganjal SURABAYA (Waspada): Langkah PIMNAD terganjal, setelah kandas 76-82 dari tangan Sahabat Semarang pada game ketiga Liga Kobatama 2009 Seri I di GOR Pasific Surabaya, Senin (20/7) malam. Meski begitu, peluang lolos ke Final Four masih terbuka lebar. Pasalnya, PIMNAD sebelumnya sudah membukukan dua kemenangan, masing-masing atas

Halim Kediri dan NSH-GMC Jakarta. Jika berhasil memetik kemenangan atas Pasific Caesar Surabaya, maka posisi empat besar tetap terjaga. “Walau kalah dari Sahabat, peluang kita masih terbuka. Untukitu,kamimohondukungan dari seluruh masyarakat Aceh agar di game terakhir bisa memetik kemenangan,” ungkap pelatih dr Lukman Hasibuan, Selasa (21/7). Dia juga menyebutkan, kekalahaninijugataklepaskarena padatnya jadwal pertandingan. Apalagi, sebelum ini PIMNAD mengikutiduaturnamen,sehing-

ga sulit untuk menjaga peak performance para pemain. “Kita akan segera melakukan evaluasi dan kekalahan ini merupakan pelajaran berharga bagi tim,” tandas Lukman. Buruknya penyelesaian akhir menjadi penyebab kekalahan PIMNAD dari Sahabat. Meski bangkit di kuarter kedua, PIMNAD belum mampu mengatasi anak-anak Sahabat yang tampil disiplin. Kerja keras Imam Awaluddin, Aji Prabowo dan Jekky LB Sagala belum mampu membawa PIMNAD unggul. Memasuki kuarter ketiga, pertarungan semakin ketat dan

sempat terjadi kejar mengejar angka. Begitu pun, Sahabat yang sudah di atas angin sedikit lebih unggul. Di kuarter penentu, PIMNAD mulai menemukan pola permainannya dan berbalik mendominasi permainan. Strategi full court press yang diterapkan Imam cs berhasil mengacaukanpertahananlawan, namun beberapa peluang gagal dimaksimalkan. Pada pertandingan ini, Gian Gumilar dari Sahabat tampil sebagai top skor dengan 26 poin. Dari PIMNAD, gelar top skor diraih Imam Awaluddin dengan 20 poin disusul Jekky LB Sagala 14 angka. (b07)

Kamis Besok Di Teladan

PSMS Seleksi Pemain MEDAN (Waspada): Meski kepengurusan PSMS Medan periode 2009-2014 belum tersusun, Ketua Umum terpilih Drs Dzulmi Eldin MSi bersama mantan Sekum PSMS Drs Randiman Tarigan akan memulai pembentukan tim Ayam Kinantan menghadapi Kompetisi Divisi Utama PSSI 2009/2010. Randiman yang disebutsebut akan menjadi Ketua Harian PSMSini,Selasa(21/7)menyebutkan, persiapan tahap pertama adalah seleksi pemain di Stadion Teladan Medan Kamis (23/7) besok. Mantan manajer PSMS yang sukses membawa The Killer menjadi finalis kompetisi 2008/ 2009 itu berharap pada Kamis nanti para pemain baik yang berdomisili di Medan maupun di luar kota dapat ikut seleksi, agar pihaknyadapatmencaripemainpemain berbakat dan berkualitas. Menanggapi tim pemantau, diakuinya sementara dilakukan pihaknya sendiri bersama tim perumus maupun formatur yang baru-baru ini terbentuk saat berlangsungnya Rapat Kerja Klub Waspada/Munawardi Ismail

Pembalap Aceh Reza Fahlevi bersiap-siap sebelum dimulainya ajang ‘adu nyali’ di Kejurda Balap Motor Seri I Honda-IMI Aceh 2009 di Calang, Aceh Jaya, Minggu (19/7).

Reza Juara Di Aceh Jaya BANDA ACEH (Waspada): Pembalap kawakan Aceh, Reza Fahlevi kembali unjuk diri. Kali ini dalam Kejuaraan Daerah (Kerjurda) yang digelar Ikatan Motor Indonesia (IMI) Aceh di Calang, Aceh Jaya, Minggu (19/ 7) lalu. Dalam ajang itu, Reza menangkan dua kelas sekaligus. Kepada Waspada, pelatih Reza Fahlevi, Faisal Al Yamani, di Banda Aceh, Selasa (21/7) mengatakan, Reza menang mudah dalam dua kelas yang diikutinya,

yakni kelas 125 cc dan 110 cc. Ditambahkan,dalamKejurda Balap Motor Seri I Honda-IMI Aceh 2009 di Calang itu, peraih medaliemasdanperakPON2008 Kaltim itu menang di kelas MP1 110 cc. Di kelas ini, Reza menunggangi Honda Blade sedangkan di kelas 125 cc (MP2) menaiki Supra X. “Kalau berbicara target, hasil dari Kejurda Seri I ini memang sudahmemuaskan.Tapikitaingin Reza bisa tampil lebih maksimal

lagi ke depan. Insya Allah hasil akhir yang kita harapkan juara umum,” ungkap Faisal yang juga ayah kandung Reza. Kata Faisal, pihaknya terus melakukan persiapan untuk Kejurda Seri II yang bakal berlangsung di Meulaboh, Aceh Barat pada27Julimendatang.“Keinginan kita, kalau bisa Riza juara pada setiap seri,” ungkapnya. Begitu pula dengan hasrat Reza. Menurut atlet binaan KONI Acehitu,dirinyaingintampilterus

maksimal dalam setiap event. “Insya Allah, jika umur panjang, saya ingin berikan yang terbaik bagi para penggemar,” papar bungsu dari empat bersaudara. Ketua Ikatan Motor Indonesia Indonesia (IMI) Aceh, Zulmafikar menambahkan, selesai Seri II di Meulaboh, selanjutnya pada 8 Agustus nanti berlangsung Seri III di Langsa. Berikutnya menyusul Seri IV di Bireuen (11 Oktober) dan SeriV atau terakhir di Banda Aceh pada 14 November. (b05)

Kompetisi PSSI Aceh Tamiang

Sei Liput FC, Bapor B Pertamina Tembus Divisi I KUALASIMPANG (Waspada): Sei Liput FC dari Grup A dan Bapor B Pertamina dari Grup B memastikan diri melaju ke Divisi I Kompetisi Pengcab PSSI Kabupaten Aceh Tamiang setelah mengoleksi poin tertinggi di klasemen sementara grupnya masing-masing. Sei Liput FC dari Kecamatan Kejuruan Muda, Kab AcehTamiang telah bertanding sebanyak empat kali main dan belum pernah kalah, sehingga mengoleksi 12 poin dan Bapor B Pertamina Rantau juga telah bermain sebanyak empat kali dengan tiga kali menang dan sekali draw, sehingga mengumpulkan 10 poin. Di Lapangan II Kebun Tanah Terban, Karang Baru, Minggu (19/7), Sei Liput FC

menggigit Singa Muda 2-0. Hasil lainnya di Grup A, Bendahara Putra ditahan Perkasa Tanjung Seumantok 2-2. Partai lainnya di Lapangan Musafat Tugu Upak, Karang Baru, Bapor B Pertamina Rantau bermain gemilang dengan mengalahkan Singa Muda Teulaga Meuku2-0,sedangkanPersijayamembantai Porsea 4-0. Di Grup C yang berlangsung di Lapangan Tepi SungaiTamiang, Senin (20/ 7),The Gill Kualasimpang bermain imbang 1-1 lawan Kivaru. Untuk Grup D yang dimainkan di Lapangan Kebun Tanah Terban, Persikip menang 4-3 atas Putra Harapan dan Bima Patra kalah 1-2 lawan PSKP. (b24)

Klasemen sementara Grup A Sei Liput FC 4 4 - - 12-3 Putra Bendahara 4 2 1 1 7-6 Singa Muda 4 2 1 1 6-5 Arsepal 4 1 1 2 8-8 Perkasa 4 - 2 2 4-7 POSKB 4 - 1 3 5-13 Klasemen sementara Grup B Bapor B 4 3 1 - 8-3 Buana Putra 4 2 2 - 6-3 Persijaya 4 2 1 1 8-4 Surya Mata Ie 4 1 2 1 2-3 PSM 4 1 - 3 1-5 Porsea 4 - 1 3 1-9

12 7 7 4 2 1

10 8 7 5 3 1

Refund Tiket MU Tiga Tahap JAKARTA (Waspada): LOC kedatangan Manchester United ke Jakarta menjanjikan refund tiket sebesar 100 persen buat fans yang membeli langsung tiket dari mereka. Sementara yang membeli di tempat lain, nasibnya masih menggantung. DemikiandiungkapkanKetua Dewan Pertandingan Joko Driyono dalam konferensi pers di Kantor PSSI, Senayan, Jakarta, Selasa (21/7). Dalam kesempatan itu, Joko didampingi Sekretaris Jenderal PSSI Nugraha Besoes dan Ketua LOC Agum Gumelar. “Pada dasarnya, LOC mengidentifikasi tiga cara pembelian tiket. Golongan pertama adalah mereka yang antri langsung di

LOC pada 1-15 Juni. Golongan dua yang memesan melalui jalurjalur yang ditunjuk LOC, seperti “3” dan RajaKarcis. Mereka digolongkan sebagai pemesan melalui ticket box, sementara yang ketiga melalui jalur corporate yang membeli putusdariLOCdanmenyebarkan padakaryawannya,”ungkapJoko. Pembagian pembeli tiket ke dalam tiga golongan tersebut membuat proses refund juga dibagi tiga tahap. Mereka yang membeli tiket langsung melalui LOCbisadibilanglebihberuntung lantarandijaminuangnyakembali 100 persen dengan proses pengembalianyangdimulaiRabu (22/7).

“Tiga kategori ini akan kita refund dengan tiga tahap. Untuk kategori satu, refund dilakukan mulai Rabu (22/7) sampai 5 Agustus dengan cara menunjukkan bukti pembelian/voucher dan menunjukkan KTP di Sekretariat LOC, dekat Pintu I Senayan,” lanjut Joko. Untuk dua kategori lain, LOC tak bisa menjamin tiket bakal kembali 100 persen. Seperti diketahui, pembelian tiket yang tidak melalui LOC sempat menimbulkankontroversikarena prosesnya yang berbelit dan harga yang melonjak sampai dua kali lipat. “Bagi mereka yang membeli tiketdiLOC,uangnyaakandikem-

balikanfull.Sementarayanglewat jalurticketbox,itutanggungjawab tiket box masing-masing. Proses refund tiket yang dibeli melalui ticket box akan diumumkanpada5Agustus.LOCjugaakan membuka situs baru, karena orang yang membeli melalui cara ini tak diharuskan datang langsung,” beber Joko kemudian. Bagipenontonyangmembeli tiket melalui corporate, LOC sama sekali belum menentukan mekanisme pengembalian uangnya. “Untuk kategori tiga, kami mohon maaf belum bisa sampaikan karena ada mekanisme khusus antara LOC dengan corporate. (m33/ini)

Anggota PSMS di Hotel Dharma Deli, Sabtu (18/7) lalu. Dalam pemilihan, pihaknya tidak ada memberi prioritas dan semua pemain harus menjalani seleksi khususnya dari segi kesehatan. Ditanya masalah pelatih,KadisPendapatanPemko Medan itu mengaku pihaknya sudah memiliki beberapa nama untuk dikontrak musim depan. Sayangnya, Randiman

engganmengungkapkanidentitas pelatih tersebut karena masih tahap pembicaraan. Kendati begitu, Randiman berjanji akan memberitahukan sang pelatih anyar kalau sudah ada kata sepakat. “Yang jelas, pelatih nanti dari dalam negeri dan berkua-litas,” katanya. Diungkapkan,PSMSmemilih pelatih yang sesuai dengan

kriterianya di antaranya memiliki sertifikat dan pernah membawa klub yang dibina meraih prestasi baik di Liga Super Indonesia atau Divisi Utama. Selain itu, pelatih tersebut harus bisa menuntun anak-anak asuhannya serta mampu menempatkan pemain dan mengambil sikap tegas jika ada pemain yang melakukan kesalahan. (m24)

Pelatih Nasional Tinjau Sepakbola Tj Pura P.BRANDAN (Waspada): Pelatihbersertifikatnasional,Jhon Simon,didampingipimpinanklub Porsabi Tanjung Pura Hamzah dan pengurus PSL Langkat meninjau perkembangan sepakbola usia dini (U-12) di kawasan Tanjung Pura, Senin (20/7). Rombongan Simon disambut hangat oleh pengurus klub Tuharta Abd Rahman selaku Ketua Klub Tuharta Desa Tapak Kuda, Kecamatan Tanjung Pura,

Langkat yang jaraknya sekitar 10 km lebih dari Tanjung Pura. Lokasi tersebut, terdiri dari desa pantai mayoritas berpenghasilan nelayan dan pertanian, mengharapkan PSL selaku induk persepakbolaan di Langkat selalu memberikan bimbingan sepakbola di desa karena menurut Abd Rahman daerah itu berpotensi melahirkan pesepakbola handal. Dikatakan, kegiatan cukup banyak di desa kami namun hen-

daknya prestasi itu bisa mencapai tingkatnasionalapalagisegifinansial didukung khususnya dari pengusaha perkebunan sawit A Kuang. Abd Rahman didampingi Jhon Simon yang juga mantan pemainPSLusaipelatihankepada Waspada mengatakan secepatnya Muscab PSL yang definitif segera dilaksanakan agar program dapat berjalan semestinya danprestasidapatmaksimal.(c02)


Sport

8

WASPADA

Rabu 22 Juli 2009

Valentino Rossi

Ingin Perpisahan Layak

AP

Lorenzo Tolak Tawaran Yamaha GERNO DI LESMO, Italia (Waspada): Keinginan Yamaha menahan Jorge Lorenzo (foto) sepertinya menemui batu terjal. Lorenzo mengklaim telah menolak tawaran kontrak yang ditawarkan Yamaha kepada pembalap asal Spanyol itu. Seperti diketahui, masa depan Lorenzo menjadi bahan pemberitaan media. Itu setelah rival Yamaha, Honda menyatakan minat untuk meminang mantan pembalap 250cc tersebut.

Yamaha langsung menawarkan kontrak baru kepada Lorenzo. Meski, pemain kelahiran Mallorca tersebut sempat menyatakan Yamaha adalah pilihan utamanya, namun dia menolak dengan tawaran

Nash Tambah Dua Tahun

kontrak tersebut. “Saya tidak tahu, saya rasa kami harus menunggu. Saya bangga bahwa ada orang yang tertarik kepada saya. Tapi, saya adalah pembalap yang bisa mengalahkan Valentino Rossi,” tegas pembalap berusia 22 tahun itu, Selasa (21/7). Saat ini, Lorenzo memang menjadi salah satu yang bersaing dengan Rossi di puncak klasemen pembalap pada musim ini. The Doctor unggul 14 poin dari rekan setimnya itu tersebut. “Saya bertarung dengannya saat ini. Jadi, saya rasa harga saya lebih besar dari apa yang ditawarkan Yamaha

PHOENIX, AS (Waspada): Steve Nash (foto) setuju untuk memperpanjang kontrak dua tahun dengan Phoenix Suns. Point guard berusia 35 tahun tersebut akan mendapatkan 22 juta dollar AS atau sekitar Rp223 miliar dari perpanjangan kontrak tersebut. CABANG LHOKSEUMAWE Rumor perpanjangan kontrak Nash sudah beredar peMengucapkan Selamat Dan Sukses kan lalu, namun kepastian tersebut diungkapkan agen Atas Pelantikan Nash, Bill Duffy, kepada AP. LETKOL INF TAUFAN AKRIDAL Duffy menegaskan negosiasi Sebagai Dandim 0103/Aceh Utara antara Nash dengan Suns Oleh DANREM 011/Lilawangsa, KOLONEL INF BACHTIAR, S.IP telah terjadi beberapa pekan Pada Sertijab tanggal 22 Juli 2009 terakhir. di Lapangan Jenderal Sudirman Lhokseumawe Namun, semuanya berjalan lancar setelah pekan lalu Semoga dalam menjalankan tugas di Ridhai Allah SWT pemilik Suns Robert Sarver Dan terimakasih kepada bertemu langsung dengan LETKOL INF YUSEF SUDERAJAT Duffy dan melakukan penaYang telah mendharmabaktikan tenaga dan pikirannya waran untuk kliennya. Duffy Selama Menjabat Dandim 0103/Aceh Utara mengaku Nash akan melattd kukan penandatanganan konEFENDI trak dengan Suns pekan ini. Nash sendiri memang Kepala BPD Aceh Cabang Lhokseumawe memulai karirnya di NBA bersama Suns pada tahun 1996. Dua tahun di Suns, Nash meraih dua gelar MVP musim The United Nations Development Programme (UNDP) reguler sebelum hijrah ke DalThe UN’s global development arm las Mavericks. Tapi, pada 2004 Nash kembali ke Suns dan keThe Tsunami Recovery Waste Management Programme (TRWMP) of UNDP is seeking qualified and committed Indonesian National to fill mungkinan besar Nash penthe following consultant post to be based in Banda Aceh: siun di klub tersebut. Musim lalu, untuk perHEAVY EQUIPMENT WORKSHOP FACILITATOR (NATIONAL) tama kali Suns absen tampil The objective of consultant is to assist the International Workshop Manager in coordinating and managing the Heavy Equipment Workshop, di babak playoff sejak Nash setting up a preventive maintenance and repair of heavy equipment fleet. kembali dari Dallas. Nash Together with the International Workshop Manager, the consultant will be memiliki pencapaian angka required to assist Dinas Kebersihan dan Keindahan Kota (DK3) Banda Aceh to plan staff requirements, draft TORs, recruit workshop staff and train rata-rata 17.1 poin dan 10.8 them in workshop management, and setting up systems for operation and assist per pertandingan kala management which can be taken over by DK3 at the end of the assignment. memperkuat Mavericks dan Degree in Mechanical Engineering, with minimum 3 years experience in vehicle and heavy equipment maintenance, management of heavy 14.4 poin serta delapan assist equipment workshop facilities, training heavy equipment workshop staff, per laga sepanjang karirnya. good management and computer skill, particularly with MS-Office. (m33/okz) Duration of contract will be 12 (twelve) months.

kepada saya. Namun, kita lihat saja apa yang terjadi di masa depan,” tandasnya. Di MotoGP Jerman, Lorenzo kalah dan kecewa berat. Tak ingin terulang lagi, rider Fiat Yamaha itu berjanji akan melakukan terbaik guna membalaskan dendam kepada Rossi di Donington. Tahun lalu, Lorenzo memulai balapan dari peringkat 16 namun berhasil finish di urutan keenam. (m33/okz)

Reuters

dah tujuh kali Rossi menjadi pemenang namun belum lagi menjejak podium tertinggi sejak 2005. Pemuncak klasemen sementara itu dipastikan akan mendapat perlawanan ketat dalam balapan nanti,

sebagaimana dirasakan di MotoGP Jerman, Minggu (19/ 7) lalu. “Ini adalah tahun terakhir kami akan membalap di sana, kondisi yang membuat saya sedih. Tapi itu juga membuat

saya semakin terpacu untuk mencoba menang di sana, juga buat fans yang selalu memperlakukan saya seperti pembalap mereka sendiri,” pungkas Rossi. (m33/ini)

Nadal Realistis MALLORCA, Spanyol (Waspada): Selama hampir dua bulan cedera lutut, Rafael Nadal (foto) sadar akan terasa berat baginya segera kembali ke level tertinggi musim ini. Alhasil, Nadal mencoba untuk realistis. “Bahkan bila saya pulih 100 persen, Anda harus realistis. Sisa musim akan sulit karena setelah berhenti selama satu bulan, nyaris dua, Anda akan kehilangan ritme kompetisi,” papar Nadal dikutip Reuters, Selasa (21/7). “Saya masih memiliki satu

kelebihan dari (Roger) Federer, yaitu saya masih berusia 23 tahun,” lanjut Nadal yang kehilangan gelar Perancis Terbuka dan Wimbledon sekaligus peringkat pertama dunia yang digenggamnya karena cedera. Nadal diperkirakan baru akan kembali berkompetisi di Montreal Masters dengan status juara bertahan. Turnamen di Kanada ini rencananya akan digelar pada 8 Agustus mendatang.

Jalan Prof. H. M Yamin No. 47 Kisaran - 21224

PENGUMUMAN LELANG KEDUA Nomor : Peng-04/WKN.2/KNL.04/2009 Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Kisaran akan melakukan penjualan di muka umum atas barang-barang sitaan PUPN Cabang Sumatera Utara, berupa : I. Penyerahan PT. BNI (Persero) Tbk. Cabang Tanjung Balai 1. Juliati Hasibuan, alamat Dusun II Desa Air Genting, Kec. Air Batu, Kab. Asahan (SPPBS-02/PUPNC.02.02/2006 tanggal 5 April 2006). - Sebidang tanah seluas 2.054 m2 berikut dengan bangunan permanen yang berdiri diatasnya, terletak di Jalan Kisaran-Tanjung Balai Desa Hessa Air Genting Kec. Air Batu Kab. Asahan, sesuai SHM No.154 tanggal 16 Januari 1996 an. Juliati Hasibuan (Nilai Limit Rp.550.000.000,00 Uang Jaminan Rp.150.000.000,00). 2.

Sutrisno, alamat Jalan Jend. Sudirman Dusun I Desa Gading Kec. Datuk Bandar Kota Tanjung Balai (SPPBS-094/PUPNC.02.02/2006 tanggal 14 Desember 2006). - Sebidang tanah seluas 335 m2 berikut bangunan rumah permanen berdiri diatasnya terletak di Jalan Sudirman Lk.I Kelurahan Gading Kec. Datuk Bandar Kota Tanjung Balai sesuai SHM No.582 atas nama Sutrisno (Nilai Limit Rp.250.000.000,00 Uang Jaminan Rp.100.000.000,00).

3.

Ali, alamat Jalan Imam Bonjol No.340 Kisaran (SPPBS-03/PUPNC.02.02/2006 tanggal 10 Oktober 2006). a. Sebidang tanah seluas 96 m2 berikut segala yang ada diatasnya terletak di Kelurahan Selawan Kec. Kota Kisaran Timur Kab. Asahan, sesuai SHM No.1003 tanggal 08 Juni 2000 an. Ali (Nilai Limit Rp.12.000.000,00 Uang Jaminan Rp.5.000.000,00). b. Sebidang tanah seluas 96 m2 berikut bangunan permanen berlantai 4 (empat) diatasnya, terletak di Kelurahan Selawan Kec. Kota Kisaran Timur Kab. Asahan, sesuai SHM No.1002 tanggal 08 Juni 2000 an. Ali (Nilai Limit Rp.200.000.000,00 Uang Jaminan Rp.50.000.000,00). c. Sebidang tanah seluas 96 m2 berikut bangunan permanen berlantai 5 (lima) diatasnya, terletak di Kelurahan Selawan Kec. Kota Kisaran Timur Kab. Asahan, sesuai SHM No.1001 tanggal 08 Juni 2000 an. Ali (Nilai Limit Rp.250.000.000,00 Uang Jaminan Rp.75.000.000,00).

4.

For full details of the Terms of Reference please visit our website at www.undp.or.id/jobs

Human Resources Department UNDP Banda Aceh 2nd Floor, Gedung ex. Biro Keuangan Komplek Kantor Gubernur NAD Jln T.Nyak Arief no. 219, Lampineung Banda Aceh

AP

AP

(m33/ant/rtr)

DEPARTEMEN KEUANGAN REPUBLIK INDONESIA DIREKTORAT JENDERAL KEKAYAAN NEGARA KANTOR WILAYAH II MEDAN KANTOR PELAYANAN KEKAYAAN NEGARA DAN LELANG KISARAN

For the above position, full working knowledge of Bahasa Indonesia and English is mandatory.

All fully supported applications for the above post should be submitted not later than 29 July 2009 to:

DONINGTON, Inggris (Waspada): Valentino Rossi (foto) kembali membidik kemenangan pada MotoGP Inggris akhir pekan ini. Bukan cuma untuk memuluskan jalan menjadi juara dunia, tapi demi perpisahan dengan Donington Park. Tahun 2009 ini akan menjadi kali terakhir Sirkuit Donington menggelar balapan MotoGP. Setelah menjadi tuan rumah sejak 1987, musim depan lintasan sepanjang 4,023 km itu akan gantian menggelar F1, sementara MotoGP Inggris bakal dihelat di Silverstone. Kalau Rossi punya ambisi besar dalam balapan akhir pekan nanti, itu bukan hanya untuk mempertahankan posisi teratas di klasemen pembalap. “Tahun lalu, saya menjalani balapan yang bagus di Donington dan finish kedua. Tahun ini, saya benar-benar ingin menang karena Donington termasuk salah satu sirkuit favorit saya di dunia,” ungkap Rossi, Selasa (21/7). Di Donington, total su-

Budi Harjo, alamat Dusun IV Rt 04 RW 04 Desa Sei Silau Timur Kec. Buntu Pane Kab. Asahan (SPPBS-100/PUPNC.02.02/2006 tanggal 14 Desember 2006). a. Sebidang tanah seluas 880 m2 berikut bangunan rumah permanen berdiri diatasnya, terletak di Dusun IV Desa Sei Silau Timur Kec. Buntu Pane Kab. Asahan, sesuai SHM No.81 atas nama Budi Harjo (Nilai Limit Rp.80.000.000,00 Uang Jaminan Rp.25.000.000,00). b. Sebidang tanah seluas 414 m2 berikut segala sesuatu yang ada diatasnya terletak di Dusun IV Gang Gedek Desa Sei Silau Timur Kec. Buntu Pane Kab. Asahan, sesuai SKT No.593/005/SKT/SST/2005 tgl.17-01-2005 atas nama Budi Harjo (Nilai Limit Rp.30.000.000,00 Uang Jaminan Rp.10.000.000,00).

II. Penyerahan PT. Bank Mandiri (Persero) Tbk. Cabang Rantau Prapat Martinus Lubis. 5. Sujiono, alamat Jalan Tk. No.165 Dusun Cinta Makmur Desa Pondok Batu Kec. Bilah Hulu Kab. Labuhan Batu (SPPBS-026/PUPNC.02.02/2005 tanggal 31 Mei 2005). - Sebidang tanah seluas 284 m2 berikut bangunan rumah permanen diatasnya terletak di Jalan TK No.165 Dusun Cinta Makmur Desa Pondok Batu d/h Desa Perbaungan Kec. Bilah Hulu Kab. Labuhan Batu, sesuai SHM No.522 tanggal 18-02-1989 an.Sujiono (Nilai Limit Rp.150.000.000,00 Uang Jaminan Rp.50.000.000,00). 6.

CV. Grafika Jaya (Penjab. Alm.Achmad Fauzi), alamat Jalan Imam Bonjol No. 39 Rantau Prapat (SPPBS-019/PUPNC.02.02/2005 tanggal 31 Mei 2005). - Sebidang tanah seluas 712 m2 berikut bangunan rumah permanen berdiri diatasnya terletak di Jalan Khairil Anwar No.61 Kel. Siol Dengan d/h Kel. Bakaran Batu Kec. Rantau Selatan d/h Kec. Bilah Hulu Kab. Labuhan Batu, sesuai SHM No. 959 tanggal 22-12-1987 an. Achmad Fauzy (Nilai Limit Rp.450.000.000,00 Uang Jaminan Rp.150.000.000,00).

7.

UD. Hasian Jaya (Penjab. Halimah Br. Naibaho), alamat Jalan Imam Bonjol No.74 Rantau Prapat (SPPBS-016/PUPNC.02.02/2005 tanggal 31 Mei 2005). - Sebidang tanah seluas 378 m2 berikut bangunan rumah kayu berdiri diatasnya terletak di Kelurahan Gunting Saga Kec. Kualuh Selatan d/h Kualuh Hulu Kab. Labuhan Batu, sesuai SHM No.160 tanggal 23-12-1996 an.Abu Naim Siagian (Nilai Limit Rp.50.000.000,00 Uang Jaminan Rp.15.000.000,00).

III. Penyerahan PT. BRI (Persero) Cabang Kisaran 8. Irwansyah Lubis dan Jumiya, alamat Dusun III Desa Tanah Tinggi Kec. Air Putih Kab. Batubara d/h Kab. Asahan (SPPBS-007/PUPNC.02.02/2006 tanggal 16 Mei 2006). - Sebidang tanah seluas 1.490 m2 berikut bangunan rumah dan bangunan bengkel berdiri diatasnya terletak di Desa Tanah Tinggi Kec. Air Putih Kab. Batubara d/h Kab. Asahan, sesuai SHM No.44 an. Irwansyah Lubis (Nilai Limit Rp.225.000.000,00 Uang Jaminan Rp.75.000.000,00). 9.

Anwar Musi/Sopiah, alamat Dusun II Desa Air Hitam Kec. Lima Puluh Kab. Batubara d/h Kab. Asahan (SPPBS-05/PUPNC.02.02/2004 tanggal 7 Juli 2004). - Sebidang tanah seluas 1.411 m2 berikut bangunan tempat tinggal yang berada diatasnya terletak di Desa Air Hitam Kec. Limapuluh Kab. Batubara d/h Kab. Asahan, sesuai SHM No.232 tanggal 22-09-2000 an. Anwar Musi (Nilai Limit Rp.125.000.000,00 Uang Jaminan Rp.50.000.000,00).

Telepon : (0623) 41427 Faksimile : (0623) 42520 10. Ali Usman dan Fitri Agustina, alamat Lk.VI RT/RW 01/01 Kelurahan Siumbutumbut Kec. Kota Kisaran Timur Kab. Asahan (SPPBS-03/PUPNC.02.03/2008 tanggal 27 Nopember 2008). a. 3 (tiga) bidang tanah menjadi satu kesatuan masing-masing seluas 1.830 m2 sesuai SHM No.1 an. Ali Usman, seluas 1.897 m2 sesuai SHM No.5 an. Ali Usman dan seluas 845 m2 sesuai SHM No.16 an.Ali Usman, berikut bangunan gudang kilang padi, bangunan pabrik dan mesin-mesin serta seluruh peralatan kilang padi yang berdiri diatasnya terletak di Kelurahan Siumbut-umbut Kec. Kota Kisaran Timur Kab. Asahan (Nilai Limit Rp.550.000.000,00 Uang Jaminan Rp.150.000.000,00). b. 2 (dua) bidang tanah menjadi satu kesatuan masing-masing seluas 4.838 m2 sesuai SHM No.9 an. Ali Usman dan 1.019 m2 sesuai SHM No.11 an. Ali Usman berikut kebun kelapa sawit yang ada diatasnya terletak di Kelurahan Siumbutumbut Kec. Kota Kisaran Timur Kab. Asahan (Nilai Limit Rp.250.000.000,00 Uang Jaminan Rp.100.000.000,00). IV. Penyerahan PT. BRI (Persero) Cabang Tanjung Balai 11. Ngatimin dan Mahyati, alamat Dusun II Desa Sijawi-jawi Kec. Sei Kepayang Kab. Asahan (SPPBS-078/PUPNC.02.02/2006 tanggal 18 Oktober 2006) - Sebidang tanah seluas 384 m2 berikut bangunan rumah yang berdiri diatasnya terletak di Dusun III Desa Sijawi-jawi Kec. Sei Kepayang Kab. Asahan, sesuai SHM No.3 tanggal 23-05-1997 an.Ngatimin (Nilai Limit Rp.120.000.000,00 Uang Jaminan Rp.50.000.000,00). 12. Sulaiman Hasibuan dan Mariati, alamat Jalan Khairil Anwar Gang Koperasi Lk.III Kelurahan Keramat Kubah Kec. Sei Tualang Raso Kota Tanjung Balai (SPPBS-37/PUPNC.02.03/2009 tanggal 18 Juni 2009). a. Sebidang tanah seluas 367 m2 berikut bangunan rumah yang ada diatasnya terletak di Gang Koperasi Kelurahan Keramat Kubah Kec. Sei Tualang Raso Kota Tanjung Balai, sesuai SHM No.122 tanggal 18-02-1998 an.Mariati (Nilai Limit Rp.150.000.000,00 Uang Jaminan Rp.50.000.000,00). b. Sebidang tanah seluas 143 m2 berikut segala apa yang ada diatasnya terletak di Gang Koperasi Kelurahan Keramat Kubah Kec. Sei Tualang Raso Kota Tanjung Balai, sesuai SHM No.123 tanggal 18-02-1998 an.Sulaiman Hasibuan dan Mariati (Nilai Limit Rp.125.000.000,00 Uang Jaminan Rp.50.000.000,00). V. Penyerahan PT. BNI (Persero) Tbk. Cabang Kuala Tanjung. 13. Tjiu Tjin Pin, alamat Jalan Batubara No.22 Dusun I Desa Sei Muka Kec. Talawi Kab. Batubara d/h Kab. Asahan (SPPBS-037/PUPNC.02.02/2005 tanggal 17 Juni 2005). - 2 (dua) bidang tanah merupakan satu kesatuan masing-masing seluas 753 m2 sesuai SHM No.675 an.Tjiu Tjin Pin alias Pini dan seluas 453 m2 sesuai SHM No.696 an. Pini berikut pondasi bangunan yang telah hancur, terletak di Desa Sei Muka Kec. Talawi Kab. Batubara d/h Kab. Asahan (Nilai Limit Rp.125.000.000,00 Uang Jaminan Rp.50.000.000,00). VI. Penyerahan PT. Bank Sumut Cabang Kisaran. 14. CV. Kepayang Mas (Penjab. Abdal), alamat Dusun III Desa Sei Kepayang Tengah Kecamatan Sei Kepayang Kab. Asahan (SPPBS-02/PUPNC.02.03/2007 tanggal 3 September 2007). - 2 (dua) bidang tanah merupakan satu kesatuan masing-masing seluas 2.871 m2 dan luas 9.283 m2 berikut dengan bangunan eks pabrik minyak kelapa, kantor bangunan rumah karyawan dan mesin-mesin pengelolaan minyak kelapa terletak di Desa Sei Kepayang Tengah Kecamatan Sei Kepayang Kabupaten Asahan, sesuai dengan SHM No.16 tanggal 08 Januari 1991 dan SHM No.15 tanggal 08 Januari 1991 atas nama Abdal (Nilai Limit Rp.306.100.000,00 Uang Jaminan Rp.125.000.000,00). SYARAT-SYARAT LELANG 1. Untuk mengikuti lelang, setiap peminat/peserta wajib menyetorkan uang jaminan lelang sebagaimana uraian tersebut di atas 2. Untuk uang jaminan lelang sampai dengan Rp. 20.000.000,00 dapat disetorkan langsung kepada Pejabat Lelang atau Bendaharawan Penerima paling lambat 15 menit sebelum pelaksanaan lelang dimulai sedangkan untuk uang jaminan lelang di atas Rp. 20.000.000,00 harus disetor melalui rekening Bendaharawan Penerima KPKNL Kisaran di Bank Sumut Cabang Kisaran Nomor : 3235-0 selambat-lambatnya efektif masuk ke dalam rekening tersebut 1 (satu) hari sebelum pelaksanaan lelang, dengan menyebutkan nomor urut barang yang akan ditawar pada bukti setor uang jaminan. 3. Ketentuan pelaksanaan lelang dan tata cara penawaran akan dijelaskan oleh Pejabat Lelang pada waktu pelaksanaan lelang dimulai. 4. Untuk nomor urut 1 sampai dengan 14, perserta yang mengikuti lelang minimal 2 (dua) orang. 5. Pemenang lelang yang ditunjuk wajib melunasi harga lelang secara tunai paling lambat 3 (tiga) hari kerja. 6. Informasi lebih lanjut dapat diperoleh di Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Kisaran, Jalan Prof. H.M Yamin, S.H No.47 Kisaran - 21224 Telepon: (0623) 41660, Faximili (0623) 42520 pada setiap hari kerja. WAKTU DAN TEMPAT PELAKSANAAN LELANG Penjualan di muka umum (lelang) dilaksanakan pada hari Kamis tanggal 6 Agustus 2009 dimulai pukul 10.00 Wib sampai selesai, bertempat di Ruang Lelang KPKNL Kisaran, Jalan Prof. H.M Yamin, No. 47 Kisaran Kisaran, 22 Juli 2009

Kepala Kantor dto

Edward Situmorang NIP 060049271


Medan Metropolitan

WASPADA Rabu 22 Juli 2009

9

Pra Kualifikasi Tender Gedung DPRDSU Terindikasi KKN MEDAN (Waspada): Pelaksanaan prakualifikasi tender pembangunangedungbaruDPRDSU senilai Rp181 miliar terindikasi KKN (korupsi, kolusi dan nepotisme). Panitia tender dituding memenangkan perusahaan yang tidak memenuhi persyaratan. Hal itu disampaikan salah satu peserta tender yang dinyatakan panitia tidak lolos pra kualifikasi,PTNindyaKaryaKSOMedan Smart Jaya kepada wartawan di sekretariat panitia tender di gedung dewan, Selasa (21/7). “Bahkan waktu kita hendak komplain, ternyata panitia tidak adasatupunyangberadadikantor. Ini bukti mereka takut menghadapi komplain perusahaan yang mereka kalahkan. Padahal sekarang ini masih dalam masa komplain,” kata pimpinan Medan Smart Jaya, Syaiful Azhar didampingiStafTeknikPTNindyaKarya, Darma Sembiring. Syaiful menjelaskan, awalnya ada tujuh perusahaan yang mengikuti pra kualifikasi tender yang dipendaftarannya dibuka Waspada/Surya Efendi

KELILING KOTA: Sepasang turis asing santai menaiki becak bermotor ketika melintas di Jl. Gatot Subroto Medan, Selasa (21/7). Turis asing banyak dijumpai di Kota Medan pasca ledakan bom di dua hotel di Jakarta beberapa hari lalu. Ini menandakan Medan masih aman.

Afifuddin Pamit, Rahudman Dituntut Lebih Berani MEDAN (Waspada): Penjabat Walikota Medan Drs H Afifuddin Lubis, MSi periode 2008-2009, pamit kepada seluruh Satuan Kerja Perangkat Daerah (SKPD) terdiri dari eselon II, III dan staf di jajaran Pemerintah Kota (Pemko) Medan dalam apel terakhir di halaman kantor Balaikota Medan, Selasa (21/7). Menurut informasi, jabatan Afifuddin Lubis akan diserahterimakan kepada Drs H Rahudman Harahap yang selama ini bertugas sebagai Asisten Administrasi dan Aset Setdaprov Sumut dan juga mantan Sekda Tapanuli

Selatan.Pelantikandirencanakan, hari ini, Rabu (22/7), oleh Gubsu H Syamsul Arifin, SE di kantor Gubernur Sumut Jalan Diponogoro Medan. Waspada mencatat, Afifuddin Lubis masih banyak me-

Rahudman Dinilai Mampu Lanjutkan Pembangunan MEDAN (Waspada): Ketua Umum Forum Rembuk Mahasiswa Tapanuli Bagian Selatan (Formatbagsel) Sumut yakin Rahudman Harahap mampu mengemban amanat sebagai PjWalikota Medan dan melanjutkan pembangunan Medan menjadi lebih baik ke depan. Ketua Formatbagsel, Shofhan Ahmadi Nasution, didampingi unsur pengurus Tamrin Harahap, Habarol Nasution, Parlindungan Dalimunthe, Edy Syahputra, Herian Sani mengatakan itu di Medan, Minggu (20/7). “ Kita sangat yakin dan hakkul yakin Rahudman Harahap akan mampu melanjutkan pembangunan Kota Medan kearah yang lebih baik”. Selain itu, lanjut Nasution, Rahudman akan mampu juga mengemban amanah untuk melaksanakan pemilihan kepala daerah (Pilkada) kota Medan yang akan digelar pada tahun 2010 secara demokratis, aman dan jurdil. Penilaian dan keyakinan tersebut beranjak dari track record Rahudman yang memulai karirnya dari tingkat bawah sepert Camat hingga Sekdakab dan pengalaman melayani tugas- tugas kepala daerah. DanyangterpentingRahudmanakanmampumengayomisemua elemen masyarakat yang ada di Kota Medan sebagaimana orang yang dipercaya Gubsu H. Syamsul Arifin, SE yang dikenal sebagai sahabat semua suku. “Yang pasti kita yakin Rahutman mampu menggerakkan Dinas PU untuk memperbaiki jalan dan drainase yang dinilai sangat prioritas untuk dikerjakan,” kata Nasution. (m14)

Warga JlTimor Suspect Flu Babi MEDAN (Waspada): Hampir setiap hari pasien terduga (suspect) flu babi memeriksakan diri ke RSUP H. Adam Malik Medan. Kemarin siang, pasien baru itu berinisial Al, 17, warga Jalan Timor Medan. Kabag Hukum dan Humas RSUP HAM AtmaWijaya mengatakan, pasien itu baru pulang dari daerah terjangkit, yakni Bali. Dia berinisiatif memeriksakan diri karena takut tertular A-H1N1 itu. “Si Al datang ke RSUP Adam Malik dengan kondisi pilek dan batuk-batuk kecil. Suhu tubuhnya 36,7 derajat celcius. Kalau dilihat dari kondisinya si Al hanya diobservasi di rumah,” katanya. Meski begitu, lanjutnya, swab dan darahnya juga diambil untuk dikirim ke Pusat Penelitian dan Pengembangan Kesehatan di Jakarta. Pasien ini juga melewati foto thorax untuk melihat apakah ada kelainan di tubuhnya. Dengan bertambahnya satu pasien yang memeriksakan diri, jumlah kesuluruhan suspect yang memeriksakan diri 55 pasien. Sementara pasien yang dirawat inap di Ruang Isolasi RSUP HAM hanya 2 orang; YM, 20, dan Ar, 60. (cmai)

ninggalkan persoalan antara lain infrastruktur, ratusan rumah toko (ruko)diJalanGagakHitamtanpa Surat Izin Mendirikan Bangunan (SIMB) belum dibongkar, Hotel JW Marriot, drainase, ternak babi di Kec. Medan Denai dan Hotel Kesawan Jalan Ahmad Yani Medan. Masyarakat berharap agar PjWalikota baru dapat menyelesaikannya setelah dilantik oleh Gubernur. Selain itu, juga dituntut lebih berani dalam membuat kebijakan terhadap pembangunan Kota Medan yang menuju kota Metropolitan yang Madani dan Religius. Ketika dikonfirmasi, Afifuddin membenarkanmasih banyak persoalan yang belum selesai dan terpaksa ditinggalkan karena sudah masa pensiun. Menu-

rutnya, masalah-masalah yang terjadi di Kota Medan selama ini tidak bisa diselesaikan dengan pidato ataupun retorika. Justru harus diselesaikan dengan tindakan sesuai aturan yang berlaku. Diharapkan masalah yang terjadi di Kota Medan selama ini dapat diselesaikan tanpa harus merugikan pihak lain. “Selama saya menjabat Pj Walikota Medan banyak timbul image negatif ataupun tuduhan yang menyebutkan terlalu lamban alias tidak berani dalam mengambil sikap. Sehingga banyak kegiatan di lingkungan Pemko Medan maupun infrastruktur jalan di tempat,” ucapnya. Halini,menurutnya,merupakan hal biasa dan demokrasi.Tapi yang perlu digarisbawahi, tegasnya, semua masalah yang terjadi

di Kota Medan bukannya tidak bisa ditindak atau tidak berani, tapi pihaknya sedang mencari solusinyasupayamasalahitutidak melebar luas. “Saya bukan tidak ingin menyelesaikanpersoalanitu,namun saya masih mencari solusinya,” katanya. Namun, dia berharap agar nantinya semua persoalan tersebut dapat terselesaikan dengan baik. Ketika ditanya apa pesannya terhadap PjWalikota yang baru, Afifuddin tidak menjawab dengantegas.Diahanyamenyebutkan akan berbicara dalam forumnya berdua. “Kalau masalah itu nanti dalam forum. Tapi saya berterimakasihkepadamasyarakatKota Medan yang sudah mendukung sampaimasajabataniniberakhir,” ucapnya. (h10)

Ancaman Bom Via SMS MEDAN (Waspada): Teror bom tidak lagi melalui percakapan telepon tetapi sudah menggunakan SMS kepada seseorang, rumahnya akan diledakkan. Hal ini dialami Indra Jaya, 40, warga Jalan Puri Medan. Saat bekerja sebagai staf operasional kursus Bahasa Inggris Angkasa Gemilang Learning Centre di Jalan Gedung Arca Medan ini menerima pesan singkat/SMS via handphonennya pukul 13.00 bertuliskan: “Sudah diletakkan bom di sekitar rumah Anda dan sebentar lagi akan meledak.” Khawatir akan isi SMS itu, Indra segera melaporkannya ke Polsekta Medan Area. Indra pun kembali ke rumahnya untuk memastikan kebenaran isi SMS itu. Kapolsekta Medan Area AKP Juliani melalui Kanit Reskrim Polsekta Medan Area Iptu J Banjarnahor mengatakan, pihak kepolisian dan tim Gegana Poldasu langsung melakukan penyisiran ke rumah Indra Jaya di Jalan Puri. Setelah diyakini tak ada benda-benda yang mencurigakan, petugas keamanan meninggalkan kediaman Indra

Jaya. “Tidak ditemukan bendabendayangmencurigakanseperti yang diancam dalam SMS itu,” ujar Iptu J Banjarnahor. Polisi Selidiki Pelaku Teror Sat Reskrim Poltabes Medan masih melakukan penyelidikan terhadap pelaku teror bom di tiga hotel berbintang di Medan, apakah menggunakan handphone (HP) atau telefon umum (TU). “Masih kita lidik, apakah pelaku menghubungi hotel menggunakan HP atau melalui TU,” kata Kasat Reskrim Kompol Gidion Arif Setyawan, Selasa (21/7). Ketikaditanyahasillidikkasus teror bom di tiga hotel, apakah identitas sudah diketahui, Gidion mengatakan belum mengetahui hasilnya. “Hasil lidik belum diketahui, tim lagi bekerja,” jelasnya. Sedangkan Kapoltabes Medan Kombes Pol Imam Margono sebelumnya mengatakan, Poltabes menjaga ketat hotel berbintang dan objek vital lainnya termasuk hotel JW Marriott di Jalan Putri Hijau Medan. Walau dijaga ketat, pasca

meledaknya dua hotel di Jakarta, yakni JW Marriott dan Ritz Carlton, tiga hotel di Medan Hotel Asean, Jalan H Adam Malik Medan, JW Marriott, Jalan Putri Hijau Medan dan Grand Swiss bel-Hotel,JalanS.ParmanMedan mendapat teror bom dari penelepon gelap. Menurut Kapoltabes, sistem pengamanan di beberapa hotel berbintang di kota ini masih diserahkan sepenuhnya kepada pihak perusahaan atau satpam hotel. “Walau begitu, pihak kepolisian terus meningkatkan pengamanan baik itu secara tertutup maupun pengamanan secara terbuka,” katanya. Tempat-tempat vital lainnya dilakukan pengamanan secara ketat untuk mengantisipasi tidak terjadinya ledakan bom seperti yang terjadi di Jakarta. Seluruh anggota dilibatkan untuk melakukan pengamanan termasuk pihak Satlantas. “ Pihak kepolisian sedang melakukan penyelidikan dan melakukan pencarian terhadap pelaku teror bom di hotel berbintang,” ujarnya. (cat/m39)

Kejari Pulangkan BAP Penyebar Selebaran MEDAN (Waspada): Berita Acara Pemeriksaan (BAP) tersangka Adi Zein, dalam kasus penyebaran selebaran gelap sudah dua kali dipulangkan Kejari Medan ke Poltabes dengan alasan belum lengkap. Kasat Reskrim Poltabes Medan, Kompol Gidion Arif Setiyawan, yang ditemui wartawan di Lapangan Merdeka Medan, Selasa (21/ 7), membenarkan BAP Adi Zein sudah dua kali dipulangkan Kejari Medan. Menurut Gidion, pihak Kejari meminta kepada penyidik untuk menghadirkantabloidMonitoryangmemuathasilwawancaradengan presiden Ikhwanul Muslim Indonesia bukan yang foto copy seperti barang bukti di kepolisian. “Polisi sudah berusaha mencari tabloid tersebut di Jakarta, namun sampai saat ini belum didapat,” jelas Gidion. Adi Zein dinyatakan sebagai tersangka karena telah menyebarkan selebaran yang berisikan “PKS Tidak Tahu Istri Budiyono Khatolik.” Selebaran itu disebarkan oleh Adi Zein pada simpatisan ataupun pendukung JK-Wiranto yang berkampanye secara tertutup di Medan, beberapa waktu yang lalu. “Adi Zein telah kami periksa yang awalnya sebagai saksi dan akhirnya karena adanya laporan dari pihak Panwaslu Medan, maka kami menetapkan sebagai tersangka. Karena sudah rampung BAP nya, maka kami limpahkan ke Kejari Medan, namun sampai saat ini masih belum lengkap (P19),” jelasnya mantan Kapolsekta Pancur Batu ini. (m39)

Waspada/Surya Efendi

RAZIA MOBIL BOKS: Dua polisi memeriksa kotak dari dalam mobil boks yang terjaring razia di Jl. Gatot Subroto Medan, Selasa (21/7). Razia mobil boks dari dan menuju Kota Medan mulai diberlakukan untuk mengantisipasi masuknya bahan peledak.

pada 3 Juli 2009 lalu. Dan ketika diumumkan pada 17 Juli 2009, panitia menyatakan hanya tiga perusahaan, PT Pembangunan Perumahan, PT Jaya Konstruksi dan PTWaskita Karya yang lulus kualifikasi. “Sedangkan empat perusahaan lainnya hanya dinyatakan tidak lulus kualifikasi tanpa diberitahu alasan mengapa kami dinyatakantidaklulus.Persyaratan mana yang tidak kami penuhi,” kata Syaiful. Apalagi, kata Syaiful, ketiga perusahaanyangdinyatakanlulus kualifikasi itu ternyata tidak memenuhi persyaratan yang diatur dalam Kepmen No.47 tentang jasa konstruksi yang menyatakan perusahaan yang mengikuti tender jasa kontruksi harus melakukan perjanjian kerjasama operasional (KSO) dengan perusahaan lokal (kecil). “Ketiga perusahaanitutidakadayangmelakukan KSO yang menjadi persyaratan kualifikasi,” katanya. Karena itu, kata Syaiful, PT Nindya Karya meminta Gubsu

agar membatalkan pra kualifikasi tender yang terindikasi praktik KKN itu. Serta memerintahkan kepada panitia tender menjelaskan kepada perusahaan yang dinyatakan tidak lulus pra kualifikasi alasan yang jelas tentang kekalahan mereka. “Karena panitia terkesan bekerjahanyauntukkepentingan ketiga perusahaan yang jelas-jelas sudah punya kesalahan itu,” katanya. SelainGubsu,PTNindyaKarya juga meminta LPJKD (LembagaPengembanganJasaKonstruksiDaerah)agarmemanggilpanitia untuk membuktikan kekalahan para perusahaan yang tidak lulus kualifikasi Sementara itu, Ketua Panitia Tender, Jeremias Sinaga yang pegawai Dinas Tarukim Pemprovsu saat hendak dikonfirmasi wartawan melalui handphonenya tidak mengangkat. Bahkan setelah dikonfirmasi melalui pesan singkat, handphone yang bersangkutan langsung tidak aktif. (h11)

Pemko Jangan Kalah Dengan Preman Tertibkan Ternak Babi Hanya Wacana MEDAN: (Waspada): PemudaMuslimin(PM)Sumutmenilai, saat ini Pemko Medan sedang diuji kemampuan dan nyalinya sejauh mana kemauan dan keinginannyauntukmenertibkan ternak babi liar di kawasan Kecamatan Medan Denai. “Jangan sampai Pemko Medan kalah dengan preman,” kata Sekretaris PM Sumut, Jhoni Koto, ketika dikonfirmasi Waspada, Selasa (21/7). PMI Sumut menilai, sejauh ini Pemko Medan baru hanya sebatas wacana serta retorika dan belum pada tingkat tindakan dalam menghadapi keresahan warga atas kehadiran ternak babi tersebut. Padahal tidak ada lagi yangditunggusetelahusaipilkada, pemilu dan pilpres. Justru, melihat kondisi di lapangan yang sudah semakin memanas ini, tegas Koto, Pemko Medan harus menjawab cepat bisa atau tidak menertibkan ternak babi tersebut. Kata Koto, saat ini Pemko Medanterkesaninginmelakukan politik adu domba agar terjadi konflik dan dengan alasan itu mungkin mereka baru turun lapangan mengambil tindak pengamanan. Harusnya Pemko melakukan tindakan pecegahan bukanpemadamansepertimobil pemadam kebarakan. Soal ternak babi itu, lanjut

Koto, bukan hanya karena berdampingan dengan masjid tapi juga saat ini telah terjadi pencemaran lingkungan di tenga kota. Medan Denai saat ini berada dalam inti kota dan Pemko telah melarang di kawasan itu menernak hewan kaki empat. PM juga menyesalkan keberadaan anggota DPRD Medan terutama dari partai Islam,karena tidak menyahuti aspirasi masyarakat Kecamatan Medan Denai yang resah akiba ternak babi. “Harusnya mereka menekan Pemko untuk melakukan penertiban bukan mendengar danmelihatkeadaanyangterjadi,” kata Koto. Koto juga mengingatkan kelompok masyarakat agar tidak memanasi para peternak untuk terusmempertahankankegiatannya di kawasan itu dengan berbagai alasan. “Mari kita dukung Pemko menertibkannya,” tutur Koto. Siap Turun Sementara itu, Badan Kontak PemudaRemajaMasjidIndonesia (BKPRMI) Sumut menyatakan siap turun menertibkan ternak babibersebelahandenganmasjid di Jalan Tangguk Bongkar, Kecamatan Medan Denai, demi mengawal dan menjaga kesucian rumah ibadah itu. Ketua BKPRMI Sumut, H. Sotar Nasution, menegaskan itu

kepada Waspada setelah kembali dari Jakarta di Medan, Selasa, menyahuti permintaan jamaah masjid di kawasan itu. Menurut Sotar, umat Islam wajib mengawal, menjaga serta memelihara masjid sebagai tempat ibadah dari segala bentuk pengerusakanterhadapkesuciannya. Mengingat hal itu, seharusnyadimintaatautidakumatwajib turun melindungi rumah Allah itu. “Saya sudah perintahkan BKPRMI Medan agar turun melindungi masjid tersebut dari ternak babi,” tegas Sotar dan menambahkandirinyajugaterusmelakukan koordinasi dengan Brigadir BKPRMISumutmaupunMedan. Sotar mengaku pihaknya prihatinterhadapapayangdirasakan jamaah masjid di kawasan ternak babi Kecamatan Medan Denai.Namun,keresahanitutidak serta merta harus ditanggapi setelah adanya keinginan Pemko Medan untuk melakukan penertiban. Kebijakan awal yang akan dilakukan BKPRMI, lanjut Sotar, turun ke lapangan melakukan pendekatandenganpeternakbabi mencari solusi terbaik minta mereka menertibkan ternaknya dari kawasan itu. “Jika tawaran terbaik tidak diterima peternak, langkah terakhir adalah dengan kekerasan,” tegasnya. (m14)

Pokja Poros Kota Demo Ke Kantor Gubsu

Tuding Ruislag SMUN 4 Siantar Konspirasi Busuk MEDAN (Waspada): Ruislagh SMUN 4 dan SD 122350 di Kota Pematang Siantar dituding demonstran dari Pokja Poros Kota dalam aksi damai di Kantor Gubernur Sumut, Selasa (21/7), sebagai sebuah konspirasi busuk. Karena tata cara tukar menukar barang milik/kekayaan negara sesuai ketentuan SK Menkeu Nomor 350/KMK.03/ 1994 belum pernah mendapat izin Presiden. “Ruislagh tersebut jelas-jelas konspirasi busuk. Karena yang seharusnya mengajukan permohonan tukar menukar adalah unit pemakai barang (UPB), yakni Dinas Pendidikan dan Pengajaran Pemko Pematang Siantar, bukan pihak swasta (PT Detis Sari Indah/DSI),” beber Imran Simanjuntak dari Pokja Poros Kota. Menurut Imran, konspirasi busuk ruislagh itu bermula pada 20 Desember 2005 lalu. Saat itu Komisaris Utama PT DSI, Hermanto aliasYempo melalui Surat Nomor 14/DSI-05 menyurati Pemko P Siantar tentang ruislagh SMUN 4 yang berada di pusat kota dengan tiga sekolah di Jalan Gunung Simanukmanuk, Jalan Medan ke arah terminal Tanjung Pinggir dan di Jalan Sisingamangaraja. Surat PT DSI itu direspon Pemko dengan mengeluarkan Surat Nomor 050/4353/VI/2006 perihal keberlangsungan proses belajar mengajar di SMUN 4 kepada Kadis Dikjar P Siantar dan Ketua Komite Sekolah. Selanjutnya, PT DSI kembali mengeluarkan Surat Nomor 15/DSI-06 perihal yang sama dengan mengganti lokasi SMUN 4 dengan hotel, pertokoan dan mall. Anehnya, lanjut Imran, usulan PT DSI itu langsung ‘diamini’ Pemko P Siantar. Indikasinya, DPRD P Siantar melalui Surat

Nomor 425/4D55/DPRD/IV/ 2007 tertanggal 17 April 2007 memberikan izin prinsip tukar menukar barang milik Pemko P Siantar berupa tanah dan bangunan SMUN 4 dan SD 122350 di antara Jalan Patimura, Jalan Merdeka dan Jalan Sutomo seluas 24.621 meter bujur sangkar seharga Rp34.956.967.000. Surat DPRD P Siantar yang ditandatangani Ketua Dewan Lingga Napitupulu dan Wakil Ketua Ir Saud H Simanjuntak serta Syirwan Hazzly Nasution, menurut Imran, sebenarnya tidak memenuhi prosedur hukum. Antara lain tidak adanya izin Presiden dan bertentangan dengan SK Menkeu. Karena mekanisme ruislagh SMUN 4 dan SD 122350 tersebut bertentangan dengan ketentuan dan prosedur hukum, lanjut Imran, maka Pemko P Siantar pun merubah strateginya.Yakni, tiga bangunan dan gedung yang dibangun PT DSI itu dipinjamkan kepada Pemko P Siantar. Hal ini dibuktikan dengan Surat Pinjam Pakai yang dibuat antara Johy (Direktur PT DSI) dan RE Siahaan (Walikota P Siantar). Pembuatan surat itu disaksikan Hermanto (Komisaris PT DSI) dan Wakil Ketua DPRD Siantar, Ir Saud H Simanjuntak. “Dengan skenario seperti ini, maka upaya pinjam pakai itu sebenarnya hanya akal-aka-

lan untuk mempermudah jalannya ruislagh yang sebenarnya illegal. Kemudian, investor yang telah empat tahun menginginkan lokasi SMUN 4 dan SD tersebut, ditengarai telah banyak mengeluarkan upeti, sehingga sudah saatnya menagih janji dan muncul kesan aparat hukum juga ikut berkonspirasi dalam hal ini,” kata Imran. Aksi massa Pokja Poros Kota ini mendapat pengawalan ekstra ketat aparat Polisi Sektor Medan Kota. Mereka diterima Kabiro Kapwat Pemprovsu Bondaharo Siregar, karena Gubsu tidak berada di tempat. Kepada mengunjukrasa Bondaharo mengatakan, pihaknya akan menyampaikan masalah ini ke atasan untuk dibahas. Namun, katanya, pihak Pemko P Siantar-lah yang paling berwenang menyelesaikan masalah ini. “Kita tak dapat berbuat banyak’” ujarnya. Sebelumnya, secara pribadi Gubsu Syamsul Arifin berharap ruislagh SMUN 4 dan SD 122350 P Siantar tersebut tidak dilakukan dengan tergesa-gesa. “Sebaiknya persoalan ini ditempuh dengan win-win solution. Karena saya tidak ingin anak didik dan investor sama-sama dirugikan. Makanya, saya minta RE Siahaan menyelesaikan persoalan ini dengan bijak,” katanya. (m19)


Medan Metropolitan 10 Sumut Dilanda Asap Kotor MEDAN (Waspada): Kawasan Sumatera Utara saat ini sedang dilanda asap kotor yang bersumber dari kebakaran hutan di Riau, ditambah asap kendaraan dan pabrik di kawasan Medan. Demikian Firman, S.Com, KepalaDatadanIinformasi(Datin) BMGWilayah I Stasiun Bandara Polonia Medan, ketika dikonfirmasi, Selasa (21/7).

“Kondisi udara terlihat begitu pekat, masa-lahnya pada Selasa pagi tidak terlihat cahaya matahari menyi-nari bumi (mendung), sehingga udara kotor

Pomdam I/BB Tatar Personel Provost MEDAN (Waspada): Polisi Militer Komando Daerah Militer I-Bukit Barisan (Pomdam I/BB) menyelenggarakan penataran terhadap personel Provost se jajaran Kodam I/BB di aula Supratman Mapomdam, Jalan Sena, Medan serta di Korem-Korem. Pembukaan penataran tersebut, Selasa (21/7), oleh Komandan Pomdam I/BB, Kolonel CPM Unggul K.Yudoyono, atas nama Pangdam, dihadiri sejumlah Asisten Kasdam I/BB, beberapa perwira menengah Makodam, Kapendam I/BB serta jajaran Pomdam I/BB. Sebelumnya, komandan penataran Kapten CPM Uncok Anggiat S Simanjuntak dalam laporannya, mengemukakan, penataran diikuti 100 personel provost dari satuan jajaran Kodam I/BB wilayah Medan dan sekitarnya. Sedangkan maksud serta tujuannya, papar Uncok, adalah memberikan bekal pengetahuan provost, penyidikan terbatas, penegakan hukum disiplin tata tertib dalam markas dan pengetahuan penyelenggaraan Surat Izin Mengemudi (SIM) TNI. Sedangkan penataran akan berlangsung hingga 24 Juli 2009. Sementara, Pangdam I/BB Mayjen TNI Burhanudin Amin dalam amanat tertulis dibacakan Kolonel CPM Unggul K.Yudoyono, antara lain mengemukakan, provost memiliki tugas dan tanggung jawab sebagai penegak hukum, tata tertib dan disiplin di satuan. Melalui penataran provost ini, diharapkan para personilnya memiliki ilmu dibidang provost dalam mendukung tugas di satuan masing-masing guna menegakkan disiplin, ketertiban dan menguasai norma aturan yang berlaku. Usai pembukaan, Danpomdam I/BB kepada wartawan mengutarakan, penataran didasarkan atas perintah Komandan Pusat Polisi Militer AD, serta atas beberapa pengalaman selama kunjungan Pangdam, ternyata provost belum bekerja/bertugas maksimal. Justru itu dengan penataran ini pula ditargetkan provost-provost satuan bisa menekan angka pelanggaran yang awalnya dari satuan.(m34)

Perjanjian Pedagang Dengan PT GKKS Sepihak MEDAN (Waspada): Lembaga Konsumen Indonesia (LKI) Sumut menilai perjanjian antara pedagang Pasar Petisah dengan Developer PT Gunung Karya Kencana Sentosa (GKKS) harus batal demi hukum. Ketua LKI Sumut Abu Bakar Siddik di Medan, Selasa (21/7), mengatakan, selama ini perjanjian hanya berjalan sepihak antara hak dan kewajiban tidak berjalan sebagaimana mestinya, sehingga hal ini telah merugikan konsumen dan perjanjian dapat dibatalkan. “Kita terjun langsung dan berdialog kepada pedagang di Lantai I Pasar Petisah Tahap I dan II, bahwa surat Perjanjian Pemakaian Kios Proyek Pasar Petisah Medan Nomor.143/Leg/X/2004 tertanggal 11 Oktober 2004 yang diteken Notaris Ekovidolo itu, hanya memberitahukansepihakhakolehPTGKKSsaja.Sedangkankewajiban kepada pedagang, nyaris tidak disebutkan dan tidak jelas,” ujarnya. Berdasarkan Undang-Undang No 11 tahun 1999 tentang perlindungan konsumen, lanjut Abubakar didampingi penasehat hukum Persatuan Pedagang Pasar Tradisional Medan (P3TM) Taufik Arief Nasution, SH, perjanjian itu tidak sah dan batal demi hukum karena hanya mengikat sepihak saja, yaitu kepentingan PT. GKKS. “Dalam hal ini Pemko Medan harus bertindak tegas dan segera mencari solusi,” ujarnya. Selain itu, katanya, pedagang juga tidak mendapatkan fasilitas apa yang telah dijanjikan seperti perawatan terhadap pasar yang saat ini sangat memprihatinkan. Padahal, jika mereka telat membayar, perusahaan melakukan penagihan secara kasar. “Pemko harus melihat langsung kondisi pedagang dan segera membatalkan perjanjian antara kedua belah pihak,” ujarnya. (m38)

GHM Peringati Isra Mikraj MEDAN (Waspada): Manajemen Griya Hotel Medan (GHM) dan karyawan menggelar acara memperingati Isra Mikraj Nabi Besar Muhammad SAW, Senin (20/7), dan memberi santunan serta bantuan sembako pada puluhan anak yatim maupun fakir miskin di halaman parkir hotel itu. Presiden Direktur Griya Hotel Medan Robert Hutahean dalam sambutannya mengatakan, antara lain, pelaksanaan kegiatan harihari besar keagamaan yang dipadu dengan pemberian bantuan kepada masyarakat sekitar menjadi agenda rutin dan sebagai bentuk kepedulian. “Saya memang berniat, bersama masyarakat untuk maju dan meningkatkan kesejahteraan. Buktinya, sebagian besar karyawan, karyawati dan staf adalah warga Helvetia,” ujarnya. Sementara itu, ustadz H. Syarifuddin dalam tausiyahnya, menceritakan kisah Isra Mikraj Nabi Muhammad SAW, merupakan umat yang dipilih Allah SWT, dengan perjalanan horizontal dari Masjidil Haram ke Masjidil Aqsa dan secara vertikal dari Masjidil Aqsa ke Siratul Muntaha (langit ke tujuh). Perjalanan itu, katanya, dimaknai dengan mendapatkan perintah shalat lima waktu sehari semalam, yang juga melambangkan manusia harus menjadi orang-orang pilihan agar di cintai Allah SWT. Hadir dalam acara itu caleg terpilih DPRD Kota Medan A Hie SH, Ketua Lembaga Dakwah Sumut Buyung Obay, tokoh masyarakat Kota Medan Zulkifli Sunara dan puluhan warga HelvetiaTimur.(m34)

YPI Hikmatul Fadhillah Studi Tour Ke Malaysia MEDAN(Waspada):Gunamemperluaswawasandankesempatan untuk mengetahui konsep pendidikan di negara jiran Malaysia, para guru dan pihakYayasan Pendidikan Islam Hikmatul Fadhillah Jalan Denai Medan, mengadakan studi tour ke berbagai kota di Malaysia awal Juli lalu. Perjalanan ke Pulau Pinang, Kuala Lumpur dan Singapura tersebut berjalan lancar dan mendapat suport dari pihak yayasan, seperti dikatakan KetuaYayasan Hj Hikmatul Fadhillah, MM, kemarin. Dia menyebutkan, perjalanan studi tour bagi para guru ini diharapkan memberikan kontribusi positif dalam mendukung karir mereka sebagai tenaga pendidik. Saat ini, kata Hikmatul Fadhillah, pola pengajaran dan pola asuh kepada siswa perlu ditingkatkan, bukan hanya merujuk kepada kurikulum yang ditetapkan oleh pemerintah, tetapi perlu dampingan lain semisal mengetahui apa yang dilakukan oleh sekolah lain seperti di negara Malaysia. Pilihan Malaysia, sambungnya, sebagai bagian dari rencana kerjasama antara lembaga pendidikan yang dipimpinnya dengan beberapa lembaga perguruan tinggi di Malaysia. “Kami sedang merancang sekolah bertaraf internasional dan akan menjalin kerjasama dengan negara Malaysia. Di samping itu, perjalanan ini sekaligus memberikan penghargaan kepada para guru yang sudah memberikan sumbangsih dan dharma baktinya sebagai tenaga pendidik selama setahun penuh. Sehingga saat dimulainya tahun ajaran baru, 13 Juli lalu, semangat mengajar para guru semakin tinggi,” kata Hikmatul Fadhillah. H Surisno, LC peserta dalam perjalanan itu mengatakan, sebagai guru dan kepala sekolah di yayasan tersebut merasa mendapat perhatian dan pola pikir yayasan yang maju. Sebab, study tour bukan hanyaberjalan-jalanataumelancongsaja,tetapilebihkepadapenilikan atau membuat suatu perbandingan terhadap apa yang dilihat di negara tujuan. Jika pedoman dan pola pikir dalam suatu lembaga pendidikan yang dikunjungi di Kuala Lumpur bisa diterapkan di YPI Hikmatul Fadhillah, tentu hal ini menjadikan gagasan atau ide yang bermanfaat. “Insyaallah apa yang kami dapatkan di sana, akan didiskusikan untuk bisa diterapkan di sekolah tempat kami mengajar,” kata Surisno. (m36)

itu bercampur dengan uap air. Kata Firman, Selasa pagi di beberapa kawasan Medan udara kotor terlihat agak gelap disebabkan ketinggian awan sangat rendahdanmencapai400meter.“Penyebab ini karena sinar matahari pagi tidak terlihat sehingga lama pupus udara kotor,” ujarnya. Dia memperkirakan, kondisi udara di Medan pada siang hari

saatinimasihdiliputiudarapanas yang mencapai angka 34 hingga 35derjatcelcius.Kondisidemikian membuka peluang hujan lebat disertai angin kencang dan petir. Menurut data pada Badan Meteorologi, Klimatologi dan Geofisika (BMKG)Wilayah I Stasiun Bandara Polonia Medan, ke depan hujan-hujan intensitas tinggi bakal terjadi di kawasan

WASPADA

Rabu 22 Juli 2009

SumutmaupunkawasanMedan. Sementara kawasan perairan,terjadigejolakdikawasanpantai barat Sumatera Utara. “Sudah beberapa hari perairan pantai barattidakamanbagiparanelayan untuk tutun ke laut,” ujarnya. Tinggi gelombang laut dari Nias, Aceh Barat hingga ke Pulau Weh Sabang mencapai 2 hingga 3 meter. (m32)

PKL Petisah Ditertibkan MEDAN(Waspada):Puluhan pedagang kaki lima (PKL) Pasar Petisah yang berjualan di tempat terlarang ditertibkan petugas PD Pasar Medan, Selasa (21/7) pagi. Dalam aksi penertiban yang berlangsungamandanterkendali tersebut, petugas penertiban berhasilmengamankansebanyak tiga truk kayu dan berbagai peralatanPKLlainnyayangdigunakan untuk berjualan. Menurut Kepala Pasar Petisah, M Salim Lubis, didampingi KepalaCabangII,AsnelHasibuan, SH dan Kepala Penertiban, Firman Sinaga, aksi penertiban yang menggunakan puluhan petugas itu dilakukan pagi. “Tindakan dilakukan di pagi hari sebelum para PKL datang yang biasanya sekira pukul 11, guna menghindarkan timbulnya hal-hal yang tidak diinginkan antara petugas penertiban dengan

pedagang,” ujarnya. Sebelumnya, pihak PD Pasar telah melakukan sosialisasi kepada para PKL agar tidak berjualan di tempat-tempat terlarang, baik melalui surat edaran dan himbauan secara persuasif yang dilakukan selama beberapa hari. Kata Salim, penertiban di Pasar Petisah dilakukan secara bertahap, yang saat ini dilakukan di halaman lantai I tahap I hingga radius beberapa puluh meter di luarpasar,kemudian akandilakukan penertiban terhadap PKL di lantai I tahap II dan dalam pasar. Dariaksipenertibanitu,petugas berhasil menyita sebanyak tiga truk kayu dan berbagai peralatanPKLlainnyayangdigunakan untuk berjualan pada hari biasa. Penertibandilakukangunamelindungi usaha pedagang formal agar mampu membayar kontribusi, sebutnya.

Pusat Pasar Sementara itu, Direktur Operasional PD Pasar Medan, Martua Simanungkalit, mengatakan, penertiban tersebut merupakan rutinitas yang selalu dilakukan pihaknya untuk melindungi pedagang resmi. Setelah menertibkan Pasar Petisah, aksi ituakandilanjutkankePusatPasar yang saat ini masih dalam tahap evaluasi di lapangan, sebutnya. Pantauan Waspada di Pusat Pasar banyak PKL tumbuh mulai dari lantai I hingga ke lantai II khususnya di sekitar tangga dan pintu masuk serta ke enam kawasan taman yang ada di dalam pasar itu. Banyaknya PKL tersebut sepertinya dilindungi oknumoknum tertentu baik dari pihak pedagang dan PD Pasar sendiri. Akibatnya, pasar terbesar yang dihuni 2500 pedagang lebih itu jadi kumuh dan jorok.(m40)

Ujian SMPTN Ekstensi Unimed Lancar MEDAN (Waspada): Pelaksanaan jian Seleksi Masuk Perguruan Tinggi (SMPTN) tahun 2009 untuk jalur ekstensi dan mandiri di Universitas Negeri Medan (Unimed)padaharipertamaSelasa (21/7), berjalan lancar. Sekretaris Panitia SMPTN Unimed,BinerAmbarita,mengatakan, pelaksanaan ujian untuk program ekstensi dan mandiri ini diikuti sekitar 9.573 peserta dengan rincian kelompok IPA 1.824, IPS: 5.318 dan IPC: 2.431. Ambarita menyebutkan, pesertayangmengikutiseleksiuntuk jalur ekstensi dan mandiri ini mengalami peningkatan yang cukup signifikan dari tahun sebelumnya yang berjumlah 6.137 pendaftar, sedangkan tahun ini meningkat sekira 50 persen lebih. “Hal ini menunjukkan peningkatan kepercayaan masyarakatkepadaUnimed,sehinggakita berusaha memberikan pelayanan maksimal untuk penyelenggaraan ujian ini dengan meminjamruangujiankeuniversitaslain,” kata Biner. Dijelaskannya, dalam pelaksanaanujianekstensidanmandiri ini, Unimed menyiapkan 319 ruangan yang tersebar di empat lokasi itu sebagai tempat ujian dan mengerahkan sebanyak 638 orang pengawas. Keempat lokasi ujiantersebutyakniUnimed,IAIN Sumut, Universitas Medan Area (UMA) dan Universitas Amir Hamzah. Ujian jalur ekstensi ini dilaksanakan selama dua hari, materi ujian pada hari pertama

Selasa (21/7) Tes Potensi Akademik dan Tes Bidang Studi Dasar, terdiri dari Matematika, Bahasa Indonesia dan Bahasa Inggris. Hari kedua Rabu (22/7), materi yang akan diujikan Tes Bidang Studi IPA dan IPS. Mengenai daya tampung mahasiswa Unimed melalui program ekstensi ini, Biner menjelaskan masih akan menunggu laporan dari tiap prodi untuk menerima mahasiswanya. “Jumlahnya belum pasti karena, masih menunggu masing-masing prodi memberikan laporan daya tampungnya,” kata Biner. Sementara itu Seksi Pengamanan ujian Drs. M. Ismail Susilo didampingi Kepala sekuriti UnimedRusli,menyebutkan,untuk pengamanan ujian ini, Unimed bekerjasama dengan pihak

kepolisian yang menurunkan 28 personel, resimen mahasiswa 38 orang, Satpam 49 orang dan PengamananTertutup sebanyak 27 orang. Ismail menjelaskan, untuk pengamanan tertutup ini terdiri dari dosen yang bertugas membantu pelaksanaan ujian juga mengawasi dan menangkap apabila ada peserta yang melakukan kecurangan-kecurangan dalam proses ujian berlangsung. “Jika ditemukan ada peserta yang melakukan kecurangan, petugas pengamanan tertutup ini akan langsung menangkapnya dan menyerahkannya kepada pihak kepolisian untuk memprosesnya,karenadianggap telah melanggar peraturan dan UU yang telah ditetapkan,” ujarnya. (m41)

Waspada/Sugiarto

TINJAU: Sekretaris Panitia SMPTN Unimed, Biner Ambarita tinjau pelaksanaan ujian hari pertama, Selasa (21/7) di gedung Serbaguna Unimed.

Sepeda Motor Tubrukan, Dua Luka-luka MEDAN(Waspada):Duapria masing-masing mengendarai sepeda motor bertubrukan dan menghantam betor di simpang empat depan kantor Harian Waspada Jalan Letjen Suprapto Medan, Senin (20/7) malam. Akibat tubrukan itu, kedua pengendara sepeda motor mengalami luka-luka yakni Ifan, 22, (mahasiswa) warga Aceh yang kost di Medan dan seorang pengendara lagi WNI turunan Tionghoabelumdiketahuinamanya, disebut-sebut dia dilarikan ke rumah sakit untuk menjalani perobatan, tapi ada juga mengatakan melarikan diri. Sementara Daniel, pengemudi betor, tidak

mengalami cedera. Petugas Satlantas Poltabes Medan bekerjasama dengan petugas Patra Brimobdasu turun ke lokasi tubrukan melakukan olah TKP dan mengamankan kedua kenderaan yang tubrukan Suzuki Kawasaki (Ninja) BK 6002 BQ (milik Ifan),Yamaha Scorpio BK 3540 FY (milik pengendaraan yang tidak diketahui namanya) warga Medan dan beca bermotor (betor) BK 1981 BK (plat kuning). Saksi mata kepada Waspada di TKP mengatakan, tubrukan itu membuat suasana di lokasi sedikitmengganguaruslalulintas. Awalnya,IfanmengendaraiSuzuki Kawasaki datang dari arah Jalan

Hj. Ani Idrus menuju Jalan Suprapto, namun di persimpangan jalan itu diduga pengendara Yamaha Scorpio yang datang dari Jl. Brigjen Katamso menuju Jl. Pemuda menerobos lampu merah trafficlight sehingga terjadi tubrukan. Akibatnya, kedua pengendara itu terjatuh ke aspal dan salah satu sepeda motor menghantam betor yang datang dari Jl Suprapto. Kasatlantas Poltabes Medan, Kompol Sabilul Alif, SH,SIK kepada Waspada mengatakan, pihaknya telah menangani kasus tubrukan tersebut dengan mengamankan kedua sepeda motor ke kantor Satlantas. (m31)

Waspada/Ismanto Ismail

LUKA-LUKA: Warga melihat dua korban menderita luka-luka dan satu diantaranya terduduk lemas di aspal meringis kesakitan akibat tubrukan di simpang empat depan Harian Waspada Jalan Letjen Suprapto Medan, Senin (20/7) malam.

Waspada/Ist

JAMBORE: Ketua TP PKK Provsu Ny Fatimah Habibi Syamsul Arifin bersama peserta Jambore Anak, serangkaian peringatan Hari Anak Nasional, Senin (20/7) di Bumi Perkemahan Sibolangit.

Globalisasi Dunia Menyimpan Dampak Negatif Bagi Anak MEDAN (Waspada): Setiap orang tua pasti merasa bersyukur dan bangga jika anak-anaknya dapatmenjadianakyangberguna bagi nusa, bangsa dan negara serta agamanya. Kesemuanya itu tentu beranjakdaripembinaan dan pengasuhananakdidalamkeluarga.Pembinaan penting dilakukan mengingat situasi dan kondisi zaman sekarang perlu perhatian serius. “Dampak perkembangan globalisasi dunia yang memberi manfaat kemudahan bagi manusia, juga menyimpan dampak negatif bagi perkembangan dan tingkah laku anak-anak,” ujar KetuaTP PKK Provsu, Ny Fatimah Habibi Syamsul Arifin, ketika membuka Jambore Anak dalam rangkaian peringatan Hari Anak Nasional (HAN) 2009 di bumi perkemahaan PTPN II Sibolangit, Senin (20/7).

Karenanya,lanjutNyFatimah Habibi, anak anak wajib dilindungi dari berbagai bahaya yang ditimbulkan seperti pornografi, pergaulan bebas yang menyebabkan rusaknya kesehatan reproduksi, penyalahgunaan Narkoba, penyebaran virus HIV/ AIDS, pernikahan dini dan sebagainya yang kesemuanya itu berawal dari kurang dekatnya hubungan komunikasi antara orangtua dan anak-anak. Istri Gubsu itu menyebutkan, penyelenggaraan Hari Anak Nasional tahun 2009 diharapkan mampu mendorong dan menumbuhkan kesadaran orang tua, keluarga, masyarakat, dunia usahadanpemerintahuntukmeningkatkan upaya pemerataan, perluasandanpeningkatanmutu kehidupan anak yang dapat menghantarkan agar anak Indonesia menjadi anak yang terlin-

dungidanterpenuhiakanhaknya. Ny Fatimah juga mengingatkan anak-anak terhadap pesan Gubsu untuk anak-anak Sumut yakni jujur pada diri sendiri, niat, doa, usaha, sungguh-sungguh, ikhlas dan jangan durhaka pada orang tua. Jambore anak yang berlangsung 19-20 Juli itu diikuti 350 anak daritingkatSD,SMPhinggaSMU. Berbagai kegiatan dilakukan untuk membangkitkan inovasi dan kreativitas anak, di antaranya lomba melukis dan mewarnai, outbond dan menanam pohon, juga ceramah tentang kesehatan. Hadir dalam kesempatan itu Kadis Kesehatan Provsu, dr Chandra Syafei SpOg, Kepala Bapemmas, H Rusli, Kabiro Binsos, Hasbullah Lubis, Kabiro Perlengkapan, Bondaharo dan Kepala Baperasda, Drs Syaiful Syafri.(m19)

60 Persen Korban Konflik Tamiang Belum Terima Bantuan MEDAN (Waspada): Sekitar 60 persen korban konflik di Seruway, Aceh Tamiang, masih belum mendapatkan bantuan dana kesejahteraan dana konflik. Mereka meminta bantuan Lumbung Informasi Rakyat (LIRA) untuk mengadukan hal tersebut ke presiden SBY. “Masih banyak masyarakat AcehTamiang yang belum mendapatkan bantuan korban konflik kemarin. Padahal, seluruh persyaratansudahkamipenuhi,”kata salah seorang warga, TeukuYusrianto,kepadawartawandiGraha LIRA Sumut, Selasa (21/7). Yusrianto menyebutkan, mereka juga akan menyerahkan bukti-bukti permohonan bantu-

an sesuai perintah BRA, seperti surat keterangan cacat fisik dari kecamatan, puskesmas, Kodim setempat. Serta foto sejumlah korban yang tidak dapat bantuan perumahan. “PadahalsesuaiperintahBRA pada 26 Februari 2009, kami sudah mengajukan, namun sampai sekarang tidak jelas. Padahal, korban cacat fisik setahu kami seharusnya mendapat bantuan Rp10 juta, serta bantuan perumahan,” katanya. Menanggapi laporan masyarakat Aceh Tamiang tersebut, Gubernur LIRA Sumut, Hendrik Halomoan Sitompul mengatakan, akan segera menyampaikan persoalan tersebut ke Presiden

SBY. “Tanggal 27 Juli nanti LIRA akan mengadakan pertemuan dengan Presiden di Pacitan, Jawa Timur. Kita akan laporkan langsung dalam pertemuan itu. Kita yakin presiden pasti belum tahu masalah ini,” katanya. Hendrik mengatakan, SBY pasti akan langsung menindaklanjuti laporan masyarakat Aceh Tamiang tersebut. Apalagi dalam Pilpres kemarin, dia mendapat dukungan 90 persen di NAD. “Kita sangat prihatin melihat kondisi mereka. Kita yakin SBY juga pasti akan langsung menindaklanjuti ini, apalagi dia m e n a n g t e l a k d i A c e h ,” katanya.(h11)

Hasnil Basri Kembali Pimpin Gafeksi Sumut MEDAN (Waspada) : Prof. H. Hasnil Basri Siregar, SH, terpilih kembali menjadi Ketua DPW Gafeksi/Infa Sumut 20092014 dalam Muswil IV di Balai Citra Hotel Tiara, Sabtu (18/7). Dalam siaran pers ke Waspada, Selasa (21/7), susunan pengurus lengkap DPW Gafeksi/Infa yaitu muatan kapal udara dan laut antara lain Ketua umum DPW Prof H. Hasnil Basri, SH, Wakil Ketua Rizal M. Riswan dan Drs H. Khairul Mahalli. SementaraSekretarisUmum, Waluyo Hartono, Sekretaris Eksekutif, Siti Suciwati. Bendahara, DajasdiDjalil.KetuaBidangOrganisasi/Hukum, Ramdan Damir, SH, Ketua Bidang Pengembangan/Diklat, A Ismail, Ketua Bidang Darat/Laut, Udara dan Sungai,Heru Asfrid, Ketua Bidang Kepabeanan/Tariff,Suryanto,dan

Ketua Bidang Kepelabuhan/ Petikemas, Sabar Marpaung. Sementara itu Administratur Pelabuhan (Adpel) Belawan, Rusman Hoesein, menyatakan, pihaknya semakin memperketat pengawasanPelabuhanBelawan, pascaledakanbomdiJWMarriott dan Rits Carlton Jakarta. Dia terus menjalin kerjasama dengan institusi terkait untuk memperketat pengawasan pelabuhan, katanya, saat menyampaikan sambutan pada pembukaan Muswil IV Gabungan Forwarder Ekspedisi Seluruh Indonesia (Gafeksi)/Infra. Rusman menyebutkan, sejak 1 Juli 2009 sudah dibuat sistim pengawasan dan pengamanan terpadu di pelabuhan. Namun, dia meminta kepada pengguna jasaagardapatmempertahankan stabilitaspelabuhandidaerahini..

Adpel Belawan juga minta agar pimpinan Gafeksi/Infra terpilih, kedepan dapat mempertahankanEkspedisiMuatanKapal Laut (RMKL), sementara yang kecil-kecil jangan dimatikan, katanya, dihadapan 152 peserta Muswil tersebut. Ketua Umum DPP Gafeksi/ Infra, Iskandar Zulkarnain, menyebutkan, ditingkat wilayah DPWGafeksi/Inframenjadimitra strategis bagi pemerintah daerah, maupun Bea dan Cukai, Adpel dan instansi terkait. Namun, dia menilai, di kancah internasional Gafeksi berpartisipasi aktif dengan berbagai asosiasi internasional seperti penyedia jasa logistik se Asean (AFFA), FIATA, FAPAA, AFFA, Unescaptermasukdengankomisi PBB bidang ekonomi dan sosial kawasan Asia Pasifik. (m32)

Guru Dan Kepsek Jadi Agen Perubahan MEDAN (Waspada) : Guru dan kepala sekolah harus mampu menjadi agen perubahan dalam rangka memenej sekolah dan membuat berbagai kebijakan yang mampu mengembangkan sekolah menuju masa keemasan. Demikian Drs Sofyan Alwi, M.Hum sepulang mengikuti program manajemen leadership kerjasama Dirjen PMTK dengan Nanyang University Singapura, berlangsung 22 s/ d 7 Juli lalu di Singapura. Disebutkannya, perubahan yang dilakukan tidak terlepas dari konsep kepemimpinan yang dimiliki oleh kepala sekolah, demikian juga para guru yang harus melakukan perubahan pada dirinya sendiri setelah itu menularkan kepada siswa dan masyarakat di lingkungannya. “Jangan pernah berpikir,

mengapa harus kita yang melakukan sedangkan orang lain belum tentu mau melakukan. Yang benar adalah, merubah diri sendiri dengan hal-hal positif dan yakin bahwa hal ini akan membuat sesuatu lebih baik dan akan diikuti oleh orang lain,” katanya. Menurutnya, negara maju seperti Singapura lebih dahulu membina dan memenej manusia yang sadar akan perubahan, sehingga mereka taat kepada berbagai peraturan dan menyadari bahwa peraturan itu merupakan kunci dari penegakan hukum. Bila semua orang sadar dan taat kepada hukum, maka perubahan sekecil apapun bisa disikapi dengan sempurna oleh masyarakat. “Disinilah pentingnya guru dan kepala sekolah menjadi contoh dari perubahan itu, Apalagi, seiring kemajuan zaman yang

banyak mengalami perubahan, akan mampu disikapi dengan arif sesuai dengan kosekwensi menghadapi perubahan itu. Ternyata Singapura maju, karena SDMnya mempunyai kesadaran dengan menjalankan berbagai peraturan dan hukum yang berlaku, karena mereka semua telah membuka diri untuk menjadi manajer perubahan bagi dirinya sendiri dan biarkan orang lain mengikutinya,” katanya. Sofyan berharap berbagai upaya yang dicanangkan pemerintah dalam rangka memperbaiki mutu pendidikan di Indonesia tidak terlepas dari peran dan kemampuan para kepala sekolah dan guru yang mampu melakukan gerakan perubahan. Di samping menempatkan kepala sekolah yang mempunyai ilmu dan kemampuan sebagai seorang pemimpin. (m36)


Medan Metropolitan

WASPADA Rabu 22 Juli 2009

11

Kinerja Kadishub Sumut Sangat Mengecewakan Truk Kelebihan Muatan Leluasa Melintas MEDAN (Waspada): Sejumlah anggota DPRDSU menilai kinerja Dinas Perhubungan (Dishub) Pemprovsu sangat mengecewakan dan gagal menjalankan tugas sesuai tupoksi (tugas pokok dan fungsi). Bahkan, akibat jeleknya kinerja dinas tersebut, jalan di sejumlah daerah di Sumut, rusak karena truk-truk yang kelebihan muatan bebas melintas. Anggota DPRDSU Fraksi PDI Perjuangan, Isrok Anshari Siregar, kepada Waspada, Selasa (21/7), mengatakan, berdasarkan kunjungan kerja yang dilakukannya bersama tim DPRDSU dari DapemVI (Tapsel, Madina, Palas dan Kabupaten Paluta serta Kota Padang Sidempuan), mereka mendapati banyak jalan rusak karena dilintasi truk kelebihan muatan. Hal itu, kata Isrok, terjadi karenafungsipengawasanDishub terhadap kendaraan angkutan barang pada UPPKB Jembatan Timbang tidak berjalan sebagai-

mana mestinya. Kenderaan yang lewat melebihi 40-60 ton, sama sekali tidak dibongkar sesuai Perda Sumut. Isrok Anshari menyebut contohjalannegaradanjalanprovinsi sepanjang kurang lebih 70 kilometer dari Pall XI ke Aek GodangGunung Tua hingga batas Kabupaten Labuhan Batu yang rusak parah karena setiap hari dilewati truk-truk kelebihan tonase. “Bahkan ketika kita mendatangi jembatan timbang di Pall XI. Layar LCD pengukur muatan langsung mati ketika sebuah truk besar memasuki jembatan

Freedom Bantu Anak Panti Asuhan MEDAN (Waspada): Perkumpulan anak muda Kota Medan bernama Freedom memberikan bantuan berupa sembako dan sejumlah uang kepada anak Panti Asuhan Kasih Indonesia di Jalan Danau Ranau Medan, Senin (20/7). Selain menyerahkan bantuan sembako dan sejumlah uang, mereka juga mengajak anak-anak panti untuk makan siang bersama. Anak-anak juga dihibur dengan aksi sulap salah seorang anggota Freedom yang sekaligus membagi-bagikan berbagai hadiah kepada masing-masing anak. “Ini adalah wujud kepedulian kita kepada sesama khususnya anak yatim dan yatim piatu,” kata Hendy Ong, anggota Freedom. PimpinanPanti AsuhanKasihIndonesia Jhonny S Zebua mengaku kagum dengan kepedulian sosial yang diwujudkan anggota Freedom. “Bantuan yang telah diberikan akan sangat bermanfaat,” ujarnya. Diamenjelaskan,berdirinyaPantiAsuhanKasihIndonesiaawalnya untuk menampung anak-anak korban gempa di Nias. Dari 86 anak yang disantuni, sebagian besar adalah korban gempa Nias yang orangtuanya menjadi korban. (m41)

Kepling Diminta Data Warga Pendatang MEDAN (Waspada): Kepling diinstruksikan untuk mendata dan melaporkan setiap penduduk yang datang maupun yang pindah, terutama bagi mahasiswa, kalangan pegawai maupun masyarakat umum. Lurah Sei Kera Hilir I Subianto telah berinisiatif memberlakukan kebijakan itu kepada keplingnya, kemarin, menanggapi razia tim gabungan unsur Muspika Kecamatan Medan Perjuangan terhadap penghuni kost maupun tamu-tamu yang masuk tanpa batas waktu dan urusan yang jelas. Secara terpisah Lurah Sei Kera Hilir II Vianti Dewi Nasution mengatakan, pihaknya telah menyahuti dan menindaklanjuti instruksi Camat Medan Perjuangan Syaifuddin Harahap Sementara itu, warga Jalan Perkasa Kelurahan Pahlawan Kec. Medan Perjuangan merasa resah dengan banyaknya tempat kost serta tamu yang masuk ke rumah penduduk tanpa batas waktu tanpa dan urusan yang jelas. KeplingIIKel.Pahlawan,AmatSayuti,mengakuiadanyakeresahan warga itu. Pasalnya, para pendatang khususnya di Jalan Perkasa terdiri dari mahasiswa, pekerja maupun masyarakat umum masih banyak yang tidak melaporkan. (m25)

Penumpang Betor Dirampok MEDAN (Waspada): Dua pelaku menggendaraiYamaha RX King merampok tas penumpang betor bernama Dona Br Harahap, 35, di perempatan lampu merah Jalan Monginsidi-Kapt. Pattimura, Senin (20/7) siang. Saksi kepada Waspada mengatakan, tas korban ditarik pelaku dari sebelah kanan betor BK 1157 PA yang melaju dari simpang Jalan Setiabudi hendak menuju rumahnya di Jalan Jaya, Seksama Medan. Pengemudi betor sempat mengejar pelaku namun tidak berhasil. Pengakuan pengemudi betor, dia sempat mencatat nomor polisi kendaraan pelaku dan mengetahui ciri-cirinya. Pelaku memakai jaket warna hitam dan yang dibonceng memakai jaket hitam les merah lengkap dengan helm. Dalam kasus ini, korban menderita kerugian berupa handphone, uang Rp500 ribu, kunci sepeda motor dan surat berharga lainnya. Kapolsekta Medan Baru AKP M Adenan AS,SH,SIK mendapat laporan kejadian itu, langsung menurunkan personelnya. Namun pelakunya belum tertangkap. (m31)

Ibu Rumah Tangga Jurtul Togel Ditangkap MEDAN (Waspada): Dua orang juru tulis togel di Jalan Tirtosari Medan Tembung dan Jalan Gurilla Gg Kartawi Medan Perjuangan diringkus petugas dari Polsekta Percut Seituan, Senin (20/7) malam. Dari kedua tersangka: Hariani alias Gendut, 36, warga Jalan Tirtosari Gang Sentosa dan Asrianto, 45, warga Jalan Gurilla Medan, petugas menyita uang Rp88.000, pulpen dan beberapa lembar kertas rekap berisi nomor-nomor tebakan. Kapolsekta Percut Seituan AKP Edi Bona Sinaga menyebutkan, Hariani alias Gendut dan Asrianto ditangkap secara terpisah. Hasriani sebagai ibu rumah tangga itu ditangkap ketika sedang menulis nomornomor tebakan di Jalan Tirtosari. Ibu rumah tangga ini tidak menyadari petugas telah menyaru membeli togelnya. Sedangkan Asrianto ditangkap ketika hendak mengantar rekap ke bandar togel. Usai menulis rekap, tersangka beranjak dari warung dan mengantar rekap, polisi langsung menyergapnya. (cat)

timbang. Seorang petugas di sana mengakui LCD itu mati karena takmampulagimencatatmuatan truk yang berlebih,” jelasnya. Bahkan, kata Isrok, banyak jalan-jalan yang baru selesai dibangun namun keadaannya sudah ‘kupak-kapik’. Contoh nyata jalan di areal hutan Nabundong di Paluta yang hancur total, padahal baru selesai dibangun tahun 2007. Selain lemah dalam bidang

pengwasan, kata Isrok, Dishub juga tidak becus menangani proyek-proyek APBD tahun anggaran 2008. Bahkan, ketika tim DPRDSU Dapem VI hendak meninjau sejumlah proyek, tidak seorangpunpegawaiDishubyang berani mendampingi tim. “Ada lima proyek APBD Sumut yang maukitatinjaudisitu,namunbatal karena tidak ada yang mendampingi.Kitamendugaadayangtidak beres dengan proyek-proyek itu,”

kata Isrok Anshari. Kondisi serupa juga disampaikan anggota DPRDSU dari Dapil X Tanah Karo, Edison Sianturi yang mengatakan banyak jalannegarayangmenghubungkan dengandengankabupatensekitar dan Aceh yang hancur karena banyaknya truk kelebihan muatan yang melintas. “Seharusnya itutugasDishubuntukmengawasi kendaraan yang melintasi melewati tonase,” katanya. (h11)

Polisi Sita Kayu Ilegal Asal Riau Ditutupi Barang Elektronik MEDAN (Waspada): Polsekta Medan Sunggal mengamankan tiga tersangka terlibat pembalakan liar di kawasan Riau dengan hasil 298 kayu broti dan papan damar seberat 7 ton. Selain tiga tersangka Fzl, 28, (sopir) dan HS, 32, (kernet) resmi ditahan dan satu lagi tersangka Af belum ditahan karena masih dalampemeriksaan,polisimenyita barang bukti truk Mitsubhisi Fuso BK 8192 BA yang digunakan mengangkut kayu-kayu ilegal itu. Sedangkanpemilikkayuberinisial Om warga Riau masuk daftar pencarian orang (DPO). Kapolsekta Medan Sunggal AKP Faisal F Napitupulu kepada

Waspada, Selasa (21/7), mengatakan, selain telah memeriksa tersangka, pihaknya sudah melakukan pemeriksaan dua orangdariDinasKehutanansebagai saksi ahli dan saksi lainnya. “Kita mulai dalam proses pemberkasan Berita Acara Pemeriksaan (BAP). Diharapkan pekan ini berkasnya sudah bisa diajukan ke JPU,” ujarnya. Kasus ini terkuak, Jumat (26/ 6) dinihari pukul 02.00, ketika personelnyasedangmelancarkan patroli melihat truk Fuso mengangkutbarangsampaimenjulang tinggimelintasiJalanBungaCempaka XIV Kelurahan PB Selayang II Kecamatan Medan Selayang.

Petugas menyetop truk itu. Sopir dan kernet hanya bisa memperlihatkan dokumen elektronik dan tidak bisa memperlihatkan dokumen kayu tersebut. Sopir, kernetdanbarangbuktidiboyong ke Mapolsekta Medan Sunggal. Untukmengelabuipetugas,kayukayu itu disusun paling bawah. Di atasnya terdapat 171 barang elektronik; mesin cuci dan telivisi. Sopirdankernetmengatakan barang elektronik itu resmi milik PT Elektronik Kencana yang dibawa dari Jakarta melalui ekspedisi Sentral Jakarta tujuan ekspedisi Sentral di Tembung, Percut Seituan Kabupaten Deli Serdang. (m31)

Sekali Bersin Pasien Flu Babi Sebarkan 100 Ribu Virus MEDAN(Waspada):Kebiasaan masyarakat awam yang tidak menutup mulut atau hidung ketika bersin dan batuk, akan berdampak kepada orang-orang disekelilingnya.Apalagi,jikaorang yang batuk atau bersin tersebut mengidap suatu penyakit seperti flubabi,tentuakancepatmenular kepada orang lain. “Untuk sekali bersin saja, pasien flu babi bisa menyebarkan 100 ribu virus ke udara. Karena itu, pasien flu babi harus dirawat diruangisolasi,”kataKepalaPusat Promosi Kesehatan Depkes RI, dr. Abidinsyah Siregar, DHSM, MKes kepada Waspada, Sabtu (18/7). Abidinsyah mengakui, masyarakatIndonesiaumumnya belum menerapkan Perilaku Hidup Bersih dan Sehat (PHBS) dalam kehidupan sehari-hari. Misalnya, tidak menutup hidung atau mulut ketika batuk dan ber-

sin, tidak mencuci tangan pakai sabun sebelum makan dan lainlain. Hasil riset kesehatan masyarakat dasar yang dilakukan Lembaga Penelitian dan Pengembangan Depkes RI tahun 2007 dan dipublikasikan pada 2008, PHBS masih relatif rendah yakni 31 persen. Artinya, hanya 31 dari 100 orang yang menerapkan PHBS termasuk olahraga teratur, mengkonsumsimakananbergizi,cukup minum, cuci tangan pakai sabun, tidak merokok di dalam rumah, menjaga kesehatan fisik dan lainlain. Sementara, target Depkes RI seharusnya sudah mencapai angka 59 persen. Jadi, pada tahun yang telah ditetapkan seharusnya sudahmencapai59persen,hanya sebatas angka 31 persen. Kondisi ini mengharuskan Depkes RI berjuang lebih keras untuk meningkatkan PHBS.

“Ini merupakan entry point yang kritis untuk kasus H1N1 di Indonesia. Sebab, pada saat yang sama PHBS masih kurang diperhatikan. Sementara, kesempatan virus ini untuk merebak, justru pada kelompok masyarakat yang kurang memperhatikan PHBS,” ujar Abidinsyah. Mengingat masih rendahnya PHBS di kalangan masyarakat, Abidinsyah mengimbau masyarakat agar mewaspadai penyakit flu babi. “Jika demam, apapun alasan demamnya, sebaiknya tidak meninggalkanrumah.Kalauanak sekolah atau pegawai, sebaiknya tidak bekerja selama lima hari. Selama dalam masa istirahat mengkonsumsimakananbergizi, cukup air dan memelihara jarak kontak dengan orang lain setidaknya lebih dari satu meter. Ini kebijakan Depkes RI,” tambahnya.(m26)

Delapan Rider Vega ZR Bertolak Ke Aceh MEDAN(Waspada):Delapan motorrombongantouringPetualanganVega ZR X-Tream berangkat dari markas besar, Medan untuk selanjutnyamenujuBanda Aceh. Keberangkatan tim kecil ini dilepas langsung Promotion & Motorsports Div Manager PT Alfa Scorpii, Yong Ting Lee, di kolam pancing Bison, Delitua. Kedelapan punggawa PetualanganVega ZR X-Trem tersebut adalah BroWilli (Ketua), Jimy Jeiraz, Kamto, Sriono, Abdee, Andra, Agus, dan Edo. Puluhan anggota klub otomotif binaan PT Alfa Scorpii diantaranya JMC, JMX Club, JRC, Yamaha Vixion Club, Mio Automatic Club, Scorpio Club Medan, melepas keberangkatan para petualangan, Sabtu (18/7). Setelah bersalamsalaman, rombongan langsung menuju Subussalam, Aceh. Perjalanan Medan-Subussalam memakan waktu 6,5 jam karena harus mengatasi derasnya hujan. Perjalanan tandem touring sekaligus menguji suspensi untuk kestabilan di segala kondisi, baik sendiri ataupun berboncengan di segala medan panas, hujan, macet, tanjakan, jalanan berlubang dan berkelok. Rombongan tiba di Subussalam setelah se-

tengah perjalanan didera hujan lebat dan kemacetan yang tidak mudah diurai, seluruh peserta hampir tidak ada yang merasa lelah karena didukung oleh performaVega ZR yang ringan, stabil, akselerasi bagus dan nyaman. Rombongan langsung menuju Multi Wahana Perkasa (MWP)Penanggahan,kotaSubussalam, dan disambut pimpinannya, Sarmo Kaloko. Selama istirahat di halaman show room ini, tim petualanganVegaZRmenjadi pusat perhatian masyarakat karena penasaran dengan Vega ZR yang sudah ditunggu-tunggu. Dalam touring ini terjawab rasa penasaran tim PetualanganVega ZRX-Tream.Perbedaankapasitas mesin yang hanya 5cc tak begitu terasa signifikan. Seperti yang dirasakan ketua tim, Bro Willi. Ketika mencoba di trek lurus sepanjang 1,5 km, ia merasakan hentakan tenaga ditiap gigi yang terasa halus. Tidak terlalu menyentak namun cukup bertenaga. Di speedometer gigi satu menyentuh angka 45 km/ jam, gigi dua sampai 65 km/jam. Tiga ada di 85km/jam dan top speed untuk trek sepanjang itu menyentuh angka 105 km/jam lebihsedikit.Akselerasijugacukup

baik. Dari 0 sampai 60 km/jam hanya ditempuh dalam waktu 6,8 detik. Sedang untuk jarak 402 meter ditempuh dengan waktu 22,9 detik. Mengenai bahan bakar, YamahaVega ZR mampu berlari sejauh 47 km dengan satu liter bensin. Konsumsi BBM tersebut didapat dengan kecepatan tak lebihdari60km/jam.Kesimpulan yang diambil tim Petualangan Vega ZR X-Tream ketika melewati jalan yang sangat sepi sehingga putaranmesinbisaselalukonstan. Rasanya tak ada yang protes bila konsumsi bahan bakar Vega ZR tergolong irit. Lebih lanjut Bro Willi mengungkapkan, di ruas jalan MedanSubussalam sangat beragam, bahkan tidak jarang ditemui jalan yang berlobang. Pada saat hujan turun kondisinya berlumpur, namun jika kering debu-debu banyak beterbangan. Jalan juga berliku-liku sehingga menuntut konsentrasi penuh. Jalanan ini melewatikawasanhutan.“Dengan ditaklukannya jalur ini, membuktikanVega ZR memang cocok untuk masyarakat Indonesia . Sebab di semua jalan Vega ZR, mampu mengatasinya,” sambung Bro Willi. (h09)

Karyawan Koperasi Dirampok MEDAN (Waspada): Dua pria tak dikenal merampok seorang pegawai koperasi di Jalan STM Kanal, Sabtu (18/7) sekira pk 13:00. Akibatnya, korban Iwan Balaloe, 26, warga Jalan MentengVII, Medan Denai, mengalami kerugian Rp7 juta. Informasi yang diperoleh di kepolisian menyebutkan, sekira pk 13:00, korban yang berprofesi sebagai karyawan koperasi mengendarai sepeda motor Supra melintas di kawasan Jalan STM Kanal. Persis di lokasi yang agak sepi, tiba-tiba korban distop dua pria yang mengenakan seragam dinas warna hijau dan berambut cepak. Salahseorangdiantaranyamengakusebagaipetugasdanmeminta identitas korban. Saat korban lengah, seorang diantara pelaku menutup kedua mata korban dengan sarung tangan, sedangkan seorang lagi menyikat tas berisi uang tunai Rp7 juta milik korban. Setelah korban tak berdaya, pelaku melarikan diri mengendarai sepeda motor Yamaha King. Sadar dirinya dirampok, korban melaporkan peristiwa tersebut ke Polsekta Delitua, sedangkan pelakunya masih diburon. (cat)

Waspada/ist

RAIDER: Para rider Petualangan Yahama Vega ZR X-Tream, yang bertolak ke Aceh.

Waspada/Surya Efendi

TERGENANG: Warga melintas di dekat aspal yang tergenang air di Jl. Arif Rahman Hakim dekat Pasar Sukaramai Medan, Minggu (19/7). Genangan air yang membuat aspal jalan keropos itu karena saluran air di dalam parit tidak tersedia alias tersumbat.

Saksi Kasus Cabul Mengaku Dipaksa Tandatangani BAP MEDAN (Waspada): Dua saksi perkara cabul dengan terdakawa Z Hrp alias Alwi yakni Fahrurroji dan Bayu Suprayogi, siswa kelas IV, Mis AL- Hasanah, mengaku dipaksa untuk menandatangani BAP oleh Syarifuddin alias Udin Badau. Pengakuan kedua saksi tersebut dituangkan dalam sebuah surat pernyatan yang ditandatangani M Ramli Haris, orang tua BayuSuprayogidanZuriah,orang tuakandungFahrurrojisertatelah dilegalisir dihadapan notaris Devi Juliastuti, SH, dengan nomor 215216/ DJ- LEG/VI/ 2009 tertanggal 18 Juni 2009. Dalam surat pernyataan itu disebutkan kalau kedua saksi dibujuk oleh Udin Badau dengan memberikanbomboncoklatagar maujadisaksi.Padahal,keduanya tidak pernah melihat atau me-

nyaksikan perbuatan cabul yang telah dituduhkan terhadap terdakwa Z Hrp alias Alwi. “Jadi keterangan mereka tidak benar dan tidak bisa dijadikan alat bukti karena cacat hukum,” kata S Hasibuan, salah seorang keluarga terdakwa Z Hrp alias Alwi kepada Waspada, Minggu (19/7). Dijelaskan Hasibuan, terdakwa adalah seorang guru sekolah dasardikawasanMedanMarelan. Sekitar bulan Maret 2009, perjalanan karir terdakwa tersandung dan harus berurusan dengan polisi dalam kasus pidana cabul yang dituduhkan dua muridnya Kh, 10, dan LM, 9, warga Kel. Rengas Pulau, Marelan, dalam laporan Polisi No. Pol : LP/ 58/ III/ 2009/ Dit Reskrim, tanggal 02 Maret 2009. “Sejak itu sepupuku ditahan dan sekarang berada di LP Klas I Tanjung Kusta,”

katanyamulaimenceritakannasib terdakwa. Belakangankasusinidipolitisir dan berkembang entah kemanamana. Setelah melalui sejumlah proses pemeriksaan di polisi dan kejaksaan, dua orang saksi yang sebelumnya memberatkan terdakwa mencabut kesaksiannya dan mengaku dipaksa saat memberikan keterangan. “Kalaupun terdakwa melakukan kesalahan janganlah diperbesar entah kemana-mana karena itu penzoliman namanya,” ucapnya. Dia berharap apa yang telah dinyatakan kedua saksi tersebut bisa menjadi bahan pertimbangan hakim yang akan bersidang, Rabu (22/7). “Surat pernyataan ini akan kami ajukan dalam persidangan sebagai bukti baru,” katanya membela terdakwa. (cre)

Teroris Kejahatan Idiologi BELAWAN (Waspada): Teroris yang melanda Indonesia saat ini bukan hanya kejahatan kriminal biasa, tapi merupakan sebuahbentukkejahatanidiologi. Hal itu dikatakan DrHilmy Bakar, MA, MBA, seorang aktifis Islam dan mantan pejuang Afganistan kepada Waspada, Senin (20/7), di Belawan. Menurutnya,pembomanJW Marriott dan Ritz Carlton merupakan buntut dari sebuah pergerakan ummat yang berfaham idiologiagamayangsalah.Selama ini pemberantasan terhadap penganutidiologiyangsalahitutidak pernah dilakukan pemerintah secaratuntas.Sehinggapimpinan dan penganut idiologi yang salah itu telah berkembang dengan mudah di Indonesia. “Jadi akar masalahnya disini, jika ingin memberantasteroris,”kataHilmy tanpa bersedia menyebutkan nama faham idiologi agama yang salah tersebut. Dijelaskannya, pemerintah dalammenanganiterorismetelah membentuk sejumlah satuan khususdiataranyaDensus88Anti Teror dengan biaya miliaran

rupiah. Dalam melaksanakan tugasnya,satuankhususituhanya bertugas untuk mencari pelaku dan indentitasnya telah disebarkan kemana- mana, diantaranya Nurdin M Top Cs. Pemerintah dalam hal ini TNI-Polri seharusnya mencari akar pemasalahan danmengapaorangmaumelakukan bom bunuh diri serta aksi teror di Indonesia. Menurutnya,apayangdilakukan oleh satuan khusus itu akan sia-sia dan tidak memutuskan akar permasalahan. Sebab terorisme bukan kejahatan kriminal biasa tapi merupakan kejahatan idiologi yang salah. Jadi akar masalah terorisme itu adalah pada sebuah kelompok dengan pemahaman idiologi yang salah. “Islam bukan agama teroris, tapi sejumlah orang yang mengaku Islam telah melakukan teror yang merupakan buntut dari pemaham idiologi agama yang salah,” ucapnya. Dikatakannya,sebuahkelompok teror tidak membutuhkan anggota dalam jumlah besar. Sebab tiga orang saja sudah

mampu melakukan sebuah aksi teror yang berkekuatan besar. Umumnya angggota teror itu direkrutdariorangmiskindengan latar belakang pendidikan agama rendah. DidampingiKetuaPresedium Masyarakat Medan Utara (PMMU), Syaharuddin, Hilmy memintapemerintahmengeluarkan aturanmengenaiagamayangboleh tumbuh dan berkembang di Indonesia beserta atuaran sanksi tegas bagi orang atau kelompok yang melanggarnya. Majelis Ulama Indonesia (MUI) selaku pembela kepentingan Islam di Indonesia harus berani mengeluarkanfatwatetangpemahaman sebuah idiologi yang salah. Saat ini aturan mengenai agama di Indonesia ada tapi tidak memililki sanksi yang tegas sehingga menjadi bahan lecehan bagi penganut faham yang salah tersebut. “Sanksinya bisa penjara atau bila perlu dicabut hak kewarganegaraannya,” pungkas Himly yang mengaku telah 20 tahun tinggal di Malaysia dan mengelutisejumlahbisnisdiAceh saat ini. (cre)

Kejatisu Dituntut Usut Dugaan Korupsi Di Dinas PU MEDAN(Waspada):Puluhan massa tergabung dalam Pusat KajianAntiKorupsi(Pukat)Sumut menggelar aksi demo di gedung Kejatisu, Selasa (21/7). Dalam aksi itu, massa Pukat menuntut Kejatisu mengusut dugaan korupsi di Dinas Pekerjaan Umum (PU) Medan senilai ratusan miliar. “Tangkap mantan Kadis PU Medan, RES, terkait kasus dugaan korupsi,” teriak massa menandai aksi mereka di Kejatisu. Selainmenggelarorasi,mereka juga mengusung sejumlah poster yang intinya memper-

tanyakan kinerja Kejari Medan yanghinggasaatinibelummemeriksa mantan Kadis PU Medan. Koordinator aksi, Ali Abubakar, mengatakan, puluhan proyek yang dianggarkan Dinas PU berbau KKN dan banyak pungli sejumlah oknum pejabat PU antara 1 persen sampai 10 persen yang diduga diberikan ke Kadis PU. “Ada proyek bernilai Rp100 juta, tapi karena banyak mulut menganga yang harus disumpal dengan rupiah-rupiah, maka pengerjaannya hanya bisa teralisasi Rp30 juta, “ teriak Abubakar.

Dipenghujungaksinya,massa Pukat menyampaikan pernyataan sikapnya, tahan mantan Kadis PU Medan yang saat ini Kadis Pengairan. Menolak RES menjadi Kadis Pengairan Sumut. MemintaBPKPmenghitungkerugian negara akibat proyek di PU. Selain itu, meminta Gubsu mencopot Kadis Pengairan Sumut. Jika tuntutan mereka tidak ditanggapi, massa Pukat akan menggelar aksi di Jakarta. Hingga akhir aksi, tidak ada seorangpun pejabat dari Kejatisu yang menerima kehadiran massa Pukat. (h05)

Hukum Berat Pembunuh Ketua DPRDSU MEDAN(Waspada):Jam’iyah Batak Muslim Indonesia (JBMI) minta hakim menjatuhkan hukuman seberat-beratnya kepada gerombolan terdakwa pembunuhan terencana yang menewaskan almarhum ketua DPRD Sumut, Drs. AbdulAzis Angkat, secara mengenaskan. “Kami minta hakim menjatuhkan hukuman seberat-beratnya, karena yang tewas itu adalah pejabatnegarabukanmasyarakat biasa,” kata Sekretaris Umum JBMI, H. Aidan Nazwir Panggabean,kepada Waspada diMedan, Senin (20/7), setelah mengetahui tuntutan jaksa hanya tujuh tahun kepada terdakwa. Menurut Panggabean, dalam hal ini hakim jangan lagi melihat kasus ini dalam konteks

politik, tetapi harus pada kasus pidanabahkanterorisyaknipembunuhan secara berencana serta terorganisir yang menewaskan pejabat negara. Di sampingmelakukanpembunuhan berencana juga melakukan perusakan institusi dan lambang-lambangnegara.Justru, lanjut Panggabean, melihat dari peristiwa itu seharusnya pihak kepolisian dan jaksa sebagai penuntut umum harusnya menetapkan mereke sebagai pelaku tindak teroris. Panggabean menegaskan, unsur-unsur yang menguatkan mereka sebagai pelaku teror sudah terpenuhi yakni membunuh pejabat negara, membubarkan sidang parlemen negara yakni paripurna dan merusak serta

menghancurkan institusi negara yakni gedung DPRD Sumut. “Jadi ukuran teroris bukan hanya menggunakan bahan peledak,” tegas Panggabean dan menambahkan bahwa gerombolan itu juga memiliki jaringan secara nasional bahkan internasional serta terorganisir secara profesional. Justru, tidak heran ada aktor intelektual gerombolan itularikeluarnegeriseharisebelum peristiwamautituterjadidiDPRD Sumut. Jaksa dan hakim, lanjut Panggabean, dalam melakukan tututandanmemutuskansatuperkara selain harus menjamin adanya kepastian hukum juga mencerminkan rasa keadilan terhadap korban yang sudah meninggal dan keluarga korban. (m14)


Opini

12

WASPADA Rabu 22 Juli 2009

No Free Lunch Oleh Ir.H.Chaidir Ritonga,MM

T

TAJUK RENCANA

Hari Anak; Kerja Keras Selamatkan Masa Depan

S

etiap tahun, tepatnya tanggal 23 Juli bangsa Indonesia memperingati Hari Anak Nasional (HAN), termasuk tahun 2009 ini. Namun, masa depan anak Indonesia sebagian besar masih memprihatinkan, suram, karena mereka sudah terkontaminasi dengan narkoba, kejahatan, pengemis, sampai korban ‘’trafficking’’. Belum lagi, banyak anak-anak yang sudah bekerja untuk menghasilkan uang bagi kehidupan keluarganya. Anak perempuan di bawah umur dijadikan pelacur di hotel, losmen, pub. Tentu saja pekerjaan itu dijalaninya dengan sangat terpaksa. Seharusnya, anak-anak Indonesia, sebagaimana juga anak-anak di negara lain, berlomba-lomba belajar di bangku sekolah (pendidikan) guna mengejar cita-citanya. Merekapunyahakuntukmendapatkanpendidikan,kasihsayang,perlindungan,bermain sambil belajar, sebagaimana ketentuan undang-undang dan isi Konvensi Penghapusan Segala Bentuk Diskriminasi terhadap Perempuan (Convention on the Elimination of All Forms of Discrimination AgainstWomen/CEDAW) menjadi Undang-Undang Nomor 7 Tahun 1984 . Bukan malah sebaliknya, menjadi anak yang dipaksa mengerjakan halhal yang tidak semestinya mereka lakoni di masa usia mudanya. Justru itu, semua pihak terutama pemerintah dan tokoh-tokoh pendidik, agama dll perlu memikirkan cara memperingati Hari Anak Nasional di pusat maupun provinsi, kabupaten/kotaagartidaklagihanya sekadarseremonial.Artinya,peringatannyadilakukan tiap tahun, bahkan dengan acara yang‘’gebyar’’ menghabiskan dana ratusan juta rupiah, namun kasus-kasus anak semakin meningkat. Tidak hanya dalam segi kuantitas, tapi juga kualitas. Hemat kita, memperingati Hari Anak Nasional sangat baik (positif), asalkan jelas agendanya untuk kepentingan dunia anak, memajukan dan menyelamatkan masa depan anak Indonesia. Jangan sampai kegiatannya sekadar ‘’hura-hura’’, menghabiskan anggaran, setelah itu senyap, sementara pelecehan terhadap hak-hak anak terus berlangsung.Anak-anaktakberpunya(miskin), semakin termarjinalkan. Intisari Kitamerasalebihhormatkepadasiapasaja, apakah individu maupun lembaga yang memperjuangkan hak-hak Peringatan HAN harus terus-menerus anak secara kontinu sebatas kemampuanmenyentuh langsung nya, karena sangat membantu meskipun hasilnya kecil, ketimbang kegiatan yang masalah anak. menghabiskan banyak biaya, banyak sponSemua lapisan masya- sor, banyak diliput media tapi pada akhirnya hanya untuk kepentingan sekelompok orang rakat harus peduli. saja. Padahal, biaya yang dihamburkan itu sangat berguna bila ditujukan secara langsung bagi kemajuan anak bermasalah. Masalahnya, pelecehan terhadap hak-anak anak terus berlangsung di hadapan kita, setiap harinya dapat dilihat di media massa, seperti anak-anak terlantar semakin banyak saja, anak yang menjadi korban ‘’trafficking’’ semakin mengenaskan kita, anak yang menderita (cacat) sampai kakinya diamputasi akibat kedua orang tuanya bertengkar, di mana sang ayah melindaskan anaknya dir el kereta api. Di persimpangan jalan semakin banyak anak yang dipaksa mengemis, menghirup lem, menenggak minuman keras, narkoba, atau anak-anak yang tidak jelas pekerjaannya, anak-anak dengan gaya pank dll. Tak pelak lagi, sudah semestinya pemerintah menaruh perhatian untuk menyelamatkan anak Indonesia sehingga masa depannya tidak suram, terutama anakanak yang saat ini bermasalah dan di ambang batas masalah karena faktor ekonomi, kalau tidak diperhatikan dapat menimbulkan ‘’booming’’ bagi jumlah anak-anak bermasalah di negeri ini. Begitu juga anak-anak di rumah gedongan dengan teman bermainnya video game (playstation) dengan tema-tema kekerasan, seks. Belum lagi tontonan di televisi yang tidak mendidik anak-anak karena usianya belum dapat menalar cerita sinetron, film karton dll. Mereka itu adalah cikal bakal anak bermasalah di masa mendatang, jika para orang tua dan guru di sekolah tidak tanggap. Kehidupan keluarga yang di bawah kemiskinan ataupun pola kehidupan yang salah di lingkungan keluarga membuat jumlah anak-anak bermasalah semakin meningkat. Padahal, pemerintah sudah menggratiskan pendidikan, semestinya tidak ada lagi anakanak usia sekolah yang tidak bersekolah. Sayangnya, pendidikan gratis hanya ‘’lips service’’ karena tidak menyentuh langsung kepada anak bermasalah. Banyak keluarga miskin mengeluh, karena anaknya masih dikutip biaya SPP, uang komite, uang buku, uang bangku dll. Akibatnya, mereka tidak mampu menyekolahkan anaknya. Jadinya mereka anak jalanan,pekerja di jermal dll. Jumlahnya dari hari ke hari semakin membesar. Kasus penculikan anak pun belakangan ini semakin meningkat. Anak orang berada diculik dengan meminta uang tebusan, si anak ketakutan, atau si anak dijadikan pengemis, diperlakukan kasar, bahkan dibunuh, sungguh perbuatan biadab. Semuanya itu memerlukan penanganan sungguh-sungguh dari semua pihak, khususnya pemerintah, aparat keamanan harus kerja keras, di antaranya dengan menjatuhkan hukuman berat kepada siapa saja yang melakukan perbuatan semena-mena terhadap anak demi masa depan bangsa.+

Hubungi kami KANTOR PUSAT

Penerbit: PT Penerbitan Harian Waspada

Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksiwaspada@gmail.com

Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002

KANTOR PERWAKILAN � Bumi Warta Jaya Jalan Kebon Sirih Timur Dalam No. 3 Jakarta 10340 Tel: (021) 31922216, Faks: (021) 3140817. � Jalan Ratu Syafiatuddin No. 21 C Banda Aceh 23122 Tel & Faks: (0651) 22385 � Jalan Iskandar Muda No. 65 Lhokseumawe Tel: (0645) 42109 � Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412

Percetakan: PT Prakarsa Abadi Press Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 6612681 Isi di luar tanggung jawab percetakan Harga iklan per mm kolom: BW Rp. 11.000,FC Rp. 30.000,Halaman depan BW Rp. 33.000,Halaman depan FC Rp. 90.000,Ukuran kolom: 40,5 mm

idakadamakansiangyanggratis (no free lunch). Itulah anekdot dalam relasi sosial masyarakat barat yang kapitalis, baik di dalam domain bisnis maupun bentuk relasi sosial lainnya. Setiap undangan makan siang,mestiadamotifdantujuannya.Pada masyarakat kapitalis, semua bentuk relasi diukur dengan materi. Berbeda dengan masyarakatTimuryangmelihatrelasisosial dengan pendekatan dan sudut pandang yang berbeda. Bisa karena alasan agama atau juga karena ritus-ritus budaya yang meskipun juga tidak sepenuhnya gratis, namun dalam perspektif yang berbeda. Pada masyarakat Timur, undangan makan siang atau lainnya seringkali diinisiasikan dengan imbalan pahala atau sekedar mengikuti budaya leluhur. Motifnya antara lain karena mengharapkan pahaladarikekuatanSupranatural,Tuhan. Jadimemang,hakikatnya,tidakadamakan siang yang gratis. DanTesis ‘No Free Lunch’ tiba-tibasajamengemukamenyikapiTeror Bom yang melanda dua Hotel Marriots danRitzCarltondiJakarta.Tesisitudidasarkan kepada konstalasi politik global yang menghalalkan segala macam cara mewujudkan semua target-target yang telah ditetapkan. Apa dan Siapa Dibalik Teror? Satu hal yang langsung bisa disepakati ialah Teror Bom tersebut dilakukan oleh teroris. Tetapi rangkaian dibalik teror itu sangatlahrumitdansulit.Selalusajabegitu, setelahsebuahperistiwaterorberlangsung, yangpastiakanselalumenarikialahdiskusi dan penyelidikan panjang tentang siapa dalang di belakang pelakunya. Apa motif dantujuannya.Danskenarioyangmenyertainya. Teror bom yang menimpa Hotel JW Marriot dan Ritz Carlton Jakarta, sama saja,analisispascaterorkinimenjadisangat menarik. Derita para korban sepertinya menjadi urusan paramedis. Sekarang media memburu berbagai pendapat dan analisis apa dan siapa dalang dibalik teror. Pertama, karena kita baru saja selesai melaksanakanPilpresyanghasilnyasudah bisa diduga. Kedua, teror bom, baik oleh teroris ataupun kelompok perlawananan separatisme atau pemberontak, biasanya selalu diikuti dengan klaim pertanggungjawaban.Teror bom di Jakarta kali ini ataupun teror bom lain sebelum ini di Bali maupun di tempat-tempat lain, berbeda, tidak ada pihak yang mengklaim melaku-

kan atau bertanggungjawab. Tahapan setelah teror bom justru lebih sulit, rumit dan panjang untuk sekedar mengetahui dalang, motif-tujuan dan skenario dibelakangnya. Ketiga, memang Amrozi dan Imam Samudera dkk yang mengaku sebagai pelaku Bom Bali dan dihukum mati untuk itu. Ada Noordin M.Top dkk atau Hambali yang hingga kini belum tertangkap. Ada banyak sekali yang mengaku dan memberikan testimoni anak-anak muda Islam di TV bahwa mereka berjihad dengan melakukan teror bom.Tapi itu tidak make sense. Tidak masuk akal. Apa motif yang sesungguhnya?Siapadonaturnya?Mereka terkesan tidak lebih daripada korban dari berbagai permainan dan kepentingan, karena kebodohan dan kemiskinan. Keempat, jangan lupa Amerika kini tengahmenatadiridanmengartikulasikan keadidayaannyadibawahkepemimpinan baru Barack Hussein Obama. Ekonomi adidaya Amerika kini tengah ditata ulang ditengah ancaman kedigdayaan ekonomi RRC yang dewasa ini tetap tumbuh sekitar 7 persen, membukukan devisa terbesar di dunia lebih dari AS $ 2 Triliun. Bandingkan dengan Devisa Indonesia yang berkisar US $ 57 Milyar. RRC memang Fantastis. Konstelasi geopolitik global akan berubah apabila Amerika tidak mengartikulasikan posisinya sebagai negara adidaya. Hutang Amerika yang sangat besar serta krisis keuangan yang masih melilitnya pastilah memerlukan penataan yang baru agar kedigdayaan ekonomi dan politik Amerika tetap bisa bertahan.Tanpa itu, rakyat Amerika akan sangat volatile. Kemakmuran dan keperkasaan Amerika bertahun-tahun harus tetap dipertahankan apabila Obama dan Partai Demokrat ingin bertahan di Kursi Kekuasaan. Padahalpilihanuntukitutidakbanyak. Amerika harus mengalahkan RRC. Bila perludenganmelakukanberbagaimacam cara. Bisa dengan cara bekerjasama dan bersahabat sebaimana dilakukan dengan Arab Saudi, Jordania, Kuwait dan Mesir. Bisa juga dengan ‘cara Amerika’ sebagaimana kita saksikan di Irak, Afganistan dan tempat-tempat lain di berbagai belahan dunia. Dalam konstalasi geopolitik Asia, di belahan Asia Selatan, Amerika bersahabat dan ‘mengusasi’ India sambil menunggu Pakistan menyelesaikan tugasnya

membersihkan diri dari anasir-anasir garis keras Islam. Di belahan Asia Timur, Amerika sangat bersahabat dan bahkan ‘menguasai’ Jepang, Taiwan dan Korea Selatan. Selebihnya, Amerika tengah memaksa Korea Utara agar bisa lebih jinak megikuti kehendak Amerika terutama dalam isu Program Nuklir. Di AsiaTenggara, Amerika telah ‘menguasai’ negara supermini Singapura, Philipina dan Papua Nugini. Amerika sangat berkepentingan ‘menguasai’ Malaysia dan tentu saja Indonesia. Tetapi posisi Indoensia jauh lebih penting dan strategis. Karena selain negara besar berpenduduk keempat terbesar di dunia,IndonesiamasihmenyimpanSumber Daya Alam yang sangat besar. Selain karena itu tadi, RRC tidak boleh dibiarkan terusmenjadilebihkuatyangpadasaatnya akan mengancam kepentingan politik Amerika di kawasan ini, yang pada gilirannya dalam pecaturan politik dan ekonomi global. Keinginan itu tentu saja harus diwujudkan dengan segala macam cara, cara damai atau apapun yang diperlukan untuk itu. Pertanyaannya ialah, apakah Amerika sudah merasa bisa‘menguasai’ Indonesia, menjadi sangat penting. Apakah Pilpres kali ini sudah mencerminkan kepentingan Amerika‘aman’ disini? Atau apakah diperlukan mengamankan hasil Pilpres yang sudah diketahui melalui cara hitung cepat (quick count)? Atau adakah diantara kekuatan politik di dalam negeri (Indonesia) yang ada sudah membuat komitmen dengan Amerika tetapi nampaknya komitmen itu perlu lebih diperkuat atau diamankan? Atau pertanyaan nakal yang sangat penting: apakah tragediTeror Bom Marriots dan Carlton terkait dengan Amerika itu? Tesis ‘No Free Lunch’ Pada saat kita bertanya-tanya apa dan siapa dalang teror bom, SBY melakukan temu pers yang segera saja direspons oleh JK, Prabowo dan Megawati. SBY mencoba menarik benang merah antara Pilpres dengan tragedi itu. Sebaliknya, Capres JK, Megawati dan Cawapres Prabowo menyatakan tidak yakin hal itu terkait dengan Pilpres. Teror bom tersebut sebagaimana teror lainnya adalah musuh bersama kita. Musuh kemanusiaan yang adil dan beradab. Terlalu dini mengaitkannya dengan Pilpres atau apalagi dengan Islam. Analisis lain bermunculan. Mulai dari pendapat Mantan Kepala BIN Hendro-

priyono yang mengaitkan teror itu dengan salahsatualirangariskerasIslamdariTimur Tengah. Kemudian diikuti oleh analisis Al Chaidar yang meyakini bahwa pelaku dan dalang teror bom terakhir ini terkait dengan Noordin MTop. Dikatakatan, Nuri Hasdi atau Nuri Sahid adalah anggota kelompok Hasmar Latin Sani, yang berafiliasi dengan Kelompok Noordin M.Top. Bagaimana dengan tesis no free lunch. Manakala ada pihak yang telah membangun komitmen dengan Amerika, baik komitmen politik dan keamanan, itu akan menjadi alasan bagi Amerika menagih komitmen. Sebaliknya, Soekarno terjungkal antara lain karena tidak bersedia membangun komitmen dengan Amerika? “Go to hell with your Aid!”, kata Bung Karno. Bung Karno tidak hanya menolak membangun komitmen, ia justru ingin membangun kemandirian bangsa. Sayang, Bung Karno gagal. Memang serba salah, berkomitmen bisa jadi salah, demikian juga sebaliknya. Pilihan ada di tangan kita. Membangun komitmen dengan Amerika atau mengambil garis tegas membangun kemandirian bangsa? Semua itu terpulang kepada SBY dan Capres terpilih hendak kemana bangsa ini dan kita semua akan dibawa. Mengambil posisi terlalu dekat atau terlalu jauh, memiliki resiko atau keuntungan tersendiri. Atau justru tesis no free lunch yang terjadi disini? Sebagaimana juga kita menyikapi teror sebelumnya, Teror Marriots dan Carlton, kita serahkan sepenuhnya kepada SBY dan Presiden terpilih untuk menemukan dalang dan skenario di belakangnya. Menghukum seberatberatnya tanpa ampun. Terkutuklah pelakunya.Terkutuklah dalang-nya. Tragedi itu sangat memilukan, lebih-lebih kepada para korban yang tidak berdosa, rakyat kecil yang tidak tahu apa-apa. Terkutuklah orang yang melakukan ini atas nama jihad atau Islam. Islam mengutuk cara kekerasan yang tidak berperikemanusiaan seperti itu. Terkutuklah orang-orangyangbersediadiperalatuntuk itu.Terkutuklah siapapun di belakangnya, apakah yang anti Amerika atau apalagi yangmelakukanituuntukmengamankan kepentingan mereka disini. Ini menjadi PR Prioritas Presiden SBY dan Presiden terpilih nantinya agar tragedi seperti itu tidak terulang kembali. Penulis adalah Wakil Ketua Partai Golkar Sumut SMS: 081962 01 23

Akankah Partai Golkar Jadi Oposisi? Oleh Hidayat Banjar

P

erolehan suara sementara untuk SBY-Boediono yang mutlak mencapai 60 persen, dimungkinkan pemilu presiden berlangsung satu putaran. Pada sisi lain, pasangan JK-Win yang diramalkan menjadi pesaing kuat justru terperosok pada angka sekitar 11 persen, lebih rendah dibandingkan dengan perolehan Partai Golkar pada pemilu legislatif.Tak ayal kekalahan ini membuat para elite partai memikirkan kemungkinan membawa Golkar sebagai oposisi. Akankah Partai Golkar jadi oposisi? Dalam pada itu, dukungan besar dari partai koalisi dengan total kursi 314 kursi amat dimungkinkan kuatnya sistem presidesial ke depan. Dalam kondisi seperti ini, dibutuhkan kehadiran partai oposisi. Sejak awal, kita telah memprediksi, kalau SBY memenangkan pertarungan Pilpres, niscaya sistem presidensial makin menguat. Hal ini tersebut dapat dilihat dari keteguhan hati Susilo Bambang Yudhoyono (SBY) menetapkan Boediono sebagai Cawapres (Calon Wakil Presiden) ketika itu, meskipun dibanjiri kritik. Memilih Boediono sebagai Cawapres memang sudah diperhitungkan SBY dengan sangat matang. Walaupun politik terkadang tidak bisa dimatematikakan, tetapi SBY yakin, hitungan itu perlu untuk capaian-capaian ke depan dalam berbangsa dan bertanah air. Ternyata, hitungan itu tepat. Merasa Nyaman Berpasangan dengan Boediono yang notabene bukan orang partai, SBY akan merasa “aman” serta “nyaman” menjalankan kebijakan-kebijakannya tanpa takut tersandung kepentingan-kepentingan partai yang telah “berbaik hati” dengannya. Bersama Boediono – di atas kertas – SBY akan dapat menyusun kabinetnya tanpa “gangguan” orang-orang partai. Bersama Boediono, SBY dapat memaksimalkan hak prero-gratif presiden sebagaimana dianut negara-negara yang menetapkan sistem presidensial, termasuk Indonesia. SBY akan memerintah dengan legitimasi dan kekuasaan besar sehingga pihak-pihak atau menteri dalam kabinet yang bersikap macam-macam akan

mudah diambil tindakan tegas. Boleh dikatakan SBY dapat memegang kendali, one man show politics dan keberlangsungan roda pemerintahanan lebih terjamin. Apalagi di pemerintahan ini juga tidak ada matahari kembar. Yang perlu dicermati, umumnya seorang presiden dengan mandat dan dukungan kuat serta pengalaman yang nyaman menjadi alergi dikritik. Dalam pada itu, kabinet yang dipimpin SBY akan dapat dibentuk lebih ramping dan efektif, serta diperoleh menterimenteri yang loyal pada pemerintah. Perlu dicatat lagi, SBY memerintah di periode kedua, yang cenderung tidak terlalu bersemangat. Oleh karena itu, masyarakat dan DPR harus berfungsi baik. Parpol harus mengawasi dan mendorong agar pemerintahan ini dapat menepati janji-janjinya. Posisi SBY yang terlalu kuat dikhawatrirkan dapat menciptakan sebuah pemerintahan baru yang otoriter lantaran merasa mendapat mandat absolut dari rakyat. Untuk bisa mengimbangi kecenderungan itu, disarankan dua parpol besar, seperti Partai Demokrasi Indonesia Perjuangan dan Partai Golkar untuk bersama-sama memosisikan diri sebagai pihak oposisi. Dalam pemerintahan periode lalu ada mekanisme checks and balances, dengan keberadaan sosok wakil presiden yang berani mengatakan tidak, maupun juga dalam hubungan antara eksekutif dan legislatif. Kalau sekarang, kita kurang yakin, apakah ada partai – terutama Partai Golkar – mau dan siap menjadi oposisi? Jadi Oposisi Partai Golkar perlu belajar menjadi partai oposisi. Pilihan menjadi oposisi tetap terhormat dan membawa manfaat besar bagi proses demokratisasi dan kepentingan rakyat. Menjadi oposisi juga bisa memberikan keseimbangan yang baik untuk masyarakat. Partai Golkar selama ini memiliki kemampuan sebagai partai pemerintah dan ikut berkuasa. Itu berarti Partai Golkar pun seharusnya bisa menjadi partai oposisi, tidak mesti harus berkuasa. Memang ada anggapan, selain masalah akses pada sumber daya, kekhawatiran paling besar yang dihadapi suatu partai jika menempatkan diri sebagai oposisi,

akan dipandang sebagai penyebab instabilitas dan menjadi kekuatan destrukti dalam sistem politik nasional. Pandangan ini amat keliru. Dalam alam demokrasi, oposisi adalah bagian dari sistem yang mengontrol tugas pemerintah, mendorong kompetisi politik, bahkan membantu peningkatan efektivitas kebijakan pemerintah. Fenomena Popsitif Kalaupun ada konfrontasi antara pemerintah dan oposisi terkait kepentingan dalam kompetisi politik, justru merupakan fenomena positif untuk kemajuan negara. Hal ini dapat diumpakanan dua pedal sepeda yang memutar rantai hubungan dan perpindahan mekanisme kebijakan. Sebaliknya, instabilitas politik hanya akan terjadi jika pemerintah melakukan tindakan yang memarjinalisasi partai politik oposisi. Misalnya, menciptakan dualisme kepemimpinan partai, membatasi akses partai pada unit-unit ekonomi, media, dan lainnya sebagaimana pada masa Orde Baru. Salah satu kekurangan – jika tidak mau disebut kegagalan – gerakan reformasi 1998 dalam bidang politik adalah menumbuhkan kekuatan oposisi yang terlembaga di DPR. Selama 10 tahun terakhir, hampir tidak ada partai politik yang konsisten melakukan counter atas kebijakan pemerintahan dengan menawarkan kebijiakan alternatif yang lebih baik. Kalaupun ada kritik atau ketidaksetujuan partai atas kebijakan ekonomi pemerintahan misalnya, namun partai sendiri sering tidak mempunyai tawaran konsep dan program ekonomi yang jelas dan nyata. Suara kritis yang disampaikan partai melalui wakilnya di DPR pada dasarnya bukan mencerminkan bentuk oposisi mengingat suara-suara berbeda di DPR sering bersifat individu dan tidak mewakili suara partai. Kesan kalut yang dapat ditangkap adalah orientasi dari sikap kritis DPR lebih dimaksudkan sebagai upaya “penjegalan” atas rencana kebijakan yang akan dikeluarkan pemerintah ketimbang perdebatan konsep program. Karena itu, perbedaan pandangan politik antara politisi dan pemerintah yang kemudian bermuara pada hak angket acap kali berakhir dengan kompromi. Mendapatkan Berkah Beberapa faktor yang melatarbelakangi belum tumbuhnya kehidupan

oposisi dalam praktik politik dewasa ini adalah, persepsi dari politisi bahwa terlibat dalam cabang kekuasaan lebih memungkinkan memperoleh berkah dalam bentuk akses tehadap sumber daya ketimbang menjadi oposisi. Oposisi sering dikonotasikan dengan tersumbatnya akses partai pada sumber daya ekonomi, baik yang di sektor swasta maupun melalui penguasaan pada jabatan-jabatan publik. Hal lain, selama 30 tahun lebih para politisi tenggelam dalam kehidupan sistem politik otoritarian dan tidak kenal oposisi. Hal ini membuat partai atau politisi tidak terbiasa membangun kultur politik berbeda dengan penguasa, baik dalam tataran artikulasi mapun konsep operasional. Seiring dengan itu, kelahiran partai politik umumnya belum didasarkan pada panggilan atas masalah yang dihadapi bangsa, tetapi lebih memanfaatkan momentum keterbukaan politik politik. Implikasinya, antara satu partai dan partai lain nyaris tidak ada perbedaan subtantif dalam platform dan program. Ditambah lagi dalam 10 tahun terakhir, sistem perekrutan anggota dalam partai dan DPR bersifat instan dan kurang melalui proses kaderisasi intensif. Melihat kenyataan-kenyataan tersebut, timbul pertanyaan di benak kita, akankah muncul partai oposisi di pemerintahan SBY kedua ini? Sang waktulah yang akan menjawabnya. Penulis adalah peminat masalah Sosial Budaya, menetap di Medan

SUDUT BATUAH * Golkar belum bicarakan kabinet - Mungkin masih terpesona hasil Pilpres * Guru diingatkan beri sentuhan nasionalis - Jangan pula sentuhan Rock ‘N Roll * Pemko salah tempatkan orang di Kadis Kesehatan - Bisa timbulkan salah duga neh! Doel

Wak

WASPADA

Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Nanggroe Aceh Darussalam: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (NAD), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril (Limapuluh), H. Abu Bakar Nasution, Nurkarim Nehe, Iwan Hasibuan, Bustami Chie Pit (Kisaran), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Parlindungan Hutasoit (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Nanggore Aceh Darussalam: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang).

� Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �


Opini

WASPADA Rabu 22 Juli 2009

13

Isu Kabinet SBY Oleh DR. Drs. H. Ramli, MM

M

enyusul hasil quick count yang mengunggulkan pasangan SBY - Boediono yang sejalan dengan hasil sementara KPU, muncul berbagai spekulasi tentang susunan kabinet yang akan dibentuk SBY, isu ini sempat kalah popularitas ketika meledak bom di JW Marriot dan Ritz Carlton, tapi tetap saja isu ini mengalir karena sifatnya yang strategis. Khususnya, para partai pendukung koalisi Demokrat yang mulai ramai membicarakan ‘kompensasi’ atas dukungan yang telah diberikan. Bahkan salah seorang petinggi Partai Kebangkitan Bangsa (PKB) secara terang-terangan melalui televisi meminta jatah Menteri Agama dalam kabinet nanti. Sedangkan Partai Keadilan Sejahtera (PKS) mengaku belum tertarik membicarakannya. Presiden PKSTilatul Sembiring menyatakan, penyusunan kabinet adalah

hak prerogatif presiden dan mereka juga masih akan menunggu hasil Pilpres resmi yang diumumkan KPU. Namun begitu dia mengatakan, hal tersebut tetap menjadi agenda pembicaraan sesuai kontrak politik. Sinyal dari seberang akan merapatnya Partai Golkar ke kubu Demokrat juga memberi nuansa tersendiri. Aroma kecurigaan menyeruak kalau-kalau SBY bakal mengakomodir calon dari Golkar, maka akan mengurangi jatah menteri bagi para mitra koalisi. Belum lagi ‘semangat bertanding’ dengan Golkar yang notabene adalah kompetitor dalam pemilihan presiden lalu belum benar-benar hilang. Tulisan ini mencoba untuk mendeskripsikan bentuk kabinet yang mungkin akan dibangun SBY untuk menjalankan roda pemerintahan lima tahun ke depan. Asumsi yang dikemukakan berdasarkan pola yang dipakai SBY dalam memutuskan memilih calon wakil presidennya. Tunggu Hasil Pilpres Menanggapi isu yang berkembang melalui ruang publik, Presiden SBY dikediaman pribadi Puri Cikeas, Kabupaten Bogor, Jawa Barat, kemarin telah menyampaikan klarifikasi. Isu tersebut tidak lain tentang susunan kabinet untuk lima tahun mendatang. SBY mengaku terkejut, ketika tiba-tiba beredar isu susunan kabinet. SBY menegaskan bahwa jika terpilih menjadi presiden periode 2009-2014 maka dirinya-lah yang memiliki hak menyusun kabinet. Berdasarkan pengalaman tahun 2004, susunan ka-

binet beredar, dipercayai sebagai bocoran dari Cikeas. Sehingga pada saat susunan disebutkan, banyak yang protes, marah dan merasa dipermainkan serta dipermalukan, karena sudah disebutkan tetapi tidak masuk dalam jajaran kabinet. SBY pun menegaskan bahwa saat ini belum sampai pada kegiatan penyusunan kabinet. Sebab memang faktanya KPU belum mengumumkan hasil final Pilpres 2009. Proses penyusunan kabinet baru akan dilakukan menjelang masa transisi pemerintahan baru pada 20 Oktober 2009. SBY juga menyampaikan, penyusunan komposisi kabinet dilakukan dirinya dibantu Boediono selaku Wapres. Karena itu tidak ada broker atau penghubung yang bisa memfasilitasi seseorang untuk duduk di kabinet mendatang. Komposisi dari kabinet baru itu disusun SBY bersama Boediono sesuai aturan main dan logika penyusunan kabinet. Klarifikasi SBY ini tentu tidak mengejutkan dan bersifat normatif; bahwa masalah kabinet baru akan dibicarakan setelah pengumuman resmi hasil Pilpres oleh KPU dan seterusnya. Namun tentu saja tidak bisa dinafikan bahwa tarik-menarik tentang posisi menteri di kabinet sedang terjadi, dan SBY berada di posisi sumbunya. Pola Memilih SBY Ada baiknya kita melihat kembali pola memilih yang telah dilakukan SBY yang jika terpilih jadi presiden lagi merupakan pemegang amanat penyusun kabinet. Gonjang-ganjing menjelang pemilihan

wakil presiden dalam pemilihan presiden kemarin tidak kalah serunya. Banyak nama yang muncul, sebut saja Akbar Tandjung, Hidayat Nur Wahid, Sutrisno Bachir, Hattaradjasa, Din Syamsuddin dan lainnya. Pada intinya nama yang mencuat tersebut adalah tokoh-tokoh yang mewakili organisasi atau kelompok massa tertentu. Namun secara mengejutkan, ternyata SBY memilih Boediono yang tidak mewakili kelompok atau massa tertentu. Boediono dipilihnya bukan karena ada referensi dari partai politik tertentu, bukan karena dia menguasai kelompok massa tertentu atau dengan kata lain, pilihan ini tidak menguntungkan secara politik. Saya menyimpulkan, bahwa pilihan ini karena pertimbangan resistensi politik Boediono yang kecil dan profesionalismenya yang tinggi. Ini akan berdampak pada peluang yang besar pada harmonisasi pasangan ini sampai akhir masa jabatan dan penanganan persoalan ekonomi bangsa yang lebih serius di bawah tanggung jawab ahlinya. Pilihan yang tidak menguntungkan secara politik ini adalah sebuah harga yang harus dibayar untuk sebuah efektifitas kepemimpinan bangsa. Karena kita ketahui bersama, SBY punya pengalaman dalam pemerintahan sebelumnya yang bahkan masih berlangsung sekarang. SBY bahkan seolah tidak mempedulikan basis dukungan massa yang dimiliki koalisi pendukungnya yang berpeluang merasa kecewa. Karena pada saat itu PKS bahkan telah mengancam untuk mencabut dukungan kare-

na pilihan SBY tersebut. Namun dengan yakin, melalui kalkulasi hasil pemilihan legislatif lalu dimana suara Demokrat melonjak tajam karena popularitas dirinya, SBY tetap keukeuh memilih Boediono sebagai pasangannya. Hingga memang tidak berlebihan jika disebutkan kalau SBY sangat yakin, yang dalam bahasa lawan politiknya dikatakan terlalu PD (percaya diri); karena memang begitu keadaannya. Kenyataannya memang kalkulasi SBY itu tepat dan tidak meleset. Melalui hasil quick count dan hasil sementara KPU, pasangan ini menang telak hingga tidak perlu pemilihan dua putaran. Maka dengan seketika (harusnya) mementahkan anggapan selama ini, bahwa wakil presiden itu adalah jabatan politis, tetapi di tangan SBY, sudah menjadi jabatan karir. Seperti, halnya Boediono yang jenjang karirnya dari mulai di struktur Bank Indonesia, Gubernur Bank Indonesia, Menteri, menteri koordinator sampai sekarang menjadi Wapres tanpa pernah dia menjadi politisi ataupun direkomendasikan partai politik. Bukan tidak mungkin pola seperti ini juga akan digunakan SBY dalam memilih orang-orang yang akan duduk di kabinet. Namun, tentu saja ada hal-hal yang mesti jadi pertimbangan hingga kalkulasi yang dilakukan menjadi benar-benar tepat dan sesuai harapan. Penutup Di tengah kondisi bangsa Indonesia saat ini, kebutuhan realistisnya adalah

kabinet yang profesional yang menjadi orang-orang yang benar-benar berkompeten duduk pada posisi yang semestinya. Sudah saatnya kita beralih dari agenda penyusunan kabinet yang hanya terikat aspirasi dari partai politik yang sarat muatan kepentingan. Karena itu mestinya, siapapun yang akan dipilih nanti duduk di kabinet maka haruslah mengedepankan faktor keahlian berdasarkan pengalaman profesionalnya, bukan semata karena faktor koalisi yang lebih menonjol kepentingan politisnya. Sehingga kalaupun orang partai yang dipilih, maka hendaknya dia juga punya kapasitas yang mumpuni. Meski, model seperti ini pun tidak benar-benar selalu objektif, karena orang partai tentu tetap akan membawa misi partainya, seprofesional dan seahli apapun dia. Maka dalam hal ini, jika pola memilih Wapres yang diterapkan SBY maka orangorang kabinet adalah tempatnya bagi para profesional dan bukan bagi para politisi. Saya menduga, orang partai tetap akan diakomodir, tentunya dengan pertimbangan yang ketat soal keahlian yang disebut di atas. Akan tetapi keinginan yang kuat akan meminimalisir resistensi dan kebutuhan akan kabinet profesional akan membawa SBY pada keputusan yang independen. Maka kemungkinan jumlah menteri non partai akan lebih banyak dibandingkan dengan kabinet sebelumnya akan sangat berpeluang untuk terjadi. Penulis adalahWakilWalikota Medan Non Aktif.

Karakteristik Terorisme Di Indonesia Oleh Eddi Elison

M

endadak sontak Jumat pagi (17/ 7) pukul 07.47 di resto Syailendra yang berada di Hotel JW Marriott terjadi ledakan bom, sehingga hotel terguncang. Dua menit kemudian resto Erlangga bagian dari Hotel Ritz-Carl-ton, terdengar pula ledakan yang sama. Tak heran, jika kedua resto hotel berbintang lima yang letaknya berdekatan dan tidak jauh pula dengan Polda Metro Jaya, di kawasan segi tiga emas Mega Kuningan, Jakata Selatan langsung berantakan. Jakarta menangis, karena jatuh korban 9 tewas dan 63 orang menderita luka-luka. Dua di antara yang tewas itu seperti dilansir Kapolri Jenderal Pol Bambang Hendarso Danuri, adalah sang peledak bom sendiri, yang identitasnya belum diungkapkan secara rinci oleh pihak kepolisian. Peledak bom bunuh diri itu salah seorang di antaranya disebut bernama Nur Hasbi alias Nursaid, berasal dari Temanggung, yang seluruh tubuhnya hancur, namun kepalanya masih utuh, sehingga dapat dikenali. Ia terbunuh di Marriott, sementara yang terbunuh di Ritz-Carlton, sama sekali tidak diketahui, mengingat seluruh tubuhnya hancur berkeping-keping dihantam bomnya sendiri. Akibat dua ledakan dahsyat itu, Tim Manchester United (MU/juara Liga Inggris 2008/2009) yang sudah berada di Malaysia, langsung membatalkan kedatangannya ke Jakarta untuk melawan Tim Indonesia All Stars, sehingga panitia lokal yang diketuai Agum Gumelar, mengalami kerugian sekitar Rp.38 miliar. Belum lagi ribuan turis asing langsung angkat koper meninggalkan obyek-obyek wisata. Dampak lainnya, kemungkinan investor berpikir ulang untuk berinvestasi di sini. Bahkan yang lebih menyakitkan, adanya stempel masyarakat dunia; Indonesia negara tidak aman! Berbeda dengan ledakan bom di ne-

gara lain, biasanya tak lama setelah terjadi pemboman ada yang memberi pengakuan: “Kami yang bertanggung jawab!”. Karena di sini, meskipun berkali-kali terjadi teror bom, namun tetap tidak ada yang memberi pengakuan, sehingga menimbulkan berbagai spekulasi tentang siapa pelaku teror tersebut. Spekulasi pertama kali justru dilancarkan Presiden Susilo Bambang Yudhoyono saat meninjau TKP dengan keterangan yang tidak terfokus, tetapi sempat menyinggung adanya usaha untuk membunuh dirinya, bahkan meskipun tidak secara implisit, disebutnya pula pemboman itu tidak bisa dilepaskan dari hasil Pilpres. Bahkan ditegaskannya, ada pihak yang tidak suka atas kemenangannya di Pilpres. Disinggung pula adanya rencana “revolusi”, oleh pihak tertentu. Jangan lupa; Megawati Soekarnoputri, tahun 2001 pernah diberitakan akan dibunuh, sesuai dengan keterangan Umar al Faruq, salah seorang tokoh JI untuk kawasan AsiaTenggara, yang berhasil ditangkap pihak berwajib di Cijeruk, Bogor, tahun 2001. Namun pengakuan al Faruq itu tidak pernah diumbar Megawati. Pernyataan SBY tersebut mendapat reaksi dari beberapa pengamat politik dan intelijen, yang umumnya menyayangkan terjadinya pemboman di kedua hotel tersebut sebagai bagian dari ketidaksukaan pihak tertentu atas hasil Pilpres, karena data-data yang dikemukakan SBY, meskipun diperolehnya dari pihak intelijen, namun akurasi dan keterkaitannya dengan Pilpres belum dapat dibuktikan. Kita membatasi diri untuk tidak ikutikut bereaksi tentang berbagai komentar yang ada, tetapi mencoba memberi kajian lebih dalam tentang “terrorist historical action” di Tanah Air, terutama yang terkait dengan pemboman, karena kita yakin dengan menelusurinya secara jernih, akan

Surat Untuk Bapak Bupati Gayo Lues Dengan hormat, Surat terbuka ini saya sampaikan kepada Bapak Bupati Gayo Lues, karena saya ingin Kabupaten Gayo Lues lebih baik dan lebih maju pada masa yang akan datang. Pemikiran-pemikiran yang ingin saya sampaikan kepada Bapak Bupati Gayo Lues adalah sebagai berikut: 1. Membangun kabupaten Gayo Lues melibatkan seluruh komponen masyarakat dengan menjaga persatuan dan kesatuan serta keadilan di Kabupaten Gayo Lues, diwujudkan dalam semua tindakan dan keputusan. 2. Menciptakan kondisi, supaya pejabat eksekutif dan legislatif harus bekerja untuk kepentingan rakyat sesuai dengan wewenangnya masingmasing. 3. Memilih, mangangkat pejabat, dan membinanya secara profesional yang memiliki visi dan misi yang jauh ke depan, sehingga dapat menghindari mutasi setiap saat. 4. Membuat program berdasarkan studi kelayakan dan bermanfaat untuk seluruh lapisan masyarakat Gayo Lues, sehingga setiap program tampak secara berkelanjutan dan hasilnya dapat dinikmati oleh masyarakat. 5. Membagikan tanah adat (perueren, perempusen, penjemuren, dan perutemen) kepada masing-masing masyarakat kampung yang berhak untuk menerimanya, supaya tidak dikuasai oleh orang yang tidak berhak memilikinya. 6. Galakkan sektor pertanian, perkebunan, dan peternakan di Kabupaten Gayo Lues. Melalui pengkajian, studi banding, pengarahan, dan pemberian contoh kepada masyarakat. 7. Memberdayakan seluruh dinas dan pejabat lainnya untuk bekerja keras, merancang, mensosialisasikan, mengawasi, dan membina semua program. 8. Membuat pemetaan wilayah dan menetapkan komiditi unggulan, karena kondisi wilayah dan kesuburan tanah berbeda di setiap kecamatan di Kabupaten Gayo Lues. Misalnya, tanaman tebu, nanas, coklat, tembakau, daun teh atau ternak lembu, kerbau, kambing, ikan mas, ikan jurung (gegaring) dan lain-lain yang memungkinkan untuk dikembangkan di Kabupaten Gayo Lues. 9. Hidupkan usaha rakyat tentang pertanian, perkebunan, dan peternakan di Kabupaten Gayo Lues, tujuannya adalah untuk meningkatkan pendapatan dan daya beli masyarakat. Sehingga dapat menghindari krisis sandang, pangan, dan papan di Kabupaten Gayo Lues pada masa yang akan datang.

dapat ditarik kesimpulan, bahwa Indonesia sulit melepaskan diri dari ancaman teroris. Pendapat mantan Kepala BIN Jenderal (Pur) A.M. Hendropriyono menyatakan, bahwa ditinjau dari metoda/pola pemboman yang terjadi di Marriott dan Ritz, pada dasarnya sama dengan pemboman yang pernah terjadi di Bali I dan II, Kedubes Australia, Marriott I (sekitar 6 tahun lalu), bahkan jenis bomnya sama pula dengan berhasil disita di Cilacap berikut penangkapan teroris Saifuddin Zuhri, sehingga ada kecenderungan bahwa yang melakukan pemboman di Marriott dan Ritz Jumat (17/7) itu didalangi oleh Noordin M. Top, teroris asal Malaysia yang sejak beberapa tahun lalu berhasil menyelusup ke Indonesia bersama Dr. Azahari (terbunuh di Batu/Malang) sekitar tiga tahun lalu, yang sampai saat ini belum berhasil digelandang oleh kepolisian kita. Apa yang disampaikan Hendropriyono, dapat dibenarkan, setelah kita menelusuri jejak langkah Noordin M. Top sejak awal beroperasi di Indonesia. Sebagai salah seorang pimpinan Al Qaeda di Indonesia, seperti diakui pengamat intelijen Sydney Jones (AS), Nurdin memiliki jaringan ke luar negeri. Namun ia tidak lagi menjadi anggota Jamaah Islamiyah (JI), setelah terus menerus diobrak-abrik pihak keamanan Indonesia melalui Densus 88. Setelah terbunuhnya Azahari, Nurdin dikabarkan digeser dari posisi pimpinan JI. Sekarang ini ia lebih banyak bergerak dalam organisasi tanpa bentuk dengan merekrut orang-orang desa yang gampang dipengaruhi dengan materi dakwah keislaman yang fanatik mendogmakan jihad sebagai “mati syahid”, bila terbunuh atau membunuh “orang kafir” yang selalu diidentikkan dengan Amerika Serikat atau sekutunya. Mengapa ada teroris internasional masuk ke Indonesia? Dari beberapa literasi, termasuk adanya pengakuan CIA yang sempat dipublikasikan oleh beberapa media di Amerika, sebenarnya diawali dari rekrutmen yang dilakukan AS (baca: CIA)

pada 1979 terhadap pemuda-pemuda Islam yang dilatih tempur menghadapi tentara Uni Soviet yang menginvasi Afghanistan beberapa tahun lalu. Pasukan Taliban membutuhkan bantuan untuk mengusir tentara Uni Soviet dan berkat bantuan AS, ratusan pemuda dari berbagai Negara seperti Thailand (Selatan), Filipina (Moro), Malaysia, Singapura dan Indonesia (Jamaah Islamiyah) berguru perang di Afghanistan, di antaranya Iman Samudra, Amrozi, Noordin M. Top, Azhari dan lainlain, yang terdidik dan pelopor Islam fundamentalis. Setelah tentara Soviet berhasil diusir dari Afghanistan, mereka kembali ke negara masing-masing, tetapi dengan kepala yang sudah ter”brain washing” sebagai pelopor/ tentara jihad melawan AS, karena Afghanistan toh akhirnya menjadi “boneka” Washington DC, bahkanTaliban yang dibeking Al Qaeda pimpinan Osama bin Laden, digusur dan terpaksa menjadi gerilyawan di gunung-gunung. Al Qaeda mengirim “orang-orang”nya ke 45 negara, termasuk Indonesia, bahkan juga AS. Ingat serangan terhadapWTC dan Pentagon (11/9-2001), lalu teror bom di Madrid/Spanyol (2004), London (2005) dan tempat-tempat lain, seperti Mesir, Libanon, Pakistan dan Indonesia. Dengan mengemukakan rekam jejak teroris dengan berbagai ledakan bom yang mereka lakukan, bisa ditarik kesimpulan bahwa teroris internasional masih eksis di Indonesia, meskipun sudah cukup banyak tokoh-tokoh yang terbunuh atau dihukum mati. Salah satu dari keeksistensian kelompok teroris, sengaja diperagakan dengan meledakkan Marriott dan Ritz, bahkan lebih cenderung menantang, sehingga sengaja memilih Marriott yang sudah pernah mereka bom di tahun 2003. Banyak kalangan yang mengemukakan, Noordin M. Top yang masih bebas berkeliaran dari satu ke tempat lain di pedesaan, bahkan menyempatkan diri menikah dan mempunyai dua anak, merasa

10. Penerimaan PNS diutamakan putra daerah. Diterima melalui hasil seleksi secara murni dan mengambil peringkat teratas, sesuai dengan kebutuhan. Membangun Sumber Daya Manusia (SDA) Kabupaten Gayo Lues berarti membangun Kabupaten Gayo Lues. 11. Memberikan beasiswa kepada siswa dan mahasiswa yang berprestasi, sehingga dapat melanjutkan pendidikan yang lebih tinggi, baik di dalam maupun di luar negri. Hal ini akan menjadi asset SDM bagi Kabupaten Gayo Lues pada masa yang akan datang. 12. Mendirikan Badan Usaha Milik Daerah (BUMD) dan KOPRASI yang profesional, bertujuan untuk menaikkan Pendapatan Asli Daerah (PAD), kesejahteraan masyarakat, dan penyeimbang harga di Kabupaten Gayo Lues. 13. Menjalin kerja sama dengan seluruh instansi dan departemen yang terkait, bertujuan saling menguntungkan. 14. Memohon dan mengajukan hak paten semua kesenian (tari Saman, Bines, Didong, Sining Bines, Kederen, Dabus, Popo, Melengkan, Kecapi, Irama Harmonika, Kenek, Maen Dincong, dan Dilo). Serta mengembangkan daerah Gayo Lues menjadi daerah wisata. 15. Membangun cagar budaya Gayo Lues yang dikoleksikan dalam Moseum (umah tulu ruang atau pitu ruang). 16. Mengkondisikan semua pembangunan harus berwawasan lingkungan dan tidak merusak alam, baik jangka pendek maupun jangka panjang. 17. Mengenang, menghormati dan menghargai para pejuang Kabupaten Gayo Lues, supaya dapat rahmat dari Allah SWT dan safaat dari Nabi Muhammad SAW. 18. Menghidupkan pengajian (belajar membaca dan tajwid Al-Quran untuk anak-anak) serta (wirid dan ceramah agama secara rutin untuk orang dewasa (pria dan wanita, secara terpisah) di seluruh desa di Kabupaten Gayo Lues. Alternatif pertama untuk membangun dan membina prilaku umat di samping sebagai amal di sisi Allah SWT. Demikian surat terbuka ini saya sampaikan, atas perhatian Bapak Bupati Gayo Lues saya ucapkan terima kasih. Mohon maf atas segala kekurangan. Selanjutnya terima kasih kepada harian WASPADA, semoga semakin jaya. Amin! Drs. Isma Tantawi, M.A. (Putra Gayo Lues, NAD)

Mohon Perhatian Manager PT. PLN Cabang Binjai Dan Manager Wilayah Sumut Menyoal Kinerja PT. PLN (Persero) Rayon Binjai Timur Mengacu pada berita di salah satu harian terbitan Medan, saya baca disana di katakan oleh Pak Galingging selaku Humas PT. PLN Wilayah Sumut, biaya penyambungan baru listrik untuk keperluan rumah tangga berkisar Rp.

perlu “unjuk gigi”, karena pihak yang berwajib terlalu obral pernyataan tentang keberhasilan “menyikat” kelompok teroris, seperti yang terjadi Palembang dan terakhir di Cilacap, sehingga masyarakat menarik kesan, “kelompok Noordin M. Top” sudah kucar-kacir dan terpuruk. Nah, tanggal 17 Juli lalu mereka beraksi. Setiap peristiwa bom meledak memang terjadi secara mendadak sontak, tetapi persiapan kelompok teroris pasti dilakukan berbulan-bulan, termasuk bagaimana merakit bomnya. Polisi mensinyalir, perakitan bom dilakukan di kamar 1808 Hotel Marriott, di mana tiga orang teroris bermalam sejak 15/7. Materi bom pasti dibawa“secuil demi secuil”, agar dapat melewati penjagaan yang ketat. Siapa pun tidak bisa membantah, pihak intelijen Indonesia kecolongan untuk kesekian kalinya. Momen yang dipakai kelompok teroris ini benar-benar diperhitungkan dengan matang, karena usai Pilpres para petugas keamanan diprediksi agak lengah, apalagi akan datangnya Tim MU yang sangat terkenal di dunia, sehingga efek dari peledakan bom itu, meskipun harus mengorbankan jiwa sang peledak, akan segera membahana ke seluruh penjuru dunia. Hal ini sesuai dengan karakteristik terorisme, yakni korban sebenarnya bukanlah tujuan utama, tetapi yang terpenting adalah dapat dijadikan perang urat syaraf yang dapat menggugah rasa takut jutaan manusia. Oleh karena itu target sasaran selalu tempat-tempat yang mencolok bisa langsung menggemparkan dunia internasional dan dilakukan secara sistematis. Ini semua dapat dilakukan oleh kelompok teroris tersebut, karena termotivasi idealisme sempit atau karena kebencian yang sudah merasuk ke tulang sumsum. Pertanyaan lain; mengapa selalu harus dilakukan sambil membunuh diri? Dari hasil analisis dan modernisasi alat deteksi, akan mudah diketahui jika membawa bom dengan mobil atau bahkan

pada tubuh se-seorang, sehingga kaum teroris kemudian memformulasikannya sedemikian rupa, seperti yang terjadi di Marriott dan Ritz atau negara lain seperti di Irak, Pakistan, India dan lain-lain. Apalagi bagi teroris bom bunuh diri, sama nilainya sebagai perbuatan jihad atau kepahlawanan, meskipun bagi setiap negara, apalagi orang-orang yang menjadi korban perbuatan teror disamakan dengan perilaku biadab, yang sama sekali meniadakan nilai-nilai kemanusiaan, sehingga sangat menakutkan. Jangan lupa pengertian teror sebenarnya sangat relatif, karena tindakan teror dianggap paling efektif mencapai tujuan komunitas yang lemah melawan kelompok yang kuat. Pengamat intelijen Dr. A.C. Manulang, mantan salah direktur BAKIN (sekarang BIN), menyatakan dugaan dan sinyalemen keterkaitan antara jaringan sel terorisme di Indonesia dengan JI dan Al Qaeda sudah dintrodusir beberapa saat sebelum sebelum meledaknya bom Bali I. Tidak lama setelah serangan bom diWTC, muncul dugaan personel Al Qaeda yang terusir oleh serangan AS ke Afghanistan menyusup masuk ke Indonesia via Pakistan. Ativis kelompok ini diduga telah melatih orangorang tertentu di Poso (Sulteng). Oleh karena itu ancaman teroris internasional, meskipun dengan tubuh Indonesia, masih akan terus mengancam di Bumi Ibu Pertiwi ini, sehingga semua lapisan masyarakat memerlukan kewaspadaan yang luar biasa, terutama di tingkat RT. Namun kita pun tentunya pantas menggeleng-gelengkan kepala, ternyata Indonesia masih saja menganut budaya “tak perlu cari yang bertanggung jawab”, jika terjadi lagi pemboman, sehingga tidak ada yang merasa perlu untuk mundur dari jabatan, meskipun mengaku kecolongan, alias ketidakmampuan mendeteksi akan terjadinya peledakan bom. *** Penulis adalah mantan wartawan Waspada, kini Asdir Pancasila Center DHN 45 Jakarta.

750.000 dan dianjurkan mengurus langsung ke PT. PLN terdekat, maka saya mencoba untuk kedua kalinya mengajukan permohonan penyambungan baru tarif/daya RI/900 VA (A) yang saya ajukan langsung ke kantor PLN terdekat di Rayon Binjai Timur, tetapi permohonannya terkesan dipersulit dengan dalih harus memasang tiang beton. Prosesnya selalu terhenti ketika di survey ke rumah, padahal di depan rumah saya sudah berdiri tiang beton berjarak ± 35 m ke rumah. Tetapi mengapa saya harus memasang tiang yang sama dengan biaya Rp. 5.000.000,- untuk 1 (satu) buah tiang. Di satu sisi saya diwajibkan harus membeli tiang beton, di sisi lain tepatnya dibelakang rumah saya yang notabene jarak dari rumahnya ke tiang terdekat ± 75 m yang kabarnya pengurusannya melalui calo dapat menikmati jaringan PLN tanpa di fasilitasi tiang beton, mirisnya lagi ada pengusaha galian C yang untuk membayar 10 tiang beton pun mampu, mengapa hanya di fasilitasi tiang bambu sebagai penyanggah kabel listrik dapat menikmati jaringan PLN yang jelas-jelas dari tiang terdekat ke lokasi galian / kantornya berkisar ± 300 m. Dalam hal ini saya mencoba memohon kebijakan PT. PLN (Persero) Rayon Binjai Timur melalui bapak Panjaitan selaku Kepala Pelayanan (Supervisor) untuk meninjau kembali permasalahan ini, tetapi beliau mengatakan saya harus memasang tiang beton dengan biaya Rp. 5.000.000,di tambah biaya penyambungan api Rp. 1.100.000,- barulah saya dapat fasilitas PLN tersebut, itupun tidak memakai KWH (meteran) selamalamanya 3 tahun, sebelum ada KWH (meteran) saya harus membayar Rp. 143.000,- / bulan. Mengapa mereka-mereka yang saya tuliskan diatas tadi bisa mendapatkan jaringan PLN, sementara saya tidak bisa, padahal jarak dari titik lokasi penyambungan api ke tiang terdekat mencapai ratusan meter, sementara saya hanya ± 35 m. ketika hal ini saya singgung, dengan berdalih beliau mengatakan terhitung sejak tahun 2009 aturan itu sudah tidak bisa lagi ketika saya katakan, di tahun 2007 pun saya pernah mengajukan hal yang sama dan surat permohonan itu sampai saat ini masih saya simpan. Lagi-lagi beliau berdalih mungkin itu pekerjaan Kantor Cabang Binjai bukan melalui kami. Terlepas dari permasalahan ini, saya mohon perhatian Manager PT. PLN Cabang Binjai dan Manager Wilayah Sumut untuk mencarikan solusi yang terbaik, yang jelas untuk membayar biaya pemasangan tiang sebesar Rp. 5.000.000,- saya merasa terbebani, selama kurun waktu 2 (dua) tahun rumah saya tidak mendapatkan jaringan PLN. Kasihan anak-anak saya yang masih bersekolah. Melalui surat pembaca ini saya mengetuk pintu hati bapak-bapak terhormat yang berkompeten dalam masalah ini. Terima kasih saya ucapakan kepada Harian Waspada atas dimuatnya surat ini. Syamsir Harahap


14 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

Bursa

AUTOMOTIVE Informasi Pembaca

AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

BMW 318i Thn. 89/90 Nama sendiri. Sangat istimewa. Mulus dan mewah sekali. Dijamin. Hrg. 38Jt Nego. Hub. 0812 64777 088 CHEROKEE ‘95 4x4 M/T, AC, RT, VR, BR 31”, PW, PS, Biru tua Met, jok Klt, DP 22 Jt. Angs: 2,33. Mercy C180 ‘95/’94, ABS, A. Bag, Jok Klt, AC, RT, VS, BR, DP 31 Jt. Angs. 3,1x 23 Hub. 68790794, 061.76700976 CHEVROLET TROOPER Thn. 89. Gardang 2 diesel, Asli Medan, AC, Tape, VR, BR, PS, PW, Mulus, siap pakai. H. Rp. 95Jt damai. Hub. 0812 650 8819 DAIHATSU Espass 1.6 S. Van ‘96, Mrh Met. Sliding Door, AC, RT, VR, BR, DP 13 Jt. Angs. 1,2Jt. TYT. Kijang LSX EFI ‘01/’02. Biru Met, AC, TP, VR, BR, DP 22 Jt. Angs: 3,47Jt. Hub. 76700976 - 7876495

DAIHATSU Charade Dijual Thn. ‘82 Warna biru. VR, BR, Tape, Ven.Hub. 0815 302 0076 DAIHATSU Espass MB 96 - 1.6 Merah metalik. Mulus, Terawat, AC. VR, BR, Tape. H. 32Jt Nego. Komp. Medan Estate B III No. 32. Desa Lau Dendang. Hub. 0812 6389 4717 - 0813 9725 3351

DAIHATSU Zebra 1.3 Jumbo. Pick Up Thn. ‘95. W. Hitam, Sehat. H. 20 Jt. Nego. Hub. 0813 70654 681 TP DAIHATSU Espass 1.3 MB Thn. 96 Orisinil. Pintu Sorong Asli Medan. VR, BR, RTP, AC DB. Dingin. Hrg. 37 Nego. Hub. 061-9135 6484 DAIHATSU Charade CS Turbo ‘87. Wrn. Hitam BK Mdn AC/TP/VR/BR. Mesin, body mulus, terawat. Hrg. Rp. 18,8Jt. Nego. Hub. 061-68741303 TP. Hub. 0812 6098 9810

DAIHATSU Zebra Pick Up Espass Thn. 2003. W. Hitam. BK Mdn. Harga Rp. 35Jt/Nego. Hub. 0816 3113 014 HONDA City New IDSI ‘04. Tiptronic, M/T, Airbag, ABS, Htm, BK Mdn, Tgn. I Ass. A/R. DP 30Jt. Angs. 4,9Jt. Hub. 76700976

5 CM 6 CM

Rp. 65.000 Rp. 78.000

ISUZU Panther Bravo Cruider Thn. 95. PS, PW, CL, Remot, AC DB, Pajak Baru perpanjang. Mobil mulus, cantik. H. 45Jt.Nego. Hub. Dr. Dewi H. 0812 6596 4197 - 0812 6359 9200 (no sms TP) MITSUBISHI LANCER GLXI THN. 96 Warna biru muda, BK Medan asli. Orisinil, Peminat serius Hub. 061-77022 - 668

Rp. 91.000 Rp. 104.000

TOYOTA Kijang Petak Thn. 86 MB. PS, Asli Medan. Harga Rp. 14Jt. Hub. 061-77584982 TOYOTA Kijang LX 2002. Pajak Full 1 Thn. Rp. 100Jt. Hub. 0813 6118 1851

MITSUBISHI GALANT V6 THN. ‘95 Tangan 1 Asli Medan. Hijau Metalic. Tape, AC, VR, BR, PS, PW, CL. Lengkap. Cantik & Bagus sekali. Rp. 52Jt/Nego. Hub. 6645446 - 77665972

TOYOTA Kijang Commando Long DIjual Cepat. Thn. 87, Biru met, 5 Speed, BK Medan asli, lampu Grand, VR/BR, Siap pakai. Hanya Rp. 32Jt. Jl. Menteng VII Gg. Sepakat No. 10 B. HP. 0813 7095 5133

SUZUKI Carry Real Van. GRV Thn. 97 Biru langit. BK Medan Asli, siap pakai. Harga Rp. 47,5 Juta/damai. HP. 0812 6545 1974

TOYOTA COROLLA GREAT 93 AC, Tape, VR, BR, BK Mdn. Wrn. Abu2 gelap mulus. Hub. 0813 7015 4503

SUZUKI Escudo 2.0 Thn. 2004. Coklat met. Plat BH Rp. 124 Jt. Hub. 0816 3113 953 SUZUKI Escudo 2.0 Thn. 95/ 06. Coklat met. BK Mdn Asli Rp. 134Jt. Hub. 77863981

- Toyota Kijang LSX Up Thn. 2003 W. Biru - Diesel - Toyota Kijang LX Thn. 2003 W. Hitam - Bensin - Toyota Kijang LGX Thn. 2001 W. Biru - Diesel - Toyota Kijang LSX Thn. 2001/2002 W. Abu-abu Diesel - Toyota Kijang LSX Up Thn. 1999 W. Abu-abu -Diesel - Toyota Kijang LGX Thn. 1997 W. Merah -Bensin - Suzuki APV Thn. 2005 W. Biru Mica Type L. Dijual Cash & Credit / Tukar (+) Hub. Jl. Mustafa Gg. VII Telp. 061- 6623810

SUZUKI Carry Minibus Thn. 86 Dijual. Warna biru, BK Medan. VR, Tape. Mobil siap pakai. Harga Nego. Hub. 061-77041653

SUZUKI KATANA 88 Wr. biru mulus, BK Medan Asli. Mobil siap pakai. Hub. 0812 6553 7423 SUZUKI SIDEKICK ‘97 DRAG I Warna ungu met. Mulus, original. Hub. Jl. G. Krakatau 2 No. 5. HP. 0811 615 276

TOYOTA Crown 2.0 Super Salon M/T. Thn. 95. Hitam met, BK Mdn asli. Rp. 59Jt. Hub. 0812 6594 2789 TOYOTA Kijang Grand Extra dijual. Thn. 93 Hijau met. Tape, AC DB, PS, PW, CL, VR, BR, Mobil sangat mulus, Ban baru. Hrg. 67Jt. Damai. Hub. Rumah Makan Surya Baru Jl. Karya No. 90 Sei Agul. 20 Mtr. Dari Simpang (4) Lampu Merah.

TOYOTA Kijang Kapsul SSX Thn. 97 Diesel BK Medan. W. Biru metalik. Jok asli. Toyota Kijang Gren Extra Thn. 95. Biru metalic. HP. 0812 655 3275. Tel. 8442320

ISUZU Troper Thn. 88/89. W. Silver met. 4x4 diesel. 5 pintu. VR, Cobra, BR, Baru, AC, Tape, PS, PW. H. 44Jt Nego. Hub. 0878 6886 5261

TOYOTA Kijang LGX Diesel 2002 Warna Green Dark Metalic. TV, DVD, Ban Maxxis Rp. 133 Juta (Nego). BU. Hub. 0852 6116 4636

ISUZU PANTHER THN. 95/96

TOYOTA 100% BARU

Grand Deluxe, Asli Medan, W. biru, Body kaleng2, AC, VR, Tape, mulus sekali. H. Rp. 60 Jt/Nego. Jl. Kamboja Raya No.84 Blok XVIII (dpn. ktr.Lurah) Perumnas Helvetia. Hub. 76684380, 0816 3191 836

7 CM 8 CM

AVANZA (READY),RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX. “Avanza DP 20 Jt-an” Hub. 0813 7512 7297 - (061) 7795 1428

TOYOTA Kijang Kapsul Th. 97 Bensin. Warna Hijau met. Tape, VR, BR, Cat mulus. AC DB, H. Nego. Hub. 061-9134 6296

TOYOTA Kijang Grand Extra ‘93 wrn abu2 met. Mulus. Hub. Jl. G. Krakatau Gg. Berkat I No. 6 HP. 0813 6104 7788

9 CM Rp. 126.000 10 CM Rp. 140.000

Bursa

BUTUH UANG

11 CM Rp. 165.000 12 CM Rp. 180.000

Bursa

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

SERVICE/AKSESORIS MOBIL

Rabu, 22 Juli 2009

FAX.4561347

Bursa

Toyota Kijang LGX Biru Mica Diesel 2001 Toyota Kijang LSX Hijau Diesel 2001 Toyota Kijang LGX Abu-abu Diesel 2000 Toyota Kijang LSX Abu-abu Diesel 2000 Toyota Kijang Super Hijau 1996 Toyota Kijang P-Up Hitamn Bensin 2005 Daihatsu Terrios TX Hitam 2008 Cash - Credit - Tukar Tambah Jl. Mustafa Depan Gudang Bulog Telp. (061-6641366)

Bursa

SEPEDA MOTOR SUZUKI Smash ‘08 (Tromol) mulus. Jarang pakai. Spt. Baru. Serius Hub. (061) 77518810

HONDA Supra X Thn 2002 Akhir Dijual, Terawat, Harga 5,8 Jt, TP Hub. (061) 3037.3367

Bursa

ELEKTRONIK

KOMUNIKASI

AND AB UTUH D AN A TUN AI ??? ANDA BUTUH DAN ANA TUNAI

KAMERA PENGINTAI BENTUK PULPEN

JUAL BLACK BERRY Storm 9500 Rp. 3,5 Jt

ANDA BUTUH DANA

Pulpen kamera ini bisa digunakan untuk merekam suatu tempat atau merekam seseorang tanpa diketahui. Hasil rekaman dapat dilihat melalui komputer / laptop. Dapat merekam gambar dan suara (jelas dan berwarna). Dapat merekam dengan kapasitas max. -/+ 6 jam (4 GB). Pulpen kamera ini bisa dibawa-bawa / dikantongi saat bepergian. Harga: Rp. 600.000.

(Tanpa Kabel Tanpa Listrik)

Kontan dan Cepat, Jaminan BPKB Mobil Thn. ‘92 Up Proses Cepat, BPKB Aman, Dana Langsung Cair. Hub. Mr. Yan’s:06177631 725, 0815 3447 0666

Jaminan Apa Saja, Sertifikat Tanah. Proses Cepat, Syarat Mudah. Hub. 061-8222774, HP. 0816 314 1807

Hub. 0813 7550 6908 NB: Harga tersebut diatas sudah fix.

BUTUH DANA CEPAT

Jaminan BPKB mobil min Th. 89. Truk Th. 93 keatas. Proses cepat, leasing resmi. Ansuran dapat diketahui, Hub. (061) 7731.1945 / 0813 7000 0055

JUAL & BELI TV, PS 1, 2, 3. Laptop, LCD Projector. Handycam Camera, Keyboard, Kulkas, M. Cuci, Sound, dll. Hub. MARKET ELECTRONIC. Telp. 821.0097. 66900693. Jl. Setia Budi No. 424B Dkt. Ring Road.

ZIDAN GAME PS GARANSI 13 BLN

BUTUH UANG KONTAN??? Jaminan BPKB Mobil 1980 keatas. BPKB Sepeda Motor & Surat Tanah. HP. 0813 6127 9181 - 0813 6126 2828

WASPADA

xpress

PS 2 Baru Rp. 1.350. Rekondisi Rp. 1.200. PS 1 Rp. 350 HDD Rp. 1.950 PSP 4 GB Rp. 1.650 NB: Service PS 1, 2, 3 Telp. 77418902 Jl. Sei BT. Hari No. 2 HR. Hakim No. 104

Bursa

ELEKTRONIK

TOYOTA Kijang Kencana ‘91. Wrn. Abu2 met. Mulus. Hub. Jl. G. Krakatau Gg. Berkat I No. 6 HP. 0813 6104 7788 TOYOTA Kijang Capsul LSX - Diesel Thn. 97. BK Asli Medan. Biru metalic. Tape, AC, VR, BR, PS, Cantik sekali. Rp. 92Jt/Damai. Hub. 0819 7314 9838 - 0888 781 6481

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

HARGA BELUM TERMASUK PPN 10%

Javelin 8900 Rp. 3,3 Jt, Bold 9000 Rp. 4,1 Jt Iphone 3G 16. GB Rp. 8 Jt & NOTE BOOK NOKIA ESeries NSeries GARANSI Pemesanan Diantar Telp: 0813.7034.6677

MAU JUALAN PULSA DENGAN BONUS HINGGA PULUHAN JUTA RUPIAH ??? 061-76216.595 - 0813 76704 595 Service

ELEKTRONIK SERVIS CUCI AC, ISI FREON, BONGKAR PASANG.

AC

REPARASI, AC CENTRAL. FLOOR STANDING Hub. DIFA SERVIS

AC

0813 9735 7061

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7050 8047 - 0813 7589 8757 Siap Ketempat

AC

AC

7030118 76750084

KULKAS, M. CUCI DISPENSER (BERGARANSI)

LEONI SERVICE

CUCI/SERVICE AC, PERBAIKAN AC, BONGKAR PASANG AC, MESIN CUCI, KULKAS. FREEZER Hubungi: 0812 6300 746

AHLI TOSHIBA, SONY, LG, POLYTRON JVC, SHARP, TV CHINA, DLL: MASTER TV

Hubungi segera... Sari di 0858 30777 555

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Bursa

PERCETAKAN

Hub. Jl. Cemara Gg. Seri 19 P. Brayan Medan (Antara Jembatan Layang Dengan Jl. Krakatau P. Brayan)

MAJU TEKNIK

Rp.300.000,-/1000 watt

Bursa

BUSANA & AKSESORIS

TV

ditempat murah Garansi 77621674 RIDWAN Siap

7862634 HP.0812 6303 4400

KERTAS

Print

Computer

Untuk: SERTIFIKAT, PIAGAM, PROPOSAL, UNDANGAN, KARTU UCAPAN, DLL Ukuran: KAJANG D/FOLIO, F4, A4, SPECIAL Hub: Toko Kertas SUKAMAJU Jl. Surabaya No. 77 Telp.: 4573961

Service

KONSTRUKSI

SERVICE / BERGARANSI CUCI - T. OBAT - BONGKAR PASANG

WC TUMP AT, Sal. AIR, K. Mandi TUMPA Tel. 7878078 NARO SERVICE Jl. Sisingamangaraja

TERCECER / HILANG

Tumpat Sedot

AC

Telp. 77677220 HP. 0813 7536 4412

TERCECER 1 (Satu) buah BPKB B 1458 UP Isuzu/Minibus. Nomor Rangka MHCTBR54BTOD9528 Nomor Mesin E009528 Milik Ibrahim Lubis Komplek Deppen Blk E722 RT 04/10 Cimanggis Harjamukti 16954

TERCECER 1(Satu) Buah BPKB Asli STNK BK 4324 DU. a/n. Boy Rahman. Alamat Jl. Durung No. 46 Kel. Sidorejo Medan.

TERCECER

1 (Satu) Buah BPKB Asli No. 2566734B. STNK BK 165 FA a/n. SAHLAN. DRS, SH Alamat Jl. Gaharu No. 56 Kec. M. Timur Medan. HILANG BPKBMobil Mits. Kuda. BK 1692 EC. atas nama Shinta Enrica Alm. Jl. Timor/Timor Raya 44 - 45. Kel. Gaharu Medan. No. BPKB 9224510-B

TELAH TERCECER BPKB Asli BK 1242 YG. a/n. EL DELINA SIREGAR. Dusun Sidorejo RT Selatan L. Batu TERCECER BPKB + STNK Honda GL Pro. Thn. 1997. BK 4848 FI. a/n. MUNJIMIN Jl. Mistar No. 65 Medan. Hub. 061-7762 9909 TELAH TERCECER Akta Notaris Reny Helena Hutagalung, S H . Te n t a n g P e m i n d a h a n D a n Penyerahan Hak Dengan Ganti Rugi No. 21 Tgl. 11-05-2002 a/n. Jhoni Bangun di Jl. A. Yani - Jl. Iskandar Muda Medan. Hubungi Telp. 061-77799973.

TERCECER / HILANG 1BPKB Toyota No. 5807251 B BK 828 FW. a/n. Hidayat Jl. Sutomo No.167 B Medan. Yang menemukan mohon dikembalikan TELAH TERCECER 1 (Satu) BPKB Spd. motor a/n. M. Rafiq Nurhadi. BK 6872-GV (alamat lama Jl. Amaliun/Jl. Santun No. 29 Kotamatsum 4 Medan). Tercecer disekitar Jl. Hindu s/d Jl. Listrik Medan. Bagi yang menemukan mohon hub. Jl. Amaliun Gg. Tak Bernama. No. 10/Gg. Medan HP. 0852 7581 0000 / 061-7647 6306 akan diberi hadiah sepantasnya. TERBAKAR

Telah hilang karena terbakar sebuah Surat Tanah yang terletak di Jl. Bromo Gg. Pukat Ujung dengan ukuran Luas +/- 400M. Atas nama Abdul Majid SK (Alm). Adapun Surat Tanah tersebut betul ikut terbakar pada saat terjadinya kebakaran di Jl. S. Parman G. Baru pada bulan September 2008. Pada Surat Tanah telah tercantum nama ahli waris diantaranya: Lismaini, Abdullah, Abdul Hamid, Wardani, Salmah Nur, Syamsidar, Misnahwati, Buyung (M. Thamrin), M. Azwar, Amiruddin. Demikianlah Pemberitahuan ini kami sampaikan, atas perhatian semua pihak diucapkan terima kasih.

TERCECER

Telah Tercecer / Hilang Asli Surat Tanah Kepala Kampung Sidorejo, Kecamatan Percut Sei Tuan. Tahun 1968 atas nama Bongkot Sinaga. Yang berlokasi di Jl. Keruntung / Rela No. 64 Kelurahan Sidorejo Kec. Medan Tembung Kota Medan.

WC

Jl. Krakatau Medan

081.37566 8211

Telp.

SAL. AIR

M. HARI

WC WC

Ada Garansi

TUMPAT/ SAL. AIR

Hub.8477835

061-77077334

Jl. Gaperta Gg. Partiasa No. 8 Bergaransi 3 Bulan

ANDA TUMPAT - SEDOT

Hub. 8219951 Jl. Setia Budi No. 2 Jl. Brayan Medan

8442246 WC 0812 642 71725 ADI

Tumpat Sedot

Telp.:

WC

WC

Tumpat Sedot

M. SAFII

Ada Garansi

TUMPAT/ SAL. AIR

845.8996 0812.631.6631

Bergaransi/ Setia Luhur 160 F

Jl. Setia Budi / Tj. Sari

Telp.: Flexi:

8442271 77944642

Jl. Gatot Subroto Medan

FD CD

KIRIMKAN... DATA IKLAN ANDA DALAM BENTUK

DIGITAL

Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347

* Format: JPG - TIFF (Photoshop)


Agenda 15 Rossa Bakal Bercerita Tentang Cinta Di Medan Studio Berebut Tampilkan

WASPADA, Rabu 22 Juli 2009

Rossa

Setelah sukses mengguncang Jakarta, Surabaya, dan Bandung, Rossa baru saja menyandang predikat janda muda ini bakal menularkan demam cintanya di panggung gedung Selecta Medan 25 Juli 2009 mendatang, begitu dijelaskan Sugema Naga Sakti -public relation Marketing-Program Director PT Limabelas Cipta Kreasindomanagement Rossa sekaligus promotor saat bertemu wartawan Selasa (21/7). Menurutnya, rangkaian tur tujuh kota Rossa menuai kesuk-

DIBUTUHKAN SEGERA Dibutuhkan 2 orang Wanita untuk ADM/ Keuangan pada sebuah lembaga yang konsen terhadap pemberdayaan UKM, dengan syarat-syarat sbb: - S1/ D3/ D2 Akuntansi - Usia 20 - 30 tahun - Jujur dan Ulet

Pendaftaran Dimulai: Tanggal 16 - 27 Juli 2009 Pada jam: 08.00 s/d 15.00 Wib Pelaksanaan Ujian: Ekstensi: Tgl. 28 - 29 Juli 2009 Reguler Mandiri: Tgl. 29 Juli 2009

Terakreditasi BAN PT (Nilai B) SK No. 037/BAN - PT /ak-IX/S1/III/2006

MENERIMA MAHASISWA/I BARU PROGRAM S1 KEPERAWATAN EKSTENSI & REGULER MANDIRI TAHUN AKADEMIK 2009/2010 GELOMBANG II HarianWASPADA Bursa

PENDIDIKAN

Sekretariat: Jl. Prof. Ma’as No. 3 Kampus USU Medan Telp. (061) 8213318 Fax. (061) 8213318 http: //www.psik-fkusu.ac.id/ Contact Person: Jefri Irmanda, SKM: 0812.631.6639

INGIN DPT KERJA ???

Moratama TC, Pusat Lat. Mekanik spd motor, Belajar 4 bln tamat, Jadi mekanik, Dpt sertifikat, Instr: Drs. Sakti Rambe, AMd HP. 0813.7556.9830 - (061) 7882.846

TERAKREDITASI BAN PT

AKBID

WIDYA HUSADA

Jl. Pancing/ Willem Iskandar 116 Telp. (061) 662.1202 - 662.1201

MEDAN IZIN DIKNAS No. 249/D/O/2002 IZIN DEPKES No. HK. 03.2.1.1.2203

PENDIDIKAN TENAGA KESEHATAN AKADEMI FISIOTERAPI SITI HAJAR MEDAN

SATU-SATUNYA TERAKREDITASI “B” DI SUMATRA

PENERIMAAN MAHASISWA BARU T.A. 2009/2010 PENDAFTARAN MULAI SEKARANG !!!

LEBIH MUDAH BEKERJA

Menerima Mahasiswi Baru Angkatan ke VIII T.A. 2009/ 2010 Bagi Tamatan SMA/ SMK/ ALIYAH SPK

“TESTING GELOMBANG I I TGL. 5 AGUSTUS 2009” Informasi Lengkap: 1. Dr. H. Wirsal Hasan, MPH, HP.0819.863.979 0812.639.88388 2. Dr. Hj. Sundari Syarif HP.0811.618.011

Informasi lebih lanjut hubungi: Kampus AKFIS SITIHAJAR MEDAN

B. Diploma-III (D-III)

1. Akademi Keperawatan (AKPER) Angkatan-XVIII 2. Akademi Kebidanan (AKBID) Angkatan-XIV 3. Akademi Analis Kesehatan (AAK) Angkatan-XVIII 4. Akademi Analisa Farmasi & Makanan Angkatan-XVI (AKAFARMA) 1. D-III Kesehatan 2. SMU/ SMA/ SPK/ MAN/ SMK Semua jurusan

DAN

YAYASAN PENDIDIKAN Dr. RUSDI Berdiri Sejak Tahun 1989

Menerima Mahasiswa Baru TA. 2009 - 2010 untuk Akademi - Akademika Kesehatan * Akademi Perawatan (Akper) * Akademi Kebidanan (Akbid) * Akademi Analis Kesehatan (AAK) * Akademi Analis Farmasi (Akafarma) * Akper Jalur Khusus Pendaftaran Mulai Sekarang (Testing Gel. II = 5 Agustus 2009) Tempat Pendaftaran / Informasi Hub:

Kampus Akademi Kesehatan Dr. Rusdi Jl. Sutan Oloan No. 1 Komp. Pondok Surya Helvetia Medan Telp. 845 5304 - 847 5679 845 0654 - 847 4290 Hp. 0812 6342 1769

LB LT RM RT

Zodia asal Papua, T: 1M, Sdh berbunga, Hrg 15 Rb/ pot Hub. 0813.7066.7221

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

INDUSTRI LILIN

Kami Menjual Lilin Jadi Bahan Buat Lilin, Mesin Lilin Cocok untuk Grosir/ Agen, Maupun yang mau buka pabrik lilin se Indonesia Hub. 0852.6229.0058 - (061) 844.2134 (Jam Kerja, No SMS)

KERJASAMA

Kami Tim dgn Ratusan Guru cr byk Mitra bg Ibu2 mau bk usaha bid private les (Bg hsl) T: 0852.6273.9457

DIBUTUHKAN

Tukang Jahit pakaian Wanita dan Tukang Jahit Bordir yang berpengalaman secepatnya Yang berminat hub: 0852.7016.6065 - 0813.9600.0750

DIBUTUHKAN GURU Bidang Studi: - Biologi - Matematika - B. Inggris - Penjaskes - BP - Ekonomi - Mesin Untuk Tingkat SD, SMP, SMA, SMK Perkapalan Kirim Surat Lamaran ke: YAYASAN HANG TUAH BELAWAN Jl. Bengkalis No. 1 Belawan Telp. (061) 694.0586/ 0813.7627.7770

Rumah Uk. 4x16m, SHM, PLN, PAM, Telp, 2 KT, 2 KM, 2.1/2 Tkt, Katamso Square T. Kuning, 375 Nego Hub. 736.4710 - 7791.0154

KRISNA WATER

RUKO/ KIOS DISEWAKAN

PELUANG BISNIS

Jl. Ring Road (dekat Iga-iga Bakso) Tanjung Sari ,Cocok utk usaha makanan, dll Khusus Muslim, Rp. 18 Jt/ thn Hub. (061) 773.893.61/ 0813.9655.7571

1. Pemasangan Depot Air Minum Dengan Sistem Filtrasi & Ro

Rp. 22 Jt s/d 38Jt

2. Air Pegunungan 6700 s/d 7000 Liter

RUMAH DIJUAL

Komplek Pemda Tk. I Tanjung Sari Jl. Cempaka 3 No. 22, Kamar 3, Kamar Mandi 3, SHM Hub. (061) 7777.0342 / 0812.633.1231 DIJUAL 1 UNIT RUMAH

Jl. Pasar I Gg. Gayo No. 18 Tanjung Sari Medan (dekat Ring Road), SHM, 5 Kamar Tidur, 3 Kamar Mandi, 3 Unit AC, Kitchen set, Mini bar, Luas Tanah 295m2, Lebar Tanah ± 200m2 Hub. (061) 7783.7909

RUMAH DIJUAL CEPAT

1 (satu) unit Rumah Baru Siap huni, Uk. 5,5x17m, Lokasi Jl. Datuk Kabu Psr. III Gg. Jawa Tembung Fasilitas: Full keramik, 2 KM, PLN, Air Bersih, Teras biasa, Surat SK Camat, Tanpa perantara Peminat hub HP. 0813.7507.1114

DIKONTRAKKAN

Ruko Lantai Dasar 2 Pintu jd satu, 8,5x26m, Lengkap, Air, List, Gas Negara, Ada Genset, Kipas angin ± 10 unit Lokasi strategis blh buka usaha apa saja Harga 40 Jt/ Thn bs nego Hub. 453.6392/ 0811.607.536

DICARI

Rp. 230.000 / Tangki

Menyediakan Mesin RO dan Yamaha

UMROH RAMADHAN 1430H MURAH - NYAMAN

1. UMROH REGULER 11 HR BERANGKAT 20 JULI 2. UMROH REGULER 9 HR BERANGKAT 11 AGUSTUS 3. UMROH RAMADHAN AWAL 21 AGUSTUS 4. UMROH PERTENGAHAN RAMADHAN 7 SEPTEMBER 5. UMROH AKHIR RAMADHAN 11 SEPTEMBER 6. UMROH 1 BULAN RAMADHAN 21 AGUSTUS S/D 21 SEPTEMBER

USD.1650 USD.1500 USD. 1600 USD. 1700

USD. 2400 USD. 2500

INFO DAN PENDAFTARAN HUBUNGI:

MULTAZAM

TANAH L. 5882M2 DIJUAL CEPAT Lokasi Strategis, Pinggir jalan lintas Sumut dekat Simpang Merbau Lab. Batu, SHM, TP Khusus Muslim, Harga 2 M Hub. 0812.6076.5099 A. Rahman AIR MINUM

Bursa

PENGOBATAN

BUTUH ALA TB ANTU DENGAR? ALAT BANTU TRA HEARING AID Hub. MEL MELTRA Jl. Kediri No. 36 Medan Tel. 4516161

WASPADA

JL. TITI PAPAN/ PERTAHANAN NO. 10 SEI SIKAMBING TELP. 061- 457.6116/ 7731.3385 HP. 0812.6566.807 - 0813.61372.321 TANAH Dijual, SHM, Uk. 11x19,5m, Hanya 100m dari Jl. Pancing/ Jl. Karya Bakti dekat Kampus Unimed, Hrg 175 Jt/nego, TP Hub. 0813.7066.7221

Hubungi: CV. HYDRO UTAMA Jl. Kapt. Muslim No. 53-d Medan Telp. (061) 8457879 / (061) 77839790 HP. 0812 600 5410

Ingin Promosikan Produk Anda Harian

(SEGERA DAFTAR SEKARANG) SEAT TERBATAS

Bursa

Beberapa orang Tukang Pangkas yang berpengalaman, Jujur, Baik, Niat bekerja, Sopan, Jaminan Rp. 30 Rb Bisa Nego Hub. Gulo 0813.7047.4964 (Pangkas Rapi) Jl. Bahagia By Pass Simp. Sempurna Medan, iklan ini berlaku beberapa minggu, makanya simpan nmr nya dan hub bila anda butuh pekerjaan

Model Terbaru

Harga Ter Murah

RUMAH Mwh Hrg Murah ! Akses Tol Bandara, ± 15 mnt Mdk Walk, DP 20 Jt-an, Angs: 1,8 Jtan, Hadiah G. Prize: Dht. Xenia H u b . 0819.7304.8763/ 6961.0305/ 7670.0975

Media yang Tepat untuk Iklan Anda

PENGOBATAN TRADISIONAL

MENGOBATI: - Belum mempunyai keturunan - Tumor, Kanker payudara - Kista, Mioma, Tumor rahim Tanpa operasi, Dengan ramuan tradisional Hub. 0813.6115.0061

THE MASTER

Ingin memiliki kemampuan spt Limbad/ Dedy Corbuzier? ingin menguasai Illusionis/ Mentalis/ Hipnotis? Kami siap membimbing anda Hub kami di HP. 0813.6165.7799 0812.6375.991 Jl. G. Singga Mata No. 26 Dekat Kampus UMSU Glugur

SPECIALIST SOFA (REPARASI & TEMPAHAN) K. Sofa, Makan, Kantor, Jepara, Spring bed, Ganti Kain/ Kulit + Busa, NB. Terima tukar tambah sofa Ayong 662.8642 - 0813.6153.6320 TEMPAHAN MURAH -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Spring Bed 3 kaki 2 lapis Spring Bed 3 kaki Dorong

Rp. 1.100.000 Rp. 1.075.000 Rp. 1.000.000 Rp. 900.000 Rp. 1.000.000

#PONDOK KEBATHINAN & TASAWUF NUR ILLAHI# ILMU DARI MADINA, YOGYAKARTA, BANTEN AKTE NOTARIS NO: 07/NA/2009

Apakah Anda Telah Meminta Bantuan Kemana-mana?Tetapi Belum Merasa Puas? I. Pengobatan Medis & Non Medis: Diabetes, TBC, Typus, Lever, Kanker, Stress, gila, kena guna2, dsb (Mahar ikhlas) II. Pelarisan usaha, Kharisma, Daya Tarik, Pemikat, Karier, Jabatan, Benteng diri, Kekebalan, Pemasangan Susuk, Mandi Minyak panas, Pengisian, Khadam, Pengisian air raksa, dsb

Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802

LOWONGAN #BUTUH SEGERA#

Hub. PAK RANDI

Alamat: Perumahan CENDANA ASRI Blok AC/ 06 Kampung UNDIAN Tj. MORAWA (masuk dari simpang Timbangan Jl. Limao Manis Tj. Morawa) Telp. (061) 7778.9233/ 0812.6083.5345 (No SMS) NB. Ribuan Orang Telah Tertolong & Membuktikannya

Perusahaan bertaraf INT’L, butuh tenaga kerja P/W (17 - 39 thn) untuk posisi di kantor, Syarat: - Bawa KTP + Pas photo Uk. 3x4 (2 lembar) - Guntingan iklan ini untuk proses interview, syarat lain bisa menyusul setelah diterima Penghasilan Rp. 1,5 Jt s/d 3,5 Jt/ bln (Sesuai Posisi Anda) HUB: IBU AISYAH, AMd

HP. 0813.6388.5458 Tdk Melayani SMS Alamat kantor:

Jl. KH. Wahid Hasyim No. 118 A Simpang Barat masuk dari Gatot Subroto Medan NB: Pendidikan min SMU/ sederajat, pengalaman kerja tdk diutamakan

061-6846 2888 061- 6846 3888

Bursa

BUSANA / AKSESORIS

PECI MAHKOTA MENJUAL PECI TEMPAHAN Berbagai Model Dan Warna Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Depan Gg. Sadu Medan

Bursa

Bursa

ALAT PESTA

MATERIAL BANGUNAN

PELAMINAN

Dijual Pelaminan/ Pakaian Adat Mandailing, Jawa, Melayu, dll (Kondisi 90% baik) Lengkap akccesories: Kain dinding, Kamar pengantin, Lemari kaca, dll Hub Telp. (061) 451.0895/ 0816.310.2646

Bursa

TROPHY/ WISATA

DIBUTUHKAN

C. Menerima Lulusan:

YAYASAN RSU Dr. RUSDI D/H GLUGUR

GR : Garasi KM : Kamar Mandi KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik

Dibutuhkan beberapa Tukang Lap/ Tukang Cuci mobil dengan persyaratan sbb: 1. Pria 2. Memiliki KTP 3. Umur max. 25 thn 4. Jujur Bagi yang memenuhi syarat lamaran diantar langsung ke: POLONIA STATION JL. MONGONSIDI NO. 2 MEDAN

1. Kesehatan Masyarakat (SKM)Angkatan-X 2. Keperawatan (SKp) Angkatan-IX

Jalan Kapten Muslim No. 79 Medan Telp. (061) 847.6769 - 845.2687 HP. 0813.6209.2630

DJUAL TANAMAN PENGUSIR NYAMUK

Informasi Pembaca Bursa Property

LOWONGAN KERJA

MENERIMA MAHASISWA/I BARU A. Program Sarjana (S-1)

Informasi selanjutnya & Pendaftaran:

Bursa

Lamaran diantar ke: BENGKEL STAR-SERVIS JL. SETIA BUDI PSR. V NO. 435/ 88-S

“TERAKREDITASI”

Biografi Michael Jackson sepertinya akan naik layar. Beberapa studio besar kini pun tengah memperebutkan hak distribusi cuplikan latihan terakhir konser The King of Pop. Seperti dikutip dari Aceshowbiz, Selasa (21/7), Viacom’s Paramount/MTV, NBC Universal, Sony Pictures dan News Corp’s 20th Century Fox/Fox Broadcasting Co tengah berlomba-lomba mendapatkan materi-materi video latihan terakhir Michael Jackson. Mereka berencana mengubah materi-materi tersebut menjadi sebuah film panjang. Kabarnya, AEG Live, promotor konser ‘This Is It’ akan melelang materi-materi itu dengan harga US$ 50 juta. Materi-materi video menampilkan persiapan Michael Jackson untuk konser ‘This Is It’, mulai dari proses audisi pendukung konser hingga aksi Michael menyanyikan lagu Thriller’ dan ‘Beat It’.(dtg) PELUANG BISNIS

Persyaratan: 1. Foto copy Ijazah terakhir 2 Foto copy KTP 3. Surat lamaran kerja

SARI MUTIARA

Jacko Di Layar Lebar

Bursa PROPERTY

DIBUTUHKAN

PENDIDIKAN TENAGA KESEHATAN

Kampus Pendidikan Sari Mutiara

tuk kedua kalinya. Bahkan album baru Rossa menduduki penjualan paling laris saat ini. Dalam konsernya nanti di Medan, Rossa bakal mengajak penggemarnya untuk merenungkan kembali arti Cinta, menghayatinya sekaligus merayakan pahit manisnya cinta di Cerita Cinta. Lewat tembangtembang histnya antara lain Nada Nada Cinta, Tegar, Hati Yang Terpilih, Pudar,WanitaYang Kau Pilih, Atas Nama Cinta dan tentu saja Ayat-Ayat Cinta yang mencatat sukses luar biasa.(m09)

Tenaga Kerja/ Karyawan, bergerak di bidang perbengkelan bersedia ditempatkan, di Psr. Merah, Pondok Kelapa, Setia Budi Posisi sebagai: 1. Kasir (Wanita, SMP/ SMA sdrjt 2. Doorsmemer (cuci mobil) 3. Mekanik (Pengalaman) 4. Pb. Mekanik 5. Tk. Cat

Jl. Jamin Ginting No. 2 P. Bulan - Medan (dekat Kampus USU) Telp. (061) 3008.4600 - 7784.6199 C/P: 0812.6051.835 (Sulaiman) 0813.6159.6851 (Ani)

D. Ujian Masuk: 05 Agustus 2009

hits diantaranya Takdir Cinta dan Kutercipta Untukmu duet bareng Ungu. Album tersebut terjual 220.000 copy dan penjualan masih berjalan sampai sekarang serta telah mendapatkan penghargaan platinum pada bulan Maret lalu. Tahun 2009 ini, Rossa telah menjadi nominasi soundtrack film terbaik dalam Indonesia Movie Award 2009 serta mengantarkannya mendapatkan penghargaan sebagai artis luar negara terbaik dari Anugerah Industri Musik di Malaysia un-

DIJUAL CEPAT

Lamaran (disertai bio data dan foto) diantar langsung ke: Jl. Brigjen. Katamso No. 127/ 415 Medan - 20159 (Kantor PINBIS)

FAKULTAS KEPERAWATAN USU UNIVERSITAS SUMATERA UTARA

sesan bahkan boleh dibilang tiketnya sold out, itu berarti nama pelantun tembang Tegar ini memang masih dicintai penggemarnya. Bahkan tak berlebihan bila disebut sekarang mantan istri Yoyo Padi ini menjadi seorang Diva dengan bayaran paling mahal serta tersibuk, karena tiap minggunya beliau harus berpindah kota melakukan konser ataupun interviu media. Kiprah Rossa selalu fenomenal, dan tahun lalu album soundtrack Ayat-Ayat Cinta dibawakannya menghasilkan tiga

Bursa

LOWONGAN KERJA DIBUTUHKAN

Pengajar TK & Play Group, Min. SMA, Berpengalaman, Islam Hub. 0813.7509.2025 (Ibu Yanti) - 0812.654.6463

DICARI Sgr 25 Lls SMU/ Sdrj U/dididik dan di slrkan menjadi Staff Airline Hub: Jl. KH. Wahid Hasim 92 Medan Tp. 4533875, 4569269 Jl. Karya Wisata No. 23 A Johor TP 7861690 Medan

LOWONGAN KERJA RESMI DI MALAYSIA

Perusahaan Elektronik (COMPANY) UNISEM (M) BERHAD di IPOH, PERAK membutuhkan Tenaga Kerja PEREMPUAN sebagai OPERATOR Fasilitas: - Kerja 4 Hari/ Minggu - Gaji Pokok : RM 440/ bulan - Tj. Kedatangan : RM 60/ bulan - Tj. Makan : RM 30/ bulan - Tj. Transport : RM 30/ bulan - Tj. Shift Pagi : RM 3/ hari - Tj. Shift Malam : RM 6/ hari - Insentive Shift : RM 30/ bulan - Levy : RM 0 Fasilitas: - Asrama Gratis - Transport Gratis - Seragam disediakan - Klinik disediakan - Asuransi di Indonesia & Malaysia SELEKSI DIADAKAN TANGGAL: 27 - 28 JULI 2009 PUKUL: 09.00 WIB Dengan syarat sbb: - Umur 18 - 28 thn - Pendidikan minimal SMP - Mendapat ijin dari orang tua “BIAYA BISA DIPOTONG SEBAGIAN DIMALAYSIA” “BERANGKAT DENGAN PESAWAT TERBANG” Interview dengan membawa:

1. Copy Ijazah, KTP, KK = 2 lbr, 2. Pass Photo 3x4= 2 lbr Untuk informasi dan pendaftaran hubungi:

PT. GENTA KARYA SEJAHTERA SIPPTKI No: KEP.310/MEN/IX/2007

Jl. Tengku Amir Hamzah, Komp. Griya Riatur Blok A No. 100 & 102 Medan Helvetia (± 25m dari Simp . Gaperta) Telp. (061) 846.0205

1. RECEPSIONIST (WANITA) - Tamatan min SMU sederajat - Usia maks. 25 Thn - Blm menikah 2. PERAWAT (WANITA) - Tamatan AKPAR - Usia 27 Thn max - Blm menikah 3. ANALIS (PRIA & WANITA) - Tamatan SMAK - Usia 27 Thn max - Blm menikah 4. SUPERVISOR - S1 Segala jurusan - Berpengalaman min. 2 thn dibidangnya - Berjiwa pemimpin - Dan bersedia ditempatkan wilayah Sumbagut Lamaran diantar/ kirim ke:

LABORATORIUM KLINIK NURUL QOLBI Jl. Sudirman No. 12 Langsa Aceh Utara Atau antar langsung ke: Jl. Karya Kasih No. 58 A Gg. ABRI Medan Johor

DIBUTUHKAN

Beberapa orang Sebagai Pramuniaga, dengan persyaratan sebagai berikut: - Pria dan wanita umur maksimal 20 tahun - Minimal lulusan SLTA sederajat - Dapat bekerja dengan team - Mampu berkomunikasi dengan baik - Berpenampilan menarik - Tinggi badan 160 cm untuk wanita dan 165 cm untuk pria - Melampirkan foto close up seluruh badan - Bersedia ditempatkan di luar kota Surat lamaran di antar langsung ke:

Jl. Nibung Baru No. 63 Medan

Paling lambat 7 hari setelah pengumuman ini

LOWONGAN KERJA

Sebuah perusahaan Jasa Outsourching Security membutuhkan tenaga kerja sebagai:

- MARKETING EXECUTIVE (A) - SECURITY (B)

Persyaratan: - Pria/ wanita tamatan min. SMU sederajat (A, B) - Usia max. 34 tahun (A, B) - Berpengalaman sebagai Marketing/ Pemasaran (A) - Berpenampilan menarik (A) - Berbadan sehat dan tegap (A, B) - Tinggi badan: - Pria : Min. 168 cm (B) - Wanita: Min. 160 cm (B) - Tinggi dan berat badan ideal - Mempunyai kendaraan sendiri (A) - Melampirkan Daftar Riwayat Hidup, Referensi kerja, Pas photo 3x4: 1 lembar (A, B)

Lamaran diantar langsung ke:

WIRA SECURITY ORGANIZER

Jl. Jend. Gatot Subroto No. 325 A Email: wirapradanamukti_wso@yahoo.co.id Telp. (061) 451.4008 - 415.7905 Fax. (061) 415.2041 (Depan Berastagi Supermarket)

HarianWASPADA Tempat Iklan Anda

TANAH TANAH DAN RUMAH DIJUAL Luas Tanah 20 x 40M. Rumah 20 x 10 M. Hub. 061-7742 9883 TP. Harga Nego. Jl. Mesjid Kpt. Muslim Ujung No. 54 A TANAH Dijual Uk. 6.875m2, Ada Rumah Permanen (SHM), Lokasi Jl. Besar Sei Glugur No. 72 Deli Serdang (100meter dari Pekan Minggu/ sblh sekolah Yapim) Hub. 0812.6579.655 , TP

Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di TVRi Tgl. 15 & 25 Juli 2009 Jam 20.00 WIB

Call Center: 0818 090 73481

DIJUAL CEPAT

Tanah Kavling, Uk. 12x26m, dekat Air port Kwala namu International, SK Camat, Harga Rp. 35 Jt/nego Hub. 0819.866.311

- KEBUN SAWIT 27 R DIJUAL Daerah pengembangan Kota Dusun IV Desa Perdamaian - KEC. BINJAT, SHM, H. 155 Jt, Tanah Kosong 10 H di Pasaman Barat, SK Wali/ Camat, Harga 110 Jt TP Hub. 0852.6119.3961 A. Syahroni

PENGOBATAN ALAT VITAL

MAK EROT DITANGANI

HAJI TEJA SYAIFUL

Bursa

PERABOT

JEPARA FURNITURE

Menjual/ Menerima tempahan & reparasi ukiran Jepara, Kursi, Lemari, Alat-alat pengantin

Jl. Denai No. 205 HP. 0852.9708.6572 Cabang Tg. Morawa - L. Pakam Km. 18,5 No. 40 Telp. (061) 9123.5036 Medan

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT

Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Bila Anda ingin periksa jangan salah masuk. Disini tempatnya, Carilah yang benar-benar asli. Perwira yang sempurnya ya disini tempatnya yang lebih joss. Bergaransi seumur hidup tanpa efek samping. Pastikan anda menjadi laki-laki yang luar biasa. Kalau anda penasaran, ikuti terapi ini berlaku untuk semua Agama, ras, dll, Legenda pengobatan Mak Erot sudah tidak diragukan lagi, ribuan pasien sudah tertolong dan sudah disembuhkan di sluruh kotakota di Indonesia, bahkan sampai kemancanagara dari keluhan laki-0laki seperti: Ganguan ereksi, penyakit kelamin secara medis sudah disembuhkan. Terapi Mak Erot ini mengutamakan ramuan. Do’a-do’a, pemijatan dan minyak poles. Tanpa bahan kimia dan tanpa perbedaan, tanpa efek samping. Jangan biarkan masalah anda berlarut-larut. Bagi wanita yang ingin punya keturunan, mau memperkencang dan memperbesar payudara disinilah tempatnya Menangani Keluhan Pria & Wanita KHUSUS PRIA - Ejakulasi dini - Impotensi - Memperbesar, panjang - Keras, Tahan lama

KHUSUS WANITA - Ingin punya keturunan - Memperkencang dan memperbesar payudara - Mengembalikan keperawanan - Mengobati keputihan

HP. 0812.403.8333

Terdaftar Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 Jl. Laksana No. 55J masuk dari Jl. Amaliun YUKI Simpang Raya Medan (Praktek Tetap)

TERAPI KEJANTANAN ALAT VITAL LANGSUNG DITANGANI OLEH AHLINYA M. SUHERDI (DARI BANTEN) HADIR DI KOTA MEDAN Terapi keperkasaan Seksualitas Pria, hasil permanen, alami tanpa efek samping. Di jamin 100% langsung reaksi ditempat untuk semua umur, dan bebas pantangan Menambah ukuran panjang: Yang bisa di pilih 13, 14, 15, 16, 17, 18, 19, 20 cm Juga melayani: Pasang susuk daya tarik pria/ wanita, memeprcepat jodoh, keharmonisan rumah tangga, penghasihan, kewibawaan, buka aura, dll Menambah ukuran besar: Yang bisa di pilih: DIameter: 3,5/ 4,5/ 5,5/-6 Kuat keras dan tahan lama, ejakulasi dini, mani encer, lemah sahwat, diabetes, ingin punya keturunan/ mandul, impotensi, dll MAHAR BUKA SETIAP HARI Rp. 500.000,JAM 08.00-21.00 WB Alamat: Jl. SM. Raja, masuk ke Jl. Utama NO. 18 dari Toko Roti Majestik: 100m HP. 0813.7000.7115 - 0812.6388.7999 Dinkes: No. 448/0648/2008 Izin: B/DSP.5/12/2007

PERAWATAN TRADISIONAL

AURA

PERAWATAN WAJAH ALAMI KECANTIKAN/ AURA PENGOBATAN ALTERNATIF SURAT IZIN DINKES NOMOR 448/484/V/2008

LIS SUSANTI

AHLI KECANTIKAN DARI KOTA BANDUNG PERAWATAN WAJAH GURAH KEWANITAAN - Mengeluarkan Aura (Cahaya Wajah) - Mengembalikan keperawanan - Memperindah bentuk wajah - Mengatasi keputihan - Memutihkan kulit wajah - Mengobati infeksi kanker rahim - Mengencangkan kulit GURAH HIDUNG - Menghilangkan flek hitam - Mengatasi jerawat Membersihkan saluran pernafasan dan membuang lendir-lendir yang PERAWATAN TUBUH mengandung virus - Melangsingkan badan - Menaikkan berat badan MENGOBATI - Mengencangkan/ memadatkan Sinusitis, Ashma, alergi dingin, alergi payudara debu, batuk, migran, membersihkan - Memutihkan badan nikotin, memerdukan suara - Menghilangkan bau badan DENGAN IZIN ALLAH SWT - Cepat untuk mendapatkan jodoh - Mengatasi retaknya rumah tangga, menjadi sakinah mawaddah warahmah - Menyembuhkan kena guna-guna/ kena pelet JL. PURI NO. 23 MEDAN HP. 0813.7050.8635 - (061) 7666.1221

TERAPI KEJANTANAN ALAT VITAL PRIA & WANITA PALING SPEKTAKULER DARI PELABUHAN RATU PANTAI SELATAN Ditangani langsung: BPK. UMAR & UST. A. AZIZ

Melayani Berbagai Macam Keluhan antara lain:

* KHUSUS PRIA, tambah ukuran * KHUSUS WANITA: - Panjang 13 - 16 - 19 - 22 cm - Memperbesar payudara Diameter: 3,5, 4 - 4,5, 5 - 5,5 cm - Terapi perawan/ virgin - Kuat & Tahan lama - Kista, lemah kandungan - Ejakulasi dini, sphilis/ rajasinga - Kanker payudara mani encer - Ingin mempunyai keturunan, dll - Lemah syahwat, Diabetes Buka Setiap Hari impoten, dll Jam 08.00-21.00 - Ingin cepat dpt jodoh, penghlaris usaha, disegani, Mahar Rp. 500.000 atasan, menyatukan & memisahkan PIL/ WIL, puter giling, juga melayani pasang susuk dll izin B-70/DSP.5/II/2007

Bergaransi, alami tanpa efek samping, langsung reaksi ditempat, hasil permanen untuk seumur hidup Alamat Praktek: Jl. SM. Raja depan Taman Makan Pahlawan No. 130 B Medan, samping showroom Auto 2000 dibelakang Bengkel tambal ban HP. 0813.8042.6253


Pentas Demokrasi

16

WASPADA

Rabu 22 Juli 2009

Gerindara Isyaratkan Oposisi JAKARTA (Antara): Ketua Dewan Pembina Partai Gerakan Indonesia Raya (Gerindra) Prabowo Subianto mengatakan, partai berlambang kepala burung Garuda itu akan mengarah menjadi oposisi bagi pemerintahan mendatang. “Wah wartawan ini mancing-mancing terus. Tertapi saya kira sikap oposisi di parlemen itu pasti akan muncul,” kata Prabowo Subianto di sela-sela Rapat Pimpinan Nasional (Rapimnas) II Partai Gerindra di Jakarta, Selasa (21/7). Yang jelas lanjut calon wakil presiden itu, Gerindra akan tetap memperjuangkan kepentingan rakyat melalui program-program ekonomi kerakyataan yang diusung partai nomor urut lima itu. “Siapapun presidennya, kami berharap program-program ekonomi kerakyatan yang kami usung dapat diterima, karena terbukti sistem ekonomi yang sekarang dijalankan tidak memberikan kesejahteraan yang adil dan merata bagi rakyat Indoesia,” katanya. Gerindra sebagai partai politik, tentu akan mengedepankan kepentingan rakyat. “Jadi, perlu

ada check and balances di parlemen. Itu sudah pasti,” tutur Prabowo. Tentang kemungkinan Gerindra membidik kursi kabinet, dengan tertawa lebar mantan Komandan Jenderal Kopassus itu mengatakan “Di tawar saja tidak...,”. Tentang sikap Gerindra terhadap hasil pemungutan suara pilpres 2009 yang akan diumumkan KPU 22 Juli mendatang, Prabowo mengatakan, tim hukum Gerindra yang akan mengkaji dan memberikan rekomendasi atas kajian tersebut. “Yang penting bagi kami, semua harus dijalankan sesuai aturan hukum dan perundangan yang berlaku secara obyektif, tidak berdasarkan emosi atau perasaan,” katanya. Terkait itu Prabowo mengajak seluruh jajarannya untuk benar-benar berpikir bagi kebaikan bangsa dan negara Indonesia ke depan, jangan hanya mendasarkan pada perolehan suara pada pilpres 2009 atau jumlah kursi di parlemen. Rapimnas Gerindra diikuti sekira 200 peserta dari seluruh perwakilan partai di daerah.

Sejumlah KPUD Kabupaten/Kota Direkomendasikan Pecat

Antara

RAPIMNAS GERINDRA: Ketua Dewan Penasihat Partai Gerindra Moerdino (2kiri) didampingi Ketua Dewan Pembina Prabowo Subianto (kiri), Ketua Umum Partai Gerindra Suhardi (kanan) dan Sekjen Partai Gerindra Ahmad Muzani menghadiri Rapat Pimpinan Nasional (Rapimnas) II partai tersebut di Jakarta, Selasa (21/7). Rapimnas tersebut dalam rangka mengevaluasi hasil pemilu presiden serta menentukan sikap politik partai di masa depan.

Pengamat: Oposis Kuat Hanya Ilusi JAKARTA (Antara): Pengamat politik Boni Hargens menyatakan, harapan bakal munculnya kekuatan oposisi yang kuat pasca pemilu presiden 2009 hanyalah ilusi.

“Oposisi kuat di parlemen hanya ilusi, yang ada oposisi ompong,” kata Boni usai acara pernyataan sikap bersama Forum Muda untuk Kemandirian Nasional di Jakarta, Selasa (21/7).

Dikatakannya, dua partai besar yakni Partai Golkar dan PDI Perjuangan, meski kalah dalam pilpres tidak akan berdiri di barisan oposisi, bahkan berpeluang merapat ke pihak

Rahudman Diminta Fokus Selenggarakan Pilkada Medan MEDAN (Waspada): Penjabat (Pj) Walikota Medan Drs H Rahudman Harahap dilantik hari ini, Rabu (22/7) di Aula Martabe Kantor Gubernur Sumut oleh Gubsu H Syamsul Arifin atas nama Menteri Dalam Negeri. Dia diminta fokus kepada penyelenggaraan pemilihan kepala daerah (Pilkada) Medan, April 2010. “Itu tugas utama Rahudman Harahap setelah dilantik menjadi Pj Walikota Medan di samping tugas-tugas lain yakni tetap menyelenggarakan pemerintahan yang baik dan bersih di ibukota Provinsi Sumut tersebut, termasuk meningkatkan pelayanan publik,” ucap Gubsu melalui Kepala Dinas Komunikasi dan Informatika Sumut Eddy Syofian di Medan, Selasa (21/7). Rahudman Harahap dilantik menjadi Pj Walikota Medan berdasarkan Surat Keputusan Mendagri No. 131.12-513 tahun 2009 tertanggal 11 Juli 2009 tentang pemberhentian dan pengangkatan Penjabat Walikota Medan. Rahudman menggantikan posisi PjWalikota Medan Drs H Afifuddin Lubis yang pensiun 22 Juli 2009, karena telah berusia 60 tahun.

“Karena ketentuan untuk posisi Pj Walikota Medan harus PNS aktif, menduduki posisi eselon II dengan pangkat minimal IV b, maka Afif yang sudah pensiun pada 22 Juli 2009 tidak lagi tepat menduduki jabatan itu, sehingga harus ditunjuk pejabat penggantinya,” terang Eddy. Rahudman dalam karier PNS-nya, mulai dari jabatan camat di Pemko Pematang Siantar, yang kemudian dilanjutkan dengan jabatan Kepala Dinas Pasar di tempat yang sama. Beberapa tahun di Pemko Pematang Siantar, Rahudman pindah ke KabupatenTapanuli Selatan dan dipercaya menjabat Kepala Dinas Pendapatan, kemudian dipercaya menjabat Sekretaris Daerah Kabupaten Tapsel. Usai dari Tapsel, Rahudman ditarik Gubsu Rudolf M Pardede ke Provinsi Sumut dengan jabatan Asisten Hukum dan Kesejahteraan Sosial menggantikan Drs Sofyan Nasution. Kemudian saat Pemprov Sumut dipimpin Gubsu Syamsul Arifin, Rahudman digeser dari Asisten Hukum dan Kesejahteraan Sosial ke posisi Asisten Administrasi Umum dan Aset Pemprov Sumut. (m19)

Jelang Rekapitulasi Nasional KPU Gelar Rakornas JAKARTA (Antara): Sehari menjelang pelaksanaan pleno rekapitulasi nasional perolehan suara pemilu presiden dan wakil presiden, KPU melaksanakan rapat koordinasi nasional (Rakornas) persiapan rekapitulasi. Menurut anggota KPU Abdul Aziz di Jakarta, Selasa (21/7), rapat koordinasi ini diikuti oleh ketua atau anggota KPU provinsi seluruh Indonesia. “Pertemuan ini sebagai bentuk persiapan saja untuk rekapitulasi nasional yang akan diselenggarakan besok (Rabu, 22/7),” katanya, ditemui sebelum rakornas di ruang sidang utama, Gedung KPU. Menurut Aziz, melalui rakornas ini dapat diketahui kesiapan KPU provinsi untuk mengikuti rekapitulasi. Selain itu, dalam rakornas akan dibahas teknis pelaksanaan rekapitulasi seperti peserta rekapitulasi, cara pelaksanaannya, serta pengamanannya. Dia menjelaskan, rekapitulasi akan dilaksanakan secara bertahap dan KPU akan meng-

inventarisasi KPU provinsi yang telah menyelesaikan rekapitulasi di tingkat provinsi, kemudian membaginya dalam beberapa kelompok. Sesuai jadwal yang telah ditetapkan KPU, rekapitulasi nasional dilaksanakan tiga hari mulai 22 hingga 24 Juli. “Rekapitulasi dilaksanakan secara terbuka, namun terbatas,” katanya. Aziz menuturkan, tidak semua pihak dapat memasuki ruang rapat pleno rekapitulasi dilaksanakan sehingga hanya saksi, pengawas dan KPU provinsi yang diizinkan masuk ruang rekapitulasi. Selain membahas persiapan pelaksanaan rekapitulasi nasional, juga dibahas tentang sengketa hasil pemilu legislatif 2009. Sehari sebelum pelaksanaan rekapitulasi, pengamanan di Gedung KPU diperketat. Pengunjung yang masuk harus melewati tiga kali pemeriksaan, yakni di bagian luar gedung, kemudian di pintu masuk gedung, dan di depan ruang sidang utama tempat rekapitulasi berlangsung.

Pelaksanaan Pemilu 2009 Tak Bisa Dibanggakan JAKARTA (Antara): Ketua Umum Pimpinan Majelis Nasional Korps Alumni Himpunan Mahasiswa Islam (KAHMI) Fuad Bawazier menilai pelaksanaan pemilu dan pilpres 2009 tidak bisa dibanggakan karena banyak masalah. “Bagaimana pemilu dan pilpres yang sudah berkali-kali dilaksanakan kok masih terjadi halhal yang seharusnya tak terjadi,” kata Fuad Bawazier usai bertemu Wapres Jusuf Kalla di Jakarta, Selasa (21/7). Pimpinan Majelis Nasional KAHMI dan Presidium Majelis Nasional KAHMI bersamasama menghadap Wapres melaporkan rencana pelaksanaan Musyawarah Nasional (Munas) bersama pada 10 Oktober 2009 di Jakarta. Fuad menjelaskan bahwa pada 1999 dan 2004 pemilu berlangsung cukup baik. Bahkan pada jaman orde baru, meski tidak ada demokrasi tetapi tidak ada persoalan dengan Daftar Pemilih Tetap (DPT). “Jaman Soekarno pemilunya hebat. Sekarang ini pemilu dan pilpres tidak bisa dibanggakan,” kata Fuad. Dia dengan nada tinggi menegaskan, jika pemenangnya pasangan capres JK-Wiranto

sekalipun pelaksanaan pemilu dan pilpres 2009 tetap buruk. Pada kesempatan itu, Tubagus Farich dari Presidium KAHMI menjelaskan kedua kubu sudah menandatangani dokumen islah pada 30 Juni 2009. Dalam deklarasi islah tersebut bertindak sebagai saksi HM Muhammad Jusuf Kalla dan Akbar Tandjung. Menurut Tubagus, islah kedua kubu KAHMI terjadi sebelum pilpres 2009 karena adanya kesamaan dalam mendukung capres JK-Wiranto. “Namun islah ini bukan semata-mata karena mau pilpres tetapi dari lubuk hati kami dan akan terus. Kami juga sepakat dalam munas nanti kami-kami tidak akan maju. Pensiunlah,” kata Tubagus. Dualisme kepemimpinan KAHMI terjadi sejak adanya Munas Luar Biasa 15-17 September 2002 di Yogyakarta. Dalam munas itu muncul dua format kepengurusan yakni format Presidium Majelis Nasional KAHMI dengan kepemimpinan presidium dan Pimpinan Majelis Nasional KAHMI dengan kepemimpinan presidensial.

yang menang. “Apalagi jika Aburizal Bakri tampil memimpin Golkar,” tambah pengamat dari Universitas Indonesia tersebut. PDI Perjuangan menurut Boni, juga tidak bisa diharapkan memainkan peran oposisi seperti periode 2004-2009 karena ada sebagian elit partai itu yang ‘lelah’ beroposisi. “Sebelumnya (oposisi) masih lumayan, masih ada PDI Perjuangan dan partai kecil. Sekarang PDI Perjuangan mungkin merapat ke pemerintah,” katanya. Dengan demikian, praktis tinggal Hanura dan Gerindra yang mungkin bertindak sebagai oposisi, dan itu tidak akan kuat. “Kalau hanya Gerindra

dan Hanura tidak akan kuat, tekanannya lemah,” katanya. Dengan kondisi semacam itu kata Boni, yang terjadi adalah suatu pemerintahan yang nyaris tanpa kontrol karena disatu sisi eksekutif sangat kuat, di sisi lain parlemen ‘tak bergigi’. “Kalau benar nanti kabinet yang dibentuk adalah kabinet kerja, maka posisi presiden lebih kuat lagi karena seluruh kebijakan berasal dari dia,” katanya. Oleh karena itu, masyarakat harus benar-benar mengawal secara kritis pemerintahan lima tahun ke depan, dalam segala bidang. Sebab lembaga-lembaga negara yang lain pun tidak akan bisa diharapkan untuk melakukan fungsi kontrol dan pengawasan.

Surya Paloh, Aburizal Sebaiknya Bersatu

BANDAR LAMPUNG (Antara): Ketua DPD Partai Golkar Lampung Alzier Dianis Thabranie mengharapkan dua tokoh Partai Golkar Surya Paloh dan Aburizal Bakrie bersatu dalam Munas mendatang, untuk memajukan kembali parpol tersebut. “Kedua tokoh ini merupakan kader Partai Golkar yang sangat kita hormati. Karenanya kita mengharapkan mereka bersatu pada Munas untuk membangun dan memajukan Golkar,” katanya di Jakarta, Selasa (21/7). Menurut dia, kader Partai Golkar Yuddy Chrisnandi, belum saatnya memimpin Partai Golkar. “Memimpin Golkar itu tidak hanya bicara saja, harus memiliki rekam jejak kemampuan yang bagus, terutama kemampuan memimpin dan kemampuan dana,” katanya. Dia mengatakan, memajukan suatu parpol tentu membutuhkan dukungan dana besar, sehingga tokoh yang layak didukung adalah kader yang punya kemampuan manejerial dan dana. Berkaitan itu, dia menyebutkan sebaiknya Golkar dipimpin kader yang juga merupakan pengusaha sukses. Dia kembali menyatakan harapannya agar Surya Paloh dan Aburizal Bakrie bersatu pada Munas demi memajukan Golkar, karena keduanya lah yang memiliki kemampuan untuk merealisasikannya. Sebelumnya Ketua Umum Dewan Pimpinan Pusat (DPP) Partai Golkar Jusuf Kalla, mendorong tokoh muda seperti Yuddy Chrisnandi maju sebagai calon Ketua Umum Partai Golkar guna regenerasi di tubuh Partai Golkar. “Ya harus (ada tokoh muda), harus mix supaya ada regenerasi dan kelanjutan, tidak boleh dimonopoli,” katanya di Jakarta belum lama ini.

KPU Tunggu Hasil Pemilu Nias Selatan

JAKARTA (Waspada): KPU belum menetapkan calon legislator terpilih hasil penghitungan tahap ketiga yang sebelumnya disengketakan di Mahkamah Konstitusi karena masih menunggu penghitungan suara pemilu ulang di Nias Selatan selesai. Hal itu dikemukakan anggota KPU Andi Nurpati di kantor KPU, Jakarta, Selasa (21/7). Pemilu legislatif ulang yang diselenggarakan di Nias Selatan itu dilangsungkan bersamaan dengan pelaksanaan pemilihan presiden 8 Juli 2009. Tetapi sampai sekarang ternyata proses penghitungannya belum juga selesai. “Masih rekap di tingkat kecamatan,” kata Andi. Hasil pemilu ulang di Nias Selatan memiliki peran penting karena akan mempengaruhi formasi perolehan kursi di DPR. Akibat masih adanya persoalan itu, sampai sekarang KPU belum memastikan kapan penetapan calon legislator terpilih.

MEDAN (Waspada): Dewan Kehormatan (DK) Etik Komisi Pemilihan Umum Daerah (KPUD) Sumut memastikan akan merekomendasikan pemecatan sejumlah anggota KPUD kabupaten/kota. Rekomendasi itu rencananya dikeluarkan awal Agustus mendatang. “Awal Agustus bakal ada rekomendasi pemecatan yang akan kita keluarkan,” kata Anggota DK Etik KPUD Sumut Ahmad Taufan Damanik kepada wartawan di Medan, Selasa (21/7). Namun Taufan menolak menyebutkan anggota KPUD kabupaten/kota mana yang kemungkinan dijatuhkan sanksi etik tersebut. Sebab pemeriksaan belum selesai sepenuhnya. “Tak perlulah saya sebut sekarang. Yang pasti ada rekomendasi seperti itu nanti,” ujarnya. Taufan menyebutkan kalau saat ini pihaknya sedang melakukan penghentian sementara pemeriksaan pelanggaran etik KPUD kabupaten/ kota. Dan baru akan dilanjutkan pasca rekapitulasi nasional perolehan suara pemilu presiden (pilpres). Taufan menjelaskan, dari beberapa kali pemeriksaan yang mereka lakukan, terbukti ada beberapa anggota KPUD kabupaten/kota yang melakukan pelanggaran etik seperti penggelembungan suara atau kecurangan lainnya. “Namun perlu diingat tugas DK Etik hanya pada sampai pada tahap rekomendasi. Sedang-

kan keputusan pemecatan atau eksekusi lainnya tetap ada di tangan KPUD Sumut,” katanya. Seperti diberitakan sebelumnya, KPUD Sumut membentuk DK untuk fokus melakukan pemeriksaan terhadap lima KPUD kabupaten/ kota antara lain, KPUD Nias Selatan (Nisel), Tapanuli Tengah (Tapteng), Mandailing Natal (Madina), Batubara dan Langkat. Sementara pengamat politik dari Universitas Sumatera Utara (USU) Warjio menilai kinerja DK etik sangat lambat. Mengingat sudah terbentuk sejak 25 Mei lalu. Padahal secara efektif rekomendasi dapat dikeluarkan dalam waktu 30 hari. Menurutnya hal itu menguatkan indikasi KPUD Sumut maupun DK tidak akan mampu menuntaskan pelanggaran kode etik. Butuh tim independen yang serius melakukan evaluasi agar bisa maksimal hasilnya. “Tidak mungkin mereka membongkar kesalahan lembaganya sendiri. Sama dengan jeruk makan jeruk. Harusnya DK etik lebih banyak berisi tokoh idependen di luar KPU,” ujar dosen Ilmu Politik, Fakultas Ilmu Sosial dan Ilmu Politik (FISIP) USU itu. Dirinya dari awal sudah tidak terlalu yakin KPUD Sumut bisa menyelesaikan kasusnya secara internal. Menurutnya akan lebih efektif jika DK ataupun tim evaluasi dibentuk dari luar lembaga.(h11)

KPU Akan Surati MK Terkait Putusan PHPU JAKARTA (Antara): Komisi Pemilihan Umum (KPU) akan menyurati Mahkamah Konstitusi (MK) terkait dengan sejumlah putusan perselisihan hasil pemilu (PHPU) legislatif yang dinilai tidak sesuai. Anggota KPU Andi Nurpati di Jakarta, Selasa (21/7) mengatakan surat tersebut akan dilayangkan setelah KPU batal bertemu perwakilan dari MK hari ini untuk membahas sejumlah putusan MK tersebut. “Kami berencana mengundang MK hari ini, tetapi karena ada sidang sehingga tidak dapat hadir,” ujarnya ditemui di sela rapat koordinasi KPU dengan KPU provinsi di seluruh Indonesia. Menjelang penyelenggaraan rekapitulasi nasional pada 22 Juli, KPU menyelenggarakan rakornas yang membahas beberapa hal diantaranya yakni teknis pelaksanaan rekapitulasi dan putusan MK. Sejumlah KPU di daerah melaporkan terdapat putusan MK yang tidak sesuai. Andi menjelaskan keputusan tersebut berkaitan dengan sengketa hasil pemilu legislatif di Tulang Bawang, Lampung.

Menurut Andi, KPU menerima dua macam putusan dengan nomor sama namun amar putusannya berbeda. Sementara untuk kasus di Sulawesi Tenggara, MK menyidangkan kasus yang tidak pernah diregistrasikan. Untuk kasus di Sultra, data diserahkan ke MK pada 14 Mei dan 11 hari kemudian yakni 25 Mei dilakukan perbaikan berkas. Menurut Andi, seharusnya perbaikan berkas diberikan 1x24 jam. “Ini yang kita pertanyakan, kenapa setelah 11 hari perbaikan ini masih diterima,” katanya. KPU ujarnya, juga menerima putusan MK yang justru membenarkan terjadinya penggelembungan suara. Selain itu terdapat putusan MK yang dinilai tidak konkret. “Untuk itu KPU di daerah mengusulkan pada KPU pusat menyurati MK guna mengkla-rifikasi amar putusan yang butuh perhatian secara institusi,” katanya. Andi menuturkan, KPU akan berkoordinasi dengan MK secepatnya, setelah rekapitulasi dan penetapan perolehan suara hasil pemilu presiden dan wakil presiden 2009 selesai.

Abdul Hafiz Kembali Beri Penjelasan Pada Bawalsu JAKARTA (Antara): Ketua KPU Abdul Hafiz Anshary kembali memberikan penjelasan kepada Badan Pengawas Pemilu (Bawaslu) mengenai jumlah tempat pemungutan suara pada pilpres 2009 dan keterlibatan International Foundation of Electoral Systems (Ifes) dalam penghitungan suara sementara. “Jadi kami katakan bahwa tidak ada pengurangan jumlah TPS karena memang undangundangnya berbeda (antara pemilu legislatif dengan pilpres),” kata Ketua KPU di Jakarta, Selasa (21/7), ketika ditemui di Gedung KPU setelah memenuhi undangan Bawaslu untuk klarifikasi. Undang-Undang No. 10 Tahun 2008 tentang pemilu legislatif mengatur jumlah pemilih disetiap TPS maksimal 500 orang. Sementara untuk pilpres, dalam UU 42/2008 disebutkan jumlah pemilih sebanyak-banyaknya 800 orang setiap TPS. “Itu ada aturannya, tidak boleh digabung

antar desa, harus mempertimbangkan geografis, waktu dan jarak tempuh. Dan itu sudah kita lakukan,” katanya. Selain itu, Ketua KPU juga memberikan penjelasan tentang peran Ifes dalam penyajian data hasil sementara pemungutan suara yang rencananya dikumpulkan dari sekitar 100 ribu TPS. Dalam kerjasama tersebut, KPU tidak menerima dalam bentuk uang, melainkan jasa. Selain dari Ifes, KPU juga menerima bantuan dari lembaga asing lainnya yang telah dikoordinasikan dengan Bappenas. Ditanya tentang tindak lanjut dari Bawaslu mengenai masalah ini, Ketua KPU mengatakan pihaknya menyerahkan sepenuhnya pada Bawaslu. Sebelumnya, Ketua KPU telah memenuhi undangan Bawaslu untuk memberikan keterangan pekan lalu, pada 15 Juli 2009. Namun forum klarifikasi tersebut tidak dapat dituntaskan karena Ketua KPU harus bertolak ke Riau memantau pemungutan suara ulang pemilu legislatif.

KPU Akan Stop Kerjasama Dengan Lembaga Asing

JAKARTA (Waspada): Ketua KPU Abdul Hafiz Anshary menyatakan ke depan kemungkinan tidak lagi menerima berbagai bantuan asing untuk penyelenggaraan pemilihan. “Tadi memang ada usul, kalau memang dipersoalkan, lebih baik tidak usah menerima bantuan asing lagi,” ujar Hafiz di kantor KPU, Selasa (21/7). Hafiz mengakui sebenarnya ada sejumlah lembaga asing yang menyatakan bersedia bekerjasama dengan KPU di antaranya UNDP, Kemitraan, IFES, dan AEC (Australian Election Commission). Semua lembaga itu kata dia, ingin membantu KPU melakukan sosialisasi, media center, simulasi pemilu, perbaikan DPT, dan penayangan tabulasi hasil pemilihan presiden. Hafiz mengatakan, tidak ada bantuan dalam bentuk uang. Semua bantuan diberikan dalam bentuk program. Hafiz menjelaskan,sebenarnya KPU memiliki otoritas menjalin kerjasama dengan lembaga-lembaga semacam itu. Tidak ada kewajiban untuk berkoordinasi dengan Badan Perencanaan Pembangunan Nasional.

Antara

AUDIENSI DENGAN BAWASLU: Ketua Bawaslu, Nur Hidayat Sardini (kiri), Anggota Bawaslu, Wahidah Suaib dan Pengamat Politik yang tergabung dalam Masyarakat Pengawal Demokrasi, Yudi Latief mendengarkan Penyanyi, Franky Sahilatua menyanyikan lagu “Pemilu Busuk” di kantor Bawaslu, Jakarta, Selasa (21/7). Dalam salah satu pernyataan sikapnya, Masyarakat Pengawal Demokrasi meminta kepada Bawaslu dan seluruh komponen masyarakat pembela Pemilu Jurdil untuk tetap kuat hati dan kemauan dalam mengungkap kebenaran dari berbagai misteri pelaksanaan Pemilu 2009.


Sumatera Utara

WASPADA Rabu 22 Juli 2009

Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane

Zhuhur 12:33 12:46 12:34 12:41 12:40 12:37 12:34 12:29 12:36

‘Ashar 15:58 16:11 15:59 16:06 16:06 16:02 15:59 15:55 16:01

Magrib 18:43 18:59 18:44 18:53 18:52 18:44 18:43 18:38 18:46

‘Isya

Imsak

Shubuh Syuruq

Kota

19:57 20:14 19:58 20:08 20:06 19:57 19:57 19:52 20:00

04:51 05:00 04:51 04:56 04:56 04:59 04:52 04:48 04:54

05:01 05:10 05:01 05:06 05:06 05:09 04:52 04:58 05:04

Langsa 12:36 L.Seumawe 12:39 L. Pakam 12:32 Sei Rampah12:31 Meulaboh 12:43 P.Sidimpuan12:31 P. Siantar 12:31 Balige 12:31 R. Prapat 12:28

06:21 06:31 06:22 06:26 06:27 06:29 06:23 06:18 06:25

Zhuhur ‘Ashar 16:01 16:04 15:57 15:57 16:08 15:56 15:57 15:57 15:53

17

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:47 18:52 18:42 18:42 18:54 18:37 18:40 18:39 18:36

20:01 20:06 19:56 19:55 20:08 19:51 19:54 19:53 19:49

04:52 04:54 04:50 04:49 05:00 04:52 04:50 04:51 04:49

05:02 05:04 05:00 04:59 05:10 05:02 05:00 05:01 04:59

Sabang Pandan Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan

12:46 12:33 12:32 12:34 12:44 12:37 12:34 12:40 12:29 12:39

19:00 18:40 18:40 18:43 18:44 18:44 18:44 18:52 18:38 18:48

20:14 19:53 19:53 19:56 19:58 19:58 19:57 20:06 19:51 20:02

05:00 04:54 04:53 04:53 04:57 04:57 04:51 04:56 04:48 04:57

05:10 05:04 05:03 05:03 05:07 05:07 05:01 05:06 04:58 05:07

Tarutung 12:32 T.Tinggi 12:31 Panyabungan 12:29 Teluk Dalam12:36 Salak 12:34 Limapuluh 12:30 Parapat 12:32 GunungTua 12:29 Sibuhuan 12:29 Lhoksukon 12:38

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:22 06:25 06:20 06:19 06:30 06:22 06:21 06:22 06:19

16:11 15:58 15:58 15:59 16:02 16:02 15:59 16:05 15:54 16:04

BINJAI (Waspada): Tersangka utama kasus pembunuhan tahun 2000, BS, 40, warga Kel. Tanah Merah, Kec. Binjai Selatan, tertangkap Senin (20/7) dini hari di tempat persembunyiannya di Tanjung Langkat, Kec. Salapian, Kab. Langkat. BS disangka membunuh Baharuddin Lubis, 37, warga Tanah Tinggi, Kec. Binjai Timur di Tanah Merah, Kec. Binjai Selatan. Kini, tersangka pelaku utama itu diamankan di Mapolresta Binjai guna proses penyidikan serta untuk mempertanggungjawabkan perbuatannya. Sementara, teman tersangka lainnya sudah menjalani hukuman. Kapolresta Binjai AKBP Roberts Kennedy ketika dikonfirmasi Waspada tentang penangkapan itu melalui Kasat Reskrim AKP HM Taufiq di ruang kerjanya, Selasa (22/7) membenarkan. Sebelumnya, Polresta Binjai mendapat informasi, tersangka berada di Tanjung Langkat. Keterangan dikumpulkan Waspada, pembunuhan terhadap korban diawali rasa cemburu terhadap korban, karena korban berpacaran dengan wanita yang juga disenangi tersangka. Kemudian tersangka dan beberapa temannya membunuh korban dan mayatnya dibuang ke Sungai Bingai. Mayat korban ditemukan di pinggir Sungai Bingai kawasan Kel. Berngam Binjai dalam keadaan membusuk. (a04)

Tiga Anggota Polresta Binjai Dipecat

Oknum Bendahara Polres Langkat Hilang, Diduga Bawa Kabur Uang Personil Rp1,3 M STABAT (Waspada): Bripka ZG, Bendahara Mapolres Langkat sejak dua pekan terakhir menghilang dan diduga kuat membawa kabur uang personil lebih dari Rp1,3 miliar. KabagBinamitraPolresKompolEdiSudarsonoketikadimintai konfirmasinya, Selasa (21/7) membenarkan. ‘’Belum ditemukan, kami masih mencarinya,’’ ujar Edi seraya menambahkan belum dapat memastikan uang yang dibawa kabur ZG lebih dari Rp1,3 miliar, namun kabar beredar demikian. Sumber lain menyebutkan, uang yang dibawa kabur diduga pencairan gaji ke-13 personil dan uang pengamanan pilpres, meskipun menyangkut gaji ke-13 sebagian kecil personil telah menerimanya. Secara terpisah Kapolres Langkat AKBP Dodi Marsidi yang sejak kemarin terkesan tertutup menyampaikan masalah akhirnya berkomentar kepada sejumlah wartawan, menyarankan untuk meminta penjelasan langsung ke Kapolda, sebab masalah menyangkut intern Polres. Kemarin sore Waspada mencoba mendatangi kediaman ZG di kawasan Lincun, Binjai, untuk memastikan keberadaannya setelah beruangkali bertanya alamat. Namun beberapa tetangga mengaku tidak mengetahui permasalahan dan sudah beberapa pekan tidak berjumpa dengan oknum polisi itu. Pintu dan jendela rumah ZG terlihat tutup. (a38)

Dirut, Staf PTPN II Dipanggil Kejatisu MEDAN (Waspada): Kejaksaan Tinggi Sumut (Kejtisu) memanggil Direktur Utama (Dirut) PTPN, Ir Batara Nasution untuk klarifikasi kasus dugaan korupsi dana anggaran sejumlah kegiatan di perusahaan itu senilai lebih kurang Rp5 miliar. Pantauan di gedung Kejatisu, Selasa (21/7), Batara Nasution datang memenuhi panggilan tim penyidik Tindak Pidana Khusus (Pidsus) pukul 09:00 . Selain dirut, dua stafnya juga turut dimintai keterangan. Mengenakan kemeja warna putih celana keper warna gelap, Batara Nasution engan berkomentar kepada wartawan tentang kehadirannya di Kejatisu.”Saya datang ke Kejatisu hanya jalan-jalan, “ ujarnya singkat dan bergegas meninggalkan wartawan. Asisten Tindak Pidana Khusus (Aspidsus) Kejatisu, Agoes Djaya, mengatakan, Dirut PTPN II dipanggil untuk klarifikasi kasus dugaan korupsi sejumlag kegiatan di perusahaan perekebunan itu, sebagaimana laporan yang diterima lembaga hukum itu “Ya benar beliau memenuhi panggilan kita untuk klarifikasi. Selain dirinya turut dimintai keterangan sejumlah stafnya, “ kata Agoes seraya menyatakan kasus ini masih dalam, tahap pendalaman. Menurut informasi yang diperoleh dan Kejatisu, kasus dugaan korupsidilingkunganPTPNIIdidugamelibatkansejumlahpejabat utama di PTPN II sudah melambung ke Kejaksaan Agung (Kejagung). Hal ini sesuai laporan Gerakan Rakyat Penyelamat Harta Negara (Gerphan) ke lembaga hukum itu. Materi laporan Gerphan yang ditandatangani Direkturnya, Janto Dearmando disebutkan, dugaan korupsi di PTPN II, terkait penyalahgunaan wewenang, memanipulasi pengadaan barang jasa, pelaksanaan pekerjaan fiktif, dan gratifikasi untuk kebun Limau Manis dan Mungkur Deli Serdang. Selain itu, anggaran pengamanan yang dibayarkan kepada koperasi perusahaan yang berjumlah lebih kurang Rp4,5 miliar per tahun diduga fiktif. Sebab PTPN II telah memiliki perangkat keamanan yang terlatih dan sudah ada kerjasama dengan Poldasu.(h05)

Zhuhur ‘Ashar 15:57 15:56 15:54 16:01 15:59 15:55 15:57 15:54 15:54 16:04

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:39 18:41 18:35 18:42 18:43 18:39 18:40 18:36 18:35 18:51

19:53 19:54 19:48 19:55 19:56 19:53 19:54 19:49 19:48 20:05

04:52 04:49 04:52 04:59 04:54 04:48 04:51 04:51 04:51 04:54

05:02 04:59 05:02 05:09 05:04 04:58 05:01 05:01 05:01 05:04

06:23 06:20 06:22 06:29 06:24 06:19 06:21 06:21 06:21 06:24

Razia Pilih Kasih, Sopir MPU Mogok Operasi

Tersangka Pembunuh Sembilan Tahun Lalu Tertangkap

BINJAI (Waspada): Tiga anggota Polresta Binjai yakni Aiptu Abdul Rahman, Briptu Marajohan Nainggolan dan Bribda Jukri Harahap, Selasa (21/7) dipecat dari Polri karena meninggalkan tugas tanpa keterangan dan izin atasan. Upacara pemecatan itu tidak dihadiri oleh ketiga personil, dan dilakukan di halaman Mapolresta Binjai di hadapan seluruh Perwira, Kabag dan Para Kasat serta Kapolsek se jajaran Polresta Binjai. Kapolresta Binjai AKBP Robets Kennedy, mengemukakan, pemecatan itu atas surat keputusan Kapoldasu Irjenpol Badrodin Haiti tentang penegakan displin dalam tugas kedinasan, dan ketiganya tanpa keterangan telah meninggalkan tugas sebagai anggota Polri selama 70 hari berturut-turut. Ketiga Bintara Polri yang disersi tersebut dipecat dengan tidak hormat, dan ini merupakan pembelajaran bagi personil lainnya, sehingga diharapkan kepada personil Polresta Binjai tetap menjalankan tugas dan fungsi Polri di tengah-tengah masyarakat dengan mengemban tugas dan tanggung jawab sebagai anggota kepolisian, ujar Kapolresta. Aiptu Abdul Rahman dipecat berdasarkan SK. No. Pol Skep/286/VI/2009 tertanggal 19 juni 2009 kasus melakukan pelanggaran kode etik Polri Pasal 4 ayat I huruf (a) PP RI No. 1 tahun 2003 karena meninggalkan tugas sebagai Polisi secara tidak sah selama 30 hari berturut-turut, tanpa izin pimpinan sejak 26 Maret 2007 sampai 19 Juni 2008. Sementara, Briptu Marajohan Nainggolan pemecatannya atas Skep No. Pol/51/I/2009 sejak 15 Desember 2006 sampai pelaksanaan sidang 17 November 2008 tidak masuk kerja sebagai mana layaknya anggota kepolisian dan pemecatan Bripda Budi Jukri Harahap dengan SK No. Skep 269/VI/2009 karena 70 hari sejak 20 Juli hingga 27 September 2007 tidak masuk kerja sehingga telah melalaikan tugas sebagai Polri. Kapolresta Binjai AKBP Robets Kennedy dalam arahannya, mengatakan, ini merupakan contoh tidak baik selaku anggota Polri yang tidak masuk kerja sebagimana layaknya anggota kepolisian selama 70 hari berturut-turut tanpa seizin pimpinan.(a04)

06:31 06:24 06:24 06:23 06:27 06:27 06:22 06:27 06:18 06:28

Waspada/Eddi Gultom

BERSERAKAN: Toge yang merupakan muatan truk colt diesel BK 8473 LD berserakan di jalanan di kilometer 57-58 Jalinsum Medan-Tebing Tinggi, bertubrukan dengan Bus Sartika persis di depan kantor Samsat Serdang Bedagai di Desa Firdaus, Kec.Sei Rampah, Senin (20/7) malam.

Tubrukan Maut Di Jalinsum Sei Rampah, 6 Tewas, 13 Luka-luka SEI RAMPAH (Waspada): Jalan Lintas Sumatera kawasan Sei Rampah kembali menelan korban. Senin (20/7) pukul 22:00, enam orang dilaporkan tewas sementara 13 orang lainnya luka-luka setelah Bus Sartika bertubrukan dengan truk colt diesel. Keterangan yang dihimpun, sebelum tubrukan maut itu terjadi, colt diesel BK 8473 LD yang dikemudikan Suheri sarat dengan muatan toge yang akan dipasarkan ke Medan datang dari Simpang Belidaan, Desa Firdaus, Kec.Sei Rampah menuju Medan. Di kilometer 57-58 Jalinsum MedanTebing Tinggi, persis di depan Kantor SamsatSerdangBedagaidiDesaFirdaus, Kec.Sei Rampah, melaju Bus Sartika BK 7069 DN yang dikemudikan Saut Maruba Sihombing,41,warga Gang Juhar, Lingkungan II, Sirantau Datuk Bandar, Kab.Asahan datang dari Medan menuju ke Tebing Tinggi. Saat itu bus berusaha mendahului mobil yang ada di depan, tanpa terlebih dahulu memperhatikan jalur yang akan dimasukinya. Sedangkan truk yang datang dari arah berlawanan berada di jalurnya dalam keadaan kencang, sehingga tubrukan tak terelakan lagi. Akibatnya kedua mobil rusak berat

Waspada/Eddi Gultom

KORBAN DIRAWAT: Korban tubrukan Bus Sartika dan truk sedang dirawat di RSU Sultan Sulaiman di Firdaus,Senin(20/7) pukul 12:00 . dan melintang di jalan raya sehingga membuat arus lalu lintas Medan-Tebing Tingimacetbeberapasaat.Untukmenghindari kemacetan itu para pengemudi mobil pribadi banyak yang mengambil jalan pintas melalui Kompleks Perumahan Griya Firdaus. Sedangkan para penumpang Bus Sartika hampir semua mengalami luka serius. Sementara toge berhamburan di tengah aspal. Satlantas Polres Serdang Bedagai yang mengetahui kejadian langsung turun ke TKP dan mengevakuasi para korban ke Rumah Sakit Sultan Sulaiman di Firdaus. Namun karena beberapa korban lukanya sangat parah akhirnya tewas di TKP sebelum mendapatkan

perawatan medis di rumah sakit. Seluruh korban yang mengalami luka berat dan ringan hingga saat ini masih dirawat secara intensif di RSU Sultan Sulaiman di Firdaus. Sementara para korban yang tewas sebagian sudah diambil keluarga dan sebagian masih berada di ruang instalasi kamar mayat menunggu dijemput keluarga. Menurut pantauan Waspada pada malam kejadian itu Kapolres Serdang Bedagai AKBP Eri Safari turun menjenguk para korban di RSU Sulaiman. Kabag Bina Mitra Polres Serdang Bedagai AKP Syamsul Bahri Lubis yang dikonfirmasi Waspada, Selasa (21/7) membenarkan. (a07)

Korban Tewas Nama 1. Suheri, 33, (pengemudi truk) 2. Sutrisno, 47. 3. Samsul, 35. 4. Untung, 42. 5. Mrs X diperkirakan 50 tahun. 6. Harianto Panjaitan, 22.

Alamat warga Dusun III, Desa Cempedak Lobang,Kec.Sei Rampah,Kab.Serdang Bedagai. Dusun Gelumpang,Desa Binjai, Kec.Seruwai, Kab.Aceh Tamiang, Provinsi Aceh. Warga Medan. Warga Jalan Sumber Amal, Lingkungan X,No.246 B,Kel. Harjosari II,Kec.Medan Amplas, Kota Medan. Warga Kampung Baru, Cilegon Barat, Banten.

Korban Luka-luka 1. Nuramnia, 49. 2. Miranda Nadia, 5. 3. Amin Safri, 54. 4. Tuhari Lakis, 45. 5. Nisa, 22, guru. 6. Ira, 21. 7. Kui Hiang, 51. 8. Andika Kurniadi, 19. 9. Andika Sunardi, 24. 10. Samen,19. 11. Amat, 24. 12. Amat, 38. 13. Saut Maruba Sihombing, 41. (sopir bus)

Ketiganya warga Jalan Tuamang Gang Sadar,Kec.Medan Barat,Kota Medan. Warga Jalan Sri Cumi, Gang Pasir,Kec.Pangkalan Brandan,Kab.Langkat, Warga Desa Panca Muktis,Kec.Bagan Sinembah,Kab.Rokan Hilir. Warga Jalan Delitua Gang Baru,Kab.Deli Serdang. Keduanya warga Desa Simpang Gambus, Kec. Limapuluh, Kab.Batu Bara. Warga Jalan Perdagangan, Kec.Limapuluh, Kab.Batu Bara. Warga Dusun Parit Pompa, Desa Sicanggang,Kab.Langkat, Keduanya warga Dusun I,Desa Cempedak Lobang,Kec.Sei Rampah, Kab. Serdang Bedagai. Warga Gang Juhar, Lingkungan II, Sirantau Datuk Bandar, Kab.Asahan.

Masyarakat Sukamakmur Rubuhkan Kafe Remang-remang STABAT ( Waspada): Puluhan warga Desa Sukamakmur Kec. Binjai, Langkat, rubuhkan kafe remang-remang di desa itu, Senin (20/7) malam. Akibatnya lima wanita penghibur berlari ke semak-semak dan lolos dari kejaran warga. Warga Sukamakmur hampir setahun terakhir resah dengan aktivitas di kafe berjoget-joget sambil menenggak minuman keras serta mengarah praktek prostitusi. Pengunjung menurut warga juga tidak segan berbuat hal kurang wajar dengan wanita penghibur saat minumminum di kafe yang berlokasi di ruas jalan umum itu. Dampak lain aktivitas belajar di beberapa madrasah di Desa Sukamak-

mur juga terganggu akibat suara hiburan keyboard yang berisik, setiap hari disediakan pemilik kafe. ‘’Aktivitas di sana tidak kenal waktu, siang malam main terus,’’ kata salah seorang warga kesal. Dua bulan sebelumnya lokasi itu juga pernah digrebek aparat Polsek Tandam Hulu karena meresahkan warga dan petugas menggiring 9 wanita penghibur untuk dinasehati kemudian diperbolehkan pulang. Sementara Senin (20/7) malam sebelum warga merubuhkan bangunan, sejumlah tokoh masyarakat telah menasehati pemilik untuk menghentikan hiburan, namun penasehat mendapat perlawanan. Akhirnya

warga beramai-ramai mendatangi lokasi dan melempari pengunjung kafe serta merubuhkan bangunan. ‘’Kami sudah tidak percaya lagi dengan Kades karena sejak lama tidak menanggapi laporan warga. Sebaliknya Kades terkesan melindungi pemilik kafe,’’ kata beberapa warga, Selasa (21/ 7). Warga menambahkan, jika dalam pekan ini kafe dibangun kembali dan menyediakan wanita penghibur, masyarakat akan terus menentang keberadaannya. Secara terpisah Camat Binjai Suwarno ketika dimintai konfirmasinya menegaskan, hasil kesepakatan unsur Muspika, kafe resmi ditutup. (a38)

BESITANG (Waspada): Sekira 40 unit mobil pengangkutan umum (MPU) trayek Besitang - P.Brandan melakukan aksi mogok massal, Selasa (21/7) pukul 11:00. Para sopir memarkirkan mobil mereka di sisi Jalinsum Bukitmas, Kec. Besitang. Aksi mogok yang dilancarkan para sopir sebagai ungkapan protes mereka terhadap tindakan sejumlah petugas Dishub Langkat yang dianggap tidak fair alias diskriminatif dalam menjalankan razia. ‘’Kami minta hukum ditegakan tanpa pandang bulu,’’teriak sopir. Para sopir mengakui, pada prinsipnya mereka tidak keberatan jika petugas Dishub melakukan penindakan jika sopir terbukti bersalah. Tapi, yang membuat mereka kesal, sasaran razia hanya kepada sopir MPUsedangkanarmadabecabermotor tidak disentuh. Roberto Sinulingga, salah seorang dari sopir menyatakan, mereka hanya menuntutperlakukanyangadil.‘’Siapa saja yang melanggar peraturan harus diproses tanpa ada unsur diskriminatif,’’ ujarnya. Hal senda juga diutarakan, Mucktar Sy, dihadapan para petugas Dishub termasuk personil Lantas. Menurut dia, sesuai edaran Bupati Langkat, seluruh betor yang beroperasi tanpa dilengkapi izin harus diambil tindakkan. Yang membuat para sopir kecewa, lanjut Mucktar, betor tanpa izin bebasberseliweransementarapetugas

terkait terlihat memicingkan mata, padahal bupati telah mengeluarkan surat edaran agar dilakukan penertiban. Para petugas Dishub yang turun melakukan razia pada hari itu tidak dapat berbuat banyak menerima berbagaikecamandariparasopir.Sebagian dari mereka berupaya mengamankan arus lalulintas di Jalinsum MedanAceh. Menanggapi tuntutan sopir terkait penertiban betor, petugas Dishub meminta kepada para sopir agar mengutusperwakilanmerekakeStabatguna membahas tuntutan sopir. Tigas utusan sopir, Helmi Ginting, Maju dan Mucktar, pada hari itu berangkat ke Stabat. Pantauan Waspada, beberapa unit betor yang melintas saat berlangsung aksi unjuk rasa dan mogok sopir MPU ditangkap petugas. Armada angkutan roda tiga yang diduga tak dilengkapi izin itu langsung diboyong ke Stabat. P. Ginting, SH, petugas Dishub Langkat yang ditemui Waspada mengatakan, pihanya akan menggelar razia besar-besaran sampai tanggal 24 Juli. ‘’Kita akan tindak armada yang tak tak dilengkapi izin termasuk mobil penumpang plat hitam,’’ ujarnya. Ironisnya, sekira pukul 13:00 saat mendekati berakhirnya aksi mogok sopir, satu unit mobil L-300 berplat hitam mengangkut penumpang dari Aceh tujuan Medan melintas persis di depan petugas, tapi tidak ditindak.(a02)

Mantan Kepala SMK Disidang Pekan Depan STABAT (Waspada): Mantan Kepala SMK Stabat SU sebagai tersangka dugaan penyimpangan program Information Center Teknologi (ICT) dan revitalisasi tahun 2007, pekan depan akan menjalani persidangan di PN Stabat. ‘’Ada dua berkas yang telah kita dilimpahkan,’’ kata Kasi Datun Kejari Rudolf Valentino, kemarin. Program ICT merupakan program pusat informasi mengenai pemahaman dunia internet bagi seluruh murid, siswa maupun pelajar se Kabupaten Langkat yang dipusatkan di SMKN.

Sementara program revitalisasi juga termasuk rangkaian ICT, yakni kebutuhan alat-alat dan komponen komputer yang harus dibeli. Hasil pemeriksan tim penyidik, tersangka diduga melakukan tindak pidana korupsi manipulasi biaya, tidak sesuai bestek dan ketidaksesuaian jumlah komputer sebagaimana yang diperlukan dan tertera dalam pagu program. Pemeriksaan awal juga menyimpulkan perbuatan tersangka merugikan negara Rp250 juta untuk kategori kasus ICT dan Rp300 juta untuk program revitalisasi. (a38)

Tiga Bulan Tak Gajian, Karyawan PD Pembangunan Gelar Demo BINJAI (Waspada ) : Rencana unjuk rasa damai ratusan karyawan PD Pembangunan ke DPRD Binjai Selasa ( 21/7) gagal. Namun tujuh karyawan sebagai perwakilan diterima DPRD Binjai guna menyampakan aspirasi. Tujuh perwakilan karyawan diterima Ketua DPRD Binjai Ir H Haris Harto didamping para wakil ketua dan ketua-ketua fraksi serta ketuaketua komisi di ruang sidang DPRD Binjai. Koordinator aksi damai HTM Syahril menyampaikan berbagai masalahdiPDPembangunan.Terutama tuntutan gaji yang tidak sesuai UMR. Karyawan tiga bulan belum menerima gaji dan pejabat struktural selama enam bulan belum menerima tunjangan jabatan. Syahril juga mempertanyakan penggunaan anggaran PD Pembangunan yang mencapai Rp19,6 miliar kurun waktu empat tahun. Ketua DPRD Binjai mengemukakan, aspirasi perwakilan karyawan PD Pembangunan akan direspon dan mempertanyakan kepada ekse-kutif. Sementara para ketua fraksi di DPRD BinjaimintaDireksiPDPembangunan Binjaiuntukdipanggil,bersamabadan pengawas, SPI, Disnaker, Jamsostek dan Dinas Pengelolaan Aset dan Keuangan Pemko Binjai. Menurut para ketua fraksi, PD

Pembangunan harus memberikan laporan kerja dan laporan keuangan, sehinggabisadiketahui,sampaidimana usahaPDPembangunan.SebabDPRD Binjai juga menerima laporan masalah tersendatnya pembangunan perumahanyangbekerjasamadenganBank Tabungan Negara (BTN) Medan. Anggota DPRD Binjai Daniel Sitepu menyebutkan, masa jabatan Direksi PD Pembangunan sudah hampir selesai. Mereka harus memberikan laporan pertanggungjawaban secara lengkap. Baik aset, surat berharga dan laporan keuangan yang dipergunakan dari APBD Pemko Binjai. Daniel juga heran, anggaran PD Pembangunan semula di tahun anggaran 2009 hanya Rp1,5 M disetujuiDPRDBinjaimengapabisaberubah menjadi Rp4,5 miliar. Sebelumnya Direktur Umum dan Keuangan PD Pembangunan Heru Ramadhan menyatakan, terlambatnya pembayaran gaji karyawan akibat dana PD Pembangunan belum dikeluarkan Dinas Aset dan Keuangan Pemko Binjai. Daniel Sitepu heran, Dirut PD Pembangunan Nazri Kamal menyebutan gaji karyawan tidak lagi dari dana APBD, tetapi sudah bisa ditanggulangi PD Pembangunan. Bahkan PD Pembangunan menurut Nazri Kamal mampu memberikan kontribusi kepada Pemko Binjai tahun anggaran 2009 sebesar Rp500 juta. (a03)

DS Utus Empat Guru Berprestasi Ke Tingkat Nasional LUBUK PAKAM (Waspada): Pemkab Deli Serdang melalui Dinas Pendidikan, Pemuda dan Olahraga (Disdikpora) Deli Serdang mengutus empat orang guru untuk mengikuti lomba guru berprestasi tingkat nasional di Jakarta 6 Agustus 2009. Keempat guru berprestasi itu, Drs Suryadi, MPd (Kepala SMP Negeri 1 Tanjung Morawa), Drs Syamsuar Sinaga(GuruSMPNegeri1Hamparan Perak), Drs Barinto (Pengawas SMP Disdikpora Deli Serdang) dan Drs Jaya Sijabat (Pengawas SMA Disdikpora Deli Serdang). Hal itu dikemukakan Kadisdikpora Deli Serdang Drs Sofian Marpaung, MPd di sela-sela lomba kreativitasanakPendidikanAnakUsiaDini (PAUD) di Balairung Pemkab Deli Serdang di Lubuk Pakam, Selasa (21/

7).

Sofian mengatakan, dibanding tahun lalu untuk mengikuti perlombaan yang sama, tahun ini utusan yang mengikuti lomba berprestasi bagi guru, kepala SMP serta penga-was SMP-SMAtingkatnasionaljum-lahnya meningkat dibanding tahun lalu. Menyangkut penilaian terhadap utusan yang akan mengikuti perlombaan tingkat nasional, Kadisdikpora Sofian menjelaskan ada beberapa kriteria. Selain melalui seleksi, penilaian terhadap guru, kepala SMP dan pengawas SMP-SMA berprestasi yang akan diutus, juga meliputi penilaian masa kerja, inovasi pembelajaran, kemampuan melaksanakan tugas serta beberapa penilaian lain menyangkut tupoksi guru. (a05)


18

Sumatera Utara

Kisaran Diselimuti Kabut Asap KISARAN (Waspada): Kabut asap yang merupakan imbas kebakaran hutan di Provinsi Riau menyelimuti Kota Kisaran, menyebabkan jarak pengemudi kendaran bermotor terganggu. “ Jarak pandang mulai terganggu diakibatkan kabut asap, sehingga pengendara kendaraan mesin harus berhati-hati dalam melintasi jalan-jalan besar kota,” ujar penarik betor Julkarnaen, 33, warga Jalan Cokroaminoto, Kota Kisaran kepada Waspada, Selasa (21/7). Oleh sebab itu, lanjut Julkarnaen, agar lebih berhati-hati berkendara, sebagian besar pengendara kendaraan bermotor menghidupkan lampu pada siang hari. “Bila keadaan seperti terus berlanjut, dikhawatirkan aktivitas kota akan menurun,” ujar Julkarnen. Menurut Zulkarnen, kabut asap yang menyelimuti Kota Kisaran, diakibatkan pembakaran hutan di Provinsi Riau, sehingga imbasnya sampai ke Kota Kisaran. “Di Riau banyak pembukaan hutan dengan cara membakar, dan lahan itu akan ditanami sawit, dan asapnya sampai kemari,” ujar Julkarnen. Senada dengan hal itu, Tan Tien, 40, warga Jalan Imam Bonjol mengkhawatirkan, bila situasi ini berlanjut akan menyebabkan terganggunya kesehatan warga Kisaran. “Bila kabut asap terus berlanjut, bisa menggangu pernafasan warga kota,” kata Tan Tien. Julkarnen dan Tan Tien berharap, agar pemerintah secepatnya menyelesaikan masalah kabut asap ini, karena semakin lama akan membahayakan keselamatan warga. “ Bila tidak secepatnya tidak ditanggulangi maka akan menimbulkan kerugian materi dan membahayakan jiwa,” ujar keduanya. (csap/a36)

PT Inalum Bantu Renovasi RKB SMAN 1 Air Putih INDRAPURA (Waspada): PT Inalum Kuala Tanjung memberikan bantuan renovasi empat Ruang Kelas Belajar (RKB) SMA Negeri 1 Kec. Air Putih, Batu Bara. Kepala SMAN 1 Air Putih, Ishak Liza, di ruang kerjanya Selasa (21/7) kepada Waspada mengatakan, renovasi itu kini sedang dikerjakan langsung pihak pemberi bantuan PT Inalum. Diperkirakan dalam pekan ini akan rampung. Ishak mengatakan, renovasi antara lain berupa rehab plafon, pintu, lantai dan pengecatan. Sejak dibangun pada 1982, empat RKB ini belum pernah mendapat perbaikan. Kondisinya sedikit memprihatinkan. Baru kali ini, mendapat renovasi dari bantuan Inalum ini. Diharapkan empat RKB ini akan kembali baik, sama dengan RKB lain yang ada di sekolah SMAN tertua di Batubara ini, ujarnya. Untuk itu, lanjut Ishak, kami haturkan terima kasih kepada manajemen PT Inalum. Sementara itu Junior Manajer Humasy PT Inalum, A Majid Sulong mengatakan, bantuan ini berasal dari dana CSR perusahaan. Merupakan salah satu bentuk kepedulian sosial Inalum kepada masyarakat sekitar perusahaan patungan Jepang dengan pemerintah Indonesia ini kepada masyarakat sekitar khususnya bidang pendidikan, ujar Majid. (a25)

Polres Tanjung Balai Sosialisasikan Pencegahan Penyalahgunaan Narkoba T.BALAI (Waspada) : Polresta Tanjung Balai, mensosialisasikan pencegahan penyalahgunaan narkoba kepada seluruh remaja masjid di kota itu, di aula Kantor Departemen Agama, Jalan Jenderal Sudirman, Selasa (21/7). Kabag Bina Mitra AKP Lukman Sirait menyampaikan, disadari atau tidak, permasalahan Narkoba telah menjangkau seluruh dunia dan sudah sampai pada taraf mengkhawatirkan. Untuk itu, kata Kabag Bina Mitra, diharapkan kepada semua pihak secara bersama untuk menanggulangi penyalahgunaan peredaran narkoba. “ Masalah penyalahgunaan dan peredaran narkoba, menjadi masalah bersama umat manusia. Jadi, keterlibatan dan peran aktif masyarakat sangat diharapkan, karena tugas tersebut bukan hanya tugas kepolisian dan pemerintah saja. Mari kita bersama-sama menanggulangi atau memberantas penyalahgunaan narkoba,” imbau Kabag Bina Mitra. Dikatakan Kabag Bina Mitra, sosialisasi penanggulangan penyalahgunaan narkoba ini merupakan salah satu solusi untuk mengatasi pertumbuhan penyalahgunaan narkoba. “ Bantu Polri dalam pemberantasan peredaran narkoba, dengan tidak ikut memakai dan mengedar narkoba. Laporkan segera apabila menemukan pemakai, pengedar dan penyimpan narkoba,” pesan Kabag Bina Mitra. (a37)

Pemotongan Gaji TKS Di Kesbang Linmas Minta Diusut Tuntas LIMAPULUH (Waspada) : Pemotongan gaji Tenaga Kerja Sukarela (TKS) di lingkungan Kantor Kesbang Linmas,Kab.Batu Bara diminta berbagai kalangan untuk diusut tuntas, demi tegaknya pemerintahan yang bersih di Batu Bara. Ketua LSM Aurel Citra Indonesia (ACI) Marzuki kepada Waspada, Selasa(21/7). “Meskipun sisa gaji mereka diberikan kembali tetapi pada intinya telah terjadi tindak pemotongan. Kita pun tidak mengetahui apakah setelah dikembalikan gaji mereka penuh diberikan sesuai dengan yang dianggarkan di APBD,” kata Marzuki. Ia juga mengharapkan agar pihak-pihak yang berkenaan dengan pelanggaran hukum ini seperti Kejaksaan Negeri Kisaran ataupun Tipikor Polres segera memeriksa oknum-oknum yang terlibat dalam pemotongan gaji TKS tersebut. Sementara itu Jaya, salah seorang TKS yang telah dipecat UR pertengahan Juli 2009 kepada Waspada sebelumnya mengatakan, ia telah bekerja sebagai TKS sejak pertengahan bulan Februari 2009, saat ia menerima gaji hanya diberi Rp 1.575.000. Karena masalah pemotongan gaji ini diungkap Wakil Bupati Batu Bara Gong Matua keesokan harinya ditambah Rp 276.000. Padahal gaji yang dibayarkan itu adalah untuk triwulan ke dua(April Juni) menurut temuan Gong Matua berdasarkan pengakuan UR satu orang TKS per triwulannya berhak menerima Rp 2.550.000. Seperti diberitakan Waspada, Sabtu(18/7) berdasarkan laporan TKS Gong Matua memeriksa Kakan Kesbang Linmas UR terkait pemotongan gaji TKS, dalam pemeriksaan itulah diketahui dan UR pun mengaku dan berjanji mengembalikan. (a31)

Komisi D Desak Pemkab Mendata Kembali Pegawai Honda KISARAN (Waspada) : Rapat kordinasi Komisi D DPRD Kabupaten Asahan, Selasa (21/7) meminta Pemkab untuk mendata kembali pengawai honor daerah (honda) yang mendapat SK Bupati tahun 2005 yang mayoritas sebagai guru sekolah untuk diajukan menjadi PNS, terkait banyaknya ditemukan pegawai honda yang belum mendapat perhatian pemerintah. “ Ada ratusan pegawai honda SK Bupati tahun 2005 yang belum masuk ke data base, sehingga kami harap Pemkab untuk mendata kembali data itu, dan memberikan kepada kami selambatnya akhir bulan Juli atau awal Agustus ini,” ujar Ketua Komisi D DPRD Asahan Darwis Sirait kepada Waspada. Data itu, lanjut Darwis, akan dibawa ke Medan untuk pemutahiran data dan dikirimkan ke Jakarta untuk diajukan menjadi PNS. “ Sehingga semua pegawai yang mendapat SK Bupati tahun 2005 diangkat menjadi PNS,” ujar Darwis didampingi Sekretaris Komisi D Armen Simargolang. Menurut Darwis, pengawai honda yang mendapat SK Bupati dari tahun 2001-2004 sudah didaftarkan kedalam databes dan akan diangkat menjadi PNS, namun untuk tahun 2005, mereka belum terdaftar di data base, sehingga mereka merasa tidak diperhatikan nasibnya. “Mereka juga warga Asahan yang telah membantu pemerintah, jadi mereka harus diperhatikan,” ujar Darwis. (csap)

WASPADA Rabu 22 Juli 2009

Pondasi Retak, Jembatan Sungai Barumun Terancam Ambruk

Waspada/Armansyah Abdi

KANAN KE KIRI: Anggota DPD-RI Parlindungan Purba SH, Pj Bupati Labusel Hj Sabrina, MSi dan anggota DPRD L.Batu Hefrin Harahap, meninjau pondasi Jembatan Sungai Barumun, yang retak, Senin (20/7).

20 Balita Di Tanjung Balai Terjangkit Gizi Buruk Dinkes Dituding Kurang Tanggap TANJUNGBALAI (Waspada): Sedikitnya 20 balita di Kota Tanjung Balai, terjangkit gizi buruk. Para balita itu tersebar di Kecamatan Datuk Bandar, Datuk Bandar Timur dan Teluk Nibung. Demikian laporan tertulis Kepala Dinas Kesehatan Kota Tanjung Balai tentang pelaksanaan penanggulangan gizi buruk, diterima Waspada,Selasa (21/7). Menurut Kadinkes, dari 20 kasus malnutrisi atau gizi buruk itu, 4 di antaranya dirujuk ke RSUD Kota Tanjung Balai dengan status marasmus. Dan, katanya, 1 orang yang dirujuk itu, telah meninggal dunia. “ Secara keseluruhan kasus, yang dirawat hanya 1 orang yang tidak melalui tahapan pelacakan, pe-

meriksaan, rujuk dan pemantauan, tapi langsung dirujuk ke RSUD atas inisiatif sendiri karena kondisi balita itu sangat buruk,” kata Kadinkes. Lebih lanjut dikatakan Kadinkes, selain faktor ekonomi, sosial, budaya, lingkungan dan prilaku serta kesehatan, penanggulangan gizi buruk terganjal pada individual (orang tua) yang enggan membawa balitanya ke Posyandu. Dan, menurutnya, kebanyakan kasus yang ditemui berasal dari keluarga miskin yang tidak mengikuti program KB, sehingga memperbesar peluang tetap berada pada kondisi gizi buruk, akibat asupan gizi tidak mencukupi. Di tempat terpisah, aktifis LSM Kota Tanjung Balai F Andreas menilai, Dinas Kesehatan kurang tanggap menanggulangi gizi buruk di Kota Tanjung Balai. Contohnya, kata Andreas, penemuan salah satu balita gizi buruk yakni Khairul, usia 1,6

tahun, warga Beting Kwala Kapias, Kec Teluk Nibung, bukan hasil pelacakan Dinkes, tapi pihak RSUD Kota Tanjung Balai. “Ironiskan, yang melacaknya bukan Dinkes, tapi pihak RSUD Tanjung Balai. Malah ketika ditemukan, kondisi balita itu sangat memprihatinkan dan keluarganya menolak dibawa ke rumah sakit untuk rawat inap dan perobatan intensif secara medis. Berarti selama ini, pelacakan kasus gizi buruk dan penyuluhan serta pemantauan kesehatan tidak terlaksana secara optimal. Jadi apa saja kerja Dinkes,” tukas Andreas. Atas dasar itu, Andreas menyarankan Walikota Tanjung Balai untuk meninjau ulang keberadaan pemangku jabatan tertinggi di Dinas Kesehatan. “ Realistis sajalah, kalau memang tak bisa menunjukkan kinerja yang baik dan optimal, buat apa dipertahankan,” tukas Andreas. (a37)

KLH Batu Bara Belum Terima Laporan Aksi Setrum Ikan LIMAPULUH (Waspada): Kantor Lingkungan Hidup (KLH) Kabupaten Batu Bara belum ada menerima laporan maraknya aksi penggunaan setrum (arus listrik) dalam penangkapan ikan air tawar pada berbagai sungai di Batubara belakangan ini. Hal itu dikatakan Kepala KLH Batu Bara, Zamachsyari, menjawab Waspada di Limapuluh, Selasa (21/7) seputar keluhan nelayan ikan air tawar daerah ini akibat aksi penangkapan ikan menggunakan setrum. ‘’Kami belum ada menerima informasi ini. Baru sekaranglah kami mengetahuinya. Ini informasi yang cukup berharga bagi kami. Kita akan segera berupaya mencarikansolusipencegahannya secepatnya,’’ ujar Zamachsyari. Menjawab bentuk upaya yang segera akan dilakukan pihaknya, Zamachsyari mengatakan, akan segera menghubungi camat dan muspika. Setelah itu baru akan dilakukan langkahlangkah pencegahan, ujarnya. Menurutnya, Pemkab Batu Bara telah memiliki upaya yang menyeluruh untuk melindungi dan mengembangkan biota air di daerah ini. Termasuk biota ikan air tawar. Upaya itu dengan mempersiapkan Peraturan Dae-

rah (Perda) tentang Perlindungan Biota air. ’’Rancangan Perdanya telah kita siapkan dan telah dimasukkan ke DPRD. Kini Ranperda itu tengah berada di DPRD guna mendapat pembahasan untuk ditetapkan sebagai Perda,’’ujar Zamachsyari. Namun, lanjutnya, anggota DPRD meminta dilakukan studi banding terlebih dahulu sebelum membahas Ranperda itu. Saat ini anggota DPRD Batu Bara sedang melaksanakan studi banding ke berbagai daerah. Dalam waktu dekat, sepulangnya dari studi banding DPRD akan memulai pembahasan Ranperda ini. ‘’Saya optimis, sebelum masa tugas DPRD

sekarang berakhir, Ranperda itu akan dapat ditetapkan dan disahkan sebagai Perda Perlindungan Biota Air,’’tegas Zamchsyari. Perda itu nanti akan menjadi landasan hukum bagi pelaksanaan perlindungan dan pengembangan biota air termasuk biota ikan air tawar di Batu Bara ini, paparnya. Zamachsyari mengakui, saat ini memang ada peraturan yang berlaku secara nasional yang dapat dijadikan dasar hukum pencegahan aksi penyetruman ikan itu. Di antaranya undangundang perikanan dan lingkungan hidup. ‘’Tapi maklumlah, kitakan kabupaten yang baru,’’ ujarnya.(a25)

Status Akper Pemkab Langkat Membingungkan STABAT (Waspada): Status yang disandang Akademi Keperawatan (Akper) dan Akademi Kebidanan (Akbid) Pemkab Langkat membingungkan dan beberapa bulan terakhir menuai kontroversi. Sejumlah pejabat berkompetensi dalam hal itu juga mengaku bingung dengan statusnya. Selain itu sekolah dimaksud juga tidak di bawah naungan SKPD seperti Dinas Kesehatan dan Dinas P Dan P Langkat. Kadis Kesehatan Langkat Indra Salahuddin ketika dimintai penjelasannya, Selasa (21/7) menuturkan, Akper merupakan konversi dari Sekolah Perawat Kesehatan (SPK). Ketika masih SPK memang di bawah pengawasan Dinkes, tetapi karena berubah menjadi Akper Dinkes tidak terlibat lagi. Sementara, status Akper Pemkab Langkat, Indra tidak paham. (a38)

SKPD Dan Warga Diajak Membangun Labura AEKKANOPAN (Waspada): Pj Bupati Labuhan Batu Utara Drs Daudsyah, MM mengharapkan bantuan para SKPD dan berbagai lapisan masyarakat agar pembangunan dan kesejahteraan masyarakat cepat terwujud dan pelaksanaan Pilkada pada 2010 dapat terselenggara dengan baik. Demikian dikatakan Daudsyah saat HUT Kabupaten La-

bura, Selasa (21/7) di halaman kantor Bupati Labura yang dihadiri Kapolres, Kepala Pengadilan Negeri danWakil Bupati Labuhan Batu serta berbagai elemen masyarakat kabupaten Labura. Menurutnya, dirinya dihunjuk Mendagri sejak 15 Januari lalu sebagai Pj Bupati Labura adalah guna menjalankan roda pemerintahan guna memberikan pelayanan kepada masyara-

Waspada/Indra Sima

LEPAS LAMBANG: Pj Bupati Labura melepas lambang Labura dengan balon ke udara menandai peringatan 1 tahun kabupaten yang dimekarkan dari Labuhan Batu, Selasa (21/7).

kat serta melaksanakan pilkada. Dalam kesempatan itu Daudsyah menyerahkan berbagai bantuan pemerintah kepada masyarakat di antaranya bibit padi, bibit sayuran dan tanaman keras lainnya serta pemberian ternak lembu untuk menunjang dan meningkatkan perekonomian masyarakat. Selain itu juga diserahkan penghargaan kepada tokoh pemekaran, perusahaan yang peduli kepada pembangunan didaerah ini dan dua penggagas pembuatan logo Kabupaten Labura Drs Ahyar Arif Zakaria dan pembuatan motto BS Pane. Sebelumnya Bupati juga melepaskan balon terbang yang menerbangkan spanduk memuat lambang Kabupaten Labura. Pj Bupati memberikan bantuan kepada fakir miskin dan anak yatim sebagai rasa syukur Kabupaten Labuhanbatu berusia satu tahun serta kepada masyarakat yang rumahnya tidak layak huni dengan cara bedah rumah agar rumahnya menjadi layak huni. (a29/csi)

KOTAPINANG (Waspada): Karena pondasinya retak, Jembatan Sungai Barumun yang melintasi Kecamatan Kotapinang, Kabupaten Labuhan Batu Selatan (Labusel), terancam ambruk. Pantauan Waspada bersama anggota DPDRI Parlindungan Purba SH dan Pejabat (Pj) Bupati Labusel Hj Sabrina, MSi serta rombongan, Senin (20/7) saat meninjau jembatan dimaksud, terlihat retakan yang lumayan besar dan panjang pada pondasi pertama jembatan dari arah Kotapinang menuju Provinsi Riau. Terlihat pula bronjong dipasang di bagian bawah fondasi yang retak yang dimaksudkan sebagai antisipasi agar pondasi bisa bertahan dari kerubuhannya. Menjelaskan kondisi Jembatan Sungai Barumun yang memiliki panjang sekira 80 meter, Pj Bupati Labusel Hj Sabrina kepada Waspada, menyampaikan, saat dirinya menjabat di daerah pemekaran baru tersebut, pondasi jembatan telah retak. Diakuinya, pihak Pemerintah Provinsi Sumatera Utara (Pemprovsu) memang memasang bronjong di bagian bawah pondasi yang retak itu guna menahan fondasi agar bertahan dari ancaman keruntuhannya. Tetapi penahan dengan menggunakan bronjong itu hanya bersifat sementara dan tidak permanen serta tidak bisa bertahan lama dalam jangka panjang menghadapi daya dukung pondasi yang sudah menurun akibat keretakan yang ada. Sebagai kepala daerah walau hanya bertugas sementara di Labusel, katanya, dia khawatir akan kondisi jembatan karena tidak ada

infrastruktur jalan alternatif dari dan ke Provinsi Riau di Labusel selain jalan yang melintasi Jembatan Sungai Barumun itu. Apabila jembatan itu putus atau ambruk, maka selain akan menimbulkan kerugian jiwa, juga akan memutuskan urat nadi perekonomian Sumatera Utara-Riau khususnya melumpuhkan kabupaten/kota di jalan lintas timur yang biasa melintasi Jembatan Sungai Barumun. Selain menanti pemerintah untuk memperbaiki pondasi Jembatan Sungai Barumun, tambah Sabrina, Pemkab Labusel juga sudah merencanakan jalan negara alternatif, yakni jalan lingkar (ring road) yang bertujuan selain untuk mengurai kemacetan, juga bertujuan agar menjaga hal-hal tidak diinginkan seperti kerusakan fisik seperti pondasi Jembatan Sungai Barumun. Jika jalan lingkar itu telah terealisasi, maka angkutan truk dan bus tidak bisa lagi melintasi kota di jalan negara yang sudah ada, melainkan harus melalui jalan lingkar. Yang boleh melintas di jalan negara di kota adalah mobil pribadi dan angkutan di luar bus dan truk. Sementara Parlindungan Purba yang prihatin melihat kondisi jembatan, segera menghubungi Kepala Balai Besar Jalan dan Jembatan Sumut Winarno dengan selularnya. Menjawab anggota DPD RI Dapem Sumut itu, Winarno menyatakan, pihaknya dalam waktu dekat akan melaksanakan perbaikan pondasi jembatan dimaksud. Parlindungan juga meyakinkan Sabrina dengan mengatakan, setelah sampai di Jakarta nanti, dia akan menemui Kementerian Pekerjaan Umum agar perbaikan pondasi jembatan itu dipastikan cepat dikerjakan. (a27)

Sudah Menang Prapid Dua Tahun Lalu, Kini Malah Akan Diserahkan Ke Jaksa MEDAN (Waspada): Ketua Kelompok Tani (poktan) Makmur Pasar XX, Desa Perbangunan, Kec. Sei. Kepayang Hj Lamsari, warga Kota Tanjung Balai yang praperadilannya dikabulkan Pengadilan Negeri (PN) T. Balai pada 2007, meminta pertanggungjawaban pengadilan karena dipanggillagiolehPolresAsahanuntukdiserahkan ke kejaksaan karena perkaranya dinyatakan P 21. ’’PN T. Balai yang memproses praperadilan Hj Lamsari pada 2007 lalu atas penangkapan dan penahanan dirinya, memutuskan penangkapan dan penahanan itu tidak sah sehingga harus dibebaskan. Namun, anehnya 13 Juli 2009 lalu dipanggillagiolehPolresAsahanuntukdiserahkan ke kejaksaan karena berkas perkaranya dinyatakansudahP21,’’tegaskuasahukum/pengacaranya Ali Pulungan, SH kepada Waspada, di Medan, Selasa (21/7). Ini hal yang sangat aneh, lanjut Ali Pulungan, selain wajar disesalkan sekaligus menimbulkan rasa prihatin kita atas kejadian itu. Apalagi, beberapa putusan PN T. Balai itu (No. 4/PRA.PID/ 2007/PN-TB) belum dilaksanakan oleh Polres Asahan, antara lain merehabilitasi sebasgai akibat tidak sahnya penahanan yang dilakukan para termohon (Polres Asahan) dengan memuat pernyataan maaf kepada pemohon (Hj Lamsari) melalui iklan di tiga surat kabar (Waspada, SIB dan Analisa) selama tiga hari berturut-turut dan penangkapan/penahananitudapatdikategorikan penyalahgunaan wewenang. Ali Pulungan selaku praktisi hukum juga dengan tegas menyatakan, pemanggilan kembali oleh Polres Asahan atas diri Hj Lamsari yang memenangkan perkara praperadilan itu, untuk diserahkan ke kejaksaan atau Kejari T. Balai, tidak

benar serta telah menyimpang dari ketentuan hukum yang ada. ’’Orang yang sudah menang praperadilan dan bebas 2 tahun lalu, malah perkaranya dinyatakan P 21 (lengkap) untuk dilimpahkan ke pengadilan.Inidikhawatirkanadakaitannyadengan bakal majunya Hj Lamsari sebagai calon independen dalam PilkadaT. Balai pada 2010 mendatang,’’ papar Ali Pulungan. Menurut Ali lagi, jika tetap perkaranya dinaikkan maka akan dimintakan pertanggungjawaban PN. Tanjung Balai tentang putusan prapid yang lalu dan status Hj. Lamsari sendiri ke depan melalui persidangan. Seharusnya, penegak hukum seperti penyidik dan jaksa menghormati putusan praperadilan tersebut. Kuasa hukum/pengacara Hj Lamsari ini juga memaparkan kronologis penangkapan dan penahanan Hj Lamsari di 2007. Disebutkan, Hj Lamsari, penduduk Jalan Beting Seroja, SS Dengki, Kel. Keramat Kuda, Kec. Sei. Tualang Raso, Kota. Tanjung Balai, telah dituduh menyuruh orang lain merambah hutan, padahal bukan hutan melainkan tanah yang diganti ruginya dari orang lain sebanyak 5 pancang di Desa Perbangunan. Hj Lamsari kemudian mempraperadilankan Polres Asahan dan oleh PN Tanjung Balai permohonannya tersebut dikabulkan sebagian. Selanjutnya dia bebas karena penangkapan dan penahanan tidak sah. Ditambahkan Ali Pulungan, dan anehnya lagi, kini tanah milik Lamsari tersebut diklaim pula oleh PT Inti Palm sebagai milik mereka. Ini menjadi sangat lebih aneh lagi, sebab lahan sudah jelas hukan hutan sebagaimana disangkakan dulu kepada Lamsari dengan tuduhan merambah hutan. (m34)

Intervensi PMD Dan Camat, BPD Tandingan ‘Gol’ TANJUNGTIRAM (Waspada): Warga Desa Limalaras, Kec. Tanjung Tiram, Batu Bara mempertanyakan keabsahan Kades R yang terus ngotot membentuk pengurus BPD tandingan disebut-sebut sudah ‘gol’ dibentuk dalam pertemuan di kantor Camat Tanjung Tiram, Kamis (16/7). Menurut sumber, pengurus BPD tandingan hasil rekayasa R diketuai A Kadir ‘gol’ dihadiri beberapa orang warga, Kadus yang pro R diduga adanya intervensi Kakan PMD Batu Bara menugaskan anggotanya bersama camat setempat. “Yang pasti pengurus BPD tidak diundang dan rapat pun di kantor Camat Tanjung Tiram. Kepengurusan BPD tandingan dibentuk beberapa orang saja,” sebut sumber. Warga mencurigai apakah ada udang di balik batu seakan pembentukan BPD tandingan dipaksakan ikut dibidani Kakan PMD dan camat bahkan rapatnya pun di kantor Camat Tanjung Tiram, mengapa tidak di Balai Desa Limalaras. Disebutkan tindakan ‘berajo di hati basutan dimato’ ini apakah dibenarkan dalam alam demokrasi atau sudah pas dalam pasal-pasal petunjuk pelaksanaan (Juklak) BPD yang mengaturnya. Dalam hal kekisruhan Kades R dengan BPD siapa yang benar dan salah, sebut warga berawal salah seorang warga mengadukan R dituduh memalsukan tandatangan ternyata keputusan Pengadilan Negeri Kisaran menjatuhkan vonis 10 bulan, dan R banding.

Kemudian BPD menuntut haknya realisasi dana sesuai ketentuan dalam proyek ADD tapi tidak diberikan R sehingga jadi kasus diadukan ke kejaksaan Labuhan Ruku belum disidangkan. Terakhir R mengundang BPD, warga untuk merevisi pengurus sambil minta agar pengaduan ke kejaksaan dicabut tidak membawa hasil. Sejak itu R terus berupaya membentuk BPD tandingan 1 Juli 2009 gagal sempat ribut kursi plastik balai desa berpatahan, dilanjutkan tanggal 14 Juli 2009 juga menga lami kegagalan. Dengan adanya intervensi Kakan PMD dan camat, R merasa berhasil membentuk BPD tandingan diselimuti tanda tanya tersebut, Kamis (16/ 7) di kantor Camat Tanjung Tiram. Ketua BPD Limalaras Laitami, Kamis (16/ 7) mengatakan pengurus harian BPD tidak mendapat undangan rapat di kantor camat, yang diundang Kadus, beberapa warga pro R. Seharusnya pihak camat maupun PMD memahami prosedur bila mau membentuk BPD berdasarkan ketentuan berlaku dengan mengundang pengurus harian serta puluhan tokoh bukan hanya diputuskan oleh beberapa orang saja. Camat Tanjung Tiram Abd Rahman Hadi di Limapuluh, Jumat (17/7) menyatakan dia tidak hadir dalam rapat di kantor camat, Kamis (16/7) diwakili Sekcam. Ditanya apakah sudah dibentuk BPD tandingan, dia tidak jelas memberi jawaban sudah atau belum terbentuk BPD Limalaras yang baru beralasan tidak hadir waktu itu.(a30)

DPP PMS Lantik DPD PMS Labusel KOTAPINANG (Waspada): DPP Partuha Maujana Simalungun (DPP-PMS) diwakili Parlindungan Purba, Senin (20/7) melantik pengurus DPD-PMS Kab. Labuhan Batu Selatan (Labusel) di Lapangan Herfinta Cikampak, Kec. Torgamba. Pengurus DPD-PMS Labusel yang dilantik Ketua Junherdison Sitopu, Wakil Ketua Bismawater Sinaga, Ir Eliakim Purba, Hotbiner Sinaga, sedangkan Sekretaris Sondang Marulitua Purba, Wakil Arhem Purba dan Adinur Sinaga, serta Bendahara Syukur Ala Akbar Purba serta Darison Purba, dilengkapi bidang-bidang. Ketua DPD-PMS Labusel mengucapkan terima kasih kepada semua lapisan dan mengharapkan dukungan serta kerjasama kepada semua pengurus dalam menjalankan roda organisasi kedepan, agar PMS Labusel dapat berdaya guna bagi masyarakat serta kendukung pembangunan di kabupaten yang baru mekar ini. Tampak hadir Pj Bupati Labusel Hj R Sabrina, Camat Torgamba Imam Ali Harahap, Evendi Ritonga dari Medan serta sejumlah tokoh adat. Evendi Ritonga yang juga bakal calon bupati pada pilkada di Labusel yang akan datang mengucapkan selamat atas pelantikan DPDPMS Labusel, dan salut kepada warga Simalungun yang menjunjung tinggi adat dan budaya

Waspada/Hasanuddin

MENARI: Drs H Evendi Ritonga, MPd, Ka.Biro Administrasi Umum dan Keuangan Unimed, bersama warga Simalungun menari bersama usai pelantikan DPD-PMS Labusel, Senin (20/ 7). Simalungun karena semua etnis serta budaya kita termasuk adat dan budaya Simalungun merupakan aset bangsa kita. Ritonga dengan kerendahan hati memperkenalkan diri sebagai putra Labuhan Batu dan selama ini mengabdi di Universitas Medan (Unimed), serta banyak bergaul dengan masyarakat Simalungun. (c05)


Rabu 22 Juli 2009

Soal Kondisi Kesehatan

Hari Ini DPRD Undang Walikota Sibolga SIBOLGA (Waspada): Dalam beberapa waktu terakhir ini DPRD Sibolga belum mengetahui secara pasti tentang kondisi kesehatan Walikota Sibolga Drs Sahat P Panggabean, maka direncanakan hari ini, Rabu (22/7) akan diundang untuk datang langsung ke DPRD Sibolga. Demikian hasil pertemuan rapat pleno DPRD Sibolga Selasa (21/7) yang dihadiri 17 anggota DPRD lainnya dan dipimpin oleh Wakil Ketua HYusran Pasaribu di ruang rapat mini DPRD Sibolga. Pada pertemuan itu juga dihadiriWakil Ketua DPRDMeida R Hutagalung, SH, juga mendengarkan hasil konsultasi pihak DPRD Sibolga dengan pihak Direktorat Jenderal Otonomi Daerah Depdagri, Rabu (15/7) tentang jabatanWalikota Sibolga Drs Sahat P Panggabean. HYusran Pasaribu dalam paparannya dan juga mengaku langsung ikut melakukan konsultasi ke Depdagri bersama 2 anggota DPRD Sibolga lainnya yakni Wajib Saruksuk dan Marlius Telambanua bahwa mereka melaporkan kekosongan jabatan Walikota Sibolga, menyusul kondisi kesehatan Walikota Sibolga yang sempat mengalami gangguan pada 24 Januari 2009 lalu, hinggaWalikota Sibolga Drs Sahat P Panggabean dibawa berobat ke Singapura.

19

Sumatera Utara

WASPADA

Kemudian, karena kondisi kesehatannya yang termasuk parah ketika itu, maka Walikota Sibolga Drs Sahat P Panggabean memberikanSuratPerintahTugas kepada Wakil Walikota H Afifi Lubis, SH sebagai Pelaksana TugasWalikota Sibolga yang dikuatkan dengan Surat Perintah No. 217/SP/2009 tertanggal 21 April 2009 yang langsung ditandatangani Walikota Drs Sahat Panggabean. Mengingat kesehatan Walikota Sibolga yang belum pulih, sementara dalam UU No. 32 tentang Pemda ada disebutkan, jika selama 6 bulanWalikota tak dapat melaksanakan tugasnya secara berkelanjutan, maka DPRD Sibolga dapat meminta keterangan danmelakukankonsultasidengan pihak gubernur dan Departemen Dalam Negeri. “Berdasarkan ketentuan undang-undang tersebutlah kita langsung melakukan konsultasi kepada Depdagri, sehingga jabatan Walikota Sibolga dapat kita tempatkan sebagaimana mestinya yang dapat melaksanakantugaspemerintahan,pelaksanaan pembangunan dan juga untuk kepentingan masyarakat lainnya,” jelas HYusran Pasaribu. Menurut HYusran Pasaribu, saatmerekamelakukankonsultasi dengan pihak Depdagri yang saat itu dihadiri oleh Imam Prasetia

Kasubdit Wilayah 4 Direktorat Pejabat Negara Dirjend Otda mewakili Dirjend Otonomi Daerah, maka Depdagri menyarankan agar pihak DPRD Sibolga langsung saja melakukan konsultasi dengan Gubernur Sumatera Utara dengan membawa buktibukti seperti Surat Keterangan Sakit, Surat Perintah Pelaksana Tugas Walikota dan lainnya. “Namun anehnya, kita tak mengetahui kondisi kesehatan yang sebenarnya Walikota Drs Sahat P Panggabean. Karena sesuai surat tembusan yang kita terimaSuratTugasPelaksanaWalikota Sibolga tertanggal 21 April 2009 telah dicabut, menyusul dengan adanya Surat Keterangan No. 800/952/2009 tertanggal 17 Juli 2009 baru-baru ini. Dengan demikian, kita sebagai lembaga DPRD tak mengetahui sebenarnya kondisi kesehatan Walikota Sibolga. Untuk itu, kita akan melakukan konsultasi dengan Gubernur Sumut sesuai petunjuk dari pihak Depdagri,” papar H Yusran Pasaribu. SetelahWakil Ketua DPRD Sibolga HYusran Pasaribu memaparkan hasil konsultasi mereka ke Depdagri dan menyikapi kelanjutan tentang jabatanWalikota Sibolga tersebut, beberapa anggotaDPRDSibolgayanghadir saat itu menanggapinya agar pihak DPRD Sibolga langsung

untuk “memanggil” Walikota Sibolga Drs Sahat P Panggabean ke DPRD Sibolga untuk diketahui langsung kondisi kesehatannya dandidengarkanketerangannnya. Di antara anggota DPRD Sibolga yang mengusulkan pemanggilan ke DPRD Sibolga di antaranya Japitonggam Samosir, Riswan Caniago, H Kasim Sinaga, Hamzah ZT dan beberapa anggota DPRD Sibolga lainnya. Mendengar saran dan pendapat dari beberapa anggota DPRD Sibolga itu, Wakil Ketua DPRD Sibolga HYusran Pasaribu yang memimpin sidang saat itu memutuskan agar pihak Sekretariat DPRD langsung mengundangWalikota Sibolga Drs Sahat PPanggabeanuntukdidengarkan keterangan dan diketahui kondisi kesehetan yang sebenarnya. “Kitatakadaniatuntukmenggantikan posisiWalikota Sibolga, namunperwujudandariamanah dari undang-undang, kita perlu untuk menjalankan undang-undangtersebutdemiterlaksananya fungsi pemerintahan sesuai yang diamanatkan u-undang-undang itu,” kata HYusran Pasaribu saat akan mengakhiri rapat pleno itu. Sementara itu Ketua Komisi 1 DPRD Sibolga Hamzah Zeb Tumory kepada sejumlah wartawanusaipertemuanitu,mengaku heran dengan adanya surat keterangan yang baru muncul itu.

“Selama ini kita mengetahui Sahat P Panggabean selama ini sakit dan juga dikuatkan dengan adanya Surat Keterangan Sakit dari salah seorang dokter yang menanganinya di Rumah Sakit Elizabeth Singapura. Namun, kita juga terkejut dengan adanya surat keterangan yang mencabut surat perintahPelaksanaTugasWalikota itu. Sepertinya terkesan ada yang aneh.Makauntukitu,sudahsewajarnyalah kita langsung menghadirkan Walikota Sibolga Drs Sahat P Panggabean untuk kita dengarkan keterangannya,” ujar Ketua Komisi 1 yang membidangi Pemerintahan di DPRD Sibolga itu.(a18)

Afifi Lubis Jadi Warga Kehormatan HIKKBAR SIBOLGA (Waspada) : Rasa simpati warga Sibolga semakin hari semakin banyak mengalir terhadapWakilWalikota Sibolga H Afifi Lubis SH. Seperti halnya HIKKBAR (Himpunan Kerukunan Keluarga Barus) akan menjadikan H Afifi Lubismenjadiwargakehormatan HIKKBAR. Tercetusnyaakandiangkatnya H Afifi Lubis menjadiWarga Kehormatan HIKKBAR itu disampaikan para petinggi HIKKBAR yang ada di Kota Sibolga dan sekaligusPanitiaPaketRamadhan HIKKBAR saat beraudiensi kepadaWakilWalikota Sibolga Afifi Lubis, Selasa (21/7). Dalam audiensi itu panitia yang terdiri dari Agus Saleh (Ketua Panitia), Adek Parangtua SekretarisPanitia) IlhamPasaribu

(Sekretaris HIKKBAR) dan Junaidi Tanjung (Ketua Bidang PHBI HIKKBAR) serta dua penasehat HIKKBAR Busron Sinaga dan SabiruddinkepadaWakilWalikota menjelaskan,pada 8Agustus2009 keluarga besar HIKKBAR akan mengadakan peringatan Isra’ Mikraj Nabi Besar Muhammad SAW di Jalan Aso-aso Sibolga

sekaligus di bulan Ramadhan ini, keluarga besar HIKKBAR mengadakan Safari Ramadhan di tigawilayahyakniPandan,Sibolga danBarusdanmengadakanHalal Bi Halal pada 3 Syawal tahun ini, serta berbagai kegiatan lainnya. “Jadipadarangkaiankegiatan itukitadariHIKKBARakanmemakaikan pakaian kebesaran HIKK BARkepadaBapakWakilWalikota Sibolga H Afifi Lubis, SH sekaligus menobatkanbeliausebagaiWarga Kehormatan HIKKBAR,”kata mereka. Wakil Walikota Sibolga Afifi Lubis kepada perwakilan HIKK BAR mengatakan, dirinya dan Pemerintah Kota menyambut baik keinginan HIKKBAR untuk melaksanakanberbagairangkaian kegiatan untuk Ramadhan tahun ini.(a18)


20

Sumatera Utara

WASPADA Rabu 22 Juli 2009

Siswa SMAN 4 Dan 1 P. Siantar Unjuk Rasa Tolak Ruislagh P. SIANTAR (Waspada): Hampir seribuan pelajar SMA Negeri dan SMA Negeri 1 bersama siswa SD Negeri 122350 dan berbagai elemen masyarakat Kota P. Siantar berunjukrasa mulai dari Jalan Pattimura sampai ke Lapangan H. Adam Malik, gedung DPRD dan berakhir di Balai Kota, Selasa (21/7) menyatakan menolak ruislagh, pergantian kepala sekolah (Kepsek) dan mutasi guru. Sejak jam belajar dimulai, puluhan siswa SMA Negeri 1 menunggu di lapangan H Adam Malik dan melakukan kegiatan seperti bernyanyi bersama tentang perjuangan mereka agar Kepsek Risbon Sinaga, SPd yang diganti walikota baru-baru ini bersama Kepsek SMA Negeri 4 agar dikembalikan ke posisi semula. Pada saat bersamaan, siswa SMA Negeri 4 berkumpul di dalam lokasi SMA Negeri 4 di Jalan Pattimura dan selanjutnya bergerak menuju lapangan H Adam Malik dengan menyusuri Jalan Sutomo seraya meneriakkan berbagai tuntutan mereka dengan membawa poster-poster, spanduk tentang berbagai tuntutan mereka dan bendera STAI Samora serta bendera HMI. Saat bergabung dengan siswa SMA Negeri 1, kembali bergema berbagai tuntutan mereka dan selanjutnya bergerak menuju gedung DPRD. Massa sempat tertahan di depan pintu gerbang DPRD yang sengaja ditutup hingga mendapat cemohan dari para pengunjukrasa. Pihak kepolisian melalui Kasat Samapta AKP Arjo dengan meminjam pengeras suara massa yang sengaja dibawa di atas mobil pick-up menyebutkan, para pengunjukrasa diperbolehkan masuk ke halaman gedung DPRD dan meminta agar menyampaikan aspirasi dengan menjaga Kamtibmas dan keamanan serta ketertiban kota. “Mari samasama menjaga ketertiban kota. Selamat berunjukrasa.” Saat menyampaikan aspira-

sinya di halaman gedung DPRD, seorang siswa SMA Negeri 1 menyebutkan sesuai ketentuan, sesudah menjabat dalam masa empat tahun, pimpinan sekolah dapat diganti. Tapi, Kepsek SMA Negeri 1 Risbon Sinaga yang sudah menorehkan berbagai prestasi di SMA Negeri 1 meski baru satu tahun tiga bulan di SMA Negeri 1 langsung diganti. “Tindakan itu sama dengan mengobok-obok dunia pendidikan. Pendidikan bukan untuk diobok-obok, batalkan surat keputusan (SK) Kepsek yang baru dan kembalikan Kepsek Risbon Sinaga, karena dia memang the best leader.” Siswa SMA Negeri 4 Robby saat menyampaikan aspirasinya, menuntut agar dicabut izin prinsip DPRD, jangan ada lagi mutasi guru. “Kembalikan mobiler sekolah kami. Kami minta polisi menangkap oknum yang melecehkan guru kami.” Sama dengan itu, satu siswa SD Negeri 122350 Naomi Simanjuntak saat menyampaikan, aspiranya berteriak agar sekolahnya dikembalikan seperti semula. “Sekolah kami dipindah tanpa sepengetahuan kami. Kami meminta Presiden SBY memperhatikan pendidikan di P. Siantar.” Fery Simarmata dari Forum Pemuda Peduli Siantar (FPPS)mendesak DPRD melakukan kebijakan mencabut izin prinsip, alumni SMA Negeri 4 Rado Damanik menyatakan, ruislagh terjadi akibat DPRD mengeluarkan izin prinsip. “Kami meminta DPRD bersidang saat ini mencabut izin prinsip. Walikota yang kita pilih dengan harapan membangun P. Siantar, tapi kenyataannya mengkhianati rakyat seperti terjadinya berbagai kasus melibatkan walikota.Walikota dan DPRD bekerjasama menghabisi kekayaan P. Siantar.” Sementara, alumni SMA Negeri 4 lainnya Rosmelina Sinaga mengingatkan, agar jangan terjebak hanya menolak ruislagh, tapi harus menuntut agar DPRD mencabut izin prinsip DPRD. Sedang Timbul Panjaitan, SPd dari PGRI menyatakan, walikota tidak pernah berhasil menciptakan Perda khususnya tentang pendidikan yang berhasil hanya Perwa. “Di P. Siantar sekarang terjadi bencana pendidi-

kan. Pemindahan SMA Negeri 4, pemutasian guru dan pergantian Kepsek. SK yang mengacaukan pendidikan tolong dicabut.” Tokoh masyarakat DM Ater Siahaan menyebutkan, dunia pendidikan berkabung dengan pelaksanaan ruislagh hingga para siswa belajar di halaman dan sangat menyayangkan penggantian Kepsek. Anggota DPRD Raja PS Janter Aruan, SH mengajak massa agar berjuang bersama-sama, sedang rekannya Ahmad Mangantar Manik dan sekaligus anggota Komite SMA Negeri 4 menyatakan, pemindahan SMA Negeri 4 tidak transparan dan tidak ada sosialisasi serta sebagai anggota DPRD siap berjuang bersama-sama. “Izin prinsip bukan satu-satunya agar bisa melakukan ruislagh dan hanya bagian kecil saja.” Rekannya P. Sihombing mengajak samasama menjaga P. Siantar agar tetap kondusif. Sebelum Ketua DPRD Lingga Napitupulu, BcEng berbicara, Kaliaman Sitio dari FPPS membacakan pernyataan sikap FPPS. “Melihat kondisi Pemko sudah tidak kondusif dengan ini meminta walikota segera membatalkan izin prinsip ruislagh (tukar guling-red) SMA Negeri 4 dan SD Negeri 122350, meninjau kembali pergantian Kepsek SMA Negeri 1 yang tidak sesuai prosedur dan mekanisme yang berlaku (Kepmendiknas nomor 162/U/2003 tentang persyaratan dan masa jabatan Kepsek).” Kemudian, segera mengembalikan mobiler SMA Negeri 4, mempertanyakan berdirinya sebuah bangunan di areal RSUD Dr. Djasamen Saragih (milik siapa?), terjadinya mutasi guru-guru di SMA Negeri 4 yang tidak sesuai prosedur dan DPRD segera membuat kebijakan/keputusan. “Jika tidak, rakyat yang akan mengambil alih kebijakan melalui sidang rakyat Siantar.” Saat Ketua DPRD berbicara tidak langsung ke pokok permasalahan dan lebih dulu meminta agar sama-sama perbaiki tulisan ruilslagh dan bukan ruislagh. Kemudian, Ketua DPRD memberitahukan saat itu ada unjuk rasa di Medan dan Gubsu menelefonnya agar hadir di Medan menjelaskan masalah di P.

Dana Pengesahan LPJ Wako T. Tinggi Ditalangi 6 SKPD T. TINGGI (Waspada): Dana pengesahan Laporan Pertanggung JawabanWalikota T. Tinggi Tahun Anggaran 2008, yang kini tengah dibahas, senilai Rp300 juta akan ditalangi enam satuan kerja perangkat daerah (SKPD) yang memiliki dana besar. Keenam SKPD itu, Dinas Pendidikan, Pekerjaan Umum, Kesehatan, Perhubungan, Perindagkop dan Pendapatan. Namun, tiga Kepala SKPD yang dikonfirmasi, Senin (21/ 7), usai mendengarkan pandangan umum fraksi DPRD menyatakan, ketidaktahuannya soal dana pengesahan itu. Kadis Pendapatan Syamsul Rizal mengatakan, ketidaktahuannya soal adanya dana talangan untuk pengesahan LPJ Wako T. Tinggi TA 2008 itu. “Saya tak tahu itu. Kalau di dinas

saya memang tak ada,” kata dia. Hal senada disampaikan Kadis Perhubungan Postel Nainggolan yang mengatakan, dana talangan itu tak ada, sambil berlalu ke mobil dinasnya. Kedua dinas itu, memiliki anggaran untuk sejumlah proyek di APBD TA 2009. Sedangkan Kadis Perindagkop dan UKM H. Suryo S, mengatakan, tidak mengetahui adanya dana talangan itu. “Kalau dinas saya tidak ada, karena memang proyek disinikan tak ada. Entah kalau dinas lain,” tegas dia, sebelum mengikuti rapat antar Kepala SKPD usai rapat paripurna DPRD, di ruang data. Sedangkan anggota DPRD Pahala Sitorus yang menyatakan akan mempertanyakan persoalan itu dalam pandangan umum fraksinya, ternyata tidak

melakukan hal itu. Saat dikonfirmasi di ruang Sekretaris DPRD Pahala Sitorus mengatakan, soal pernyataan Wakil Ketua DPRD Joni Sinaga sebelumnya dibantah yang bersangkutan. “Waktu saya tanya, dia mengatakan tak ada membuat pernyataan itu,” kilah Pahala. Sementara itu, sumber menyatakan dana talangan memang tidak dikeluarkan semua SKPD, tapi hanya beberapa saja. Umumnya, kata sumber, dana berasal dari SKPD yang memiliki proyek pada TA 2009. Proses penyaluran dana itu, jelas sumber, diantarkan langsung kepala SKPD terkait ke ‘kamar satu’ dan dana itu kemudian diberikan melalui anggota DPRD yang jadi utusan. “Setahu saya dananya cash dan tidak melalui rekening atau cek,” tegas sumber. (a08)

DPRD T. Tinggi Pertanyakan Cicilan Kendaraan Dan Traffic Light TEBING TINGGI (Waspada): Fraksi DPRD Kota Tebing Tinggi mempertanyakan sejumlah persoalan terkait dengan Laporan Pertanggung Jawaban Walikota terhadap pelaksaanan APBD TA 2008. Di antaranya, cicilan kendaraan roda dua yang dimasukkan sebagai sumber pendapatan asli daerah dan rehab traffic light Simpang Empat yang dialokasikan kembali. Fraksi Perhimpunan Indonesia Baru melalui juru bicara EnnyW Ningsih, mempertanyakan hal itu, Selasa (21/7) dalam pandangan umumnya di rapat paripurna DPRD menanggapi nota pengantar Walikota. Menurut FPIB, meskinya cicilan itu tidak menjadi sumber pendapatan daerah, karena ada pengadaan kendaraan roda dua itu berasal dari APBD juga. Demikian pula dengan traffic light Simpang Empat di mana tahun sebelumnya dana itu telah dianggarkan, tapi bermasalah. Nyatanya tahun berikutnya justru dianggarkan kembali. Fraksi Persatuan Demokrat melalui jurubicara Emri Siregar juga mempertanyakan soal cicilan kendaraan roda dua yang diperuntukkan bagi PNS di jajaran

Pemko Tebing Tinggi. Fraksi Amanah Bintang melalui jubirnya HM Hamzah Lubis, memuji kinerja Pemko Tebing Tinggi dan berharap agar pengawasan dan peningkatan kinerja terus dilakukan dalam upaya peningkatan PAD. Bahkan Fraksi Golkar melalui Pahala Sitorus, meminta Pemko Tebing Tinggi menambahkan dana penyertaan modal ke Bank Sumut, karena penerimaan deviden yang besar mencapai Rp2,086 miliar. Dalam pandangan umum itu, tiga fraksi memuji kinerja RSU Dr H Kumpulan Pane, karena memberikan kontribusi yang signifikan terhadap PAD. Di mana unit pelayanan kesehatan itu mampu menyumbang PAD hingga Rp3,558 miliar. Beberapa elemen masyarakat memberi tanggapan berbeda dari DPRD. Misalnya, soal sumbangan RSU terhadap PAD, merupakan indikasi kian tidak sehatnya masyarakat Kota Tebing Tinggi. “Dengan peningkatan retribusi RSU terhadap PAD ada indikasi kian banyak warga yang sakit. Sama artinya visi kesehatan Pemko tak jalan,” tegas salah seorang pejabat

SKPD itu. Selain itu, retribusi RSU sebenarnya tidak bisa dipandang sebagai PAD, karena unit pelayanan kesehatan itu selama ini masih menerima dana APBD. “Coba bagikan antara retribusi yang diperoleh dengan bantuan yang diterima, pasti RSU tekor. Tapi kalau selama ini pendanaannya swadana baru betul ada kontribusinya” kata PNS yang kritis itu. Namun, Kepala RSU Vive Kananda membantah dengan menyatakan peningkatan PAD itu, karena banyak warga yang berobat ke RSU karena peralatannya lengkap.Yang pasti bukan banyak yang sakit, tapi warga memindahkan perobatannya dari tempat lain ke RSU,” kata Kananda. Demikian pula dengan cicilan kendaraan roda dua untuk PNS yang dimasukkan dalam item pendapatan asli daerah. Meskinya komponen itu tidak bisa dimasukkan dalam PAD, karena hanya bersifat pengalihan dari APBD sebelumnya, kata warga lain. Apalagi kebijakan cicilan kendaraan itu merupakan temuan BPK RI dan program itu tidak bisa dilanjutkan lagi. (a08)

Siantar. Mengenai ruislagh, Ketua DPRD menyebutkan, tahun 2005 ada pengusaha yang memiliki tiga gedung dan mengajak berembuk dan meminta pandangan Ketua DPRD dan walikota bagaimana kalau dilakukan tukar menukar. “Izin prinsip bukan satu-satunya hak. Contohnya, membeli mobil masih harus ada STNK, BPKB dan lainnya. Izin prinsip hanya proses dan ruislagh harus tetap mengacu kepada PP nomor 06 tahun 2006 tentang pengelolaan barang milik negara/daerah. “Sampai saat ini, kami belum pernah menerima persetujuan presiden. Kalau memang benar ada sertifikat SMA Negeri 4 dan SD Negeri 122350, kami belum pernah melihat. Kalau belum ada sertifikat berarti itu masih milik pemerintah pusat. SD di Jalan Pane, saya tidak mengetahui punya siapa.” Agar anak-anak tidak terlantar, lanjut Ketua DPRD semua sekolah dikembalikan ke tempat semula dan mobiler sekolah dikembalikan. “Bila Pemko tidak mengembalikan akan sama-sama kita jemput.” Ketua DPRD kembali ke soal izin prinsip menyebutkan, di dalam izin prinsip tidak ada disebutkan mana gantinya dan beberapa kali DPRD meminta kepada Pemko turunan izin prinsip berupa MoU, namun tidak ada

diberikan. “Kepada kepolisian, kami meminta jangan asal kawal, tapi ketentuannya tidak beres. Negara ini bukan negara kuasa, tapi negara hukum.” Ketika Rosmelina dan Jansen Napitu selaku Wakil Ketua Komite Sekolah SMA Negeri 4 meminta ketegasan, Ketua DPRD meminta agar diberi waktu menelefon Gubsu. “Menurut informasi, Gubsu beserta stafnya sudah menunggu-nunggu walikota, namun tidak hadir.” Ketika didesak tentang penggantian Kepsek SMA Negeri 1, Ketua DPRD menyebutkan, itu include dengan pemindahan SMA Negeri 4. “Saya akan bawa aspirasi penggantian Kepsek, mutasi guru dan masalah ruislagh ke Gubsu.” Usai mengatakan itu, Ketua DPRD langsung pergi. Massa selanjutnya bergeser ke Balai Kota dan menyampaikan berbagai aspirasi mereka. Asisten I Drs Jonson Simanjuntak menyebutkan sudah menerima aspirasi mereka dan sudah mengetahui apa yang disampaikan. “Kepada siswa agar tetap mengikuti proses belajar mengajar, guru-guru bekerja dengan baik dan mengajar anak didik di tempat yang sudah ditentukan.” Usai mangatakan itu, Asisten I langsung pergi. Massa pun akhirnya pergi dan kembali ke SMA Negeri 4.(a14)

Waspada/Edoard Sinaga

SAMPAIKAN ASPIRASI: Siswa SD 122350 Jalan Sutomo, Kota P. Siantar Naomi Simanjuntak menyampaikan aspirasinya di halaman gedung DPRD, Selasa (21/7) saat siswa SMA Negeri 4, SMA Negeri 1, siswa SD Negeri 122350 bersama berbagai elemen masyarakat berunjukrasa menolak ruislagh SMA Negeri 4, penggantian Kepsek SMA Negeri 1 dan lainnya.

Wartawan Dianiaya Di Kantor OKP P. SIANTAR (Waspada):Wartawan satu suratkabar terbitan Medan Samsudin Harahap, 48, warga Jalan Tanah Jawa, Gang Puri, Kelurahan Melayu, Kecamatan Siantar Utara, Kota Pematang Siantar diduga dianiaya hingga babak belur di kantor satu OKP. Berbagai keterangan dihimpun dan pengaduan Siti Hawa Batubara, 42, istri Samsudin, warga Jalan Tanah Jawa, Gang Puri, Kelurahan Melayu di Polresta, Selasa (21/7) dini hari menyebutkan Samsudin diduga dianiaya tiga pria di teras kantor

OKP itu di JalanWR. Supratman, Kelurahan Dwikora, Kecamatan Siantar Barat, Senin (20/7) pukul 23:30. Penganiayaan itu terjadi ketika Samsudin melintas dan singgah di satu warung di dekat kantor OKP itu. Saat itulah salah satu pria yang diduga turut menganiaya Samsudin mendatangi Samsudin dan mengatakan dipanggil ketua. Tanpa curiga, Samsudin mengikuti pria itu ke teras kantor OKP itu dan penganiayaan itu pun terjadi. Akibat penganiayaan itu, Samsudin mengalami luka di bibir, pipi kanan,

di bawah mata kanan, hidung mengeluarkan darah, rusuk kiri dan sekujur tubuh terasa sakit. Kapolresta AKBP Andreas Kusmaedi saat dikonfirmasi melalui Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap, Selasa (21/7) menyebutkan sesuai pengaduan istri Samsudin belum diketahui siapa tersangka pelaku penganiayaan itu. Menurut Kasat Reskrim, kasus itu masih dalam proses dengan mengambil visum Samsudin dan menyelidiki siapa tersangkapelakudanmotifnya.(a14)


Sumatera Utara

WASPADA Rabu 22 Juli 2009

Pelantikan Pejabat Di Palas Mengandung Dendam Politik SIBUHUAN (Waspada): Sejumlah kalangan menilai, pelantikan dan mutasi jabatan eselon III dan IV di lingkungan pemerintahan Kabupaten Padang Lawas baru-baru ini mengandung unsur dendam politik. Demikiansejumlahkalangan kepada Waspada, Selasa (21/7) terkait kegiatan pelantikan dan mutasi jabatan yang dilakukan Pemerintah Kabupaten Padang Lawas di bawahpimpinanBupati Basyrah Lubis danWakil Bupati, H Ali Sutan Harahap yang juga akrab dipanggil H TSO. Seperti Ahmad Kamil Lubis,

S.Pd.I, aktivis Pergerakan Mahasiswa Islam Indonesia (PMII) sebagai putra daerah yang peduli pembangunan Padang Lawas dari Medan , selasa (21/7) setelah membaca berita di beberapa media terbitan medan terkait pelantikan dan mutasi jabatan di jajaran Pemkab Padang Lawas. Menurutmasyarakatpelantikan dan mutasi jabatan yang dilakukan tidak berdasarkan kredibilitas dan prestasi serta kemampuanyangdimiliki.Sehinggatidak heran jika banyak di antara pejabat yang dilantik yang penempatannya tidak proporsional atau

tidak sesuai dengan porsi dan kualifikasi sesuai kemampuan masing-masing, Bahkan terkesan, mutasi dan pelantikan jabatan eselon III dan IV itu terjadi diskriminasi, bahkan tanpa melalui seleksi dari banyak di antara yang dilantik sebagai imbasdarimasapemilihankepala daerah lalu. Hal senada juga disampaikan beberapa tokoh pemekaran Padang Lawas. Mereka kecewa terhadappemerintahansetempat yangsampaisaatinibelumterlihat tanda-tanda akan perubahan, kecuali adanya pelantikan dan

mutasijabatanyangtidakproporsional dan terkesan diskriminasi. Diantaranyatidaksedikityang punya jabatan eselon III a kemudian di mutasi ke jabatan eselon IVa, seperti dari camat menjadi kepala seksi di salah satu instansi. Sebaliknya ada yang diangkat jabatannya mendadak. Sementara Bupati Padang Lawas, Basyrah Lubis usai acara pelantikan dan mutasi jabatan hari itu hanya mengatakan tidak ada unsur politis ataupun KKN, tetapi demi penyegaran untuk kelancaran roda pemerintahan. (a32)

21


22

WASPADA Rabu 22 Juli 2009

Hukuman Terdakwa Korupsi APBD Pemko P.Sidimpuan Dikurangi P.SDIMPUAN (Waspada): Pengadilan Tinggi Negeri Medan mengurangi hukuman penjara 4,5 tahun menjadi 1 tahun kepada Pane Hasibuan, terdakwa korupsi APBD Pemko Padang Sidimpuan Tahun 2004 sebesar Rp 8,5 miliar. Amar putusan nomor 438/PID/2009/PT-Medan tertanggal 26 juni 2009 itu ditanda tangani majelis hakim PT Medan diketuai Prof DR Jatinar Nababan, SH, bersama anggota R Rohantoro, SH, dan Yasrin Nazir Nasution, SH, serta Panitera Pengganti Susila Wardhani, SH. Demikian disampaikan Ketua Pengadilan Negeri Padang Sidimpuan, Bambang Kusmunandar, SH.MH, melalui Hakim Humas ,Taufik Pandu Jomantara, kepada wartawan di ruang kerjanya, Selasa (21/7). Katanya, putusan merupakan putusan banding yang diajukan Pane Hasibuan terhadap putusan PN P.Sidimpuan tertanggal 11 Mei 2009 No:57/Pid.B/2009/PN.PSP yang salah satu bunyinya menghukum terdakwa dengan hukuman penjara 4,5 tahun. Pada amar putusan majelis hakim PT Medan itu juga dinyatakan, Pane Hasibuan tidak terbukti secara sah dan meyakinkan melakukan tindak pidana sebagaimana dakwaan primer Jaksa Penuntut Umum (JPU). Sehingga majelis PT Medan membebaskannya dari dakwaan itu. Namun PT Medan menyatakan Pane Hasibuan terbukti secara sah dan meyakinkan bersalah dan melakukan tindak pidana korupsi secara bersama-sama dan secara berlanjut. Sehingga terhadapnya dijatuhkan hukuman penjara selama 1 tahun dan denda Rp 50.000.000. Menurut Hakim Humas PN P.Sidimpuan, Taufik P Jomantara, majelis PT Medan menilai terdakwa tidak terbukti dalam dakwaan primer. Tapi hanya terbukti dalam dakwaan subsider. Putusan ini justru berbanding terbalik dengan putusan PN P.Sidimpuan. “Kalau di PN, dakwaan primer Pane Hasibuan terpenuhi dan dakwaan subsidernya tidak. Tapi setelah di PT, dakwaan primer Pane Hasibuan tidak terpenuhi dan malah dakwaan subsidernya yang terbukti,” kata Taufik. Selain itu Pane Hasibuan dinilai tidak terbukti ikut dalam menikmati uang APBD Kota P.Sidimpuan yang ‘digelapkan’. Namun karena saat itu posisi jabatan Pane Hasibuan sebagai Bendahara Umum di Pemko P.Sidimpuan, maka terdakwa dipersalahkan karena turut terlibat dalam proses pengeluaran uang itu. “Keputusan PT Medan, Pane Hasibuan tidak ikut menikmati uang. Tetapi hanya sebagai perantara pencairan uang, karena jabatannya saat itu sebagai bendahara umum,” ujar Taufik. Di tempat terpisah, Kepala Kejaksaan Negeri Kota P.Sidimpuan Indrasyah Djohan kepada wartawan menegaskan, pihaknya mengajukan kasasi atas putusan PT Medan itu ke Mahkamah Agung. “Segera kita ajukan,” tegasnya. Untuk diketahui, dua terdakwa kasus korupsi dana APBD Pemko P.Sidimpuan tahun anggaran 2004, Kholid Daulay dan Pane Hasibuan, telah divonis bersalah oleh majelis hakim PN P.Sidimpuan. Terhadap keduanya dijatuhi hukuman 10 tahun penjara dalam sidang lanjutan kasus korupsi Rp 8,5 Miliar APBD 2004 Pemko P.Sidimpuan di Pengadilan Negeri setempat, Senin (11/5) lalu. Putusan ini lebih ringan dari tuntutan JPU yang menuntut terdakwa Kholid Daulay dan Pane Hasibuan masing- masing 8 dan 7 tahun penjara. Dalam amar putusan dibacakan secara terpisah oleh majelis hakim disebutkan, terdakwa Kholid Daulay dihuku 5,5 tahun denda 200 juta. Jika tidak mampu membayar denda maka diganti dengan tahanan penjara selama 3 bulan. Kemudian diwajibkan membayar uang pengganti sebesar Rp 7.015.413.327, bila tidak mampu akan disita harta bendanya. Jika tidak mencukupi maka diganti dengan hukuman penjara 1 tahun. Sementara Pane Hasibuan dihukum penjara 4,5 tahun dan denda 200 juta. Jika tidak mampu membayar diganti dengan tahanan penjara 3 bulan. Sedang uang pengganti tidak dibebankan kepada terdakwa Pane. Atas putusan PN P.Sidimpuan itu, Kholid Daulay mengajukan banding ke PT Medan, sedangkan JPU tidak. Namun untuk terdakwa Pane Hasibuan, JPU dan etrdakwa sama-sama banding. Kini PT Medan telah memutus perkara banding Pane Hasibuan dengan mengurangi masa hukuman tahanannya dari 4,5 tahun menjadi 1 tahun. Atas hal itu, JPU akan mengajukan kasasi ke MA. (a20)

Brankas LSM Bobol, Empat Staf Diperiksa SIDIKALANG (Waspada): Sebanyak empat orang staf Lembaga Swadaya Masyarakat (LSM) Petrasa Dairi, diperiksa Satuan Serse Polres Dairi, Selasa (21/7). Pemeriksaan itu terkait dengan bobolnya brankas LMS yang berlokasi di Panin Suburabura, Senin (20/7) dinihari hingga uang tunai Rp 80 juta dan sejumlah barang berhaga lainnya hilang. Kapolres Dairi, AKBP Marzuki melalui Pahumas Kompol Ramasten Purba didampingi Kasat Reskrim, AKP SN Harahap kepada Waspada, Selasa (21/7) pemeriksaan itu masih hanya sebatas saksi untuk diambil keterangannya, terkait dengan bobolnya brankas LSM. Namun Harahap mengakui, kasus itu bukan tidak mungkin ada indikasi keterlibatan orang dalam dan minimal sebagai aktor, sesuai dengan olah TKP. Dikatakan, uang baru diambil dari salah satu bank di Sidikalang dan disimpan di brankas kantor LSM itu di Pani Siburabura Sidikalang. Saat uang itu hilang dari brankas, semua kondisi kantor tidak ada yang rusak, kecuali brankas tempat uang itu disimpan. (a28)

Simalungun Bangun 30 Unit Poskesdes SIMALUNGUN ( Waspada): Pemkab Simalungun melalui Dinas Kesehatan jajarannya akan melaksanakan pembangunan 30 unit Pos Kesehatan Desa (Poskesdes) senilai Rp 5,9 miliar. Hal itu dikemukakan Kadis Kesehatan Kab. Simalungun, dr Waldy Saragih, melalui Sekretaris Dinas Delianto Sinaga, Selasa (21/7) di Pematangraya. Dikatakan, pembangunan 30 unit Poskesdes merupakan langkah serta upaya Pemkab Simalungun dalam pemerataan pembangunan khususnya dalam bidang pelayanan kesehatan masyarakat hingga ke pelosok desa. Menurut Delianto Sinaga yang didampingi Kabag Humas Pimpinan Simesono Hia, mengatakan, hingga kini Poskesdes yang sudah dibangun 146 unit. Sedangkan jumlah nagori (desa) 345 nagori yang tersebar di 31 kecamatan se-Kab. Simalungun. “Artinya untuk pemerataan pembangunan Poskesdes, satu setiap nagori, Pemkab melalui Dinas Kesehatan masih harus mengupayakan 169 unit Poskesdes lagi dan ini diharapkan terlaksana selama kurun waktu lima tahun,” jelas Sinaga. Lebih lanjut dikatakan, pembangunan Poskesdes sebagai upaya pemerataan pelayanan kesehatan. Kalau nantinya seluruh nagori telah memiliki Poskesdes, maka program nasional menuju Indonesia Sehat 2010 bisa tercapai. (a15)

Inspektorat Periksa Penggunaan Dana Bantuan Depdiknas SAMOSIR (Waspada): Inspektorat Pemkab Samosir segera meneliti penggunaan bantuan Depdiknas terkait Widya Krama 2008 senilai Rp500 juta untuk seluruh SLTP se Samosir. Sesuai surat Inspektorat Provinsi Sumut ditujukan kepada Bupati Samosir dan ditembuskan ke Gubsu melalui Sekdaprov, meminta supaya penggunaan dan penyaluran dana bantuan Depdiknas di Samosir diperiksa terkait pemberitaan di Waspada baru-baru ini. Hal itu dikatakan Kepala Inspektorat Kab. Samosir Tombor Simbolon, SH kepada Waspada, Jumat (17/7) seraya menunjukkan surat dari Inspektorat Provsu yang dilampiri klipping koran. Pihak inspektorat saat ini masih menunggu laporan penggunaan Dana Widya Krama 2008 Rp500 juta di Diknas Samosir dan akan diteliti kemana penggunaan dana itu. Ditambahkan Tombor, masih ada beberapa kegiatan Widya Krama 2008 belum terlaksana hingga saat ini, dan dalam hal ini pihak Inspektorat Kabupaten segera melaporkannya ke Inspektorat Provsu. (c10)


Aceh WASPADA Rabu 22 Juli 2009

23

B. Aceh, Sigli, Bireuen, Lhokseumawe

Dua Ruko Musnah Terbakar

Anak-anak Usia Dini Jadi Korban DBD LHOKSEUMAWE (Waspada): Sejumlah anak usia dini di kawasan Uteun Kot-Cunda, Pemko Lhokseumawe menjadi korban Demam Bedarah Dengue (DBD). Jumlah korban yang dilarikan ke rumah sakit semakin bertambah, sehingga warga mengharapkan petugas terkait segera melakukan antisipasi. Informasi dihimpun Waspada dari keluarga korban, Senin (20/7) anak-anak penderita penyakit yang ditularkan nyamuk tersebut telah dilarikan ke beberapa rumah sakit di Lhokseumawe. Salah seorang korban Ulfi,9, dari Desa Uteuen Kot dinyatakan terkena DBD, Minggu (19/7) sehingga terpaksa dirawat di salah satu RS swasta di Lhokseumawe. Sedangkan sehari-sebelumnya, M. Aziz, 12, dan M. Zaki, 3, dari lingkungan yang sama juga mendapat perawatan medis diduga akibat DBD. Sementara Minggu lalu Miftah, seorang bayi usia 9 hari juga dari Uteuen Kot dinyatakan menjadi korban demam berdarah. Setelah menyadari anaknya menderita DBD kedua orang tua korban, Julian dan Nova Meliza melarikan putri pertamanya itu ke rumah sakit. Menurut M. Jafar Yusuf orang tua M. Zaki, sebelum dibawa di rumah sakit, anaknya mengalami demam dan kejang-kejang. Pada awalnya dia menyangka putranya mengalami panas biasa. Sehingga dia hanya memberikan sirup untuk menurunkan panas. “Namun tubuhnya semakin panas dan ditambah kejang-kejang,” jelas Jafar. Sehingga mereka memutuskan untuk membawa anaknya ke rumah sakit. Karena korban anak-anak dari lingkungan yang sama sehingga warga mensinyalir kawasan itu telah menjadi lokasi penyebaran DBD. Menurut warga, tahun lalu petugas pernah melakukan fogging di kawasan Cunda, namun sekarang upaya pemberatas jentik nyamuk penyebara DBD sekarang sudah jarang dilakukan. Sehingga warga sangat mengharapkan pihak terkait dapat segera mengantisipasi penyakit DBD yang mewabah dikawasan pinggiran pasar Cunda tersebut.(b17)

Masyarakat Pesisir Eks Tsunami Masih Menderita LAPANG, Aceh Utara (Waspada): Kendati berbagai pihak telah menggelontorkan triliunan dana rehabilitasi untuk merehab berbagai sarana di kawasan pesisir, terutama yang luluh lantak dihantam gelombang tsunami 2004 silam. Namun sampai sekarang banyak masyarakat pesisir eks tsunami yang masih hidup menderita. Di Kecamatan Lapang Aceh Utara, misalnya. Empat desa peisir di kecamatan itu yakni Desa Kuala Cangkoi, Matang Tunong, Geulanggang Baroe dan Keude Lapang, hingga kini masih dihadapkan pada persoalan usang yaitu kesulitan mendapatkan air bersih. Padahal sebagian besar masyarakat dari empat desa tersebut ikut merasakan dahsyatnya peristiwa gempa disusul tsunami, 26 Desember 2004 lalu. Mantan Kepala Desa Kuala Cangkoi, Ilyas Hasan kepada Waspada, Senin (20/7) menyebutkan, pihak PDAM Tirta Mon Pasee Aceh Utara sebenarnya telah memasang pipa baru untuk menyuplai air bersih ke kawasan tersebut, sekaligus mengganti jaringan pipa lama yang telah rusak. Tapi sayangnya, pipa itu seolah mubazir karena sejauh ini belum berfungsi alias hanya menyuplai angin. “Pipa baru tersebut direkontruksi sekitar empat bulan lalu. Entah kenapa sampai sekarang belum difungsikan. Sebelumnya, kami tidak terlalu susah karena meski jaringan belum berfungsi, PDAM menyuplai air bersih dengan mobil tangki. Tapi sejak dua bulan lalu, solusi inipun telah dihentikan, tanpa alasan jelas. Akibatnya, masyarakat kelimpungan mendapat air bersih dan sebagian besar terpaksa mengkonsumsi air keruh dari sumur yang kadar garamnya cukup tinggi,” tandas Ilyas Hasan.(cmus)

Waspada/Musyawir

LUDES: Sejumlah warga melihat puing dua pintu ruko di Desa Meunasah Panton Kecamatan Tanah Jambo Aye, Aceh Utara yang ludes terbakar, selasa (21/7) sekira pukul 04:00 dinihari.

Pidie Kering SIGLI (Waspada): Hampir seluruh lahan pertanian di Kab. Pidie mengalami kekeringan, disebabkan musim kemarau melanda daerah itu. Besar kemungkinan tanaman pangan dan palawija gagal panen.

Amatan Waspada, Selasa (21/7) di beberapa kecamatan di daerah itu, seperti terlihat di Desa Raya Paya, Kec. Simpang Tiga, Kab. Pidie sekira ratusan hektar sawah yang telah ditanami padi terlihat tanahnya telah retak-retak, sedangkan tanaman padi sudah layu dan daunnya menguning karena tidak ada air dalam sawah. Ratusan petani mulai berjaga-jaga siang malam di pematang sawah untuk memantau air, bila sewaktu-waktu air di dalam tali air mulai terisi maka mereka (para petani-red) akan cepat mengairi air ke sawah. Pemandangan serupa juga terlihat di persawahan Kec. Peukan Baro, Kec. Pidie, Glumpang Tiga, Muara

Tiga dan Bate. Kondisi ini menyulitkan para petani di kabupaten tersebut, yang selama satu bulan terakhir ini kesulitan memperoleh air menghidupi tanamannya pada musim tanam gadu tahun ini. Sejumlah petani yang dijumpai Waspada, kemarin mengaku kesulitan memperoleh air. Bahkan, akibat sulit mendapatkan air para petani terpaksa menggali sumur dan menarikkan air dengan mesin pompa. Namun usaha tersebut juga dinilai kurang efektif, karena air di dalam sumur yang digali itu tidak mencukupi untuk kebutuhan tanaman padi. Alhasil, para petani tetap mengeluh dan berharap Pemkab Pidie melalui dinas terkait dapat turun tangan mengatasi krisis air yang melanda daerah itu selama satu bulan terakhir ini. ”Sudah banyak tanaman padi yang mati karena tidak ada air di sawah. Kami sudah berupaya sekuat tenaga dengan kemampuan dan

Polhut Dan Pamhut Perlu Pelatihan Tambahan LHOKSEUMAWE (Waspada): LSM Silfa menganggap Polisi Hutan (Polhut) dan Pengamanan Hutan (Pamhut) perlu mendapat pelatihan tambahan. Karenanya Silfa minta pemerintah memberi pengetahuan tambahan bagi Polhut yang sudah direkrut supaya punya bekal standar. “Hal ini penting guna peningkatan kemampuan dan keahlian tugas Polhut dan Pamhut Aceh. Penting pula bagi kesiapan mental dan keahlian di hutan bagi petugas pengamanan hutan yang baru,” kata Direktur LSM Selamatkan Isi Alam dan Flora-Founa (Silfa), Irsadi Aristora, S Hut kepada Waspada, Senin (20/7). Yang sangat dibutuhkan bagi mereka adalah mengambil sikap guna peningkatan kemampuan skill pengaman hutan di Aceh. Pengunaan GPS, Survival di Hutan, Pemetaan Dasar, Penanganan Konflik satwa liar, Hukum dan Undang-Undang Kehutanan dan Latihan pengenalan Jenis kayu dan tanaman hutan. Ihwal ini, kata Irsadi, menjadi tambahan penting bagi Pamhut Aceh saat ini agar siap di tempatkan di tengah hutan dan mental yang kuat untuk bertugas. Bila perlu Pamhut dapat di persenjati kembali, agar pelaku kejahatan kehutanan semakin takut terhadap pengamanan hutan Aceh. Irsadi berpendapat, kondisi hutan Aceh saat ini sedang dalam ancaman penjarahan yang tiada habisnya. Makanya, dia mendukung gerakan pemerintah yang mengambil sikap tegas dalam mengantisipasi berbagai bentuk kejahatan yang terjadi terhadap hutan, baik perambahan maupun perburuan binatang liar.(b12)

Wagub Lantik KPID Aceh 2009-2012 BANDA ACEH (Waspada): Wakil Gubernur Aceh Muhammad Nazar melantik anggota Komisi Penyiaran Indonesia Daerah (KPID) Aceh periode 2009-2012, Kamis (16/7), di gedung Serbaguna Setdaprov Aceh, di Banda Aceh. Mereka yang dilantik sebagai anggota KPID Aceh, Sayed Fadil, Safir, Yusra Jamali, Cut Hayatun Nufus, M. Isa Yusuf, Nurali Iidrus dan Said Firdaus. Wagub Muhammad Nazar mengatakan kehadiran KPID di Aceh mempunyai arti sangat besar bagi proses pendewasaan publik melalui informasi yang sehat dan baik. Dikatakan, dengan diberlakukannya UndangUndang Pemerintah Aceh No. 11 tahun 2006, KPID punya peran sangat penting sebagai mitra Pemerintah Aceh bidang penyiaran. “Sebagaimana kita ketahui bahwa informasi dapat mengambil berbagai bentuk, termasuk berita, hiburan dan ilmu pengetahuan. KPID dalam hal ini dituntut dapat bekerja optimal menjaring informasi agar dapat secara sehat diterima masyarakat.” “Saya ingin mengingatkan kembali bahwa KPID Aceh juga mempunyai fungsi yang amat vital dalam memantau dan mengawasi lembaga-lembaga penyiaran di Aceh sesuai dengan amanat UU No. 32 Tahun 2002,” tegas Nazar. (b04)

Waspada/Muhammad Riza

SIRAM: Serang petani bawang merah dan cabai di Desa Me, Bate, Kab. Pidie menyiram tanamannya di sawah. Akibat musim kemarau petani ini terpaksa menggali dua sumur di dalam sawahnya untuk menutupi kebutuhan air bagi tanaman cabai dan bawang, Selasa (21/7).

Rusdi, adalah masyarakat Kota Banda Aceh agar terus menerus mengawasi dan memberi semangat kepada Pemko Banda Aceh dalam menegakkan semua aturan yang ada dalam Qanun RTRWK Banda Aceh tahun 2006-2026. Kota Air Dalam laporan hasil pembahasan qanun RTRW Kota Banda Aceh 2006-2026 oleh Pokja RTRWK DPRK Banda Aceh,dalam sidang paripurna yang dipimpin Ketua DPRK Banda Aceh H. Muntasir Hamid, kelompok kerja (Pokja) ini melihat potensi Kota Air masih layak diberikan kota Banda Aceh. Kenapa? Karena, bila dilihat sejarah berdirinya pemerintahan Aceh diawal sejarah, sehingga konsep pengembangan kota yang berbasis Water Front City (WFC) terutama pada kawasan sepanjang Daerah Aliran

but. Rumah Diana sendiri hanya terpaut 10 meter dari rumah korban. Menurut Diana, saat kejadian ia sedang tertidur pulas. Tiba-tiba anaknya yang masih balita menangis keras hingga ia pun terjaga dari tidur. Begitu bangun, Diana mendengar suara riuh menyerupai suara letupan seng terbakar. Selanjutnya Diana berusaha melongok keluar rumah melalui celah jendela dan spontan ia menjerit saat melihat api sudah membumbung di atap ruko Ismail. ”Sesaat kemudian, suami saya terbangun. Kemudian kami bergegas menggedor pintu para tetangga lainnya. Dalam tempo singkat, puluhan warga mendatangi lokasi serta berusaha memadamkan api dengan menyiram air dari selokan. Namun usaha itu sia-sia karena api sudah sulit dijinakkan. Bahkan, hanya dalam waktu kurang dari 30 menit, seluruh konstruksi ruko musnah terbakar,” kisah Diana. Pantauan Waspada, hingga berita ini diturunkan kemarin sore, pemilik ruko, Ismail beserta keluarga masih berada di Beureunun, Sigli. Sementara warga sekitar masih ramai memadati lokasi kebakaran. Sebagai wujud solidaritas, para warga juga menggalang sumbangan se ikhlasnya untuk keluarga korban.(cmus)

Pemkab Aceh Utara Seperti Menuang Air Ke Keranjang ilmu pengetahuan yang kami miliki, namun tidak berhasil juga. Karena itu kami mengharapkan pemerintah dapat membantu kami mengatasi persoalan ini,” kata Abdullah salah seorang petani di Kec. Simpang Tiga. Menurut dia, bila persoalan itu tidak bisa dilakukan, besar kemungkinan Pidie akan gagal panen, dan masyarakat akan hidup papa. Berbeda dengan petani di Kab. Pidie Jaya yang merupakan daerah pemekaran Kab. Pidie. Kendati musim kemarau, namun para petani di sana masih dapat bercocok tanam, karena saluran irigasi dan tali air di daerah itu masih berfungsi dengan baik. Tanam Palawija Berbeda dengan petani di Desa Me, Kec. Bate, Pidie, pada musim gadu tahun ini banyak warga petani di desa terisolir tersebut lebih memilih menanam tanaman jenis palawija, seperti bawang merah, tembakau, kacang hijau dan cabai. Kendati sulit memperoleh air, namun masih dapat menggunakan air dalam sumur yang digali di dalam sawahnya masing-masing. Kendati begitu para petani di daerah tersebut mengakui debit air di dalam sumur yang digali tidak mencukupi untuk meyiram tanaman palawija mereka. Sehigga harus menggali sumur lainnya di sekitar sawah mereka. Sedangkan air di dalam sungai kecil yang berada di sekitar sawah mengalami kekeringan. “ Kalau kami tidak menggali sumur banyak-banyak, maka air tidak cukup untuk menyiram tanaman cabai dan bawang,” Abdullah petani cabai dan bawang di Desa Me, Bate. Menurut dia, sebenarnya masyarakat petani di daerah itu tidak kesulitan memperoleh air, apabila waduk Lhokseumani yang merupakan peninggalan kolonial Belanda dapat difungsikan dengan baik. Namun, karena kurang terawat kini waduk itu telah rusak dan tidak bisa lagi mengairi air ke sawah-sawah, tandas Abdullah.(b20)

Penegakan Aturan Dalam RTRW Jangan Pandang Bulu BANDA ACEH(Waspada): DPRK Banda Aceh desak Pemerintah Kota untuk mensosialisasikan secepatnya Qanun Rencana Tata Ruang Wilayah (RTRW) Kota Banda Aceh tahun 20062026 setelah disahkan dewan. Selain itu, Pemko juga diminta untuk menegakkan semua aturan yang ada didalamnya dengan sangat ketat tanpa pandang bulu, apakah yang melanggar dari kalangan biasa, mengatasnamakan anggota TNI, Polri dan lainnya, sehingga tidak ada ketimpangan lagi dalam penetapan tata ruang di ibukota provinsi Aceh ini. Demikian antara lain, rekomendasi laporan hasil pembahasan qanun RTRW Kota Banda Aceh tahun 20062026 , yang dibacakan Sutan Muhammad Rusdi,SE selaku pelapor Pokja RTRW DPRK Banda Aceh, dalam sidang Paripurna DPRK Banda Aceh, Selasa (21/7). Pokja RTRW DPRK Banda Aceh, juga meminta kepada Pemko agar segera menyusun Rencana Detil Tata Ruang (RDTRWK) Kota Banda Aceh tahun 2006-2026, karena RDTRWK merupakan bagian yang tidak terpisahkan dari qanun ini, dn RTRWK tidak dapat dijalankan tanpa adanya RDTRWK. Sedangkan kepada Pimpinan DPRK Banda Aceh bersama Panmus, Sutan Muhammad Rusdi, mendesak segera menjadwalkan paripurna pengesahan Rancangan Qanun RTRWK Banda Aceh tahun 2006-2026 menjadi Qanun RTRWK Banda Aceh sebelum berakhirnya bulan Juni 2009. Pokoknya dari rekomendasi Pokja RTRW DPRK Banda Aceh, sebut

PANTONLABU, Aceh Utara (Waspada): Dua pintu rumah toko (Ruko) ukuran 6X9 berkontruksi semi beton di Desa Meunasah Panton Kecamatan Tanah Jambo Aye –Pantonlabu Aceh Utara, Selasa (21/7) sekira pukul 04:00 dinihari, musnah terbakar. Tidak ada korban jiwa karena kebetulan pemilik ruko, Ismail Abdurrahman,43 bersama keluarga sedang mengunjungi famili meninggal, di Beureunun, Sigli, sehari sebelum kebakaran. Namun seisi rumah ludes dilalap api. Kerugian ditaksir senilai Rp150 juta. Informasi dihimpun Waspada di lokasi, penyebab kebakaran diduga kuat akibat hubungan pendek arus listrik dari salah satu pintu ruko. Api kemudian membumbung dalam waktu singkat hingga menghanguskan seluruh bangunan dan isinya termasuk sejumlah pesawat elektronik, satu unit becak bermotor dan gabah yang ditaksir mencapai dua ton lebih. ”Para tetangga sempat berusaha memadamkan api dengan peralatan seadanya. Tapi upaya itu gagal mengingat api terlanjur cepat membesar. Apalagi salah satu ruko dempet tersebut, terbuat dari material kayu yang mudah terbakar,” kata Diana, 25, tetangga korban sekaligus saksi mata yang pertama kali mengetahui kebakaran rumah milik pengrajin cincin sumur terse-

Sungai (DAS) Krueng Aceh dan Krueng Daroy masih sangat urgen dan mungkin direalisasikan. Rehabilitasi Krueng Aceh dan semua sungai yang ada di Kota Banda Aceh disamping untuk menjaga kelestarian dan keindahan lingkungan sungai, juga akan sangat prospek untuk dikembangkan ke arah wisata air dalam kota, sehingga mempunyai nilai jual dan ekonomi tinggi. Untuk itu, dengan lahirnya Qanun RTRWK Banda Aceh tahun 2006-2026 akan menjadi darah baru bagi pemerintah untuk menata ulang Kota Banda Aceh menuju arah yang lebih baik. “Apalagi, UU No.26 tahun 2007 yang merupakan aturan terbaru tentang penataan ruang , telah memberikan kewenangan dan legitimasi hukum yang kuat untuk penataan ruang,” ungkap pelapor Pokja Sutan Muhammad Rusdi.(b06)

SAMPONIET, Aceh Utara, (Waspada): Miliaran anggaran pembangunan jalan di Aceh Utara terserap percuma. “Pememerintah kabupaten, sama halnya dengan menuang air ke dalam keranjang kosong.” Ungkapan itu disampaikan anggota Panitia Khusus (Pansus) VI Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Utara, H. Hamdani AG, S.Pdi kepada Waspada, Minggu (19/7). Pernyataan itu terkait hasil kunjungan Pansus VI terhadap ruas jalan menghubungkan Samponiet, ibukota Kec. Baktiya Barat – Kec. Lapang, Aceh Utara, Kamis (16/7) pekan lalu. Volume jalan ini sepanjang 4,3 kilometer dibangun dengan Anggaran Pendapatan dan Belanja Kabupaten (APBK) Aceh Utara, Tahun Anggaran (TA) 2008 sebesar Rp 3,9 miliar. “Baru usia enam bulan terakhir, lapisan aspalnya rusak kembali,” kata Hamdani. “Ini mutlak kelemahan pengawas Dinas Bina Marga Aceh Utara, kalau begini fenomenanya kapan pembangunan jalan di kabupaten ini bisa tuntas. Rakyat jangan mimpi ada perubahan pembangunan, karena dana besar dari APBK terbuang mubazir,” lanjut anggota dewan dari Fraksi Partai Golkar (F-PG) ini, geram. Pengawas lapangan dari Dinas Bina Marga Aceh Utara, Azhari, ST membenarkan kondisi jalan tersebut sebagaimana temuan Pansus VI DPRK. Pasalnya, ruas jalan ini dikerjakan kontraktor pada musim hujan November 2008 dan memburu penarikan dana pada Desember 2008, bersamaan berakhirnya tahun anggaran, sehingga tidak heran kalau kualitas jalan tidak bagus. Anggaran untuk pembangunan jalan itu, menurut Azhari, sudah

ditarik kontraktor pelaksana 90 persen dari total Rp3,9 miliar. Rekanan pekerja berbadan usaha PT. Mulia Sari Lhoksukon, dengan pemilik H. Nasruddin, ujarnya seraya mengirimi no. handphone dirut perusahaan tersebut lewat SMS. Ketika H. Nasruddin dihubungi via telepon selularnya, ia beralasan badan jalan tidak kokoh dibuat kontraktor sebelumnya. “Ini diperparah dengan beberapa titik tanah labil yang menuntut pembangunan talud di kiri kanan ruas jalan, agar badan jalan kokoh dan lapisan aspal hotmix dapat tahan lama,” ujarnya. “Pekan depan saya akan perbaiki kembali, karena bangunan talud sekarang sedang dikerjakan rekanan lain,” janjinya sambil menambahkan, bahwa dia komit terhadap tanggungjawabnya. Tapi ketika dikonfrontir kembali dengan anggota Pansus VI, Hamdani AG, ia mengatakan alasan itu kurang rasional. TA/2007 body jalan ini sudah kokoh dikerjakan kontraktor kawakan dengan biaya besar. “Karenanya tak rasional, kalau kontraktor pelaksana berusaha buang badan dengan alasan body badan jalan dasar tidak bermutu. Barang kali itu cuma akal-akalan dan kita pun belum tahu, mutu aspal klasifikasi apa yang dia pakai. Untuk ini kami tim Pansus akan minta keterangan Kadis Bina Marga terhadap klasifikasi aspal yang tersebut di spek kontrak,” tegasnya. Hamdani juga menuding kontraktor pelaksana terkesan buang badan. “Sebab dalam kasus ini bukan tepi jalan yang bergeser, tapi pada bagian tengah-tengah ruas jalan yang mengalami kerusakan aspal. Lalu, apa hubungannya dengan bangunan talud,” tanyanya.(b10)

Satpol PP Sita Mobil Dan Lapak PK-5 BIREUEN (Waspada): Satuan Polisi Pamong Praja (Satpol PP) Kabupaten Bireuen. Selasa (21/7) menertibkan sepuluh lapak pedagang kaki lima (PK-5) yang selama ini beroperasi di depan Meunasah kota dan BNI pada pusat kota Bireuen. Dalam aksinya itu, pihak Satpol PP yang menurunkan sebanyak 15 orang anggotanya juga menyita satu unit mobil Daihatsu box yang digunakan untuk berjualan, serta kursi milik para pedangang yang mengelar dangangannya di malam hari. Jamaluudin kepala Satpol PP, WH, dan Pemadam mengatakan, penertiban itu dilaksanakan karena selama ini banyak para pedagang yang telah menyalahi ketentuan dan peraturan yang telah di tentukan pemerintah Bireuen.

“Ketentuan jualan di kawasan itu sebenarnya dilakukan pada malam sore hingga subuh dinihari, dari pukul 15:00 hingga pukul 04:00 dini hari, namun selama ini para pedagang telah menyalahi aturan dan qanun yang berlaku,” terangnya. Lanjutnya, pihaknya melakukan penertiban hanya bagi para pedagang yang telah menyalahi aturan, sehingga bila di biarkan terus menerus pemandangan kota menjadi semrawut. “Dari hasil penertiban tadi, kami telah mengankan 10 lapak dagang, kursi, serta satu unit mobil box, dan telah kami amankan di kantor, untuk selanjutnya kami akan memanggil para pemilik barang tersebut untuk diberikan penjelasan agar jangan mengulangi lagi,” demikian Jamaluddin.(cih)

Peran Serta Masyarakat Diharapkan MEUREUDU (Waspada): Bupati Pidie Jaya, Drs. H.M. Gade Salam mengutarakan dalam peningkatan pembangunan sarana transportasi dari desa ke kota dan sebaliknya, sangat diharapkan peran serta masyarakat untuk merelakan tanahnya yang terkena pelebaran jalan. Seperti terhadap pembangunan sekaligus pelebaran jalan di kawasan Desa Meuraksa, Kecamatan Meureudu, Pidie Jaya dan sekitarnya. “Demi kelancaran pembangunan sarana jalan, diharap peran serta masyarakat yang langsung ditangani

geuchik (kepala desa-red) dan camat,” ujar bupati kepada Waspada, Senin (20/7). Menurut bupati, meski pemerintah terus-menerus membangun jalan setiap tahun, namun akan siasia kalau peran serta masyarakat tidak dikedepankan, kalau masyarakat masih keberatan melepaskan tanahnya tanpa ganti rugi untuk pembangunan sekaligus pelebaran jalan dihawatirkan lebar jalan yang direncanakan mencapai 6 hingga 7 meter akan menjadi kendala di lapangan. (b21)

Waspada/Irham Hakim

BARANG SITAAN: Sejumlah barang sitaan hasil dari penertiban pedagang kaki lima di dua tempat dalam pusat kota Bireuen terlihat diamankan anggota Satpol PP Bireuen di kantor mereka yang masih berlokasi dengan pendopo bupati Bireuen, Selasa (21/7).


24

Langsa, Kualasimpang, Kutacane, Singkil

Kepala Kampung Pertanyakan Lambannya Pencairan Honor SINGKIL (Waspada): Sejumlah kepala kampung di Kabupaten Aceh Singkil pertanyakan lambannya pencairan honor mereka, pasalnya hingga pekan ketiga Juli 2009, honor Kepala dan perangkat Kampung di kabupaten itu belum jelas jadwal pencairannya. Kepala Kampung Lipat Kajang Atas, Kec Simpang Kanan, Ali Sadikin yang ditanya Waspada, Senin (20/7) di Rimo, terkait pencairan honor kepala dan perangkat kampung, membenarkan pihaknya hingga kini belum menerima honor. “Hingga memasuki Bulan Juli 2009, honor Kepla dan perangkat Kampung belum jelas kapan dibayarkan,” sebut Ali.

Sejumlah kepala kampung Kecamatan Gunung Meriah dan Suro yang dihubungi secara terpisah juga mengeluhkan lambannya pencairan honor untuk menunjang kegiatan mereka. “Meski jumlah honor itu relatif kecil nilainya namun dana tersebut dapat merangsang aktivitas dan kegiatan di kampung,” sebut mereka. Hingga berita ini diturunkan, Waspada yang coba menanyakan prihal honor yang dikeluhkan itu belum memperoleh keterangan dari pihak Sekretrait Daerah Kabupaten (Setdakab) setempat terkait lambannya pencairan honor yang dikeluhkan pengurus kampung di sana.(b30)

Israk Mikraj Jajaran Pemkab Gayo Lues Sepi BLANGKEJEREN (Waspada): Melalui Dinas Syariat Islam, jajaran Pemkab Gayo Lues melaksanakan Israk Mikraj, Selasa (21/07) di Masjid Raya Al-Salihin Blangkejeren. Kali ini penceramahnya yaitu Ustad Drs. Bahrun Nasution dari Medan. Hadir pada acara itu Wakil Bupati Gayo Lues Firdaus Karim dan para Kadis, Badan, Kantor serta para stafnya, juga tokoh ulama dan pemuda. Pada kesempatan itu, Kadis Syariat Islam Gayo Lues Drs. Bungkes Absyah merasa sedih melihat yang hadir tidak begitu ramai. “Saya sedih melihat kurangnya para pegawai yang datang pada hari seluruh Umat Islam memperingati perjalanan Israk Mikraj Rasulullah Muhammad SAW, tetapi kalau acara Pasar Malam, mereka hadir memadati lapangan,” kata Bungkes dalam sam-bu-

tannya. Wakil Bupati Gayo Lues Firdaus Karim, dalam sambutannya mengharapkan pada hari peringati Israk Mikraj ini agar dapat menjadi tauladan bagi seluruh umad Islam pada umumnya, khususnya masyarakat Gayo Lues. Karena dapat diketahui bahwa sejarah Israk Mikraj itu penuh tantangan bagi Rasulullah Muhammad SAW. Ustadz Drs. Bahrun Nasution disitu menjelaskan dalam cerahmahnya, pentingnya Umat Islam memperingati hari Israk Mikraj, karena Umat Islam senantiasa mengikat apa itu Israk Mikraj. “Pentingnya kita memperingati Israk Mikraj, untuk dapat terus mengetahui apa itu Isra’ dan Mi’rad, dan untuk para generasi seterusnya sehingga tidak hilang dari ingatan kita,” jelas ustadz.(cb01)

IDI, Aceh Timur (Waspada): Pemerintah Kabupaten Aceh Timur, Provinsi Aceh, bertekad, 135 imigran Myanmar dan Bangladesh yang tersisa di Kamp Penampungan Kota Idi Rayeuk, 6 hari lagi bertepatan 28 Juli mendatang angkat kaki dari wilayah itu.

Sebab, selain ulah dan keberadaan warga asing itu telah meresahkan warga sekitar,

195 etnis Rohingya itu juga mulai tidak betah lagi dibarak penampungan. Buktinya, 60 diantaranya kini hilang dari kamp pengungsian yang diisukan sengaja kabur dengan dalih menolak dideportasikan. Hal tersebut dilakukan Pemkab setempat seiring dengan disuratinya pihak Departemen Luar Negeri (Deplu) usai rapat Muspida Plus, Kamis (16/7) di Aula Serbaguna Idi. Dimana isi surat yang tembusannya juga dikirimkan ke Gubernur Aceh, drh. Irwandi yusuf, BSC di Banda Aceh, antara lain meminta Deplu se-

gera menyelesaikan dan mendeportasikan imigran yang tersisa di Kamp penampungan di belakang Gedung Kantor Camat Idi Rayeuk, Aceh Timur. “Jika dalam tempo seminggu atau paling lama 10 hari dari tanggal dibuatkannya keputusan tersebut tidak ada sebuah kepastian dari pihak Deplu RI di Jakarta, maka Pemda Aceh Timur akan paksakan 135 warga kulit hitam diangkut ke Kantor Imigrasi Langsa,” demikian Wakil Bupati Aceh Timur, Nasruddin AB, S.Pd.I, menjawab Waspada, Selasa (21/7) di Idi.

Waspada/Zamzamy Surya

kepada Al Quran. Sementara Ketua Panitia Pembangunan Masjid Baiturrahim Pasar Singkil H. Ismail Saleh dalam paparannya mengatakan keberadaan Masjid Baiturrahim Singkil yang telah berusia satu abad bukti sejarah masyarakat Singkil tempo dulu memiliki semangat yang kuat membangun masjid sebagai lambang kejayaan Islam di masa penjajahan Belanda. Sebelumnya Ketua Panitia Drs. Azmi dalam laporannya mengatakan Peringatan Israk Mikraj dan satu abad Masjid Baiturrahim Pasar Singkil juga dirangkaikan dengan perlombaan Shalat Subuh berjamaah antar remaja masjid dalam kota Singkil. Hadir pada acara peringatan Israk Mikraj dan peringatan satu abad Masjid Baiturrahim Singkil Dandim 0109/ Singkil Letkol Czi Dadang Rusmana, Kajari Singkil Yuswadi SH.MH, Wakapolres Aceh Singkil Kompol Ali Usman SH, Ketua MPU Aceh Singkil H. Rasyiduddin, SH dan Sekdakab Aceh Singkil H. Ridwan Hasan SH.MM Kepala SKPD dan undangan lainnya.(cb02)

Dampak Bobolanya Deposito Rp220 M

Anggaran Pembangunan Aceh Utara Devisit Besar ACEH UTARA ( Waspada): Dampak bobolnya deposito sebesar Rp 220 M di Bank Mandiri Kantor Cabang Pembantu (KCP) Jelambar, Jakarta Barat. Biaya pembangunan dari APBK Aceh Utara, TA/2009 terancam devisit (kekurangan) dalam jumlah yang sangat signifikan. Sebagian besar dana kas Pemkab Aceh Utara tersebut, sekarang sudah terkumpul di Polda Metro Jaya, Jakarta, sebagai barang bukti yang disita penyidik baik sebelum maupun pasca penahanan lima tersangka, kata sekretaris Pansus (khusus) Dewan Perwakilan Rakyat Kabupaten (DPRK) Aceh Utara, Tgk H Syamsul Bahri, SH menjawab pertanyaan Waspada di gedung dewan, Jl T Nyak Adam Kamil Lhokseumawe, Selasa (21/7). Kata dia, Pansus (khusus) yang bertugas menelusuri dan menyelamatkan dana Anggaran Pendapatan dan Belanja Kabupaten (APBK) Aceh Utara, Tahun Anggaran (TA) 2009 yang didepositokan di Bank Mandiri KCP Jelambar (Rp 220 M) sudah bekerja maksimal. “Dalam perjalanan penelusuran itu, pertemuan khusus dengan tim Mapolda Metro Jaya, termasuk salah satu agenda yang telah kami lakukan,” tandas Syamsul Bahri. Demi menghindari membengkaknya devisit APBK Aceh Utara, TA/2009 yang berimplikasi kepada mandeknya roda pembangunan di kabupaten yang membawahi 27 tingkat kecamatan ini, kami meminta kepada pihak Polda Metro Jaya, agar dana yang sudah diamankan itu dapat dipinjam pakai oleh Pemkab Aceh Utara. “Pihak Polda Metro Jaya tidak keberatan,

dengan mengajukan syarat. Yaitu, surat permohonan pinjam pakai dari Bupati Aceh Utara, Tgk Ilyas A Hamid dan ketua DPRK Aceh Utara, Tgk H Saifuddin Ilyas. Dasar surat itu pihak Polda Metro Jaya dapat menjelaskan, berikut memperlihatkan permohonan kedua pejabat penting Aceh Utara tersebut kepada Pengadilan Negeri (PN),” jelas Syamsul Bahri seraya menambahkan. “Arahan Polda Metro Jaya selaku penyidik kasus bobolnya kas Pemkab Aceh Utara, Rp 220 miliar itu telah kami sampaikan dalam laporan Pansus (khusus) pada sidang paripurna dewan, 29 Juni lalu, namun sampai sekarang kedua pucuk pimpinan (eksekutif dan legislatif ) di Aceh Utara, masih belum melaksanakan amanah tersebut,” ujarnya. Dalam hal ini Pansus (khusus) telah bertanya kepada jajaran eksekutif, tapi mereka mengemukakan alasan-alasan yang tidak masuk akal. Seperti adanya kekhawatiran pihak eksekutif, jika dana itu diambil sebagian sisanya nanti tidak akan dibayar oleh Bank Mandiri KCP Jelambar, atau institusi bank tersebut. “Alasan ini terkesan dibuat-buat alias tak rasional, karena yang kita pinjam adalah barang bukti di Mapolda Metro Jaya. Apa urusannya dengan institusi Bank Mandiri, namun jika nanti ada gugatan dari Pemkab Aceh Utara terhadap Bank Mandiri dan mereka mengkonvensasi pembayaran, tinggal kita potong pinjaman barang bukti di Polda Metro Jaya, kan begitu logikanya ?,” sebut sekretaris Pansus (khusus) DPRK Aceh Utara. (b10)

Bupati Aceh Selatan Husin Yusuf didampingi sejumlah pejabat kabupaten dan kecamatan saat melakukan panen pertadana jagung, di areal seluas 15 ha di kawasan Trumon.

Kejayaan Trumon Harus Ditebus Dengan Palawija Dan Sawit TAPAKTUAN (Waspada): Bupati Aceh Selatan Tgk Husin Yusuf meminta masyarakat daerahnya khususnya warga Kecamatan Trumon, agar tidak membiarkan lahan terlantar. Lahan-lahan kosong harus dimanfaatkan dengan berbagai tanaman produktif seperti palawija dan sawit. Apalagi Trumon yang kesohor dengan sejarah kejayaannya yang agung. “Makanya masyarakat di sini kita minta agar bias kembali menebus masa kejayaannya dengan produksi pertanian dan perkebunan seperti palawija dan sawit,” kata Bupati Husin Yusuf kepada wartawan seusai panen perdana tanaman jagung seluas 15 hektar di kawasan

Desa Sigleng, kecamatan setempat, Sabtu pekan lalu. Menurut dia, dalam rangka memanfaatkan lahan terlantar yang ditinggalkan petani sejak masa konflik harus dimanfaatkan sesuai dengan potensi lahannya. Seperti di daerah tadah hujan bisa ditanam palawija dan di adaerah pengairan bias ditanam padi dan kacang tanah. “Jadi persoalannya selama ini hanya karena faktror sosialisasi belaka,” sebutnya seraya memianta agar pihak Dinas Pertanian dan Penyuluhan agar dapat meningkatkan penyuluhan kepada petani sehingga lahan terlantar bisa membawa manfaat bagi masyatakat. Karenanya Lembaga Pem-

berdayaan Ekonomian Rakyat (LPER) Banda Aceh selaku fasilisator, mencoba merangkul para petani untuk memanfaatkan lahan tidur di daerah Trumon. Petani mengharapkan Pemprov Aceh dan Pemkab Aceh Selatan diminta memperhatikan kebutuhan petani itu melalui pembuatan pagar dalam satu kawasan pertanian yang luas. Menanggapi keluhan masyarakat tersebut, Bupati Husin Yusuf mengaku akan menjalin kerja sama dengan lembaga yang ada termasuk Pemprov Aceh. “Bila Pemerintah Aceh menyediakan dana tersebut sangat baik dan akan dilaksanakan sesuai pemanfaatan,” sebutnya.(b19)

Wartawan Peras Kasek Ditangkap Polisi TAKENGON (Waspada): Seorang wartawan terbitan sebuah harian di Banda Aceh, ditangkap polisi. JNL ditangkap aparat keamanan ini, ketika sedang melakukan aksi pemerasan. “Kita menangkapnya, ketika tersangka sudah menerima uang pemerasan senilai Rp10 juta. Uang itu sudah dipegang tersangka, kemudian diletakkan di meja, walau belum sempat dibawa tersangka,” sebut Kapolres Aceh Tengah AKBP Edwin Rahmat Adikusumo menjawab Waspada, Selasa (21/7). Menurut Kapolres didampingi KBO Reskrim Polres Aceh Tengah, Iptu. Asrul Rinaldi menjelaskan, barang bukti untuk menahan tersangka sudah terpenuhi dan dikuatkan dengan alat bukti. Barang bukti berupa uang senilai Rp10 juta dan selembar kwitansi yang dibuat tersangka dengan tangan sendiri, sudah diamankan. Handphone dan mobil tersangka yang mendukung aksi pemerasan ini, juga akan dijadikan barang bukti. “Dalam melakukan aksi pemerasannya, tersangka membuat selembar kwitansi yang bunyinya, uang itu untuk

pembayaran koran/ iklan,” jelas Kapolres. Saksi korban Suryani, kepala SMU Negeri 1 Bebesen, Aceh Tengah, dalam keterangannya kepada penyidik, sebut Kapolres, mendapat ancaman dari tersangka yang akan mengekpos berita di medianya bila saksi korban tidak menyediakan Rp12 juta. Namun setelah melalui proses nego, akhirnya disepakati Rp10 juta. “Tersangka saat itu mempersoalkan seputar adanya kutipan Rp1 juta per siswa baru yang akan belajar di sekolah favorit Aceh Tengah ini,” jelas Edwin. Kutipan Rp 1juta itu menurut saksi korban kepada penyidik, sesuai hasil rapat komite sekolah. Karena anak yang akan belajar di sana bukan siswa yang sebelumnya dinyatakan lulus di SMU itu. Mereka yang belum bernasib baik untuk belajar di SMU 1 Bebesen ini, para walinya sepakat untuk mengumpulkan Rp1 juta per siswa guna membangun gedung baru agar anak mereka dapat bersekolah di SMU Nibes ini. Kutipan itu yang dipersoalkan JNL, sebut Kapolres. Ter-

sangka mengancam akan memberitakan persoalan itu bila pihak sekolah tidak menyediakan uang. Akhirnya disepakati kapan transaksi. Saat transaksi itu, Jumat (16/7) menjelang siang, tersangka ditangkap aparat Polres Aceh Tengah. Tersangka JNL dikenakan pasal 369 KUHAP tentang pemerasan dan pasal 378 KUHAP tentang penipuan. Sementara barang bukti sebuah mobil milik tersangka, untuk saat sekarang ini sudah diizinkan oleh penyidik untuk dipinjam pakai oleh keluarga tersangka. “Kita akan perdalam terus kasus ini. Kita juga akan tanya mengapa saksi korban mau menyerahkan uang kepada tersangka,” sebut Edwin Rahmat Adikusumo. Mengapa kasus pemerasan yang dilakukan oleh wartawan dan jaksa yang juga ketangkap tangan (30/5) lalu, tiga tersangkanya tidak ditahan? “Pasal yang dikenakan berbeda. Kalau jaksa dan wartawan ini hanya kena pasal 369 KUHAP. Sementara JNL dijerat dengan pasal yang sama, namun ada tambahannya pasal 378 KUHP,” sebut Kapolres.(b18)

Nurul Fatwa Remaja Putri Berprestasi Aceh Timur

Waspada/Muhammad H. Ishak

EKSTRA HATI-HATI: Mobil Dinas BL 150 D milik Kepala Dinas Pendidikan Kabupaten Aceh Timur, Provinsi Aceh, Haji Agussalim, SH, MH tampak ekstra hati-hati melewati salah satu jembatan batang kelapa di lintasan utama Peureulak – Lokop, Kabupaten Aceh Timur dalam kunjungan kerja (Kunker) ke daerah terisolir itu, Senin (13/7) lalu.

Rabu 22 Juli 2009

Enam Hari Lagi Imigran Angkat Kaki

Umat Islam Jangan Lari Dari Ajaran Al Quran SINGKIL (Waspada) : Umat Islam diminta agar tidak lari dari ajaran Al Quran karena Al Quran pedoman hidup yang membimbing manusia untuk bisa selamat di dunia dan selamat di akhirat. Demikian Tausiah Tgk. Drs. H. Rasyidin Abdullah.Lc pada Tablig Akbar dalam rangka memperingati Israk Mikraj Nabi Besar Muhammad SAW sekaligus peringatan satu abad Masjid Baiturrahim Pasar Singkil, Minggu (19/7) malam. Disebutkan Al Quran sumber segala ilmu yang akan membimbing umat manusia kejalan kebenaran, dan apabila manusia jauh dari Al Quran maka tunggulah kehancuran. Anggota DPR Aceh itu juga menyebutkan, peristiwa tsunami yang melanda Aceh bukti nyata Aceh daerah serambi Mekkah, tapi masyarakatnya sudah lari dari ajaran Al Quran. Untuk itu Rasyidin mengajak seluruh masyarakat Aceh dan Aceh Singkil, khususnya tidak lari dari ajaran Al Quran sebagai mana yang menjadi perjuangan Rasulullah dalam mensyiarkan Islam yang berpegang

WASPADA

LANGSA (Waspada): Nurul Fatwa siswi SMAN Unggul Aceh Timur terpilih sebagai remaja putri berprestasi Kabupaten Aceh Timur tahun 2009 menyisihkan ratusan peserta lainnya yang datang dari seluruh kecamatan di daerah tersebut, Senin (20/7). Acara pemilihan yang digelar Badan Pemberdayaan Masyarakat Perempuan dan Keluarga Sejahtera (BPMPKS) menjaring peserta siswi dari seluruh sekolah tingkat SMAsederajat dalam wilayah Aceh

Timur. Adapun remaja putri berprestasi tersebut yakni juara I diraih oleh Nurul Fatwa siswi SMAN Unggul Aceh Timur, II Risna Wati siswi SMAN 1 Peureulak, juara III Nurul Fazria Nasution siswi SMAN Unggul Aceh Timur. Septrina Razeva dari SMAN 1 Idi meraih posisi harapan I, Wiwi Handawi dari SMAN 1 Peureulak meraih harapan II, dan Siti Hardianti Rahmadillah siswi MAN Idi merebut posisi harapan III. Siaran pers yang

diterima dari Humas Aceh Timur menyebutkan acara itu ditutup Wabup, Nasruddin Abubakar, S.PdI. Kepala Badan Pemberdayaan Masyarakat Perempuan dan Keluarga Sejahtera (BPMKS) Aceh Timur, Jamaluddin, S.Sos, M.Si memaparkan, tujuan kegiatan ini mendorong dan memotivasi tingkat kompetensi remaja putri sebagai generasi muda penerus bangsa dalam meningkatkan kualitas potensi diri sebagai aset pembangunan.(b25)

Dia melanjutkan, pada dasarnya sesuai dengan komitmen pihak Pemerintah Daerah Aceh – Pemerintah Republik Indonesia, bahwa 195 imigran asing yang terdampar di Kuala Idi, Selasa (2/2) lalu akan ditampung sementara waktu di Idi menunggu keputusan dari pihak Deplu, dimana ketika itu Deplu berjanji segera menyelesaikan kasus manusia perahu itu dalam waktu benerapa bulan sejak tanggal resminya etnis Rohingya itu sebagai pengungsi asing di Aceh. “Tapi hampir delapan bulan mereka (imigran asing— red) dalam penampungan dan pengawasan kita pihak Deplu sama sekali belum mengambil kebijakan apapun. Nah, apakah ini yang namanya penyelesaian? Dari pada ulah mereka meresahkan masyarakat lebih baik kita serahkan ke pihak Imigrasi, barangkali Imigrasi dapat menempuh jalan lain, sehingga masyarakat kita yang berada disekitar kamp tidak yerganggu lagi,” jelas Wabup Aceh Timur. Menurutnya, Pemkab Aceh Timur mengambil kebijakan tersebut atas beberapa dasar. Di antaranya ulah imigran asing itu dengan bernyanyi hingga larut malam membuat warga sekitar kamp tidak dapat tidur. Selain itu,

relawan kamp juga kewalahan menghadapi mereka (sesama etnis di kamp), sebab kerap terjadi perkelahian dalam barak. “Tidak hanya itu, lebih jahilnya Pemkab Aceh Timur kerap disalahkan dalam kaburnya 60 etnis Rohingya dari barak penampungan dalam beberapa tahap,” ujar Nasruddin seraya menandaskan relawan kamp yang tergabung dalam PMI Ranting Idi tanpa mengenal siang malam terus mengoordinir hampir 200 warga kulit hitam itu, tapi diisukan relawan kamp telah berbuat kasar terhadap etnis Rohingya itu, padahal isu yang mencuat tersebut sama sekali tidak mendasar. Sebagaimana diwartakan Waspada dalam benberapa edisi pekan lalu menyebutkan, 195 warga Myanmar itu terdampar di Selata Malaka, laut Aceh Timur, Provinsi Aceh, Senin (1/2) lalu pasca belasan hari terapung-apung di laut lepas usai dibuang pihak keamanan Thailan dalam sebuah perahu tanpa mesin, bahkan sebelumnya mereka (imigran— red) sempat disekap dan disiksa beberapa bulan dalam sebuah pulau di Thailan. 195 imigran itu berhasil didaratkan nelayan Kuala Idi, Selasa (2/2) sekira pukul 05.00 pagi. (cmad)

BRA Telusuri Calon Penerima Rumah Konflik IDI, Aceh Timur (Waspada): Badan Reintegrasi Aceh (BRA) Kabupaten Aceh Timur, Provinsi Aceh, Senin (20/7) melakukan cek langsung ke lapangan para calon penerima rumah bantuan konflik. Hal ini dianggab penting mengingat bantuan itu harus tepat sasaran. Selain itu, BRA setempat melakukan hal itu berkaitan dengan adanya laporan via SMS tentang data bantuan rumah konflik diseputaran Idi dan sekitarnya kurang benar dan bantuan yang disalurkannya juga kurang tepat sasaran. Kali ini Ketua BRA Aceh Timur, Tgk. Ahmadi Mustafa bersama stafnya melakukan pengecekan di Desa Pulau Blang Kecamatan Darul Ihksan, Aceh Timur. Selain desa tersebut, sebelumnya Ketua BRA Aceh Timur juga meninjau langsung calon penrima bantuan rumah konfik di Desa Lueng Peut dan Desa Abeuk Geulanteu, Kecamatan Madat. “Hal ini kita lakukan agar data penerima bantuan rumah konflik tepat sasaran dan sesuai kriteria sebagaimana pentunjuk mekanisme operasional bantuan rumah tahun 2008,” terang Tgk. Ahmadi Mustafa kepada wartawan. Dalam tinjauannya Ketua BRA mengakui ada temuan yang masih meragukan dipihaknya, namun demikian Ahmadi menolak menyebutkan satu persatu lokasi pemalsuan dokumen tersebut.(cmad)

SMAN Unggul Jawarai Putri Berprestasi IDI, Aceh Timur (Waspada): SMA Negeri Unggul Aceh Timur, berhasil merebut juwara pertama Lomba Putri Berprestasi yang digelar Pemkab Aceh Timur melalui Badan Pemberdayaan Masyarakat Perempuan dan Keluarga Sejahtera (BPMPKS), Minggu (20/7). Kegiatan yang diselenggarakan tiga hari itu Pemilihan Remaja Berprestasi berpisah dari keluarga karena selama penyelenggaraan Panitia menempatkan mereka di Hotel Bandar Khalifah, Idi Rayeuk. Dalam pengumuman pemenang Pemilihan Remaja Berprestasi Tahun 2009 itu diikuti 15 SMA sederajat dalam wilayah Kabupaten Aceh Timur, dimana dari masingmasing sekolah diwakili dua peserta. Setelah menilai dewan juri akhirnya memutuskan pemenangnya yakni Juara I diraih Nurul Fatwa utusan SMAN Unggul Aceh Timur, juara II Risna Wati asal SMAN 1 Peureulak, dan Juara III Nurul Fazria Nasution utusan SMAN Unggul Aceh Timur. Sementara Septrina Razeva SMAN 1 Idi meraih posisi harapan I, dan Wiwi Handawi utusan SMAN 1 Peureulak mendapatkan Harapan II, serta Siti Hardianti Rahmadillah utusan MAN Idi berhasil merebut posisi harapan III. (cmad)

Abu Ibrahim Woyla Wafat BANDA ACEH (Waspada): Ulama kharismatik Aceh, Abu Ibrahim Woyla yang berasal dari Pantai Barat Aceh wafat, Sabtu (18/7) siang. Wakil Bupati Aceh Barat, Fuadri dalam pernyataannya Sabtu (18/7) sore mengatakan ulama tersebut wafat di Woyla, Kabupaten Aceh Barat pada usia 129 tahun. “Abu meninggal tadi sore, mungkin langsung dikebumikan,” kata Fuadri. Wafatnya ulama itu mengejutkan umat Islam di Aceh, dan bagi warga Aceh terutama yang mendiami wilayah pantai barat, mengenal Abu Ibrahim sebagai ulama yang sangat berpengaruh. Tidak banyak cacatan tentang perannya semasa hidup, namun banyak warga di Aceh meyakini Abu Ibrahim sebagai Aulia Allah atau orang memiliki tingkat keimanan yang tinggi.(b32)

Kapolres Aceh Timur: ‘Senjata Api Masih Potensi’ PEUDAWA, Aceh Timur (Waspada): Menurut laporan intelijen, pihak kepolisian memprediksi senjata api (senpi) masih berpotensi digunakan pelaku kejahatan dalam beraksi. Buktinya, dalam beberapa operasi gabungan pertugas berhasil menemukan barang bukti (BB) dari tangan pelaku. “Bahkan, menurut informasi masyarakat ditambah dengan pengembangan yang dilakukan polisi pasca diringkusnya beberapa otak dibalik sejumlah aksi penculikan dan perampokan di wilayah hukum kita, dideteksi bahwa pelaku dalam setiap aksi menggunakan senjata api dari berbagai jenis,” kata Kapolres Aceh Timur, AKBP Drs. Ridwan Usman diruang kerjanya, Selasa (21/7). Menjawab Waspada kemarin AKBP Ridwan Usman menerangkan, penegak hukum mengira tidak tertutup kemungkinan kawanan pejahat bersenjata api itu terus mengincar sasarannya. Meski sejumlah pelaku yang masuk dalam DPO telah berhasil dilumpuhkan dan ditangkap serta diamankan untuk proses pengemnbangan lebih lanjut, namun polisi memperkirakan masih terdapat pelaku kriminalitas yang menggunakan senpi. (cmad)


WASPADA DAILY  

WASPADA RABU 22 JULI 2009

Read more
Read more
Similar to
Popular now
Just for you