Page 1

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) KAMIS, Kliwon, 29 Agustus 2013/22 Syawal 1434 H

No: 24324 Tahun Ke-67

Terbit 20 Halaman “ The Hottest Hi Tech Modified Motorshow” Djarum Black Autoblackthrough Siap Menghentak Medan International Convention Center @Santika

Pekanbaru Berstatus Bahaya Asap PEKANBARU (Antara): Dinas Kesehatan Provinsi Riau menyatakan, kondisi udara di Kota Pekanbaru dalam status berbahaya bagi kesehatan akibat tercemar asap sisa kebakaran lahan dan hutan. Dari pantauan Indeks Standar Pencemaran Udara (ISPU) yang dipasang di sejumlah titik di wilayah Pekanbaru, mencatat kualitas udara mencapai 300 pollutant standart index (PSI), kata Kepala Seksi Kesehatan Lingkungan pada Dinas Kesehatan Provinsi Riau, Dewani, kepada pers di Pekanbaru, Rabu(28/8). Lanjut ke hal A2 kol 5


KABUT ASAP MEDAN: Kabut asap kiriman menyelimuti kawasan peti kemas di perairan Pelabuhan Belawan Medan, Rabu (28/8). Kabut asap yang menyelimuti kawasan pelabuhan Belawan tersebut berasal dari kebakaran hutan yang kembali melanda kawasan di daerah Riau.

PARA penggemar modifikasi mobil di kota Medan diharapkan segera mempersiapkan diri. Djarum Black siap menggelar “The Hottest Hi Tech Modified Motorshow” di Indonesia yakni Djarum Black Autoblackthrough pada tanggal 31 Agustus – 1 September 2013. Medan International Convention Center (MICC) @Santika, menjadi lokasi digelarnya Djarum Black Autoblackthrough. Merupakan seri ketiga sepanjang tahun 2013 yang sebelumnya meraih sukses di Surabaya dan Yogyakarta, dengan melibatkan ratusan mobil modifikasi dan dihadiri penggemar modifikasi dari berbagai kota. Sempat absennya Djarum Black Autoblackthrough sepanjang tahun 2012, diyakini Djarum Black sebagai alasan kuat demi semakin terpuaskannya para peserta dan pengunjung. Sebab, kembalinya Djarum Black Autoblackthrough tahun ini telah mengalami berbagai penyempurnaan dalam regulasi, hingga melibatkan juri dari mancanegara. Pihak Djarum Black memboyong peralatan-peralatan mutakhir untuk kompetisi performa mesin Dyno Attraction memakai Mainline DynoLog dari Australia dan kompetisi audio Black Out Loud berstandar penjurian EASCA (European Auto Sound Association). Dapat dikatakan bahwa Djarum Black Autoblackthrough menjadi gelaran modifikasi paling bergengsi dan terlengkap di Indonesia. Lanjut ke hal A2 kol 1

Emas Dan Dolar Meroket MEDAN (Waspada): Harga emas dunia terus meroket, berada di level 1.420 dolar AS per troy ons pada perdagangan Rabu (28/8). Kenaikan harga emas dunia tersebut, membuat harga emas dalam negeri mengalami kenaikan cukup signifikan sebesar Rp530.000 per gram. Sementara rupiah masih di dalam tekanan berada di kisaran Rp11.500-an per satu dolar AS. “Harga emas masih terus naik, sekarang Rp530.000 per gram. Sedangkan harga emas dunia sudah melewati batas psikologis dengan menembus level 1.420 dolar AS per troy ons,” kata Pemilik Toko Mas Sinar Agung di Pusat Pasar Medan Kornalius Tarigan kepada Waspada, Rabu (28/8). Sehari sebelumnya harga

emas dunia berada di level 1.407 dolar AS per troy ons, sedangkan emas dalam negeri Rp510.000 per gram. Menurutnya, dengan kenaikan harga emas tersebut, banyak para spekulan mulai bermain melakukan take profit (mengambil keuntungan) dengan menjual emasnya. Lanjut ke hal A2 kol 6 Waspada/Surya Efendi

Waspada/Surya Efendi

INVESTASI EMAS: Seorang warga memperlihatkan emas sebagai investasi pribadinya di Medan, Rabu (28/8). Investasi dilakukan menunggu harga emas yang terus naik.

DOLAR TERUS NAIK: Seorang karyawati money changer di Medan menghitung uang dolar AS yang mencapai Rp12 ribu, Rabu (28/8).

Ajib Shah Ketua Partai Golkar Sumut

Rupiah Melemah Hingga Awal 2014

MEDAN (Waspada): H. Ajib Shah terpilih menjadi ketua DPD Partai Golkar Sumatera Utara hingga tahun 2015. Dia terpilih secara aklamasi dalam Musyawarah Daerah Luar Biasa (Musdalub) DPD Partai Golkar Sumut yang digelar di Jakarta, Rabu (28/8). Musdalub itu diikuti seluruh peserta, berjumlah 37 suara. Yakni dari 33 DPD kab/kota, 1 DPD Sumut dan 1 DPP serta 2 suara organisasi yang dilahirkan partai yang kemudian secara langsung menyatakan persetujuan memilih Ajib Shah, menjadi ketua DPD Partai Golkar Sumut. Tidak ada lagi calon lain

berani menyatakan maju. Dengan terpilihnya Ajib Shah, posisi Andi Achmad Dara, yang selama ini menjabat sebagai Pelaksana Tugas Ketua langsung berakhir. Setelah terpilih menjadi ketua, Ajib Shah, berjanji akan merangkul seluruh kader partai pohon beringin itu di kepengurusannya nanti. ‘’Seluruh potensi akan kita himpun di pengurusan. Karena tujuan kita (Golkar) adalah untuk memenangkan Pemilu, Pilpres dan Pilkada yang dilaksanakan di sejumlah kab/kota di Sumut,” kata Ajib. Ajib, juga mengatakan segera melakukan konsolidasi untuk

memperkuat struktur sampai ke tingkat yang paling bawah. Musdalub tersebut dibuka Wakil Ketua Umum DPP Partai Golkar Syarif Cicip Sutardjo. Kemudian, setelah terpilih secara aklamasi, selanjutnya dilakukan pemilihan formatur untuk menyusun kepengurusan DPD Partai Golkar Sumut. Sementara Wagubsu yang juga kader Golkar HT Erry Nuradi kepada Waspada melalui pesan singkat mengucapkan selamat kepada H Ajib Shah. “Semoga dengan kepemimpinan Ajib, Partai Golkar Sumut akan lebih besar dan maju,” sebutnya. (m12/m46)

Bendahara PU DS Divonis 1 Tahun MEDAN (Waspada) : Majelis Hakim Pengadilan Tipikor yang bersidang di Pengadilan Negeri Medan, Rabu(28/8) menjatuhkan vonis satu tahun penjara kepada Elvian, bendahara Dinas PU Pemkab Deliserdang. Seperti vonis terhadap Ir. Faisal sebelumnya, dua anggota majelis hakim dalam persidangan tersebut beda pendapat dengan putusan tersebut. Dalam amar putusannya, Elvian terbukti bersalah melakukan tindak pidana korupsi secara bersama-sama atas anggaran proyek pemeliharaan dan pembangunan jalan dan jembatan di Dinas PU Deliserdang.

‘’ Untuk itu, majelis menjatuhkan pidana kepada Elvian dengan hukuman setahun penjara, denda Rp50 juta dan subsider satu bulan kurungan,” ujar majelis hakim, diketuai Denny L Tobing, Rabu (28/8) di ruang utama PN Medan. Mendengar putusan majelis hakim, ratusan pendukung Elvian dari Deliserdang sekitarnya tampak kecewa. Mereka memeluk Elvian sembari memberikan dukungan moral. Ir Faisal, Kadis PU Deliserdang yang telah divonis 1,6 tahun penjara, juga tampak hadir. Sebelumnya, dalam amar putusannya, dua dari lima hakim

Al Bayan

Sisakan Untuk Akhirat Oleh Muhammad Arif Fadhillah Lubis, SHI, MSI SUATU hari, Umar bin Khattab melihat Jabir bin Abdullah membawa daging. Umar bertanya, “Apakah ini, hai Jabir?”. “Ini daging yang saya beli karena saya menginginkannya, “ jawab Jabir. Mendengarnya Umar menukas, “Apakah semua yang kamu inginkan kamu beli? Tidakkah sebaiknya kamu mengosongkan sebagian perut kamu untuk memberikan makanan kepada tetanggamu dan keponakanmu. Tidakkah kamu perhatikan Firman Allah,”Kamu telah menghabiskan rezekimu yang baik dalam kehidupan duniawimu (saja) dan kamu telah bersenang-senang dengannya?” Pada kisah di atas, Umar bermaksud mengingatkan pada Jabir bahwa manusia yang terus-menerus memenuhi keinginannya, pada hakikatnya tidak menyisakan sebagian dari kesenangan itu untuk akhirat. Seandainya manusia mengurangi kenikmatan itu dan membagikannya kepada orang lain, sesungguhnya ia telah menyisakan untuk hari Akhirat. Lanjut ke hal A2 kol. 6

lainnya diantaranya Kemas Djauhari dan Sugianto, menyatakan perbedaan pendapat. Mereka menilai perbuatan terdakwa sesuai aturan dan kewenangannya. Dengan demikian terdakwa tidak terbukti secara sah dan meyakinkan melakukan tindak pidana korupsi sebagaimana dalam dakwaan dan tuntutan Jaksa. Menurut kedua hakim tersebut, jaksa tidak dapat membuktikan nilai kerugian yang disebut mencapai Rp 105,83 miliar. Dengan demikian, Lanjut ke hal A2 kol. 7


KAPAL perang dilengkapi misil penjelajah meluncur di perairan sebelah timur Laut Tengah. Pejabat AS mengatakan kepada para pemeriksa PBB di Syria agar keluar.

Rusia Anggap Barat “Monyet Bawa Granat” MOSKOW, Rusia (AP): Pemerintah Rusia marah atas sikap Amerika Serikat dan sekutu baratnya yang mengancam akan menyerang Syria, menyusul tuduhan penggunaan senjata kimia pada rakyat sipil. Karena marahnya, Wakil PM Rusia Dmitry Rogozin sampai mengeluarkan makian. Dalam akun Twitternya, Wakil PM Rusia menyamakan Barat dengan monyet. “Sikap Barat terhadap dunia Islam seperti monyet bawa granat,” ujar Rogozin, seperti dilansir GMA News, Selasa. Tidak dijelaskan maksud dari perkataannya ini. Sebelumnya Rusia memang telah mengingatkan AS untuk berhati-hati dalam bersikap. Menurut mereka, serangan AS ke Syria tanpa melalui persetujuan Dewan Keamanan PBB hanya akan menyebabkan bencana yang lebih besar. “Percobaan untuk tidak melalui Dewan Keamanan, sekali lagi akan menciptakan alasan-alasan tidak berdasar untuk intervensi militer di wilayah yang tengah menderita seperti Syria dan akan menciptakan konsekuensi bencana bagi negara lagi di Timur Tengah dan Afrika Utara,” kata jurubicara Kementerian Luar Negeri Rusia, Alexander Lukashevich. Lanjut ke hal A2 kol. 1


ROONA Begum, lahir di sebuah desa terpencil di India menderita Hydrocephalus dan sempat divonis tidak hidup lama. baring di tempat tidur. Menjadi sangat sulit bagi kami untuk menggendongnya dan membawanya ke mana-mana,” kata sang ayah Abdul Rehman, yang dikutip dari CNN,

di kantor Direktorat Jenderal Pajak Jakarta, Rabu (28/8). Ia menambahkan, pelemahan Rupiah ini masih dipengaruhi oleh tekanan pasar dan tappering off Amerika Serikat yang masih berlanjut pada masa mendatang. Pemerintah akan tetap melakukan stabilisasi dari pelemahan Rupiah ini. Sebelumnya dalam Rapat Paripurna DPR di Jakarta, Selasa (27/8), Menkeu M Chatib Basri menyebutkan tren pelemahan Rupiah masih akan berlanjut hingga awal tahun 2014. Meski demikian, pemerintah masih optimistis, nilai tukar Rupiah rata-rata pada tahun 2014 ada-

lah Rp 9.750 per Dolar AS. Hal itu merupakan jawaban pemerintah atas pandangan umum fraksi-fraksi DPR terhadap Rancangan Anggaran Pendapatan dan Belanja Negara Tahun 2014. Nilai tukar Rupiah selama beberapa pekan terakhir terus berfluktuasi di atas Rp 10.000 per dolar AS. Bahkan, pada Rabu siang, nilai Rupiah di pasar spot mencapai Rp 11.335 per dolar AS. Dalam paparannya, Chatib menyebutkan empat faktor eksternal yang akan memberikan tekanan pada rupiah. Lanjut ke hal A2 kol. 5

Kalapas Tanjung Gusta Diganti JAKARTA (Antara): Delapan Kepala Lembaga Pemasyarakatan (Kalapas) Klas I, termasuk Medan (Tanjung Gusta)diganti. Pelantikan dilakukan Menteri Hukum dan HAM Amir Syamsuddin di Jakarta, Rabu (28/7). Amir dalam arahannya setelah pelantikan pejabat Eselon II Kementerian Hukum dan HAM mengatakan, dalam rangka penguatan pelaksanaan tugas dan fungsi, serta dalam upaya percepatan pencapaian target-target yang telah ditetapkan, salah satu strategi yang saya ambil adalah melakukan mutasi dalam jabatan-jabatan strategis.

Sementara itu, Wakil Menteri Hukum dan HAM Denny Indrayana membantah pergantian kepala-kepala Lapas Klas I terkait peristiwa kerusuhan dan narapidana kabur di sejumlah lembaga pemasyarakatan di Indonesia. “Tidak dikait-kaitkan yang kemarin karena yang pasti Lapas Kelas I itu ada penguatan. Termasuk Medan dan Jakarta,” kata Denny. Sejumlah Kepala Lapas Kelas I yang dilantik yaitu Kepala Lapas Klas I Semarang (Tedja Sukmana), Kepala Lapas Klas I Cipinang Jakarta (Sutrisman), Kepala Lapas Klas I Bandar

Lampung (Petrus Kunto Wiryanto) dan Kepala Lapas Klas I Tangerang (Dedi Handoko). Kemudian, Kepala Lapas Klas I Palembang, Kepala Lapas Klas I Batu Nusakambangan Cilacap Jawa Tengah (Liberti Sitinjak), Kepala Lapas Klas I Cirebon Jawa Barat (Agus Soekono) dan Kepala Lapas I Medan (Lilik Sujandi). Selain delapan Kalapas Klas I, Menkumham juga melantik 16 Kepala Kantor Wilayah Kementerian Hukum dan HAM, dan sejumlah direktur di Direktorat-direktorat Jenderal Kementerian Hukum dan HAM.

Seorang TKW Terancam Ada-ada Saja Hukuman Mati Di Malaysia Penyakit Jam Karet

Penderita Hydrocephalus Membaik Pasca Operasi MELIHAT gambar ini, mungkin sebagian orang ragu, apakah bayi ini akan mampu bertahan hidup. Namun, bayi 18 bulan asal India bernama Roona Begum mengalami keajaiban setelah kondisinya membaik usai menjalani operasi. Bayi perempuan yang lahir di sebuah desa terpencil di timur laut India ini didiagnosa menderita Hydrocephalus parah dan kepalanya mengalami pembengkakan cairan di otak. Dokter sempat meramal bayi ini hanya akan hidup selama beberapa bulan saja. “Hari demi hari, kepalanya mulai tumbuh besar, selera makannya terus menurun, dia hanya ingin ber-

JAKARTA (Waspada): Menteri Keuangan Chatib Basri menegaskan, pemerintah dan Bank Indonesia (BI) tidak akan membiarkan Rupiah terus tertekan terhadap Dolar AS. Meskipun diprediksi pelemahan Rupiah ini bisa berlanjut hingga awal tahun depan, seiring ketidakpastian ekonomi global. “Jika saya mengatakan, pelemahan Rupiah akan berlanjut hingga awal tahun 2014, maka seolah-olah Bank Indonesia (BI) dan pemerintah akan membiarkan Rupiah itu melemah. Itu tidak mungkin, karena akan berakibat negatif bagi pasar,” kata Chatib saat konferensi pers

Rabu (28/8). Roona memiliki lingkar kepala 94 sentimeter, hampir tiga kali lipat ukuran bayi Lanjut ke hal A2 kol. 3

JAKARTA (Waspada): Anggota Komisi IX DPR RI Rieke Diah Pitaloka mendesak Presiden Susilo Bambang Yudhoyono (SBY) melakukan diplomasi politik kepada pemerintah Malaysia, untuk membatalkan rencana hukuman mati terhadap tenaga kerja wanita (TKW) Wifrida Soik. Ancaman hukuman mati terhadapWifrida karena dituduh membunuh majikannya Yeap Seok Pen, 60, di Malaysia. Selain masih di bawah umur (17 tahun), Wifrida dalam insiden itu untuk membela diri karena dipukuli dan sang majikan terjatuh dan meninggal. “Wifrida membela diri dan masih di bawah umur. Karena itu Presiden SBY harus melakukan diplomatik untuk menghentikan ancaman hukuman mati itu dengan menyediakan

pengacara. Juga membongkar jaringan perdagangan manusia atau trafficking antara Indonesia-Malaysia,” tandas Rieke Diah Pitaloka bersama aktivis buruh migran Anis Hidayah, Wahyu Susilo, dan anggota DPD RI Sarah Lerry Mboik di Gedung DPR RI Jakarta, Rabu (28/8). Selain itu meminta Komnas HAM untuk terlibat aktif dalam proses persidangan di Malaysia. “Perlu dukungan masyarakat Indonesia dan masyarakat internasional agar memperhatikan ini karena satu nyawa itu merupakan bagian dari bangsa ini. Mengapa? Karena kita tak lagi bisa berharap pada Kemenakertrans dan BPN2TKI. Kementerian luar negeri juga tak akan berarti jika Presiden SBY tak aktif lobi dengan Malaysia,” tambahnya. (j07)

Karena tak pernah tepat waktu bila membuat janji untuk bertemu, teman-teman dan saudaranya selalu berpikir pria ini hanya membuat alasan jika ia datang terlambat. Namun setelah diperiksa dokter, ternyata pria bernama Jim Dunbar ini didiagnosis dengan penyakit keterlambatan Lanjut ke hal A2 kol. 3

Serampang - Biarlah benjol asal ada hujan emas - He...he...he...

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) KAMIS, Kliwon, 29 Agustus 2013/22 Syawal 1434 H

z zNo: 24324 * Tahun Ke-67

Terbit 20 Halaman

Seorang TKW Terancam Hukuman Mati Di Malaysia JAKARTA (Waspada): Anggota Komisi IX DPR RI Rieke Diah Pitaloka mendesak Presiden Susilo Bambang Yudhoyono (SBY) melakukan diplomasi politik kepada pemerintah Malaysia, untuk membatalkan rencana hukuman mati terhadap tenaga kerja wanita (TKW) Wifrida Soik. Ancaman hukuman mati terhadap Wifrida karena dituduh membunuh majikannya Yeap Seok Pen, 60, di Malaysia. Selain masih di bawah umur (17 tahun), Wifrida dalam insiden itu untuk membela diri karena dipukuli dan sang majikan terjatuh dan meninggal. “Wifrida membela diri dan masih di bawah umur. Karena itu Presiden SBY harus melakukan diplomatik untuk menghentikan ancaman hukuman mati itu dengan menyediakan pengacara. Juga membongkar jaringan perdagangan manusia atau trafficking antara IndonesiaMalaysia,” tandas Rieke Diah Pitaloka bersama aktivis buruh migran Anis Hidayah, Wahyu Susilo, dan anggota DPD RI Sarah Lerry Mboik di Gedung DPR RI Jakarta, Rabu (28/8). Selain itu meminta Komnas HAM untuk terlibat aktif dalam proses persidangan di Malaysia. “Perlu dukungan masyarakat Indonesia dan masyarakat internasional agar memperhatikan ini karena satu nyawa itu merupakan bagian dari bangsa ini. Mengapa? Karena kita tak lagi bisa berharap pada Kemenakertrans dan BPN2TKI. Kementerian luar negeri juga tak akan berarti jika Presiden SBY tak aktif lobi dengan Malaysia,” tambahnya. Sementara itu Anis Hidayah berharap DPD dan DPR RI mengawal proses persidangan tersebut sebagai komitmen terhadap rakyat dan TKW karena hukuman Lanjut ke hal A2 kol 1

Waspada/Surya Efendi

DOLLAR TERUS NAIK: Seorang karyawati money changer di Medan menghitung uang dollar AS yang mencapai Rp12 ribu, Rabu (28/8).

AS$1 = Rp 12.000


ASAP GANGGU PENERBANGAN PEKANBARU: Asap sisa kebakaran lahan dan hutan menyelimuti Bandara Sultan Syarif Kasim II, Pekanbaru, Rabu (28/8). Aktivitas penerbangan domestik dan internasional di Bandara Pekanbaru selama dua hari terakhir terganggu asap pekat mengakibatkan jarak pandang mencapai 300 - 500 meter dan tidak aman bagi penerbangan.

JAKARTA (Waspada): Nilai tukar rupiah terus tertekan terhadap dolar AS pada transaksi Rabu (28/8). Pada sejumlah bank di Jakarta, nilai tukar makin mendekati level Rp12.000 per dolar AS. Padahal, data transaksi aktual antar bank atau Jakarta Interbank Spot Dollar Rate (JISDOR) pagi tadi, rupiah berada di posisi Rp10.950 per dolar AS. Sehari sebelumnya, rupiah di level Rp10.883 per dolar AS. Berdasarkan data di PT Bank Central Asia Tbk, kurs jual rupiah mencapai Rp11.800 per dolar AS. Sementara itu, kurs beli tercatat Rp11.300 per dolar AS. Untuk bank pelat merah, seperti PT Bank Negara Indonesia Tbk, kurs jual rupiah dipatok Rp11.750 per dolar AS. Kurs beli di level Rp11.250 per dolar AS. Selanjutnya di PT Bank Danamon Indonesia Tbk, kurs jual rupiah mencapai Rp11.635 dan beli Rp11.290. Namun, di PT Bank Internasional Indonesia Tbk, kurs jual rupiah telah menembus Rp12.000 per dolar AS, dan beli Rp11.300. Seperti dikutip Reuters, Kepala Riset Samsung Futures di Seoul, Jeong, mengatakan, konflik di Suriah meningkatkan risiko geopolitik, sehingga memberi tekanan pada mata uang Asia. Beberapa mata uang di Asia, seperti rupee dan rupiah, dia melanjutkan, tidak mungkin mengalami pemulihan cepat. Sebab, masalahnya bukan karena likuiditas jangka pendek. “Meskipun pemerintah sudah melakukan yang terbaik, itu akan memakan waktu lama untuk menstabilkan ekonomi mereka,’’ tambah Jeong. (vn/m09)

Rusia Tanggapi Ancaman Amerika Serang Syria

Barat Seperti Monyet Bawa Granat MOSKOW, Rusia (AP): Pemerintah Rusia berang atas sikap Amerika Serikat dan sekutu baratnya yang mengancam akan menyerang Syria, menyusul tuduhan penggunaan senjata kimia pada rakyat sipil. Saking marahnya, Wakil PM Rusia Dmitry Rogozin sampai mengeluarkan makian.

Dalam akun Twitternya, PM Rusia menyamakan Barat dengan monyet. “Sikap Barat terhadap dunia Islam seperti monyet bawa granat,” ujar Rogozin, seperti dilansir GMA News, Selasa. Tidak dijelaskan maksud dari perkataannya ini.

Sebelumnya Rusia memang telah mewanti-wanti AS untuk berhati-hati dalam bersikap. Menurut mereka, serangan AS ke Syria tanpa melalui persetujuan Dewan Keamanan PBB hanya akan menyebabkan bencana yang

lebih besar. “Percobaan untuk tidak melalui Dewan Keamanan, sekali lagi akan menciptakan alasan-alasan tidak berdasar untuk intervensi militer di wilayah yang tengah menderita seperti Suriah dan akan men-

ciptakan konsekuensi bencana bagi negara lagi di Timur Tengah dan Afrika Utara,” kata jurubicara Kementerian Luar Neger i Rusia, Alexander Lukashevich. “Kami menyerukan mitra Amerika dan seluruh anggota

komunitas internasional untuk menun-jukkan kehatihatian dan menerapkan hukum internasional, terutama prinsip-prinsip dasar dari piagam PBB,” lanjutnya lagi. Akibat isu Syria, hubungan AS dan Rusia ikut renggang. AS

memutuskan untuk membatalkan pertemuan Senin lalu dengan Rusia di Denhag, Belanda, untuk membicarakan soal keterlibatan militer Barat di Syria. Lanjut ke hal A2 kol 1

JK Tak Ikut Tapi Jagokan Pramono JAKARTA (Antara): Mantan Wakil Presiden, M. Jusuf Kalla ( JK), tak mau mengikuti konvensi calon presiden yang diselenggarakan Partai Demokrat, kata Sekretaris Komite Kovensi Partai Demokrat, Suaedy Marasabessy. “Pak JK belum bersedia. Beliau pernah menjadi Ketua Umum Partai Golkar, sehingga menjadi tidak etis,” ujarnya di Wisma Kodel, Kuningan, di Jakarta, Rabu (28/8). Dalam kode etik konvensi, seseorang yang mempunyai jabatan struktural di partai lain harus nonaktif dari jabatannya di partai itu. Selain itu, pemenang konvensi capres harus menjadi kader Partai Demokrat karena Demokrat tetap ingin mengusung kadernya sendiri pada pemilihan umum (Pemilu) 2014. Ia menjelaskan, sebenarnya Komite Konvensi Partai Demokrat belum memberikan undangan konvensi kepada JK. Akan tetapi, sejauh ini pihaknya hanya menemui dan berkomunikasi dengan Ketua Umum Palang Merah Indonesia (PMI) itu. Lanjut ke hal A2 kol 4 Antara

ANGGOTA Dewan Pembina Partai Demokrat Jenderal TNI (Purn) Pramono Edhie Wibowo (kanan) bersiap mengikuti sesi pra konvensi dengan anggota Komite Konvensi Calon Presiden Partai Demokrat di Wisma Kodel, Jakarta, Rabu (28/8).

2 September Simulasi Perjalanan Calhaj MEDAN (Waspada): Simulasi perjalanan jamaah calon haji (Calhaj) Embarkasi Medan dari Asrama Haji Pangkalan Mahsyur Medan menuju Kualanamu International Airport (KNIA), untuk bertolak ke tanah suci akan digelar 2 September 2013. Demikian disampaikan Ketua Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan Drs Abd Rahim M.Hum, Rabu (28/8).

Kepada wartawan, Abd Rahim menyebutkan, simulasi ini penting, mengingat situasi perjalanan ke KNIA dengan jarak tempuh antara satu jam lebih. Selain itu, kondisi jalan yang belum sempurna karena masih ada berbagai perbaikan dan lebih sering antrean di sepanjang jalan menuju bandara. “Simulasi nantinya melibatkan petugas PPIH, media, keamanan dan stakeholder yang mendukung perjalanan

Ajib Shah Ketua Partai Golkar Sumut

ibadah haji. Hal ini sangat perlu dilakukan guna mengetahui bagaimana sistem yang tepat dalam rangka memperlancar perjalanan Calhaj dari Asrama Haji menuju bandara,agar jadwal penerbangan yang sudah ditetapkan tidak mengalami penundaan,”kata Abd Rahim. Hal lain yang dia sampaikan, saat ini Asrama Haji sudah

MEDAN (Waspada): H. Ajib Shah, terpilih menjadi ketua DPD Partai Golkar Sumatera Utara hingga tahun 2015. Dia terpilih secara aklamasi dalam Musyawarah Daerah Luar Biasa (Musdalub) DPD Partai Golkar Sumut yang digelar di Jakarta, Rabu (28/8). Musdalub tersebut diikuti seluruh peserta, berjumlah 37 suara. Yakni dari 33 DPD kabupaten/kota, 1 DPD Sumut dan 1 DPP serta 2 suara organisasi yang dilahirkan partai yang kemu-dian secara langsung menyatakan persetujuan memilih Ajib Shah, menjadi ketua DPD Partai Golkar Sumut. Tidak ada lagi calon lain berani menyatakan maju. Dengan terpilihnya Ajib Shah, posisi Andi Achmad Dara, yang selama ini menjabat sebagai Pelaksana Tugas Ketua langsung berakhir. Setelah terpilih menjadi ketua, Ajib Shah, berjanji akan

Lanjut ke hal A2 kol 2

Lanjut ke hal A2 kol 1

Waspada/Bahtiar Gayo

KAMPUNG Serempah ini, tinggal kenangan setelah gempa dengan kekuatan 6,2 SR menghilangkan sebagian besar areal perumahan. Pertapakan perumahan penduduk dilarikan ke dasar lembah, setelah kampung itu berubah menjadi kawah.

Warga Serempah Minta Pindah Dari Areal Relokasi TAKENGEN (Waspada): 317 Jiwa warga Serempah,Kec. Ketol, Aceh Tengah, kawasan terparah dilanda gempa Gayo, yang sudah dipindahkan (direlokasi) Pemda Aceh Tengah, mengusulkan agar mereka dipindahkan dari kawasan relokasi. Tempat pemukiman baru, Kute Alam yang disiapkan Pemda ternyata masuk dalam kawasan bencana.Angin di lokasi baru ini sangat kencang.

Rumah petak, yang dibangun untuk tempat tinggal darurat, sudah banyak yang rubuh. “Kami tidak tahan di lokasi baru. Angin sangat kencang, rumah darurat rubuh. Kami ketakutan di lokasi baru. Di sini juga kawasan musibah, anginnya mengundang maut. Selain itu lokasi kebun usaha kami jauh dari tempat tinggal,” sebut Arman, Reje (Gecik) Kampung Serempah menjawab pertanyaan Pers, Rabu

(28/8). Menurut Reje Serempah, pihaknya sudah meminta petunjuk ke bupati Aceh Tengah sehubungan dengan keresahan masyarakat. Surat yang turut ditanda tangani warga ini belum mendapat jawaban bupati. Waspada bersama rombongan wartawan yang turun ke kawasan relokasi ini, Lanjut ke hal A2 kol 6

Ada-ada Saja

Al Bayan

Penyakit Jam Karet

Sisakan Untuk Akhirat! Oleh: Muhammad Arif Fadhillah Lubis,SHI,MSI SUATU hari, Umar bin Khattab melihat Jabir bin Abdullah membawa daging. Umar bertanya, “Apakah ini, hai Jabir?”. “Ini daging yang saya beli karena saya menginginkannya, “ jawab Jabir. Mendengarnya Umar menukas, “Apakah semua yang kamu inginkan kamu beli? Tidakkah sebaiknya kamu mengosongkan sebagian perut kamu untuk memberikan makanan kepada tetanggamu dan keponakanmu. Tidakkah kamu perhatikan Firman Allah,”Kamu telah menghabiskan rezekimu yang baik dalam kehidupan duniawimu (saja) dan kamu telah bersenang-senang dengannya?” Pada kisah di atas, Umar bermaksud mengingatkan pada Jabir bahwa manusia yang terus-menerus memenuhi keinginannya, pada hakikatnya tidak menyisakan sebagian dari kesenangan itu untuk akhirat. Seandainya manusia mengurangi kenikmatan itu dan

Lanjut ke hal A2 kol 2

“ The Hottest Hi Tech Modified Motorshow” Djarum Black Autoblackthrough Siap Menghentak Medan International Convention Center @Santika


PELANTIKAN PPM IPDN: Presiden Susilo Bambang Yudhoyono (kedua kiri) didampingi Ibu Ani Yudhoyono (kanan) dan Mendagri Gamawan Fauzi (kiri) memberi ucapan selamat kepada para orang tua Praja Muda ketika menyaksikan perayaan Pelantikan Pamong Praja Muda (PPM) angkatan XX 2013 di kampus Institut Pemerintahan Dalam Negeri, Jatinangor, Sumedang, Jabar, Rabu (28/8). SBY melantik 1.541 Praja Muda dengan Program D IV, S1 dan MAPD yang selanjunya ditempatkan di seluruh instansi pemerintahan di Indonesia.

PARA penggemar modifikasi mobil di kota Medan diharapkan segera mempersiapkan diri. Djarum Black siap menggelar “The Hottest Hi Tech Modified Motorshow” di Indonesia yakni Djarum Black Autoblackthrough pada tanggal 31 Agustus – 1 September 2013. Medan International Convention Center (MICC) @Santika, menjadi lokasi digelarnya Djarum Black Autoblackthrough. Merupakan seri ketiga sepanjang tahun 2013 yang sebelumnya meraih sukses di Surabaya Lanjut ke hal A2 kol 7

KARENA tak pernah bisa datang tepat waktu bila membuat janji untuk bertemu, teman-teman dan saudaranya selalu berpikir pria ini hanya membuat alasan jika ia datang terlambat. Namun setelah diperiksa Lanjut ke hal A2 kol 5

Serampang - Kalau di sini monyet bawa topeng - He.... he....he....

Berita Utama

A2 Ajib Shah ....

merangkul seluruh kader partai pohon beringin tersebut di kepengurusannya nanti. ‘’Seluruh potensi akan kita himpun di pengurusan. Karena tujuan kita (Golkar) adalah untuk memenangkan Pemilu, Pilpres dan Pilkada yang dilaksanakan di sejumlah kabupaten/kota di Sumut,” kata Ajib. Ajib, juga mengatakan segera melakukan konsolidasi untuk memperkuat struktur sampai ke tingkat yang paling bawah. Musdalub tersebut dibuka Wakil Ketua Umum DPP Partai Golkar Syarif Cicip Sutardjo. Kemudian, setelah terpilih secara aklamasi, selanjutnya dilakukan pemilihan formatur untuk menyusun kepengurusan DPD Partai Golkar Sumut. (m12)

Barat Seperti ....

Rusia berkeyakinan bahwa serangan kimia pekan lalu yang menewaskan 1.700 orang dilakukan oleh pejuang Syria. Sementara Barat dan negaranegara Teluk haqul yakin rezim Bashar Assad yang melakukannya, berdasarkan penelitian dan kesaksian di Ghouta. AS, Prancis dan Inggris sedemikian jauh telah mengindikasikan rencana mereka menyerang Syria dalam waktu dekat ini. AS bahkan telah menyiagakan empat kapal perang mereka di laut Mediterania, siap luncurkan roket. Menurut analisa kantor berita NBC, tiga negara ini kemungkinan hanya akan menggunakan serangan dari laut. Berbeda dengan penyerangan udara NATO ke Libya, Suriah memiliki kemampuan jet tempur yang cukup bisa menandingi kekuatan udara Barat. Syria memiliki lebih dari 600 armada tempur, kebanyakan dari kelas MiG buatan Rusia. Jika nekat menyerang Syria dari udara, AS diprediksi akan menggunakan pesawat nirawak seperti pesawat siluman pengebom B-2 yang akan diterbangkan dari pangkalan udara Whiteman di Missouri. Pesawat ini terkenal ampuh menghindari radar lawan. Empat kapal itu adalah USS Barry, USS Mahan, USS Ramage dan USS Gravely, yang lempar jangkar di sebelah timur Mediterania. Kapal destroyer AS lainnya, USS

Seorang TKW ....

mati itu tak boleh terjadi bagi anak yang masih di bawah umur, akibat dipalsukan oleh agency pekerjaaan (AP). Padahal Wifrida lahir pada 12 Oktober 1993, tapi dipalsukan dalam paspor menjadi 8 Juni 1989 dan berangkat ke Malaysia pada 23 Oktober 2010. “Jadi, DPR dan DPD RI ini harus mengawal dan membatalkan ancaman hukuman mati ini,” ujarnya. Anis dan Wahyu Susilo merasa heran dengan kasus Wifrida ini, sebab kasusnya sudah dua tahun (2010), tapi baru diketahui pada Desember 2012. “Ini menjelaskan bahwa pemerintah tidak memperhatikan nasib TKI di luar negeri. (j07)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. c8(M)+, Gd8. 2. BxG+, Be8. 3. BxB+, Rh7. 4. Bh8+mat. (Jika 1. ...., Rh7. 2. KxG+, g7xK. 3. Bxf7+mat). Jawaban TTS: TTS


Jawaban Sudoku: 8 4 2 7 6 1 9 3 5

3 1 6 5 8 9 2 4 7

7 9 5 4 3 2 8 6 1

9 2 8 6 1 7 4 5 3

4 5 7 3 2 8 6 1 9

1 6 3 9 4 5 7 2 8

5 8 4 2 9 3 1 7 6

6 3 9 1 7 4 5 8 2

2 7 1 8 5 6 3 9 4

2 September ....

dipersiapkan secara khusus untuk menerima kedatangan Calhaj dari berbagai daerah yang dimulai pada 9 September mendatang. “90 persen fasilitas dan keperluan Calhaj di Asrama Haji sudah rampung,” ujarnya sembari menyebutkan saat ini ada b e b e ra p a r u a n g a n y a n g diperbaiki agar lebih nyaman saat Calhaj tiba dan menginap selama satu malam sebelum berangkat ke tanah suci. Menurut Rahim, sarana prasarana pendukung yang tersedia dan telah siap untuk melayani Calhaj di Asrama Haji berupa, pemondokan jamaah, pemondokan petugas, aula penerimaan jamaah, aula pembinaan jamaah, aula

pemberangkatan jamaah, ruang makan jamaah dan dapur umum. Na m u n , k a t a Ra h i m , masih ada ruang tidur Calhaj yang belum menggunakan AC atau masih menggunakan kipas angin karena belum ada pendanaan untuk itu. “ Ada 500 tempat tidur untuk Calhaj dan baru 75 persen ruangan yang menggunakan AC,’’ katanya. Tahun depan, ujar Rahim, jika rencana renovasi dan pembangunan Asrama Haji dilaksanakan, berbagai fasilitas yang lebih menyamankan Calhaj akan tersedia. Sebab, dana untuk renovasi dan pembangunan yang akan dikucurkan pemerintah mencapai Rp 75 miliar,” ujarnya. (m37)

Stout, juga telah memasuki Mediterania melalui Selat Gibraltar. Namun USS Stout tidak akan ikut serta dalam penyerangan. Tiap kapal perang ini membawa hingga 90 rudal jelajah Tomahawk. Kapal selam AS juga bisa meluncurkan rudal jelajah ini. Tahun 2011, armada ini menembakkan 212 Tomahawk ke Libya untuk menggulingkan Moammad Khadafi. Sementara Inggris kemungkinan akan meluncurkan rudal jelajah mereka dari kapal selam Trafalgar. Kapal perang HMS Tireless juga dilaporkan terpantau di Gibraltar pekan ini. Kapal angkatan laut kerajaan gugus tugas reaksi cepat Inggris yang terdiri dari HMS Illustrious, fregat HMS Montrose dan HMS Westminster telah lebih dulu ada di kawasan untuk tugas rutin. Selain itu, Inggris bisa juga menggunakan kekuatan udara mereka dari pangkalan Cyprus. Ka p a l i n d u k Pra n c i s Charles de Gaulle saat ini sedang bertugas di wilayah barat Mediterania, siap merapat ke Suriah jika dibutuhkan. Prancis juga bisa menggunakan jet tempur Raffale dan Mirage mereka di pangkalan udara Al-Dhahra, Uni Emirat Arab, untuk melancarkan serangan. Utusan PBB: Ada bukti Utusan PBB ke Syria Lakhdar Brahimi mengatakan bukti memperkuat bahwa beberapa jenis ‘bahan’ kimia

telah digunakan dalam satu serangan yang menewaskan ratusan orang, namun katanya, suatu serangan militer ke Syria harus punya persetujuan dari Dewan Keamanan PBB. Brahimi berbicara kepada para wartawan Rabu (28/8) di Jenewa ketika satu tim pemeriksa PBB menyelidiki dugaan penggunaan gas beracun oleh Syria dalam serangan dekat Damaskus pada 21 Agustus dan momentum itu digunakan oleh Barat untuk melakukan aksi militer terhadap Presiden Syria Bashar Assad. Sekjen PBB Ban Ki-moon memohon Rabu agar dilakukan suatu penyelesaian diplomatik terhadap konflik Syria, meski kekuatan dunia tampaknya telah mengerahkan kekuatan untuk melaksanakan hukuman militer terhadap rezim Assad karena apa yang disebut AS dan sekutunya bahwa rezim itu menggunakan senjata kimia. Ban mengatakan Rabu satu tim penyelidik PBB sedang melakukan penyelidikannya tentang dugaan penggunaan senjata kimia dan tim itu harus memberikan fakta yang benar-benar kuat. Para penyelidik meninggalkan hotel mereka Rabu dan dua aktivis anti-rezim Damaskus mengatakan tim tersebut diharapkan akan berkunjung ke satu kawasan pinggiran timur ibukota yang terkena serangan 21 Agustus lalu yang menurut Dokter Tanpa Batas sebanyak 355 orang tewas di sana. (vn/m10)

Al Bayan ....

akhirat dengan tidak lupa membagikan kebahagian yang ada pada kita kepada sesama. Dunia hanyalah tempat sementara, dan akhirat merupakan kehidupan sesungguhnya. Namun bukan berarti kesadaran ini menafikan kesenangan dunia. Kehidupan di dunia harus dijadikan tempat menanam kebaikan agar hasilnya di akhirat nanti kebaikan juga yang diperoleh. Kehidupan dunia ini merupakan ladang untuk kampung atau kota akhirat. Jadi kehidupan akhirat tergantung pada amal kebajikan apa yang kita tanam di dunia ini. Pesan umar kepada Jabir di atas karena Umar mencontoh Sunnah Rasulullah SAW. Umar bercerita, “Saya menemui Rasulullah SAW yang kala itu sedang berbaring di atas sehelai tikar. Lalu aku duduk dan mendekati Sang Nabi SAW. Tiba-tiba, saya melihat anyaman tikar membekas di punggung Sang Rasul SAW. Maka melelehlah air mata saya.” Melihat Umar menangis, Rasulullah SAW bertanya, “Mengapa kamu me-

membagikannya kepada orang lain, sesungguhnya ia telah menyisakan untuk hari Akhirat. Jika rujuk secara utuh ayat yang dibacakan Umar kepada Jabir, yakni ayat ke-20 dari surah Al-Ahqaf (46), “Dan (ingatlah) hari (ketika) orangorang kafir dihadapkan ke neraka (kepada mereka dikatakan): “Kamu telah menghabiskan rezekimu yang baik dalam kehidupan duniawimu (saja) dan kamu telah bersenangsenang dengannya; maka pada hari ini kamu dibalasi dengan azab yang menghinakan karena kamu telah menyombongkan diri di muka bumi tanpa hak dan karena kamu telah fasik.” Jelaslah Umar tidak menghendaki Jabir mengikuti langkah orang kafir yang menghabiskan semua kesenangan di dunia ini. Walaupun teks ayat tersebut berbicara tentang orang kafir, namun Umar mengingatkan Jabir juga kita untuk menyadari hidup di dunia hanya sementara dan harus mempersiapkan juga kehidupan

Harga Emas Meroket

WASPADA Kamis 29 Agustus 2013


BANDARLAMPUNG (Antara): Gempa berkekuatan 5,5 skala Richter menguncang Sumatera Barat yang juga terasa sampai Jambi, Rabu (28/8) pukul 12.43. Badan Meteorologi, Klimatologi, dan Geofisika menyatakan gempa terjadi pada 74 km barat laut Sungai Penuh Jambi, tidak berpotensi tsunami.

BMKG melalui Kepala Stasiun Geofisika Kotabumi Lampung Yuharman merincikan gempa itu berada pada Lintang 2.03 derajat Lintang Selatan (LS) dan Bujur 100.66 derajat Bujur Timur (BT ), dengan kedalaman 24 km. Kepala Pusat Data Informasi dan Humas Badan Nasional Penanggulangan Bencana

Sutopo Purwo Nugroho melalui pesan singkat yang diterima di Jakarta, Rabu, mengatakan gempa dirasakan sangat keras di pesisir selatan yang menghentak dan disertai suara menderu selama 30 detik. Pusat gempa berada di Kecamatan Air Haji, Kabupaten Pesisir Selatan, Sumbar.

JK Tak Ikut ....

Komando Pasukan Khusus (Kopassus) TNI AD, yang terkenal dalam pembersihan Partai Komunis Indonesia (PKI) pasca-peristiwa Gerakan 30 September 1965. “Karakter yang dimiliki Pak Sarwo dimiliki Pak Pramono,” ujarnya. Ia juga menyatakan, Pramono, yang anggota Dewan Pembina Partai Demokrat, memiliki kecerdasan dan wawasan kebangsaan yang jauh ke depan. Pengalaman militer yang panjang, menurut dia, menjadikan Pramono sosok yang tidak jauh dari masyarakat dan mampu memimpin negara ini. “Beliau paham benar kondisi masyarakat, dan apa yang diinginkan. Beliau punya konsep, tumbuh dalam lingkungan keluarga yang baik, memiliki pengetahuan yang cukup dalam mengelola negara,” kata Suaedy Marasabessy. Tak Diistimewakan Mantan Kepala Staf TNI Angkatan Darat (Kasad) Jen-

deral (Purn) Pramono Edhie Wibowo merasa tak diistimewakan dalam keikutsertaannya untuk konvensi calon presiden Partai Demokrat, meski dirinya adik kandung Ibu Negara Ani Yudhoyono. “Ini tadi ditanyakan dalam dialog dengan komite. Tidak ada yang menekan perasaan saya. Justru saya mengatakan hubungan dengan presiden itu adik ipar, sejak kakak saya menikah dengan Yudhoyono. Kebetulan sekarang jadi presiden,” jelas Pramono, usai menemui komite konvensi di Wisma Kodel, Kuningan, Jakarta, Rabu (28/8). Ia mengaku, dirinya tidak mendapatkan perlakuan khusus, meski dirinya adik ipar Presiden Susilo Bambang Yudhoyono (SBY). “Semua peserta diperlakukan sama. Dengan ikut konvensi, semua menjadi berpeluang. Tidak asal menunjuk, tetapi dipilih rakyat. Saya diberi ruang berkompetisi, tidak ada di istimewakan,” ujar anggota Dewan Pembina Partai Demokrat itu. Pramono mengemukakan, hingga hari ini belum membentuk tim sukses (timses) untuk kemenangan dirinya di konvensi.

dan Yogyakarta, dengan melibatkan ratusan mobil modifikasi dan dihadiri penggemar modifikasi dari berbagai kota. Sempat absennya Djarum Black Autoblackthrough sepanjang tahun 2012, diyakini Djarum Black sebagai alasan kuat demi semakin terpuaskannya para peserta dan pengunjung. Sebab, kembalinya Djarum Black Autoblackthrough tahun ini telah mengalami berbagai penyempurnaan dalam regulasi, hingga melibatkan juri dari mancanegara. Pihak Djarum Black memboyong peralatan-peralatan mutakhir untuk kompetisi performa mesin Dyno Attraction memakai Mainline DynoLog dari Australia dan kompetisi audio Black Out Loud berstandar penjurian EASCA (European Auto Sound Association). Dapat dikatakan bahwa Djarum Black Autoblackthrough menjadi gelaran modifikasi paling bergengsi dan terlengkap di Indonesia. Kota Medan yang mulai dilirik Djarum Black sejak tahun 2005, selalu menjadi tempat paling potensial bagi gelaran Djarum Black Autoblackthrough. “Autoblackthrough merupakan kelanjutan komitmen Djarum Black dalam mendukung semangat kreativitas dan inovasi generasi muda pecinta mobil modifikasi di Indonesia, dan tahun ini merupakan kali ke-9 penyelenggaraan sejak tahun 2004,” ujar Raymond Portier, Brand Manager Djarum Black. Salah satu juri mancanegara untuk seri Medan Djarum Black Autoblackthrough sebagai “The Hottest Hi Tech Modified Motorshow” di Indonesia, mengharapkan para peserta tidak sekedar memajang kendaraannya. Hal lain yang juga menjadi perhatian adalah kebersihan hingga kerapian serta menonjolkan keistimewaan mobil modifikasinya. “Para peserta wajib menampilkan kendaraan dengan sebaikbaiknya. Penampilan mobil haruslah selalu bersih, siap untuk dipertontonkan dan tidak ada kabel berantakan di berbagai sisi yang bisa mengganggu estetika keseluruhan,” jelas Daniel Wee dari Graffiti Garage, salah satu juri mancanegara Djarum Black Autoblackthrough 2013. Selain itu Djarum Black Autoblackthrough semakin diakui oleh kalangan modifikasi yang mengikuti ajang bergengsi ini. Para pelaku bisnis modifikasi mengamini bahwa hadirnya gelaran ini memberikan dampak yang positif terutama dalam penjualan komponen. Potensi Djarum Black Autoblackthrough dengan regulasi yang baru mampu melambungkan nama rumah modifikasi asal Bandung, Signal Kustom Built. Sebab gelar paling bergengsi di tiap seri “The King Autoblackthrough” berhasil diraihnya dengan memajang “Honda Jazz Future” di Surabaya, dan Toyota Yaris “Yellow Dino” di Yogyakarta. Bahkan Andre Mulyadi selaku pemilik Signal Kustom Built tengah mempersiapkan mobil modifikasi untuk mengikuti Djarum Black Autoblackthrough di Medan. “Djarum Black Autoblackthrough ini memang kompetisi modifikasi mobil paling ekstrem yang pesertanya benar-benar serius menggarapnya,” ujar Ganny Chan salah satu anggota OPTION Surabaya yang Honda Accord racikan Auto Maxx menjadi salah satu King Nominee Djarum Black Autoblackthrough Surabaya. Rudi Purnomo dari Kupu Kupu Malam, yang sudah berkecimpung di dunia modifikasi sejak sebelas tahun lalu, mengagumi gelaran Djarum Black Autoblackthrough dan tak pernah absen dalam setiap acara final Djarum Black Autoblackthrough. “Autoblackthrough memang sangat berbeda dari gelaran yang lain. Karena semuanya dikemas sangat menarik bagi peserta dan pengunjung,” pungkas Rudi. “Setiap gelaran Djarum Black Autoblackthrough melibatkan penggemar modifikasi yang memang selalu update dalam dunia otomotif. Hal ini tentu saja berpengaruh terhadap industri otomotif, terutama pada industri aftermarket,” tutup Raymond. Meramaikan gelaran Djarum Black Autoblackthrough Medan sepanjang dua hari, para pengunjung dan peserta akan kembali dimanjakan oleh hiburan musik dari band dan penampilan beberapa DJ terkenal. Djarum Black secara spesial menghadirkan band terkenal seperti NAIF, Spinach Candies (Tiara Eve, Patricia Schuldtz, Gisa Geez, Princess Joana), dan The Angel’s Project, serta Girlkana Daydow dan Chantal Dewi 1945MF.

Ada-ada Saja ....

ton film pada pukul 19.00, saya sudah bangun pada pukul 08.15 untuk melakukan persiapan,” kata seperti dilansir, Rabu (28/8). Pria berumur 57 tahun ini menghabiskan banyak waktu bertanya-tanya tentang penyakitnya. Bahkan keluarganya juga mengira dia hanya membuat alasan. Namun diagnosis dari dokter telah meyakinkan dia bahwa penyakitnya ini disebut ‘chronic lateness’ atau keterlambatan kronis. Tapi tetap saja, ketika membikin janji dengan dokter

untuk mendiagnosis penyakitnya, Jim terlambat 20 menit dari kesepakatan semula. Pada kenyataannya, depresi diduga menjadi akar masalah dari penyakit ini. Banyak penderita ADHD mengalami gejala depresi akibat gangguannya. Sebuah penelitian dari San Francisco State University di tahun 1997 menemukan bahwa 17 persen dari populasi mengalami kelainan ini. Pengidap chronic lateness cenderung mengidap ADHD. Gejalanya berupa sering sering menunda, kurangnya kontrol diri, dan kecenderungan mencari sensasi.

“Orang yang mengalami penyakit keterlambatan kronis sering bergulat dengan kecemasan atau ambivalensi kondisi internal psikologisnya” kata psikolog, Dr Pauline Wallin Shine. Yang lebih mengkhawatirkan, penderitanya cenderung gemar berjudi, makan berlebihan, berbelanja secara impulsif, dan sering minum alkohol. Meskipun demikian, ada beberapa ahli yang masih bersikukuh masalah ini berkaitan dengan ketidakmampuan mengelola waktu. (odtc/rzl)

Warga Serempah ....

dari tenda pengungsian Kute Gelime, dan bermukim di Kute Alam. Kawasan ini diharapkan menjadi perkampungan baru bagi korban musibah gempa ini. Namun hanya dua hari warga di Kute Alam berada di lokasi baru ini, tiupan angin kencang membuat warga yang masih trauma gempa ini, semakin ketakutan. Rumah darurat yang dibangun untuk hunian sementara, berterbangan disapu angin. Menjadi Pertimbangan Bupati Aceh Tengah, Nasaruddin ketika diminta Waspada komentarnya, menjelaskan, permintaan masya-

rakat Insya Allah akan dipenuhi. “ Kita sayang dengan rakyat, apalagi kini mereka jadi korban gempa,” sebut Nas singkat. Sementara itu wakil Bupati Aceh Tengah, Khairul Asmara, menanggapi permintaan warga Serempah, sempat terkejut dengan kejadian itu. “ Aduh, perlu kajian lagi persoalan ini. Sebelum dipindahkan ke lokasi baru, warga setempat yang tertimpa musibah ini yang meminta lokasi perkampungan mereka di sana. Namun walau demikian, karena itu saudara kita, rakyat kita perlu diperhatikan,” sebut Erol panggilan akrab wakil bupati. (b32)

MEDAN (Waspada): Harga emas dunia terus meroket , berada di level 1.420 Dolar AS per troy ons pada perdagangan Rabu (28/8). Kenaikan harga emas dunia tersebut, membuat harga emas dalam negeri mengalami kenaikan cukup signifikan sebesar Rp530.000 per gram. Sementara Rupiah masih di dalam tekanan berada di kisaran Rp11.500-an per satu Dolar AS. “Harga emas masih terus naik, sekarang Rp530.000 per gram. Sedangkan harga emas dunia sudah melewati batas psikologis dengan menembus level 1.420 Dolar AS per troy ons,” kata Pemilik Toko Mas

Sinar Agung di Pusat Pasar Medan Kornalius Tarigan kepada Waspada, Rabu (28/8). Sehari sebelumnya harga emas dunia berada di level 1.407 Dolar AS per troy ons, sedangkan emas dalam negeri Rp510.000 per gram. Menurutnya, dengan kenaikan harga emas tersebut, banyak para spekulan mulai bermain melakukan take profit (mengambil keuntungan) dengan menjual emasnya. “Secara technical, harga emas saat ini berada di titik puncak. Bila tidak ada faktor fundamentalis yang mempengaruhinya, maka harga emas ini akan sedikit meng-

alami koreksi, sehingga banyak para pemain mulai menjual emasnya untuk mendapatkan keuntungan,” ujarnya. Analis Ekonomi di salah satu sekur itas BUMN di Medan Gunawan Benjamin menyebutkan, kisruh geopolitik di Timur Tengah hingga ekspektasi melunaknya sikap The FED (Bank Sentral AS), membakar harga minyak dunia yang terus naik di kisaran 110 Dolar AS/Barel (data jam 2.30 siang). Meroketnya harga minyak tersebut menghembuskan wacana kemungkinan inflasi dunia akan kembali naik seiring dengan membaiknya prospek ekonomi AS. (m41)

Sumbar Dan Jambi Gempa 5,5 SR

Pada Selasa (27/8) malam, Komite Konvensi mengunjungi Jusuf Kalla di kediamannya di Jalan Brawijaya, Kebayoran Baru, Jakarta Selatan, untuk menanyakan kesediaan JK menjadi peserta konvensi capres yang diselenggarakan Partai Demokrat. “Undangan belum sempat diberikan. Pembicaraan tatap muka dengan JK secara nonformal antara Ketua Komite, Maftuh Basyuni, dan Wakil Ketua Komite, Taufiequrachman Ruki,” kata Suaedy. Ia mengemukakan, mantan Kepala Staf Angkatan Darat (Kasad) Jenderal (Purn) Pramono Edhie Wibowo layak menjadi salah satu calon presiden (capres) 2014 karena kapasitas dan kapabilitasnya. “Buah jatuh tidak jauh dari pohonnya. Pramono duplikat Sarwo Edie Wibowo,” katanya. Suaedy menilai, Pramono memiliki ketegasan, seperti ayahnya, Sarwo Edhie (almarhum), mantan komandan Re s i m e n Para Ko m a n d o Angkatan Darat (RPKAD), kini nangis, wahai putra Khaththab? “Lalu saya menjawabnya, “Wahai Nabi Allah, bagaimana saya tidak menangis, sementara tikar ini telah menimbulkan bekas di punggungmu. Engkau adalah Rasul Allah dan kekasih pilihan-Nya. Kekayaanmu hanya yang saya lihat sekarang ini. Padahal, di tempat sana, kisra dan kaisar duduk di atas katil emas berbantalkan sutra.” Sang Rasul SAW bersabda, “Mereka telah menyegerakan kesenangannya sekarang; kesenangan yang akan cepat berakhir. Kita adalah kaum yang menangguhkan kesenangan kita untuk hari Akhir kita. Perumpamaan hubunganku dengan dunia adalah seperti orang yang bepergian pada musim panas. Ia berlindung sejenak di bawah pohon kemudian berangkat meninggalkannya.” Hadis ini berasal dari Abdullah bin Abbas yang diriwayatkan oleh Imam Ahmad. Akhirnya, semoga kesadaran kita bahwa kehidupan dan kesenangan di dunia ini hanya sementara terus membekas di hati dan diri.

dokter, ternyata pria bernama Jim Dunbar ini didiagnosis dengan penyakit keterlambatan akut alias jam karet yang tak tersembuhkan. Tiap kali membuat janji ber temu dengan seseorang, pria yang kini berumur 57 tahun itu akan selalu datang terlambat. Bukannya malas atau menyepelekan, sebab sebenarnya dia sudah bersiap-siap sampai 11 jam sebelumnya. Gangguan yang dialami pria asli Skotlandia ini lebih disebabkan karena gangguan kejiwaan ketimbang masalah manajemen waktu. Para ilmuwan percaya ada gangguan pada fungsi otaknya terkait pengaturan waktu yang juga mempengaruhi gangguan Attention Deficit Hyperactivity Disorder (ADHD). Jim sendiri telah mengalami gangguan ini sejak berumur 5 tahun. Dia selalu terlambat masuk ke sekolah, juga selalu terlambat datang berkencan. Dia tahu bahwa gangguannya ini tak hanya merugikan bagi dirinya sendiri, tapi juga membuat orang lain tidak nyaman. “Saya sering kecewa karenanya dan sungguh mengganggu orang lain jika saya datang terlambat. Pada hari di mana saya berencana menon-

menyaksikan dari dekat bagaimana keadaan alam di sana. Letak kampung Kute Alam ini, memang strategis di atas bukit. Hamparannya luas. Namun tidak ada tanaman pelindung di sana, angin terasa sangat kencang, dingin menusuk tulang. Jaraknya sekitar 4 kilometer dari Kampung Serempah, kampung asal mereka yang kini telah berubah menjadi kawah dihantam gempa. Perumahan di sana, dilarikan ke dalam lembah bersama tanah. Menjelang lebaran 1434 H,, Pemda Aceh Tengah memindahkan warga Serempah

Berita Utama

A2 Djarum Black ... Kota Medan yang mulai dilirik Djarum Black sejak tahun 2005, selalu menjadi tempat paling potensial bagi gelaran Djarum Black Autoblackthrough. “Autoblackthrough merupakan kelanjutan komitmen Djarum Black dalam mendukung semangat kreativitas dan inovasi generasi muda pecinta mobil modifikasi di Indonesia, dan tahun ini merupakan kali ke-9 penyelenggaraan sejak tahun 2004,” ujar Raymond Portier, Brand Manager Djarum Black. Salah satu juri mancanegara untuk seri Medan Djarum Black Autoblackthrough sebagai “The Hottest Hi Tech Modified Motorshow” di Indonesia, mengharapkan para peserta tidak sekedar memajang kendaraannya. Hal lain yang juga menjadi perhatian adalah kebersihan hingga kerapian serta menonjolkan keistimewaan mobil modifikasinya. “Para peserta wajib menampilkan kendaraan dengan sebaikbaiknya. Penampilan mobil haruslah selalu bersih, siap untuk dipertontonkan dan tidak ada kabel berantakan di berbagai sisi yang bisa mengganggu estetika keseluruhan,” jelas Daniel Wee dari Graffiti Garage, salah satu juri mancanegara Djarum Black Autoblackthrough 2013. Selain itu Djarum Black Autoblackthrough semakin diakui oleh kalangan modifikasi yang mengikuti ajang bergengsi ini. Para pelaku bisnis modifikasi mengamini bahwa hadirnya gelaran ini memberikan dampak yang positif terutama dalam penjualan komponen. Potensi Djarum Black Autoblackthrough dengan regulasi yang baru mampu melambungkan nama rumah modifikasi asal Bandung, Signal Kustom Built. Sebab gelar paling bergengsi di tiap seri “The King Autoblackthrough” berhasil diraihnya dengan memajang “Honda Jazz Future” di Surabaya, dan Toyota Yaris “Yellow Dino” di Yogyakarta. Bahkan Andre Mulyadi selaku pemilik Signal Kustom Built tengah mempersiapkan mobil modifikasi untuk mengikuti Djarum Black Autoblackthrough di Medan. “Djarum Black Autoblackthrough ini memang kompetisi modifikasi mobil paling ekstrem yang pesertanya benar-benar serius menggarapnya,” ujar Ganny Chan salah satu anggota OPTION Surabaya yang Honda Accord racikan Auto Maxx menjadi salah satu King Nominee Djarum Black Autoblackthrough Surabaya. Rudi Purnomo dari Kupu Kupu Malam, yang sudah berkecimpung di dunia modifikasi sejak sebelas tahun lalu, mengagumi gelaran Djarum Black Autoblackthrough dan tak pernah absen dalam setiap acara final Djarum Black Autoblackthrough. “Autoblackthrough memang sangat berbeda dari gelaran yang lain. Karena semuanya dikemas sangat menarik bagi peserta dan pengunjung,” pungkas Rudi. “Setiap gelaran Djarum Black Autoblackthrough melibatkan penggemar modifikasi yang memang selalu update dalam dunia otomotif. Hal ini tentu saja berpengaruh terhadap industri otomotif, terutama pada industri aftermarket,” tutup Raymond. Meramaikan gelaran Djarum Black Autoblackthrough Medan sepanjang dua hari, para pengunjung dan peserta akan kembali dimanjakan oleh hiburan musik dari band dan penampilan beberapa DJ terkenal. Djarum Black secara spesial menghadirkan band terkenal seperti NAIF, Spinach Candies (Tiara Eve, Patricia Schuldtz, Gisa Geez, Princess Joana), dan The Angel’s Project, serta Girlkana Daydow dan Chantal Dewi 1945MF. # # #

Rusia Anggap Barat ... “Kami menyerukan mitra Amerika dan seluruh anggota komunitas internasional untuk menun-jukkan kehati-hatian dan menerapkan hukum internasional, terutama prinsip-prinsip dasar dari piagam PBB,” lanjutnya lagi. Akibat isu Syria, hubungan AS dan Rusia ikut renggang. AS memutuskan untuk membatalkan pertemuan Senin lalu dengan Rusia di Denhaag, Belanda, untuk membicarakan soal keterlibatan militer Barat di Syria. Rusia berkeyakinan bahwa serangan kimia pekan lalu yang menewaskan 1.700 orang dilakukan oleh pejuang Syria. Sementara Barat dan negara-negara Teluk haqul yakin rezim Bashar Assad yang melakukannya, berdasarkan penelitian dan kesaksian di Ghouta. AS, Prancis dan Inggris sedemikian jauh telah mengindikasikan rencana mereka menyerang Syria dalam waktu dekat ini. AS bahkan telah menyiagakan empat kapal perang mereka di laut Mediterania, siap luncurkan roket. Menurut analisa kantor berita NBC, tiga negara inikemungkinanhanyaakanmenggunakanserangandarilaut.Berbeda dengan penyerangan udara NATO ke Libya, Syria memiliki kemampuan jet tempur yang cukup bisa menandingi kekuatan udara Barat. Syria memiliki lebih dari 600 armada tempur, kebanyakan dari kelas MiG buatan Rusia. Jika nekat menyerang Syria dari udara, AS diprediksi akan menggunakan pesawat nirawak seperti pesawat siluman pengebom B2 yang akan diterbangkan dari pangkalan udara Whiteman di Missouri. Pesawat ini terkenal ampuh menghindari radar lawan. Empat kapal itu adalah USS Barry, USS Mahan, USS Ramage dan USS Gravely, yang lempar jangkar di sebelah timur Mediterania. Kapal destroyer AS lainnya, USS Stout, juga telah memasuki Mediterania melalui Selat Gibraltar. Namun USS Stout tidak akan ikut serta dalam penyerangan. Tiap kapal perang ini membawa hingga 90 rudal jelajah Tomahawk. Kapal selam AS juga bisa meluncurkan rudal jelajah ini. Tahun 2011, armada ini menembakkan 212 Tomahawk ke Libya untuk menggulingkan Moammad Khadafi. Sementara Inggris kemungkinan akan meluncurkan rudal jelajah mereka dari kapal selam Trafalgar. Kapal perang HMS Tireless juga dilaporkan terpantau di Gibraltar pekan ini. Kapal angkatan laut kerajaan gugus tugas reaksi cepat Inggris yang terdiri dari HMS Illustrious, fregat HMS Montrose dan HMSWestminster telah lebih Jawaban Problem Catur, dulu ada di kawasan untuk tugas rutin. Selain itu, Inggris bisa juga TTS Dan Sudoku menggunakan kekuatan udara Dari Halaman Sport. mereka dari pangkalan Cyprus. Kapal induk Prancis Charles de Gaulle saat ini sedang bertugas Jawaban Problem Catur: di wilayah barat Mediterania, siap merapat ke Syria jika dibutuhkan. 1. c8(M)+, Gd8. Prancis juga bisa menggunakan jet tempur Raffale dan Mirage 2. BxG+, Be8. mereka di pangkalan udara AlDhahra, Uni Emirat Arab, untuk 3. BxB+, Rh7. melancarkan serangan. (vn/m10)

4. Bh8+mat. (Jika 1. ...., Rh7.

2. KxG+, g7xK. 3. Bxf7+mat). Jawaban TTS: TTS


Jawaban Sudoku: 8 4 2 7 6 1 9 3 5

3 1 6 5 8 9 2 4 7

7 9 5 4 3 2 8 6 1

9 2 8 6 1 7 4 5 3

4 5 7 3 2 8 6 1 9

1 6 3 9 4 5 7 2 8

5 8 4 2 9 3 1 7 6

6 3 9 1 7 4 5 8 2

2 7 1 8 5 6 3 9 4

2 September Simulasi Perjalanan Calhaj MEDAN (Waspada) : Simulasi perjalanan jamaah calon haji (Calhaj) Embarkasi Medan dari Asrama Haji Pangkalan Mahsyur Medan menuju Kualanamu International Airport (KNIA), untuk bertolak ke tanah suci akan digelar 2 September 2013. Demikian disampaikan Ketua Panitia Penyelenggara Ibadah Haji (PPIH) Embarkasi Medan Drs Abd Rahim M.Hum, Rabu (28/8). Kepada wartawan, Abd

Rahim menyebutkan, simulasi ini penting, mengingat situasi perjalanan ke KNIA dengan jarak tempuh satu jam lebih. Selain itu, kondisi jalan yang belum sempurna karena masih ada berbagai perbaikan dan lebih sering antrean di sepanjang jalan menuju bandara. “ Simulasi nantinya melibatkan petugas PPIH, media, keamanan yang mendukung perjalanan ibadah haji. Hal ini sangat perlu dilakukan guna mengetahui bagaimana sistem

yang tepat dalam rangka memperlancar perjalanan Calhaj dari Asrama Haji menuju bandara, agar jadwal penerbangan yang sudah ditetapkan tidak mengalami penundaan,”kata Abd Rahim. Hal lain yang dia sampaikan, saat ini Asrama Haji sudah dipersiapkan secara khusus untuk menerima kedatangan Calhaj dari berbagai daerah yang dimulai pada 9 September mendatang. “90 persen fasilitas dan keperluan Calhaj di

Rombongan Haji Mulai Memasuki Arab Saudi JEDDAH, Arab Saudi (Waspada): Beberapa hari terakhir rombongan haji telah mulai memasuki Arab Saudi dan pihak berwenang negeri itu telah memerintahkan semua jamaah Umrah yang masih berada di

Makkah dan Madinah agar keluar, mereka tidak akan diberi perpanjangan visa. “Perhatikan bahwa selama tiga hari terakhir kita mulai melihat kelompok orang yang datang untuk melakukan Haji. Jumlah

Ikut Konvensi Capres Demokrat

Pramono Edhie Merasa Tak Diistimewakan JAKARTA (Antara): Mantan Kepala Staf TNI Angkatan Darat (KSAD) Jenderal (Purn) Pramono Edhie Wibowo merasa tak diistimewakan dalam keikutsertaannya untuk konvensi calon presiden Partai Demokrat, meski dirinya adik kandung ibu negara Ani Yudhoyono. “Ini tadi ditanyakan dalam dialog dengan komite. Tidak ada yang menekan perasaan saya. Justru saya mengatakan hubungan dengan presiden itu adik ipar, sejak kakak saya menikah dengan Yudhoyono. Kebetulan sekarang jadi presiden,”

jelas Pramono usai menemui komite konvensi di Wisma Kodel, Kuningan, Jakarta, Rabu (28/8). Ia mengaku, dirinya tidak mendapatkan perlakuan khusus, meski dirinya adik ipar Presiden Susilo Bambang Yudhoyono (SBY).”Semua peserta diperlakukan sama. Dengan ikut konvensi, semua menjadi berpeluang. Tidak asal menunjuk, tetapi dipilih rakyat. Saya diberi ruang berkompetisi, tidak ada di istimewakan,” ujar anggota Dewan Pembina Partai Demokrat itu.

Penderita Hydrocephalus ...

sekira Rp 600 juta. Separuh dari total uang yang terkumpul akhirnya dikirim ke badan amal Rumah Sakit Fortis di New Delhi untuk biaya perawatan Roona. Pihak rumah sakit kemudian membantu sisa biaya operasi. Krantz dan Borchgrevink rencananya akan mengirim sisa uang amal yang terkumpul untuk biaya perawatan lanjutan bagi Roona. Ketua bedah syaraf rumah sakit syaraf Vaishya, yang telah merawat ratusan anak penderita Hydrocephalus sama sekali tidak tahu bagaimana cara mengobatinya. Vaishya awalnya tidak yakin operasi akan berjalan mulus. Roona mengalami kekurangan gizi. Bayi ini terkena infeksi parah di belakang kepalanya karena sering berbaring, dan kulitnya sangat tipis dan rentan. Sang dokter juga dihadapkan dengan resiko kematian yang besar, dan hampir kehilangan Roona saat operasi berlangsung. Namun akhirnya operasi itu berhasil dengan baik. Setelah menjalani lima kali operasi, lingkar kepala Roona kini menciut menjadi 58 senti-

normal. Ada kelebihan cairan sepuluh liter di dalam otaknya. Kepalanya sangat berat dan membuatnya hampir tak bisa bergerak. “Roona punya kepala yang besar, hingga membuat orang takut untuk melihatnya,” jelas sang ibu Fatima Begum. Kemiskinan membuat orangtua Roona tak mampu memberi pengobatan yang layak bagi anak tunggal mereka. Bulan April lalu, seorang wartawan mengambil foto Roona dan tak lama setelah itu banyak orang di seluruh dunia termasuk dua pelajar asal Norwegia bernama Natalie Krantz dan Jonas Borchgrevink tersentuh oleh Roona. Krantz dan Borchgrevink memposting foto Roona di situs website amal dan berharap dapat mengumpulkan AS$ 1,600 atau sekira Rp 16 juta untuk biaya operasi Roona. Dalam dua bulan, mereka berhasil mengumpulkan uang dua kali lipat biaya yang diperlukan untuk operasi. Dan, Agustus 2013, mereka mengumpulkan lebih dari AS$ 60.000 atau

Ada-ada Saja ... akut alias jam karet yang tak tersembuhkan. Tiap kali membuat janji bertemu dengan seseorang, pria yang kini berumur 57 tahun itu akan selalu datang terlambat. Bukannya malas atau menyepelekan, sebab sebenarnya dia sudah bersiapsiap sampai 11 jam sebelumnya. Gangguan yang dialami pria asli Skotlandia ini lebih disebabkan karena gangguan kejiwaan. Para ilmuwan percaya ada gangguan pada fungsi otaknya terkait pengaturan waktu yang juga mempengaruhi gangguan Attention Deficit Hyperactivity Disorder (ADHD). Jim sendiri telah mengalami gangguan ini sejak berumur 5 tahun. Dia selalu terlambat masuk ke sekolah, juga selalu terlambat datang berkencan.

Dia tahu bahwa gangguannya ini tak hanya merugikan bagi dirinya, tapi juga membuat orang lain tidak nyaman. “Saya sering kecewa karenanya dan sungguh mengganggu orang lain jika saya datang terlambat. Pada hari di mana saya berencana menonton film pada pukul 19.00, saya sudah bangun pada pukul 08.15 untuk melakukan persiapan,” kata Jim seperti dilansir, Rabu (28/8). Pria berumur 57 tahun ini menghabiskan banyak waktu bertanya-tanya tentang penyakitnya. Bahkan keluarganya juga mengira dia hanya membuat alasan. Namun diagnosis dari dokter telah meyakinkan dia bahwa penyakitnya ini disebut ‘chronic lateness’ atau keterlambatan kronis. (odtc/net/rzl)

orang-orang yang tiba sejauh ini baru 300, yang kebanyakan berasal dari India. Mayoritas dari mereka adalah orang tua pensiunan,” kata Menteri Urusan Haji Arab Saudi Banjar Hajjar. Sebelumnya, Deputi Menteri Urusan Haji Hatim Qadi mengatakan, pihaknya menolak permintaan lebih dari 200 perusahaan penyelenggara Umrah untuk memperpanjang visa bagi sejumlah orang yang kini berada di Makkah dan Madinah untuk melaksanakan haji. Dalam satu wawancara dengan Arab News, yang diterbitkan Rabu (28/8) Qadi mengatakan,“berbagaiinstruksidanaturan dari kementerian sudah jelas dan dalamhalini:TidakadavisaUmrah yangdapatdiperpanjangdanmereka tidak bisa tinggal untuk melakukanhaji.Siapapunyangtinggal sampai akhir musim Haji akan melanggar peraturan dan akan dikenakan sanksi. Izin operasional perusahaan yang bertanggung jawab untuk itu akan dicabut selama setahun.” (an/m10) meter tapi masih lebih besar dari ukuran normal yaitu 38 48 sentimeter. Meski begitu, kondisinya yang sekarang bisa mempermudah bayi ini menjalani kehidupan normal. Pasca operasi kondisinya membaik dan kini ia tampak lebih ceria dan bisa menjalani hidup seperti bayi kebanyakan. “Kami ingin Roona bisa membaca dan menulis jika ia sudah besar. Saya dan suami buta huruf, jadi kami tidak ingin Roona menjadi seperti kami. kami ingin ia memiliki masa depan yang cerah,” kata sang ibu, Fatima. (rzl)

Rupiah Melemah ... Pertama adalah kebijakan pengetatan stimulus moneter oleh Bank Sentral Amerika Serikat yang diperkirakan dikeluarkan pada akhir tahun 2013. Kedua, muncul kekhawatiran investor terhadap perkembangan ekonomi di negara-negara emerging market, terutama China, India, dan Brasil. Hal ini berdampak pada aktivitas transaksi perekonomian di pasar internasional. Ketiga, gejolak harga minyak dunia akibat gejolak geopolitik beberapa negara produsen di kawasan Timur Tengah. Keempat, mengecilnya selisih suku bunga Bank Indonesia dan suku bunga dunia sehingga membuat investor mulai tertarik untuk mengalihkan modal ke Indonesia. Meski demikian, menurut Chatib, pemerintah tetap memasang target nilai tukar rupiah tahun 2014 di level Rp 9.750 per dolar AS. Alasannya, sejauh pemerintah bisa menjaga stabilitas perekonomian, meningkatkan tingkat konsumsi masyarakat, dan menaikkan prospek pertumbuhan ekspor komoditas andalan, pelemahan rupiah bisa ditekan. (j03)

Pekanbaru Berstatus ... “Di Pekanbaru angkanya sekarang mencapai 300, dan sebenarnya sejak Selasa (27/8) juga sudah seperti itu. Ini artinya kondisinya sudah berbahaya. Kategorinya bendera merah,” ujarnya. Kota Pekanbaru selama dua hari ini diselimuti kabut asap akibat kebakaran, juga mengakibatkan aktivitas penerbangan di Bandara Sultan Syarif Kasim II terganggu karena jarak pandang hanya mencapai 300 meter.

Asrama Haji sudah rampung,” ujarnya sembari menyebutkan saat ini ada beberapa ruangan yang diperbaiki agar lebih nyaman saat Calhaj tiba dan menginap selama satu malam sebelum berangkat ke tanah suci. Menurut Rahim, sarana prasarana pendukung yang tersedia dan telah siap untuk melayani Calhaj di Asrama Haji berupa, pemondokan jamaah, pemondokan petugas, aula penerimaan jamaah, aula pembinaan jamaah, aula pemberangkatan jamaah, ruang makan jamaah dan dapur umum. Namun, kata Rahim, masih ada ruang tidur Calhaj yang belum menggunakan AC atau masih menggunakan kipas angin karena belum ada pendanaan untuk itu. “ Ada 500 tempat tidur untuk Calhaj dan baru 75 persen ruangan yang menggunakan AC,’’ katanya. (m37)

Emas Dan Dolar ... “Secara technical, harga emas saat ini berada di titik puncak. Bila tidak ada faktor fundamentalis yang mempengaruhinya, maka harga emas ini akan sedikit mengalami koreksi, sehingga banyak para pemain mulai menjual emasnya untuk mendapatkan keuntungan,” ujarnya. Sementara itu, Staf Treasury Regional BNI Wilayah Medan Okta Sanjaya menyebutkan, Rupiah saat ini masih dalam tekanan dolar AS dan diperdagangkan di kisaran 11.400-11.600 per dolar AS. Akibat tekanan dolar AS terhadap Rupiah yang terus berlanjut dan sudah berada di puncak psikologis banyak eksportir melepas dolarnya. “Range rupiah saat ini sudah tinggi, sehingga banyak pelaku eksportir yang melepas dolarnya untuk mendapatkan keuntungan. Kondisi seperti ini terakhir pernah terjadi pada tahun 2008 dan kembali lagi pada tahun ini,” ujarnya. Sementara itu, lanjutnya, bagi para nasabah importir saat ini sudah banyak yang membeli karena menjelang akhir bulan biasanya sudah jatuh tempo pembayaran kontraknya. “Saat ini sudah masanya jatuh tempo pembayaran, sehingga para nasabah importir terpaksa membeli Dolar meskipun dengan harga yang tinggi,” ujarnya. Analis Ekonomi di salah satu sekuritas BUMN di Medan Gunawan Benjamin menyebutkan, kisruh geopolitik di Timur Tengah hingga ekspektasi melunaknya sikap The FED (Bank Sentral AS), membakar harga minyak dunia yang terus naik di kisaran 110 dolar AS/Barel (data jam 2.30 siang). Meroketnya harga minyak tersebut menghembuskan wacana kemungkinan inflasi dunia akan kembali naik seiring dengan membaiknya prospek ekonomi AS. “Setali dua uang, harga emas dunia juga terus mengalami kenaikan di level 1.420

WASPADA Kamis 29 Agustus 2013

Gempa 5,5 SR Guncang Sumbar Dan Jambi JAKARTA (Antara): Gempa berkekuatan 5,5 Skala Richter (SR) mengguncang Sumatera Barat dan Jambi yang dirasakan sangat keras di Pesisir Selatan yang menghentak dan disertai suara menderu selama 30 detik. “BMKG melaporkan gempa 5,5 SR, pada Rabu (28/8) pukul 12:43:25WIB dengan lokasi 74 KM Barat Laut Sungai Penuh, Jambi, dengan kedalaman 24 km,” ujar Kepala Pusat Data Informasi dan Humas Badan Nasional Penanggulangan Bencana Sutopo Purwo Nugroho melalui pesan singkat yang diterima di Jakarta, Rabu. Sutopo mengatakan, pusat gempa berada di Kecamatan Air Haji, Kabupaten Pesisir Selatan, Sumbar dan tidak berpotensi tsunami, namun guncangan yang besar membuat masyarakat berhamburan keluar rumah. Sutopo menambahkan, menurut Camat Air Haji, belum ada laporan kerusakan bangunan dan korban, sementara daerah yang terkenagempasebagianbesaradalahperkebunankelapasawit.“Posko BNPB telah melakukan pengecekan berkoordinasi dengan BPBD Sumatera Barat dan BPBD Pesisir Selatan,” ujar Sutopo. Menurut Sutopo, berdasarkan peta guncangan gempa intensitas gempa cukup kuat dengan IV-V MMI. Sutopo menambahkan, sebelumnya gempa pernah terjadi hingga VI MMI ketika gempa 7,5 SR pada 12-13 september 2007. “BPBD masih melakukan pemantauan di lapangan. Info lanjut akan diberikan jika ada perkembangan data,” ujar Sutopo. dolar AS per troy ons pada perdagangan Rabu (28/8). Sementara itu nilai tukar rupiah masih terpuruk terhadap dolar AS di kisaran Rp11.500-an. Pelaku pasar berharap ada langkah konkrit yang akan diambil BI dan ekspektasi kebijakan yang diambil harus lebih baik dari sejumlah langkah yang pernah diumumkan Presiden SBY sebelumnya,” ujar Gunawan. Sementara itu, Indeks Harga Saham Gabungan (IHSG) berhasil ditutup naik 1,48 persen di level 4.026,47. Kondisi yang tidak sama dibandingkan dengan kinerja rupiah yang masih terpuruk terhadap do-

lar AS. “Penguatan IHSG didorong oleh ekspektasi kebijakan BI dalam merespon pasar. BI sudah mengumumkan akan menggelar Rapat Dewan Gubernur Kamis (29/8), guna merespon buruknya kinerja pasar keuangan domestik,” ujarnya. Kemungkinan, IHSG berpeluang bergerak sideways dengan kecenderungan yang sangat bergantung dari kebijakan Bank Indonesia. Selain itu, bila ekspektasi pasar terhadap PDB AS yang akan dirilis justru pesimis, maka IHSG memiliki potensi menguat pada perdagangan Kamis. (m41)

Bendahara PU DS Divonis ... terdakwa tidak dapat dikenakan uang pengganti. Sebab berdasarkan keterangan saksi ahli dari BPKP (Badan Pengawas Keuangan dan Pembangunan) Perwakilan Sumut, potensi Rp7 miliar tidak terbukti menjadi kerugian negara dan bukan merupakan tindak pidana karena potensi itu sudah ditindaklanjuti Pemkab Deliserdang. Dua hakim anggota itu, juga mengapresiasi kepemimpinan terdakwa selama menjabat Bendahara Dinas PU Deliserdang. Begitupun, dua hakim anggota tersebut, kalah suara dengan tiga hakim lainnya masing-masing Ketua Majelis Hakim Denny L Tobing dan dua hakim anggota Denny Iskandar serta Jonner Manik. Mereka beranggapan, Elvian terbukti bersalah sebagaimana dalam Pasal 3 jo UU Nomor 31 Tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi sebagaimana diubah dengan UU Nomor 20 Tahun 2011 jo Pasal 55 ayat (1) ke-1 KUHPidana, seperti yang tertera pada dakwaan subsidair. Hukuman yang dijatuhkan kepada Elvian lebih ringan dari tuntutan Jaksa Penuntut Umum (JPU) yang menuntutnya dengan hukuman 7 tahun penjara, denda Rp500 juta dan subsider 6 bulan kurungan. Selain itu, jaksa menuntut Elvian agar membayar uang pengganti kerugian negara sebesar Rp 52 miliar. Dalam dakwaan jaksa disebutkan, Ir Faisal bersama Elvian (Bendahara Dinas PU Deliserdang) dan dengan bantuan Agus Sumantri (Bendahara Umum Daerah Pemkab Deliserdang) telah melakukan tindak pidana korupsi pada tahun anggaran 2010. Dalam kasus ini, Ir Faisal berinisiatif mengalihkan kegiatan-kegiatan yang terdaftar dalam Dokumen Pelaksanaan Anggaran (DPA) Dinas PU Deliserdang dari kegiatan bersifat tender (lelang) menjadi kegiatan swakelola. Padahal kebijakan itu harus melalui perencanaan yang dituangkan dalam Kerangka Acuan Kerja (KAK) dan disetujui legislatif (DPRD). Namun, anggaran tahun 2010, ada digunakan untuk membayar kegiatan-kegiatan pada tahun anggaran sebelumnya, yakni 2007, 2008, 2009 dan 2010. Akibat perbuatan itu, negara dirugikan Rp105,83 miliar. (m38)

Al Bayan ... Jika rujuk secara utuh ayat yang dibacakan Umar kepada Jabir, yakni ayat ke-20 dari surah Al-Ahqaf (46), “Dan (ingatlah) hari (ketika) orang-orang kafir dihadapkan ke neraka (kepada mereka dikatakan): “Kamu telah menghabiskan rezekimu yang baik dalam kehidupan duniawimu (saja) dan kamu telah bersenangsenang dengannya; maka pada hari ini kamu dibalasi dengan azab yang menghinakan karena kamu telah menyombongkan diri di muka bumi tanpa hak dan karena kamu telah fasik.” Jelaslah Umar tidak menghendaki Jabir mengikuti langkah orang kafir yang menghabiskan semua kesenangan di dunia ini. Walaupun teks ayat tersebut berbicara tentang orang kafir, namun Umar mengingatkan Jabir juga kita untuk menyadari hidup di dunia hanya sementara dan harus mempersiapkan juga kehidupan akhirat dengan tidak lupa membagikan kebahagian yang ada pada kita kepada sesama. Dunia hanyalah tempat sementara, dan akhirat merupakan kehidupan sesungguhnya. Namun bukan berarti kesadaran ini menafikan kesenangan dunia. Kehidupan di dunia harus dijadikan tempat menanam kebaikan agar hasilnya di akhirat nanti kebaikan juga yang diperoleh. Kehidupan dunia ini merupakan ladang untuk kampung atau kota akhirat. Jadi kehidupan akhirat tergantung pada amal kebajikan apa

yang kita tanam di dunia ini. Pesan umar kepada Jabir di atas karena Umar mencontoh Sunnah Rasulullah SAW. Umar bercerita, “Saya menemui Rasulullah SAW yang kala itu sedang berbaring di atas sehelai tikar. Lalu aku duduk dan mendekati Sang Nabi SAW. Tiba-tiba, saya melihat anyaman tikar membekas di punggung Sang Rasul SAW. Maka melelehlah air mata saya.” Melihat Umar menangis, Rasulullah SAW bertanya, “Mengapa kamu menangis, wahai putra Khaththab? “Lalu saya menjawabnya, “Wahai Nabi Allah, bagaimana saya tidak menangis, sementara tikar ini telah menimbulkan bekas di punggungmu. Engkau adalah Rasul Allah dan kekasih pilihanNya. Kekayaanmu hanya yang saya lihat sekarang ini. Padahal, di tempat sana, kisra dan kaisar duduk di atas katil emas berbantalkan sutra.” Sang Rasul SAW bersabda, “Mereka telah menyegerakan kesenangannya sekarang; kesenangan yang akan cepat berakhir. Kita adalah kaum yang menangguhkan kesenangan kita untuk hari Akhir kita. Perumpamaan hubunganku dengan dunia adalah seperti orang yang bepergian pada musim panas. Ia berlindung sejenak di bawah pohon kemudian berangkat meninggalkannya.” Hadis ini berasal dari Abdullah bin Abbas yang diriwayatkan oleh Imam Ahmad. Akhirnya, semoga kesadaran kita bahwa kehidupan dan kesenangan di dunia ini hanya sementara terus membekas di hati dan diri.

Medan Metropolitan

WASPADA Kamis 29 Agustus 2013


Polisi Tangkap Dua Pencuri Kabel Telkom MEDAN (Waspada): Petugas Reskrim Unit Jahtanras Polresta Medan menangkap dua tersangka pencuri kabel telkom dalam penyergapan di Jln. Pahlawan dan Jln. Masjid Taufiq Medan, Rabu (28/8). Tersangka RW, 37, warga Dusun IV, Tanjung Morawa, Kab. Deliserdang, merupakan mantan karyawan perusahaan yang bermitra dengan PT Telkom. Selain itu, polisi juga menangkap HS, 30, warga Jln. Masjid Taufiq, Gg. Kinantan Medan. Kasat Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak didampingi Waka Sat AKP Yudi Priyanto dan Kanit Jahtanras AKP Anthoni Simamora saat ekspos di Polresta Medan, Rabu (28/8) mengatakan, RW ditangkap dari hasil pengembangan tersangka HS, 30. “Tersangka HS ditangkap Polsek Medan Timur karena melakukan pencurian kabel Telkom sepanjang 45 meter di Jln. Masjid Taufik Medan,” jelas Calvijn. Korban dari PT Telkom sudah membuat pengaduan di Polresta Medan, Minggu (18/8), dengan pelapor Suwonto Nainggolan sesuai surat tanda bukti laporan No. LP/2167/VIII/2013/SPKT Resta Medan. Berdasarkan laporan itu, polisi menangkap tersangka RW saat

Waspada/Rudi Arman

KASAT Reskrim Polresta Medan Kompol Jean Calvijn Simanjuntak (dua kiri) didampingi Waka Sat AKP Yudi Priyanto dan Kanit Jahtanras AKP Anthoni Simamora (kanan) menginterogasi tersangka pencuri kabel Telkom dan telepon umum, Rabu (28/8).

melakukan aksinya mencuri telepon umum di Jln. Pahlawan simpang Jln. Sakti, Kec. Medan Timur. “Saat melakukan aksinya tersangka RW memakai baju kemeja lengan panjang warna biru seperti baju kerja lapangan milik perusahaan mitra PT Telkom,” jelas Calvijn. Polisi juga menyita barang bukti enam set telepon umum dalam keadaan rusak, mobil Mitsubishi BK 8321 MA, kunci T, obeng, pahat, linggis, palu, tas sandang berisi ratusan kunci, uang pecahan Rp500 sebanyak 17 keping, uang pecahan Rp100 sebanyak 55 keping, uang pecahan Rp200 sebanyak 11 keping dan baju kemeja lengan panjang warna biru. Tersangka RW mengaku sudah beraksi di beberapa tempat yakni di Jln. Pembangunan, Deliserdang; Jln. Sekip, Deliserdang; Jln. Lintas Lubuk Pakam; Jln. Pahlawan dan Jln. Stadion belakang Polsek Medan Kota serta Jln. Pelajar Kec. Medan Kota. “Akibat perbuatan tersangka, pihak PT Telkom menderita kerugian mencapai ratusan juta rupiah,” jelas Kompol Jean Calvijn Simanjuntak. Saat ini, lanjut Calvijn, pihaknya masih mengembangkan kasus pencurian kabel milik PT Telkom. Sebab, polisi menduga tersangka merupakan sindikat pencuri kabel Telkom. “Dugaan ini karena tersangka RW melakukan aksinya hingga ke luar daerah Medan serta menjual barang hasil curian kepada penadah yang masih kita cari keberadaannya,” jelas Calvijn seraya menambahkan tersangka dijerat Pasal 363 KUHPidana dengan ancaman hukuman lima tahun penjara. Sedangkan tersangka RW yang ditanya wartawan mengaku nekat melakukan aksinya karena perlu biaya untuk persalinan sang istri. “Isteri butuh biaya persalinan. Karena tidak mempunyai uang, aku terpaksa mencuri,” katanya. (m39)

Kejatisu Siap Bersinergi Dengan MPI Ingin Hidup Mewah Dan Berfoya-foya

MEDAN (Waspada): Kejaksaan Tinggi Sumatera Utara (Kejatisu) siap membuka diri dan bersinergi dengan Masyarakat Pancasila Indonesia (MPI) dalam upaya penegakan hukum guna membangun dan memajukan Sumatera Utara. Hal itu dikatakan Kajatisu Bambang SetyoWahyudi ketika menerima audiensi pengurus Dewan Pimpinan Provinsi (DPP) MPI Sumut di ruang kerjanya, Rabu (28/8). Dalam kunjungan itu, Ketua DPP MPI Sumut Irwan Pulungan, S.Sos MSi didampingi Siswanto Adi SH (Ketua Bidang Hukum), Teddy Gatot (Ketua Bidang Ekonomi), Taufk Helmi Sitorus, SE (Ketua Bidang Sosial), Kamsir Aritonang,SE, Ak (Bendahara), Jeffri Sitindaon, ST (Wakil Sekretaris), H. Zakiyuddin Harahap, SE (Ketua OKK), Nujuar, SE (Bidang Ekonomi) dan Antoni Siregar (anggota OKK). Kajatisu mengatakan, pihaknya ingin selalu bersinergi dengan masyarakat, pemerintah dan dunia usaha. Sebab, Ke-

jatisu tidak bisa berdiri sendiri. “Sinergi itu ibarat lidi. Jika lidi-lidi itu disatukan, maka perannya akan maksimal. Di sini, saya bertugas memberikan pelayanan hukum. Karena itu, perlu komunikasi dengan semua pihak. Tanpa komunikasi tidak bisa saling mengetahui,” ujar Bambang. Dia menyatakan bangga dan memberikan apresiasi kepada MPI Sumut yang peduli terhadap penegakan hukum. Bahkan, untuk bersinergi, pihaknya siap berkoordinasi dengan MPI yang ada di daerahdaerah. Sementara itu, Ketua DPP MPI Sumut Irwan Pulungan mengatakan, kunjungan silaturahmi ini bertujuan memperkenalkan para pengurus MPI Sumut periode 2013 - 2018 yang akan dilantik pada 7 September mendatang, sekaligus mengundang Kajatisu untuk hadir dalam acara pelantikan tersebut. Dilarang Meminta-minta Pada kesempatan itu, Irwan menegaskan, sesuai amanah

Ketua Umum DPN MPI Meher Ban Shah, seluruh kader MPI dilarang keras meminta-minta uang atau sumbangan dalam bentuk apapun, untuk kegiatan pelantikan, ulang tahun dan sebagainya. Jika ada kader MPI yang meminta-minta uang, langsung dipecat. Terkait sinergi, lanjut Irwan, MPI siap mendukung kinerja Kejatisu dan menjadi garda terdepan dalam menegakkan hukum di Sumatera Utara. Di tempat terpisah, Ketua Umum DPN MPI, Meher Ban Shah menyatakan, MPI merupakan milik bangsa dan rakyat Indonesia yang bersifat terbuka tanpa membeda-bedakan suku, agama, ras dan antar golongan, serta latar belakang politik dan sosial kemasyarakatan, “MPI sebagai salah satu pilar Ormas yang ada di Indonesia, bertindak sebagai penyeimbang bagi pelaksanaan pembangunan nasional. Karena itu, MPI akan membantu penegakan hukum dan memberantas para koruptor di Indonesia,” demikian Meher Ban Shah.(m36)


KETUA DPP MPI Sumut Irwan Pulungan (dua dari kiri) menyerahkan cenderamata kepada Kajatisu Bambang Setyo Wahyudi (kiri) saat beraudiensi, Rabu (28/8).

Dua Pelajar SMA Merampok MEDAN (Waspada): Karena ingin bergaya hidup mewah dan berfoya-foya, dua pelajar SMA, melakukan aksi perampokan di sejumlah lokasi. Mereka akhirnya ditangkap petugas Polsek Sunggal di Jln. Sei Batanghari, Pasar I, Medan. “Dari tersangka KS, 18, penduduk Perumnas Simalingkar Medan dan AM, 17, warga Jln. Pancing, Deliserdang, polisi menyita barang bukti sepedamotor dan lainnya,” kata Kapolsek Sunggal AKP Eko Hartanto melalui Kanit Reskrim Iptu I Gusti Ngurah AAA SH, kepada Waspada, Rabu (28/8) sore. Menurut Gusti, penangkapan itu bermula ketika kedua tersangka beraksi di Jln. Kutilang Medan. Saat itu, tersangka mengendarai sepedamotor Jupiter MX merampok tas milik Putri yang mengendarai sepedamotor. Melihat kejadian itu, petugas Reskrim Polsek Sunggal yang sedang melakukan patroli langsung memburu tersangka. Akhirnya, kedua tersangka bersama barang bukti berhasil diamankan. Saat menjalani pemeriksaan, tersangka KS mengaku sudah tiga kali melakukan perampokan.Yakni di kawasan Jln. Pancing, Jln. Letjen Jamin Ginting-Padangbulan dan terakhir tertangkap saat merampok di

Jln. Kutilang Medan. Dihajar Massa Sebelumnya, seorang anak jalanan dihajar massa di Jln. Melati, Kel. Pahlawan, Kec. Medan Perjuangan, Selasa (27/ 8) siang sekira pukul 12:00, setelah kepergok mencuri di salah satu rumah warga. Dalam kondisi babak belur, tersangka AS, 18, asal Rantau Prapat, Labuhanbatu, dijebloskan ke dalam sel Polsek Medan Timur. Sedangkan korbannya Fuji Astuti, 51, membuat pengaduan. Kepada petugas Polsek Medan Timur, tersangka AS mengatakan, siang itu dia melintas di rumah milik Fuji. Melihat suasana sepi, tersangka AS masuk ke dalam rumah tersebut. Setelah masuk ke dalam rumah, tersangka AS langsung menuju kamar dan mengambil tiga handphone dan satu Ipad. Namun, saat hendak ke luar dari kamar, tersangka AS dipergoki oleh penghuni rumah. “Saat hendak keluar dari kamar, tiba-tiba saja yang punya rumah sudah di depan pintu kamar,” ujarnya. Sedangkan korban Fuji mengetahui ada orang tak dikenal berada di dalam rumahnya, spontan berteriak maling sehingga mengundang perhatian warga sekitar. Belasan warga langsung berdatangan. Melihat massa mulai ramai, tersangka AS ber-

usaha melarikan diri. Namun, dia berhasil ditangkap warga dan dihajar hingga babak belur. Petugas Reskrim Polsek Medan Timur yang mengetahui ada pelaku pencurian diamuk massa segera turun ke lokasi. Sementara itu, Kapolsek Medan Timur Kompol Juliani Prihartini SIK mengatakan, tersangka AS masih menjalani pemeriksaan. (m36/h04)

Waspada/Ismanto Ismail

TERSANGKA KS, 18, dan AM, 17, saat diamankan

Medan Metropolitan A4 Sub Agen Judi Bola Dan Togel Ditangkap MEDAN (Waspada): Delapan tersangka kasus perjudian toto gelap (togel) Singapura dan judi bola ditangkap petugas Subdit III/Umum Direktorat Reskrimum Polda Sumut, di empat lokasi berbeda di Medan, kemarin sore. Hingga Rabu (28/8), ke delapan tersangka masih dalam pemeriksaan intensif penyidik Unit Judi Poldasu. Kasubdit III/Umum Direktorat Reskrimum Poldasu AKBP Andry Setiawan di dampingi Kanit Judi AKP Harry Azhar kepada Waspada di Mapoldasu, Selasa menjelaskan, dari delapan tersangka, enam merupakan penulis togel Singapura dan dua lainnya sub agen dan pemasang taruhan judi bola. “Mereka ditangkap di tempat berbeda, namun pada hari yang sama,” kata Harry Azhar.

Disebutkannya, penangkapan pertama terhadap Ros Br S, 53, penduduk Jln. Jati III, Kel. Teladan Timur, Kec. Medan Kota. Tersangka Ros ditangkap di warung tuaknya Jln. Jati III dengan barang bukti 1 HP, 2 buku tafsir mimpi, 1 kertas berisi nomor togel, 1 kertas rekap dan uang Rp195 ribu. Bersama tersangka Ros, juga diamankan FA alias Olop, 48, penduduk Jln. Jati III, Teladan Timur. Dari tersangka Olop disita barang bukti 1 kalkulator, 2 pulpen, 1 buku tafsir mimpi, 2 buku rekap togel, 1 buka ekspedisi berisi nama-nama penulis togel dan omset, 3 HP dan uang Rp785 ribu. “Tersangka Olop beroperasi siang dan malam dengan omset perharinya antara Rp1,5 juta sampai Rp2,5 juta. Saat ini kita sedang mengejar bandarnya berinisial B,” sebut Harry. Di tempat berbeda, petugas

Tewas Ditabrak Truk MEDAN (Waspada): Seorang wanita pejalan kaki tewas dengan kondisi mengenaskan karena ditabrak truk pengangkut batu bata di Jln AH Nasution, Rabu (28/8). Menurut informasi di lokasi kejadian, peristiwa tersebut terjadi sekira pukul 14:00, truk Mitsubishi BK 9856 ML yang mengangkut batu bata datang dari arah kawasan Amplas hendak menuju Padang Bulan melaju dengan kecepatan tinggi. Ketika melintas tak jauh dari persimpangan lampu merah Jln. AH Nasution-Jln. Karya Jaya tiba-tiba seorang wanita menyeberang jalan. Sopir truk tidak dapat mengendalikan kendaraannya sehingga menabrak wanita tersebut hingga tewas di tempat dalam kondisi mengenaskan. Salah seorang warga yang melihat kejadian tersebut mengatakan, korban sering terlihat melintasi jalan AH Nasution. “Korban sempat terseret beberapa meter,” katanya. Selain itu, lanjut warga itu, seorang pengendara sepedamotor juga tersenggol hingga jatuh dan mengalami luka lecet disebagian tubuhnya. “Pengendara sepedamotor itu sudah dilarikan ke rumah sakit terdekat,” sebutnya. Sementara sopir truk dan tiga kernetnya sempat diamankan warga, namun saat warga lengah keempatnya melarikan diri. Sedangkan jenazah wanita tersebut dievakuasi ke RSUP Adam Malik oleh petugas Polsek Delitua. Pantauan Waspada, akibat kecelakaan itu arus lalu lintas di Jln. AH Nasution dan Jln. Tritura, Kec. Medan Johor, macat total karena banyak pengendara menghentikan laju kendaraannya untuk melihat peristiwa tersebut. Panit Lantas Polsekta Delitua Iptu N Siregar yang berada dilokasi kejadian mengatur arus lalulintas ketika dikonfirmasi mengatakan, kondisi mayat korban sudah tidak dapat dikenali.(m40)

Tambahan Penghasilan PNS Pemprovsu Tidak Dihapus MEDAN (Waspada): Gubernur Sumatera Utara H Gatot Pujo Nugroho, ST, MSi menepis rumor yang merebak di kalangan PNS di jajaran Pemerintah Provinsi Sumatera Utara, terkait penghapusan Tambahan Penghasilan Pegawai (TPP) PNS di jajarannya. Gubsu menegaskan, walaupun membutuhkan alokasi dana yang besar, Pemprovsu tetap akan membayarkan TPP. “Tidak benar Pemprov Sumut akan menghapuskan Tambahan Penghasilan PNS,” ujar Gubsu, di kediaman dinasnya, Rabu (28/8) pagi. Penegasan Gubsu tersebut, membantah isu penghapusan kebijakan pembayaran tunjangan bagi PNS yang akhir-akhir ini cukup meresahkan belasan ribu PNS di jajaran Pemprov Sumut. Gubsu mengatakan, meskipun saat ini Pemprovsu harus melakukan berbagai penghematan anggaran, namun pihaknya tidak akan menghapuskan Tambahan Penghasilan PNS. Terlebih lagi, TPP sudah menjadi kebijakan Pemprovsu untuk meningkatkan kesejahteraan PNS sekaligus mendorong kinerja PNS. “Saya minta PNS tidak perlu resah, bekerjalah sebagaimana seharusnya pamong masyarakat,” katanya. Gubsu mengakui, tambahan penghasilan PNS di jajaran Pemprovsu nilainya terhitung besar jika dibandingkan dengan tambahan penghasilan yang diterapkan di kebanyakan kabupaten/ kota. Walaupun alokasi anggaran untuk pembayaran TPP cukup besar, namun dia menegaskan tidak akan menghapuskan TPP. “Ini sudah menjadi kebijakan yang merupakan komitmen Pemerintah Provinsi Sumatera Utara dengan DPRD Sumatera Utara. Jadi kami akan selalu berupaya mempertahankan apa yang sudah menjadi komitmen,” sebutnya.(m28)

menangkap MJ, 36, P alias Sipit, 37, dan Her, 62, ketiganya penduduk Jln. Kapten Rahmad Budin Gg Jambu Pasar V, Kel. Rengas Pulau, Kec. Medan Marelan. Mereka ditangkap di warung kopi tidak jauh dari kediaman mereka di Marelan. Dari para tersangka, polisi mengamankan barang bukti uang Rp110 ribu, 1 HP, 1 kalkulator, 3 pulpen, 2 blok kupon judi togel, 2 buku tafsir mimpi, dan 1 lembar kertas rekap togel. Kemudian ditangkap Su, 52, penduduk Jln. Sunggal, Kel. Tanjungrejo, Kec. Sunggal. Dia ditangkap di kediamannya

dengan barang bukti 1 HP. “Dari keterangan tersangka ini, bisnis judinya dibandari oleh seseorang berinisial As, warga Sunggal. Sedangka tersangka mengaku sebagai penulis togel dengan omset antara Rp600 ribu hingga Rp1 juta rupiah per putaran,” ujar Harry. Sedangkan dua tersangka perjudian bola yaitu Z, 42, penduduk Jln. Purwosari, Kel. Pulo Brayan Bengkel Baru, Kec. Medan Timur, dan RJS, 47, penduduk Jln. Krakatau, Medan Timur, ditangkap di warung kopi Jln. Yos Sudarso, Medan Deli. Dari kedua tersangka di-

amankan barang bukti 4 HP dan uang Rp1,5 juta. Berdasarkan pemeriksaan sementara, tersangka RJS diduga sebagai sub agen judi bola, sedangkan tersangka Z sebagai pemasang taruhan untuk Liga Eropa. Harry Azhar menyebutkan, tersangka R mengaku menyetor uang kemenangan kepada bandarnya yang juga pemilik website judi bola “Para tersangka akan dijerat pasal 303 KUHPidana tentang perjudian, dengan ancaman hukuman di atas lima tahun penjara,” tuturnya.(m27)

Terdakwa Penipuan Rp800 Juta Terancam Empat Tahun Penjara MEDAN (Waspada): TerdakwaVani, warga Medan Tembung, terancam hukuman empat tahun penjara karena melakukan penipuan dengan modus pembelian barang-barang kosmetik. Hal itu terungkap dalam persidangan penipuan dan penggelapan yang digelar di ruang Cakra II Pengadilan Negeri (PN) Medan, Selasa (27/8). Berdasarkan fakta yang terungkap, saksi korban A Mei dan suaminya Mak Kok Long mengaku penipuan ini bermula pada November 2012 silam. “Waktu itu kami berbisnis kosmetik pak hakim. Saya berbisnis kosmetik dengan dia sejak tahun 2005 hingga tahun 2012,” ujar saksi korban ketika dihadirkan Jaksa Penuntut Umum

(JPU) Fattah. Menurut saksi, setelah barang-barang kosmetik diantar ke rumah terdakwa, wanita itu berjanji akan membayar kosmetik tersebut dengan menggunakan cek giro. Tapi, setelah tenggat waktu pembayaran sudah jatuh tempo, terdakwa tidak juga membayar uang tagihan pemesanan barang kosmetik tersebut. “Biasanya terdakwa membayar dengan menggunakan cek giro. Di awal bisnis, pembayarannya lancar. Tapi belakangan dia tidak membayar tagihannya itu,” kata A Mei dihadapan majelis hakim yang diketuai SB Hutagalung. Akibat kasus penipuan ini, saksi korban dan suaminya meng-alami kerugian Rp800 juta lebih. “Sampai sekarang

tidak ada dibayar. Kalau soal kerugian, kami merugi Rp800 juta lebih pak,” tutur saksi. Sementara terdakwa Vani membantah keterangan saksi korban saat dimintai tanggapannya. Kata dia, yang melakukan penipuan itu adalah suaminya yang bernama Gunong alias Abun. “Jadi yang pesan barangbarang kosmetik itu suami saya (Abun) pak. Saya tidak tahu menahu soal pemesanan barang itu,” katanya. Usai mendengarkan keterangan saksi-saki, majelis hakim menunda sidang hingga pekan depan dengan agenda mendengarkan keterangan saksi lainnya. Dalam kasus ini, JPU Fattah menjerat terdakwa atas Pasal 378 KUHPidana dengan ancaman empat tahun penjara. (m38)

Pemilihan Anggota KPU Sumut Diduga Dipengaruhi Tiga Kekuatan MEDAN (Waspada): Direktur Eksekutif Indonesia Constitutional Watch (Icon Watch) Razman Arif Nasution mensinyalir pemilihan anggota Komisi Pemilihan Umum (KPU) Sumut oleh Tim Seleksi KPU Sumut dipengaruhi tiga kekuatan, yakni kekuatan partai politik, ormas, dan oknum eks orangorang KPU. Dicontohkannya, ada calon anggota KPU Sumut, padahal istrinya merupakan seorang caleg di Madina. “Saya minta agar calon tersebut tídak diloloskan karena diragukan independensi dan diduga ada skenario bermain, sebab istri yang bersangkutan menjadi caleg. Halhal yang seperti ini harus menjadi perhatian tim seleksi dan kondisi ini sudah saya sampaikan juga kepada ketua anggota timsel Prof Asmuni,” kata Razman Arif (foto). Menurut dia, ada beberapa dampak ketika pemilihan anggota komisioner KPU dipengaruhi tiga kekuatan tadi. Pertama, penyelenggara pemilu rawan diintervensi oleh kekuatan politik atau ormas. Akibatnya, pilkada, pileg menghasilkan wakil rakyat yang jauh dari yang diharapkan, sehingga tidak mampu menyerap aspirasi rakyat. “Bob-

roknya negara karena KPU gagal menjadi filter atau penyaring yang baik, KPU tidak bekerja dengan independen dan adil,” ujarnya. Kedua, lanjut Razman, partisipasi masyarakat dalam pemilu semakin merosot, karena masyarakat sudah semakin apatis dengan ini semua.“Untuk mengatasi kemerosotan ini, anggota-anggota KPU harus jujur dan adil. Makanya proses seleksi calon anggota KPU harus benar-benar independen, tanpa ada intervensi dari pihak manapun,” sebutnya. Menanggapi temuan Ombudsman Republik Indonesia (ORI) yakni peserta seleksi calon anggota KPU Sumut lulus seleksi tahapan pemeriksaan administrasi, meski tidak memenuhi persyaratan, Razman Arif me-

minta Dewan Kehormatan Penyelenggara Pemilu (DKPP) ikut turun untuk menyelesaikan permasalahan ini. “Terkait sengketa pemilu, apakah itu pemilu legislatif, presiden dan kepala daerah, bisa turun. Jika memang ada kolusi di KPU dan tim seleksi ini, maka DKPP berhak memberhentikan. Jangankan KPU daerah, anggota KPU pusat pun bisa diberhentikan DKPP,” tuturnya. Dia berharap, anggota KPU Sumut yang terpilih benarbenar independen, berkompeten mengenai UU penyelenggaraan pemilu. “Jadi anggota KPU itu harus memahami betul UU pemilu. Ditangan mereka sekarang diberi amanah untuk menyelenggarakan pemilu yang baik atau buruk, maka mereka harus memiliki trackrecord, apalagi dengan jumlah mereka yang sangat sedikit, ditangan merekalah nasib bangsa ini,” ujarnya. Untuk itu, DKPP berkewajiban memberhentikan anggota KPU yang menyalahgunakan wewenangnya, sehingga Pemilu 2014 yang berkualitas bisa diselenggarakan. “Karena padatahapan pemilu inilah kita menentukan nasib bangsa ini,” sebut Razman. (cwan)

WASPADA Kamis 29 Agustus 2013

Waspada/Surya Efendi

TUNTUT UU KEPERAWATAN: Puluhan perawat dan mahasiswa keperawatan berunjukrasa di depan gedung DPRDSU Jln. Imam Bonjol Medan, Rabu (28/8). Mereka mendesak DPR RI segera mensahkan UU Keperawatan.

PPNI Sumut Gelar Aksi Damai Minta Sahkan UU Keperawatan MEDAN (Waspada): Persatuan Perawat Nasional Indonesia (PPNI) Wilayah Sumatera Utara (Sumut) menggelar aksi damai dengan mendatangi Gedung DPRDSU, Rabu (28/8). Para perawat dari berbagai rumah sakit pemerintah dan swasta serta mahasiswa keperawatan ini menuntut agar pemerintah segera mensahkan UU Keperawatan sehingga ada payung hukum yang melindungi mereka. Mereka memulai aksi dengan berjalan kaki dari Lapangan Merdeka menuju Gedung DPRDSU sambil membawa spanduk dan poster. Setibanya di gerbang gedung DPRDSU, mereka dihadang petugas keamanan. Kemudian koordinator lapangan yang juga Ketua PPNI Martoni

Calvein menjelaskan tentang maksud dan tujuan aksi damai tesebut. Akhirnya, mereka diterima Wakil Ketua DPRDSU Kamaluddin Harahap di gerbang masuk gedung. Salah seorang wakil pengunjukrasa dari PPNI menyampaikan surat pernyataan tuntutan. Sementara, Mahirah dari Ilmu Keperawatan USU menyatakan akan terus berjuang agar UU Keperawatan segera disahkan, sehingga mereka merasa nyaman dalam mengabdikan diri sebagai pelayan medis. Sekretaris PPNI Sumut Soep Sp.Kp mengatakan, pengesahan UU Keperawatan sangat dibutuhkan untuk memperkuat eksistensi perawat. Selama ini, pekerja yang berprofesi perawat membutuhkan payung hukum

profesi untuk memperkuat eksistensi tugasnya. “Kami bukan menuntut untuk menjadi dokter, tetapi tetap ingin jadi perawat dengan perlindungan hukum,” kata Soep seraya menambahkan, jam kerja perawat sudah melebihi jam dokter. Saat ini, katanya, jumlah perawat di Sumut berkisar 25 ribu orang yang tersebar di berbagai sarana kesehatan baik rumah sakit pemerintah maupun swasta. Mereka tidak pernah berhenti mengabdi meski UU Keperawatan belum disahkan pemerintah. Wakil Ketua DPRDSU Kamaluddin Harahap yang menerima aspirasi PPNI berjanji akan menyampaikan tuntutan tersebut ke DPR RI bersama tuntutan dari pihak lainnya.(m22)

Caleg DPRD Medan Hadiri Tiruvila Umat Hindu Tamil MEDAN (Waspada): Calon Legislatif (Caleg) DPRD Kota Medan dari Partai Keadilan Persatuan Indonesia (PKPI) daerah pemilihan (Dapil) III dengan nomor urut 4, DraVeronika Sitanggang hadiri perayaan ritual keagamaan Tiruvila bagi umat Hindu Tamil di Shri Kaliamman Kuil Mangkubumi Medan, baru-baru ini. Kedatangan Dra Veronika Sitanggang bersama suami Drs Irwanto Tampubolon (anggota DPRD Medan) ini menyahuti undangan panitia perayaan Tiruvila umat Hindu Tamil yakni Ketua Panitia Naden, Pendeta Damak, dan bendahara Anand. Pasangan suami istri ini disambut ratusan penganut Hindu Tamil dan menerima kalungan bunga dari Ketua Tamil Peduli Rakyat P Krisnna Bakhty Naidu, Kamis (28/8). Dalam kunjungannya,Veronika Sitanggang kagum melihat perayaan penganut Hindu Tamil yang tetap mengenang para leluhurnya dan percaya diri sehingga kegiatan dapat dijalankan dengan baik. Ritual Tiruvila diharapkan dapat membina perilaku santun dan budi pekerti serta bersolidaritas yang tinggi terhadap sesama. Veronika berharap, perayaan Tiruvilla dapat terus berlangsung sehingga dapat dijadikan bagian dari wisata rohani dan daya tarik kunjungan wisata ke Kota Medan. Kepada Pemko

Medan diharapkan dapat memfasilitasi serta memperhatikan kelangsungan budaya dan ritual dimaksud. Sementara itu, Ketua Panitia Perayaan Sembahyang Tiruvila Naden bersama Pendeta Damak sertra Bendahara Anand menyatakan sangat berterimah kasih atas kehadiran Veronika Sitanggang bersama Irwanto Tampubolon. Mereka menilai pasangan suami istri merupakan sosok pengusaha yang memiliki rasa solidaritas yang tinggi terhadap perbedaan suku dan keyakinan agama. Sebagaimana diketahui, ri-

tual Tiruvila merupakan penghormatan dan perwujudan bhakti seorang hambanya kepada para dewa khususnya Dewa Kali, salah satu dewa umat Hindu Tamil. Selain itu acara ritualTiruvila biasanya diadakan pada bulan tertentu untuk menjauhkan manusia dari bencana yang tidak diinginkan. Sedangkan untuk bisa melakukan ritual tersebut seseorang harus terlebih dahulu membersihkan diri urusan duniawi. Biasanya, ritual yang dijalankan berpuasa beberapa hari bahkan sampai satu bulan. (m30)


CALEG DPRD Medan dari PKPI DraVeronika Sitanggang bersama Dra Irwanto Tampubolon (anggota DPRD Medan) menerima kalungan bunga dan sari dari Pendeta Damak saat menghadiri perayaan Tiruvila di Shri Kaliamman Kuil Mangkubumi.

Hadirkan Sfaf Ahli Dirjen Dikti Pada Seminar Dan Workshop

USM Indonesia Tingkatkan Kemampuan Dosen MEDAN (Waspada): Universitas Sari Mutiara (USM) Indonesia terus berupaya meningkatkan kemampuan dosen dan staf pengajar lainnya dalam menguasai ilmu pengetahuan di bidangnya masing-masing, sesuai perkembangan era globalisasi. Dengan demikian, seluruh mahasiswa yang mengikuti perkuliahan di USM Indonesia mendapat ilmu pengetahuan dari dosen-dosen yang berpengalaman. Pada akhirnya, USM Indonesia akan menghasilkan lulusan yang berkualitas dan profesional. Karena itu, USM Indonesia menghadirkan dua Staf Ahli Direktur Jenderal Pendidikan Tinggi (Dirjen Dikti) yakni Dr. Ir. Endrotomo, MT dan Emilia Tarigan, S.Pk, M.Kes dalam Seminar dan Workshop “Learning Outcome Lulusan dengan Standar Kerangka Kualifikasi Nasional Indonesia (KKNI)”. Seminar yang berlangsung di Kampus USM Indonesia Jln. Kapten Muslim Medan pada 24 – 26 Agustus 2013 ini, diikuti 120 dosen/staf pengajar termasuk ketua program studi dan para dekan di lingkungan perguruan tinggi tersebut.

Staf Ahli Dirjen Dikti Dr. Ir. Endrotomo, MT mengatakan, Kerangka Kualifikasi Nasional Indonesia (KKNI) diharapkan akan mengubah cara pandang kompetensi seseorang, yakni tidak lagi semata melihat ijazah. Namun, melihat kerangka kualifikasi yang disepakati secara nasional sebagai dasar pengakuan terhadap hasil pendidikan seseorang secara luas yang akuntanbel dan transparan. KKNI adalah kerangka penjenjangan kualifikasi kompetensi yang dapat menyandingkan, menyetarakan dan mengintegrasikan antara bidang pendidikan dan bidang pelatihan kerja serta pengalaman kerja dalam rangka memberi pengakuan kompetensi kerja sesuai dengan struktur pekerjaan di berbagai sektor. Kurikulum yang pada awalnya mengacu pada pencapaian kompetensi menjadi mengacu pada capaian pembelajaran (learning outcomes). “Learning outcomes mencakup internalisasi dan akumulasi ilmu pengetahuan, keterampilan, sikap dan kompetensi yang dicapai melalui proses pendidikan terstruktur dan mencakup suatu bidang ilmu/keahlian tertentu atau melalui pengalaman

kerja,” kata Endrotomo. Pelaksanaan KKNI melalui delapan tahapan.Yakni, penetapan profil kelulusan, merumuskan learning outcomes, merumuskan kompetensi bahan kajian, pemetaan learning outcomes bahan kajian, pengemasan mata kuliah, penyusunan kerangka kurikulum dan penyusunan rencana perkuliahan. Dalam hal ini, kompetensi adalah akumulasi kemampuan seseorang dalam melaksanakan suatu deskripsi kerja secara terukur melalui asesmen terstruktur, mencakup aspek kemandirian dan tanggungjawab individu pada bidang kerjanya. Demi meningkatkan kualitas lulusan perguruaan tinggi ada beberapa hal yang menjadi titik berat learning outcomes. Yakni, jumlah Satuan Kredit Semester (SKS), waktu studi minimum, mata kuliah wajib untuk mencapai hasil pembelajaran dengan kompetensi umum, proses pembelajaran yang berpusat pada mahasiswa, akuntabilitas asesmen dan perlunya diploma supplement (surat keterangan pelengkap ijazah dan transkrip). Pada seminar dan workshop hari kedua, Senin (26/8), USM

Indonesia menampilkan pembicara EmiliaTarigan, S.Pk, M.Kes yang juga Staf Ahli Dirjen Dikti. Sementara itu, Wakil Rektor I USM Indonesia Asima Sirait, SPd, MKes mengatakan, Seminar dan Workshop “Learning Outcome Lulusan dengan Standar Kerangka Kualifikasi Nasional Indonesia (KKNI)” sangat baik bagi para dosen atau tenaga pengajar karena dengan adanya KKNI akan mensetarakan standar kualifikasi pendidikan secara nasional. “USM Indonesia berharap dengan Seminar danWorkshop Learning Outcome Lulusan dengan Standar Kerangka Kualifikasi Nasional Indonesia akan melahirkan tenaga pengajar yang berkualitas,” kata Asima Sirait. Dia menambahkan, kegiatan ini dihadiri 120 dosen USM Indonesia termasuk ketua program studi dan para dekan. Diharapkan, hasil seminar dan workshop ini akan diterapkan dalam pengembangan mata kuliah, kurikulum, terutama meningkatkan capaian pembelajaran lulusan dari kampus ini. Saat ini, USM Indonesia memiliki tujuh fakultas terdiri dari Fakultas Ilmu Kesehatan dengan program studi Kesehatan

Masyarakat (S1), Keperawatan (S1), Ners (Profesi), Keperawatan (D3), Kebidanan (D3), Analis Kesehatan (D3) dan Teknik Elektro Medik (D3). Fakultas Matematika dan IPA dengan program studi Kimia (S1), Farmasi (S1) serta Ana-

lisa Farmasi dan Makanan (D3). Fakultas Ilmu Komputer dengan program studi Sistem Informasi (S1). Fakultas Psikologi dengan program studi Psikologi (S1). Fakultas Ekonomi dengan program studi Akuntansi (S1) dan Manajemen (S1).

Kemudian, Fakultas Ilmu Komunikasi dan Perpustakaan dengan program studi Ilmu Komunikasi (S1) dan Ilmu Perpustakaan (S1). Fakultas Hukum dengan program studi Ilmu Hukum (S1). USM Indonesia juga memiliki Program Pasca

Sarjana dengan program studi Kesehatan Masyarakat (S2). Kini, USM Indonesia terus berbenah dengan melengkapi berbagai fasilitas, sarana dan prasarana kampus sebagai penunjang segala aktivitas para mahasiswa.(m25)


DARI KIRI KE KANAN: Dekan Fakultas Keperawatan dan Kebidanan Janno Sinaga, SKp, M.Kp; Wakil Rektor III Karnirius Harefa, SKp, S.Pd, M.Biomed; Ketua Yayasan Sari Mutiara Drs.Washington Purba; Staf Ahli Dirjen Dikti Dr. Ir. Endrotomo, MT; Wakil Rektor IV Elisabeth Haloho, ST, MM dan Dekan Fakultas Ilmu Kesehatan Taruli Rohana Sinaga, SP, MM foto bersama usai acara seminar dan workshop di kampus tersebut.

Medan Metropolitan

WASPADA Kamis 29 Agustus 2013


Cuaca Masih Buruk Diguyur Hujan, Medan Tergenang MEDAN (Waspada): Badan Meteorologi Klimatologi dan Geofisika (BMKG) memperkirakan, hingga akhir Agustus 2013, kondisi cuaca di kawasan Medan dan sekitarnya masih buruk. Selama beberapa hari ke depan, hujan akan terus mengguyur pada pagi, sore maupun malam.

“Dibandingkan Juli, cuaca pada Agustus tergolong kurang stabil,” kata Mega Sirait, SP, Kepala Seksi Data dan Informasi pada BMKG Wilayah I Stasiun Meteorologi BandaraKualanamu saat dikonfirmasi, Rabu (28/8). Pada Rabu (28/8) pagi hingga siang, kawasan Medan dan sekitarnya diguyur hujan. Sementara, kondisi cuaca yang

Temu Kangen 31 Tahun Alumni 82 SMAN 8 Medan MEDAN (Waspada): Alumni angkatan 1982 SMA Negeri 8 (Smandel) Medan, Sabtu (31/8), menggelar temu kangen 31 tahun, setelah sekian lama tidak saling bertemu. “Sejumlah alumni yang kini menjadi tokoh penting di berbagai bidang sudah menyatakan kesediaan hadir pada temu kangen tersebut,” kata Koordinator Acara Sutio Budiman di Medan, kemarin. Acara digelar di Restoran Kenanga Jln. Djamin Ginting Medan mulai pukul 09:00 hingga 17:00 WIB. Di penghujung acara dilaksanakan musyawarah pembentukan pengurus Komunitas Alumni 82 Smandel Medan. Sebelum acara puncak, pada Jumat (30/8) pukul 16:00, dilakukan gladi resik yang dihadiri para koordinator kelas di lokasi acara. Menurut Sutio, kesuksesan acara akan sangat tergantung pada kepedulian serta partisipasi para alumni. “Mari kita saling bahumembahu untuk menyukseskan acara ini,” harapnya. Bagi para alumni yang ingin berpartisipasi dalam bentuk bantuan dana, kata Sutio, dapat mengirimkan donasi ke rekening Bank Mandiri nomor 1050011202813 atas nama Desliana Hasibuan selaku Bendahara Temu Kangen. Dijelaskan Sutio, sejumlah alumni Smandel Medan yang kini menjadi tokoh penting di berbagai bidang tersebar di Jakarta, Surabaya, Medan, Pematang Siantar dan lainnya. Susunan Panitia Temu Kangen, Ketua R Handy Oktaruna, Sekretaris Armaya Putra, Bendahara Desliana Hasibuan. Koordinator Acara Sutio Budiman, Humas Zulkifli Nasution, Konsumsi Martina dan Laniari, Dokumentasi Ilham dan Loyani, Publikasi Junaidi, dan keamanan Chairul Bahri.(m08)

PT KAI Sumut Terima Lokomotif Bekas MEDAN (Waspada): Jajaran PT Kereta Api Indonesia (KAI) Divre I Sumatera dapat kiriman tiga unit lokomotif bekas dari Pulau Jawa. Tiga unit lokomotif memiliki dua kali lipat kekuatan lokomotif yang ada selama ini, untuk operasional kereta api (KA) barang. Humas PT KAI Sumut Rapino Situmorang saat dikonfirmasi via telpon selular, Selasa (27/8), membenarkan tiga lokomotif tersebut dikirim dari Jakarta menggunakan kapal laut dan beberapa hari sebelumnya tiba di Belawan. Ke tiga unit lokomotif tersebut CC 201.8312, CC 201.8904, dan CC 201.8910. Dimana Lok CC 201.8312, merupakan Lok yang biasa beroperasi di wilayah Daerah Operasi (Daop) V Purwokerto. Sementara dua Lok lagi, biasanya beroperasi di Daerah Operasi (Daop) Jakarta. Ketiga Lokomotif tersebut rencananya akan digunakan untuk pengangkutan barang berupa Crude Palm Oil (CPO) Bahan Bakar Minyak (BBM) dan lateks. Dengan kekuatan daya tarik sebesar dua kali lipat dari kekutan lokomotif yang ada saat ini, lebih efisien dalam operasional angkutan barang. Menurut Rapino, bila kereta barang bisa berjalan dua kali, maka dengan adanya Lok CC 201, akan menjadi sekali angkut, menghemat waktu dan biaya operasional. (m32)

sama terjadi pada Senin (26/8). Hal ini menyebabkan sejumlah ruas jalan dan pemukiman penduduk di Kota Medan digenangi air setinggi 5 hingga15 Cm. Mega kembali mengingatkan masyarakat tentang ancaman banjir kiriman dari hulu sungai seiring meningkatnya intensitas hujan sejak beberapa hari terakhir. Intensitas hujan semakin meningkat khususnya di kawasan pegunungan dan pesisir Timur seperti Medan, Deliserdang, Karo, Taput, Simalungun dan Toba Samosir. Di kawasan Medan dan sekitarnya, akan terjadi hujan deras disertai petir dan angin kencang. Sementara kecepatan angin bisa mencapai 20-25 knot atau sekitar 50 km/jam khususnya di wilayah Medan, Deliserdang, Sergai dan Simalungun. Kendati demikian, kata Mega, kondisi cuaca ini belum berpengaruh terhadap pergerakan pesawat baik saat landing (mendarat) maupun take off (terbang) pada rute internasional maupun dalam negeri melalui Ban-

dara Kualanamu.

Tergenang Sementara itu, hujan deras yang mengguyur Kota Medan, Rabu (28/8) pagi sejak pukul 07:30 hingga 09:30 membuat sejumlah ruas jalan dan pemukiman penduduk tergenang. Pantauan Waspada, Rabu (28/8), sejumlah ruas jalan yang digenangi air yakni Jln. Thamrin, Jln. Sutomo kawasan Pusat Pasar dan Jln. Sutomo Ujung, Jln. Asia, Jln. Timor, Jln. Denai, Jln. Mandala Bypass, Jln. Letda Sujono dekat tol Belmera, Jln. Sejati, Jln. Sudirman dan lainnya. Genangan air paling parah terlihat di sebagian ruas Jln. Thamrin dan Jln. Denai. Banjir di Jln. Denai nyaris merata di sepanjang jalan tersebut. Hal ini disebabkan saluran drainase di kawasan tersebut tidak berfungsi. Seorang pengemudi mobil, Syafruddin Lubis alias Acil mengaku resah saat melintasi Jln. Denai karena terjebak banjir. “Untung saja mesin masih bagus sehingga mobil tidak mogok di tengah jalan saat banjir,” sebut Acil. (m32/h04)

Daftar Pemilih Pemilu Di Sumut Bermasalah MEDAN (Waspada): Pemutakhiran data pemilih pemilihan umum legislatif di Sumatera Utara dari Daftar Pemilih Sementara (DPS) ke DPS Hasil Perbaikan (DPS HP) belum maksimal, bahkan yang meninggal dunia masuk dalam daftar pemilih. “Masih ditemukan pemilih yang sudah meninggal dunia,” kata Perwakilan Panitia Pengawas Pemilihan Umum (Panwaslu) Labuhanbatu Selatan, dalam kegiatan monitoring dan evaluasi di Hotel Soechi Medan, Senin (26/8). Sedangkan Panwaslu Kota Tanjungbalai menyampaikan pengurangan jumlah dari 3.118 menjadi 2.988 di desa yang berada di Kecamatan Keramat Kubah. Ada pengurangan 130 orang. Sementara. Ketua Badan Pengawas Pemilihan Umum (Bawaslu) Sumut Syafrida R Rasahan mengatakan, monitoring dan evaluasi Bawaslu RI datang ke Medan untuk menghimpun hasil monitoring Panwaslu Kabupaten/Kota di Sumut. “Terungkap masih ditemukan pemilih ganda, pemilih

yang belum usia 17 tahun dan belum pernah menikah, tidak ada nomor induk kependudukan pada DPS HP,” sebutnya. Persoalan lain, penyelenggara Pemilu tingkat Panitia Pemilihan Kecamatan (PPK), Panitia Pemungutan Suara (PPS) tidak menyampaikan hasil penetapan DPSHP kepada Panwaslu. “Ada yang tidak pleno di tingkat PPS. Ada juga yang tidak diumumkan sebagaimana perintah undang-undang,” ujarnya. Sedangkan alasan penyelenggara tidak menyampaikan salinan DPSHP sangat klasik, tidak tersedia anggaran penggandaan.“Hasil monitoring dan evaluasi ini dihimpun dan disampaikan ke Bawaslu RI,” tuturnya. Divisi Pengawasan Bawaslu Sumut, Aulia Andri menambahkan, Bawaslu belum membuat kesimpulan, namun dari laporan Panwaslu Kabupaten/Kota banyak ditemukan persoalan yang harus menjadi perhatian KPU. “Kita meminta KPU serius membenahi DPS,” kata dia. (m34)

HWK Medan Gelar Pengobatan Gratis MEDAN (Waspada): Himpunan Wanita Karya (HWK) Kota Medan menyelanggarakan bakti sosial dalam bentuk pemeriksaan dan pengobatan gratis serta pembagian sebanyak 500 paket sembilan bahan pokok (Sembako) kepada warga kurang mampu di Pendopo Bambu Kuning Jln. Pancing/Suasa Tengah Lingkungan IV, Mabar Hilir, Kec. Medan Deli, Rabu (28/8). Bakti sosial pemeriksaan dan pengobatan gratis serta pemberian Sembako kepada 500 masyarakat kurang mampu di Mabar Hilir, Medan Deli ini, dirangkaikan dengan acara pelantikan pengurus HWK Kota Medan priode 2013-2013. Ketua HWK Kota Medan Dra Ainal Mardiah mengatakan, bakti sosial ini sebagai bentuk rasa kepedulian terhadap masyarkat yang kurang mampu. “Ini salahsatu bentuk kepedulian kita selaku pengurus HWK Kota Medan, sebab ternyata cukup banyak masyarakat di Kelurahan Mabar Hilir ini yang butuh perhatian terutama dalam hal kesehatannya,” ujar Ainal Mardiah di sela-sela acara bakti sosial tersebut. Menurut anggota DPRD Medan dari Faksi Partai Golkar ini, acara bakti sosial dan penyerahan paket Sembako kepada masyarakat kurang mampu ini juga dirangkaikan dengan pelantikan pengurus HWK priode 2013-2015. “Mudah-mudahan dengan diadakannya kegiatan ini, ada perhatian pemerintah terhadap kesehatan masyarakat di daerah ini, sebab dilihat begitu antusiasnya masyarakat yang datang menunjukkan betapa mereka sangat membutuhkan perhatian,” tuturnya. Ainal Mardiah yang juga calon legisltif (Caleg) DPRD Medan untuk Daerah Pemiilihan (Dapil) V ini mengatakan, HKW yang merupakan bagian dari Partai Golkar ini akan terus menunjukkan kepeduliannya kepada masyarakat kurang mampu yang ada di Kota Medan. “HKW yang merupakan bagian dari Partai Golkar akan terusmenunjukkankepeduliannyakepadamasyarakatkurangmampu yang ada di Kota Medan, sebagaimana yang sering dilaku-kan Dewan Pimpinan Daerah (DPD) Partai Golkar Kota Medan,” katanya. Artinya, kata dia, kegiatan seperti ini tidak hanya dilakukan di Kecamatan Medan Deli saja, tapi mungkin juga di kecamatan lain yang ada di Kota Medan, sebab HWK Kota Medan meliputi 21 kecamatan, sehinga diharapkan kegitan sosial ini dilaksanakan secara bergilir. Dia berharap apa yang dilakukan HWK Kota Medan hari ini dapat bermanfaat bagi masyarakat. “Saya berharap apa yang dilaksanakan HWK hari ini dapat bermanfaat bagi masyarakat, dengan harapan yang sakit lekas sembuh,” sebutnya. (m30)


KETUA HWK Dra Ainal Mardiah didampingi pengurus lainnya foto bersama disela-sela pengobatan gratis.

Waspada/Amir Syarifuddin

SEKDAPROVSU H Nurdin Lubis dan sejumlah staf foto bersama pimpinan SMA Unggulan CT Foundation yang berkunjung ke Kantor Gubsu.

Sekdaprovsu Apreasiasi SMA Unggulan Untuk Anak Kurang Mampu MEDAN (Waspada): Sekretaris Daerah Pemerintah Provinsi Sumatera Utara (Sekdaprovsu) H Nurdin Lubis SH, MM mengapresiasi CT Foundation yang telah mendirikan sekolahu unggulan untuk anak kurang berkemampuan secara ekonomi. Hal itu ditegaskan Sekdaprovsu saat menerima audiensi rombongan Sekolah Menengah Atas (SMA) unggulan CT Foundation di ruang kerja Kantor Gubsu, Selasa (27/8). “Pemprovsu memberikan apresiasi kepada pihak CT Foundation yang mendirikan sekolah dan pendidikan untuk korban tsunami dan masyarakat yang kurang mampu sehingga bisa melanjutkan sekolahnya,” katanya. Sekda berharap, SMA CT Foundation juga dapat mendukung visi dan misi Sumatera Utara menjadi provinsi yang berdaya saing dengan menciptakan SDM yang unggul dan berkualitas. “Berbicara daya saing tentu harus ada sumber daya manusia yang handal. Untuk itu sangat diperlukan upaya mencetak SDM unggul sebagai ujung tombaknya,” ujarnya. Kepsek SMA CT Foundation Drs Daulat Siregar MPd, MSi menjelaskan, kedatangannya untuk melaporkan keberadaan sekolah CT Foundation yang terletak di Jln. Veteran Psr VII Manunggal-Labuhan Deli. Sekolah ini sudah berjalan 3 tahun dan lulusan pertama SMA CT Foundation berhasil lulus 100 % dengan jumlah 50 siswa, 44 di antaranya masuk ke Pergu-

ruan Tinggi Negeri (PTN) favorit. “SMA CT Foundation merupakan sekolah bagi para anak korban tsunami dan kurang mampu yang dilihat dari tingkat kemiskinan dan intelektualnya,” sebutnya. Daulat mengatakan, sekolah ini juga sering mewakili Sumatera Utara, dalam mengikuti olimpiade ke berbagai negara. Mereka berharap Pemprovsu ikut serta mendukung kemajuan pendidikan di SMA CT Foundation. Menurut dia, SMA Unggulan CT Foundation adalah sebuah lembaga pendidikan yang memberikan beasiswa kepada siswa siswi tamatan SMP dan MTs yang lulus seleksi. Beasiswa meliputi seluruh biaya pendidikan dan biaya hidup selama masa pendidikan di SMA Unggulan CT Foundation. SMA ini diresmikan pada 18 Juli 2010 oleh Gubsu dan Ketua CT Foundation Ibu Anita Chairul Tanjung. “Tujuan SMA Unggulan CT Foundation yaitu mengentaskan kemiskinan di Sumut dengan memutus mata rantainya melalui pendidikan dan beasiswa penuh, sehingga kemiskinan bukan menjadi kendala dan halangan bagai anak-anak di Sumut untuk menjadi pribadi yang pintar, cerdas, beretika, memiliki etos kerja yang tinggi, dan berjiwa entrepreneur,” tuturnya. Turut hadir dalam audiensi ini Asisten III Pemprovsu Arsyad Lubis, Kabid Aptel Elly Suhayriah, Mewakili Kadisdik Provsu Henri Siregar, Mewakili Biro Binsos Rosmawaty.(m28)

Waspada/Rizky Rayanda

TERGENANG: Hujan deras yang mengguyur Kota Medan, Rabu (28/8) pagi, menyebabkan ruas Jln. Thamrin digenangi air. Terlihat seorang pelajar SD harus menjinjing sepatunya saat melintasi genangan air saat pergi ke sekolah.

Camat Dinilai Tidak Peduli Kondisi Jalan Dan Drainase BELAWAN (Waspada): Camat Medan Belawan Khaidir Said dinilai warga tidak peduli dan tidak serius dalam mengupayakan perbaikan jalan dan drainase di wilayah kerjanya. Pasalnya, walau telah pernah didemo, kondisi Jln. Yos Sudarso, persisnya persimpangan Sicanang tetap belum diperbaiki dan drainasei di Belawan banyak yang tumpat atau tidak berfungsisebagaimanamestinya. “Camat tidak serius dan terkesan hanya menunggu perintah tanpa berusaha berjuang untuk memperbaiki jalan dan drainase yang sangat parah di Belawan ini,” kata H Irfan, pemuka masyarakat Belawan, melalui telepon kepada Waspada, Rabu (28/8). Menurut Irfan, lambatnya perbaikan jalan persimpangan

Sicanang tidak terlepas dari kurang mampunya Camat Medan Belawan dalam menyampaikan keinginan warga kepada pemerintah. Sebab jika hanya melayangkan surat tanpa sering diingatkan kepada pejabat yang berkompeten perbaikan jalan dan drainase Belawan tidak akan terwujud. “Seharusnya beliau jemput bola jangan hanya duduk manis di kantor menunggu bola datang,” ujarnya. Selain itu, kata dia, kinerja 11 anggota DPRD Kota Medan asal DapilV yang sekarang, sama dengan camat. Selama 11 anggota dewan itu menjadi wakil rakyat maka pembangunan di Kec. Medan Belawan nyaris tidak ada. Namun, pernyataan itu dibantah Camat Medan Belawan Khaidir Said. Ketika dikonfir-

masi Khaidir mengatakan, sejak adanya unjukrasa warga sekitar bulan Juni lalu, pihaknya telah dua kali menyurati BalaiWilayah Jalan Sumatera I mengenai kondisi jalan Simpang Sicanang itu. “Dalam surat itu juga kita lampirkan foto kondisi jalan, namun sampai sekarang belum ada jawaban,” sebutnya. Disinggung tentang drainase, Khaidir mengaku sering melakukan gotong royong untuk memperbaikinya. Namun, mengingat kondisi Belawan yang sering tergenang air pasang, permasalahan itu tetap tidak tuntas selama tidak ada pembentengan di sepajang pantai Belawan. “Jadi selama pantai Belawan tidak dibendung maka masalah drainase atau genangan air tidak akan tuntas,” tuturnya.

Terpisah, anggota DPRD Sumut M Nasir mengatakan, prihatin dengan kondisi jalan di persimpangan Sicanang tersebut dan meminta Kepala Balai Wilayah Jalan Sumatera I khususnya Satker Kota Medan, untuk segera mengambil tindakan perbaikan yang bersifat sementara sebelum dilakukan perbaikan permanen. “Perbaikan awal perlu segera dilakukan mengingat saat ini banyak sekali lobang yang menganga di jalan itu,” katanya. Bahkan, akibat kondisi jalan yang sudah sangat rusak parah itu, sering terjadi kecelakaan akibat pengendara sepedamotor terjatuh di kubangan jalan, selain itu menjadi langganan kemacatan yang memperlabat pengiriman barang dari dan ke dalam Pelabuhan Belawan. (h03)



1 CM Rp. 13.200 1,5 CM Rp. 19.800

2 CM 3 CM


AUTOMOTIVE Informasi Pembaca

Bursa Automotive


: : : : :

Air Condition Ban Radial Central Lock Nippon Denso Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing :Electric Window


GRANMAX Pu Dp 25.500.000 Angs 2.054.000x47 Xenia(double blower)Dp37.500.000 Angs 3.284.000x59 Dp 38.500.000 Angs 3.723.000 x 59 Terios Dp SUdah Bersih (Tinggal Keluar Unit). Proses 1 Hari. Hub : 0852 7759 8975 / 77598969 DAIHATSU ROCKY Thn 93. Hitam, 4 x 4, Harga Damai. Hub. 0853 7234 4929 DAIHATSU TERIOS TX Thn 2008. Hitam Met, Bk Medan, Ada Tv, Dijual / Bisa Kredit. Hub. 0823 6332 9592

DAIHATSU XENIA Li Sporty (1000 cc) Thn 2007. Hitam, Bk Medan, 1 Nama dari baru, Rp. 105 Jt/Nego. Hp : 081 5306 5120 FORD RANGER PU 4 X 2 2010. Hitam, Bk Asli, Satu Tangan, Jarang Pakai, B.U, TP. Hubungi : 0852 6100 5716 Harga 115 Jt Nego

Rp. 26.400 Rp. 39.600

4 CM 5 CM

Rp. 52.800 Rp. 71.500

OVER KREDIT MOBIL HONDA CITY Th 2013. Type Paling Tinggi “Reclining”. Ganti Dp 130 Jt. Sudah dibayar 7 Bulan (Nego). Hub. Joko 0821 6830 0100 HONDA CITY 1,5 EX1 Matic Thn 98 (Over Kredit). Silver Met, Mulus, Dp 37 Jt (Nego), Sdh Byr 13 Bln, Sisa Angs 2,3 Jt x 23 Bln. NB : Bisa Tkr Tmbh dgn Mobil yg lbh Murah/Spd Motor, SUZUKI CARRY 1,0 Adi Putro Thn 95, Merah Met, (Pintu Belakang), Mulus, 4 Ban Baru, Bk Medan (Mutasi), Hrg 35 Jt (nego), Kredit Dp 16 Jt, Angs 920 Rb x 35 Bln. Hub : 0811 635 367 - 77756757 Jl. Sm Raja Km 9,5


MITSUBISHI KUDA SUPER EXCEED Thn 2000. Coklat Muda, Bk Medan, 85 Jt Nego, Siap Pakai. Hub 0853 5978 4554


INFO : PANTONI 0812 6558 178 SUZUKI KATANA GX 95. Merah Maron, Vr, Tr, Original, Kondisi Bagus, 48 Jt. Hub. 0813 6106 7593 TOYOTA KIJANG SUPER G 95. Biru, Kondisi Siap Pakai. Harga 50 Juta. Hub. 0813 6106 7593

SUZUKI CARRY MINIBUS Th 85. Warna Merah, Dijual Segera, B. U. Harga Rp. 14.500.000 Damai. Hub. 0813 7086 5875 SUZUKI KATANA GX 2004. Hiaju Metalik, Bk Medan Asli, Ban Baru simex 31’, Shock Procomp 1 Set, Gaya Offroad, Ac, Tape, Jok Kulit, Over Kredit Balik Dp 45 Jt, Sisa 24 x 1.680.000. Hp : 0852 1090 8422

6 CM 7 CM

Rp. 85.800 Rp. 100.100


8 CM Rp. 114.400 9 CM Rp. 138.000


SUZUKI CARRY MB Thn 98. Warna Hitam, Ac, Db, Bk Mdn, H : 45 Jt. Hp : 0852 0771 6414


TOYOTA KIJANG JANTAN Thn 1990. Biru, Bk Medan Asli, Lengkap, Siap Pakai, Hrg 43 Juta/Damai. 0812 6545 1974


TOYOTA AVANZA G ‘11. Wrn Hitam Metalik, Pajak panjang, 1 Nama, Rp 138 Jt. Hub : 0815 3373 3688 / 7851402 TOYOTA INNOVA G Bensin Th’08 Manual, W. Silver Metalik, Pakai TV, Soundsystem, Km 60 xxx, Mobil Ctk, 1 tangan dari Baru, Rp. 178 Jt. Depan Sekolah Eria No. 200. 0821 6767 7000 / 7851402


Office : Rp 55000 Membuat Toko Online : Rp 55000 Design Grafis : Rp 55000 3Dsmax : Rp 55000 Adobe Flash : Rp 55000 Membangun Jaringan : Rp 59000 AutoCad : Rp 60000 Visual Basic Net : Rp 60000 Menerima Pendaftaran Reseller/Agen di seluruh Indonesia Bagi Pihak Sekolah & Pihak Kampus ingin Kerjasamanya Bisa Hub Kami. Datang segera ketoko kami :

Jl. Marelan V Pasar II Barat Lingk III Terjun Gg Keluarga II No.10 Medan Jl. Pasar Nibung Perumahan Griya Indrapura Asri Blok C9 Kab Batu Bara HP : 0 8 1 3 6 1 4 0 1 0 1 8 / 0 8 7 7 4 4 7 5 5 9 3 7 w w w. e y h a n k o m p u t e r. n e t

10 CM Rp. 154.000 11 CM Rp. 181.000

12 CM Rp. 198.000 6x6,6 kolom Rp. 132.000

Kamis, 29 Agustus 2013





(Personal Transformation Program Reguler Medan)

Informasi Pembaca Bursa Property G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

Di Pandu oleh Trainer ESQ Licenced Bpk. Ary Ginanjar Agustian

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

31 - 01 September 2013 Hotel Madani

Komp. Villa Mutiara Blok B.20 Jl. Bajak V Gg. Bahagia Medan Amplas. Hp. 0853 5507 8888 / 0853 5844 8888


TOYOTA KIJANG KAPSUL LGX Th 2003. W. Hitam Metalic, Ac Dbl, Tape, Vr, Br, Ps, Pw, Cl, Jok Kulit, Body Kaleng, Mulus. H. Nego. Hub. 0813 7582 3555


JL. Flamboyan Raya Komplek Waikiki Blok E No. 7 Tanjung Selamat. Uk : 4 x 14 (SHM). Telp : 061 4533745, 06177577333

TOYOTA KIJANG JANTAN Th 90/91. W. Hijau Metalic, Vr, Ban Baru, Cd, Sangat Mulus, Rp. 39 Juta (nego). Hub : 0853 6172 0189

SEWA RUKO MURAH Ruko Strategis 3 TKT, Jl. B. Katamso No 436, Siap Huni, Simp. Pelangi Rp. 32 Jt/NEGO/Thn. Hub. 0823 6521 2693 / 0852 9666 3403

BUTUH DANA SPESIALIS DANA CEPAT Proses 3 Jam Cair, Tanpa USaha, Surat Terjamin, Jaminan : SHM, SK Camat, HGB, BPKB Mobil, Spd Mtr, Truk, Mobil Kredit/ Over Leasing, Bantu Pelunasan BPKB, UP : Family Finance : Bpk Ray 0813 7044 6633.0813 7044 6668


HILANG Surat Akte Perjanjian Akan jual beli Tgl 4-6-1990 No. 25. Surat Pengikatan Jual-Beli Tgl 4-6-1990 No. 22 Di Buat Notaris A/N Drs. ADE RACHMAN MAKSUDI TELAH HILANG

Surat tanah nomor 592.2/396/HP.VI/2001 A/N Hayani terletak di Dusun I, Desa Lama Hamparan Perak. Diperkirakan Hilang saat mandah dari Marelan ke Desa Lama Tahun 2003-2004. Bila ada menemukannya, mohon kembalikan ke alamat LK VI, Jl. Jala XI, Gg Arjuna, Kel Rengas Pulau, Kec Medan Marelan


STUK. Bk 8975 Bk. No uji : MDN 03724 C. A/N : Rezi Puspita. Alamat : Jl. Garu III No. 163 B. Medan Amplas. Merk : Mitsubishi


STUK. Bk 9268 BL. No uji : JKT. 550000. A/N : Rosli. Alamat : Jl. Pelita No. 9 B Medan. Merk : Mitsubishi


SURAT AKTE JUAL BELI No. 75. Tgl 30 Agustus 1985. Notaris A/N ZULFIKAR S.H TELAH TERCECER TELAH TERCECER Satu Buah Surat Tanah / Akte Ganti Rugi No. 78/MT/1975. Sekitar Jl. Jamin Ginting, Jl. Ngumban Surbakti. AN : CARA SEMBIRING Alamat Komplek Smp Negri 19 Simalingkar B Medan. Hp. 0813 6118 8800 HILANG / TERCECER - STNK Bk 1875 JN - SIM A atas nama Sudewi. Dra tercecer di Jl. Setiabudi Bagi yang menemukan akan diberikan hadiah sepantasnya dan tidak akan dituntut atau hubungi No Hp. 0821 6657 8272

RUMAH DISEWAKAN Di Perumahan Tata Alam Asri Gaperta, 3 KT, 2 KM, Carport. Hub : 0853 6221 1688


Jl. Pahlawan No. 90 Medan. Ukuran 8 x 23 M, SHM, Cocok untuk di Bangun 2 Ruko. Harga 700 Jt (Nego). Hub. 0821 6563 0200


Dijual rumah kost mewah model minimalis dilokasi strategis jumlah kamar sebanyak 12 kamar, lengkap sprinbed, Ac & Tv Didalam Kamar, ada kamar mandi, Lokasi Parkir Luas, ada rumah induk Jl. Cemara No. 122 Rantau Prapat & SHM, Harga 1,4 M (Bisa Nego) Dan Dijual ruko dilokasi strategis Pajak Baru, Jl. Gelugur No. 61 SHM, Rantau Prapat, harga Rp. 800 Jt (Bisa Nego) Maaf Tanpa Perantara. Hub : Leo 0813 9676 0761 DIJUAL RUMAH BESAR, MEWAH

Halaman Super Luas, Tanah Uk 30x50.Tembok Keliling ABCD di sertifikat Uk. 30 x 36 m. Sertifikat Hak Milik, Bisa Bangun Kolam Renang atau rumah sewa kopel 10 unit buat air pam, dll. di Jl. Purwosari No. 131 Medan dekat cemara asri dan cemara hijau. Harga 3,8 M Nego. Siapa cepat dapat. Hub. 0813 7748 9000/ 0853 6189 0150

Feel the experience & Cp Suhadi : 0813 6351 6751 Get the meaningful life Muhammad Barli : 0853 6115 9497 Office : Jl. Gaperta // Manaf Manaf Lubis Lubis No. No. 25 25 CC (061) 800 21 21 102 102






PT. CTW, Perusahaan yang sedang berkembang membutuhkan karyawati untuk menempati posisi sebagai : SEKRETARIS/ADM/MARKETING Persyaratan : * Pendidikan SMK, D1-3, S1. * Wanita, usia max 27 thn * Sehat, penampilan bersih, rapi & menarik. * Mampu mengoperasikan komputer (Ms Office, Coreldraw, dll). * Mempunyai kemampuan komunikasi dan manajemen yang baik. * Bekerja keras, jujur & bertanggung jawab. Lamaran lengkap beserta CV, pasfoto 4x6, no telp.hp, dikirim paling lambat tgl. 10 Sept. 2013 ke PT. CTW, Jl. Karya Bakti No. 52 Medan 20143, Medan Johor. KLINIK TRADISIONAL ALAT VITAL DITANGANI LANGSUNG A.H. AMARUDIN DARI BANTEN

Metode pengobatan dengan cara ditotok dibagian syaraf dan kelemahannya dan diberikan Ramuan/ Jamu, 100% alami tidak ada efek samping bebas usia, bebas untuk semua agama, REAKSI DITEMPAT KHUSUS PRIA: - Panjang: 13, 15, 16, 18, 20 - Besar: 3, 4, 5, 6 - Impotensi - Kurang Keras/Ejakulasi dini - Tidak punya keturuan - Hernia KHUSUS WANITA: - Memperbesar payudara - Mempersepit vagina KONSULTASI UMUM: - Buka Aura - Pengasihan/penglarisan usaha - Masalah rumah tangga - Ingin dapat jodoh/pelet Alamat: Jl. SM. Raja depan Hotel GARUDA PLAZA samping Klinik BUNDA Gg. Keluarga No. 13C HP. 0812 6057 6444


Ditangani Langsung M.Syamsudin, Anak Pertama Ibu Hj. IROH

Pengobatan dengan menggunakan cara ditotok/ kusuk, syarat-syarat yang berhubungan dengan keluhan masingmasing pasien, dan diberikan ramuan-ramuan tradisional yang telah kami olah secara alami sehingga bebas dari efek samping, Hasil Permanen. Khusus Pria : Reaksi Langsung Khusus Wanita dibuktikan - Mengencangkan - Penyakit Gula Bisaditempat Payudara - Impotensi - Mempersempit Vagina - L. Syahwat/ Mani Encer - Menurunkan berat badan - Tambah Ukuran 3,3-3,4-3,5 - Sulit Punya Keturunan, dll

- Tambah panjang 3,4,5,6 cm - Hernia/ Turun Bro, dll

Alamat : Jl Sm Raja, Masuk Jl. Utama No. 18 Medan (+/- 100m dibelakang Toko Roti Majestik) Hp. 0813 1868 4589



Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama Ust. M. OTONG

Bila anda ingin perkasa ingat jangan sampai salah masuk, carilah yang benar-benar pewaris ilmu mak Erot sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful sudah terkenal di seluruh Indoneisa dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak Erot SUDAH TIDAK DIRAGUKAN LAGI KEBERHASILANNYA, INGAT untuk kaum pria jangan sampai anda terhina kaum wanita karena kondisi alat vital yang kurang sempurna KHUSUS WANITA: KHUSUS PRIA: - Ejakulasi dini - Ingin punya keturunan - Impotensi - Memperkencang & memperbesar payudara - Memperpanjang “Alvit” - Keras dan tahan lama, dll - Memperbesar “Alvit” DIJAMIN 100% KONSULTASI UMUM: HANYA TEMPAT - Buka aura KAMI KLINIK - Cari jodoh MAK EROT - Pelaris - Mencari orang hilang JL. LAKSANA NO. 55 J MASUK DARI JL. AMALIUN YUKI SIMPANG RAYA MEDAN (PRAKTEK TETAP) HP: 0812 4038 333 -







Wanita Gadis/Janda Mjd : Pengasuh Anak, Prwt Orang Sakit, Prt Gaji 1 Jt s/d 1,6 Jt/Bln (Bersih) Makan, Asrama Gratis. Hub : “Cahaya “ Jl. Helvetia Raya 6, 0852 6207 9555 Mdn

TANAH Sebidang Tanah, yg terletak di Jl. Kapt. Sumarsono Masuk Karya Bakti 1 No. 83, Medan, Luas Tanah 2.683 m2, Hrg Jual 2.250.000/m (nego tanpa perantara), Hub 0812 7107 9999 JUAL TANAH KAPLING 7 X 19 M dan 7 x 22 M. Harga 350 Rb/m, nego. Psr 7 Simp Jodoh, Jl. Makmur Gg. Sidomulyo. Hub : 0852 6209 4949


Jalan Benteng Hilir III Desa Bandar Khalifah Kec. Percut Sei Tuan. Uk. 10 m x 20 m. Hub : 0813 1535 9044



Menerima cepat P/W (17-38 thn) untuk diposisikan di “Kantor” min. SMU/SMK Sederajat mahasiswa/i pengalaman kerja tidak di utamakan. penghasilan Rp. 2.500.000-/Bln Hub : Bpk MARCHEL RAMBE SE/ IBU IRAWATI HP : 0853 6241 0606 / 0852 0775 4768 Alamat kantor : Disamping Medan Plaza belakang Macan Mart No. 120 Syarat : F.C KTP + GUntingan Iklan untuk mendaftar / Interview




LOWONGAN KERJA Kami Perusahaan yang bergerak di bidang Chemical membutuhkan bagian Engineer dengan persyaratan sbb : * Pria * Min D3 Teknik Kimia / Teknik Industri * Bersedia dinas keluar kota namun berbasis di Kota Medan * Mohon Cantumkan Kode “BWT” * “Lamaran paling lambat kami terima 1 (satu) minggu sejak iklan diterbitkan



Guru Matematika, Bahasa Inggris, Fisika, & Komputer. Kirim CV. ke Saint Mark Jl. Letda Sujono No. 153 / Simp. Aksara (061) 7355303


Daftarkan segera !!! Anda, Keluarga, & Sahabat

Tingkat pertama Dan Bergabunglah dalam ESQ FAMILY training ESQ ini, akan mengubah paradigma anda akan arti sebuah kebahagiaan dan pekerjaan. Jika selama ini kita memaknai kebahagiaan sebagai sesuatu yang bersifat materi dan emosional, maka melalui training ini kita akan diajak menemukan kebahagiaan lain yaitu spiritual happiness, sehingga hidup menjadi lebih bernilai dan bermakna (meaning & values)


Ruko 2 (dua) Pintu Uk. 11 M x 27 M. Status : SHM Letak di Jalan Negara Medan - Lubuk Pakam. DS. Km 24 - Sebelum RS U- Medistra Harga Rp. 900 Juta. Hub. 0821 6387 6242


Avanza Dp 42 Jt......Angs 2,4 Jtan Innova Dp 57 Jt.......Angs 3,6 Jtan Fortuner Dp 102 Jt....Angs 6 Jtan Rush DP 50,6 Jt... Angs 3,1 Jtan Hub : Josua Tobing / 0813 2772 6052

Info Iklan Hub. 0811 604 690



Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo, Genset Hub. SURYA TEKNIK SERVICE


061-7725 4947 - 0813 7589 8757 Siap Ketempat




Spring Bed 6 kaki 2 lapis Rp. 1.250.000 Spring Bed 5 kaki 2 lapis Rp. 1.200.000 Spring Bed 4 kaki 2 lapis Rp. 1.100.000 Spring Bed 3 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki Dorong Rp. 1.150.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188 TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188



DIGITAL Keterangan lebih lengkap silahkan hubungi:

TELPON : 061 - 4576602 FAX : 061 - 4561347 * Format: JPG - TIFF (Photoshop)


WASPADA Kamis 29Agustus 2013


Konvensi Capres PD Untuk Tahan Tekanan Internal JAKARTA (Waspada): Pakar hukum tata negara Refly Harun menilai pelaksanaan konvensi capres Partai Demokrat (PD) diduga hanya untuk menahan tekanan dari internal Demokrat. Sementara capres dari internal PD sendiri dalam banyak survei elektabilitasnya tak pernah naik dan tertinggal jauh dengan peserta konvensi dari luar PD. “Masalahnya akan menjadi paradoks, kalau pemenang konvensi belum tentu dinominasikan menjadi capres Demokrat. Juga apa maknanya konvensi kalau Demokrat belum tentu lolos parliamentary threshold (PT) dan Presidensial Threshold (PT)?” tanya Refly Harun dalam diskusi “Konvensi, Solusi Menjaring Pemimpin Bangsa” bersama Direktur eksekutif Pol-tracking Institute HantaYudha, dan anggota DPD

RI Juniwati T. Masjchun Sofwan di Gedung DPD/MPR RI Jakarta, Rabu (28/8). Menurut Refly, itu dilema bagi Demokrat, yang juga tak mungkin akan menghapuskan PT presiden, karena konvensi akan kehilangan makna. Oleh sebab itu dia mengusulkan sebaiknya PT presiden itu dihapus. “Persoalannya judicial review itu ditolak Mahkamah Konstitusi (MK). Sehingga selama menggunakan konstitusi PT presiden itu harus diikuti,” katanya. Untuk Pilpres 2014 mendatang, menurut Refly, dengan PT presiden dan PT DPR RI, maka capres yang akan muncul maksimal ada 4 pasangan. Golkar sudah jelas dengan Aburizal Bakrie (ARB), PDIP tergantung Megawati, Demokrat tunggu konvensi, dan keempat sebagai alternatif gabungan parpol dengan mencapreskan Jokowi atau Prabowo. “Jadi, rakyat sebenarnya menunggu kejutan-

kejutan capres alternatif dari konvensi Demokrat. Tapi, kalau yang muncul kemudian orangorang itu saja, maka tak ada capres yang menjadi kejutan,” pungkasnya. Hanta Yudha meragukan konvensi capres yang digelar Partai Demokrat (PD), jika hasil konvensi itu bisa diveto oleh Ketua Mejelis Tinggi PD Susilo Bambang Yudhoyono (SBY). Apalagi mekanisme penjaringannya tertutup, misalnya mengapa nama ini bisa masuk, dan itu tidak masuk? Kriterianya juga tidak jelas, di mana tak ada pelibatan publik dalam penentuan nama-nama yang masuk konvensi capres PD tersebut. “Anehnya, konvensi capres di Indonesia ini selalu by accident, seperti Golkar dulu karena muncul Akbar Tandjung, dan Demokrat kini akibat citranya terpuruk. Hanya saja kalau proses pembobotannya jelas, maka perlu diapresiasi,

tapi kalau penentu akhirnya ada di tangan SBY, tentu disayangkan,” ungkapnya. Hanta mempertanyakan apakah konvensi capres PD itu sama dengan proses Kongres di Bali atau Bandung. “Mungkinkan SBY menghendaki bukan orang-orangnya dan benarbenar berdasarkan nama-nama yang beredar selama ini. Kita tahu bahwa konstelasi politik pencapresan itu didominasi dan dikendalikan oleh parpol. Jadi, peran parpol sangat kuat, dan dikuasai segelintir elit atau oligarki politik,” tuturnya. Irman Gusman Menunggu Nasib Sementara itu anggota DPD RI dari Dapil Provinsi Jambi, Juniwati T. Masjchan Sofwan berharap Ketua DPD RI Irman Gusman banyak berdoa agar bisa lolos dalam konvensi capres Partai Demokrat mulai September 2013 mendatang.

Selama ini nama Irman memang selalu disebut-sebut dan telah mendapat undangan dari PD untuk mengikuti konvensi capres PD tersebut. “Kita sebagai senator tentu mendukung Pak Irman Gusman untuk mengikuti konvensi capres PD. Karena itu, selain merupakan garis tangan, nasib dan takdir jika lolos konvensi, beliau juga harus banyak berdoa agar benarbenar lolos dalam konvensi partai Presiden Susilo Bambang Yudhoyono itu,” saran Juniwati. Yang menjadi pertanyaan khusus untuk konvensi Capres PD, kata Juniwati, apakah PD siap kalau yang lolos konvensi itu bukan dari kader internal PD sendiri? “Kalau siap berarti konvensi itu memang bukan untuk pencitraan, tapi kalau sebaliknya, maka konvensi itu hanya untuk pencitraan partai yang memang lagi merosot,” ujarnya. (j07)

Perkiraan Nurdin Akan Sulitnya Capai Target RAPBN 2014 Jadi Kenyataan JAKARTA (Waspada): Analisis atau perkiraan anggota Komisi XI DPRRI Ir Nurdin Tampubolon akan sulitnya pemerintah untuk mencapai target pendapatan negara sebesar Rp 1.662,5 triliun dalam Rancangan AnggaranPendapatanBelanjaNegara (APBN) 2014, sebagaimana yang disampaikan Presiden Susilo Bambang Yudhoyono di DPR, Jumat (16/8) menjadi kenyataan. Bahkan, pemerintah pun secara terbuka menyampaikan permintaan perlu adanya kesepakatan baru antara DPR dan pemerintah mengenai asumsi pertumbuhan ekonomi di tahun 2014 yang lebih realistis dengan mempertimbangkan perkembangan terkini, di mana kondisi ekonomi global yang penuh ketidakpastian. “ Sejak awal, saat presiden mencapaikan pidato kenegaraannya soal RAPBN 2014 beserta nota keuangannya di paripurna DPR 16 Agustus lalu, saya sudah langsung menyatakan pesimis, sebab target itu

sulit dicapai, “ujar Nurdi Tampubolon Rabu (28/) di Gedung DPR Jakarta, menanggapi permintaan pemerintah yang disampaikan Menteri Keuangan Chatib Basri dalam jawaban pemerintah atas pandangan umum Fraksi-fraksi di DPR terhadap RAPBN 2014 beserta Nota Keuangannya, Selasa (27/8). Menuru politisi dari Partai Hanura ini, pertumbuhan ekonomi nasional tidak terlepas dari perekonomian dunia yang masih melambat. Patokan nilai kurs rupiah sebesar Rp 9.600 sampai Rp 9.800 per dolar AS juga sulit, sebab nilai tukar rupiah saat ini sudah mencapai Rp 11 ribu dan ini tentu akan mengganggu kelangsungan industri dalam negeri yang melakukan kegiatan impor menggunakan mata uang dolar. Karena itu, Nurdin Tampubolon kembali mengingatkan pemerintah agar segera merealisasi penigkatan ketahanan pangan dan energi melalui pengalokasian anggaran yang

lebih besar pada RAPBN 2014. “Ditengah pengaruh ekonomi global yang kurang menguntungkan dan inflasi kita yang masih tinggi tentu sulit mencapai target pendapatan negara. Karena itu kita harus bijak dan bekerja keras untuk menggejot pertumbuhan ekonomi. “Penangan sektor moneter dan penigkatan ekspor serta menekan impor, harus segera direalisasi dengan peningkatan ketahanan pangan dan energi. Jika tidak, dengan keadaan ekonomi global saat ini, sektor sektor riil hanya menunggu waktu untuk mulai melakukan Pemutusan Hubungan Kerja (PHK), dan akhirnya mati suri,” ujarnya. (aya) Nurdin Tampubolon yakin jika anggaran pertanian, dalam arti luas diperbesar, maka bukan hanya menumbuhkembangkan pertanian dan menciptakan kesejahteraan rakyat, tapi juga akan mampu menjadi benteng ketahanan pangan. (aya)

Indonesia Gelar Pameran Maritim Tingkat Internasional 2013 JAKARTA (Waspada): Indonesia kembali menggelar pameran kelautan dan industri bahari bertajuk “Indonesia Maritime Expo (IME) 2013”. IME ke-4 tahun ini bakal digelar di Jakarta Convention Center, Jakarta, 5-7 September mendatang. Senior Project Director IME, Yeow Hui Leng, memastikan nama-nama besar dalam industri bahari akan hadir di IME tahun ini. “IME dipastikan bakal menarik perhatian dunia pada potensi industri bahari Indonesia yang hebat,” katanya di Jakarta, Selasa (27/8). Yeow mengatakan, pameran ini akan mempertemukan pemangku kepentingan dan pelaku usaha terkemuka dalam dunia bahari dari sektor publik maupun swasta dalam suatu acara internasional kelas dunia. “Acara yang diadakan oleh industri bagi industri ini juga akan mendorong alih pengetahuan dan peluang pelatihan dan pekerjaaan di sektor ini,” tambahnya. Acara yang diselenggarakan selama tiga hari ini diharapkan dapat menjadi ajang pertemuan bagi 5.000 pengunjung dan delegasi dagang dari industri bahari. Ada 144 peserta pameran dari 25 negara yang akan menampilkan industri bahari masing-masing seperti dari China, Jerman, Jepang, Norwegia, Singapura, Belanda, Ing-

gris, Norwegia, dan Indonesia sebagai tuan rumah. Salah satu acara puncak IME 2013 adalah konferensi bahari internasional gratis yang bertujuan memfasilitasi pembentukan jejaring, penjajakan kerjasama dan menyoroti peluang bisnis antara pemangku kepentingan domestik dan internasional. Topik yang akan dibahas amat beragam, antara lain tentang perubahan dan inovasi internasional, industri gas dan minyak lepas pantai di Indonesia, pemutakhiran peraturan asas cabotage serta implikasi lokal dan internasionalnya, tantangan ketenagakerjaan dan peluang sektor bahari, masalah keselamatan dan keamanan bahari, pembiayaan pelayaran, dan asuransi. Ketua INSA (Indonesian National Shipowners’ Association), Carmelita Hartoto, menilai baik pameran ini. “Sebagai mitra strategis IME 2013, kami gembira bahwa acara ini akan fokus pada sektor-sektor penting industri, mengingat kesempatan yang sedang berkembang dapat ditemui di sini,” jelasnya. Carmelita berharap pameran ini dapat menjadi sarana koordinasi dan membuka peluang bisnis untuk memacu pertumbuhan industri maritim dalam negeri. termasuk juga menjadi peluang bagi Indonesia

menunjukan potensi baharinya kepada negara lain. Ketua Ikatan Perusahaan Industri Kapal dan Lepas Pantai Indonesia (Iperindo), Tjahjono Roesdianto, mengatakan pameran ini merupkan momen tepat untuk komunikasi, berkerjasama dan membuka potensi investasi di bidang industri kompenan kapal dan pendukung bahari lainnya. Dengan tema ”The Gateway to Indonesia’s Rising Maritime Market” (Gerbang Menuju Pasar Bahari Indonesia yang Ber-kembang), IME menjadi ajang penting bagi para pelaku usaha industri bahari terbesar dari Indonesia untuk bertemu, berbagi wacana, dan menjalin hubungan bisnis. “IME juga akan menjadi kesempatan yang sangat baik bagi Indonesia menunjukkan potensi sektor baharinya kepada negara-negara lain di dunia,” tambah Yeow. IME 2013 diselenggarakan oleh P T R e e d P a n o r a m a Exhibitions dan didukung oleh Kementerian Industri Republik Indone-sia, Kementerian Perhubungan Republik Indonesia, ASCOATINDO atau Asosiasi Coating Indonesia, HINABI (Asosiasi Industri Alat Besar Seluruh Indonesia), INSA (Asosiasi Pemilik Pelayaran Nasional Indonesia), dan IPERINDO atau Ikatan Perusahaan Industri Kapal dan Sarana Lepas Pantai Indonesia. (adji k.)


SEJUMLAH Praja Muda meluapkan kegembiraan dengan melempar topi mereka ke uadara seusai Pelantikan Pamong Praja Muda (PPM) angkatan XX 2013 di kampus Institut Pemerintahan Dalam Negeri, Jatinangor, Sumedang, Jabar, Rabu (28/8).

Presiden Minta Pamong Praja IPDN Jauhi Korupsi JATINANGOR, Sumedang (Antara): Presiden Susilo Bambang Yudhoyono berpesan kepada para pamong praja muda Institut Pemerintahan Dalam Negeri (IPDN) agar menjauhi segala bentuk penyalahgunaan wewenang dan tindak pidana korupsi. Pesan itu merupakan satu dari empat pesan yang disampaikan Presiden Yudhoyono saat melantik Pamong Praja Muda IPDN Angkatan XX Tahun 2013 di Lapangan Parade Abdi Praja IPDN, Jatinangor, Sumedang, Rabu (28/8). “Pertanggungjawabkan tugas kalian dan sumpah jabatan pada Tuhan, pemerintah dan masyarakat. Jauhi segala bentuk penyalahgunaan wewenang dan tindak pidana korupsi,” kata Presiden dihadapan 1.459 lulusan IPDN tersebut. Kepala Negara juga berpesan agar para pamong praja muda melaksanakan tugas dengan penuh tanggung jawab serta berbuat baik kepada rakyat. Pesan selanjutnya adalah agar para pamong praja muda turut memelihara kehidupan masyarakat yang rukun dan damai serta penuh tolerasi di masyarakat Indonesia yang majemuk. “Mari kita bangun citra pemerintahan yang baik dan bersih serta langsung dirasakan kehadirannya di masyarakat,” katanya. Empat pesan Presiden itu merupakan bagian dari upaya pemerintah untuk mewujudkan reformasi birokrasi dan tata kelola pemerintahan yang baik. Pada kesempatan itu Presiden Yudhoyono selaku inspektur upacara secara simbolis menyematkan lencana pamong dan menyerahkan penghargaan Kartika Astha Brata kepada pamong praja muda lulusan terbaik program diploma IV yaitu Ardhi Kasmono S.STP serta lencana pamong dan menyerahkan penghar-gaan Kartika Pradnya Utama kepada pamong praja muda lulusan terbaik program sarjana (S-1) yaitu Ayu Ika Sulistyaningrum, S.IP. Komandan Upacara dalam upacara pelantikan itu adalah Bupati Simeulue Riswan yang merupakan alumni IPDN dari Aceh tahun 1984. Kemudian perwira upacara adalah Sekretaris Daerah Kabupaten Bolaangmongondo, Tahlis Gallang yang merupakan alumni STPDN angkatan V tahun 1997.

KPK Periksa Dirut Dan Komisaris PT Kernel Oil JAKARTA (Antara): Komite Pemberantasan Korupsi memeriksa Direktur utama PT Kernel Oil Private Limited (KOPL) Indonesia Fincenlia Andika dan Komisaris PT KOPL Ari Kusbiantoro terkait kasus pemberian gratifikasi kepada mantan Kepala Satuan Kerja Khusus Pelaksana Kegiatan Usaha Hulu Minyak dan Gas Bumi (SKK Migas) Rudi Rubiandini. “Direktur utama dan komisaris PT KOPL diperiksa untuk tersangka RR (Rudi Rubiandini),” kata Kepala Bagian Pemberitaan dan Informasi KPK Priharsa Nugraha di Jakarta, Rabu (28/8). Selain dirut dan komisaris, KPK juga memeriksa karyawan bidang Finance PT KOPL Indonesia Prima Hasyim Kardsidik, staf divisi komersil minyak SKK Migas Iman Permana, pegawai di SKK Migas Ridha Permana, Kepala Divisi Komersialisasi Minyak Bumi dan Kondensat SKK Migas Agus Sapto Raharjo yang juga telah dicegah KPK sejak 15 Agustus 2013, serta “head of sales” PT Indobuana Autoraya Lis Damayanti.


MENKES Nafsiah Mboi didampingi Menteri Pembangunan Daerah Tertinggal (PDT) Helmy Faishal Zaini melepas sejumlah dokter dan dokter gigi Pegawai Tidak Tetap (PTT) asal DKI Jakarta yang akan bertugas ke berbagai wilayah di Indonesia di Kantor Kemenkes Jalan Rasuna Said, Kuningan, Jakarta, Rabu (28/8).

927 Dokter PTT Siap Bertugas Di Daerah Terpencil JAKARTA (Waspada): Menteri Kesehatan Nafsiah Mboi didampingi Menteri Pembangunan DaerahTertinggal (PDT) Helmy Faishal Zaini memberi pembekalan serta secara simbolis melepas 122 orang dokter dan dokter gigi Pegawai Tidak Tetap (PTT) asal DKI Jakarta, Rabu (28/8) di Auditorium Kementerian Kesehatan, Jakarta. Secara serentak, pelepasan dokter PTT juga dilakukan di 12 daerah lainnya dengan total 927 dokter/dokter gigi PTT. Para dokter ini adalah mereka yang telah memenuhi syarat sebagai dokter PTT yang siap mengabdi di daerah terpencil dan sangat terpencil di wilayah Sumatera, Kalimantan, Sulawesi dan sejumlah provinsi di wilayah timur Indonesia. Menkes dalam sambutannya mengatakan, para dokter adalah kunci utama kesehatan dan kebahagiaan masyarakat di daerah terpencil. Dokter sangat dibutuhkan untuk mengupayakan berbagai kegiatan promotif, preventif dan kuratif

bagi masyarakat yang secara geografis sulit dijangkau. Dikatakannya, masa kerja dua tahun bagi para dokter PTT tidak akan terasa lama, jika masing-masing dokter mau menjalankan tugas dengan penuh semangat dan keikhlasan. Ditambahkan Nafsiah, pemerintah berjanji tidak akan menyia-nyiakan pengorbanan para dokter/dokter gigi yang mau bertugas ke daerah terpencil. Para dokter akan diberi gaji pokok sebesar Rp 2.050.000 setiap bulan. Bagi dokter di daerah terpencil akan ditambah insentif sebesar Rp 3.350.000 setiap bulan. Sedangkan bagi yang mengabdi di wilayah sangat terpencil, insentifnya sebesar Rp 5.800.000. “Pemerintah juga akan membayarkan asuransi bagi para dokter PTT ini,” kata menkes. Untuk periode 1 September 2013 ini, ada 927 dokter/dokter gigi PTT. Jumlah itu berkurang 500 orang dibanding tahun lalu. Sekretaris Jenderal Kemenkes, Supriyantoro menyayang-

kan adanya kekurangan jumlah dokter PTT periode akhir tahun ini. Dia memperkirakan saat ini sudah semakin banyak dokter yang dihasilkan kampus-kampus di daerah yang akhirnya memenuhi kuota kebutuhan dokterdimasing-masingwilayah. Keberadaan para dokter PTT, dikatakan Menteri PDT Helmy Faishal Zaini sangat membantu proses pembangunan daerah terpencil. Akses layanan kesehatan memang hak dasar yang harus dipenuhi pemerintah pusat dan daerah, supaya prinsip keadilan yang merata dalam pembangunan dapat dirasakan seluruh masyarakat Indonesia. “Karena Indonesia ini negara belasan ribu pulau, pasti akan terjadi disparitas. Kondisi itu, sedikit banyak akan diminimalisir oleh kehadiran program dokter PTT ini,” kata Helmy. Saat ini masih ada 183 kabupaten yang masuk kategori daerah tertinggal. Dari jumlah itu, 128 daerah di antaranya berada di kawasan timur Indonesia. (dianw)

Panja Komisi IX Apresiasi Persiapan Pelayanan Kesehatan Haji Kemenkes JAKARTA (Waspada): Panitia Kerja Kesehatan Haji Komisi IX DPR RI memberikan apresiasi terhadap persiapan pelayanan kesehatan haji yang telah dilakukan Kepala Pusat Kesehatan Haji, Dirjen Pengendalian Penyakit dan Penyehatan Lingkungan (P3L) dan Dirjen Bina Kefarmasian dan Alat Kesehatan (Binfar dan Alkes) Kementerian Kesehatan. “Semua informasi yang telah disampaikan, akan digunakan Panja Kesehatan Haji untuk merekomendasikan perbaikan sistem penyelenggaraan pelayanan kesehatan haji,” kata Wakil Ketua Komisi IX Nova Riyanti Yusuf saat memimpin rapat dengar pendapat Panja Kesehatan Haji dengan Kepala Pusat Kesehatan Haji, Dirjen Pengendalian Penyakit dan Penyehatan Lingkungan dan Dirjen Bina Kefarmasian dan Alat Kesehatan Kementerian Kesehatan di Gedung DPR RI, Jakarta, Selasa (27/8) Menurut Nova, Panja Kesehatan Haji bertujuan untuk

melakukan pengawasan terhadap persiapan dan juga pelaksanaan pemberian pelayanan kesehatan terhadap jamaah haji, khususnya bagi jamaah haji dengan risiko tinggi, seperti karena usia atau mempunyai riwayat penyakit kronis, serta kesiapan pemerintah dalam mengantisipasi penularan virus Corona/MERS. Kapus Kesehatan Haji, Fidiansjah menyampaikan bahwa berdasarkan Keputusan Menteri Kesehatan Nomor 442 Tahun 2009 Penyelenggaraan Kesehatan Haji bertujuan untuk meningkatkan kondisi kesehatan jamaah haji sebelum keberangkatan, menjaga agar jamaah haji dalam kondisi sehat selama menunaikan ibadah, sampai tiba kembali di tanah air, dan mencegah terjadinya transmisi penyakit menular yang mungkin terbawa ke luar/ masuk oleh jamaah haji. Sebagai persiapan penyelenggaraan kesehatan haji di tanah air tahun 2013, telah dilakukan rekruitmen petugas

kesehatan haji secara online dan melakukan kompetensi di bidang pembekalan yang terintegrasi dengan petugas Kementerian Agama, orientasi dan penguatan Sistem Kesehatan Haji, Advokasi dan kemitraan dengan KBIH/PIHK/AKHI, dan mengintegrasikan sistem informasi SISKOHATKES Kemenkes dan SISKOHAT Kemenag. Untuk persiapan Embarkasi dan Debarkasi, Kemenkes akan melakukan pemantauan Higine Sanitasi Asrama Haji dan katering. “Perbekalan kesehatan dan obat jamaah haji akan disiapkan oleh Ditjen Binfar dan Alkes, dan akan tiba di Arab Saudi pada akhir Agustus 2013,” kata Fidiansjah. Sedangkan persiapan penyelenggaraan kesehatan haji di Arab Saudi, telah dilakukan pengujian aplikasi dan jaringan di tiga daerah kerja yaitu Makkah, Madinah dan Jeddah, pengujian fungsi dan kalibrasi alat kesehatan, serta penyiapan alat pengamanan makanan dan alat ukur Kesling. (aya)

Timwas DPR Apresiasi Laporan Tim Pendukung Pengembalian Aset Century JAKARTA (Waspada): Tim Pengawas Kasus Bank Century DPR mengapresiasi laporan perkembangan yang disampaikan Tim Pendukung Pengembalian Aset Bank Century secara realistik, meski hasil aset yang diselamatkan angkanya masih jauh dari yang diharapkan. Demikian kesimpulan Rapat Timwas Century DPR yang dipimpin Wakil Ketua DPR Priyo Budi Santoso di Jakarta, Rabu (28/8), dengan Tim Pendukung Pengembalian Aset Bank Century di bawah Koordinator Menteri Hukum dan HAM (Menkumham) HAM Amir Syamsudin. Selain Menkumham, hadir juga Jaksa Agung Basrif Arief, Sekjen Kementerian Keuangan dan pejabat dari Kementerian Sekreriat Negara (Setneg). Kepada Tim Pendukung Pengembalian Aset Bank Century, Timwas Century DPR juga mengharapkan untuk menyampaikan progress report mengenai biaya yang dikeluarkan untuk memburu aset Bank Century yang masih dalam sengketa, aset yang dapat diselamatkan dan yang berhasil dibekukan.

Timwas juga meminta kepada pemerintah untuk membuat rangkuman mengenai sisa-sisa aset Bank Century di antaranya mengenai harga/nilai dari sisa aset dan upaya pemerintah untuk me-recoverynya. Dalam paparannya, Menkumham Amir Syamsuddin menjelaskan dari yurisdiksi Hongkong perkiraan awalnya sebesar USD 2.084.705.585 dan SGD 6.921, namun setelah penelusuran nilai asetnya hanya sebesar USD 7.500.000. Sementara itu, di Yuridiksi Jersey perkiraan awal sebesar USD 16,5 juta dan nilai asetnya sedang dalam proses penelusuran. Begitu pula, Yuridiksi Swiss yang perkiraan awalnya USD 156.000.000 yang juga masih dalam proses penelusuran. Sementara Jaksa Agung Basrif Arief menjelaskan perkembangan penanganan aset dalam negeri kasus Bank Century uang tunai sejumlah Rp 51,8 miliar terdiri dari penuntutan sejumlah Rp 808,16 juta, upaya hukum sejumlah Rp 24,09 miliar dan eksekusi uang tunai sejumlah Rp 26,16 miliar. Sedangkan aset berupa barang antara lain Mall Serpong Plaza,

8 kavling dan 1 rumah serta 269.250.000 lembar saham Bank Century milik Morgan Piere, CO Ltd dalam proses penuntutan. Sedangkan 1 buah handphone Blackberry Dakota dan 1 buah Handphone Nokia 1280 masih dalam upaya hukum. Pada kesempatan itu Jaksa Agung menjelaskan bahwa pada 15 Juli 2013 lalu pemerintah RI telah menyampaikan jawaban dan rekonvensi atas gugatan Hesham dalam pengadilan arbitrase internasional. Disebutkan, bailout Century yang dilakukan pemerintah RI merupakan perbuatan legal, dan bukan tindakan perampasan. Jaksa Agung menegaskan, pihak penggugat pun tidak bisa membuktikan bahwa kerugian yang diterimanya akibat dari pelanggaran perjanjian namun kerugian yang diderita penggugat tersebut disebabkan oleh tindak pidana korupsi yang dilakukan oleh penggugat dan kawan-kawan. “Pemerintah RI menuntut ganti rugi dari penggugat sejumlah uang dari kerugian akibat bailout Bank Century sebesar 360 juta juta dolar AS,” tukasnya.(aya)


Luar Negeri

WASPADA Kamis 29 Agustus 2013

Helikopter PBB Serang Pemberontak M23 Di Kongo KINSHASA, Kongo (AP): Seorang jurubicara militer untuk misi pemelihara perdamaian PBB di timur Kongo mengatakan sejumlah helikopter PBB telah menembaki pemberontak M23. Sejumlah helikopter yang mendukung pasukan Kongo ketika mereka terlibat perang dengan pemberontak Rabu (28/8) di luar Goma, satu kota berpenduduk hampir satu juta. Letkol. Felix Basse mengatakan kepada para wartawan serangan Rabu itu dimulai sebelum pukul 08:00 di perbukitan di kawasan Kibati, kira-kira 15 km utara Goma. Pemberontak M23 sempat menguasai Goma akhir tahun lalu sebelum mereka mundur ke perbukitan di utara kota. Pertempuran baru itu meningkatkan kecemasan di kalangan penduduk bahwa pemberontak dapat lagi menyerang kota tersebut. Pasukan Kongo sekarang menerima bantuan ekstra dari brigade intervensi PBB yang baru dibentuk yang membuat mereka mampu melancarkan serangan terhadap pemberontak.(m10)

Polisi Bongkar Pabrik Narkoba Di Panti Pijat KUALALUMPUR,Malaysia(Antara):PolisiMalaysiamembongkar sindikat pengedar narkoba yang menjadikan panti pijat di Jalan Macalister, Georgetown, Pulau Pinang, sebagai pabrik pemro-sesan sabu-sabu serta ekstasi, kemudian menyita berbagai jenis narkoba senilai 11,56 juta ringgit (sekitar Rp35 miliar). Enam lelaki berusia 35—46 tahun yang diduga anggota sindikat tersebut ditahan dalam beberapaserbuanberbeda,termasukdipantipijattersebut,demikian dilaporkan berbagai media lokal di Kuala Lumpur, Rabu (28/8). Penggerebekan dilakukan oleh petugas Unit Kejahatan Narkotika (JSJN) Bukit Aman dan Pulau Pinang. Kepala JSJN Bukit Aman Datuk Noor Rashid Ibrahim mengatakan bahwa penang-kapan terbesar di Pulau Pinang sejak tiga tahun lalu itu berawal dari penangkapan dua lelaki dalam sebuah mobil di Machang Bubuk pada hari Selasa petang.NoorRashidmengatakan,dalampenggerebekan,polisimenyita 48,04 kg serbuk ekstasi, 9,29 kg pil ekstasi, 27,8 cairan sabu-sabu, 8,7 kg sabu-sabu, 20,4 kg heroin, 3,3 kg pil perangsang, 35,5 kg kafein, 64gramganja,752gramheroinbase,sertaperalatandanbahankimia untuk memproses narkoba.

Pada Saat Ketegangan Meningkat, Israel Bergegas Ambil Masker Gas JERUSALEM (AP): Kerumunan masyarakat Israel melakukan antrian di pusat pembagian masker gas di seluruh Israel guna mengantisipasi kemungkinan serangan Syria ke Israel. AS telah memberikan sinyal bahwa pihaknya segera menyerang Syria sebagai respon terhadap dugaan penggunaan senjata kimia pekanlaludipinggiranDamaskus.Serangantersebuttelahmeningkatkan spekulasi bahwa Syria kemungkinan melancarkan serangan balasan atas Israel, negara sekutu dekat AS. Maya Avishai dari pelayanan pos Israel, yang mengawasi pendistribusian masker gas tersebut, mengatakan permintaan telah berlipat ganda dalam beberapa hari terakhir. Dia mengatakan kira-kira lima juta warga Israel, kira-kira 60 persen dari penduduk, kini telah memiliki masker gas. Televisi Israel Channel 2 menunjukkan sejumlah besar masyarakat berkerumun di satu pusat pendistribusian di Tel Aviv Rabu (28/8) dan katanya, orang menunggu selama beberapa jam untuk mendapatkan masker gas gratis.(m10)

Jepang: Kebocoran Air Beracun Di Fukushima ‘Insiden Serius’ TOKYO, Jepang (CNN): Pengawas nuklir Jepang Rabu (28/ 8) mengatakan, kebocoran air beracun di reaktor nuklir Fukushima Daiichi diklasifikasi berada pada ‘insiden serius’ level 3 sesuai skala internasional. Otoritas Regulasi Nuklir (NRA) mengatakan, pihaknya telah membuat keputusan tersebut setelah membahasnya dengan Badan Energit Atom Internasional yang bermarkas di Wina, kata Juntaro Yamada, jubir NRA. Ketika berita tentang bocornya ratusan ton air radioaktif dari tankipenyimpananmencuatminggulalu,NRAmengatakanpihaknya berencana mengeluarkan peringatan, peringatan terkeras sejak gempa dan tsunami 2011 yang menyebabkan tiga reaktor di kompleks perusahaan listrik Fukushima itu rusak. Kebocoran itu sebelumnya dinilai level 1 ‘tingkat ganjil’ berdasarkan Skala Kejadian Radiologi dan Nuklir Internasional, yang kisarannyadarinol,untukkadaraman,sampaitujuh,untukkecelakaan paling besar. Keputusan mengeluarkan peringatan level 3 dilakukan dua hari setelah seorang menteri pemerintah Jepang membandingkan usaha operator reaktor dalam menangani kebocoran air beracun di tempat itu dengan permainan ’ whack-a-mole’. Toshimitsu Motegi, Menteri Perindustrian, mengatakan Senin setelah mengunjungi reaktor itu bahwa‘mulai sekarang, pemerintah akan melangkah ke depan’. Kementriannya telah ditugaskan PM Shinzo Abe untuk mengambil tindakan guna mencegah masalah makin parah di Fukushima Daiichi. Operator reaktor, Perusahaan Listrik Tokyo (Tepco), berjuang menangani pencemaran air volume tinggi di reaktor itu. Bulanlalu,Tepcomengakuibahwaairbawahtanahyangtercemar radioaktif telah mencemari Samudera Pasifik setelah air tercemar tersebut bocor dari penampungan bawah tanah. Sekitar 400 ton air bawah tanah mengalir ke penampungan itu setiap hari, dan Tepco juga memompakan sejumlah besar air ke sekitar bangunan itu agar reaktor yang sudah rusak tetap dingin.(m23)

Putra Jenderal Di China Diadili, Karena Dugaan Perkosaan BEIJING, China (AP): Putra seorang jenderal terkemuka China telah diajukan ke depan sidang pengadilan atas tuduhan perkosaan berkelompok yang telah memusatkan perhatian pada perilaku keterlaluan dari para anggota keturunan elit negara itu. SekelompokwartawanmenungguLiTianyidanempattemannya terdakwadisatupengadilandistrikBeijingRabu(28/8).Liyangberusia 17 tahun itu membantah ikut ambil bagian dalam kejadian perkosaan FebruarilaludisatuhotelBeijingsetelahmerekapestaminum-minum. Li adalah putra Li Shuangjiang, seorang jenderal yang dikenal umum untuk melantunkan lagu-lagu patriotik untuk Tentara Pembebasan Rakyat dan membintangi sejumlah gala televisi. Dia dijatuhi hukuman satu tahun di tahanan pada tahun 2011 pada saat usianya 15 tahun karena menyerang satu pasangan atas persengketaan lalulintas ringan dan mengancam penonton dalam sebuah kasus yang menarik perhatian luas. Namun Li kembali berulah atas kasus yang lebih serius, yaitu perkosaan. Sebelum pengadilan atas Li dimulai, kasus ini mendominasi halaman pertama surat-surat kabar setempat di China. Publik selama ini kesal dengan ulah anak-anak maupun kerabat pejabat yang semena-mena di tempat umum dan seenaknya melanggar hukum. Li dituduh sebagai salah satu pemerkosa atas seorang perempuan di suatu hotel di Beijing Februari lalu. Selain dia, empat orang lain menerima tuduhan yang sama. Maka, Li kini menjadi target terkini kekesalan publik. “Masyarakat khawatir bahwa keluarga dia, mengingat kedekatan mereka dengan kekuasaan, akan menggunakan pengaruh mereka,” kata Zhang Ming, seorang pengamat politik di Universitas Renmin. Juli lalu, para peretas mensabotase laman milik kantor salah satu firma hukum yang menjadi pembela Li. Di laman yang diretas itu tertulis “Kami hanya ingin klien mereka diberi keadilan yang setimpal.” (m10)

The Associated Press

WARGA memeriksa lokasi serangan bom mobil di Sadr City, Baghdad, Irak, Rabu (28/8). Satu gelombang serangan terkoordinasi merobek sejumlah kawasan Syiah di dan sekitar Baghdad, Rabu, yang menewaskan puluhan jiwa dan mencederai lebih banyak lagi, demikian menurut sejumlah pejabat.

66 Orang Tewas Akibat Bom Di Irak BAGHDAD, Irak (AP): Satu gelombang pengeboman terkoordinasi telah merobek beberapa kawasan Syiah di dan sekitar Baghdad Rabu (28/8), yang merupakan bagian dari satu gelombang pertumpahan darah yang menewaskan sekurang-kurangnya 66 orang dan mencederai sejumlah lainnya, demikian menurut sejumlah pejabat. Rangkaian ledakan itu, yang terutama ditujukan pada para penduduk di luar pertokoan dan dalam perjalanan mereka ke kantor atau bekerja.

Sekurang-kurangnya terjadi 12 ledakan, sebagian besar adalah bom mobil, tetapi juga paling tidak satu serangan bunuhdiri

— menghantam daerah berpenduduk mayoritas Syiah di ibukota Irak itu, serta satu kota berpenduduk campuran di selatan Baghdad,kataparapejabatmedis. Serangan-serangan itu juga mencederai sekitar 140 orang, tambah para pejabat itu. Serangan terjadi kendatipun operasi keamanan dipublikasi secara luas yang ditujukan pada kelompok garis keras di Baghdad, walaupun pemerintah menghadapi kecaman dalam menangani akar penyebab aksi kekerasan terburuk di Irak sejak tahun 2008. Di Mahmoudiyah, kira-kira 30 km selatan Baghdad, seorang pengebom bunuhdiri meledakkan bomnya di luar satu restoran, yang menewaskan empat orang dan mencederai 13 lainnya. Di Madain, kira-kira 25 km tenggara Baghdad, satu bom jalananmenghantamsatukendaraan militeryangsedangberpatroli,yang menewaskan empat tentara dan mencederai enam lainnya. Peningkatan aksi kekerasan itu terjadi sejak awal tahun ini, dengan lebih dari 3.700 orang te-

was tahun 2012, yang menimbulkan kekhawatiran bahwa negara itu berada diambang kembali padaperangsektarianyangkejam tahun 2006 dan 2007. Serangan yang paling banyak menimbulkan korban jiwa Rabu itu terjadi di daerah pemukiman Jisr al-Diyala, Baghdad Tenggara, dengan sekurang-kurangnya tujuhorangtewasdan21oranglainnyacederadalamdualedakanbom. SatubommobillainnyadidaerahJadidahBaghdad,yangmenewaskan empat orang juga menghancurkanmobil-mobildantokotoko yang berada dekat lokasi itu, kata seorang pejabat. Ledakanledakanjugamenghantampemukiman penting Syiah termasuk Kadhimiyah dan Sdr City. Para pejabat memberikan angka korban yang berbeda, yang biasa terjadi setelah seranganserangan bom di Baghdad, dan jumlah korban itu nampaknya segera meningkat. Belum ada kelompok yang mengaku bertanggung jawab bagi serangan-serangan itu, tetapi pada anggota kelompok garis keras Sunni yang

punyahubungandenganalQaida sering melancarkan seranganserangan terkoordinasi yang ditujukan pada warga Syiah. Serangan-serangan Rabu itu adalahgelombangseranganbom terbaru melanda Baghdad bulan ini. Pada 6 Agustus setidaknya delapan bom dan beberapa bom pinggirjalanmenewaskan31orang sementara 47 orang tewas dalam serangkaianledakandanserangan senjata api di ibu kota itu pada 10 Agustus. Lima hari kemudian, 24 orangtewasdalamsembilanserangan bom di Baghdad. Irak dilanda aksi kekerasan meningkatsejakawaltahunini,bertepatan dengan unjuk-unjuk rasa oleh etnik minoritas Arab Sunni menentang perlakuan buruk pemerintahyangdikuasaiSyiahdan pasukan keamanan. Kendatipunparadiplomatdan pengamat mendesak dilakukan usaha-usahaluasuntukmenangani frustrasiwargaSunni,yangmereka katakan memberikan ruang pada kelompok-kelompok garis keras untukmerek-rutdanmelancarkan serangan-serangan. (m23/m10)

Bangunan Runtuh Di India, 11 Tewas NEW DELHI, India (AP/ CNN): Sedikitnya sebelas orang tewas dan 10 lainnya diyakini masih terperangkap setelah dua bangunan pemukiman runtuh di bagianbaratIndia,katapihakberwenang Rabu (28/8). Petugas penyelamat melakukan pencarian untuk menemukan penyintas di tengah-tengah reruntuhan gedung berlantai tiga

itu di distrik Vadodara, Gujarat, kata Vinod Rao, administrator distrik itu. Tujuh orang juga mengalami cedera akibat gedung runtuh itu, yang terjadi sekitar pukul 05:00 Rabu pagi, kata Rao. Pihakberwenangtengahmenyelidiki apa penyebab runtuhnya bangunan berusia 13 tahun itu. April lalu, sejumlah orang te-

was akibat runtuhnya gedung bertingkat banyak yang illegal di Thane, kota dekat Mumbai. Dua gedung apartemen yang berdempetan itu rubuh Rabu dinihari, kata polisi dan regu pemadam kebakaran. Regu pertolongan berhasil mengeluarkan 11 mayat dan empat korban cedera parah dari reruntuhan bangunan tiga tingkat itu yang rubuh, kata

The Associated Press

REGU pertolongan India membawa sesosok mayat korban yang mereka keluarkan dari reruntuhan setelah dua gedung apartemen yang berdempetan runtuh di Vadodara di negara bagian Gujarat, India, Rabu (28/8). Sekurang-kurangnya 11 orang tewas dan sejumlah lain masih terperangkap di bawah reruntuhan, kata polisi.

kepala tim pemadam kebakaran Hitesh Taparia. Sebagianbesardaripenghuni apartemen 14 di gedung pertama sedang tidur nyenyak pada saat terjadi peristiwa itu. Gedung yang bergandengan dengannya sempat dievakuasi beberapa menit sebelum rubuh, demikian polisi Bhanu Pratap Parmar. Bangunanitumerupakanbagian dari 33 blok rumah yang dibangun oleh pemerintah Gujarat lebihdarisatudasawarsalaluuntuk masyarakatmiskin.Lebihdari250 pekerjabantuanbekerjakerasuntuk membersihkan reruntuhan dari lokasidanmencariparapenyintas di tengah reruntuhan, kepingan beton dan batubata. Taparia mengatakan sebab runtuhnya bangunan tersebut masih belum diketahui. Para pejabat kepolisian mengatakan hujan lebat yang selalu turun diVadodara selama musim hujan ini telah menyebabkan rusaknya fondasi gedung. Pemerintah Gujarat telah memerintahkan satu penyelidikan dan akan memeriksa kerusakan bangunan di 31 gedung lainnya di kompleks tersebut, kata Taparia. Bangunan runtuh jadi biasa di India sementara para pembuat bangunan mengurangi penggunaan dana dengan menggunakanmaterialdiba-wah standar. (m23/m10)

Korban Jiwa Akibat Banjir Di Kamboja Naik Jadi 13 PHNOMPENH,Kamboja(Antara/Xinhua-OANA):Banjirbandang telah menewaskan tak kurang dari 13 orang dan mem-pengaruhi sebanyak 3.000 keluarga di Kamboja sejak awal Agustus, kata juru bicarapengendalibencanaRabu(28/8).Empatprovinsiyangdilanda banjir adalah Banteay Meanchey, Preah Vihear, Kampong Thom, Kratie, dan KeoVy, kata Kepala Kominte Nasional bagi Penanganan Bencana (NCDM) di Kabinet. Selain itu, katanya, sebanyak 20.000 hektaresawahterendamair.BanjirbiasamerendamKambojaantara AgustusdanOktober.Pada2011,negeritersebutdilandabanjirterparah, yang menewaskan sampai 250 orang, kata NCDM.Tahun lalu, banjir merenggut 14 nyawa.

PM YINGLUCK Terkaya Di Antara Anggota Kabinet BANGKOK, Thailand (Antara/Xinhua-OANA): PM Thailand YingluckShinawatraadalahseorangterkayadiantaraanggotakabinet dengan kekayaan bersih sebesar AS$19,5 juta, kata lembaga negara anti-korupsi mengungkapkan Selasa (27/8). Komisi Nasional AntiKorupsiThailand(NACC)mengungkapkanasetparaanggotakabinet baru, yang ditunjuk Juni pada Selasa lalu. Ini adalah hukum bahwa semua anggota kabinet harus menyatakan aset mereka sebelum dansetelahmemangkujabatan.PMenyatakanasetnyakepadaNACC.

China Benarkan Penggerebekan Atas Satu Sel Terorisme BEIJING,China (AP): China membenarkan Rabu (28/8) bahwa polisi telah melakukan satu penggerebekan pekan lalu atas dugaan selterorismedidaerahbergolakdikawasanbaratlautdiXinjiang.Namun belum ada rincian tentang korban tewas dan jatidiri dari orang-orang yang tewas dalam insiden berdarah yang masih jadi teka-teki itu. Para pejabat telah menolak untuk membahas insiden 20 Agustus itu, yang merupakan insiden terakhir dari serangkaian peristiwa bentrokan tahun ini yang telah menewaskan puluhan orang dan sejumlah lainnya ditahan. Namun,pejabatdisuratkabar KashgarDaily melaporkamtentang serangan 20 Agustus dalam sebuah artikel Rabu yang menyebutkan polisi Yan Xiaofei, yang tewas dalam bentrokan itu. Surat kabar itu mengatakan wakil komandan SWAT yang berusia 32 tahun tewas saat mengambil bagian dalam tindakan untuk “mengatasi sekelompok teroris pengacau.” Dikatakan dia berjuang di garda depan dalam aksi tersebut, tetapi tidak mengatakan bagaimana dia meninggal. MengacupadakepolisianXinjiangdansumberpemerintah,Radio Free Asia yang dibiayai pemerintah AS itu mengatakan 22 anggota kelompok etnis Uighur tewas dalam serangan tersebut dan mayat mereka dikuburkan di gurun pasir tanpa diberitahu para keluarga mereka. Radio tersebut mengatakan polisi memantau kelompok tersebutdarisatuhelikopterselamasatumingguketikamerekaberkumpul di satu rumah di kotaYilkiqi, di prefektur Kashgar, Xinjiang. Katanya, polisi menyerang saat para anggota kelompok tersebut menunaikan sholatnya dan mereka menemukan enam kapak dan pisau di lokasi kejadian. (m10)

Tujuh Orang Tewas Dalam Dua Kecelakaan Pesawat SEOUL, Korea Selatan (Antara/AFP): Tujuh orang tewas, dua di antaranya pilot Korea Selatan Rabu (28/8) akibat pesawat latih jet angkatan udara negara itu jatuh di dekat kota Gwangju, kata kementerianpertahanan.Korbanlainnyaadalahpenumpangpesawat kecil yang jatuh di Jerman beberapa jam sebelumnya. Penyelidikan dilakukan untuk menetapkan penyebab pesawat T-50itujatuh,katajurubicara.KecelakaandiKoreaSelatanitumerupakan yang kedua dalam kurun waktu kurang darisetahun,yangmelibatkan T-50,pesawatsupersonikbuatandalamnegeripertama,yangdiproduksi Korea Aerospace Industries dan Lockheed Martin. Satu pesawat T-50B jatuh di gunung di timurlaut November lalu menewaskan seorang pilot. Indonesia pada tahun 2011 memesan 16 T-50 dan Seoul memburu kontrak-kontrak lain dari Filipina dan Irak. Dari Jerman dilaporkan, satu pesawat kecil jatuh di barat Jerman beberapa saat sebelum mencapai tujuannya, yang menewaskan tiga orang dewasa dan dua anak-anak serta mencederai tiga anak lainnya, demikian menurut pihak berwenang Rabu. Pesawat bermesin tunggal Piper PA-32 jatuh Selasa malam di satu perladangan di kawasan Dortmund. Pihak berwenang memberitahu kantorberitaJermandpabahwapesawatitujatuhdalampenerbangannya kembali dari kawasan pantai utara Jerman dan hanya berada 5 km dari tujuannya satu lapangan terbang Arnsberg pada saat jatuh. Pilotnya yang berusia 59 tahun, seorang wanita berusia 72 tahun, putriny yang berusia 34 tahun dan putranya yang berusia 15 tahun bersama putrinya 5 tahun, semuanya tewas, kata polisi. Semua korban berasal dari Arnsberg. Dua anak lainnya dari putri wanita tua itu, yang berusia tujuh dan empat tahun ditemukan selamat dalam keadaan cedera terlempar ke luar pesawat dan bayi berusia 16 bulan berhasil dikeluarkan cedera dari pesawat. Ketiganya segera dilarikan ke rumah sakit. (m10)


WASPADA Kamis 29 Agustus 2013


Tiga Pemain Tumbal Tiket Pool LONDON (Waspada): Liverpool membutuhkan dua gol pada masa perpanjangan waktu untuk mengalahkan Notts County 4-2, Selasa (Rabu WIB), melengkapi malam berat buat klubklub Liga Premier pada putaran kedua Piala Liga Inggris. Penyerang Daniel Sturridge dan pemain pengganti Jordan Henderson, mengamankan langkah The Pool, setelah tamunya dari League One itu bangkit untuk menyamakan kedudukan menjadi 2-2 pada waktu normal. Selain kesulitan menang, tiket lolos Si Merah juga harus dibayar mahal dengan cedera tiga pemainnya. yakni Aly Cissokho, Joe Allen, dan Habib Kolo Toure. Ketiga tumbal itu diragukan dapat main saat The Reds. menjalani laga krusial di Liga Premier dengan menjamu Manchester United di Anfield, Minggu (1/9). Toure paling parah, disinyalir dia mengalami cedera paha hingga ditandu keluar lapangan. Cissokho dan Allen lebih ringan, tapi tetap saja perlu penanganan tim medis klub. “Untuk Toure kami masih menunggu hasil diagnosisnya, dia mengalami cedera paha. Jujur saja saya sangat khawatir,” beber manajer Brendan Rodgers dalam laman resmi klub, Rabu (28/8).

Klasemen Liga Premier Chelsea Liverpool Tottenham Man United West Ham Southampton Man City Arsenal Aston Villa Stoke Cardiff Fulham Hull Everton Norwich Sunderland West Brom Newcastle C Palace


BEK baru Liverpool Habib Kolo Toure ditandu keluar lapangan saat menghadapi Notts County di Stadion Anfield, Rabu (28/ 8) dinihari WIB. “Cissokho dan Allen juga masih menunggu hasil diagnosa. Khusus Cissokho, harusnya tidak perlu absen lama karena cederanya ringan,” tambah mantan pelatih Swansea City itu. Setelah didatangkan dari Manchester City bulan lalu, posisi Toure cukup penting di jantung pertahanan Pool. Bek Pantai Gading itu menjadi tandem ideal bagi Daniel Agger di depan gawang The Kop. Untungnya Martin Skrtel mulai pulih, sehingga dapat dimainkan menjamu . Jika Toure tidak bisa diturunkan, ma-

ka Skrtel akan menjadi pilihan utama untuk mengisi pos di lini belakang. “Skrtel sudah mulai pulih. Dia dalam kondisi baik dan sudah mengikuti latihan untuk beberapa kesempatan,” jelas Rodgers. Pool sepertinya bakal mudah menjinakkan tamunya di Anfield, setelah unggul dua bola pada babak pertama lewat gol Raheem Sterling menit keempat dan Daniel Sturridge menit 29. Namun Noots County bangkit di babak kedua dengan menyarangkan gol balasan melalui Yoann Arquin menit 62 dan

Adam Phillip menit 84. Sturridge memulihkan keunggulan tuan rumah menit 105 dan Henderson memantapkannya lagi menit 110. Hull City juga melaju melalui kemenangan 1-0 di masa perpanjangan waktu atas tuan rumah Leyton Orient. Fulham memenangi adu penalti 5-4 di markas klub League Two, Burton Albion, setelah laga aktif berakhir 2-2. Bristol City menaklukkan tim pendatang baru di Liga Premier, Crystal Palace 2-1. Sunderland memerlukan aksi heroik Connor Wickham untuk me-

Rooney Bertahan LONDON (Waspada): Wayne Rooney dilaporkan sejumlah media Inggris, Rabu (28/8), tidak akan mengajukan transfer request kepada Manchester United. Itu artinya Rooney bakal bertahan di Old Trafford. Keputusan ini membuat pupus harapan Jose Mourinho untuk memboyong bomber berumur 27 tahun itu ke Chelsea. Mou pun mulai berpaling kepada Samuel Eto’o, mantan bomber Barcelona dan Inter Milan yang sudah tidak kerasan bersama Anzhi Makhachkala. Mou sendiri sudah memberi tenggat waktu selama 48 jam terhitung sejak Selasa kemarin, supaya Rooney memutuskan bertahan dengan MU atau pindah ke Stamford Bridge. Sky Sports melansir, Rooney berkata kepada temannya bahwa dia akan dianggap tidak menghormati klub, pelatih, dan fans bila meminta untuk dijual. Daily Mail menyebutkan bahwa setelah moody dan me-

narik diri selama sebulan terakhir, Rooney akhirnya kembali tertawa dan bercanda di tempat latihan United, Carrington HQ. Padahal, dia sempat tertangkap kamera tidak merayakan gol yang dicetak Robin van Persie saat Setan Merah menggulung Swansea City 4-1 pada pekan perdana Liga Premier, 18 Agustus lalu. Namun pada matchday 2 melawan Chelsea yang berakhir 0-0 di Old Trafford, Senin kemarin, Rooney diturunkan pelatih David Moyes sebagai starter dan mendapat sambutan hangat dari para pendukung The Red Devils. “Para suporter selalu mendukung para pemain, tidak ada bedanya dengan Wayne. Dia telah didukung selama bertahun-tahun di sini,” klaim kapten MU Nemanja Vidic melalui The World Game. Selama laga melawan John Terry cs, para fans United terus meneriakkan chant untuk Roo-


BASTIAN Schweinsteiger (kanan) rawan absen melawan Chelsea, menyusuli nasib Thiago Alcantara (kiri).

Problem Catur Jawaban di halaman A2. 8







1 A








1 0 0 1 1 1 0 0 0 0 0 0 0 2 1 1 1 1 0

0 0 0 0 0 0 1 1 2 1 1 1 1 0 1 1 1 1 2

4-1 2-0 2-0 4-1 2-0 2-1 6-3 4-4 4-4 2-2 3-4 2-3 1-2 2-2 2-3 1-2 0-1 0-4 1-3

7 6 6 4 4 4 3 3 3 3 3 3 3 2 1 1 1 1 0

STRIKER Inggris Daniel Sturridge merayakan golnya ke gawang Notts County. -AP-

Anfield Bukan Tempat Hangat MU LONDON (Waspada): Stadion Anfield kembali akan menggelar pertarungan seteru abadi Liverpool melawan Manchester United pada matchday 3 Liga Premier, Minggu (1/9). Keangkeran stadion berkapasitas 46.000 penonton itu tetap diwaspadai The Red Devils, terutama oleh manajer anyarnya David Moyes. “Pertarungan di Anfield tidak akan pernah terasa mudah. Tekanan besar sudah pasti Anda rasakan. Anfield bukan tempat hangat bagi Manchester United,” jelas Moyes, seperti dilansir Sky Sports, Rabu (28/8). Tekanan berat dari para pendukung The Reds berjulukan Liverpudlian, sudah pasti akan

BUENOS AIRES (Antara/Reuters): Seorang pemain semaput di lapangan kemudian dinyatakan tewas di rumah sakit, saat melakoni laga divisi empat Argentina. Hector Sanabria (foto) tidak sadarkan diri pada babak pertama ketika membela Deportivo Laferrere melawan General Lamadrid di kompetisi Primera C, Rabu (28/8) pagi WIB. Bomber lokal berumur 28 tahun itu lantas dibawa ke rumah sakit dan pertandingan dihentikan. Pengumuman kematiannya

dirasakan punggawa MU. Apalagi mereka diarsiteki Moyes, mantan pelatih Everton yang dalam satu dekade terakhir menjadi musuh Si Merah. “Ini akan menjadi pertandingan besar bagi pelatih dan para pemain. Kita harus pergi ke sana dan menjadi yang terbaik. Saya yakin ujung tombak kami bisa mencuri poin penuh dari sana,” klaim Moyes. Kapten MU Nemanja Vidic juga berpandangan demikian. “Selalu sulit melawat ke Anfield, tahun ini juga tak akan berbeda. Mereka malah memulai musim dengan baik lewat dua kemenangan,” ucapnya. The Pool memang telah melakukan pembenahan pasca hanya finis di peringkat ketujuh musim lalu. Pelatih Brendan Rodgers membeli beberapa pe-

dinyatakan klub tak lama kemudian dalam laman “Dia tidak memiliki riwayat penyakit jantung. Anda lihat segala sesuatu bisa saja terjadi pada pemain di lapangan dan kita tidak mengira ini akan terjadi pada pemain kami,” ucap pelatih Eduardo Caceres kepada Radio La Red. “Kami sudah melakukan pemeriksaan terhadap dia dan kalangan medis akan mengumumkan hasil pemeriksaan mereka,” bunyi pernyataan klub.

Freiburg Hukum FC Hollywood AP

WAYNE Rooney bakal gagal gabung John Terry di Chelsea. ney. Uniknya , fans Chelsea juga sama menggemakan chant untuk striker Inggris itu. “Dia (Rooney) telah mencetak begitu banyak gol dan me-

nas Jerman di kualifikasi Piala Dunia 2014 melawan Austria dan Kepulauan Faroe, September mendatang. “Engkel dia (Schweinsteiger) terkilir, tes medisnya besok. Saya harap dia akan main pada Jumat, tapi kami belum tahu,” papar pelatih Pep Guardiola. Bintang berusia 29 tahun itu mesti berpacu dengan waktu supaya bisa menjajal Chelsea selaku penyandang trofi Liga Europa di Stadion Eden, Praha. Itu problem berat buat Pep, yang sebelumnya sudah kehilangan Thiago Alcantara selama lebih dari dua bulan karena cedera engkel. Gelandang Spanyol berusia 22 tahun, yang gabung Bayern dari Barcelona, Juli lalumenderita cedera ligamen saat Die Roten mengatasi Nurenberg 2-0.


Putih melangkah, mematikan lawannya empat langkah.

2 2 2 1 1 1 1 1 1 1 1 1 1 0 0 0 0 0 0

main anyar guna menutupi kekurangan di beberapa sektor. Hasilnya terlihat cukup baik, Steven Gerrard cs menang atas Stoke City dan AstonVilla di dua laga awal Liga Premier. Pada Selasa (Rabu WIB), pasukan Rodgers juga menunjukkan konsistensi permainannya dengan memukul Notts County 4-2 pada ajang Piala Liga Inggris. Menurut bek serba bisa MU, Phil Jones, striker Daniel Sturridge yang paling perlu diwaspadai. Terbukti Sturridge selalu menyarangkan gol dalam tiga laga terakhir Liverpool. “Dia (Sturridge) cerdik dalam mencari celah. Dia salah satu pemain yang akan mendapat perhatian khusus selama pertandingan,” tegas Jones. (m15/okz/sky/tf)

Sanabria Semaput Lantas Tewas

menangkan banyak piala bersama United. Saya berharap dia juga menerima sambutan yang baik dari para fans,” pungkas Vidic. (m15/vvn/sky/twg)

Pukulan Tambahan Bayern Vs Chelsea BERLIN (Waspada): Selain kecewa ditahan SC Freiburg 1-1 pada spieltag 4 Bundesliga, Selasa (Rabu WIB), Bayern Munich juga menderita pukulan tambahan. Gelandang andalannya Bastian Schweinsteiger harus keluar lapangan menit 79, setelah mengalami masalah pada pergelangan kakinya. Pemain senior Jerman yang digantikan Franck Ribery itu akibatnya diragukan dapat tampil pada Piala Super Eropa melawan Chelsea, Jumat (30/8) malam. “Dia akan diperiksa di Munich, kami berharap dia akan dapat dimainkan melawan Chelsea,” tutur direktur media Bayern Markus Hoerwick, seperti dilansir DPA, Rabu (28/8). Schweinsteiger juga rawan absen pada pertandingan Tim-

nang 4-2 atas klub League One lainnya, MK Dons. Wickham mencetak dua gol dan memberi umpan untuk terciptanya gol ketiga pada 15 menit terakhir yang menegangkan, saat Sunderland membalikkan defisit dua gol di Stadium of Light. Saido Berahino menyarangkan trigol pada babak pertama ketika memenangkan West Bromwich Albion 3-0 atas klub League Two, Newport County. West Ham United menang 2-1 atas Cheltenham Town, Southampton menghancurkan Barnsley 5-1 dan Norwich City menikmati kemenangan 6-3 atas Bury di Carrow Road. (m15/ant/rtr/afp)

3 2 2 2 2 2 2 2 3 2 2 2 2 2 2 2 2 2 2

“Ini pukulan besar dan kami benar-benar akan kehilangan dia. Dia memiliki kemampuan tertentu yang tidak dimiliki pemain lainnya. Kami harus menemukan solusi ,” tambahnya. Namun Presiden Bayern Uli Hoeness optimis, Pep mampu mengatasinya. Apalagi Pep telah membuktikan dirinya lebih baik dibanding manajer Chelsea Jose Mourinho, saat keduanya berseteru di La Liga. “Pep dan Mourinho bersaing dalam sebuah pertarungan menarik di Spanyol selama beberapa musim dan pelatih kami keluar sebagai pemenang,” klaim Hoeness. “Selalu ada tensi antara mereka. Ini duel menarik dan menambah sesuatu yang ekstra di pertandingan Jumat,” ujarnya lagi. (m15/goal/dpa/bild)

B E R L I N (Waspada): Bayern Munich kehilangan angka untuk pertama kalinya musim ini di Bundesliga Jerman, Selasa (Rabu WIB), setelah ditahan 1-1 oleh tuan rumah SC Freiburg. Penyandang treble winners dari arena Liga Champions, Bundesliga dan Piala Jerman itu sempat unggul lebih dulu melalui gol Xherdan Shaqiri menit 33. Bayern terus mendominasi permainan, tetapi gagal mengonversi serangkaian peluang meski menikmati 75 persen penguasaan bola. Pasca mencanangkan rekor baru dengan meraih 81 poin kemenangan beruntun saat mengalahkan Nuremberg, Sabtu lalu, FC Hollywood malah kebobolan gol Nicolas Hofler menit 86. Menurut kapten Philipp Lahm, timnya dihukum Freiburg akibat gagal memaksimalkan sekian banyak peluangnya di Stadion Badenova. “Kami hanya dapat menyalahkan diri kami sendiri,” jelas Lahm, seperti diberitakan AFP, Rabu (28/8). “Kami memiliki peluangpeluang yang cukup untuk membuatnya menjadi 2-0, tapi kami kemudian dihukum,” tam-

bah sang kapten, yang masuk menggantikan Mario Gotze menit 62. Pelatih anyar Pep Guardiola yang memperkenalkan sistem baru 1-4-1-4-1 sejak menggantikan Jupp Heynckes, melakukan beberapa perubahan di susunan timnya dari tim yang menang 2-0 atas Nuremberg. Pria Spanyol berusia 42 tahun itu mengistirahatkan enam pemain pilihan pertamanya, termasuk winger kembar Arjen Robben dan Franck Ribery. “Jika Anda hanya memimpin 1-0,



Klasemen Bundesliga B Munich 4 Dortmund 3 Leverkusen 3 Mainz 3 Hertha 3 Bremen 3 Hanover 3 Hoffenheim 3 Wolfsburg 3 Gladbach 3 Frankfurt 3 Augsburg 3 Nuremberg 3 Freiburg 4 Hamburg 3 Schalke 3 Stuttgart 3 Braunschweig 3 AP

BINTANG Bayern Thomas Mueller (kiri) bertarung seimbang dengan Fallou Diagne di Freiburg, selatan Jerman, Rabu (28/8) dinihari WIB.

maka Anda selalu rentan untuk kemasukan gol penyama kedudukan,” papar Pep. “Saya tidak berpikir diri saya mengambil resiko terlalu banyak dengan susunan pemain seperti itu. Saya tidak tahu apakah kami kehilangan satu atau dua pemain, saya mengambil keputusan dan di lapangan itu berjalan dengan baik,” ujarnya lagi. FC Hollywood sebenarnya memulai duel dengan bagus dan memperlihatkan kelasnya ketika striker Thomas Mueller


3 3 3 3 2 2 2 1 1 1 1 1 0 0 0 0 0 0

1 0 0 0 1 0 0 2 0 0 0 0 2 2 1 1 0 0

0 0 0 0 0 1 1 0 2 2 2 2 1 2 2 2 3 3

7-2 10 7-1 9 8-3 9 7-3 9 9-3 7 2-1 6 4-4 6 10-6 5 4-4 3 6-7 3 3-7 3 2-6 3 4-6 2 6-9 2 4-9 1 4-9 1 3-6 0 1-5 0

menaklukkan tiga bek di sisi kanan lawan dan mengirim umpan silang ke tiang jauh. Umpan itu langsung disambut winger Shaqiri menjadi gol. Masuknya Mike Hanke menggantikan Karim Guede menit 75, mengubah permainan dari kiri ke sayap kanan Freiburg. Sebastian Freis lantas mengirimkan umpan silang yang ditembakkan gelandang Hoefler menembus gawang kiper Manuel Neuer dari jarak dekat. “Saat Anda melawan Bayern Munich, Anda memerlukan toleransi yang sangat tinggi untuk frustrasi,” ungkap pelatih Freiburg Christian Streich. (m15/ant/afp/espn)

Sudoku 1. Gerak badan untuk menguatkan dan menyehatkan tubuh. 5. Olahraga (Inggris). 7. Sikap bersedia mengakui keunggulan (kekuatan) lawan; Kesportifan. 11. Seri (Inggris). 12. Liga (Inggris, jamak). 14. Kode negara Jepang dari Komite Olimpiade Internasional (IOC). 15. Bunyi dering kalau dipukul (dalam pertandingan tinju). 16. Ruang besar (di sekolah dsb) untuk kegiatan olahraga dsb. 18. Angka (di belakang jersey pemain). 19. Singkatan olahraga. 20. Kode negara Kuwait dari IOC. 22. Undian dengan uang logam. 23. Kode negara Indonesia dari FIFA. 24. Satuan ukuran panjang (untuk lomba lari dsb). 26. Alat pelepas panah. 27. Kesebelasan. 28. Over Time. 30. Perbuatan; Tindakan; Olahraga. 31. Air tempat lomba boat, yacht dsb. 33. Gerakan berguling ke depan. 34. Klub sepak bola Italia yang dijuluki Ducali. 35. Sebutan lain Barcelona, klub sepak bola Spanyol.

2. Klub sepak bola Inggris yang jerseynya ada tulisan Emirates. 3. Ibukota Brazil, tuan rumah Piala Konfederasi 2013 dan Piala Dunia 2014. 4. Petinju legendaris AS. 5. Babak (dalam bulu tangkis, tenis). 6. Olahraga raket dengan jaring setinggi kira-kira satu meter. 8. Pertandingan diikuti beberapa regu. 9. Stadion balap sepeda. 10. Olahraga menggunakan pedang. 11. Lepaskan peluru (olahraganya Perbakin). 13. England Premier League. 17. Negara berkota Melbourne, tempat turnamen tenis internasional. 19. Lawan in. 21. Olahraga bertempur/bela diri China. 22. Pelatih (Inggris populer, selain coach) 25. Air beku, lapangan Ice Skating. 26. Adu kecepatan. 27. Penjaga gawang. 29. Technical Knock Out. 30. Perkumpulan (olah raga). 32. Kelompok; Regu.

Isi dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di kotak 3x3 bergaris tebal. Tingkat kesulitan: sulit (****), bisa diselesaikan dalam waktu tak sampai 15 menit. Jawabannya di halaman A2 kolom 1.

6 4 1 2 5 4 5 8 7 2 1 6 8 7 5 6 2 9 8 7 1 9 1 2 3 9 7 4




WASPADA Kamis 29 Agustus 2013

Wenger Minati Mata


BINTANG kemenangan Arsenal Aaron Ramsey (kiri) merayakan gol keduanya ke gawang Fenerbahce dengan rekannya Yaya Sanogo di Emirates Stadium, London, Rabu (28/8) dinihari WIB.

Nikmat Ramsey LONDON (Waspada): Arsenal memastikan penampilan ke-16 kalinya secara berturut-turut di fase grup Liga Champions, Selasa (Rabu WIB), setelah mengatasi Fenerbahce 2-0 pada leg kedua babak playoff. The Gunners telah menapakkan satu kakinya untuk undian fase grup, Kamis (29/ 8) ini, karena mampu menang 3-0 di markas Fenerbahce pada pertandingan pertama. Namun mereka menyelesaikan pekerjaan dengan impresif, sekali lagi Aaron Ramsey menjadi bintang pertunjukan. Gelandang 22 tahun itu merasa nikmat dengan memborong kedua gol Meriam London masing-masing menit 25 dan 72. “Saya sangat menikmati. Setelah cedera, dibutuhkan waktu untuk mendapatkan lebih dari itu,” beber Ramsey. “Mental saya tentu juga perlu pemulihan. Tapi saya merasa lebih baik sekarang dan senang bisa menunjukkan ke

orang-orang apa yang saya bisa,” katanya lagi kepada ITV, Rabu (28/7). Pekan lalu di Istanbul, bintang Wales ini juga turut menyumbangkan satu gol ke gawang Fenerbahce. Total tiga gol telah dihasilkannya untuk membawa Gunners mulus melaju dengan keunggulan agregat 5-0. Arsenal sekaligus menjadi langganan lolos dari playoff, menyusul sukses serupa pada 2006, 2007, 2008, 2009, dan 2011. Namun laga berat sudah menanti anak asuh Arsene Wenger, karena akan melakoni North London Derby melawan Tottenham Hotspur akhir pekan ini di Liga Premier. Ramsey tentu diharapkan

Hasil Leg II Playoff, Selasa (Rabu WIB) Arsenal v Fenerbahce 2-0 Austria Vienna v Dinamo Zagreb 2-3 FC Basel v Ludogorets Razgrad 2-0 Legia Warsaw v Steaua Bucharest 2-2 PAOK Solaniki v FC Schalke 2-3 kembali menjadi bintang, seperti yang telah ditunjukkannya dalam laga home and away melawan Fenerbahce. Dia menggulirkan bola ke gawang yang kosong menit 25, setelah Lukas Podolski dan Theo Walcott berkombinasi untuk memberi umpan. Gelandang Wales itu kemudian mencetak gol keduanya menit 72 melalui sepakan voli, memanfaatkan assist Kieran Gibbs. Peran Ramsey ke depan makin vital, karena Gunners rawan kehilangan Podolski dan Jack Wilshere akibat cedera. Penyerang Jerman itu harus ditarik keluar lapangan pada awal babak kedua. Gelandang Wilshere mengalami masalah

Arsenal menang gol agregat 5-0 Vienna menang gol agregat 4-3 Basel menang gol agregat 6-2 Steaua menang gol tandang 3-3 Schalke menang gol agregat 4-3

LONDON (Waspada): Arsitek Arsenal Arsene Wenger mengaku kagum kepada Juan Mata. Namun dia enggan mengungkapkan besarnya minat The Gunners terhadap gelandang serang Chelsea itu. “Saya pernah mendengar seperti Anda, karena saya menyaksikan pertandingan tadi malam (Senin), bahwa Juan Mata bisa berada di bursa,” tutur Wenger, seperti dilansir AFP, Rabu (28/8). Mata pemain pengganti yang tidak digunakan saat Chelsea bermain 0-0 di Manchester United pada bigmatch Liga Premier, Senin lalu. Kenyataan itu memicu spekulasi bahwa status Mata tidak jelas lagi setelah The Blues ditukangi Jose Mourinho. Ayah sekaligus agen Mata, yang juga disebut Juan, dilaporkan hadir menonton sukses The Gunners menggunduli Fenerbahce 2-0 pada leg kedua play-off Liga Champions di Emirates Stadium. “Saya tidak tahu. Selalu ada keengganan di Inggris untuk menjual satu sama lain. Ya, saya menyukainya,” beber Wenger. Ketika ditanya apakah ayah Mata telah hadir di Emirates Stadium, Wenger menjawab dengan cara misterius. “Tidak, aku tidak tahu. Mungkin saja,” dalihnya. Wenger jelas sangat meminati Mata untuk digabungkan dengan rekan senegaranya Santiago Cazorla dan Mikael Arteta di Arsenal. Beda sekali tanggapannya saat dikonfirmasi mengenai tawaran kepada penyerang Inggris Wayne Rooney. “Kita tidak dapat berbicara tentang pemain yang berada di bawah kontrak dengan klub lain,” tegas Wenger. “Karena ketika seorang pemain berada di bawah kontrak di klub lain, dia harus menghormati kontrak. Jadi jika Anda ingin membeli pemain, Anda harus berbicara dengan klub pertama,” katanya lagi. Sebelumnya banyak penggemar Gunners mendesak Wenger untuk berinvestasi membeli pemain baru, setelah kegagalan penawaran terhadap Rooney (MU), penyerang Liverpool Luis Suarez dan striker Real Madrid Gonzalo Higuain. Meriam London makin membutuhkan amunisi baru, karena Lukas Podolski mengalami cedera hamstring. Aaron Ramsey dan Jack Wilshere juga menderita masalah di pangkal paha. “Saya tidak bisa mengatakan lebih dari itu, kita berada di bursa transfer. Semua orang tahu, seluruh dunia tahu itu sekarang,” pungkas Wenger. (m15/ant/afp/rtr)

sud adalah Hardiantono, M Irvan, Irvandi, dan Rico Simanjuntak yang sebelumnya sempat membela PSMS Divisi Utama PT Liga Indonesia (LI). Namun seiring tidak jelasnya nasib dan realisasi sisa gaji mereka, Hardiantono cs pun memilih berlabuh di Asahan. “Kami berharap bergabungnya keempat pemain tersebut dapat lebih meningkatkan

kualitas klub, mengingat kita punya target promosi ke Divisi Utama tahun depan,” ujar Sekretaris PS Bintang Jaya, Azwar Mahmud, didampingi Pelatih Legimin Sadat di Stadion Mutiara Kisaran, Rabu (28/8). Menurut Azwar, laga Divisi I dijadwalkan kembali berlanjut pada 14 September mendatang di Bogor. PS Bintang Jaya bergabung di Grup 13 Sumatera

pada pergelangan kakinya di fase akhir pertandingan. “Itulah hal negatif pada malam ini. Kami membayar harga yang mahal akibat cedera di depan, karena kami kehilangan Podolski,” tutur Arsene Wenger. “Saya tidak tahu bagaimana Wilshere merespon masalah pergelangan kaki. Dia terlihat baik-baik saja. Namun Podolski dipastikan absen selama 21 hari,” tambah pelatih asal Prancis itu. Podolski dipastikan absen melawan Hotspur, serta berpacu dengan waktu agar dapat pulih ketika Arsenal memulai penampilannya di fase grup Liga Champions pada 17 atau 18 September. (m15/ant/rtr/afp)


EMPAT mantan pemain PSMS Medan, Hardiantono (kiri bawah depan), M Irvan, Irvandi, dan Rico Simajuntak diabadikan bersama skuad tim PS Bintang Jaya, Rabu (28/8).

Timnas U-19 Jajaki Kamboja JAKARTA (Waspada): Pelatih Timnas U-19, Indra Sjafri, mengaku tengah menjajaki kemungkinan untuk melakoni laga ujicoba melawan Kamboja. Hal tersebut menyusul batalnya agenda uji tanding dengan Timor Leste yang telah dijadwalkan sebelumnya. Menurut Indra, anak asuhnya sangat membutuhkan jam terbang internasional sebagai bagian dari persiapan jelang tampil di Piala AFF 2013

yang sesuai rencana akan dihelat di Surabaya, 9-22 September mendatang. “Kami mendapat informasi jika Timor Leste telah membatalkan laga ujicoba yang awalnya direncanakan digelar antara 30 atau 31 Agustus nanti. Alasannya, karena Stadion Nasional Timor Leste dipakai untuk kegiatan kenegaraan,” kata Indra, Rabu (28/8). Ditambahkan, menyusul adanya pembatalan dari Timor

Leste, Badan Tim Nasional (BTN) sudah mengirim undangan kepada Federasi Sepakbola Kamboja untuk berujicoba pada 1 September mendatang di Stadion Petrokomia Gresik. Hanya saja, hingga saat ini belum ada jawaban dari pihak Federasi Sepakbola Kamboja. Informasi yang dihimpun menyebutkan, belum adanya jawaban pasti dari Kamboja, karena kesepakatan urung tercapai terkait teknis pelaksanaan

bersama Kwarta Deliserdang, Persidi Idi (Aceh Utara), PS Siak, Persi Sijunjung, Sumbar, dan PSBL Lampung. “Dari lima klub lawan nanti, Kwarta, Persidi, dan PS Siak sudah pernah kita hadapi dan tahu pola permainannya. Sebaliknya, Persi dan PSBL belum pernah kita hadapi, sehingga kedua tim itu bakal menjadi tantangan berat,” jelas Azwar. Gabung di Bintang Jaya, Hardiantono mengaku senang bisa kembali membela mantan timnya itu. Mantan Kapten Tim PON Sumut di Riau itu berharap bisa membantu memenuhi target klub promosi ke Divisi Utama tahun depan. “Saya sengaja memilih bermain di sini (Bintang Jaya). Meski pendatang baru, kualitas Bintang Jaya mulai diakui dan disegani lawan, termasuk klub yang sudah lama bercokol di Divisi Utama,” ujar Tono juga mengaku senang bisa kembali berkumpul bersama teman-teman mantan PON Sumut di Bintang Jaya. (a15) laga uji tanding tersebut. Kabarnya, pihak Kamboja mengajukan permintaan agar BTN menanggung semua akomodasi mereka hingga digelarnya AFF. Seperti diketahui, Kamboja merupakan salah satu kontestan AFF U-19 yang berada di Grup A bersama Laos, Filipina, Australia, Timor Leste, dan Singapura. (yuslan)


KAPTEN Schalke Benedikt Howedes (kanan) bertarung seru dengan penyerang PAOK Stefanos Athanasiadis di Toumba Stadium, Thessaloniki, utara Yunani, Rabu (28/8) dinihari WIB.

ROMA (Waspada): Penanganan pasca kecelakaan kapal yang dialami Gonzalo Higuain (foto kiri), membuat kesal Presiden Napoli Aurelio De Laurentiis (foto kanan), yang langsung mengecam standar rumah sakit setempat. “Rumah sakit itu bahkan samasekali tak tahu bagaimana membuat sepuluh jahitan,” kecam De Laurentiis dalam Tribal Football, Rabu (28/8). De Laurentiis pun siap melayangkan gugatan kepada Pemerintah Kota Campania sebesar 10 juta euro, karena buruknya standar penanganan kecelakaan mereka. “Saya kesal karena tak ada fasilitas medis dengan standar bagus. Terlepas apakah pasien tersebut adalah aktor, pesepakbola atau orang biasa, ketika mereka pergi ke rumah sakit, mereka harus benar-benar

bab, posisinya memang lebih dekat berada di Asia Tenggara,” sambung Djohar menambahkan masuknya Australia tentu akan ikut bertanggung jawab secara bersama membangun sepakbola di kawasan Asia Tenggara. “Kesempatan ini akan kita manfaatkan untuk kemajuan sepakbola Indonesia. Tentu ada positif dan negatifnya, apalagi akan terjadi persaingan yang tambah berat,” tutup Djohar yang mengikuti council meeting bersama Sekjen PSSI, Joko Driyono. (yuslan)

PAOK yang menjadi peserta sebagai pengganti klub Ukraina Metalist Kharkov yang mendapat hukuman, harus mencetak dua gol untuk dapat lolos. Pemain veteran Kostas Katsouranis mencetak satu gol. Namun Draxler kembali membawa petaka bagi tim Yunani itu. Dia memberi umpan kepada Szalai untuk mengamankan kemenangan 3-2 bagi Schlake, yang melaju dengan agregat gol 4-3. Austria Wina juga lolos agregat 4-3 atas Dinamo Zagreb. Meski kalah 2-3 pada leg kedua di kandang sendiri, Austria tetap melaju karena menang 2-0 pada leg pertama. Infostrada Sports melansir bahwa ini menjadi kali pertama Austria Wina masuk ke fase grup. Mereka menjadi klub Austria keempat yang lolos ke fase grup atau yang pertama sejak Rapid Wina padamusim 2005-06. Juara Piala Champions 1986 Steaua Bukarest melaju setelah bermain imbang 2-2 saat tandang melawan LegiaWarsawa. Pada leg pertama, Steaua ditahan 1-1 di kandang sendiri dan klub Rumania itu berhak lolos berkat aturan gol tandang. (m15/ant/afp/uefa)

mendapatkan pelayanan yang benar,” kritiknya lagi. “Apa sih yang dilakukanWali Kota Capri? Apa yang dilakukan Presiden dari daerah tersebut,” hardik De Laurentiis. Higuain mengalami kecelakaan ketika menikmati wisata air di Campania akhir pekan kemarin. Operasi kecil dilakukan dan bomber yang baru dibeli Napoli dari Real Madrid itu harus mendapat sepuluh jahitan di wajahnya. Tak ada cedera serius lain, namun jahitan Higuain membuat De Laurentiis marah besar. Higuain sendiri sudah terlihat menjalani sesi latihan secara terpisah dari rekan-rekan satu timnya. Dia diharapkan bisa tampil menghadapi tuan rumah Chievo Verona pada giornata 2 Liga Seri A, Sabtu (31/8) malam. Pulihnya penyerang Argentina itu, ditambah tingginya mobilitas gelandang serang


Marek Hamsik, Goran Pandev dan Gokhan Inler, membuat alenatorre anyar Rafael Benitez sangat optimistis dengan kans skuadnya. Bukan hanya di Seri A, tetapi juga di Liga Champions. “Ada banyak elemen yang membuat kami layak berkibar di Liga Champions. Tim ini memiliki

kualitas,” klaim Benitez melalui Goal Italia. Musim lalu I Partenopei menjadi runner-up Seri A dan mampu menembus babak 16 besar Liga Champions. Kini dengan komposisi skuad lebih mumpuni, mantan klub Diego Maradona itu siap menggapai prestasi lebih tinggi.

Duo Red Bull Dukung Ricciardo

Anggota Baru AFF “Dasar AFF menerima Australia menjadi anggota tak terbendung, karena negara itu telah menjadi anggota penuh AFC beberapa waktu lalu,” tulis Djohar dalam surat elektroniknya kepada Waspada, Rabu (28/8). Satu hal lagi, masih tulis Djohar, Australia adalah tetangga yang paling dekat dengan negara Asean, sehingga tidak ada alasan bagi AFF menolaknya untuk bergabung. “Tidak mungkin kan Australia bergabung dengan Asia Timur, Asia Tengah, Asia Selatan atau bagian lainnya di Asia. Se-

ATHENA (Waspada): FC Schalke kembali menembus fase grup Liga Champions, setelah mengungguli klub Yunani PAOK Saloniki 3-2 pada leg kedua babak playoff di Stadion Toumba, Thessaloniki. Ditangani mantan pelatih Schalke Huub Stevens, PAOK sebetulnya punya peluang lebih bagus menjelang pertandingan tersebut. Pasalnya, Stefanos Athanasiadis cs mampu memaksakan hasil 1-1 pada pertemuan pertama di Jerman. Namun sejumlah keuntungan mereka hilang akibat fakta harus memainkan pertandingan kandang tanpa kehadiran penonton. Heningnya suasana stadion membuat tim tamu seperti tanpa beban. Atsuto Uchida kemudian memberi peluang kepada Adam Szalai untuk membawa The Royal Blues unggul lebih dulu menit 43. Tuan rumah berusaha meningkatkan tekanan pada babak kedua dan mendapatkan imbalannya saat Athanasiadis mencetak gol balasan menit 53. Royal Blues harus tampil dengan sepuluh pemain ketika Jermaine Jones mendapatkan kartu kuning kedua menit 64. Namun Julian Draxler mampu memulihkan keunggulan klub Jerman itu menit 67.

De Laurentiis Kecam Jahitan Higuain

PSSI Sambut Positif Australia JAKARTA (Waspada): Keputusan Australia untuk menjadi bagian dari Federasi Sepakbola Asia Tenggara (AFF) mendapat sambutan positif dari PSSI. Australia bahkan dianggap sebagai pesaing berat yang nantinya akan menaikkan level sepakbola di kawasan Asean. Demikian dikatakan Ketua Umum PSSI, Djohar Arifin Husin, menanggapi hasil dari council meeting AFF di Timor Leste beberapa hari lalu yang salah satu keputusannya adalah menerima masuknya Australia sebagai anggota baru.


Royal Blues Kembali Tembus

Kuartet PSMS Perkuat Bintang Jaya KISARAN ( Waspada): Empat pemain PSMS Medan hijrah ke PS Bintang Jaya yang sedang bersiap menghadapi babak lanjutan kompetisi Divisi I Liga Amatir Indonesia (LAI). Nantinya, mereka diharapkan bisa memuluskan target PS Bintang Jaya promosi ke kompetisi Divisi Utama tahun depan. Keempat pemain dimak-

DUO Spanyol, Juan Mata (bawah) dan Santi Cazorla (atas), potensial bergabung di Emirates Stadium.


PEBALAP Toro Rosso Daniel Ricciardo (kiri) mendapat dukungan dari Sebastian Vettel untuk bergabung dengan Red Bull musim depan.

MILTON KEYNES, Inggris (Waspada): Duet Sebastian Vettel dan Mark Webber, memberi dukungan kepada Daniel Ricciardo bergabung dengan Red Bull Racing pada musim depan. Vettel mengatakan tidak menutup kemungkinan timnya mengontrak Ricciardo sebagai rekan setimnya untuk balapan Formula One (F1) musim 2014. Tim yang berbasis di Milton Keynes ini harus menemukan rekan setim baru untuk Vettel, menyusul keputusan Webber pensiun di akhir tahun nanti. Secara luas, Red Bull diyakini condong memilih Ricciardo sebagai suksesor Webber. Sebelumnya, Kimi Raikkonen (Lotus) dan Fernando Alonso (Ferrari) juga masuk dalam daftar incaran Red Bull. Meski begitu, Christian Horner selaku Ketua Tim Red Bull menegaskan belum ada satu pun pebalap yang telah dikontrak untuk menggantikan Webber. Vettel, sebelumnya mengakui akan “lebih memilih Kimi” jika pebalap Finlandia itu dibandingkan dengan Alonso. Kini, Vettel tampaknya merasa Ricciardo akan menjadi pilihan yang

baik, karena telah menjadi bagian Red Bull untuk beberapa waktu. “Ini akan masuk akal untuk menerima Ricciardo, karena dia telah berada di Red Bull untuk waktu yang lama,” kata Vettel, Rabu (28/8). Terkait pengalaman Ricciardo di ajang F1 yang dinilai masih minim, Vettel merasa Ricciardo adalah contoh yang baik ketika timtim papan atas mulai memberikan kesempatan kepada pebalap muda. “Orang-orang akan berpendapat bahwa dia (Ricciardo) mungkin belum siap, tapi apa saya siap ketika bergabung dengan Red Bull dulu?” tanya Vettel. Selain Vettel, Webber juga mendukung keputusan Ricciardo memperkuat Red Bull. Ricciardo sebagai penggantinya. Mendengar ucapan pebalap Australia itu, Ricciardo mengaku sangat senang mendengarnya. “Dia benar mengatakan itu? Kita semua mengenal Webber. Dia suka melakukan prediksi, terkadang hal itu benar, bisa juga mereka salah,” tutup Ricciardo, andalan Toro Rosso. (m33/auto)


WASPADA Kamis 29 Agustus 2013


Sukses IRT Di Tri Nation Benny Kibarkan Merah Putih

MEDAN (Waspada): Para pereli Sumut yang bergabung dalam Indonesia Rally Team (IRT) menuai sukses saat tampil di ajang Tri Nation Rally 2013 Putaran I yang berlangsung di Johor Bahru, Malaysia. Dalam event yang juga menjadi putaran II Malaysian Rally Championship 2013, 23-25 Agustus itu, Benny Lautan didampingi Edwin Nasution di atas Mitsubishi Evo 9 berhasil merebut gelar di Grup TN3 (Grup N4 WD) dengan raihan waktu 3 jam 44 menit 3 detik. Sori Siregar/Riswansyah yang diperkuat Proton Satria 4WD menempati posisi kedua dengan catatan waktu 4:00:46,7 disusul pasangan tuan rumah Nandakumar Puspanathan/Mathew Palmer (4:25:55,5). Pada kesempatan ini, IRT menurunkan lima pasangan pereli dalam kejuaraan Tri Nation Rally 2013 yang total berlangsung tiga putaran itu. Selain Benny dan Sori, tiga pasangan Sumut lain yang tampil adalah Ijeck/Uche, Robby Harahap/Boy Martadinata, dan Partogi Sirait/Arjuna. “Prestasi yang direbut di Malaysia sesuai dengan target yang kita usung, yakni mampu membawa pulang gelar pada kelaskelas yang diikuti,” ucap pereli andal Sumut, Ijeck, di Medan, Rabu (28/8). Dengan hasil ini, sebut Ijeck, peluang pereli Indonesia menjadi DUET Benny Lautan dan Edwin Nasution mengibarkan bendera putih di ajang Tri Nation Rally 2013 Putaran I di Johor Bahru, Malaysia. -Waspada/ist-

yang terbaik dalam ajang tiga negara ini semakin besar, mengingat putaran kedua akan digelar di Sumut. Ketua Pengprov IMI Sumut itu mengungkapkan putaran II Tri Nation Rally 2013 akan berlangsung 12-13 Oktober mendatang. “Nanti pasti ketat dan seru, pasalnya beberapa pereli luar dari Malaysia dan Thailand sudah konfirmasi ikut serta, termasuk dari Jepang, Selandia Baru, dan Kaledonia Baru,” ungkap Ijeck didampingi Rudi Siregar dan John Lubis yang juga Ketua Harian Pengprov IMI Sumut. Rudi Siregar menambahkan, event Tri Nation Rally 2013 putaran I diikuti oleh 17 peserta dari total 34 kompetitor Malaysian Rally Championship 2013 putaran II. Ceremonial start pada Jumat (23/8) di Angsana Complex Johor Bahru Malaysia turut dihadiri Ketua Umum PP IMI Nanan Soekarna dan Konjen RI untuk Johor Bahru. Tiga pereli Indonesia lain bernasib kurang beruntung, karena berhenti saat lomba. Ogi/Arjuna, mengendarai Proton Neo 1600 cc, mengalami kendala di Spesial Stages (SS) dengan turunnya hujan sebelum perlombaan. Begitupun, Ogi menempati posisi III di Grup TN1 (1.600 cc) di belakang duo, Karamjit Singh dan Azmeer Yusri. Ijeck/Uche mengalami kendala suspensi dan berhenti di SS 12, sedangkan Robby/Boy Martadinata terhenti di SS 2. “Lokasi perlombaan di Kota Tinggi Johor Bahru dengan jumlah 14 SS banyak membuat peserta berhenti karena masalah mesin atau keluar lintasan. Total hanya 19 dari 34 peserta yang mampu finish,” tambah John Lubis. (m47)

Duo Aceh Resmi Perkuat Timnas U-19 Putra/Putri Popnas Sumut Semifinal Bola Voli Pantai HUT Tapteng MEDAN (Waspada): Regu putri Popnas Sumut melaju ke semifinal turnamen bola voli pantai dalam rangka HUT Kabupaten Tapanuli Tengah (Tapteng) yang berlangsung di Pantai Kalangan, Rabu (28/8). Pasangan Popnas putri Sumut, Fitri/Mita, memastikan tiket empat besar setelah mengungguli pasangan tuan rumah Tapteng 4 dengan skor 2-0 (21-6, 21-9). Selanjutnya, Fitri/Mita di semifinal akan menghadapi pasangan asal Korem Tapteng. Sukses pasangan putri diikuti duet putra Popnas Sumut 1, Yuanda/Sutan. Pasangan tersebut juga melaju ke semifinal usai mengatasiTapteng 2 dengan skor 2-0 (23-21, 21-19). Laga semifinal lainnya, putra Pematangsiantar menghadapi Tebingtinggi dan putri Deliserdang melawan Sibolga 2.

“Sukses anak-anak melaju ke semifinal sangat kita syukuri. Kejuaraan ini kita jadikan sebagai ajang pemanasan sebelum mereka tampil dalam Pekan Olahraga Pelajar Nasional (Popnas) 2013 di Jakarta,” ujar Penanggung Jawab Tim Popnas Sumut, Indra Kasih. Indra mengaku akan terus melakukan evaluasi tim, salah satunya mengikutsertakan tim dalam satu turnamen atau kompetisi, maupun dengan melakukan laga ujicoba dengan klub-klub di Sumut. “Tujuannya agar tim bola voli indoor maupun pantai dapat lebih padu dan siap menghadapi Popnas. Apalagi kita dibebani target untuk bisa meraih prestasi terbaik,” timpal duet Pelatih Tim Bola Voli Popnas Sumut, Sudarianto dan Herry Susanto. (m42)

Timnas Voli Tatap Dua Kejuaraan SURABAYA (Waspada): Timnas bola voli putra berencana tampil pada dua ajang internasional pada September nanti sebagai pemanasan sebelum berlaga di SEA Games 2013 di Myanmar, Desember mendatang. Pelatih timnas voli putra, Ibarsyah Danu Tjahjono, mengatakan dua kejuaraan internasional yang diikuti timnya adalah prakualifikasi Kejuaraan Dunia Zona Asia pada pertengahan September dan Islamic Solidarity Games (ISG) di Palembang, akhir September. “Sebelumnya, anak-anak sudah tampil pada prakualifikasi putaran pertama kejuaraan dunia di Thailand, akhir Juni lalu, dan berada di peringkat kedua setelah tuan rumah. Untuk putaran kedua, rencananya digelar pertengahan September, tapi kami masih menunggu jadwal,” ujar Ibarsyah,

Rabu (28/8). Setelah prakualifikasi kejuaraan dunia, Bagus Wahyu cs langsung bersiap tampil di ISG 2013 di Palembang. Saat ini, timnas putra terus menjalani pemusatan latihan nasional secara intensif di Padepokan Bola Voli, Sentul, Bogor, Jawa Barat. “Kami ingin meraih hasil maksimal dari kedua ajang tersebut, terutama di ISG. Tapi, kami belum banyak mengetahui kekuatan negara-negara pesaing,” tambah pelatih klub bola voli Surabaya Samator itu. “Setelah libur lebaran lalu, latihan tidak hanya difokuskan pada pemantapan taktik dan strategi, tetapi juga menggenjot kondisi fisik pemain, karena sebagian besar staminanya kedodoran,” katanya. (m42/ant)

Porwanas Perebutkan 120 Medali BANJARMASIN (Waspada): Pekan Olahraga Wartawan Nasional (Porwanas) yang akan berlangsung 11-20 September 2013 di Kota Banjarmasin, Kalimantan Selatan, akan memperebutkan total 120 keping medali. “Ke-120 medali tersebut terbagi dalam 10 cabang yang dipertandingkan,” ujar Sekretaris Persatuan Wartawan Indonesia (PWI) Cabang Kalsel, Zainal Helmi, kepada wartawan di Banjarmasin, Rabu (28/8). Sejumlah 10 cabang olaraga yang dipertandingkan adalah sepakbola memperebutkan 1 emas, 1 perak, 1 perunggu, kemudian atletik (2-2-2), tenis lapangan (9-9-9), futsal (2-2-2), catur (2-2-2), bridge (2-2-2), biliar (3-3-3), bulutangkis (9-9-9), tenis meja (9-9-9) serta voli (1-1-2). Dengan demikian, jumlah medali diperebut-

kan terdiri atas 40 emas, 40 perak, dan 40 perunggu. Cabang-cabang tersebut dipertandingkan baik yang berada di Kota Banjarmasin serta di Kota Martapura yang notabene ibukota Kabupaten Banjar yang berjarak sekira 45 km dari Banjarmasin. Mengenai jumlah atlet dan ofisial yang bakal hadir di Banjarmasin, berdasarkan data yang ada di PWI Kalsel selaku Panitia Daerah Porwanas tercatat 2.048 orang, yakni 1.581 atlet dan 467 ofisial. Ke-34 peserta yang sudah terdaftar adalah Aceh, Sumut, Riau, Sumbar, Jambi, Sumsel, Bengkulu, Lampung, Babel, Kepri, DKI Jakarta, Jabar, Jateng, Surakarta, Yogyakarta, Jatim, Banten, Bali, Kalbar, Kalsel, Kalteng, Kaltim, Sulut, Sultra, Sulteng, Gorontalo, Sulbar, Sulsel, Maluku, Malut, NTT, NTB, Papua, dan Papua Barat. (m42/ant)

BANDA ACEH (Waspada): Dua dari tiga pemain Aceh masuk dalam daftar 20 pemain yang akan memperkuat Timnas U-19. Nama pemain muda asal Tanah Rencong itu sudah resmi dirilis Badan Tim Nasional (BTN). Para pemain Garuda Muda ini dipersiapkan berlaga pada Piala AFF U-19. Sebelumnya, Timnas U-19 diperkuat 32 pemain. Namun BTN kini mengerucutkannya menjadi 20 pemain saja untuk berlaga di Piala AFF U-19 pada 9-22 September mendatang. Dua pemain Aceh yang lolos itu tak lain adalah Zulfiandi (PSSB Bireuen) dan Hendra Sandi Gunawan (Persiraja Banda Aceh). Sementara, Miftahul Hamdi gagal bersaing sehingga harus kerja keras lagi. “Di luar nama 20 orang yang sudah diumumkan itu, kami masih diberi kesempatan oleh pelatih untuk bersaing lagi. Kata pelatih, kemungkinan ada pemain yang terdegradasi dan promosi,” jelas Miftahul Hamdi kepada Waspada, Rabu (28/8). Katanya, dia mengakui harus berbesar hati gagal menembus tim inti, akibat gagal bersaing dengan pemain yang kualitasnya bagus. Saingan Hamdi adalah Maldini, pemain asal Makassar didikan Uruguay.

“Saya harus akui, kualitas Maldini bagus, saya harus menerima fakta ini. Tapi Alhamdulillah, pelatih masih memberi peluang kepada kami untuk tampil lebih bagus dan bisa membela Timnas di Piala AFF nanti,” harapnya. Di kejuaraan tersebut, Garuda Muda tergabung di Grup B bersama Thailand, Vietnam, Malaysia, Brunei Darussalam, dan Myanmar. Sedangkan Grup A dihuni Laos, Filipina, Australia, Timor Leste, Singapura, dan Kamboja. Juara dan runner-up masing-masing grup otomatis lolos ke babak semifinal Dalam rilis AFF, Indonesia akan menghadapi Brunei pada 10 September mendatang. Selanjutnya, tim besutan Indra Sjafri menjamu Myanmar (12/9),Vietnam (14/9), Thailand (16/9), dan Malaysia (18/9). Piala AFF U-19 akan berpusat di Stadion Gelora BungTomo, Surabaya. Namun laga-laga lainnya juga bakal digelar di Stadion Petrokimia (Gresik) dan Stadion Gelora Delta (Sidoarjo). (b07)

KNPI Atim Gelar Turnamen Voli IDI (Waspada): Dewan Pengurus Daerah Komite Nasional Pemuda Indonesia (DPD KNPI) Kabupaten Aceh Timur (Atim) menggelar turnamen bola voli di Lapangan Idi (sebelah Kantor Pegadaian Idi Rayeuk), mulai Kamis (29/8) ini. “Rencananya, turnamen akan dibuka resmi Bupati Aceh Timur, Hasballah M Thaib atau akrab disapa Rocky,” kata Ketua KNPI Aceh Timur, Iskandar Waspada/Muhammad Usman Alfarlaky SHi (foto) didampingi Ketua Panpel Al Muyasir, Rabu (28/8). Iskandar menjelaskan, turnamen memperebutkan hadiah uang tunai senilai Rp3 juta untuk juara pertama itu, mengangkat tema “Tumbuhkan Semangat Pemuda Menuju Perdamaian Hakiki”. “Tim-tim yang akan bertanding dalam turnamen kali ini, di antaranya berasal dari Kecamatan Nurussalam (Bagok), Peureulak Kota, Julok, 05, Peudawa Rayeuk, Idi Cut, Keutapang Mameh, dan Madat,” tutur Iskandar. “Kami juga berharap turnamen ini dapat menumbuhkembangkan semangat atlet, pemuda, dan masyarakat umum dalam menyongsong serta menyukseskan Aceh Timur sebagai tuan rumah Pekan Olahraga Aceh (Pora) 2014,” pungkasnya. (b24)


HENDRA Sandi Gunawan dan Zulfiandi lolos seleksi memperkuat Timnas U-19 dalam menghadapi Piala AFF, September mendatang.

IPSI Medan Dukung Porkot Berkualitas MEDAN (Waspada): Pengcab Ikatan Pencak Silat Indonesia (IPSI) Medan mendukung misi KONI Medan melahirkan atlet berkualitas. Karenanya, IPSI berharap Pekan Olahraga Kota (Porkot) Medan 2013 yang berlangsung 5-12 Oktober tersebut, atlet yang berlaga lebih baik dari pada tahun lalu. Ketua IPSI Medan, H Ahmad Arief SE MM (foto), didampingi Sekretaris Umum Zulham SH menyatakan adanya Porkot berkualitas sebagaimana misi event tahunan tersebut kali ini, maka cabang silat juga dipastikan siap dipertandingkan. “Kita sangat mendukung

Para Unggulan Amankan Tiket NEW YORK, AS (Waspada): Kegagalan menjuarai AS Terbuka tahun lalu tampaknya sudah mulai dilupakan Victoria Azarenka (foto). Di laga perdananya tahun ini, Rabu (28/8), petenis Belarus itu memperlihatkan tekad tingginya untuk kembali tampil di partai puncak. Pada pertandingan pembukanya melawan Dinah Pfizenmaier (Jerman), Azarenka tampil mengesankan. Mantan ratu tenis itu menang straight set dengan telak 6-0, 6-0 dalam tempo sekira satu jam. Setelah menutup set pertama dalam waktu 36 menit, set kedua juga menjadi ajang dominasi bagi Azarenka. Tanpa ampun, unggulan kedua itu mendikte Pfizenmaier sebelum memastikan kemenangan dengan pukulan backhand tajam yang gagal dikembalikan lawan. Bagi Azarenka, kemenangan ini otomatis menambah kepercayaan dirinya menatap babak selanjutnya. Apalagi, dirinya menggeser Maria Sharapova di peringkat dua WTA menyusul hasil buruk yang dicapai petenis Rusia itu dalam beberapa turnamen terakhir. “Saya benar-benar senang untuk kembali ke lapangan ini, terakhir kali saya berada di sini terasa sangat emosional. Untuk kembali dan bersaing di salah satu arena paling terkenal di dunia, itu adalah luar biasa. Saya suka Kota New York,” tambah petenis berusia 24 tahun ini. Hadir tanpa pelatih di Flushing Meadows, Samantha Stosur mendapatkan kejutan besar di pertandingan pertamanya. Juara AS Terbuka 2011 asal Australia itu secara mengejutkan takluk d i tangan petenis muda Victoria Duval (AS) 7-5, 4-6, 4-6. “Perasaan saya belum bagus pada ronde pertama. Saya mungkin akan memberikan banyak jawaban yang salah saat ini ketimbang yang logis,” jelas Stosur. Selain Azarenka dan Duval, kemenangan juga diraih duet Serbia, Ana Ivanovic dan Jelena Jankovic, Sara Errani (Italia), Svetlana Kuznetsova (Rusia), Peng Shuai (China), dan Aleksandra Wozniak (Polandia). Di bagian putra, unggulan utama Novak Djokovic bermain nyaris sempurna melawan Ricardas Berankis (Lithuania). Petenis Serbia itu tampil dominan untuk menang 6-1, 6-2, 6-2. Sukses ini mengikuti kemenangan Roger Federer, saat jagoan Swiss ini menyingkirkan Grega Zemlja (Slovenia) 6-3, 6-2, 7-5. Kekalahan dialami Jerzy Janowicz (Polandia) dan Grigor Dimitrov (Bulgaria). Bila Janowicz tak berdaya menghadapi Maximo Gonzalez (Argentina) 4-6, 4-6, 2-6, maka Dimitrov yang juga pacar Maria Sharapova kalah 6-3, 3-6, 4-6, 7-5, 2-6. (m33/ap)


tujuan KONI menjaring atlet berkualitas. Kita juga bekerjasama dengan perguruan silat di Medan untuk menjaring atlet tersebut. Karena itu, kita juga harapkan pencarian atlet berbakat perlu dukungan dari KONI Sumut,” ucapnya di Medan, Rabu (28/8). Dikatakan, misi Porkot berkualitas erat kaitannya dengan upaya Medan menghadapi sejumlah event ke depan, seperti Porwil pada April-Mei 2014, Porprovsu 2014 pada November 2014 serta Pra PON 2015. “Untuk itulah, dengan adanya Porkot berkualitas, Kota Medan akan mampu sebagai penyumbang atlet terbesar di Sumut di seluruh event sampai pada tingkat nasional (PON),” ujarnya lagi. Zulham SH menambahkan, IPSI Medan memastikan siap


sebagai penyelenggara cabang silat Porkot pada 6-12 Oktober di Gelanggang Remaja Medan. Cabor pencak silat tercatat diikuti sebanyak 150 peserta dari 17 kecamatan, dengan kelas yang di pertandingkan dari A sampai I (putra) dan A sampai F (putrid). Untuk seni, tunggal ganda regu diikuti putra dan putri. (m47)

Sport Amukan Azarenka



Kamis 29 Agustus 2013

NEW YORK, AS (Waspada): Kegagalan menjuarai AS Terbuka tahun lalu tampaknya sudah mulai dilupakan Victoria Azarenka (foto). Di laga perdananya tahun ini, Rabu (28/8), petenis Belarus itu memperlihatkan tekad tingginya untuk kembali tampil di partai puncak. Pada pertandingan pembukanya melawan Dinah Pfizenmaier (Jerman), Azarenka tampil mengesankan. Mantan ratu tenis itu menang straight set dengan telak 6-0, 6-0 dalam tempo sekira satu jam. Setelah menutup set pertama dalam waktu 36 menit, set kedua juga menjadi ajang dominasi bagi Azarenka. Tanpa ampun, unggulan kedua itu mendikte Pfizenmaier sebelum me-

mastikan kemenangan dengan pukulan backhand tajam yang gagal dikembalikan lawan. Bagi Azarenka, kemenangan ini otomatis menambah kepercayaan dirinya menatap babak selanjutnya. Apalagi, dirinya menggeser Maria Sharapova di peringkat dua WTA menyusul hasil buruk yang dicapai petenis Rusia itu dalam beberapa turnamen terakhir. “Saya benar-benar senang

untuk kembali ke lapangan ini, terakhir kali saya berada di sini terasa sangat emosional. Untuk kembali dan bersaing di salah satu arena paling terkenal di dunia, itu adalah luar biasa. Saya suka Kota New York,” tambah petenis berusia 24 tahun ini. Hadir tanpa pelatih di Flushing Meadows, Samantha Stosur mendapatkan kejutan besar di pertandingan pertamanya. Juara AS Terbuka 2011 asal Australia itu secara mengejutkan takluk d i tangan petenis muda Victoria Duval (AS) 7-5, 4-6, 4-6. “Perasaan saya belum bagus pada ronde pertama. Saya mungkin akan memberikan banyak jawaban yang salah saat

ini ketimbang yang logis,” jelas Stosur. Kemenangan telak 6-0, 6-0 juga digapai petenis mungil asal Italia, Sara Errani, atas Olivia Rogowska (Australia). Rekor impresif pun masih diperlihatkan Agnieszka Radwanska. Unggulan ketiga asal Polandia tersebut menang atas Maria Teresa Torro (Spanyol) 6-0, 7-5. Selain Azarenka dan Duval, kemenangan juga diraih Svetlana Kuznetsova, Anastasia Pavlyuchenkova (Rusia), Peng Shuai (China), dan Aleksandra Wozniak (Polandia). Petenis China, Li Na, menjaga peluang dengan keberhasilan menaklukkan Sofia Arvidsson (Swedia) 6-2. 6-2. (m33/ap)

Senior Berjaya, Junior Berduka NEW YORK, AS (Waspada): Petenis unggulan putra menunjukkan tajinya dalam babak pertama AS Terbuka 2013, Rabu (28/8). Sebaliknya, sejumlah petenis junior harus menerima kenyataan pulang lebih awal dari Flushing Meadows. Unggulan utama Novak Djokovic (foto) bermain nyaris sempurna pada pertandingan pertamanya. Melawan Ricardas Berankis (Lithuania), petenis Serbia itu menang mudah de-

ngan total membuat dua kesalahan saja. Sempat bermain sedikit ceroboh pada set ketiga, The Djoker akhirnya menutup pertandingan 6-1, 6-2, 6-2 Selanjutnya, Djokovic berhadapan dengan Benjamin Becker (Jerman) yang sukses menghadang Lukas Rosol (Rep Ceko) 6-3, 3-6, 6-3, 6-4. Djokovic pun menyusul dua petenis unggulan lainnya, Rafael Nadal dan Roger Federer yang

sudah lebih dulu lolos ke babak kedua. Mengalami masa-masa kelam dalam kariernya dan diplot sebagai unggulan tujuh, kecintaan Federer terhadap tenis tidak pernah goyah. Hal ini dibuktikan dengan kemenangan atas petenis Slovenia, Grega Zemlja. Dengan motivasi merebut trofi di usia 32 tahun, Federer unggul 6-3, 6-2, 7-5. Sebagian pihak menilai bahwa menurunnya performa petenis Swiss itu akibat dikaru-

niai putri kembar. FedEx pun membantah anggapan tersebut. “Saya benar-benar baikbaik saja. Mereka (dua putri Federer) berada di lapangan hari ini. Saya sangat senang melihat mereka sebelum dan sesudah pertandingan,” tandasnya. Unggulan lain yang melangkah ke babak berikutnya adalah Tomas Berdych. Unggulan kelima asal Republik Ceko ini sukses mengatasi perlawanan Paolo Lorenzi (Italia) 6-1, 6-4, 6-1. Turut menuai kemenangan adalah Marcos Baghdatis (Siprus), Tobias Kamke dan Florian Mayer yang sama-sama asal Jerman) serta duet petenis tuan rumah, DonaldYoung dan Denis Kudla. (m33/ap)


Sirnas Bulutangkis Banjir Peserta


Porwanas Perebutkan 120 Medali BANJARMASIN (Waspada): Pekan Olahraga Wartawan Nasional (Porwanas) yang akan berlangsung 11-20 September 2013 di Kota Banjarmasin, Kalimantan Selatan, akan memperebutkan total 120 keping medali. “Ke-120 medali tersebut terbagi dalam 10 cabang yang dipertandingkan,” ujar Sekretaris Persatuan Wartawan Indonesia (PWI) Cabang Kalsel, Zainal Helmi, kepada wartawan di Banjarmasin, Rabu (28/8). Sejumlah 10 cabang olaraga yang dipertandingkan adalah sepakbola memperebutkan 1 emas, 1 perak, 1 perunggu, kemudian atletik (2-2-2), tenis lapangan (9-9-9), futsal (2-2-2), catur (2-2-2), bridge (2-2-2), biliar (3-3-3), bulutangkis (9-9-9), tenis meja (9-9-9) serta voli (1-1-2). Dengan demikian, jumlah medali diperebut-

kan terdiri atas 40 emas, 40 perak, dan 40 perunggu. Cabang-cabang tersebut dipertandingkan baik yang berada di Kota Banjarmasin serta di Kota Martapura yang notabene ibukota Kabupaten Banjar yang berjarak sekira 45 km dari Banjarmasin. Mengenai jumlah atlet dan ofisial yang bakal hadir di Banjarmasin, berdasarkan data yang ada di PWI Kalsel selaku Panitia Daerah Porwanas tercatat 2.048 orang, yakni 1.581 atlet dan 467 ofisial. Ke-34 peserta yang sudah terdaftar adalah Aceh, Sumut, Riau, Sumbar, Jambi, Sumsel, Bengkulu, Lampung, Babel, Kepri, DKI Jakarta, Jabar, Jateng, Surakarta, Yogyakarta, Jatim, Banten, Bali, Kalbar, Kalsel, Kalteng, Kaltim, Sulut, Sultra, Sulteng, Gorontalo, Sulbar, Sulsel, Maluku, Malut, NTT, NTB, Papua, dan Papua Barat. (m42/ant)

MEDAN (Waspada): Kejuaraan Bulutangkis Djarum Sirkuit Nasional Li-Ning dibanjiri peserta. Sampai Rabu (28/8) malam, sudah 900-an peserta yang mendaftar dan merupakan jumlah terbesar. Biasanya, pelaksanaan Sirnas yang merupakan “pesta” bulutangkis bergengsi nasional ini diikuti sekitar 700an peserta. “900-an peserta itu belum final. Kemungkinan jumlah peserta bisa bertambah berkisar 1000-an peserta,” kata Ketua Umum Pengprov PBSI Sumut, Ir Johannes IW (foto), seusai rapat kepanitiaan di Gedung PBSI

MEDAN (Waspada): Atlet bulutangkis PWI Sumut digenjot di Gedung PBSI Sumut JlWillem Iskandar Medan Estate setiap Rabu dan Jumat dalam persiapan mengikuti Pekan Olahraga Wartawan Nasional (Porwanas) XI di Banjarmasin, 14-20 September mendatang. Sebelumnya, tim bulutang-

kis Sumut yang terdiri atas Armin R Nasution (Waspada), Anthony Limtan, Aswadi (Analisa), Khairul Muslim, dan Malik Ariadi (Medan Pos), menggelar pelatihan di Gedung PWI Sumut, Jl Adinegoro. “Agar lebih maksimal latihan kita pindahkan ke Gedung PBSI Sumut. Di tempat ini kawan-

kawan wartawan punya banyak mitra tanding. Karenanya di sisa waktu yang ada hendaknya sarana yang ada di PBSI Sumut dapat dimanfaatkan,” kata pelatih bulutangkis PWI Sumut, H Syari “Aweng” Arwansyah, Rabu (28/8) malam. Aweng mengakui masih buta kekuatan lawan. Namun

IPSI Medan Dukung Porkot Berkualitas

Bola Voli Pantai HUT Tapteng “Sukses anak-anak melaju ke semifinal sangat kita syukuri. Kejuaraan ini kita jadikan sebagai ajang pemanasan sebelum mereka tampil dalam Pekan Olahraga Pelajar Nasional (Popnas) 2013 di Jakarta,” ujar Penanggung Jawab Tim Popnas Sumut, Indra Kasih. Indra mengaku akan terus melakukan evaluasi tim, salah satunya mengikutsertakan tim dalam satu turnamen atau kompetisi, maupun dengan melakukan laga ujicoba dengan klub-klub di Sumut. “Tujuannya agar tim bola voli indoor maupun pantai dapat lebih padu dan siap menghadapi Popnas. Apalagi kita dibebani target untuk bisa meraih prestasi terbaik,” timpal duet Pelatih Tim Bola Voli Popnas Sumut, Sudarianto dan Herry Susanto. (m42)

Waspada/Setia Budi Siregar

dingkan 21 nomor, yakni tunggal anak-anak (putra/putri), pemula (tunggal, ganda putra/putri), remaja (tunggal, ganda putra/ putri, campuran), taruna (tunggal, ganda putra/putri, campuran), dan dewasa (tunggal,


MEDAN (Waspada): Pengcab Ikatan Pencak Silat Indonesia (IPSI) Medan mendukung misi KONI Medan melahirkan atlet berkualitas. Karenanya, IPSI berharap Pekan Olahraga Kota (Porkot) Medan 2013 yang berlangsung 5-12 Oktober tersebut, atlet yang berlaga lebih

baik dari pada tahun lalu. Ketua IPSI Medan, H Ahmad Arief SE MM (foto), didampingi Sekretaris Umum Zulham SH menyatakan adanya Porkot berkualitas sebagaimana misi event tahunan tersebut kali ini, maka cabang silat juga dipastikan siap dipertandingkan. “Kita sangat mendukung tujuan KONI menjaring atlet berkualitas. Kita juga bekerjasama dengan perguruan silat di Medan untuk menjaring atlet tersebut. Karena itu, kita juga harapkan pencarian atlet berbakat perlu dukungan dari KONI Sumut,” ucapnya di Medan, Rabu (28/8). Dikatakan, misi Porkot berkualitas erat kaitannya dengan upaya Medan menghadapi sejumlah event ke depan, seperti

Porwil pada April-Mei 2014, Porprovsu 2014 pada November 2014 serta Pra PON 2015. “Untuk itulah, dengan adanya Porkot berkualitas, Kota Medan akan mampu sebagai penyumbang atlet terbesar di Sumut di seluruh event sampai pada tingkat nasional (PON),” ujarnya lagi. Zulham SH menambahkan, IPSI Medan memastikan siap sebagai penyelenggara cabang silat Porkot pada 6-12 Oktober di Gelanggang Remaja Medan. Cabor pencak silat tercatat diikuti sebanyak 150 peserta dari 17 kecamatan, dengan kelas yang di pertandingkan dari A sampai I (putra) dan A sampai F (putrid). Untuk seni, tunggal ganda regu diikuti putra dan putri. (m47)

Pereli Sumut Sukses Kibarkan Merah Putih MEDAN (Waspada): Para pereli Sumut yang bergabung dalam Indonesia Rally Team (IRT) menuai sukses saat tampil

di ajang Tri Nation Rally 2013 Putaran I yang berlangsung di Johor Bahru, Malaysia. Dalam event yang juga men-

jadi putaran II Malaysian Rally Championship 2013, 23-25 Agustus itu, Benny Lautan didampingi Edwin Nasution di atas


DUET Benny Lautan dan Edwin Nasution mengibarkan bendera putih di ajang Tri Nation Rally 2013 Putaran I di Johor Bahru, Malaysia.

ganda putra/putri, campuran). “Kami mengharapkan agar Pengkab/Pengkot PBSI se-Sumut mengirim atlet berprestasinya pada Sirnas itu guna menambah jam terbang dan meningkatkan performa pemain,” kata Johannes didampingi Ketua Panpel Kasim Wijaya dan Sekum H Syari “Aweng” Arwansyah. Disebutkan, Sirnas Bulutangkis 2013 berlangsung di 10 kota. Seri pertama di Balikpapan, selanjutnya Lampung (Sumatera A Terbuka), Manado (Sulawesi Terbuka), Jakarta, Bandung, Medan (Sumatera Terbu-

ka), Semarang, Yogyakarta, Bali (Bali/NTT/NTB Terbuka), dan Surabaya. Di Medan, Sirnas memberdayakan 24 wasit dengan 16 orang di antaranya dari Medan. Dari Mandailing Natal ada dua wasit, kemudian Sibolga dan Simalungun masing-masing satu wakil. PB PBSI sendiri mengutus empat wasit bersertifikat nasional. “Kita memohon doa dan dukungan masyarakat agar pelaksanaan Sirkuit Nasional Bulutangkis dapat berjalan lancar dan sukses,” pungkasYohannes. (m18)

Pebulutangkis PWI Sumut Pindah Latihan

Putra/Putri Popnas Sumut Semifinal MEDAN (Waspada): Regu putri Popnas Sumut melaju ke semifinal turnamen bola voli pantai dalam rangka HUT Kabupaten Tapanuli Tengah (Tapteng) yang berlangsung di Pantai Kalangan, Rabu (28/8). Pasangan Popnas putri Sumut, Fitri/Mita, memastikan tiket empat besar setelah mengungguli pasangan tuan rumah Tapteng 4 dengan skor 2-0 (21-6, 21-9). Di semifinal, Fitri/Mita akan menghadapi pasangan asal Korem Tapteng. Sukses pasangan putri diikuti duet putra Popnas Sumut 1, Yuanda/Sutan. Pasangan tersebut juga melaju ke semifinal usai mengatasiTapteng 2 dengan skor 2-0 (23-21, 21-19). Laga semifinal lainnya, putra Pematangsiantar menghadapi Tebingtinggi dan putri Deliserdang melawan Sibolga 2.

Sumut, Jl Willem Iskandar Medan Estate. Untuk menampung peserta, Pengprov PBSI Sumut mempergunakan Gedung Serba Guna di Jalan Pancing. Event yang digelar pada 9-14 September mendatang itu memakai 10 lapangan dengan kapasitas 7.500 tempat duduk (penonton). Johannes menyebutkan, dalam rapat kepanitiaan dimaksudkan untuk mematangkan persiapan. Kejuaraan tersebut, bukan hanya diikuti para pebulutangkis tanah air, melainkan juga atlet Singapura, Malaysia, dan Thailand. Sirnas nanti mempertan-

Mitsubishi Evo 9 berhasil merebut gelar di Grup TN3 (Grup N4 WD) dengan raihan waktu 3 jam 44 menit 3 detik. Sori Siregar/Riswansyah yang diperkuat Proton Satria 4WD menempati posisi kedua dengan catatan waktu 4:00:46,7 disusul pasangan tuan rumah Nandakumar Puspanathan/ Mathew Palmer (4:25:55,5). Pada kesempatan ini, IRT menurunkan lima pasangan pereli dalam kejuaraan Tri Nation Rally 2013 yang total berlangsung tiga putaran itu. Selain Benny dan Sori, tiga pasangan Sumut lain yang tampil adalah Ijeck/Uche, Robby Harahap/ Boy Martadinata, dan Partogi Sirait/Arjuna. “Prestasi yang direbut di Malaysia sesuai dengan target yang kita usung, yakni mampu membawa pulang gelar pada kelas-kelas yang diikuti,” ucap pereli andal Sumut, Ijeck, di

Medan, Rabu (28/8). Dengan hasil ini, sebut Ijeck, peluang pereli Indonesia menjadi yang terbaik dalam ajang tiga negara ini semakin besar, mengingat putaran kedua akan digelar di Sumut. Ketua Pengprov IMI Sumut itu mengungkapkan putaran II Tri Nation Rally 2013 akan berlangsung 12-13 Oktober mendatang. “Nanti pasti ketat dan seru, pasalnya beberapa pereli luar dari Malaysia dan Thailand sudah konfirmasi ikut serta, termasuk dari Jepang, Selandia Baru, dan Kaledonia Baru,” ungkap Ijeck didampingi Rudi Siregar dan John Lubis yang juga Ketua Harian IMI Sumut. Rudi Siregar menambahkan, event Tri Nation Rally 2013 putaran I diikuti oleh 17 peserta dari total 34 kompetitor Malaysian Rally Championship 2013 putaran II. Ceremonial start pada Jumat (23/8) di Angsana

Complex Johor Bahru Malaysia turut dihadiri Ketua Umum PP IMI Nanan Soekarna dan Konjen RI untuk Johor Bahru. Tiga pereli Indonesia lain bernasib kurang beruntung, karena berhenti saat lomba. Ogi/Arjuna, mengendarai Proton Neo 1600 cc, mengalami kendala di Spesial Stages (SS) dengan turunnya hujan. Begitupun, Ogi menempati posisi III di Grup TN1 (1.600 cc) di belakang duo, Karamjit Singh dan Azmeer Yusri. Ijeck/Uche mengalami kendala suspensi dan berhenti di SS 12, sedangkan Robby/Boy Martadinata terhenti di SS 2. “Lokasi perlombaan di Kota Tinggi Johor Bahru dengan jumlah 14 SS banyak membuat peserta berhenti karena masalah mesin atau keluar lintasan. Total hanya 19 dari 34 peserta yang mampu finish,” tambah John Lubis. (m47)

dilihat dari seleksi yang digelar beberapa waktu lalu, Aweng menyebutkan tim bulutangkis PWI Sumut tetap berpeluang juara. “Ini merupakan latihan perdana di Gedung PBSI Sumut. Dalam tahap awal kita melihat format pemain di sektor tunggal dan ganda sesuai dengan kelompok umur yang dipertandingkan,” lanjutnya. Sebelumnya, Pengprov PBSI Sumut pimpinan Ir Johannes

IW memberikan bantuan peralatan bulutangkis. Bantuan tersebut dimaksudkan sebagai penambah motivasi kepada pebulutangkis PWI Sumut menghadapi Porwanas nanti. Di Banjarmasin, PWI Sumut mengikuti cabang olahraga bulutangkis, futsal, catur, tenis meja, atletik dan biliar. Kontingen direncanakan bertolak menuju Banjarmasin, 12 September mendatang. (m18)


TIM bulutangkis Porwanas Sumut dan pelatih H Syari “Aweng” Arwansyah diabadikan bersama di Gedung PBSI Sumut, JlWillem Iskandar Medan Estate, Rabu (28/8) malam.


WASPADA Kamis, 29 Agustus 2013

Sumatera Utara

WASPADA Kamis 29 Agustus 2013


Zhuhur ‘Ashar

Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

12:28 12:42 12:29 12:36 12:36 12:32 12:29 12:25 12:31 12:31

15:40 15:50 15:40 15:45 15:46 15:46 15:41 15:37 15:43 15:41

Magrib 18:35 18:49 18:36 18:44 18:43 18:37 18:35 18:31 18:38 18:38



Shubuh Syuruq


19:44 19:59 19:45 19:53 19:52 19:46 19:44 19:40 19:47 19:47

04:54 05:06 04:55 05:01 05:01 05:00 04:55 04:51 04:57 04:56

05:04 05:16 05:05 05:11 05:11 05:10 05:05 05:01 05:07 05:06

L.Seumawe 12:34 L. Pakam 12:27 Sei Rampah12:27 Meulaboh 12:38 P.Sidimpuan12:26 P. Siantar 12:27 Balige 12:27 R. Prapat 12:23 Sabang 12:41 Pandan 12:28

06:19 06:31 06:20 06:26 06:26 06:25 06:21 06:16 06:23 06:22

Zhuhur ‘Ashar 15:44 15:39 15:38 15:49 15:40 15:39 15:39 15:37 15:50 15:41





Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq







Shubuh Syuruq

18:42 18:34 18:33 18:45 18:31 18:33 18:32 18:29 18:49 18:33

19:51 19:43 19:42 19:55 19:40 19:42 19:41 19:38 19:59 19:42

04:59 04:53 04:52 05:04 04:53 04:53 04:54 04:50 05:05 04:55

05:09 05:03 05:02 05:14 05:03 05:03 05:04 05:00 05:15 05:05

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:28 12:29 12:39 12:32 12:29 12:35 12:24 12:34 12:27 12:26

18:33 18:35 18:47 18:37 18:35 18:43 18:30 18:40 18:33 18:33

19:42 19:44 19:56 19:47 19:45 19:52 19:39 19:50 19:42 19:42

04:55 04:56 05:03 04:59 04:55 05:01 04:50 05:00 04:54 04:52

05:05 05:06 05:13 05:09 05:05 05:11 05:00 05:10 05:04 05:02

Panyabungan Teluk Dalam Salak Limapuluh Parapat GunungTua Sibuhuan Lhoksukon D.Sanggul Kotapinang AekKanopan

12:25 12:32 12:30 12:25 12:27 12:24 12:24 12:34 12:28 12:22 12:24

15:39 15:46 15:42 15:37 15:40 15:38 15:38 15:43 15:41 15:36 15:37

18:29 18:36 18:35 18:31 18:33 18:29 18:29 18:41 18:33 18:28 18:30

19:38 19:45 19:44 19:41 19:42 19:38 19:38 19:51 19:43 19:37 19:39

04:53 05:00 04:56 04:51 04:54 04:52 04:52 04:58 04:55 04:50 04:51

05:03 05:10 05:06 05:01 05:04 05:02 05:02 05:08 05:05 05:00 05:01

06:24 06:19 06:18 06:29 06:19 06:18 06:19 06:16 06:31 06:20

15:41 15:42 15:48 15:45 15:40 15:46 15:36 15:46 15:40 15:38

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:20 06:21 06:29 06:24 06:20 06:26 06:16 06:26 06:19 06:18

06:18 06:25 06:21 06:17 06:19 06:17 06:17 06:24 06:20 06:15 06:16

Kembalikan Dana Rp1,2 Miliar

Tersangka Korupsi Mohon Penangguhan Penahanan Pria Mabuk Ditabrak KA Tewas Di Jalinsum TEBINGTINGGI (Waspada): Seorang ayah dua anak yang diduga mabuk, tewas ditabrak kereta api (KA) saat berjalan di lintasan kereta api (KA) Ling. IV, Kel. Bagelen, Kec. Padang Hilir atau Km 82/67 Tebingtinggi, Rabu (28/8) sekira pukul 07.00. Kondisi tubuh korban dalam keadaan tak utuh dan berserakan di lintasan kereta api. Korban diketahui identitasnya oleh warga karena kartu tanda penduduk (KTP) nya ditemukan di lokasi kejadian. Korban bernama Abdul Rahman, 29, warga Dusun VIII, Desa Paya Pinang, Kec. Tebing Syahbandar, Kab. Serdang Bedagai. Petugas Polres Tebingtinggi langsung mengamankan lokasi dan mengumpulkan potongan tubuh korban. Kuat dugaan korban tewas akibat mabuk-mabukan. Diperkirakan saat kereta api melintas ia tidak menghiraukannya hingga akhirnya tertabrak dan tewas di lokasi kejadian. Kapolres Tebingtinggi, AKBP Drs. Andi Rian Djajadi, S.Ik ketika dikonfirmasi membenarkan kejadian tersebut. Dari lokasi petugas mengamankan botol berisi minuman keras dan sepedamotor. Kini kasus tewasnya ayah dua anak ini dalam penyelidikan petugas. Untuk pengusutan korban dibawa ke rumah sakit BhayangkaraTebingtinggi untuk outopsi. Di Jalinsum Sementara di Tanjungmorawa, Muhammad Khairuddin, 23, warga Pematang Kasih, Pantai Cermin, Kab. Serdang Bedagai (Sergai) tewas di Jalinsum Medan-Lubukpakam, Pasar VII, Desa Tanjung Baru, Kec. Tanjungmorawa, Deliserdang, setelah sepedamotor yang dikendarainya tabrakan dengan dump truk pengangkut material beskos, Selasa (27/8) sekira pukul 23:00. Unit Laka Satlantas Polres Deliserdang dipimpin Kanit Laka Iptu Andi Gustawi Lubis tiba di lokasi langsung mengevakuasi jenazah korban ke RSUD Lubukpakam dan mengamankan sopir berikut kendaraan yang terlibat tabrakan ke Mapolres.(a11/a07/c02)

PPDB Online Dituding Merusak Sekolah Agama Dan Swasta TEBINGTINGGI (Waspada): Sistem Penerimaan Peserta Didik Baru(PPDB)onlineyangditetapkanDinasPendidikankotaTebingtinggi pada tahun ajaran 2013/2014, dituding merusak keberadaan sekolah agama dan swasta. Pasalnya, kebijakan PPDB online diiringi penambahan rombongan belajar (rombel) yang tak konsisten di sekolah negeri, sehingga perguruan agama dan swasta tak dapat siswa. Kepala Madrasah Aliyah Negeri (MAN) kotaTebingtinggi Sujarno Alamsyah,S.Ag,MM,Rabu(28/8),diruangkerjanya,mengatakanterjadi penurunan siswa di MAN hingga 50 persen dari tahun sebelumnya. Pada 2012/2013 ada 120 siswa mendaftar, tapi tahun ini hanya 64 orang. “Ini dampak PPDB online yang tak konsisten,” tegas dia. Hal sama terjadi di Perguruan Tamansiswa. Dari keterangan Kepala Drs. Muhammad Ardi, total siswa tahun sebelumnya 1.200 orang, tapi tahun ini turun menjadi 980 siswa. Demikian pula di Perguruan Katholik Cinta Kasih, dikabarkan penurunan siswa baru dari tahun sebelumnya hingga dua lokal. Menurut Sujarno Alamsyah, ada beberapa penyebab rusaknya perguruan agama dan swasta di kota Tebingtinggi. PPDB online yang menerapkan kuota 30 persen untuk siswa luar daerah. Pembesaran rombel dan penetapan jumlah yang tidak konsisten. “Sekarang ini rombel sekolah negeri ditambah, juga jumlah rombel yang seharusnya 32 bisa lebih. Ini penyebab kurangnya minat ke sekolah agama dan swasta,” terang Sujarno. Dia minta tahun depan kuota siswa luar daerah 10 persen saja. Ketua Perguruan Tamansiswa, mengatakan, dulu ada sekolah mengutamakan kepintaran, ada sekolah mengutamakan ketrampilan. Tapi sekarang, semua diborong sekolah negeri.“Kebijakan ini merusak sistem yang ada,” tegas dia. Sementara Kabid Pendidikan dan Pengajaran Dinas Pendidikan Drs J. Sitinjak, membenarkan adanya keluhan dunia pendidikan kota Tebingtinggi. “Tak usahlah itu kita bahas, bagaimana baiknya tahun depan,” kata Sitinjak. Dikatakan, ada rencana tahun depan diberlakukan sistem jarak antar sekolah dengan siswa. Di mana siswa yang dekat dengan suatu sekolah memiliki nilai lebih tinggi dibanding siswa yang jaraknya jauh dari sekolah.“Artinya, nanti siswa yang rumahnya dekat sekolah lebih berpeluang dari yang rumahnya jauh,” terang dia. (a09)

Timsel KPU Binjai Tidak Transparan BINJAI (Waspada):Tim seleksi (Timsel) Komisi Pemilihan Umum (KPU) Kota Binjai dinilai tidak transparan dalam melakukan seleksi administrasi bakal calon KPU yang mendaftar. Dari 69 pendaftar, 36 dinyatakan lulus seleksi administrasi. Menurut Erwin, Rabu (28/8), ketidaklulusan seleksi administrasi pelamar tidak dijelas. “Padahal kita sudah mengikuti ketentuan yang ditentukan sesuai formulir yang dikeluarkan timsel, seharusnya ada penjelasan, kekurangan apa, sehingga seleksi administrasi tidak lulus,” ujar Erwin. Berbeda dengan Budi yang juga tidak lulus seleksi administrasi. Budi menilai KPU mendatang penuh kepentingan pihak tertentu, sehingga penyeleksian tidak terbuka. Bahkan ada peserta yang makalahnya tidak memenuhi persyaratan, diluluskan. Itu membuat Erwin dan Budi menilai Timsel KPU tidak transparan dan sarat kepentingan pihak tertentu. Menurut Arma Delisa Budi, masa jabatan KPU juga harus ada batasnya.“Presiden, Gubernur dan Bupati sertaWali Kota, batas jabatan duaperiode,kenapadiKPUtakada.Haltersebutharusmenjadiperhatian KPUSumutatautimselKPUSumut.“Secarajuridisdibenarkan,namun tata krama dan etika sudah tak benar,” tambah Erwin. Timsel KPU Binjai yang ingin dikonfirmasi, semuanya sibuk dan tak bisa dihubungi, dengan alasan masih memproses hasil ujian tertulis dan Rabu masih sibuk mengurus pemeriksaan kesehatan dan mempersiapkan wawancara dan psikotes. Erwin dan Budi menilai, KPU Binjai mendatang dari 36 peserta ujian hanya menseleksi 32 orang untuk mencari satu pengganti anggota KPU lama, empat lainnya tetap diberikan kepada incumbent. “Hal ini sudah terbaca dan menjadi pembicaraan masyarakat kota Binjai, terutama pengurus partai politik.”(a04)

STABAT (Waspada): Tersangka korupsi proyek pengerasan jalan tahun 2011 senilai Rp21 miliar di PTPN 2 Kebun Sawit Seberang yang mengembalikan Rp1,2 miliar kepada penyidik kemarin, masih ditahan di LP Tanjungpura. Kajari Stabat Hendri, SH mengatakan permohonan penangguhan penahanan yang diajukan tersangka menunggu izin Kajatisu. “Permohonan yang bersangkutan akan diteruskan ke Kejatisu, tim penyidik masih menimbang,” kata Hendri di dampingi Kasi Pidsus Ricardo Marpaung, Selasa (27/8) pagi. Kajari menambahkan, dengan pengembalian uang tersebut bukan berarti langsung mengabulkan permohonannya untuk menjaditahanankota,melainkan ada pendapat dari masing-ma-

singpenyidikyangharusdidengar sebelum dipertimbangkan dan diambil kesimpulan. “Meski demikian kita apresiasi pengembalian itu dan secara tidak langsung uang negara sudah kita selamatkan,” ujarnya. SecaraterpisahKepalaPengamananLPTanjungpuraKamaruddinManikkepadaWaspadaSelasa soremembenarkantersangkaAEK masih ditahan di LP.

Kasusyangmenjeratrekanan warga Medan itu berawal dari penyidikan yang dilakukan Kejari Stabat sehingga dia ditetapkan menjadi tersangka karena dinilai bertanggungjawab atas penyimpangan hasil pekerjaan. Proyek pengerasan jalan yang dipecah sembilan di sembilan afdeling berlokasi di Kec. Sawit Seberang Kab.Langkat,hasilnyatidaksesuai bestek dan volume pembangunan jalan menyimpang. Masing-masing proyek bernilai sekira Rp2 miliar dan pengerjaan selesai tahun 2012, padahal proyek dimaksud anggaran tahun 2011. Dalam kasus tersebut Kejari menahan dua tersangka dari pihak rekanan, sementara dua mantan manager kebunditetapkantersangka.(a03)

Ngogesa Sitepu – Sulistianto Harus Tabah MEDAN (Waspada): Genderang Pemilihan Kepala Daerah (Pilkada) di Kab. Langkat untuk memilih Bupati periode tahun 2014-2019 sudah dimulai setelah Komisi Pemilihan Umum (KPU) Selasa (20/8) menetapkan nomor urut kepada empat Capub/ Cawabup peserta Pilkada. Direncanakan Rabu (23/10), dilakukan pencoblosan pemilihan Cabup dan Cawabup. Sudah menjadi tradisi pada setiap Pilkada di daerah mana pun di Indonesia, baik itu Pilkada Kepala Desa, pemilihanWali Kota atau Bupati maupun pemilihan Gubernur sampai kepada pemilihan Presiden pun pasti dibumbui fitnah, menzalimi dengan segala cara. Ustadz Ramsyah, tokoh ulama di Langkat, kemarin melihat sosok H. Ngogesa Sitepu, SH yang berpasangan dengan Drs Haji Sulistianto, M.Si adalah pasangan calon bupati dan calon wakil bupati nomor urut 4 yang pantas dan diyakini bisa serasi memimpin kabupaten berpenduduk 1 juta jiwa. Kita semua sudah tahu dengan aktivitas Ngogesa Sitepu di lapangan terhadap masyarakat bahkandiasosokpemimpinyang mengayomi masyarakat, semua etnis (suku, red). Menanggapi fitnahkepadaNgogesa,menurutnya harus sabar menghadapi cobaan ini. Karena menurut Al quran, menfitnah itu tidak dibolehkan, memburuk-burukkan lagi, kadang yang memburukkan lebih jelek dari yang diburukkan. AllahuAkbar,AllahuAkbar,Allahu Akbar, kata Ustadz Ramsyah.


PASANGAN Cabup/Cawabup Langkat Nomor Urut 4 Haji Ngogesa Sitepu dan Haji Sulistianto. Begitujugakatatokohmasyarakat Drs HM Samin yang juga pengurus Ikatan Persaudaraan Haji Kecamatan Stabat, semua sudah tahu sosok Bupati Ngogesa Sitepu yang selalu berpihak kepada kaum lemah, kaum tak mampu, sosok yang peduli dan dermawan. Disaat Pilkada ini, Ngogesa mulai diserang fitnah yang keji, dengan mengatakan dia korupsi, tidak ada berbuat, ini jelas membohongi masyarakat. Kita sebagai manusia sudah pasti tidak sempurna, ibarat pepatah, “kita tidak mau seperti setan, namun tidak mungkin seperti malaikat”, dan cara-cara pembusukan dengan melontarkan fitnah, menzalimi Ngogesa

dan Sulistianto adalah cara-cara lama yang muncul disaat pemilihan Bupati. Masyarakat tidak mau dibodoh-bodohi lagi, mereka sudah cerdas, tahu mana emas dan mana loyang, papar Haji Samin sambil meminta Ngogesa bersabar. Di sisi lain dikatakan tokoh etnis Jawa, Sartono Amnas yang juga pengurus Pujakesuma di Langkat.Diaherandenganmaraknya hujatan dan derasnya pihakpihak yang menfitnah Ngogesa. Kenapa fitnah ini tidak dilakukan disaat beliau bertugas sebagai Bupati selama 4 tahun lalu. “Kita berharap beliau sabar, yakinlah orang sabar dikasihi Allah,” ujar Sartono Amnas, optimis.(m14)

OK Arya, Bupati Masa Depan Batubara LIMAPULUH (Waspada): Ruas jalan Desa Tiga Negeri, Kec. Limapuluhsalahsatujalanutama menuju pelabuhan global hub internasional sebagai pengembangan dari pelabuhan Kuala Tanjungsebagaimanaprogrampembangunan Batubara ke depan. “Ini salah satu jalan utama menuju pelabuhan internasional global hub Kuala Tanjung,” kata Bupati Batubara yang juga Cabup H. OK Arya Zulkarnain, SH, MM pada pertemuan silaturahmi bersama masyarakat Desa Tiga Negeri sambil menunjukan ruas jalan protokol desa, kemarin. Silaturahmi dikaitkan halal bihalal Idul Fitri 1434 H sekaligus penyantunan anak yatim dan kaumduafabesertakhitanmassal

itu, diselenggarakan relawan Harmoni. Mendapat antusias yang tinggi dari masyarakat baik anak-anak, pemuda hingga orangtua dan omak-omak. Pembangunan mega proyek tersebut, lanjut OK Arya, menurut rencana tahap awal dikerjakan satu modul Tahun 2014 dari 21 modul ditargetkan dalam upaya mendukung program Master Plan Percepatan Perluasan Pembangunan Ekonomi Indonesia (MP3EI) dan Kawasan Industri SeiMangkeiberbasiskelapasawit. Kenapa Desa Tiger merupakan kawasan perlintasan menuju pelabuhan Kuala Tanjung-Perupuk? Karena jarak tempuhnya sangat dekat dari Jalinsum SimpangBendosebagaipangkaljalan

yang mempertemukan Kawasan EkonomiSeiMangkeidiperkirakan hanya belasan kilometer. Apa lagi soal ganti rugi tanamankelapasawitmilikkebuntelah selesai hingga tidak menjadi kendala lagi dalam pekerjaan perluasanjalan.Selainpelabuhan juga ditempuh melalui ruas jalan lingkar Limapuluh kota ke Simpang Dolok dan Barung-barung Perupuk mau pun melalui Jalinsum. Keberadaan RSU juga berkembang dengan penempatan tenaga medis profesional tidak saja berasal dari dalam daerah, namunluarnegeri.Kab.Batubara memilikki tujuh wilayah kecamatankinisudahbangkitdari keterpurukan.(a13)

Halal Bi Halal PNS Pemkab Deliserdang:

Bupati Amri Apresiasi Tekad Dan Kebersamaan Jajarannya LUBUKPAKAM (Waspada): Bupati Deliserdang Drs H. Amri Tambunan memberikan apresiasikepadajajaranpegawainegerisipil(PNS) karena dengan tekad dan kebersamaan berhasil menorehkan berbagai prestasi. “Bahkan Deliserdang menjadi salah satu kab/ kota di Sumut yang mampu menjadi sebatang “lilinpenerang”dalamkeburamanpemerintahan sekarangini,”kataBupatipadahalalbihalaljajaran PNS Pemkab Deliserdang yang juga dihadiriWakil Bupati H. Zainuddin Mars, Sekdakab Drs H. Asrin Naim, MM, Ketua TP PKK Ny. Hj. Anita Amri Tambunan, Ketua GOPTKI Ny. Hj. Asdiana Zainuddin serta pimpinan dan staf SKPD, di pelataran parkir kantor bupati di Lubukpakam, Selasa (27/8). Menurut Bupati, berkat kesungguhan adikadik PNS di jajaran Pemkab Deliserdang kita mampu menjadi salah satu kab/kota yang pada setiapeventerusmenorehkanprestasimembanggakan. “Saya mewakili kita semua berulangkali menerimasatyalencanadanpenghargaanseperti pada sektor infrastruktur, pertanian, kesehatan, lingkungan hidup, pendidikan, koperasi dan sebagainya.” Pada sektor pembangunan jalan dan jembatandariseluruhkab/kotadiIndonesia,Deliserdang masuk tiga besar nasional setelah Pacitan dan

Bogor. Bahkan terakhir Deliserdang menjadi salah satu kabupaten yang menorehkan prestasi sebagai kabupaten yang memiliki perencanaan pembangunan terbaik di Indonesia, papar Amri yang akan mengakhiri masa jabatan periode keduanya, April 2014. Meski berbagai keberhasilan berhasil diraih, namunmasihbanyakprogram dankebijakanyang masih terkendala. Kalau bagi saya tidak ada istilah ‘jualbeli’jabatanuntukmendudukkanseorangpada posisinya. Namun di bawah, masih ‘terdengar’ ada kutipan-kutipan dan pembebanan, ucap bupati disambut tepuk tangan ribuan PNS yang hadir. Semua itu harus terus kita benahi dan bersihkan. Namun semua itu juga tidak mungkin hanya dilakukan seorang bupati. Karenanya, mari terus kitapupukdantingkatkankebersamaanagarkelanjutanpembangunanDeliserdangdapatkitalakukan. Bupati H. Amri Tambunan juga menyampaikan maaf dan pamit kepada seluruh PNS. “Secara formal halal bi halal hari ini merupakan halal bi halal terakhir bagi saya, karena pada 2014 saya meletakkan jabatan sebagai bupati setelah periode kepemimpinan saya bersama Pak Zai berakhir.” Ustadz Drs H Abdul JalilTanjungWS menyampaikan tausiyah yang menekankan pentingnya saling bermaafan agar pahala yang kita dapat pada bulan suci Ramadhan menjadi berkah.(a06)

Bupati Soekirman Halal Bi Halal Dengan Masyarakat Sergai SILINDA (Waspada): Bupati Serdang Bedagai (Sergai) Ir. H. Soekirman kembali melakukan kunjungan kerja sekaligus berhalal bi halal dalammeningkatkansilaturahmi di Kec. Silinda dan Kotarih, disambut Camat, Forum Pimpinan Kecamatan, Ketua TP PKK Kecamatan, Kades, Ketua TP PKK Desa, para Penyuluh, para guru, kepala Puskesmas dan masyarakat. Silaturahmi, kemarin di halaman Kantor Camat masing-masing ini, turut dihadiri Sekdakab Drs. H. Haris Fadillah, M.Si, Kadis Tarukim Herman Sitorus, SH, MSP dan lainnya. Waspada/Ist Bupati sebagai kepala PARA Kepala Desa dan Tokoh Masyarakat Kec. Silinda daerah mewakili seluruh jajaran pemerintah daerah memakaikan baju adat Simalungun berupa topi Gotong dan Ulos Tanah Bertuah Negeri Beradat kepada Bupati Sergai Ir. H. Soekirman di sela-sela acara halal ini, mengucapkan mohon bi halal Idul di halaman Kantor Camat Silinda. maaf lahir dan batin. yang sudah berjalan. Karenanya jargon “Sergai “Semoga kelemahan yang ada tidak dijadikan bangkit,raihprestasidanbantuyanglemah”adalah sebagai alasan untuk tidak berbuat bagi daerah milik seluruh masyarakat, untuk bangkit bersamaini, namun tetap bersatu padu dalam kebersa- sama dengan seluruh jajaran pemerintahan, maan demi mencapai tujuan bersama demi pemangkukepentingandalammengupayakanyang masyarakat yang makmur dan sejahtera. Beban terbaikdiseluruhaspekkehidupandanbermasyarakat. seberat apa pun jika dipikul bersama-sama pasti Disela-sela acara halal bi halal di Kec. Silinda, akan terangkat,” kata Bupati Soekirman. Bupati menerima seperangkat Baju Adat SimaMenurut H. Soekirman, dalam pembangu- lungun berupa topi gotong, ulos tumbuk dan ulos nan tidak bisa jika hanya pemerintah bersama sibahat bambu yang langsung dipakaikan para para pemangku kepentingan yang bangkit dan kepala desa dan tokoh masyarakat. Gotong yang bersemangat melaksanakannya. Masyarakat berbentuk tengkuluk batik ini perlambang paling dari bawah harus bersama-sama bangkit untuk tinggi dan dihormati, ulos tumbuk dan sibahat mendukung, melaksanakan mau pun bersama- bambu merupakan perlambang dari kesatuan sama mengawasi pelaksanaan pembangunan dan kebersamaan.(a08)

Upaya PLN Atasi Krisis Listrik Terganjal Masalah Sosial Besi 13 Tower SUTET Di Langkat Dicuri

Judi Marak Di Salapian Langkat STABAT (Waspada): Judi jenis dadu kopyok marak di Kec. Salapian Kab. Langkat. Pantauan sepekan terakhir, di salah satu warung di Desa BandarTelu puluhan warga bebas berjudi setiap hari. Diperoleh informasi omzet per hari mencapai belasan juta rupiah karena para pemain berdatangan dari luar kecamatan tersebut. Sejumlah warga yang resah berharap polisi turun ke lokasi.Warga juga mengaku heran, padahal perjudian sudah berlangsung lama namun tak tersentuh polisi.Terkait keresahan warga tersebut Kapolsek Salapian Resort Langkat AKP Zulkarnain S, beberapa kali belum berhasil dikonfirmasi.(a03)

Waspada/HM Husni Siregar

BUPATI Deliserdang, H. Amri Tambunan bersama Wakil Bupati H. Zainuddin Mars masingmasing didampingi istri, menerima ucapan Minal Aidin Walfaizin mohon maaf lahir dan batin dari para PNS pada halal bi halal Idul Fitri 1434 H, Selasa (27/8).

Waspada/Iwan Has

BUPATI Batubara H. OK Arya Zulkarnain yang juga Cabup no. 6 pada halal bi halal di Desa Tiga Negeri, Kec. Limapuluh.

MEDAN (Waspada): Guna meningkatkan pelayanan energi listrik kepada masyarakat di Sumatera Utara, PLN membangun PLTU Pangkalansusu2x220MWsejak2008.Seyogianya. energi listrik dari PLTU tersebut sudah dapat dinikmati masyarakat sejak Juni 2013, namun karena beberapa masalah sosial, di antaranya pencurian besi pada 13 tower saluran udara tegangan tinggi (SUTET) di Langkat, menjadikan ini terkendala,” kata Manajer Operasi Konstruksi PLNUnitIndukPembangunanIIRobertAprianto Purba, Rabu (28/8). Permasalahan lainnya, di antaranya pembangunan tapak tower T.162 di Desa Tangkahan Durian, Kec. Brandan Barat yang belum bisa dilaksanakan meski pun ganti rugi sudah dibayar, dikarenakan lahan dalam sengketa ahli waris. Kemudian 13 tower yang dicuri dengan memotong besi stub angle towernya sehingga pembangunannya tidak dapat dilanjutkan. “Pencurian itu terjadi di Desa Securan Utara Kec.

Babalan, Desa Tangkahan Durian Kec. Berandan Barat,DesaPangkalanBatu,DesaPayaTampakKec. Pangkalan Susu dan Desa Tanjung Pasir,” ujarnya. Selain itu, ada 5 tower di Desa Serapuh ABC, Kec. Padang Tualang, Desa Paya Bengkuang Kec. Gebang dan Desa Air Hitam yang tidak diizinkan warga didirikan tower, padahal pondasinya sudah dibangun. “SebagianwargamintaPLNmembayar jalan akses menuju lokasi tower dengan jumlah tak wajar,” ujarnya sambil menambahkan, pihaknya sudahmelaksanakankerjasamapengamanandengan Polres Binjai, Polres Langkat dan Kodim Langkat. “KamiberharappihakKepolisiandanTNIdapat melaksanakan tugas menjaga ObjekVital Nasional (Obvitnas) berupa fasilitas ketenagalistrikan sesuai perundang-undangan yang berlaku.” “Hal-hal inilah yang utamanya menyebabkan keterlambangan penyelesaian transmisi 275 kV yang berdampak tidak terpenuhinya kebutuhan energi untuk proses pengujian dan penyetelan PLTU sampai saat ini,” ujar Robert.(m41)

Sumatera Utara


Terdakwa Korupsi Dinas PUPE Divonis 1 Tahun


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

LABUSEL (Waspada): Majelis Hakim Pengadilan Tindak Pidana Korupsi (Tipikor) Medan memvonis dua terdakwa kasus korupsi pelaksanaan proyek Pengaspalan Dusun Air Serdang, Desa Air Merah menuju Dusun BIS II Desa Tolan, Kec. Kampungrakyat, Kab. Labusel yang dibiayai APBD 2011 Kab. Labusel, masing-masing satu tahun penjara pada persidangan berbeda yang digelar di Pengadilan Negeri (PN) Medan. Kepada Waspada Rabu (28/8), Kepala Cabang Kejaksaan Negeri (Kejari) Rantauprapat di Kec. Kotapinang, Kab. Labusel Iwan Ginting menjelaskan, kedua terdakwa yakni mantan PPK Dinas PUPE Labusel, Donni Alfenda ST dan Kuasa Direktur CV. Syahara Asyukuriah, Indra Mono selaku rekanan terbukti melanggar Pasal 3 Jo Pasal 18 UU No. 20 tahun 2002 tentang perubahan atas UU No. 31 tahun 1999 tentang tindak pidana

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu Lusia Damayanti (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: H. Halim Hasan. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Zulkifli Harahap. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Promosi: Edward Thahir (Koordinator). Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: H. Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Hj. Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Avli Yarman. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Arianda Tanjung, Dio Utama. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebingtinggi: Muhammad Idris, Abdul Khalik. Pematangsiantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Tarutung: Parlindungan Hutasoit. Sibolga/Tapanuli Tengah: Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan/Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies, H. Rusli Ismail, Arman Konadi. Aceh Besar: Iskandarsyah. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar, Dedek Juliadi. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Jasvira Sautisa. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan WASPADA dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada yang mengaku wartawan WASPADA tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 13.000,-, berwarna Rp. 36.000,Halaman depan: hitam-putih Rp. 39.000,-, berwarna Rp. 108.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

Istri PNS Harus Dukung Program Pembangunan RANTAUPRAPAT(Waspada): Sebagai Anggota DharmaWanita Persatuan (DWP) Kab. Labuhanbatu dan sebagai istri Pegawai Negeri Sipilharussiapmendukungprogrampembangunanyangdilaksanakan pemerintah, untuk melaksanakan dan mendukungnya. Marikitajalandiatasrelwalaupunjalannyabecek.Halituditegaskan Bupati Labuhanbatu dr H Tigor Panusunan Siregar, SpPD dalam acara silaturahmi dan Halal Bi Halal yang dilaksanakan DWP Kab. Labuhanbatu, Kamis (22/8). Dalam kesempatan itu, Bupati juga mengingatkan para istri PNS tersebut untuk mengevaluasi apa yang sudah dilakukan terutama sebagai pengurus dan anggota Dharma Wanita, terutama dalam menghadapi tahun prestasi yang dicanangkan pemerintahan Tigor – Suhari pada tahun 2013 ini. (c07)

KABUT asap menyelimuti ruas Jalinsum di Asahan.

Waspada/Rasuddin Sihotang

Asap Tebal Kembali Landa Jalinsum SIMPANGEMPAT (Waspada): Asap tebal kembali melanda Jalan Lintas Sumatera (Jalinsum) kawasan Asahan, diduga dampak dari kebakaran hutan di Riau. Akibatnya, jarak pandang hanya berkisar antara 200 hingga 300 meter. Kondisi ini tentu sangat mengganggu penglihatan para sopir dan pengendara sepedamotor. “Terganggu sekali, apalagi di beberapa lokasi yang kami lewati, terjadi hujan sehingga jalanan berubahputihsemua,”kataMuro, 40, pengemudi truk pembawa barangkelontongdisambangisaat beristirahat di sebuah rumah

makan di Simpangempat, Kab. Asahan, Rabu (28/8). Menurutnya, kabut asap ini telah berlangsung sejak beberapa harilalunamunbelumadatandatanda akan segera pulih. Ditambahkan, pekatnya kabut ini ham-

pir merata di sepanjang Jalinsum mulai dari Pekanbaru hingga Asahan. Untuk menghindari terjadinya kecelakaan lalu lintas, pengemudi diimbau agar menghidupkan lampu di siang hari. Selain itu, sopir juga diminta untuk tidak kebut-kebutan dan senantiasa mematuhi rambu lalu lintas. “Paling utama harus ekstra hati-hati, situasi ini datangnya tidak diduga-duga. Jadi kita harus siap menghadapi,” kata petugas Sat Lantas Pos Simpangempat. (a32)

Soal Ujian Calon KPUD Dibakar KISARAN(Waspada):Naskah soal ujian calon anggota KPUD Asahan dibakar setelah seleksi ujian tertulis yang diikuti 36 peserta, demi menjaga kerahasiaan. Ujian dilakukan di lantai II Kampus Muhammadiyah Kisaran,Selasa(27/8). danpeserta yangikutiinitelahdinyatakanlulus administrasi. Soal ujian sebanyak 75 soal dan diselesaikan selama 100 menit. “Alhamdulillah,ujianberjalan dengan ating. Demi menjaga keamanan, setelah seleksi tertulis, naskah ujian dimusnahkan (dibakar-red,” Ketua Tim Seleksi KPUD Asahan Strisno S.Sos, melalui Sekretaris Adv.Hidayat Afif, ditemui Waspada. Hidayat mengatakan, kebocoran soal, sedikit kemungkinan, karena naskah ating dibawa anggota KPU Provinsi Sumut, dalam keadaan bersegel dan ditunjukkan dengan para peserta ujian. “Ujian berjalan dengan aman dan diawasi dengan ketat, danpeluangkecurangantertutup rapat,” jelas Hidayat. Setelah ujian ini, peserta akan mengikutiujianteskesehatandan


ANGGOTA KPU Provinsi Sumut sedang membakar naskah ujian calon anggota KPUD Asahan, setelah ujian tertulis berlangsung. ujian psikotes, dan dari hasil itu akan keluar 10 besar. “Dalam hal ini kita mengharapkan respon baik dan buruk dari masyarakat terhadap calon KPUD Asahan yang ikut, sehingga kandidat yang duduk nantinya bisa memberikan yang terbaik bagi Asahan,”

jelas Hidayat. Sebelumnya, jumlah peserta calon KPUD yang mendaftar sebanyak 37 orang, dengan klasifikasi laki-laki sebanyak 31 orang dan perempuan enam orang. Dan yang tidak lulus administrasi sebanyak satu orang. (a15)

Hutan Ditebang Sungai Mendangkal TANJUNGBALAI (Waspada): Maraknya penebangan hutan secaraliardibagianhulubeberapa tahun belakangan ini telah menimbulkanlajupendangkalan di Sungai Asahan yang sangat tinggi, Rabu (28/8). Akibatnya, sedimentasi ini telahmengganggulalulintastransportasi laut baik angkutan barang maupun jasa. Pendangkalan ini pula berdampak negatif terhadap peningkatan perekonomian Kota Tanjungbalai. Berdasarkan penelitian, kata petugas Kantor Syahbandar dan Otoritas Pelabuhan Juliansyah beberapa waktu lalu, laju pengendapan (sedimentasi) di alur Sungai Asahan cukup rata-rata 331.924 meter kubik per bulan. Kondisi demikian telah menyebabkan kapal berbobot besar

tidak dapat melintas menuju PelabuhanTeluknibung maupun Baganasahan. Kedalaman alur sungai mulai dari lampu pertama atau sepanjang dua mil dari laut ke Pelabuhan Teluknibung ungkapnya hanya 0,4 meter saat terjadi air surut. Sedangkan ketika pasang, kedalaman alur mencapai tiga meter. Padahal, kapal berbobot 30 GT (gross ton) membutuhkan kedalaman sekitar 2,5 meter agar dapat melintas dengan lancar. Saat ini, kapal berukuran besar seperti kargo, penumpang, pukat apung, fisher, hanya bergantung pada pasang surut air laut. Syukran, 45, warga Tanjungbalai kepada Waspada mengimbau agar para pembalak liar yang telah membabat hutan segera menghentikan kegiatannya. Dia

juga meminta agar segera dilakukan reboisasi (penanaman hutan kembali), sebab jika tidak akan terjadi bencana seperti banjir dan tanah longsor. “Logikanya,jikatakadalagikayu dan akar menahan air hujan di gunung,tentutanahakantergerus kesungaidanjadilahpendangkalan. Lebihparahlaginanti,akanterjadi musibahbanjirdanlongsor.Mohon kepadapenegakhukumagarmenindaktegasoknumpembalakini,” pungkas Syukran. Sementara,aktivisLSMArsyad Nasutionmemintaagarpihakterkait mengeruk alur sungai yang dangkal.Halitudemipeningkatanperekonomian masyarakat pesisir pantai Timur Sumut ini. “Kalau sudahdikeruk,lalulintaskapalpun lancar. Tidak lagi menunggu air pasang,” kata Arsyad. (a32)

Aset Pemkab Labuhanbatu Diduga Serobot Lahan Warga PANAI HULU (Waspada): Aset milik Pemerintah Kabupaten (Pemkab) Labuhanbatu di pasar pagi Desa Sei Sentosa, Kec. Panai Hulu diduga me-

korupsi, sehingga menyebabkan kerugian keuangan negara senilai Rp. 103.574.690. Kedua terdakwa, kata dia, masing-masing dijatuhi hukuman 1 tahun penjara dan denda Rp50 juta ditambah subsider 1 bulan kurungan. Vonis ini lebih ringan dari tuntutan jaksa yang sebelumnya menuntut kedua terdakwa 1,5 tahun kurungan. “Kedua terdakwa masih pikir-pikir apakah akan mengajukan banding atas putusan hakim atau tidak,” katanya. Pada persidangan yang digelar, Selasa (27/ 8), majelis hakim yang diketuai M Guntur SH memberikan vonis 1 tahun kurungan terhadap terdakwa Indra Mono. Sementara lanjut Ginting, vonis serupa juga diberikan majelis hakim kepada terdakwa Donni Alfenda ST dalam persidangan yang digelar, Rabu (21/8) dipimpin oleh hakim SB Hutagalung SH. (tim)

Pilbup Batubara Terganggu Seleksi Anggota KPU BATUBARA (Waspada): Banyak kalangan tokoh masyarakat di Kab.Batubara mengkhawatirkan pelaksanaan pemilihan kepala daerah (Pilkada) Batubara dijadwalkan 19 September 2013 terancam gagal. Pasalnya, menurut tokoh masyarakat di Limapuluh, Rabu (28/8), pada saat ini beberapa anggota KPU Batubara mengikuti seleksi calon anggota KPU Kab. Batubara. Calon anggota KPU sudah mempersiapkan dirisejak14Agustus2013mendaftardanpenelitian administrasi. Bagi yang lulus mengikuti seleksi tertulis 27 Agustus 2013, berlanjut 29 Agustus 2013 tes kesehatan, tes psikolog untuk meminta tanggapan masyarakat, 14 -16 September 2013 seleksi wawancara dan klarifikasi tanggapan

masyarakat, 17 -18 September 2013 rapat penetapan hasil seleksi wawancara. “Berdasarkan jadwal kegiatan calon KPU diikuti empat anggota KPU Batubara yaitu Khairul Anwar, SH, Drs. Azhar Tanjung, M.Si, Taufik Abdi Hidayat, S.Sos, Abdul Masri, S,Sos hampir bersamaan tugas mereka selaku anggota KPU di Pilkada Batubara 19 September 2013, apakah tidak mengganggu bahkan disangsikan terancam gagal,” sebut sumber. Masyarakat Batubara hanya mengharapkan KPU Batubara sukses menjalankan tugasnya pada Pilbup 19 September 2013 sampai selesai, jangan gagal.Semuanyaituperludipertimbangkan,apakah pihak tim seleksi calon anggota KPU Kab. Batubara dapatmemahamikekhawatiranmasyarakat. (a12)

208 Calhaj Labusel Manasik Akbar KOTAPINANG (Waspada): Sebanyak 208 calon jamaah haji asal Kab. Labusel yang akan diberangkatkan ke tanah suci September, mengikuti kegiatan bimbingan (manasik) haji akbar. Wakil Bupati Labusel, Maslin Pulungan secara resmi membuka manasik akbar tersebut di Masjid Jami’ Kotapinang, Selasa (27/8). Pada kesempatan itu Wakil Bupati mengharapkan kepada para calon jamaah untuk terus mengikuti dan melaksanakan segala petunjuk yang diberikan oleh para tutor, sehingga nantinya pelaksanaan ibadah haji yang dilaksanakan di tanah suci dapat berjalan lancar

tanpa ada satu rukunpun yang tertinggal. “Hal ini penting untuk memperoleh haji yang mabrur,” katanya. Maslin memberikan apresiasi atas kerja keras panitia dan tutor atas terlaksananya kegiatan ini. Dia berpesan kepada Jamaah Calon Haji untuk tetap mendoakan kemajuan bagi Kab. Labusel. Di tempat serupa Kepala Kantor Kementerian Agama Kab. Labusel Chairul Syam mengatakan, kegiatan manasik ini akan digelar selama tiga hari hingga, Kamis (29/8). Kepada para jamaah dia berharap agar senantiasa menjaga kesehatan selama pelaksanaan manasik. (c18)

Staf Ahli Bupati Tak Pernah Masuk Kerja

nyerobot lahan milik masyarakat sekitar.Pasalnya,luaskeseluruhan areal lokasi pasar pagi tidak sesuai dengan yang tertera di plang aset milik Pemkab Labuhanbatu.

Suriono Bantu Korban Kebakaran SUKAJAYA, Batubara (Waspada): Suriono, ST, M.Si, Wabup pasangan Cabup Ir. Zahir,MAP Nomor 5 memberikan bantuan kepada dua warga DusunVIII Desa Sukajaya, Tanjungtiram, korban kebakaran yang meludeskan rumah Udin Banga dan Kimin Aini, Jumat (23/8). Kebakaran terjadi, Rabu (21/8), dan karena jalan sempit, mobil kebakarantakbanyakmembantuyangmengakibatkankerugianpuluhan juta. “Jangannilaiharganya,kamiCabup/WabupBatubaraZahir-Suriono No.5turutprihatinatasmusibahmenimpaUdindanKiminsekeluarga,” ujar Suriono, sambil menyerahkan bantuan berupa satu kodi seng, dan beras 10 kg yang diterima istri korban. (a12)

WASPADA Kamis 29 Agustus 2013

Waspada/Budi Surya Hasibuan

WARGA Dusun Satu Desa Sei Sentosa, Kec. Panai Hulu, merasa keberatan dengan jumlah luas areal di papan plang sebagai aset Pemkab Labuhanbatu di pasar pagi.

Ahmad Darbi, warga Dusun satu Desa Sei Sentosa tidak menyangka dengan apa yang dilakukan pihak Pemkab yang telah memasang papan plang asset Pemkab Labuhanbatu di pasar pagi dengan jumlah luas areal 2.17900M2, yang mana jumlah luas areal tersebut tidak sesuai dengan jumlah luas areal tanah yang dimiliki almarhumah Nainah orangtua Darbi. Sembari memperlihatkan berkas-berkas surat tanah yang dimiliki almarhumah orang tuanya, Darbi menuturkan bahwa dahulu ia pernah mempermasalahkan ini karena ada bangunan terletak di lokasi tanah miliknyasehinggadibongkaroleh pihak kecamatan setempat. Namun kali ini, ia merasa keberatan karena terpampang papan plang yangmenyatakanpasarpagiDesa Sei Sentosa aset Pemkab Labuhanbatudenganjumlahluasareal yang ditetapkan. (c07)

RANTAUPRAPAT (Waspada): Sejak dilantik sekitar satu tahun yang lalu, Sabar Sitompul, staf ahli Bupati Labuhanbatu Bidang Pendidikan tidak pernah masuk kerja, sementara tunjangan jabatan dan Kesra tetap diterimanya secara utuh. Kejadian ini benar-benar membuat para staf yang bertugas di kantor staf ahli tersebut merasa kesal dan geram, karena tidak mendapat tindakan apapun dari bupati. Informasi yang diperoleh Waspada dari Bagian Orta Setdakab Labuhanbatu,, ketidakhadiran Sabar Sitompul ini telah berulang kali dilaporkan kepada bupati melalui Sekdakab, tetapi sampai sekarang tidak mendapat tanggapan.

Masih menurut staf tersebut yang tak ingin disebutkan namanya, sebelum Sabar Sitompul, jabatan staf ahli tersebut diduduki oleh Herianto yang di non job kan. “Kalau pak Herianto walau dinonjobkan masih aktif masuk kerja, tidak seperti pak Sabar Sitompul sejak dilantik tidak pernah aktif,” ungkapnya. Informasi yang berkembang di tengahtengah masyarakat, bahwa ketidak beranian bupati untuk mengambil tindakan kepada oknum ini disebabkan adanya janji-janji bupati yang belum bisa dipenuhinya. Santer terdengar kalau Sabar Sitompul dijanjikan menduduki Kadis Pendidikan. (c07)

Lulusan Akper Agar Menambah Ilmu RANTAUPRAPAT (Waspada): Saya ingin lulusan Akademi Keperawatan (Akper) Pemkab Labuhanbatu yang baru diwisuda dapat meningkatkan dan menambah ilmu keperawatannya melalui pelatihan-pelatihan dibidang kesehatan dan ilmu komputer serta bahasa arab. Keinginan itu disampaikan Bupati Labuhanbatu dr H Tigor Panusunan Siregar, SpPD kepada mahasiswa/i Akper dalam acara Wisuda Ahli Madya Keperawatan Akper Ika Bina Pemkab Labuhanbatu angkatan XV Tahun 2013, Selasa (27/8) di halaman Akper Ika Bina Rantauprapat, Kab. Labuhanbatu. Kesempatan untuk meningkatkan ilmu itu ada di tangan kalian, sebab jalan hidup yang telah kalian putuskan tiga tahun lalu adalah berprofesi sebagai perawat. Menurut dr Tigor, saat ini lulusan Ahli Madya Keperawatan (AMK) masih banyak dibutuhkan masyarakat, terutama

masyarakat di pedesaan, sebab masih banyak desa yang tidak punya perawat karena perawat kebanyakan menumpuk di kota, padahal lulusan AMK sudah bisa membuka praktek pribadi dan secara undang-undang itu diperbolehkan. Pudir I Joko Sumarno dalam laporannya menjelaskan bahwa, melalui Sipensimaru Jenjang Pendidikan Tinggi (JPT) TA 2010/2011 diterima Mahasiswa/i Akper Pemkab Labuhanbatu sebanyak 107 orang terdiri dari laki-laki 53 orang, perempuan 54 orang. Dan dari jumlah pendaftar 107 orang itu, yang diterima sebanyak 85 orang sedangkan 10 orang mengundurkan diri. Peserta wisuda Akper Pemkab Labuhanbatu Tahun2013sebanyak77orangterdiridariAngkatan XVsebanyak75orangditambah2orangdariangkatan XIV, sementara predikat kelulusan pada angkatan XV meliputi cum laude dengan pujian 2 orang, dan sangat memuaskan 75 orang. (c07)

Baik Buruk Masa Depan PNS Terletak Di Pundak Sendiri RANTAUPRAPAT (Waspada): Baik buruknya masa depan Pegawai Negeri Sipil (PNS) terletak di pundak PNS itu sendiri. Hal itu dikatakanWakil Bupati Labuhanbatu Suhari Pane S.IP ketika membuka secara resmi pendidikan dan latihan (Diklat) Prajabatan Calon Pegawai Negeri Sipil (CPNS) golongan III gelombang I (Angkatan I dan II) Tahun 2013, di aula Badan Kepegawaian Daerah (BKD), Senin (26/8). Pada bagian lain Suhari mengatakan, jika kita perhatikan maraknya tuntutan masyarakat saat ini menunjukkan tingkat kepercayaan masyarakat terhadap aparatur pemerintah sangat rendah. Untukitusudahmenjaditugasdantanggungjawab setiap PNS agar menumbuhkan kembali kepercayaan masyarakat terhadap aparatur pemerintah. Suhari juga menegaskan, Diklat ini juga

bertujuan untuk merubah pola pikir CPNS yang berasal dari berbagai latar belakang yang berbeda serta pola pikir yang bervariasi sehingga dapat menimbulkan persepsi yang berbeda dari masingmasing personal dan perbedaan tersebut akan berdampakterhadapefektivitaskinerjaPNSitusendiri. Sebelumnya Kepala BKD Aswad Siregar SE MAP melaporkan, Diklat Prajabatan CPNS golongan III gelombang I Angkatan I dan II Tahun 2013 diikuti sebanyak 80 orang yang terdiri dari tenaga teknis 18 orang, dan tenaga guru 62 orang. Diklat dilaksanakan dari 26 Agustus sampai 16 September 2013 dengan pembelajaran dilakukan pagi dan sore, selama berlangsungnya pelaksanaan Diklat, tambahnya, para peserta diwajibkan untuk tinggal/menginap di asrama yang disediakan. (c07/a18)

31 Calon Anggota KPU Labusel Ujian Tertulis TORGAMBA (Waspada): Sebanyak 31 peserta seleksi calon anggota Komisi Pemilihan Umum Daerah (KPU) Kab. Labusel periode 2013-2018 mengikuti ujian tertulis di AulaYayasan Universitas Labuhanbatu (YULB), Desa Asam Jawa, Kec. Torgamba, Selasa (27/8). PengamatanWaspada,parapesertamengikuti ujian selama 100 menit dimulai pukul 09.00. Sebelum ujian, peserta mengikuti apel pembuka yang dipimpin oleh Ketua Tim Seleksi Junita didampingi tim seleksi lainnya yang kemudian dilanjutkan dengan serahterima naskah soal dan lembar jawaban dari KPU Provsu kepada Tim Seleksi. Para peserta menjalani ujian tertulis dalam

bentuk pilihan ganda dengan soal seputar sistem politik, Pemilu, dan peraturan per Undangundangan tentang kepemiluan. Usai mengikuti ujian, hari itu juga seluruh naskah soal kemudian dimusnahkanolehTimSeleksidengancaradibakar disaksikan seluluruh peserta ujian. “Semoga hasilnya memuaskan. Kita berharap seleksi ini mengedepankan prinsip-prinsip kejujuran,” kata salah seorang peserta ujian, Samsuten Ritonga. Ketua Tim Seleksi Junita yang dikonfirmasi mengatakan, ujian tertulis ini merupakan seleksi tahap kedua setelah sebelumnya dilakukan seleksi administrasi. Pada seleksi administrasi lalu, enam dari 37 pendaftar dinyatakan tidak lolos dan tidak berhak mengikuti ujian tertulis. (c18)

Sumatera Utara

WASPADA Kamis 29 Agustus 2013


Pembunuh Dan Perampok Pasutri Di Madina Dibekuk PANYABUNGAN (Waspada): Setelah melarikan diri tiga minggu, tersangka pembunuhan dan perampok pengusaha warung makan di komplek pertambangan PT M3 di wilayah Kel. Tapus, Kec. Linggabayu, Kab. Mandailing Natal (Madina) yakni Nasrun Majid alias Acun, 48, dan istrinya Suntari, 23, pada 2 Agustus 2013, dibekuk polisi. Empat tersangka ditangkap di beberapa tempat. Kini, tersangka diamankan di Mapolres Madina untuk mempertanggungjawabkan perbuatannya. KeempattersangkayakniBNAlias Ucok, 26, AN alias Ahdi, 25, KH alias Kasro, 27, ZL alias Indin, 25. Kapolres Madina AKBP Mardiaz Kusin Dwihananto SIk Mhum melalui Kabag Ops Kompol HS Siregar SH dan Kasat Reskrim AKP Arfin Fachreza SH SIk kepada wartawan, Selasa (27/ 8) mengatakan, satu ditangkap

di daerah Ujung Gading Pasaman, Sumatera Barat, satu ditangkap di Rao Kab. Pasaman Barat, Sumbar, satu ditangkap di Simpanggambir, dan satu lagi ditangkap di Medan. Dijelaskan, sejauh ini motif dasarnyaadalahperampokandan pembunuhan, namun kuat dugaan ada juga unsur dendam pelakuterhadapkorban,sehingga petugas masih t erus mendalami kasus pembunuhan tersebut Arfin mengungkapkan, uang yang berhasil dibawa kabur

tersangka Rp47 juta dan dua HP milik korban, lalu setelah berhasil ditangkap dari tangan tersangka petugas menemukan sisa uang rampokan Rp6 jutaan. “Uang hasil rampokan itu mereka gunakan sebagian untuk membayar utang, sebagian lagi untuk belanja lebaran karena kejadian itu bertepatan beberapa hari lagi mau lebaran, dan sebagian uangnya digunakan untuk foya-foya, dan Rp3 juta kita temukan di TKP berserakan,” bebernya. Kasat Reskrim Polres Madina itumenjelaskan,awalnyakeempat tersangka sudah berencana melakukan perampokan itu sejak Juni, dan terlaksana pada 2 Agustus 2013, karena setiap tanggal muda pasangan suami istri ini menagihutangdarikaryawandan pekerja perusahaan tambang.

Perampokan ini dilakukan sekira pukul 02.00. Tersangka Ucok dan Ahdi masuk ke dalam kamar korban. Istri Acun mengetahuiaksimereka,lalumenjerit. Ucok memukul kepala Suntari empat kali menggunakan kayu bakar yang dibawa dari luar, lalu naik ke atas punggung Suntari dan menekan kepala korban. Dan saat itu suami Suntari yakni Acun terbangun.Tersangka Ahdi langsung menghantam kepala Acun menggunakan batu kali lima kali, dan Acun terjatuh dari tempat tidur ke lantai. Setelah kedua korban dilumpuhkan, keempat tersangka membawa kabur uang milik korban Rp47 juta, dan dua HP merk Nokia, namun HP tersebut dibuang di sungai Tapus saat mandi pada pagi harinya. Lalu, sambung perwira ber-

pangkat balok tiga di pundaknya itu, uang hasil rampokan Rp47 juta dibagi Ucok terhadap temantemannya Rp11 juta per orang, dan sisanya Rp3 juta digunakan mereka untuk belanja keperluan sehari-hari dan berfoya-foya. Dari keempat tersangka petugas berhasil mengumpulkan barang bukti berupa pakaian diperoleh dari uang hasil rampokan, HP Black berry, sepedamotor dan sebagainya. Sedangkan di TKP petugas menemukan satu kayu bakar ukuran 40 cm, batu kalidanuangkertasnominalRp50 ribu, 60 lembar. “Perbuatan keempat tersangka dijerat pasal 365 ayat 1, ayat 2 jo pasal 338 subsider pasal 170 subs pasal 351 KUHP dengan ancaman hukuman paling tinggi pidana penjara seumur hidup dan paling rendah lima tahun,” ujarnya. (a28/c14)

321 Caleg Peserta Pemilu 2014 P.Sidimpuan


BUPATI Simalungun DR JR Saragih, SH, MM didampingi Kadis Koperasi Kab. Simalungun.

Peringatan HUT Koperasi Ke-66 PARAPAT (Waspada): Perayaan Peringatan Hari Ulang Tahun (HUT) Koperasi RI ke-66 Kab. Simalungun dilaksanakan di Parapat dan diawali dengan gerak jalan oleh Bupati Simalungun DR. JR. Saragih, SH, MM, Selasa (27/8) di Open Stage Parapat. Kegiatan juga dihadiri Kajari Kab. Simalungun, Kepala Dinas Koperasi, anggota DPRD Joharlim Purba, Mansur Purba, para Camat Se- Kabupaten Simalungun,Tokoh masyarakat dan Uspika Kab. Simalungun. Dalam sambutannya, Bupati Simalungun DR. JR. Saragih, SH, MM mengungkapkan, tujuan koperasi adalah untuk mensejahterakan masyarakat melalui gotongroyong. Pemerintah harus memberi perhatian penuh untuk membangkitkan semangat koperasi yang berjumlah 534 kelompok koperasi dan yang aktif hanya 289 kelompok. Seandainya yang 289 bangkit bersama-sama pemerintah di tengah masyarakat Bupati, percaya Kab. Simalungun menjadi contoh suri tauladan di Negara Republik Indonesia. “Kalau mau bangkit, Bupati berjanji akan menyalurkan pinjaman Rp3 miliar untuk tahun anggaran 2014 untuk disimpanpinjamkan kepada masyarakat, dengan tujuan ingin koperasi ada di tengahtengah masyarakat untuk kebangkitan perekonomian masyarakat yang belum bisa di sentuh secara langsung,” ujarnya. (crn)

P. SIDIMPUAN (Waspada): Komisi Pemilihan Umum (KPU) Kota Padangsidimpuan telah menetapkan 321 orang calon anggota legislatif (caleg) dari 12 partai politik sebagai peserta Pemilihan Umum Legislatif (Pileg) tahun 2014. “Jumlah caleg peserta Pemilu 2014diKotaPadangsidimpuansebanyak 321 orang. Sudah kita tetapkan dan tidak akan berubah lagi,” kata Ketua KPU, Mudzakir KhotibSiregarMA,danKomisioner KPU, Mohot Lubis, Rabu (28/8). Dijelaskannya, seiring dengan pertumbuhan jumlah penduduk Padangsidimpuan, maka jumlah kursi yang diperebutkan pada Pileg 2014 nanti menjadi 30

atau bertambah lima kursi dari hasil Pileg 2009. Penambahan kursi ini didasarkan pada bunyi Pasal 26 ayat 2 Point C UU No.8 tahun 2012 tentang Pemilu Anggota DPR, DPD, dan DPRD. Dimana kabupaten/kotaberpenduduk200ribu sampai300ribujiwa,memperoleh alokasi 30 kursi di DPRD. “Untuk Pileg 2014 nanti, enam kecamatan di Kota Padangsidimpuan kita bagi jadi tiga Dapil. Peserta Pileg 2014 di Dapil I sebanyak 120 orang caleg, Dapil II 93, Dapil III 108, dan total seluruhnya 321 orang,” ujarnya. Mengenai alokasi kursi di setiap Dapil, Ketua KPU Kota Padangsidimpuan menjelaskan,

untuk Dapil I yang terdiri dari Kec. Sidimpuan Utara dan Sidimpuan Hutaimbaru memiliki alokasi 11 kursi. Dapil II, Kec. SidimpuanTenggara, Sidimpuan Batunadua, dan Sidimpuan Angkola Julu, sebanyak 9 kursi. Dapil III yang hanya Kec. Sidimpuan Selatan memiliki alokasi 10 kursi. Sementara Mohot Lubis menjelaskan, dari 321 caleg peserta Pileg 2014 di Kota Padangsidimpuan, 125 orang merupakan caleg perempuan dan196laki-laki.Kemudianhanya tiga partai politik yang mengisi seluruh kuota caleg di tiap Dapil, yakni Partai NasDem, Golkar, dan Gerindra. (a27)

Proyek Irigasi Misterius Terkesan Asal-asalan P. SIDIMPUAN (Waspada): Proyek pembangunan irigasi misterius di Desa Mompang, Kec. Angkola Julu, Kota Padangsidimpuan diduga banyak penyimpangan,pekerjaannyaterkesanasalasalan. Amatan Waspada baru-baru ini,proyekpembangunansaluran irigasi yang dilaksanakan sekira dua bulan ini dengan dana tidak diketahui dan siapa kontraktornya, di lokasi plank proyek tidak terpasang. Alhasil, harap warga lainnya, proyekpembangunanirigasiyang

bertujuan agar pembagian air irigasi di musim kemarau bisa meratakesawahmilikwargadesa ini, sehingga petani tidak kekurangan air, akhir-akhir ini tak sepi dari kritikan, bahkan beberapa kali Waspada ditemui warga akan kondisi parah ini, Rabu (27/8). Tokoh Masyarakat setempat, Dahlan Hasibuan, 52, menyesalkankondisirusaknyasaluranirigasi yang sedang dibangun itu. Menurutnya, material yang digunakan sangat tidak layak. Dari pengamatannya, kondisi pembangunan tersebut memang

memprihatinkan. Beberapa masyarakat pun mengetahui jika pembangunannya terkesan asal-asalan, apalagi sangat ironis beberapa buah batu sebesar kerbau masih menyumpal di mulut irigasi namun tetap dicor dengan lapisan semen. Kata warga lainnya, retakretaknyabangunanirigasidisebabkankurangterjagakualitasproyek. Pelaksanaproyekhanyamemoles sisi luarnya saja agar terlihat baik, “Kita kawatir saja, jangan-jangan nantiambrol.Kanyangsusahmasyarakatjuga,”keluhHasibuan.(c13)

Wakil Wali Kota P. Sidimpuan Gagal Berangkat Haji P.SIDIMPUAN (Waspada): Calon jamaah haji asal Kota Padangsidimpuan kloter (kelompok terbang) empat (IV) akan berangkat pada 11 September mendatang ke Asrama Haji Medan, Wakil Wali Kota gagal berangkat haji. Kepala Kantor Kementerian Agama (Kakan Kemenag) Kota Padangsidimpuan, Drs H Efri Hamdan Harahap, diwakili Kepala seksi (Kasi) Haji dan Umroh, Basyrah Nasution Sag kepada Waspada mengatakan, jumlah calon haji asal Kota Padangsidimpuan yang akan berangkat tahun ini 380 orang. “Setelah pemotongan kuota 20 persen dari jumlah kuota 2013 sebanyak 52 orang, WakilWali kota, M Isnandar Nasution Ssos juga gagal berangkat haji tahun ini. Sedangkan calhaj laki-laki 151 orang dan calhaj perempuan 229, calhaj tertua perempuan umurnya 76 tahun dan termuda 21 tahun perempuan juga,” ujar Basyrah, Rabu (27/8). Ia mengatakan, kloter empat dari Padangsidimpuan pada 12 September 2013 sudah harus berada di Asrama Haji Kota Medan untuk bersiap-siap diberangkatkan keTanah Suci Mekah.‘’Sedangkan pemberangkatan 13 September dari Bandara Internasional Kualanamu menuju Mekkah,” tutur Basyrah di ruang kerjanya. (c13)

Dapat Dukungan Jadi Anggota KPUD Tapteng TAPTENG (Waspada): Sejumlah wartawan media cetak yang bertugas di wilayah Kota Sibolga dan Kab. Tapteng memberikan dukungan kepada Poltak Tarihoran, wartawan Harian Waspada, yangsaatinimendaftarkandirimenjadicalonanggotaKomisiPemilihan Umum Daerah (KPUD) Kab. Tapteng. “Kita dari organisasi KorpsWartawan Republik Indonesia (KOWRI) Sibolga-Tapteng, menyatakan mendukung penuh saudara Poltak Tarihoran, yang juga anggota KOWRI dan saat ini ikut dalam seleksi penerimaan calon anggota KPUD Tapteng,” ungkap Maruli, Ketua KOWRI Sibolga-Tapteng, kepada wartawan, Selasa (27/8) di Sibolga. Menurut Maruli, kredibilitas Poltak Tarihoran sebagai seorang jurnalis yang profesional dan independen tidak perlu diragukan. Sosoknya yang sederhana dan polos telah menjadikannya cukup dikenal selama bertugas di Sibolga dan Tapteng. Ketua PK KNPI Sorkam Barat, Alam Satriwal Tanjung menilai, bahwa Poltak Tarihoran sudah layak duduk sebagai anggota KPUD Tapteng. “Secara jujur, Poltak Tarihoran dalam melaksanakan tugas dan tangggung jawabnya sebagai jurnalis kita kenal sangat profesional, termasuk dalam menyuarakan aspirasi masyarakat dan cepat mengambil suatu keputusan”, terang Alam, yang juga mantan Ketua Panwaslu Sorkam Barat ini. (a24)

Waspada/Ahmad Cerem Meha

PROYEK irigasi misterius di Desa Mompang, Kec. Angkola Julu, Kota Padangsidimpuan diduga banyak penyimpangan, pekerjaannya terkesan asal-asalan.

Puskesmas Kotanopan Diminta Jadi RS PANYABUNGAN(Waspada): WargaMandailingJulukhususnya Kec.Kotanopan,Kab.Mandailing Natalmemintapemerintahdapat mengalokasikan dana bantuan untuk peningkatan status Pusat Kesehatan Masyarakat (Puskesmas) Kotanopan yang kini rawat inap menjadi rumah sakit (RS). Upaya perluasan sekaligus peningkatan status menjadi rumah sakit sangat wajar, apalagi dilihat dari luasnya jangkauan maupun kebutuhan masyarakat yang semakin meningkat dalam upaya memenuhi pelayanan kesehatan yang maksimal dan bermutu di daerah ini.

“Permintaan masyarakat ini sangat logis karena lokasi Puskesmas sangat strategis. Ini demi kepentingandankebaikanmasyarakat. Perubahan Puskesmas menjadi rumah sakit membuat akses pelayanan kepada warga sekitar dapat dilakukan dengan cepat,” ucap Sangkot Syukur Nasution, salahseorang tokoh masyarakat Kotanopan, Minggu (25/8). Sangkot Syukur yang akrab disapa Pak Koteng mengatakan, selama ini secara geografis keberadaan RSUD Panyabungan dianggap terlalu jauh dan sulit dijangkau pasien maupun keluarga

pasien dari Mandailing Julu. “Jarak tempuh Kotanopan - Panyabungan 40 kilometer, dengan waktu perjalanan sekira satu jam. Waktu yang satu jam ini dari pusat Pasar Kotanopan, bagaimana dengan desa-desa sekitar yang lama perjalanan menuju Kotanopan memakan waktu satu hingga dua jam,” ujarnya. Harapan yang sama juga disampaikan Jasamidun Lubis bahwakomitmenmenghadirkan pelayanan kesehatan yang bermutu bagi setiap warga di daerah itumerupakanbagiandarivisidan misi Pemkab Madina. (a28)

Rahmad-Andri Pukau 20 Ribu Massa SIBUHUAN (Waspada): Pasangan Cabup dan Cawabup nomor urut 3, Haji Rahmad dan Haji Andri tampil memukau di hadapan ribuan massa pada kampanye terbuka calon Bupati/ Wakil Bupati Padanglawas di Lapangan Merdeka Sibuhuan, Selasa (27/8). Kampanye yang dihadiri sedikitnya 20 ribu warga Kec. Barumun itu menampilkan sejumlah juru kampanye, antara lain HTongku Muhammad Paruhum, Ketua DPC Partai Demokrat yang juga Ketua DPRD Palas H. M Rido Harahap, Tokoh Adat Padanglawas Patuan Banggor. Turut tampil pelawak Ucok Baba dan artis Ibukota, dan grup kasidah lokal. Kehadiran Ucok Baba yang ditemani artis ibu kota ternyata cukup menyedot animo masyarakat. Dalam orasi politiknya, Haji Tongku Muhammad Paruhum membakar semangat massa yang menyemut di lokasi kampanye. Katanya, Padanglawas membutuhkan perubahan karena sangat tertingal dari daerah lain yang dimekarkan dalam waktu yang bersamaan. Hal yang sama juga dilakukan oleh Ketua DPRD Palas. Dia mengatakan warga Padanglawas harus melakukan perubahan. Katanya, Haji Rahmad dan Haji Andri jika terpilih sebagai pemimpin akan mampu melakukan perubahanperubahan yang nyata untuk kemaslahatan masyarakat. Cawabup H Andri Ismail Putra Nasution

dalam orasinya antara lain menyampaikan akan tetap mendukung Haji Rahmad dan tidak akan ada perselesihan diantara mereka. Sementara Haji Rahmad mengatakan, warga Palas harus memandang masa depan daerah yang dimekarkan dari hasil perjuangan seluruh rakyat Padanglawas. Sebelumya, Senin (26/8) sore, kampanye terbuka hari kedua pasangan nomor urut 3 ini, di Lapangan Sepak Bola Desa Pinarik Kec. Batang Lubu Sutam, juga dihadiri ribuan massa. Selain cabup dan cawabup, serta Ketua Tim Harapan dan Ketua DPRD Palas, orasi politik juga disampaikan tokoh masyarakat setempat Tahir Nasution dan Raja Bangun Hasibuan. Usai acara, seratusan warga Desa Ujung Batu menunggu kedatangan Haji Rahmad di rumah H Saleh Daulay, Desa Ujung Batu Kec. Sosa. Dalam silaturahmi itu tokoh masyarakat Sosa, Haji Mamora dan Haji Ginda Hasibuan menyatakan sikap untuk memilih dan memenangkan pasangan nomor 3 Haji Rahmad dan Haji Andri. Turut memberikan sambutan Sodoguron Hasibuan,SutanOloanHasibuan,AbbasNasution dan Haji Partahanan Hasibuan serta sejumlah warga lainya. Pertemuan yang singkat namun berkesan itu juga dihadiri Kepala Desa Ujung Batu, Hamdani Daulay dan puluhan pemuda dan pemudi setempat. (a34)

Aparat Terkait Diminta Periksa Plt. Kadiskes Madina PANYABUNGAN (Waspada): Aparat terkait diminta agar segera memeriksa Plt. Kadis KesehatanKab.MandailingNatal,drg.Ismailatasdugaan korupsi dana Alkes tahun 2008 dan dugaan pemotongan Jamkesmas. Hal itu disampaikan Ketua Umum DPP Majelis Mahasiswa Muslim Mandailing Natal (M FOUR), Faisal Ardiansyah didampingi Koordinator Lapangan Darwin saat melakukan demontrasi di depan kantor Kadis Kesehatan Madina, Rabu (28/8). Selainitu,MFOURjugamemintaBupatiMadina segera memberhentikan drg. Ismail sebagai Plt. Kadis Kesehatan, karena dinilai sebagai pejabat bermasalah, tidak kredibel, tidak komunatif serta arogan sehingga tidak pantas untuk memimpin Dinas Kesehatan Madina yang nota benenya adalah salah satu dinas paling vital dalam rangka

mewujudkan visi misi Bupati Madina. Pantuan di lapangan, massa M FOUR yang berjumlah sekitar empat puluhan itu hadir sekitar pukul 11.00 dengan mengenderai mobil dan sepedamotor. Mereka langsung berorasi dengan membawa spanduk dan meminta berjumpa langsung dengan Plt. Kadis Kesehatan Madina. Setelah berorasi sekitar setengah jam, perwakilandariDinasKesehatandatangmenjumpai massa. Namun massa menolak berjumpa dengan yang bersangkutan karena dianggap tidak berkompoten. Setelah negoisasi dengan pihak keamanan, perwakilanmassasebanyakempatorangakhirnya diperbolehkan masuk untuk mencek keberadaan Plt. Kadis Kesehatan. Kecewa dengan tidak adanya Plt Kadiskes di tempat, perwakilan massa akhirnya menyegel pintu masuk ruangan Kadis. (c15)

Pemkab Karo Cegah Penjualan Tuak KABANJAHE (Waspada): Bupati Karo melalui suratnyayangdiedarkankeseluruhjajaranPemkab Karo nomor 524/Satpol PP/2013, tertanggal 21 Agustus 2013, mengimbau masyarakat agar menghentikan mengkonsumsi minuman tradisional“tuak”karenadapatmerusakkesehatan. Hal ini dilakukan sehubungan dengan surat dari Kadiskes Dr Jansen Perangin-angin tertanggal 16 Agustus 2013, tentang hasil pemeriksaan komposisi minuman tuak yang masuk ke Kab. Karo mengandung alkohol yang cukup tinggi. Sehingga, apabila dikomsumsi secara terus menerus dapat mengakibatkan gangguan kesehatan yang cukup fatal. Himbauan ini berdasarkan hasil pemeriksaan Balai POM Sumatera Utara terhadap beberapa sampel tuak yang diserahkan untuk diperiksa kadar alkoholnya. Berdasarkan hasil pemeriksaan. Balai POM Sumatera Utara atas sampel yang diberikan oleh Dinas Kesehatan Kab. Karo tersebut, diketahui bahwa minuman tuak mengandungalkoholantara15-20%danMetanol di atas 1 %. Disebutkan dalam surat bupati tersebut,

dengan ditemukannya kadar alkohol dalam minuman tuak tersebut berarti bahwa tuak yang dikonsumsi masyarakat Karo pada umumnya sudahtidakmurnilagihasilfermentasidariglukosa yang terdapat di air nira. Minuman tuak tersebut jika dikonsumsi secara terus menerus dalam jangka waktu yang lama akan mengakibatkan gangguan kesehatan seperti: Gangguan saluran pencernaan, gangguan fungsi hati, radang otang, infeksi paru-paru dan kebutaan. Untuk itu, Bupati Karo (DR) HC. Kena Ukur Karo Jambi Surbakti meminta seluruh jajarannya di Pemkab Karo agar melakukan upaya-upaya pencegahan penjualan atau peredaran minuman tuak di Kab. Karo sesuai dengan tugas pokok dan fungsi instansi masing-masing, terutama tuak yang masuk dari luar. Kepadaparacamatse-KabupatenKaro,Bupati Karo meminta agar memberikan informasi kepada masyarakat mengenai dampak gangguan kesehatan akibat mengkonsumsi minuman tuak tersebut, dan melarang peredaran tuak yang masuk dari luar Kab. Karo di masing-masing kecamatan. (c09)

Panas Bumi Samosir Menjadi Sumber Listrik 200 MW SAMOSIR (Waspada): Kab. Samosir diduga memiliki kandungan gas bumi yang dapat digunakan sebagai sumber listrik yang sangat dibutuhkan masyarakat dan instansi pemerintah/swasta. Kadis Koperindag Kab Samosir K Sihotang, melalui SekretarisWalson Sagala yang didampingi Kabid Pertambangan Samosir J Pandiangan .kepada Waspada, Rabu (28/8) mengatakan, mengatakan bahwa sebelumnya sumber panas bumi di Kab. Samosir sudah di survei yang berada di dua lokasi yakni Pusuk Buhit Kec. Pangururan dan Desa Simbolon. Kabid Pertambangan Provsu Zubaidy yang dikonfirmasi Waspada, Rabu (28/8) mengatakan. pengolahan panas bumi di Samosir masih terkendala akibat adanya perubahan Peraturan Pemerintah (PP) N0 27 tentang payung hukum

dan lelang pengolahan panas bumi yang hingga saat belum terealisasi dari pemerintahan atasan. Menurut Zubaidy, panas bumi Samosir diperkirakanmampumenghasilkanenergisebesar 200 MegaWatt yang akan didistribusikan melalui jaringan nasional PLN. Anggaran pengeboran 1 lubang berkisar 7 juta dollar dan perusahaan yang akan mengikuti tender harus menyetor dana awal sebesar Rp1 miliar sebagai jaminan kesungguhan rekanan peserta lelang kemudian apabila dia menjadi pemenang harus menyetor dana Rp10 miliar. Hingga saat ini sudah ada rekanan dari Amerika Chevron berencana mengikuti lelang. “Apabila tidak ada kendala, pekerjaan akan dilaksanakan padatahun2014sebabproseslelangakanmenghabiskan waktu 10 bulan,” ujarnya. (c11)

Calon Anggota KPU Pakpak Bharat Dan Dairi Tes Kesehatan

Kontingen Dairi Siap Ikuti FDT SIDIKALANG (Waspada): Kontingen Dairi telah siap mengikuti Festival DanauToba (FDT) yang akan diselenggarakan di Kab. Samosir (selakutuanrumah),8sampai14September2013.Haltersebutdijelaskan Kadis Pariwisata Pemuda dan Olahraga, Drs Bonar Butarbutar selaku ketua kontingen kepada Waspada, Rabu (28/8). FDTmenampilkan30-anikonkegiatanyangbersifatlokal,nasional daninternasional.SedangkankontingenDairiyangakandiberangkatkan untuk mengikuti even tersebut, terdiri dari peserta lomba solu, renang dan lomba tari tarian. Kemungkinan besar, keberangkatan kontingen itu akan didampingi unsur Muspida. Menurut Butarbutar, peserta lomba solu dan renang telah disiapkan. Mereka adalah warga Kec. Silahisabungan yang berada di pinggir Danau Toba terdiri dari nelayan, yang handal di bidang renang maupun solu. (a20)

Waspada/Syarif Ali Usman

HAJI Rahmad Pardamean Hasibuan Cabup nomor urut 3 saat menyampaikan orasi politik dalam kampanye di Lapangan Merdeka Sibuhuan, Selasa (27/8).

Waspada/Munir Lubis

BANGUNAN Puskesmas Kotanopan berada di kawasan Sindang Laya, Kec. Kotanopan.Warga minta Puskesmas ini ditingkatkan statusnya menjadi rumah sakit.

SALAK, Pakpak Bharat (Waspada): Sejumlah 62 Calon Anggota KPU Kab. Pakpak Bharat dan Dairi melakukan Tes Kesehatan Di Rumah Sakit UmumDaerah(RSUD)Salak,Kab.PakpakBharat. Hal tersebut merupakan salah satu persyaratan yangakandigunakanuntukmelengkapirangkaian Seleksi Calon Anggota di Kab. Tanah Pakpak dan Dairi itu. Sebanyak 37 orang peserta seleksi anggota KPU Dairi melakukan yest kesehatan di RSUD Salak, sementara dari Kab. Pakpak Bharat melakukan tes sebanyak 25 orang.

Direktur RSUD Salak dr. Pintar Manihuruk kepadaWaspada,Rabu(28/8)mengatakan,bahwa ke 62 peserta itu melakukan beberapa tahapan test kesehatan, seperti test narkoba, test darah rutin, test EKG, test ronsen dan test psikologi. Dengan biayakeseluruhantestkesehatansesuaiPerdayang telahditentukandiRSUDSalakhanyasebesarRp572 ribu. Dan dalam rangka memberikan pelayanan yang prima guna melengkapi seluruh rangkaian test kesehatan, RSUD Salak menghadirkan psikiater dr. Ira Aini Dania SP M.Ked SPKJ, dari Rumah Sakit Jiwa Lhokseumawe. (csb)



Harus Bisa Hentikan Konsumsi Barang Impor


enteri Keuangan Muhamad Chatib Basri memperkirakan pelemahan nilai tukar rupiah masih akan berlanjut hingga awal 2014 mendatang. Meski begitu, kata dia mengatakan pemerintah akan berupaya menjaga agar nilai agar tetap sesuai dengan asumsinya. “Pemerintah masih memiliki optimisme terhadap perkiraan pergerakan rata-rata nilai tukar terhadap dolar Amerika Serikat pada kisaran Rp 9750 per dolar AS,” kata Chatib dalam pemaparan jawaban pemerintah atas pandangan fraksi terkait RUU APBN 2014 di Kompleks Parlemen Senayan, Jakarta, kemarin. Dalam upaya menjaga stabilitas nilai tukar dan neraca trasaksi berjalan, dan pertumbuhan ekonomi, Chatib mengatakan pemerintah sudah menetapkan empat paket kebijakan, yaitu paket memperbaiki defisit transaksi berjalan, kedua memastikan agar defisit APBN 2013 tetap 2,38 persen, ketiga paket kebijakan untuk meningkatkan daya beli masyarakat, dan keempat kebijakan untuk mempercepat investasi. Menurut Chatib, dalam beberapa tahun terakhir, nilai tukar rupiah terhadap dolar AS masih cenderung stabil, kecuali pada 2011 lalu. Berdasarkan catatan, pada 2009 asumsi nilai tukar ditetapkan sebesar Rp 10.500 per dolar AS, sementara realisasinya Rp 10.408 per dolar AS. Pada 2010, asumsi nilai tukar Rp 9.500 per dolar AS, sedangkan realisasinya Rp 9.087 per dolar AS. “Pada 2011 nilai tukar berada di atas angka asumsi, yaitu Rp 8.779 sedangkan asumsinya Rp 8.700 per dolar AS. Sementara pada 2012 asumsinya Rp 9.900 dan realisasinya Rp 9.384 per dolar AS dan pada 2013 pemerintah berupaya menjaga nilai tukar dalam kisaran Rp 9.600 per dolar AS,” katanya. Salah satu yang merasakan dampak dari kenaikan harga dolar tadi tentunya para importir buah-buahan dan sayur mayur. Bukannya iri, namun dapat kita pastikan mereka yang meraih keuntungan dengan tingginya nilai dolar terhadap rupiah. Padahal kebijakan impor berbagai produk pertanian hanya akan membuat sengsara para petani di Indonesia. Kebijakan impor berbagai produk pertanian seperti buah, sayur Intisari dan yang terakhir menjadi kasus besar korupsi impor daging sapi adalah hal yang menyakitkan bagi petani di Indonesia. Petani kita akan sulit untuk sejahtera. Sungguh ironis, Indonesia yang dikenal sebagai negara agraris, saat ini justeru menjadi negara pengimpor berbagai produk pertanian yang sebenarnya banyak terdapat di Indonesia. Indonesia juga tercatat memiliki lulusan sarjana pertanian yang terbanyak jumlahnya di dunia hingga saat ini, namun ironisnya justeru tercatat sebagai salah satu negara pengimpor terbesar produk pertanian. Dari data yang dirilis Badan Pusat Statistik yang menyebutkan laju ekspor pada April lalu turun 7,36 persen dibanding bulan sebelumnya menjadi AS$ 15,98 miliar. Penurunan ekspor terjadi untuk produk migas dan non-migas masing-masing menjadi AS$ 3,36 miliar dan AS$ 12,62 miliar. Laju impor justru meningkat 11,65 persen menjadi AS$ 16,62 miliar. Kitanya tentunya mendukung larangan impor oleh pemerintah terhadap 11 jenis produk hortikultura. Penolakan sementara impor 11 produk hortikultura ini karena bertepatan dengan masa panen petani. Aturan impor produk hortikultura diatur melalui Peraturan Menteri Pertanian Nomor 60 Tahun 2012 tentang Rekomendasi Impor Hortikultura dan Peraturan Menteri Perdagangan Nomor 60 Tahun 2012 tentang Ketentuan Impor Produk Hortikultura. Atas dasar aturan itu, pemerintah menghentikan sementara keran impor 11 jenis produk hortikultura mulai akhir Januari ini hingga Juni mendatang. Jenis yang dihentikan sementara adalah kubis, wortel, cabai, nanas, melon, pisang, pepaya, durian, bunga krisan, bunga anggrek, dan bunga heliconia. Kebijakan ini sangat kondusif bagi petani dan merupakan peluang untuk meningkatkan produksi hortikultura dalam negeri. Ke depannya, angka importasi bisa ditekan untuk memberikan ruang bagi produk buah dan sayuran lokal, mengingat selama ini buah-buahan impor telah merajai pasar domestik. Pemerintah juga harus memastikan bahwa infrastruktur penunjang dan biaya distribusi dapat ditekan seminimal mungkin. Sebab, selama ini yang membuat buah lokal kalah bersaing dengan buah impor di pasaran karena berbagai alasan, seperti aspek pengemasan. Selain membatasi importasi, pemerintah perlu mendorong iklim investasi dalam peningkatan kegiatan usaha hortikultura di dalam negeri. Penyediaan iklim investasi yang kondusif dibutuhkan untuk memberikan kenyamanan dan keamanan bagi para investor. Dan tentunya menyelamatkan anak negeri yang sudah berpeluh di ladang dan sawah untuk memenuhi kebutuhan hidupnya dengan menanami buah-buahan dan sayur-mayur yang harusnya kita perlu selamatkan.****

Penyelamatan nasib hasil pertanian lokal itulah yang penting.


Dedi Sahputra

Game Di Komputer Bisa jadi apa yang selama ini kita kerjakan bukanlah hal yang membahagiakan, dan yang dihindari justru soal yang sebenarnya kita inginkan. Gary Kasparov misalnya, maestro itu mengatakan catur adalah permainan yang menyiksa mental. Tentu saja ini mengejutkan, karena hampir seluruh hidupnya dihabiskan untuk catur. Maka kekhawatiran saya pada anak-anak itu menemukan metaforanya. Anda tahu bahwa selain untuk mengetik, komputer di rumah adalah tempat main game. Bagiku, komputer itu telah mendatangkan kebiasaan buruk anak mereka. Setiap pulang sekolah, apalagi di masa liburan tiba, bermain game akan jadi ritual. Selain mengganggu pekerjaanku, keributan di antara mereka juga merupakan persoalan tak kalah pelik. Sering aku melarang atau sengaja membuat syarat yang berat untuk bermain game. Tapi wajah murung mereka sering membuat hatiku luluh. Si sulung biasanya memajukan mulutnya sambil terus berargumentasi, adiknya biasanya lari masuk ke kamar mengurung diri.Yang paling “watak” si bungsu.Wajahnya sungguh khas sekali ketika mengespresikan kecewanya; matanya tiba-tiba redup, mulutnya membentuk lengkungan, dan suaranya mendadak jadi terdengar berat. Jadi sebenarnya hatiku lebih dekat ke “lucu” ketimbang “luluh”. Apalagi anak-anak itu dasarnya adalah anak rumahan yang tak kenal main game di Warnet. Pikirku, tak ada salahnya sesekali mengizinkan mereka. Maka jadilah; sesering aku membuat aturan main game, sesering itu pula aku melanggarnya. “Boleh, tapi jangan lama-lama,” kataku memberi izin. “Yesss.., kata mereka sambil mengepalkan tangan. See.., aku terpedaya lagi. *** Tapi soal game itu tak menghilangkan khawatirku. Dari referensi yang kuketahui, game bisa berbahaya bagi tumbuh kembang anak-anak. Maka tak ada jalan lain, aku harus terus mengawasi mereka. Kepada istri juga kupesankan untuk berlaku tegas membatasi waktu bermain game anak-anak itu—selagi aku tak di rumah. Suatu saat si sulung bersama si bungsu bermain game Real Racing. Saya berdiri dengan wajah garang, wajah saya ketatkan untuk memberi sinyal serius. Mata saya pelototkan memerhatikan setiap gerak-gerik mereka. Saya jadi tahu, mobil balapnya keren-keren juga. Suara deru gasnya, pergantian gear-nya, tikungan sirkuitnya seolah hidup dan benar-benar nyata. Ooo.., rupanya

ada beberapa sirkuit yang berbeda-beda; ada di Jepang, Australia, Jerman, Amerika Serikat dengan tingkat kesulitan berbeda pula. Ooo.., rupanya mobil baru yang canggih bisa dibeli dengan uang yang didapat setiap kali menang balapan. Ooo.., setiap kali selesai balapan, rupanya mobil harus diservis dulu, ganti oli, perbaikan kerusakan di lintasan tadi, dan di-tune up untuk menambah akselerasi— tapi untuk ini kita harus menunggu sekian menit—benar-benar seperti nyata. Dan itu.., mobil yang baru dibeli itu dari jenis tercanggih dengan kecepatan 215 kilometer per jam. Bisa lebih cepat lagi kalau dimasukkan bengkel. Dan.., cukup sudah. Ini permainan menarik yang selama ini kusiasiakan. Saya harus mencobanya. Tapi sebagai orang tua yang berwibawa harus tunggu anakanak berangkat sekolah dulu. *** Benar saja. Saya menemukan kesenangan dari main game ini. Di antara buku, dan jurnal ilmiah yang saya baca, di antara inspirasi yang sedang diwujudkan, dan di antara rumitnya memahami bahasa yang tertulis itu, game memberikan nuansa baru. Sejenak bermain membuat saya seolah melupakan keletihan tadi. Wuaahh.., saya bahkan sudah bisa beli mobil baru. Sangat cepat lajunya. Saya pasti berpeluang menjuarai setiap balapan. Sementara mobil sedang diservis, cukup hari ini, besok saya bakal menghadapi sirkuit Australia yang terkenal ekstrim sempit itu. Saya bahkan bisa membayangkan serunya balapan besok. Tapi.., jejak saya terendus juga. Anak-anak mulai curiga dengan nilai hadiah yang terus berkurang. Ditambah dengan mobil yang baru dibeli, mereka mengasumsikan ada balapan ilegal di luar mereka. Kepada ibunya kecurigaan itu disampaikan, dan saya adalah terduganya. Hal yang akhirnya harus saya akui—bukan cuma bermain diam-diam—bahwa sayalah pihak yang sebenarnya paling menginginkan bermain game. Hanya saja anak-anak itu yang lebih jujur. Sebenarnya saya merasa malu. Tapi resiko dengan senang hati kuambil, jika karenanya aku terhindar dari yang dialami Gary Kasparov. Sebentar kemudian aku memang mulai bosan bermain game. Tapi rupanya, hidup menawarkan banyak sekali macam kebahagiaan penangkal derita mental itu. Kasihan Gary, dia pasti tak tahu itu. Karena hidup itu bukan menunggu badai berlalu, tetapi bagaimana berjumpalitan di antara hujan dan deras anginnya. Maka bergeliatlah dan jujurlah, karena di balik setiap bulir hujan itu ada kebahagiaan-kebahagiaan yang tak terduga.(Vol.441, 29/8/2013)

Kolom foliopini dapat juga diakses melalui

WASPADA Kamis 29 Agustus 2013

Agama Dalam Realitas Sosial Oleh M.Ridwan Lubis Etos kerja berangkat dari keyakinan bahwa Tuhan bukanlah Zat yang harus ditakuti dalam arti dijauhi, tetapi Zat yang harus dirindukan, dicintai dan didekati


ilihat dari sudut teologi, maka semua jenis agama yang memiliki konsep tentang ketuhanan maka ia dapat disebut agama sementara yang tidak memiliki konsep yang jelas tentang Tuhan maka dengan sendirinya tidak dapat disebut sebagai agama. Dilihat dari sudut sosiologi, maka setiap yang diakui oleh penganutnya sebagai agama, apakah agama lokal atau agama dunia, maka ia adalah agama karena penilaian terhadap agama bukan otoritas negara tetapi oleh penganutnya. Selanjutnya apabila dilihat dari sudut tata perundang-undangan di Indonesia maka yang disebut sebagai agama tanpa mempertimbangkan muatan keyakinannya, hanya terbatas enam yaitu Islam, Kristen, Katholik, Budha, Hindu, Konghucu. Sedang agama lainnya tetap memiliki hak hidup di Indonesia seperti Yahudi, Tao, Shinto dan lain sebagainya. Tugas negara terhadap agama di Indonesia sebagai negara kebangsaan terbatas dua hal yaitu memberikan pelayanan untuk kemudahan umat beragama melaksanakan ajaran agamanya serta memberikan perlindungan—manakala terjadi kesulitan atau gangguan terhadap umat beragama ketika mereka melaksanakan ajaran agamanya. Namun untuk pelaksanaan fungsi fasilitasi dan proteksi tersebut memerlukan rambu-rambu sehingga ia menjadi sebuah keutuhan sistem. Di antara rambu yang telah berhasil dirumuskan dan disepakati umat beragama sekalipun— belum lengkap—hanyalah Peraturan Bersama Menteri Agama dan Menteri Dalam Negeri No. 9 dan 8 Tahun 2006 tanggal 21 Maret 2006 yang terkait dengan Pedoman Bagi Kepala Daerah/ Wakil Kepala Daerah tentang Pemeliharaan Kerukunan Beragama, Pemberda-

yaan Forum Kerukunan Umat Beragama Dan Izin Pendirian Rumah Ibadat. Menurut Leonard Swidler, secara tradisional, jantung setiap budaya adalah agama karena agamalah penjelasan mutlak terhadap arti hidup serta bagaimana cara hidup yang sesuai dengannya dan biasanya semua agama mencakup tiga “C” yaitu creed, code dan cult. (Leonard Swidler, “Toward A Universal Declaration of A Global Ethic” dalam Islamic Millenium Journal, Volunteerism and Global Ethics, Vol. II, Number 2, JanMarch 2002, hal. 11). Creed atau kredo adalah merujuk kepada aspek agama yang mencakup kepada penjelasan terhadap arti mutlak dari kehidupan. Oleh karena kredo adalah bagian terpenting dari batang tubuh agama maka kredo dapat juga disebut kata kunci agama. Ajaran setiap agama pada dasarnya adalah kesatuan sistem yang saling terkait antara ajaran yang satu dengan yang lainnya. Ajaran tentang tauhid dalam Islam akan saling terkait berbagai upacara maupun hukum serta akhlak. Code atau kode adalah adalah hukum tentang baik dan buruk yang diukur menurut kredo. Sedang cult adalah upaya untuk menyerap makna dari keberagamaan sehingga ia menjadi bagian utama dari praksis kehidupan. Keberagamaan yang ideal, sejalan dengan agama sebagai jantung budaya, adalah berfungsinya agama sebagai landasan etos kerja. Etos kerja berangkat dari keyakinan bahwa Tuhan bukanlah Zat yang harus ditakuti dalam arti dijauhi, tetapi Zat yang harus dirindukan, dicintai dan didekati, karena Ia adalah wujud puncak dari kemahasempurnaan (kamalat). Konsep inilah yang menjadi perbedaan dasar antara agama lama dengan agama samawi. Kemudian, agama tampil dalam dua bentuk yaitu agama ajaran dan agama panutan. Agama ajaran

adalah yang didasarkan kepada doktrin atau ajaran yang termakub dalam kitab suci mencakup akidah, ibadat, akhlak dan pranata sosial. Agama ajaran menjadi tuntutan dari agama untuk diamalkan penganutnya. Tipologi orang yang sungguh-sungguh sebagai penganut agama ajaran disebut bertakwa. Sedang agama panutan adalah penghayatan agama yang tergantung kepada tokoh yang dijadikan sandaran. Apabila panutannya tokoh yang luas pandangannya maka pemahaman agama menjadi toleran dan sebaliknya, apabila tokoh panutannya orang yang dangkal wawasannya tentulah akan melahirkan konflik di antara umat beragama.. Menurut Wendy Tyndale, pemuka agama panutan hendaklah memiliki kedalaman spiritualitas, karena hal itu akan menjadi jalan alternatif untuk mengorganisir kehidupan bersama umat beragama, karena spiritualitas adalah sumber kekuatan dan kebijaksanaan. Lihatlah persaudaraan tasawuf, tarekat, bersikap ramah kepada sesama karena keberagamaan terletak pada relung hati yang terdalam. Mereka tidak

suka untuk mempermasalahkan keberagamaan orang lain. Waktu mereka habis untuk merenungi kekurangan dirinya. Karena itu, beragama bukan untuk mencari musuh tetapi mencari makna agar memperoleh kehidupan yang bahagia. Agama-agama besar dunia telah melakukan berbagai perumusan tentang nilai-nilai kemanusiaan. Menurut Abraham Maslow kebutuhan dasar manusia hanya bisa dipenuhi dengan melalui manusia yang lain yaitu masyarakat. Kebutuhan adanya masyarakat (community) seperti perasaan bagian dari satu kesatuan dan kontak sosial dengan sendirinya merupakan kebutuhan dasar. Sementara kesepian (lonelyness), keterpencilan (isolation), pengucilan (ostracism), penolakan (rejection) oleh kelompok, semuanya tidak hanya menyakitkan tetapi juga bisa memicu datangnya penyakit (pathogenic). Dalam kaitan itulah rangkaian wacana keberagamaan memasuki wilayah yang amat penting yaitu pencerahan batin menuju toleransi kehidupan beragama. Penulis adalah Guru Besar UIN Syarif Hidayatullah Jakarta.

Perginya Seorang Pejuang Oleh M. Muhammad TWH Strategi seorang komandan tidak saja diperlukan di medan tempur, tetapi dalam menggerakkan pasukan dari satu tempat ke tempat lain yang penuh bahaya, memerlukan perhitungan yang tepat.


ullu nafsin zaikatul maut. Tiap manusia akan menemui ajalnya. Ada yang lambat ada yang cepat. Agama memesankan, belajarlah kamu seolah hidup selamanya dan beribadahlah kamu seolah kamu akan mati besok. Belum lama berselang (22/ 6) telah berpulang ke Rahmatullah seorang pejuang kemerdekaan yang telah banyak memberi dharma baktinya kepada negara masyarakat khususnya masyarakat Sumatera Utara. Tokoh pejuang itu adalah Mayor Jenderal (Purn) H. Raja Sjahnan SH lahir tahun 1923, berarti beliau menutup umur sekitar 90 tahun. Di masa hayatnya telah banyak berbuat untuk negara dan masyarakat, memberi keteladanan sebagai seorang pemimpin. Gaya kepemimpinan yang mantap dirasa oleh masyarakat, apalagi sikap rendah hatinya yang sangat berkesan dan tidak bisa dilupakan. Semoga Allah memberi tempat yang sebaik-baiknya di sisiNya dan diampunkan semua dosanya. Komandan Kompie Ketika itu Raja Sjahnan berpangkat Letda, memimpin satu kompie pasukan berkedudukan di Tebingtinggi. Waktu itu Inggris yang diboncengi NICA/Belanda telah menduduki kota Medan, yang mulai merekrut bekas KNIL, Poh An Tuai dan Barisan Pengawal. Kota Siantar, Tebingtinggi dan Binjai menjadi basis perjuangan. Para pengungsi mengalir ke kota-kota ini. Pimpinan perjuangan waktu itu menilai kekuatan pasukan di Binjai belum memadai. sementara basis perjuangan Two Rivers (Trepes) yang tadinya ditempati pasukan Batalyon B Nip Xarim yang persenjataan lengkap dipindahkan ke Langkat, khususnya di Kuala Serapoh untuk menghadapi kemungkinan Belanda mendarat di tempat itu. Menurut Mayjen (Purn) H. Raja Sjahnan dalam bukunya “Dari Medan Area ke Pedalaman Kembali ke Kota Medan) pasukannya berada di Front Two River sejak 15 Januari 1947. Kompi III pimpinannya menempati front Two Rivers berkekuatan satu Kompi harus mengcover tugas dari satu batalyon. Sementara beliau ditetapkan menjadi Komandan Front. Mengelabui Tentara Inggris Memberangkatkan dua Kompi pasukan dari Tebingtinggi dan Sungai Rampah menuju Binjai juga mengalami resiko. Betapa tidak, di Stasiun Besar Medan pengawasan tentara Inggris sangat ketat. Penumpang kereta api yang datang dan naik selalu digeledah demikian juga gerbong penumpang digeledah. Namun para pimpinan pasukan harus mencari jalan agar pasukan bisa melewati Stasiun Besar Medan menuju Binjai. Menurut Kolonel (Purn) Basuddin Dasuki yang menjadi pelaku sejarah

memberangkatkan kompinya dari Sungai Rampah ke Binjai mengemukakan kepada penulis di masa hayatnya sebagai berikut: Sebelum hari yang telah ditetapkan pemberangkatan ke Binjai, lebih dahulu diadakan suatu pertemuan dihadiri dua orang Sep (Kepala Stasiun) dan dua orang Kondektur kereta api masing-masing Sori Tua Siregar dan Genduk Bangun yang akan ikut dalam kereta api yang mengangkut pasukan. Disepakati pemberangkatan kereta api yang mengangkut penumpang umum dan yang mengangkut pasukan hampir bersamaan. Seluruh pasukan diinstruksikan harus berpakaian seperti rakyat biasa. Senjata-senjata dibungkus dengan tikar dan goni diletakkan di tempat duduk di kereta api. Antara kereta api penumpang dan kereta api yang membawa pasukan harus berjalan beriring-iringan, silih berganti jalan di depan. Hal ini penting untuk security, karena kalau sampai diketahui oleh kaki tangan NICA maka bahaya besar. Kalaupun diketahui, sulit ditandai yang mana kereta api penumpang dan yang mana kereta api yang membawa pasukan. Sampai di Perbaungan, kereta api yang membawa pasukan berada di depan. Ketika sampai di Batangkuis kereta api yang membawa penumpang mendahului. Sampai di stasiun Medan Pasar kereta api yang membawa penumpang umum berhenti, sedangkan kereta api yang membawa pasukan lebih dahulu masuk Stasiun Besar Medan. Menjelang sampai di Stasiun Besar Medan masinis memberi isyarat tanda kereta api masuk dan segera akan berhenti. Begitu masuk Stasiun Besar kereta api yang membawa pasukan itu membuat gerakan seolah segera akan berhenti dengan memperlambat jalannya. Melihat tentara sekutu/Inggris yang ada di Stasiun Besar Medan itu sedikitpun tidak curiga, gerakan-gerakan kereta api langsir dilakukan. Rupanya dua kereta api yang hampir bersamaan masuk ke Stasiun Besar Medan memecahkan konsentrasi tentara Inggris yang mengawasi di Stasiun Besar itu. Dalam situasi yang begitu, kereta api yang membawa pasukan segera meningkatkan kecepatan menuju Binjai. Dengan demikian pasukan yang didatangkan dari Tebingtinggi dan Sungai Rampah selamat sampai di Binjai untuk memperkuat kedudukan pasukan Burhanuddin yang telah lebih dahulu berada di sana. Komandan pasukan memerintahkan, Kompi III Pimpinan Letda Raja Sjahnan dipindahkan dari Tebingtinggi ke Trepes. Pasukan harus diberangkatkan dengan truk. Sedangkan pasukan lain juga yang tadinya direlokasi di Tebingtinggi dan Sungai Rampah harus diberangkatkan dengan kereta api. Pasukan yang harus diberangkatkan ke Binjai adalah kompie pimpin Letnan

Basuddin Dasuki yang tadinya berkedudukan di Sungai Rampah, dan kompie yang dipimpin oleh Sarpan. Bahaya Serangan Udara Memindahkan pasukan dari satu tempat ke tempat yang lain apalagi tempat itu jarak jauh, pimpinan pasukan harus mengatur strategi dan perhitungan yang tepat untuk menghadapi kemungkinan bahaya serangan udara. Pernah terjadi konvoi yang bergerak dari front Langkat pesawat mustang Belanda memberondong peluru menjatuhkan bom terhadap konvoi yang sedang yang dialami seorang pejuang bernama Amran Zamzami di Front Barat Medan Area. Peristiwa sejarah ini diangkat penyair nasional L.K.Ara dalam sebuah puisi berjudul : “18 Januari 1947 Suatu Pagi” untaian kata puisi tersebut antara lain sebagai berikut : Pesawat terbang musuh meraung-raung dan mustang itu memberondongkan peluru menjatuhkan bom ke konvoi kendaraan kami kendaraan pun terbakar Ada yang terguling ada yang meledak para syuhada pun gugur ia mati muda peluru mustang menembus dadanya. Letnan Raja Sjahnan telah memperhitungkan bahaya serangan udara terhadap konvoi pasukannya yang berangkat beriringan. Karena itu diambil kebijaksanaan semua kendaraan truk yang ditumpangi anggota pasukan kompinya, harus dikamuflase dengan daun-daun kayu. Kendaraan harus berangkat satu per satu, tidak boleh beriringan. Kalau mendengar ada deru pesawat terbang, harus segera menghindar dari jalan raya mencari tempat yang terlindung sehingga tidak jelas dilihat pesawat. Dengan cara ini yang dilakukan Letnan Raja Sjahnan maka pasukannya selamat sampai di Trepes. Two Rivers Diserang Belanda melancarkan Agresinya pertama 21 Juli 1947. Tanggal 22 Juli 1947 Belanda merebut Pancurbatu dan Bekala. Serangan ini menyebabkan Front Two Rivers yang berada di bawah pimpinan Letnan Raja Sjahnan terancam. Selain harus menghadapi musuh yang datang dari Gedung Johor juga musuh datang dari arah Pancurbatu. Dari jauh telah terdengar suara tank Belanda menderu datang dari arah Bekala yang diiringi pasukan infantri. Pasukan kita melakukan penghadangan dengan tembakan gencar menyebabkan pasukan Belanda tertahan gerakannya selama beberapa jam. Menurut Mayjen (Purn) H.Raja Sjahnan, SH dimana hajatnya menghadapi gerakan Belanda yang hendak merebut Two Rivers cukup berat. Bukan saja karena pasukan yang terbatas, tetapi Belanda mengerahkan kekuatan

yang sedemikian rupa. Mungkin karena Belanda menganggap bahwa di Front Two Rivers itu masih dipertahankan Batalion B Nip Xarim. Begitu berat pertempuran yang dihadapi waktu itu, apalagi bulan puasa dan Raja Sjahnan menyatakan kepada kami untuk berbuka puasa terpaksa minum air parit. Menurut Kolonel (Purn) Arifin Pulungan dalam bukunya “Kisah Dari Pedalaman” setelah pasukan kita bertempur beberapa waktu lamanya pasukan diundurkan ke dekat pengawalan Pasar III. Komandan Front Letnan II Raja Sjahnan memerintahkan melalui telepon lapangan agar pasukannya yang bertahan di Gedung Johor agar segera mengundurkan diri ke arah Kutatuala agar pasukan jangan sampai terkepung oleh Belanda. Setelah mempertahankan Delitua, Pancurbatu pasukan Letda Raja Sjahnan yang terbatas jumlahnya akhirnya pasukan terpaksa ditarik untuk menghindari banyak korban. Emplasmen yang ada di Two Rivers dibumihanguskan agar jangan digunakan Belanda. Akhirnya Pancurbatu dan Two Rivers jatuh ke tangan Belanda. Demikian sekelumit kisah kepemimpinan dan pengalaman Mayjen (Purn) H. Raja Sjahnan, SH di masa perang kemerdekaan. Penulis adalah Veteran Pejuang Kemerdekaan, Wartawan Senior, Pemerhati Sejarah.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Wagubsu: Entaskan kemiskinan perlu dukungan - Kalau cuma cakap saja pun tak guna * Parlindungan Purba: Banyak pengusaha terpuruk - Masih terpuruk, belum tersungkur, he...he...he * Damri akan masukkan bus baru ke KNIA - Bikin malu kalau terus pakai bus tua


D Wak

Ekonomi & Bisnis

WASPADA Kamis, 29 Agustus 2013


Emas Di P.Sidimpuan Naik Rp18.000 P.SIDIMPUAN (Waspada): Harga emas murni (99,99 persen) dan emas London (97,5 persen) di Kota Padangsidimpuan terus bergerak naik. Pada perdagangan Rabu (28/8), harga emas kembali naik sebanyak Rp18.000 per gram, dibanding dengan perdagangan hari sebelumnya. “Warga Tapanuli Bagian Selatan (Tabagsel) biasa membeli emas per 2,5 gram atau satu (1) ameh. Dibanding semalam, harga emas murni dan London naik Rp45 ribu per ameh,” kata Untung, pemilik Toko Emas Elisa di Lantai I Pasar Raya Sangkumpal Bonang. Dijelaskannya, pedagang di Tabagsel mayoritas menjual emas London yang sudah ditempah dalam bentuk gelang, kalung, cincin, dan anting. Tapi ada juga yang menyediakan emas murni 99,99 persen berbentuk padu. Saat ini satu ameh emas London mereka jual Rp1.265.000, atau Rp506.000 per gram. Sedang-

kan jika ada warga yang ingin menjual emasnya, Toko Emas Elisa akan membeli Rp1.215.000 per ameh atau Rp486.000 per gram. Untuk jenis emas murni 99,99 persen, mereka jual Rp1.295.000 per ameh atau Rp518.000 per gram. Untuk pembelian, mereka membandrol satu ameh emas murni dengan harga Rp1.245.000 atau Rp498.000 per gram. Kenaikan harga ini dibenarkan Yani, 23, putri pemilik Toko Emas BL Siregar. Katanya, penjualan emas berbentuk kalung, cincin, gelang, anting, dan lainnya, selalu dikenakan tambahan upah tempah. “Cincin dikenakan upah tempah antara Rp10 ribu sampai Rp50 ribu per ameh. Kalung Rp30100 ribu, dan gelang Rp20-200 ribu. Upah dikenakan berdasarkan model permintaan pembeli, dan tiap toko emas punya harga tempah tersendiri,” jelas Yani.(a27)

Tokio Marine LII Incar Pasar Sumatera MEDAN (Waspada): PT Tokio Marine Life Insurance Indonesia (TMLI) memperkuat eksistensinya di Indonesia dan mengincar pasar asuransi jiwa di wilayah Sumatera dengan meresmikan kantor TMLI di Medan di Gedung Mandiri lantai 6 Jalan Imam Bonjol No 7 Medan, Rabu (28/8). “Medan adalah kota yang menjanjikan bagi pasar asuransi jiwa karena Medan salah satu kota terbesar dengan populasi penduduk 3 juta orang pertahunnya. Peresmian TMLI di Medan merupakan komitmen untuk memberikan pelayanan dan solusi bagi kebutuhan finansial bagi masyarakat Medan,” kata President Director of TMLI David John Beynon didampingi Chief Marketing Officer of TMLI, Soebagia Iman, Rabu (28/8). Peresmian kantor pemasaran di Kota Medan merupakan ketiga setelah Jakarta dan Bali. Selanjutnya, untuk 6 sampai 7 bulan ke depan

akan meresmikan kantor peresmian di beberapa kota di Indonesia di antaranya, Semarang, Surabaya, Bandung dan banyak lagi. Di Indonesia, lanjutnya, ada sekitar 40 asuransi jiwa yang besar, namun bagi Tokio Marine Life Insurance Indonesia, ini bukan kompetisi karena pasar asuransi jiwa sangat luas dengan pertumbuhan penduduk Indonesia signifikan setiap tahunnya. “Dengan begitu, ada delapan kunci sukses untuk meyakinkan nasabah TMLI dibanding industri asuransi lainnya yang meliputi, education funding, wealth accumulation, wealth enhancement, living with impaired health, income replacement, retirement funding, legacy planning dan business continuation,” jelasnya. Ditambahkan, Chief Distribution Officer of Tokio Marine Life Insurance Indonesia, Mr Facrizal Octavianus menjelaskan, dari catatan TMLI hingga semester I 2013 perseroan berhasil membukukan premi sebesar 195 persen. Dimana atas capaian tersebut, secara nasional target premi yang ditetapkan sebesar 92,8 miliar dengan dibarengi perekrutan 2.200 agen dan leader. “Di Medan sendiri, premi asuransi yang ditargetkan hingga akhir tahun berkisar Rp15 miliar. Target ini akan dibarengi dengan perekrutan sejumlah 450 agen dan leadres. Di mana Waspada/Sugiarto nilai premi asuransi minimum Jajaran direksi PT Tokio Marine Life Insurance Indonesia (TMLI) Rp300 ribu dan nilai maksimum meresmikan kantor cabang Medan di Gedung Mandiri lantai 6 Rp5 juta per orang,” ujarnya diJalan Imam Bonjol No 7 Medan, Rabu (28/8) ditandai dengan dampingi Chief Agency Officer of TMLI, Ike Buddi Raya. (m41) pengguntingan pita.

Bank Syariah Permata Resmikan Kancab MEDAN (Waspada): Bank Syariah Permata meresmikan Kantor Cabang (Kancab) di Jalan Palang Merah, Medan, Senin (26/8). Acara dirangkai dengan pemberian santunan dan bingkisan kepada anak yatim piatu. Head Syariah Network Bank Permata Pahala David Panjaitan, mengatakan, pemberian santunan dan bingkisan kepada anak-anak yatim-piatu merupakan wujud kebersamaan dan berbagi kasih kepada mereka. Hadir dalam acara itu ReWaspada/Ist. gion Head 10 Ruslan Tono, Head PERESMIAN: Head Syariah Network Bank Permata Pahala David of Area 1 Delly Arnaz dan Kepala Panjaitan didampingi Kepala Cabang Bank Syariah Permata Cabang Bank Syariah Permata Medan Hamrizal Razali (kanan) menggunting pita tanda peresmian Medan Hamrizal Razali, Ketua Bank Syariah Permata Jalan Palang Merah Medan, Senin (26/8) Umum MUI Medan H Mohd Hatta serta utusan BI Medan. Bank Permata sendiri. Acara diisi dengan penyerahan bingkisan Sedangkan Kancab Bank Syariah Permata dan santunan kepada anak-anak yatim-piatu di Indonesia, sambungnya, ada sebanyak 13 dari Panti Asuhan Aisyiyah Medan. Pahala David Kancab. Pada tahun 2014 nanti bakal menjadi Panjaitan, menyebutkan bahwa kehadiran 20 Kancab. “Saya yakin, berkat kerjasama yang Kancab Bank Syariah Permata merupakan wujud baik dengan seluruh nasabah Bank Syariah dan komitmen manajemen Permata Bank yang Permata dengan manajemen, maka kehadiran bertujuan untuk memberikan pelayanan yang Bank Syariah Permata yang sangat diharapkan baik kepada nasabah. Bukan saja kepada nasabah masyarakat akan lebih berkembang dan maju Bank Syariah Mandiri, tetapi juga kepada nasabah pesat,” kata Pahala Panjaitan. (rel)

Pelindo I Peroleh Dua Penghargaan MEDAN (Waspada): PT Pelabuhan Indonesia I (Persero) I memperoleh dua penghargaan kategori Strategic dan Tactical. Penghargaan diterima Direktur Utama Pelindo I Bambang Eka Cahyana pada acara BUMN Marketing Day 2013 di Jakarta, Selasa (27/8). Humas Pelindo I M. Eriansyah, menjelaskan, penyelenggaraan BUMN Marketing Day 2013 ini merupakan yang kedua kalinya setelah 2012. Pada tahun ini pelaksanaannya bertemakan Marketing For Innovation Reality Check For BUMN dengan tiga agenda yaitu Awarding, Sharing dan Exhibition. Eriansyah, menambahkan awarding dalam bentuk BUMN Marketing Award 2013 ini merupakan apresiasi yang akuntabel dan kredibel bagi BUMN dan Marketer BUMN yang telah mengembangkan marketing dan inovasi marketing sebagai faktor dominan dalam proses

transformasi. Pelindo I memperoleh penghargaan karena berhasil melakukan pencapaian positif dan terobosan dalam hal pelayanan kepada pengguna jasa. Di Belawan International Container Terminal (BICT) Kinerja Turn Round Time (TRT) atau Total Waktu Kapal di Pelabuhan kondisi sebelumnya per kapal dapat mencapai 7-8 hari dengan produktivitas bongkar muat berkisar 18 box/crane/ hour (B/C/H), sekarang hanya menjadi 1,5 - 2 hari saja, dan dengan produktivitas bongkar muat menjadi berkisar 25 box/crane/hour (B/C/H). BUMN Marketing Award 2013’diikuti 44 perusahaan BUMN. Melalui seleksi berkas dan kuesioner, terpilih 20 BUMN untuk memperesentasikan konsep, strategi dan kiat marketing, yang terbagi dalam kategori Strategic dan Tactical. (m35)

Waspada/Sori Parlah Harahap

SURYADI, 39, pemilik industri tahu dan tempe di Desa Siunggam, Kecamatan Padang Bolak, Kabupaten Padanglawas Utara (Paluta) beberapa hari terakhir mengeluh akibat naiknya harga kedelai.

Pemerintah Pastikan Tidak Akan Terjadi PHK JAKARTA (Waspada): Pemerintah memastikan tidak akan terjadi Pemutusan Hubungan Kerja (PHK) hingga satu tahun ke depan. Pemerintah berjanji akan memberikan berbagai insentif jangka pendek untuk mengatasi terjadinya PHK tersebut. Menteri Perindustrian (Menperin) MS Hidayat, mengatakan itu dalam konferensi pers tentang Paket Kebijakan Insentif Fiskal dalam Rangka Memberikan Stimulus Pertumbuhan Ekonomi di Direktorat Jenderal Pajak Jakarta, Rabu (28/8). MS Hidayat, menjelaskan, pemerintah berusaha mencegah PHK dengan memberi-

kan insentif jangka pendek. Yakni berupa pengurangan PPh 25 persen (PPh pasal 25) bagi wajib pajak tidak berorientasi ekspor dan pengurangan pajak sebesar 50 persen bagi wajib pajak berorientasi ekspor pada masa pajak Agustus 2013. Juga, katanya pemerintah memberikan keringanan pembayaran PPh pasal 29 tahun 2013 paling lama tiga bulan dari

optimis mampu mencapai target tersebut, walaupun saat ini sedang terjadi berbagai faktor ekonomi, seperti pelemahan nilai tukar rupiah maupun inflasi,” jelasnya. Saat ini, tuturnya, pasar kendaraan jenis MPV Medium masih didominasi Toyota Kijang Innova dengan market share mencapai 70 persen. Selain pasar domestik, TAM juga menargetkan mampu mengekspor 40.000 unit Innova ke berbagai negara di kawasan Asia Tenggara, Timur Tengah dan Afrika. Dimas, mengatakan, sejak diluncurkan pertama kali September tahun 2004, penjualan Innova hingga Juli 2013 telah

mencapai 492.369 unit. ‘’Tapi kalau dilihat sejak Toyota Kijang diluncurkan pertama kali tahun 1977, maka angka penjualannya sudah mencapai 1.558.256 unit hingga Juli 2013,” jelasnya. Sementara Kacab Auto 2000 Medan Aplas Martogi Siahaan, menyatakan bahwa tingginya nilai dolar terhadap rupiah tidak akan mempengaruhi harga New Toyota Kijang yang baru dikeluarkan dalam tiga bulan ke depan. Sedangkan adanya kenaikan sebesar 4,6 persen s/d 4,7 persen, lanjut Martogi, adalah kenaikan harga dikarenakan adanya penambahan fitur didalam varian tersebut khusus-

tax allowance untuk insentif investasi melalui perluasan cakupan bidang usaha dan penyederhanaan prosedur. “Kami mengusulkan tambahan cakupan jenis-jenis atau bidang usaha baru industri (KBLI) dan persyaratan untuk mendapatkan tax allowance,” katanya. Menurut Hidayat, insentif PPh akan diberikan kepada lima sektor industri padat karya. Yakni industri tekstil, pakaian jadi, alas kaki, funitur dan mainan anak-anak. Katanya, ada 1.000 lebih perusahaan yang mendapatkan insentif tersebut. Dengan kebijakan tersebut,

diyakini arus kas (cashflow) perusahaan akan terjaga hingga Juni 2014 atau batas akhir pembayaran utang pajak. “Mereka akan dapat cahsflow-nya hingga Juni dengan fasilitas ini. Kita upayakan sesuai untuk yang ekspor fifty-fifty,” katanya. Namun, menurut dia, Kementerian Perindustrian belum merumuskan sistem pengawasan dan sanksi bagi perusahaan yang tidak memenuhi komitmennya terkait fasilitas tersebut dan tidak melakukan PHK. “Anda tahu, kebijakan ini kita ciptakan dalam keadaan darurat. Jadi saya belum memikirkan sanksinya,” katanya. (ant)

Gubsu Telah Tandatangani SK Kenaikan Tarif Air Sosialisasi Dengan Komisi C Di Parapat MEDAN (Waspada): Gubernur Sumatera Utara Gatot Pujo Nugroho, ternyata telah menandatangani Surat Keputusan (SK) tentang kenaikan tarif air minum dan retribusi air limbah. Yakni pada tanggal 3 Juni 2013. Hal ini terbilang aneh, karena Fraksi Partai Keadilan Sejahtera (FPKS) DPRD Sumut mengaku tidak mengetahuinya. Pernyataan tentang SK tarif air minum itu, disebutkan Sekretaris Daerah Provinsi Sumatera Utara (Sekdaprovsu) Nurdin Lubis, pada rapat paripurna DPRD Sumut, Senin (26/8) lalu. Dihadapan anggota dewan, Sekda Nurdin Lubis, membacakan nota jawaban Gubsu atas pemandangan umum anggota dewan atas nama fraksi-fraksi terhadap Ranperda tentang Pertanggungjawaban Pelaksanaan APBD Tahun 2012. Pada rapat paripurna sebelumnya, FPKS DPRD Sumut saat menyampaikan pandangan umumnya mengaku tidak mengetahui telah terjadi kenaikan tarif air minum PDAM Tirtanadi. Karenanya, mereka meminta Gubsu Gatot Pujo Nugroho, menjelaskan tentang kebenaran telah mengeluarkan SK tentang hal itu. Juru bicara FPKS DPRD Sumut Taufik Hidayat, selanjut-

nya juga meminta kepada PDAM Tirtanadi untuk mensimulasikan terlebih dahulu besaran kenaikan tarif air minum tersebut secara ril. Dengan begitu baru dapat diketahui berapa persen sebenarnya kenaikan tarif air tersebut dibayar konsumen. Berdasarakan praktek kenaikan tarif air sebelumnya, konsumen membayar jauh di atas presentase kenaikan tarif tarif yang diumumkan. ‘’Karenanya penting sekali dilakukan simulasi kenaikan air tersebut. Carannya dengan menggunakan data pembayaran konsumen dalam satu bulan sebelum tarif naik, dan selisih yang akan dibayar dengan menggunakan tarif yang baru,’’ kata Taufik Hidayat. Di samping itu, katanya, FPKS mencatat bahwa pemberlakuan tarif secara progresif pada prakteknya hanya akan membebani konsumen. Karena pencatatan petugas selalu membuat data pemakaian lebih kecil dari sebenarnya dalam beberapa bulan. Sementara kekurangan tersebut akan diakumulasikan pada bulan tertentu. Sehingga pemakaian menjadi membengkak dan harus dibayar pada tarif progresif yang paling mahal. Praktek seperti ini, kata Tau-

TAM Optimis Capai Target MEDAN (Waspada): Meski nilai rupiah mengalami penurunan, namun PT Toyota Astra Motor (TAM) optimis dapat mencapai target penjualan MPV Medium Toyota Kijang Inova seperti tahun sebelumnya. Hal itu diungkapkan Head of Media Relation, Public Relation Department PT TAM Dimas Ibrahim Saleh Aska, disela acara peluncuran New Toyota Kijang Inova di Santika Hotel, Medan, Selasa (27/6). Dimas Ibrahim, mengatakan pihaknya menargetkan penjualan antara 70.00072.000 unit Kijang Innova hingga akhir tahun 2013. Pihaknya

saat terutangnya serta penghapusan sanksi administrasi atas penundaan pembayaran PPh Pasal 29 tersebut. Kementerian Perindustrian, jelas Hidayat, akan mendata pelaku industri dan menerbitkan peraturan menteri mengenai daftar perusahaan yang akan mendapat fasilitas tersebut. Selain itu, pemerintah akan memberikan relaksasi pembatasan fasilitas di Kawasan Berikat (KB) dengan memperbolehkan penjualan 50 persen produksinya ke pasar dalam negeri. Selain itu, pemerintah juga akan memberikan insentif jangka panjang melalui revitalisasi


Para kepala cabang Auto 2000 di Medan foto bersama dengan New Toyota Kijang Inova di Santika Hotel, Selasa (26/8). nya yang berkaitan dengan fitur keselamatan serta perubahan beberapa bagian. “Seperti halnya bagian eksterior New Kijang Inova hadir dengan desain yang lebih advance, prestigious, dan kesan

emosional yang lebih tegas. Perubahan bagian eksterior di antarnaya new shield shape radiator grile, new foglamp ornament, back door garnish with reflector dan new aerokit,” ujarnya. (m38)

fik, sangat banyak terjadi di lapangan. Sedangkan PDAM Tirtanadi menutup mata atas realita ini. Tirtanadi, sampai saat ini juga tidak memiliki mekanisme untuk menerima komplain konsumen. Juga tidak ada mekanisme solusi atas kerugian yang diderita konsumen. Mekanisme klarifikasi Anggota dewan dari FPKS juga mengaku banyak menemukan realitas di masyarakat dari tarif air konsumen berubah dari golongan tarif (RT) yang satu ke RT yang lebih tinggi. Perubahan itu terjadi tanpa pemberitahuan kepada kon-sumen. PDAM Tirtanadi juga tidak memiliki mekanisme klarifikasi atas laporan perubahan golongan tarif tersebut yang disampaikan petugas di lapangan. Kata Taufik Hidayat, informasi yang diterima pihaknya bahwa ternyata petugas yang memberi informasi perubahan itu justru mendapatkan insentif atas informasi perubahan yang disampaikannya tanpa jelas kebenaran informasinya. Namun, jika konsumen merasa keberatan atas perubahan golongan tarif tersebut, justru konsumen diminta membuat laporan kebenaran dengan dikenakan bayaran. Membacakan jabawan Gubsu Gatot Pujo Nugroho, Sekda Nurdin Lubis menjawab berbagai hal yang dipertanyakan FPKS. Termasuk tentang sosialisasi yang menurut dewan tidak pernah dilakukan. Disebutkan bahwa banding bayar tarif air minum PDAM Tirtanadi telah disosialisasikan kepada pelanggan di 21 kecaman dengan 34 lokasi kegiatan. Pelaksanaan sosialisasi dilakukan selama dua bulan sebelum diberlakukan secara efektif untuk rekening bulan Agustus 2013. Saat ditanya Waspada, Sekdaprovsu Nurdin Lubis, juga mengaku bahwa PDAM sudah melakukan sosialisasi kepada banyak pihak. Termasuk sosialisasi kepada DPRD Sumut. “Sosialisasi kepada dewan sudah kita lakukan kepada Komisi C di Parapat, beberapa waktu lalu,’’ katanya. (m12)

Jaringan XL di Bali Siap Dukung APEC PT XL Axiata Tbk (XL) telah menyiapkan jaringan telekomunikasi seluler yang memadai untuk ikut mendukung penyelenggaraan Asia-Pacific Economic Cooperation (APEC) di Bali, 1-8 Oktober 2013. Berbagai persiapan telah dilakukan, mulai dari kawasan Nusa Dua menjadi lokasi pertemuan tingkat tinggi para pemimpin negara-negara Asia Pasifik itu, Bandara Internasional Ngurah Rai, juga di hotel-hotel menjadi lokasi menginap para peserta pertemuan. Vice President (VP) East Region XL – Titus Dondi (foto) mengatakan, berbagai persiapan telah kami lakukan sejak jauh-jauh hari. Kami memperkirakan, para peserta akan membutuhkan layanan telekomunikasi yang bagus, termasuk akses internet dan layanan data. Karena itu kami berharap bisa memberikan dukungan kualitas jaringan maksimal mengingat pentingnya acara ini, lebih-lebih mengingat Bali dan Indonesia sebagai tuan rumah. Titus menambahkan, khusus di area Nusa Dua akan digunakan untuk APEC seluruh site sudah dimodernisasi. Untuk kawasan Nusa Dua ini, XL juga melakukan antara lain penambahan coverage, terutama di beberapa hotel baru akan digunakan untuk APEC. Saat ini, jaringan XL di area Nusa Dua sudah full 3G dengan kapasitas cukup besar. Jumlah BTS di area Nusa Dua terdiri dari 45 BTS 2G dan 51 BTS 3G, sekaligus menunjukkan keseriusan XL melayani komunikasi Data. Hingga saat ini, petugas XL juga akan terus memastikan kualitas jaringan terutama di lokasi-lokasi menjadi tempat kesibukan terkait penyelenggaraan acara APEC. Selain menambah coverage di hotel-hotel baru yang digunakan untuk APEC, XL juga menambah kapasitas jaringan 2G dan 3G yang sudah ada, serta menambah kapasitas transmisi di area Nusa Dua. Dari kapasitas jaringan XL di Bali yang saat ini tersedia, sudah cukup besar dan masih akan mampu menampung jika terjadi lonjakan traffik selama ajang internasional ini berlangsung. Jaringan XL di Bali telah menjangkau seluruh kecamatan yang ada. Sementara untuk layanan 3G, sudah meng-cover seluruh kabupaten/kota. Proses modernisasi jaringan XL di Bali dimulai tahun 2011 sehingga hampir semua BTS XL sudah menggunakan teknologi terbaru yang Go Green.



150-an Honorer K1 Simeulue Datangi DPRK

53 Personil SAR Pijay Ikut Pendidikan Dasar BANDAACEH(Waspada);Sebanyak 53 orang personil SAR Pidie Jaya memperoleh materi pendidikan dasar penanganan terhadap korban kecelakaan dan kesehatan. Selain materi penyelamatan di air (water rescua) peserta juga dibekali materi medical firshresponder (MRF) masalah penanganan kesehatan. “Kami berharap nantinya petugas SAR khususnya Pidie Jaya, tidak lagi canggung atau panik ketika berhadapan dengan korban di lapangan. Dalam kegiatan ini mereka juga kita beri teori pelatihan menyelam,”kata T Akbarruddin, SH panitia pelaksana kepada Waspada, Rabu (28/8). Menurutnya, seluruh pemateri berasal dari Basarnas Provinsi Aceh yang berjumlah 5 orang. Mereka merupakan pemateri yang memiliki keahlian masing-masing. “Kegiatan ini kami jadwalkan 3 hari. Selain diruangan, juga ada praktek langsung yang lokasinya diseputaran pantai Trienggadeng, Sungai Meureudue. Dilaut seperti cara evakuasi korban menggunakan perahu dayung maupun spead boat,”kata Akbar. (cb06)

SIMEULUE (Waspada): 150-an Honorer daerah di Pemerintahan Kabupaten Simeulue yang masuk dalam kategori satu (K1) untuk diangkat menjadi Calon Pegawai Negeri Sipil Daerah (CPNSD), Rabu (28/8) mendatangi gedung DPRK setempat. Dalam kunjungan yang tergabung dalam Forum Tenaga Honorer K1 (FTHK1) yang diketuai AbdulWahab menanyakan kejelasan status mereka yang sampai saat ini belum jelas untuk diangkat menjadi CPNS. Sementara sudah dijanjikan oleh Pemerintah Kabupaten Simeulue sejak 2010. Dalam audiensi ke gedung DPRK Simeulue FTHK1 mengajukan beberapa tuntutan inti. Tuntutan utama, tenaga honorer yang sudah sebelumnya masuk dalam FTHK1 agar segera diangkat menjadi CPNSD sesuai PP Nomor 48/ 2005 Jo, PP Nomor 43/2007 dan surat edaran Menpan RB Nomor 05 Tahun 2010. Tuntutan kedua para honorer FTHK1 untuk yang sudah masuk dalam kategori 1 supaya tidak

Panwaslu Kabupaten Harus Perkuat Kapasitas TAKENGEN (Waspada) Panwaslu Aceh Tengah diminta untuk memperkuat kapasitas jajaran oleh Bupati Aceh Tengah, Ir H Nasaruddin, MM sebagai pihak yang memiliki peran utama dalam mengawal kesuksesan pemilihan umum di tingkat Kabupaten. “ Pemilu yang baik akan sangat ditentukan dengan kuatnya kapasitas Panwaslu “, kata Nasaruddin pada saat beraudiensi, Selasa (27/8) di Kantor Bupati setempat. Kapasitas yang dimaksud Nasaruddin dimulai dari kejelian Panwaslu Kabupaten dalam memilih Panwaslu di tingkat kecamatan hingga ke tingkat kampung.” tolong cari yang punya idealisme tinggi dan jangan berorientasi politik “, tegasnya. Panwaslu diharapkan oleh Nasaruddin agar bisa menjalankan tugas sesuai dengan ketentuan dan tegas dalam menindak pelanggaran Pemilu yang terjadi. Ketua Panwaslu Aceh Tengah, Maryeni mengakui pihaknya akan berupaya optimal untuk merekrut Panwaslu di tingkat bawah yang berkualitas, walaupun waktu untuk itu relatif singkat. “ Sangat sulit mengetahui rekam jejak tenaga Panwaslu yang akan dipilih dalam waktu singkat, namun kami akan berusaha yang terbaik “, katanya. Menurut Maryeni setiap berlangsungnya tahapan pemilu selalu saja dihadapkan pada persoalan waktu akibat telatnya pelantikan anggota Panwaslu, sehingga diperlukan langkahlangkah cepat untuk menyesuaikan dengan tahapan Pemilu yang akan dilaksanakan.(b32)

Galian Pertama SKSO Backbone Bireuen-Kabanjahe BANDA ACEH (Waspada): Telkom Group meresmikan penggalian pertama pembangunan SKSO (Sistem Komunikasi Kabel Optik) Backbone jalur Bireuen (Aceh)-Kabanjahe (Sumatera Utara) dan on air 3369 Node B Telkomsel, Rabu (28/8) di Meuligo Gubernur, Banda Aceh. Jaringan Fiber Optic (FO) sepanjang 550 kilometer di jalur tengah Aceh yang menghubungkan Kabupaten Biruen, Bener Meriah, Aceh Tengah, Gayo Lues dan Aceh Tenggara tembus ke Kabanjahe, Kabupaten Karo, Sumatera Utara. Penggelaran FO di jalur tengah Aceh merupakan program nasional dalam kerangka besar Indonesia Digital Network (IDN) dalam mendukung MP3EI. Diharapkan dapat menjawab kebutuhan akses telekomunikasi yang lebih besar,” kata Rizkan Chandra. Direktur Network IT Solution (NITS) Telkom ini mengatakan, proyek fiber optik di jalur tengah Aceh diharapkan dapat mendorong tersedianya berbagai layanan telekomunikasi, informasi dan komunikasi) yang dapat memenuhi harapan masyarakat di dataran tinggi Gayo-Alas itu. “Pemerintah Aceh sangat mendorong agar perusahaan penyedia layanan teknologi informasi untuk terus meningkatkan kualitas layanannya di seluruh Aceh,” ujar Gubernur Zaini Abdullah pada persemian pertama penggalian FO dan on air 3369 Node B Telkomsel itu. Pihaknya bersyukur Telkomsel telah memperluas jaringan mereka hingga kawasan pedalaman Aceh. “Hadirnya teknologi ini, diharapkan kualitas komunikasi yang menggunakan jaringan Telkomsel akan semakin canggih,” tandasnya. Gubernur Aceh Zaini Abdullah mengingatkan kecanggihan teknologi komunikasi ini jangan sampai digunakan untuk halhal yang negatif. “Pemanfaatannya harus diarahkan dengan baik agar mampu mendorong kita lebih sadar tentang makna kehidupan ini,” paparnya. (b06)

KUA-PPAS Perubahan Ditandatangani BANDAACEH (Waspada): Pemerintah Kota (Pemko) Banda Aceh dan DPRK melakukan penandatangan nota kesepakatan Rancangan Kebijakan Umum Anggaran (KUA) dan Rancangan Prioritas Plafon Anggaran Sementara (PPAS) Perubahan APBK Banda Aceh Tahun 2013. Nota kesepakatan KUA-PPAS Perubahan APBK Banda Aceh tahun 2013, itu ditandatangani oleh walikota Banda Aceh Mawardy Nurdin dan dua wakil ketua DPRK Banda Aceh yaitu Razali dan Edi Aryansyah, dalam sidang paripurna DPRK Banda Aceh, Selasa (27/8). Wakil Ketua DPRK Banda Aceh Razali usai menandatangani kesepakatan, itu mengatakan KUA-PPAS ini merupakan dokumen yang menjadi pedoman dan acuan anggaran bagi dinasdinas atau badan, kantor dan bagian-bagian serta kecamatankecamatan yang berada di lingkungan Pemko Banda Aceh. Sebelumnya,Wali Kota Banda Aceh Mawardy Nurdin pada (19/8), mengajukan rancangan KUA dan PPAS Perubahan APBK Banda Aceh tahun 2013, dengan target Pendapatan Daerah sebesar Rp 948.919.903.116 meningkat (6,29 persen) dari sebelumnya Rp.892.785.194.394,Peningkatan tersebut,kata walikota, bersumber dari PAD sebesar Rp 6.377.767.158,- dan dari lain-lain pendapatan daerah yang sah sebesar Rp 49.756.941.564,- (b02)

Pengaspalan Jalan Tersendat, Warga Hirup Debu MEUREUDU (Waspada) : Proyek pembangunan jalan di Kemukiman Beuracan, Kecamatan Meureudu, Kabupaten Pidie Jaya, hingga saat ini belum kunjung diaspal. Warga setempat protes karena setiap hari menghirup debu, bahkan di musim penghujan harus berenang di genangan air yang memenuhi lubang besar dan kecil di badan jalan. Beberapa tokoh masyarakat setempat, Selasa (27/8) mengatakan, sejak dikerjakan kontraktor hingga saat ini kondisi jalan dipenuhi debu dan karena belum kunjung diaspal. Ironisnya, pelaksanaan pengaspalan yang dikerjakan pada tahun anggaran 2011 terputus, sebagian sudah diaspal, itu pun dilakukan tidak menyambung di titik-titik tertentu. Kepala Mukim Beuracan Hasballah mengaku tidak banyak tahu terhadap pekerjaan yang belum diselesaikan itu. Yang jelas saat ini warga terpaksa menghirup debu dan bermain air di musim hujan. “Kami berharap Pemkab Pidie Jaya serius mengawasi dan menindaklanjuti pekerjaan pembangunan,” ujar Mukim. Ketua Komisi D DPRK Pidie Jaya Mumfizar Zakarya mengatakan, belum dikerjakan pembangunan kedua poros jalan tersebut akibat molornya tender dilakukan Dinas PU setempat. Kadis PU Pidie Jaya Hanief Ibrahim mengatakan, kedua proyek jalan itu sudah selesai dilaksanakan tender pekan lalu lalu. Sekarang dalam proses pembuatan kontrak dan Agustus ini juga proyek jalan itu mulai dikerjakan. (b09)

WASPADA Kamis 29 Agustus 2013

Waspada/Muhammad Riza

BEBERAPA petani di Desa Cot Paleu, Kecamatan Simpang Tiga, Kabupaten Pidie sedang memotong tanaman padi yang terserang fuso pada musim gadu tahun ini, Rabu (28/8).

Pidie Kering, 2.423 Ha Sawah Gagal Panen SIGLI (Waspada): Dari total 13.000, Ha sawah. Seluas, 2.423 Ha, di antaranya mengalami kekeringan pada Musim Tanam (MT) gadu April/September 2013, di Kabupaten Pidie. Akibatnya, produksi gabah tahun ini gagal panen. Data yang diperoleh Waspada dari Dinas Peretanian dan Peternakan (Distannak), Pidie, Rabu (28/8), daerah paling luas mengalami kekeringan, Kecamatan Simpang Tiga, mencapai 33 Ha. Disusul Kecamatan KembangTanjong, seluas lima Ha dan delapan kecamatan lainnya. “ Ada 12 kecamatan dalam Kabupaten Pidie yang mengalami kekeringan. Paling besar terjadi di Kecamatan Simpang Tiga” kata Sekretaris Distannak, Pidie Ir Fakhriddin, H. Disebutkan, dampak dari kekeringan yang disebabkan kemarau panjang terjadi selama ini, telah menyebabkan fuso seluas 47 Ha, rusak ringan seluas 1.324 Ha, rusak sedang 425 Ha dan rusak berat seluas 212 Ha. Menurut Fakhruddin, ekses lain yang disebabkan gagal panen pada MT gadu tahun ini, telah menyebabkan para petani di daerah itu merugi. Biasanya kata dia, dalam satu hektar sawah,para petani bisa menda-

patkan hasil produksi sebanyak empat ton, namun sekarang hanya bisa didapat sekira satu ton. Sebenarnya, untuk mengatasi persoalan kekeringan pada MT gadu April/September, 2013, Distannak Pidie merekomdasi seluas 9.000 Ha sawah yang dapat ditanami, dari jumlah luas total sawah keseluruhan di Pidie 29.391 Ha. Tetapi masyarakat di daerah itu menanam seluas 13.000, akibatnya sulit memperoleh air, apalagi hampir sepanjang tahun ini daerah tersebut didera musim kemarau panjuang. “ Tetapi namanya masyarakat tetap saja menanam, karena mereka memiliki keyakinan sendiri memanfaatkan peluang yang ada. Dan kita tidak bisa melarang, terlebih kita harus mendukung program pemerintah dalam peningkatan hasil gabah” jelas Ir Fakhruddin. Junaidi, 38, Geuchik (Kepala Desa) Cot Paleu, Kecamatan Simpang Tiga, ditemui Waspada, Rabu (28/8), mengungkapkan akibat musim kering yang terjadi sepanjang 2013, telah menyebabkan seluas 42 Ha sawah di di desa itu saja mengalami kekeringan yang berdampak pada gagal panen. Kekeringan itu, ungkap Junaidi, selain disebabkan musim kemarau, juga dikarenakan pembangian air keareal persawahannya yang bersumber di

Pintu Air (irigasi-red) Rambayan, Kecamatan Mutiara tidak adil. Para petani di Desa Cot Paleu dan sekitarnya hanya memperoleh jatah air, satu kali dalam satu minggu, dan itupun tersendat-sendat akibat saluran air tersier yang menghubungkan kawasan persawahan di desa dipimpinnya itu tidak bagus. Padahal ungkap Junaidi, Pemkab Pidie pada masa bupati Pidie dijabat Mirza Ismail danWabup Nazir Adam, pernah berjani pada 2012, persoalan air dapat teratasi dengan dibangunnya saluran air diseluruh areal persawahan di daerah itu. “ Namun nyatanya sampai sekarang persoalan air masih saja terjadi” timpalnya. Untuk mengatasi terjadinya kelangkaan air diareal persawahaan pada musim kemarau, Junaidi bersama masyarakat lainnya mengusulkan kepada Pemkab Pidie dan Pemrov Aceh, supaya dapat membangun sumber air berupa penggalian sumur boor pada setiap areal persawahan warga, seraya terus memperbaiki atau membangun saluran air yang baik guna mengatasi kelangkaan air pada musim tanam. “ Mudah-mudahan keluhan kami ini bisa dipertimbangkan dan direalisasikan oleh pemerintah” demikian Junaidi, Keuchik Cot Paleu, Kecamatan Simpang Tiga. (b10)

200 Juta Orang Per Tahun Tewas Karena Narkoba BANDA ACEH (Waspada): Berdasarkan data yang diterbitkan UNODC, organisasi yang menangani masalah narkoba dan kriminal dunia, diperkirakan ada 300 juta orang pertahun didunia yang mengkonsumsi berbagai jenis narkoba. “Menurut World Drug Report 2012, sekitar 200 juta orang diantaranya meninggal dunia tiap tahun akibat mengkonsumsi narkoba itu,” ungkap Saidan Nafi, Kepala Badan Narkotika Nasional Provinsi (BNNP) Aceh, Rabu (28/8) di Banda Aceh. Pada acara advokasi Pencegahan, Pemberantasan, Penyalahgunaan dan Peredaran Gelap narkoba (P4GN) untuk pemerintah kabupaten/kota di Aceh, Saidan menyebutkan orangorang yang terlibat penyalahgunaan narkoba itu merupakan usia produktif antara 15 hingga

64 tahun. “Untuk Aceh berdasarkan data yang ada, saat ini berada pada peringkat delapan nasional dalam kasus peredaran narkoba. Jika dibandingkan dengan jumlah penduduk Aceh sekitar 5,2 juta jiwa, maka peringkat ini sudah pada tingkat meresahkan,” tandasnya. Begitupun, Saidan tidak yakin dengan hasil survey yang menyebutkan Aceh peringkat delapan itu. “Melihat kondisi sekarang ini, mungkin Aceh berada pada peringkat empat nasional,” sebutnya dengan alasan karena narkoba sekarang sudah masuk pelosok gampong. Bukti, katanya, hampir seluruh lembaga pemasyarakatan (Lapas) yang ada di Aceh 52 persen diataranya tersangkut kasus narkoba. “Malah ada lapas yang lebih jumlahnya, seperti Lapas Pidie 82 persen penghuninya

merupakan narapidana narkoba,” tuturnya. Pada sisi lain, tambahnya, narkoba juga sudah merasuk mahasiswa diberbagai perguruan tinggi di Aceh. “Dari 10 perguruan tinggi di Banda Aceh yang dites urine mahasiswanya, delapan perguruan tinggi positif mahasiswanya terkait narkoba,” ungkap Saidan. Terkait rehabilitasi pecandu, sebut Saidan, dari 5,2 juta orang di Indonesia positif narkoba hanya 18 ribu orang yang direhabilitasi. Untuk Aceh hanya dapat ditampung 10 orang di BNNP Aceh, 10 orang diruang NAFZA dan panti rehab Rumoh Geutanyo 10 orang. Kegiatan advokasi P4GN untuk kalangan pemerintahan itu diikuti 46 peserta dari Kesbangpol Linmas kabupaten/ kota se- Aceh. (b06)

Populasi Harimau ‘Menciut’ Di Gayo REDELONG (Waspada): Satu dari sejumlah hewan langka yang mendiami belantara hutan di Bener Meriah dan Aceh Tengah yaitu harimau, populasinya mulai menurun. Diprediksi‘sisa’ jenis hewan buas tersebut tidak lebih dari 80 ekor yang bertahan hidup di alam liar. “Kami duga saat ini, harimau yang bertahan hidup tinggal sedikit bila dibanding beberapa tahun lalu. Salah satu penyebabnya akibat meningkatnya pembukaan lahan baru di lokasi hutan,” jelas Abrar Syarif, Ketua LSM Green Hill, kepada wartawan, kemarin di Gayo. Dikatakan, akibat menciutnya hutan sebagai tempat berbiak hewan, menyebabkan sejumlah satwa langka melakukan migrasi. Harimau termasuk salah satunya. Namun dalam proses mencari tempat bernaung lebih baik, ada di antaranya mati terbunuh, dibunuh atau diburu.

“Di sebagian kasus, saat melintasi jalur migrasinya, harimau kerap terjerat perangkap babi di hutan yang telah diolah petani jadi lahan baru. Kemudian, satwa langka tersebut mati di tempat. Kejadian seperti ini pernah terjadi beberapa waktu lalu di hutan Bener Meriah,” jelasnya. Lainnya, tambah Abrar, mirisnya lagi ada sebagian orang yang tak bertanggungjawab dengan sengaja memburunya untuk selanjutnya memperjualbelikan kulit dan bagian tertentu yang dianggap berharga. Hal itu merupakan jadi pemicu terparah kepunahan harimau, di tengah berbagai upaya pelestarian dan perlindungan yang dilakukan pihak berkompeten. “Kami taksir jumlah harimau yang tersisa di hutan Bener Meriah hanya 45 ekor, sementara di belantara Aceh Tengah, tidak lebih dari 35 ekor. Jumlah tersebut, sungguh sangat meng-

khawatirkan untuk keberlangsungan spesies ini,” imbuhnya, sembari menambahkan hewan langka lainnya yang perlu mendapat perhatian serius, di antaranya gajah, badak, orang-utan, burung murai dan be-ruang madu. Saidi, seorang personil Pulhut Kementerian Kehutanan dari BKSDA yang bertugas di resort Bener Meriah dan Aceh Tengah menjawab wartawan menyebutkan, beragam persoalan tersebut termasuk masalah hutan sulit diatasi karena masih minimnya petugas di lapangan. “Hanya ada 4 personil BKSDA di sini. Sementara wilayah pantau kami cukup luas, Bener Meriah hingga Aceh Tengah. Dari itu, upaya yang bisa kami lakukan selain mengadakan sosialisasi, juga berpatroli guna memperkecil kemungkinan rusaknya hutan maupun flora dan fauna yang ada di dalamnya,” paparnya. (cb09)

ikut test lagi karena hal itu sudah tidak masuk lagi kategori pemutihan. Kemudian mereka juga menuntut sebelum ada kejelasan status FTHK1 Simeulue agar tidak ada test bagi honorer kategori 2. Pada dialog di mana lembaga DPRK sempat diancam para honorer akan diduduki bila pihak DPRK tidak memberikan jawaban konkrit alhasil membuahkan. Ketua DPRK Simeulue Aryaudin menjanjikan para honorer untuk mendampingi pengurusan hingga ke Kementerian Pemerintah dan Aparatur Negara (Kemen-PAN) bersama dengan Rahmad dan juga Khani serta sejumlah anggota DPRK Simeulue lainnya. Lebih jauh Ketua Ariaudin juga menjanjikan akan mengajak Kepala Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Amran Z dan juga Asisten 1 Setdakab Simeulue Kusmayadi. Kemudian Ariaudin juga berupaya menyertakan Bupati dan Wakil Bupati Simeulue untuk melakukan follow-up ke Jakarta. (cb08)

Testing CPNS Belum Jelas Di Aceh Tamiang KUALASIMPANG (Waspada) : Testing seleksi penerimaan Calon Pegawai Negeri Sipil (CPNS) untuk formasi K-2 (tenaga honorer) dan formasi umum belum jelas pelaksanaannya di Kabupaten Aceh Tamiang. Hal itu dikatakan Ka. Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Aceh Tamiang Ahmad As’adi, kemarin, terkait kian santernya disebut-sebut Pemkab Aceh Tamiang akan menerima CPNS yang direkrut dari tenaga honorer K-2 dan formasi umum pada 2013. Ahmad menerangkan, memang benar ada ratusan tenaga honorer formasi K-2 yang akan direktrut menjadi CPNS melalui jalur testing dan begitu juga ada penerimaan CPNS formasi umum sebanyak 30 orang yang direkrut melalui jalur seleksi testing penerimaan CPNS.

“Hanya saja jadwal pelaksanaan testingnya sampai saat ini belum jelas karena pihak Pemkab Aceh Tamiang belum menerima surat edaran dari MenPAN dan BR. Ka.BKPP Aceh Tamiang itu juga menjelaskan, peserta testing K-2 adalah peserta yang tidak lulus K-1, namun memenuhi persyaratan administrasi untuk ikut testing K-2 ditambah dengan peserta K-2 memenuhi syarat untuk mengikuti testing K-2. “Kita belum mengetahui berapa orang yang bakal diterima nanti sebagai CPNS dari formasi K-2,” ujar Ahmad. Sedangkan untuk formasi umum, lanjut Ahmad, jumlah yang akan diterima sebanyak 30 orang yang semuanya untuk formasi guru kelas SD, SMA/SMK,sedangkan untuk SMP memang tidak ada formasinya yang diterima. (b23)

Unsyiah Luluskan 179 Wisudawan Berpredikat Cumlaude BANDA ACEH (Waspada): Universitas Syiah Kuala kembali melepas para lulusannya dalam dua hari terakhir sebanyak 1.987 orang lulusan. Dari jumlah tersebut, ada 179 wisudawan yang lulus dengan predikat pujian (cumlaude). Rektor Universitas Syiah Kuala Samsul Rizal menyebutkan, Rabu dan Kamis (28-29/8), Unsyiah melepas ribuan mahasiswa yang sudah menyelesaikan pendidikan di berbagai strata. Kata dia, dalam upacara wisuda periode MeiJuli 2013 ini, Unsyiah akan melepas 1.987 orang lulusan, yang terdiri dari 169 lulusan Pascasarjana, 81 lulusan Pendidikan Profesi, 1.475 orang lulusan sarjana (S1), serta 262 orang Diploma III. “Hari ini Unsyiah akan melepas 991 orang hasil didikannya kembali kepada masyarakat.

Di antara mereka, terdapat 81 orang hasil pendidikan Profesi, 648 lulusan Sarjana S1, dan 262 lulusan Diploma III,” kata rektor. Lalu sambungnya, Unsyiah masih akan mewisuda 996 lulusan lagi pada Kamis (29/8) besok. “Secara keseluruhan, dalam upacara Wisuda Periode Mei-Juli 2013 ini, Unsyiah akan melepaskan 179 lulusan yang berhasil lulus dengan tingkat yudisium cumlaude (pujian). Sebanyak 90 orang lulusan cumlaude,” papar Samsul Rizal. 179 Lulusan terbaik itu berasal dari Fakultas Ekonomi 48 Fakultas Ekonomi, 2 FakultasTeknik, 10 Fakultas Kedokteran, 3 Fakultas Kedokteran Hewan, 18 Fakultas Pertanian, 4 Fakultas Matematika dan Ilmu Pengetahuan Alam, dan 4 orang dari Koordinatorat Kelautan dan Perikanan. (b07)

Di RSUD Teungku Peukan Tak Tersedia Dokter Gigi BLANGPIDIE (Waspada) : Rumah Sakit Umum Daerah (RSUD) Teungku Peukan, Abdya, dalam operasionalnya ternyata tidak memiliki dokter gigi, selama beberapa bulan terakhir, setelah dokter sebelumnya habis masa kontrak. Informasi yang diperoleh, Selasa (27/8), pasien penyakit gigi kecewa karena tidak bisa dilayani di rumah sakit yang sudah ditetapkan sebagai Badan Layanan Umum Daerah (BLUD) tersebut, termasuk yang menderita gangguan paru serta syaraf. Pasien penderita penyakit syaraf dan paru, terpaksa mengambil rujukan untuk berobat ke RSUD Cut Nyak Dhien, Aceh Barat, malah ada yang harus ke RSU Zainoel Abidin, Banda Aceh. Sedangkan pasien yang menderita penyakit gigi, berobat di puskesmas yang memiliki tenaga dokter gigi, seperti di Puskesmas Blangpidie dan puskesmas lainnya. Informasi lain menyebutkan bahwa di Puskesmas Blangpidie memiliki tenaga dokter gigi status PTT, namun tidak memiliki peralatan,

seperti kursi pasien gigi dan alat lain yang dibutuhkan dalam penanganan gigi. Masyarakat berharap Pemkab Abdya segera menangani persoalan kekosongan tenaga dokter tersebut. Bila dibiarkan akan berdampak buruk terhadap kesehatan masyarakat setempat. Dokter gigi yang tersedia di puskesmas-puskesmas, disarankan supaya ditarik ke RSUD Teugku Peukan, karena rumah sakit bantuan Pemerintah Korea tersebut, memiliki peralatan perawatan gigi yang tergolong lengkap. Kepala Tata Usaha (KTU) RSUD Teungku Peukan Abdya, Riat mengakui bahwa tenaga dokter ahli syaraf telah habis masa kontrak sejak enam bulan lalu dan dokter ahli paru dan dokter gigi sudah habis masa kontrak sekitar dua bulan lalu. Saat ini, katanya, Plt Direkur RSUD Teuku Peukan Ramli Bahar sudah melaporkan ke bupati dan berkoodinasi mencari tenaga dokter ahli di luar daerah yang bersedia bekerja di Abdya dengan perjanjian kontrak. (cb05)

Wirausaha Solusi Kurangi Pengangguran INGIN JAYA (Waspada): Bupati Aceh Besar Mukhlis Basyah mengatakan, pengembangan wirausaha adalah solusi mengurangi pengangguran. Karena itu, peran pemuda sangat penting dalam membantu menciptakan lapangan pekerjaan melalui wirausaha. Hal itu diungkapkan bupati dalam sambutan tertulisnya yang dibacakan Asisten Perekonomian dan Pembangunan Setdakab Samsul Bahri saat membuka Pelatihan Kewirausahaan Pemuda dilaksanakan 27-29 Agustus 2013 di Hotel Noris, Lambaro Kecamatan Ingin Jaya, Aceh Besar. Dia mengatakan, pelatihan dilaksanakan untuk meningkatkan minat para pemuda terhadap dunia enterpreneurship dan mau berwirausaha. “Harapan kita semua bahwa pemuda menjadi insan-insan kreatif yang tidak hanya mengharapkan pekerjaan sebagai pegawai (PNS) atau karyawan, namun mampu membuka lapangan kerja baru,” paparnya. Untuk itulah, Bupati Aceh Besar berharap para pemuda dapat memanfaatkan pelatihan dan kesempatan yang telah diberikan dalam rangka menumbuhkembangkan sikap mandiri dan jiwa wirausaha. Seperti diketahui, kegiatan tersebut digelar Dinas Kebudayaan Pariwisata Pemuda dan Olahraga (Disbudparpora) dan Dewan Pengurus Daerah Komite Nasional Pemuda Indonesia (DPD KNPI) Kabupaten Aceh Besar. Kadisparpora Aceh Besar M Ali diwakili Sekretaris Dinas Yusri mengatakan, pelatihan kewirausahaan merupakan tujuan sebagaimana dicita-citakan pemerintah pusat melalui Kementerian Pemuda dan Olahraga (Kemenpora). “Kita akui membangun karakter mental kewirausahaan pemuda memang tidaklah mudah, selain kesadaran pemuda, dukungan keluarga, lingkungan yang kondusif serta peran semua pihak lainnya yang sangat dibutuhkan,” katanya.

Ketua panitia pelaksana Khalid Wardana mengatakan, pelatihan yang dibekali dengan teori dan tinjauan lapangan diikuti 40 peserta terdiri dari kalangan pemuda dan pemudi yang memiliki bakat wirausaha tersebut bertujuan untuk menyiapkan dan meningkatkan pengetahuan serta mewujudkan potensi pemuda yang mandiri untuk menjadi pengusaha profesional. Pemateri pelatihan ini adalah orang-orang terampil dan wirausahaan, seperti Taufik (pemilik usaha Taufik Kupi), Suparno (pemilik kuliner Ayam Lepaas), TM Sunandar (perbengkelan), Cut Suryati (menjahit) dan Wira Darma dari HIPMI Aceh. (b05)

Dinas Kelautan-Perikanan Harus Aktif Akses Dana Pusat TAPAKTUAN (Waspada) : Bupati Aceh Selatan T Sama Indra mengatakan, Dinas Kelautan dan Perikanan daerahnya, harus pro-aktif dan strategis mengakses dukungan dana dari pusat, guna menunjang pembangunan infrastruktur yang tidak tertam-pung melalui APBK. Hal ini dimaksudkan dalam rangka mewujudkan percepatan pembangunan bidang kelautan dan perikanan. Sehingga potensi yang ada, tidak terlantar begitu saja, tanpa dimanfaatkan untuk meningkatkan kesejahteraan masyarakat nelayan. Hal itu dikemukakan bupati dalam sambutannya pada acara halal bi halal dan lepas sambut pejabat eselon II dan III di lingkungan Dinas Kelautan dan Perikanan Aceh Selatan di komplek kantor dinas tersebut kawasan TPI Batu Merah, Gampong Lhok Bengkuang, Tapaktuan, Senin (26/8). Bupati menilai kegiatan halal bi halal merupakantradisi positif,dijadikansebagaimomentum untuk saling memaafkan. (b30)


WASPADA Kamis 29 Agustus 2013

GM PT PLN Wilayah Dorong RTRW Kelistrikan di Aceh

Ketua Hanura Aceh Hadiri Pernikahan Agus-Bella BANDA ACEH (Waspada) : Ketua DPD Hanura Provinsi Aceh, Syafruddin Budiman dipastikan akan ikut menghadiri acara pernikahan Bella Saphira dan Mayor Jenderal H Agus Surya Bakti, Jumat (30/8) di Stabat, Sumut. “Tadi pagi Jenderal Agus sudah memastikan langsung jadwalnya ,” kata Syafruddin. Menurut Syafruddin, pasangan Bella, Agus. Bukanlah orang baru bagi masyarakat Aceh, Alumni Akabri 1984 itu pernah lama bertugas di Aceh, terakhir jenderal bintang dua itu menjabat Asintel Kodam IM dan kini Agus adalah salah satu Deputi di BNPT, sebuah lembaga yang mengurusi terorisme di Indonesia. Selain itu, sejumlah pejabat militer dan tokoh masyarakat Aceh juga dipastikan akan hadir. (b08)

Pemkab Bireuen Rampungkan KUA/PPAS Tahun 2014 BIREUEN (Waspada): Pemerintah Kabupaten Bireuen telah merampung perumusan Kebijakan Umum Anggaran/Plafon Perioritas Anggaran Sementara (KUA/PPAS) tahun 2014 untuk disampaikan ke Dewan Perwakilan Rakyat Kabupaten (DPRK) setempat. Bupati Bireuen, H. Ruslan M. Daud kepada Waspada, Rabu (28/8) antara lain mengatakan, sebelum KUA/PPAS ini disampaikan ke dewan untuk bahas, dia akan memanggil kembali para kepala SKPD supaya memaparkan kembali program-program pembangunan yang diusulkan untuk dikerjakan pada tahun 2014. “Buku KUA/PPAS sudah ada sama saya,” ucapnya. Dengan rampungnya KUA/PPAS ini, Ruslan berharap pengesahan Qanun Anggaran Pendapatan dan Belanja Kabupaten Bireuen tahun 2014 terlaksana tepat waktu dan semua program yang dilaksanakan dapat memberi manfaat kepada masyarakat di Kabupaten Bireuen.(b17)

Pemerkosa Gadis Ditangkap PANTONLABU (Waspada) : Satu dari tiga tersangka kasus pemerkosaan terhadap seorang gadis warga Kec. Tanah Jambo Aye, yang terjadi 17 Maret 2013 lalu ditangkap aparat Polsek Tanah Jambo Aye. Tersangka Ar, 25, warga Desa Pucok Alue Kec. Tanah Jambo Aye. Ayah satu anak itu ditangkap di dangau kebunnya, Desa Blang Seunong, pedalaman Pantee Bidari, Aceh Timur, Selasa (27/8) sekira pukul 02:00 dan kini ditahan di sel Mapolsek Tanah Jambo Aye. “Ar ini diduga orang pertama yang memerkosa korban. Setelah itu, baru digilir oleh tersangka Anw dan Rd, yang kini masih buron,” kata Kapolres Aceh Utara AKBP Gatot Sujono melalui Kapolsek Tanah Jambo Aye Iptu Mukhtar, kemarin. (b19)

Main Kartu Domino, Siswa Dibekuk LHOKSEUMAWE (Waspada): Karena cabut sekolah, sebanyak enam siswa SMK dan satu SMP di Kota Lhokseumawe dibekuk aparat Satpol PP di warnet dan pantai Ujung Blang, Rabu (28/8). Setelah diamankan ke kantor petugas dan dipanggil pihak dinas, kemudian dilepas. Kepala Satpol PP dan WH Lhokseumawe, M Irsyadi, Rabu (28/8) mengatakan, mereka menangkap siswa ini atas laporan masyarakat karena banyak anak sekolah berkeliaran di luar di saat jam belajar, dan nongkrong di warnet serta main kartu. “Kami tangkap mereka saat di warnet, dan di Pantai Ujung Blang sedang santai-santai. Setelah kami amankan, kami dapatkan kartu domino di dalam tas, handphone,” ujar Irsyadi. (cmk)

Kajari Bireuen Berhalal Bi Halal BIREUEN (Waspada) : Kepala Kejaksaan Negeri Bireuen Thohir menyelenggarakan Halal Bi Halal, Selasa (27/8). Halal Bi Halal keluarga besar Kejari Bireuen itu dihadiri Bupati Bireuen Ruslan M Daud, Wakil Ketua DPRK Syafruddin, Sekda Zulkifli. Kajari Bireuen Thohir dalam sambutannya antara lain mengatakan, acara Halal Bi Halal jamuan makan malam yang diselenggarakan keluarga besar Kejari Bireuen untuk mempererat silaturahmi keluarga besar Kejari Bireuen dengan seluruh pejabat di lingkungan Pemkab Bireuen yang sudah terjalin baik selama ini. (b12)

Mayat Lelaki Dibawa Ke RSUZA BIREUEN (Waspada) : Mayat lelaki tanpa identitas ditemukan warga Desa Barona Bale Panah terapung di Kruen Peusangan Teupin Mane, Kecamatan Juli dengan kaki terikat kain seprai, Sabtu (24/8) sudah dibawa ke RSUZA Banda Aceh untuk diotopsi. Direktur RSUD Fauziah Mukhtar Mars mengatakan, hingga Senin kemarin belum ada pihak keluarganya yang datang menjemput. Kapolres Bireuen AKBP Yuri Karsono mengatakan, kendati identitas mayat itu belum diketahui secara pasti, Polres BIreuen akan terus berupaya untuk mengetahui identitas korban dan menyelidiki akibat kematiannya. Melalui otopsi yang dilakukan diharapkan akan dapat membuka tabir yang belum jelas diduga korban pembunuhan. Hasil visum paramedis di RSUD dr Fauziah menyebutkan, di bagian tubuh korban terdapat dua luka tusuk dan dahi terdapat luka selebar dua sentimeter. (b12)

Kuala Raja Desa Binaan PMI Bireuen BIREUEN (Waspada) : Ketua PMI Cabang Bireuen Murdani telah memilih Desa Kuala Raja di Kecamatan Kuala, Bireuen, menjadi desa binaan Palang Merah Indonesia. Penetapan Desa Kuala Raja menjadi desa binaan PMI berlangsung di meunasah desa setempat, Minggu (25/8). Ketua PMI Bireuen Murdani mengatakan, desa binaan merupakan program khusus PMI yang mengamanahkan harus ada minimal satu desa untuk setiap kabupaten/kota. Untuk Kabupaten Bireuen, dipilih Desa Kuala Raja, dengan penilaian tersendiri dan sejumlah pertimbangan. Di antaranya keramahtamahan penduduknya. Penetapan Kuala Raja menjadi desa binaan PMI akan dibuat suatu MoU kesepakatan kerjasama yang ditandatangani pihaknya dengan perangkat Desa Kuala Raja. Sekretaris Desa Kuala Raja Jufrizal M Jafar mengucapkan terima kasih pada pihak PMI Bireuen yang telah memilih gampongnya sebagai desa binaan. (b12)

Tiba (flight, asal, waktu)

Garuda Indonesia

GA 0278 Medan GA 0142 Jakarta/Medan GA 0146 Jakarta/Medan

Lion Air

JT 304 Jakarta JT 306 Jakarta/Medan JT 396 Jakarta/Medan

Sriwijaya Air

SJ 010 Jakarta/Medan

Air Asia

QZ 8023 Medan AK 1305 Kuala Lumpur *

Fire Fly

FY 3401 Penang* * Setiap Senin, Rabu, Jumat dan Minggu.

Berangkat (flight, tujuan, waktu)

07:05 10:45 14:50

GA 0279 Medan GA 0143 Medan/Jakarta GA 0147 Medan/Jakarta

07:45 11:3 0 15:45

11:35 15:55 21:30

JT 397 Medan/Jakarta JT 307 Jakarta JT 305 Medan/Jakarta

06:00 12:15 16:35


SJ 011 Medan/Jakarta


12:00 11:20

QZ 8022 Medan AK 1306 Kuala Lumpur*

12:25 11:45


FY 3400 Penang*



Waspada/Aldn Nl

KETUA PWI Aceh, Tarmilin Usman menjelaskan dihadapan GM PT PLN Wilayah Aceh saat audiensi di kantor PLN, Lamprit, Banda Aceh, Selasa (27/8)

Pelayanan Publik Aceh Belum Berjalan Baik BANDA ACEH (Waspada): Pelayanan publik di Aceh belum berjalan sesuai kebijakan perundangundangan yang berlaku dan juga berbagai prinsip pelayanan publik yang ada. Buruknya pelayanan disebabkan mental serta akhlak para pegawainya. Hal itu dikatakan Khairani Arifin dari Pusat Studi Hukum dan HAM (PUSHAM) Unsyiah dalam seminar nasional yang diselenggarakan Ombudsman Aceh dan akademisi Unsyiah di gedung Fakultas Hukum Universitas Syiah Kuala, Rabu (28/8).

Seminar yang mengambil tema Peran Ombudsman Dalam Pengawasan Pelayanan Publik di Aceh menghadirkan tiga narasumber yakni, Azlani Agus,Wakil Ketua Ombudsman, Muzakkar, Asisten Administrasi Umum Sekretariat Provinai Aceh dan akademisi Unsyiah, Khairani Arifin. Menurut Khairani, untuk kebaikan pelayanan publik, sebaiknya Pemerintah Aceh secara berkala membuat survei Indeks Kepuasan Masyarakat serta memperbaikinya di berbagai unit pelayanan sesuai temuan IKM. Lalu, perlu juga menyediakan media komplain yang efektif yang memudahkan masyarakat menyampaikan keluhan dan saran untuk pelayanan

publik serta menggunakan anggaran yang cukup guna meningkatkan kualitas petugas pelayanan publik. Sebab, sambung dosen Fakultas Hukum Unsyiah ini, dalam sejumlah kasus, salah satunya keluarga miskin di Bireuen yang menikah di masa konflik berharap mendapatkan isbath nikah di Mahkamah Syariah setempat, tapi karena biaya cukup besar dan prosedur berbelit dan tidak dapat memperoleh sidang prodeo. Sementara dua pembicara lainnya yakni, Azlani lebih menjelaskan peran dan fungsi Ombudsman, sedangkan Muzakkar dari pihak pemerintah menjelaskan aturan normatif yang dipakai dalam memberi pelayanan publik. (b07)

Izin Industri Ekstraktif Aceh Masih Tumpang Tindih BANDAACEH(Waspaada); Sejumlah regulasi dalam industri ekstraaktif di Aceh dinilai masih tumpang tindih. Akibatnya kabupaten/kota di Aceh belum memperoleh keuntungan dari keberadaan industri ekstraaktif. Hal itu terungkap dalam diskusi mekanisme perizinan Industri Ekstraktif yang digelar Gerakan Anti Korupsi (GeRAK) Aceh bersama Pemerintah Aceh dan Aceh Besar, Rabu (28/8). Turut hadir Satuan Kerja Pemerintah Aceh, Aceh Besar serta lembaga swadaya masyarakat. “Dari diskusi di beberapa daerah kami menemukan adanya beberapa regulasi sektor pertambangan yang masih tumbang tindih, misalnya regulasi yang mengatur lahan per-

tambangan yang berbenturan dengan regulasi kehutanan tentang lahan,”kata Hayatuddin, Manager Program Advokasi Pendapatan Anggaran Aceh dari Ekstraktif GeRAK Aceh. Dikatakan, selain wilayah pertambangan yang sebahagian besar masuk dalam kawasan hutan, tumpang tindih perizinan disebabkan ketidakpahaman masyarakat mengenai industri ekstraktif. Padahal dari sisi pendapatan seluruh keuntungan dari keberadaan industri ekstraaktif harus dipergunakan untuk kesejahteraan masyarakat khususnya diwilayah pertambangan. “Perlu pemahaman dan kesepakatan bersama untuk menyeragamkan proses pembe-

rian izin agar menguntungkan daerah penghasil industri ekstraaktif,”ujar Hayatuddin. Acara yang berlangsung di Hotel The Pade tersebut bertujuan mencari pemahaman yang sama antara pemerintah Aceh dengan pemerintah Kabupaten/Kota di Aceh sesuai hasil diskusi yang telah dilakukan GeRAK. Sebelumnya diskusi juga dilakukan di beberapa daerah di antarannya Kabupaten Aceh Besar, Tengah, Barat, Tamiang, Timur, Selatan serta kabupaten Aceh Barat Daya. “Kita berharap ini menghasil rekomendasi yang sama untuk disampaikan ke Pemerintah Aceh maupun kabupaten/ kota sehingga bisa diterapkan dan ada keseragaman ke depan,”pungkasnya.(cb06)

Sambut SBY, Panitia PKA Ke-6 Persiapkan Rapai Pase LHOKSEUMAWE (Waspada): Panitia pelaksana Pekan Kesenian Aceh (PKA) ke-6 Provinsi Aceh telah menyepakati untuk menampilkan kesenian rapai pase untuk menyambut datangnya Presiden Susilo Bambang Yudhoyono (SBY) pada pembukaan PKA ke-6 di Banda Aceh yang akan dilaksanakan pada tanggal 21 September 2013. Hal itu disampaikan Nurdin Ismail, Ketua Dewan Kesenian Aceh (DKA) Kabupaten Aceh Utara. “Alhamdulillah, kemarin sudah ada satu kesimpulan dan kepastian bahwasanya panitia PKA ke 6 akan menampilkan kesenian rapai pase pada acara penyambutan Presiden SBY. Saya pikir sebuah kehormatan

bagi Kabupaten Aceh Utara,” kata Nurdin Ismail, Ketua DKA Aceh Utara. Bukan hanya itu, pada penampilan itu, panitia juga meminta Ketua DKA Aceh Utara, agar mau menampilkan beberapa kesenian lainnya seperti seureunee kalee dan beberapa musik lainnya untuk mengiringi rapai pase. Dan permintaan tersebut sudah disanggupi dan siap untuk ditampilkan di hadapan Presiden SBY. Menjawab Waspada, Nurdin mengatakan, pada PKA ke 6 Aceh Utara akan menampilkan beberapa kesenian dari Aceh Utara antara lain Alee Tunjang dari Kecamatan Tanah Pasir, Hikayat dari Syamtalira

Aron, Ranup Lampuan dari Lhoksukon, Mop-mop dari Muara Batu, Tari Legenda dari Dewantara, Rapai Geleng dari Baktya, dan tarian Seudati oleh Syeh Jamal. Ditanya mengapa panitia sangat berkeinginan untuk menampilkan rapai pase pada hari pembukaan, Nurdin mengatakan, rapai pase memiliki bentuk yang besar dengan suara yang enak untuk didengar. Dikatakannya, rapai berasal dari Persia. Awalnya bentuk rapai yang dikenal bentuknya kecil, namun karena masyarakat yang ditinggal di Pase berukuran besar, maka dirubah bentuknya menjadi besar disesuaikan dengan masyarakat setempat. (b18)

Ketika Hak Para Keucyiek “Diperkosa” SEJAK 2009, Pemkab Aceh Utara dan DPRK tidak menganggarkan lagi iuran Jamsostek untuk 852 keucyik gampong (desa). Besarnya iuran tersebut setiap tahun mendekati angka Rp1 miliar. Penghentian pembayaran iuran disebabkan Aceh Utara mengalami kekurangan anggaran, sehingga tidak mampu menutupi kebutuhan tersebut. Selain itu, Pemkab Aceh Utara juga berdalih, dihentikannya pembayaran iuran Jamsostek untuk 852 keucyiek karena dinilai pemborosan. Pasalnya, anggaran yang dikeluarkan tidak seimbang dengan hasil yang diperoleh. Begitupun, Pemda Aceh Utara tetap berkomitmen memberikan santunan kepada para keucyiek yang mengalami kecelakaan kerja. Namun, janji tersebut hingga kini belum pernah ditepati. Hal itu disampaikan Muksalmina, Ketua Asosiasi Keucyiek

Aceh Utara, Rabu (28/8). “Hingga kini lebih dari 30-an keusyiek yang mengalami musibah tidak mendapat santunan apapun dari Aceh Utara,” kata Muksalmina, Ketua Asgara. Seorang keucyiek mengemban tugas cukup berat. Keucyiek bukan hanya bertugas untuk memberesakan persoalan desa, tapi juga berkewajiban mendamaikan perkelahian warga. Menyadari tugas keucyiek mengandung risiko tinggi, pada tahun 2011, Asgara melaksanakan seminar mencari jalan mengembalikan kepesertaan keucyiek sebagai anggota Jamsostek. Kalau kepesertaan 852 keucyiek tidak dikembalikan, maka ke depan ada tindakan rill. Pasalnya, sudah cukup lama para kepala desa mencoba untuk bersabar. Karena itu, Bupati Aceh Utara Muhammad Thaib diminta untuk menganggarkan kembali dana Jamsostek pada 2014. “Selama ini, hak-hak kami

telah‘diperkosa’ oleh penguasa,” katanya. Bupati Aceh Utara Muhammad Thaib mengatakan, pihaknya sama sekali tidak pernah bermaksud untuk ‘memperkosa’ hak-hak 852 keucyiek. Dia mengaku ingin memakmurkan para keusyiek. Dia mengaku tidak bisa memberikan jawaban yang tepat dan itu menjadi tanggungjawab Asisten 1. Safwan, Kabag Pemerintah Gampong dan Mukim di Aceh Utara mengaku pihaknya tidak pernah ‘memperkosa’ hak para keucyiek karena meskipun iuran Jamsostek telah dihentikan, namun Pemda Aceh Utara masih memperhatikan mereka dengan memberikan uang habis masa jabatan Rp2,5 juta, uang kematian Rp13 juta dan uang kecelakaan yang besarnya tergantung kondisi yang dialami. Maimun Asnawi

BANDA ACEH (Waspada): Untuk pengembangan program listrik nasioal khususnya di Aceh sejumlah wilayah harus dimasukkan dalam RTRW (rencana tata ruang wilayah). Sehingga pembangunan transmisi PLN ada disemua tempat, seperti pantai barat, wilayah timur, tengah dan Banda Aceh. Untuk wilayah Subulussalam, selama ini pasokan arus listrik dari Sidikalang, sementara untuk ke Tapaktuan, Aceh Selatan terputus lantaran alasan masuk kawasan ekosistem leuser ( KEL) dan ke depan wilayah pantai barat dan selatan Aceh ini sudah memiliki transmisi sendiri. “Karena itu kita dorong menjadi RTRW dan RTRW kelistrikan Aceh itu harus segera disahkan,” kata General Manajer PT PLN Wilayah Aceh, Sulaiman Daud ketika menerima audiensi pengurus PWI Aceh, di gedung PLN setempat, Selasa (27/8). Didampingi Said Mukaram, Humas PLN Aceh dan Agung Murdifi, Manajer Niaga PLN Aceh, Sulaiman Daud menjelaskan tentang potensi sumber energi dan PLN terus berusaha membangun pembangkit-pembangkit listrik di Aceh. Mulai dari energi listrik terbarukan hingga memakai minyak dan gas. “Khusus potensi air di Aceh yang cukup besar dapat kita manfaatkan menjadi kebijakan kelistrikan di Aceh. Sebab, bila tidak dimanfaatkan, akan hilang percuma,” sebutnya. Sulaiman juga menyinggung PLTU Nagan Raya yang mempunya kapasitas 2 x 110 MW dan PLTA Peusangan dengan kapasitas 2 x 43 MW, sedangkan pembangkit listrik tenaga panas bumi Seulawah Agam potensinya juga tidak kalah besar. Sebaliknya, dia mengaku tidak berkompeten menjelaskan tentang PLTU Nagan Raya yang sampai sekarang belum opererasional. Ia hanya menyebut sudah tahap penyelesaian akhir. Dari

PLTU Nagan Raya ini nanti listriknya dialirkan ke Sungai Mas, Gempang, Tangse dan Bireunun yang dikoneksikan dengan transmisi SumutAceh. Sedangkan PLTA Peusangan yang ditargetkan selesai 2015 akan memenuhi kebutuhan listrik wilayah Tengah Aceh kemudian ditarik ke Juli, Bireuen dan terkoneksi dengan jaringan pantai timur Aceh. Bila kedua proyek itu selesai, menurutnya, Aceh mengalami surplus energi dan bisa dipasok untuk memenuhi kebutuhan listrik di Sumut. “2016 kita estimasikan Aceh alami surplus energi,” tambah Said Mukaram. Saat ini, kata Sulaiman kebutuhan listrik Aceh 350 MW (beban puncak) dan 100 MW masih dipasok dari Sumut, sedangkan kekurangan lainnya menggunakan pembangkit yang ada. Seperti saluran udara tegangan menengah(SUTM) berkapasitas 20.000 volt atau 20 KV, untuk wilayah Aceh tengah dan Banda Aceh. “Kita akui untuk suplay keutuhan listrik kepada pelanggan, kita masih sewa kepada pihak swasta sebesar 200 KW,” aku Sulaiman.

BIREUEN (Waspada): Panitia Pengawas Pemilu (Panwaslu) Kabupaten Bireuen yang direkrut oleh Badan Pengawas Pemilu (Bawaslu) Provinsi Aceh telah dilantik di Banda Aceh pada Selasa (20/8) bersamaan dengan Panwaslu kabupatan/kota lainnya se-Aceh, namun keberadaannya belum mendapat pengakuan diterima atau ditolak oleh Pemkab Bireuen. “Saya tidak dalam kapasitas menerima atau menolak Panwaslu yang telah dilantik ini sebelum ada kejelasannya dari Pemerintah Aceh,” ucap Bupati Bireuen, H Ruslan M. Daud di kediamannya, Rabu (28/8) . Pasalnya, Ruslan menjelaskan, dualisme perekrutan Panwaslu oleh DPRK dan Bawaslu yang belum ada titik temu dan hingga kini masih menunggu kejelasannya. “Aceh adalah bagian dari NKRI, tapi Aceh juga memiliki undang-undang khusus yaitu Undang-undang tentang Pemerintah Aceh (UUPA),” terang Ruslan M. Daud. Ruslan menjelaskan, UU tentang Pemerin-

tah Aceh adalah undang-undang kekhususan Aceh yang lahir menyusul perjanjian damai antara Pemerintah RI dengan GAM di Helsinky. Dimana, dalam uu ini juga mengatur tentang kewenangan DPRA dan DPRK untuk merekrut penyelenggara pemilu di Aceh. “Saya atas nama Pemerintah Kabupaten Bireuen juga tidak menginginkan ada pihak-pihak yang merasa dirugikan dan saya juga tidak ingin melanggar undang-undang,” jelas Ruslan seraya menambahkan, dari UUPA kemudian dibuat qanun oleh Pemerintah Aceh yang mengatur tentang penyelenggara pemilu di Aceh. “Sama seperti KIP juga direkrut oleh dewan,” ucapnya. Terkait dengan dukungan fasilitas dan tenaga sekretariat, Pemkab Bireuen juga belum dapat menentukan sikap. “Tadi mereka (anggota Panwaslu Bireuen—red) juga sudah menjumpai saya, dan saya sampaikan kita ikuti saja perkembangannya hingga ada kejelasannya dari Pemerintah Aceh,” ucap Ruslan M. Daud. (b17)

Tunggakan Listrik Rp95 M Jumlah pelanggan di Aceh sekitar 1,1 juta dan 95 persen diantaranya rumah tangga. Sisanya untuk industri, bisnis dan perkantoran. Menyinggung tunggakan rekening listrik masih tergolong besar. Per Juli 2013, disebutkan tembus angka Rp. 95 milyar, tunggakan. Rinciannya untuk rumah tangga sekitar lebih setengah (Rp. 46 m) yang menungggak rata-rata setiap bulan.diikuti Pemda, Rp. 20 M, dinas vertikal Rp. 12 m dan tunggakan untuk BUMN sekitar 165 juta. Untuk listrik pra bayar yang sudah diberlakukan sejak 2010 lalu tercatat 194,505 pelanggan dengan omset Rp.11,780 M per Juli 2013. (b01)

Bupati Bireuen: “Saya Tak Dalam Kapasitas Menerima Atau Menolak Panwaslu”

Kejari Lhoksukon Nominator Kejari Terbaik LHOKSUKON (Waspada): Tim dari Kejaksaan Agung (Kejagung) RI menyambangi kantor Kejaksaan Negeri LhoksukondiDesaReudeub,Lhoksukon, Aceh Utara, Rabu (28/8). Tim ini dipimpin Inspektur II Jaksa muda Pengawasan (Jamwas) Kejagung, I Ketut Arthana dan turut didampingi Asisten Pengawasan Kejaksaan Tinggi Aceh, Bambang Bachtiar. Waspada/Musyawir “Tim datang untuk melakukan penilaian karena kejari INSPEKTUR II Jamwas Kejagung I Ketut Arthana saat mengunjungi kita masuk 10 besar nominasi di kantor Kejari Lhoksukon, Rabu (28/8) Kejari Type B terbaik se-Indonesia tahun 2013,” kata Kepala Kejaksaan Negeri ngah), Pangkem (Sulawesi Selatan) dan Kejari (Kajari) Lhoksukon, Teuku Rahmatsyah, kemarin. Sungai Liat (Bangka Belitung). “Kita belum tahu kriteria apa saja yang dinilai. Adapun sembilan nominator lainnya, masing-masing, Kejari Wonosari (DIY), Cikarang Itu sebabnya, mohon dukungan dan doa dari (Jawa Barat), Kalianda (Lampung), Sangata (Kali- seluruh lapisan masyarakat Aceh Utara, agar kita mantan Timur), Bengkalis (Riau), Kayu Agung mendapat yang terbaik,” papar Teuku Rah(Sumatera Selatan), Sampit (Kalimantan Te- matsyah. (b19)

Dividen Bank Aceh Untuk Pemkab Aceh Utara Rp14 Miliar LHOKSEUMAWE (Waspada): Penyertaan modal Pemkab Aceh Utara untuk Bank Aceh mencapai Rp77,9 miliar. Sebagai kabupaten yang menempatkan dana terbesar kedua, setelah pemerintah provinsi tersebut, Aceh Utara mendapat dividen (laba) Rp14 miliar lebih. Kepala Bank Aceh Cabang Lhokseumawe Anshari, Rabu (28/8) mengatakan, penyertaan modal Pemkab Aceh Utara untuk Bank Aceh mencapai Rp77.954.050.000. Dana tersebut telah disalurkan kepada masyarakat, melalui kredit usaha. Akhir tahun 2012, Pemkab mendapat dividen (laba) lebih dari Rp14 miliar. Anshari juga menjelaskan, penyertaan modal Pemkab Aceh Utara merupakan terbesar kedua setelah modal dari Pemerintah Aceh. “Penyertaan modal Pemkab Aceh Utara menca-

pai 9 persen,” jelasnya. Penyertaan modal itu digunakan untuk berbagai usaha masyarakat melalui pinjaman kredit. Seperti, usaha perdagangan, pertanian, konstruksi dan berbagai usaha produktif lainnya. Muhammad Satari dari Panitia Anggaran (Panggar) DPRKAceh Utara mengatakan, penyertaan modal Pemkab Aceh Utara untuk bank dan BUMD mencapai Rp197.323.757.462. Dana tersebut ditempatkan sebagai investasi permanen untuk bank, PDAM Tirta Mon Pase, PD Bina Usaha dan BPR Sabee Meusampe. “Namun penyertaan modal di Bank Aceh yang mendapat hasil,” jelasnya. Sedangkan penempatan modal untuk perusahaan yang masuk dalam Bandan Usaha Milik Daerah (BUMD) hanya menguras uang rakyat. (b15)

Keluarga Keucyiek Keude Punteut Terima Santunan LHOKSEUMAWE (Waspada): Anak almarhum Nurdin Hasan, keucyik Gampong Keudee Punteut, Kecamatan Blang Mangat, Pemkot Lhokseumawe, Rabu (28/8) menerima santunan sebesar Rp26 juta dari PT Jamsostek Lhokseumawe diserahkan Tarmizi T Jalil, Kepala Jamsostek Lhokseumawe di ruang kerjanya. Tarmizi T Jalil melalui Yuli Agustina, Kepala Bidang PelaWaspada/Maimun Asnawi yanan PT Jamsostek LhokTARMIZI T Jalil, Kepala PT Jamsostek Lhokseumawe, Rabu (28/ seumawe menjelaskan, penyerahan santunan kematian 8) menyerahkan santunan jaminan kematian dan jaminan hari dan jaminan hari tua kepada tua sebesar Rp26 juta kepada Mimi Jumiati, anak dari almarhum tenaga kerja atas nama Nurdin Nurdin Hasan, Keucyiek Gampong Keudee Punteut. sebagai Keusyiek Keude Punteut, Blang Ma- tek kepada Mimi Jumiati, anak sulung dari almarngatsudah menjadi kewajiban pihaknya, karena hum. Semasa hidupnya, almarhum mening-galkan yang bersangkutan merupakan peserta PT lima anak. Kata Yuli, seharusnya dana santunan itu diberikan kepada istrinya, namun istrinya juga Jamsostek. Santunan Rp26 juta diserahkan PT Jamsos- telah meninggal dunia beberapa waktu lalu. (b18)



BNN Langsa Tes Urine 871 Mahasiswa STAIN Cot Kala

Pria Stres Kabur Dari RSJ PEUREULAK (Waspada): Abdurrahman, 30, pria asal Meunasah Keude, Peureulak, Kabupaten Aceh Timur yang mengalami gangguan jiwa dan juga sebagai pelaku penikaman dua bocah yaitu Arismunandar, Badruzzaman dan anggota TNI dari Koramil Sertu Yopie di Desa Lhok Dalam, Peureulak beberapa bulan lalu kini kabur dari Rumah Sakit Jiwa (RSJ) Banda Aceh. M Nur, 42, abang kandung Abdurrahman, Selasa (27/8) mengaku khawatir bila Abdurrahman bertingkah aneh. ‘’Apalagi sempat melukai orang lain, karena itu kami sangat berharap kepada pihak rumah sakit untuk segera menangkapnya kembali,’’ harapnya. Disampaikan, adiknya mengalami gangguan jiwa akibat konflik Aceh dan saat itu Abdurrahman masih duduk di bangku sekolah Madrasah Ibtidaiyah, lebih kurang sudah 5 kali dibawa berobat ke RSJ Banda Aceh, ketika di rumah sakit dan saat kembali ke rumah penyakit Abdurrahman kambuh kembali. (cri)

Tabrak Truk, Siswa SMK Tewas PEUREULAK (Waspada) : Muhammad Fajir, 17, siswa SMK di Langsa yang juga warga Lhokdalam, Kecamatan Peureulak, Kabupaten Aceh Timur meninggal dunia dalam kecelakaan lalu lintas di lintas jalan negara Medan- Banda Aceh, di Dang Dang Na, Peureulak, Rabu (28/8). Kapolres Aceh Timur AKBP Muhajir melalui Kasatlantas Iptu Tesyar Rhofadli menjelaskan, truk colt diesel yang tidak diketahui identitasnya melaju dari arah Banda Aceh menuju Medan dengan kecepatan rendah, sedangkan sepedamotor Yamaha Jupiter Z yang dikemudian korban melaju dari arah yang sama dengan kecepatan tinggi. “Setiba di TKP truk colt diesel membelokkan kendaarannya untuk menempel ban. Karena sudah kelewatan kemudian truk memundurkan kendaraannya, karena jarak sudah dekat pengendara tidak dapat mengendalikan kendaraannya sehingga menabrak truk,” kata Iptu Tesyar Rhofadli. Truk langsung melarikan diri dan sampai kini truk yang menewaskan Faijir belum ditemukan, sedangkan korban selanjutnya ditolong warga dan dilarikan ke RS Rehab Medik Peureulak, kemudian korban dirujuk ke RSUD Idi, namun nyawa pemuda ini juga tidak tertolong. (cri)

PPP Idi Pusat Kenduri Laot IDI (Waspada): Kenduri Laot yang dimotori Pengurus Panglima Laot Aceh Timur dipastikan dipusatkan di Pelabuhan Perikanan Pantai (PPP) Idi, Senin (2/9) mendatang. Selain menyantuni anak yatim, ribuan undangan telah disebarkan untuk kenduri tersebut. Kadis Kelautan dan Perikanan Aceh Timur Ahmad, Rabu (28/8) mengatakan, penyantunan anak yatim piatu menjadi agenda utama dalam Kenduri Laot kali ini. Namun, agenda peresmian Minapolitan oleh Menteri Kelautan dan Perikanan RI ke Aceh Timur hingga kini masih menunggu jadwal dari Dirjen Perikanan Tangkap. “Namun kita terus mempersiapkan kedatangan menteri ke Aceh Timur pada 2 September mendatang, namun apakah akan diwakili ataupun tidak ini masih menunggu konfirmasi dari Kementerian Kelautan dan Perikanan RI di Jakarta,” tutur Ahmad. (b24)

Beri Sanksi Bagi Pelanggar Lalu Lintas LANGSA (Waspada): Dalam upaya mensosialisasikan tertib lalu lintas kepada masyarakat, Polisi Lalulintas (Polantas) Polres Langsa memberikan sanksi menyanyikan lagu-lagu kebangsaan kepada pengendara yang melakukan pelanggaran lalu lintas ringan di Jalan Protokol A Yani depan Lapangan Merdeka Langsa, Rabu (28/8). Kapolres Langsa AKBP Hariadi melalui Kasatlantas AKP M Junaeddy Jhony di sela-sela razia mengatakan, razia ini merupakan razia rutin dalam rangka penertiban kelengkapan kendaraan bermotor terhadap warga di jalan umum. Hanya saja, katanya, cara yang kita lakukan sedikit berbeda dari biasanya, yaitu untuk pelanggaran ringan selain kita berikan pembinaan dan peringatan untuk melengkapi kelengkapan kendaraan juga kita berikan sanksi menyanyikan lagu-lagu kebangsaan. Dijelaskannya, tujuan sanksi menyanyikan lagu kebangsaan adalah sebagai upaya untuk mengajak masyarakat agar mengingat kembali nilai-nilai nasionalisme. Juga sebagai media untuk mendidik kesadaran masyarakat dalam tertib berlalu lintas, karena itu bagian dari nilai nasionalisme juga. (m43)


KEPALA BNN Langsa AKBP NavriYulenni, SH MH (kanan) ketika memeriksa hasil tes urine mahasiwa Cot Kala di kampus setempat, Rabu (28/8).

Massa Gagalkan Penurunan Bendera Bintang-Bulan LHOKNIBONG (Waspada): Sekelompok massa yang didominasi anggota dan simpatisan Partai Aceh menggagalkan upaya penurunan bendera Bintang Bulan oleh polisi dan TNI di seputaran Lhoknibong— pusat kecamatan Pantee Bidari, Aceh Timur, Selasa (27/8) malam. Massa yang berjumlah sekitar seratus orang itu sempat mendatangi Mapolsek Pantee Bidari untuk meminta kembali

bendera yang sudah diturunkan. Tapi, aksi itu berjalan tertib dan massa langsung bubar setelah aparat menunda menurunkan bendera yang tersisa dan mengembalikan bendera yang sudah diturunkan. Informasi dihimpun Waspada, Rabu (28/8), aparat gabungan dari Polsek dan Koramil Pantee Bidari, awalnya menurunkan bendera Bintang Bulan di pinggiran jalan nasional, mulai dari Desa Putoh Sa hingga komplek pasar buah Lhoknibong—Karona. Penurunan dimulai sekitar pukul 22:00. Saat tiba di kawasan Karona, tiba-tiba timbul protes

dari warga dan sejurus kemudian massa langsung berkumpul di seputaran SPBU Lhoknibong. Massa meminta bekas bendera GAM itu tidak diturunkan karena sudah ada payung hukumyangdisahkanDPRA,yakni Qanun nomor 3 Tahun 2013. Kapolres Aceh Timur AKBP Muhajir yang dihubungi wartawan mengimbau masyarakat bersabar dan menahan diri. “Kita akan terus berusaha berkoordinasi dan memberi pengertian kepada semua pihak, termasuk KPA agar bendera itu tidak dikibarkan dulu, karena masih dalam pembahasan di pusat,” katanya. (b19)

Waspada/Dede JR

Camping CAI Digelar Di Bukit Rata LHOKSEUMAWE (Waspada): Sekitar 200 pemuda di Kota Lhokseumawe dan perwakilan tiap kabupaten/kota di Aceh mengikuti Perkemahan Akhir Tahun (Permata) ke-34 di Bukit Rata, Lhokseumawe, mulai Rabu sampai Jumat (30/8). Acara Cinta Alam Indonesia (CAI) Permata XXXIV dibukaTaufan mewakiliWali Kota Lhokseumawe, di TPA Al Izzah, Bukit Rata, Rabu (28/8). Dan dihadiri lebih dari 200 perserta dan pengu-rus LDII dariKotaLhokseumawedanKabupatenAcehUtarasertaperwakilan pengurus dari berbagai kabupaten/kota di Aceh. Ketua Dewan PimpinanWilayah (DPW) Aceh Burhan didampingi Ketua DPD Lhokseumawe Nurdin mengatakan, perkemahan ini dilakukan untuk mendidik anak-anak usia dini, remaja dan pemuda supaya berakhlak mulia dan timbul ketakwaannya. Kegiatan perkemahan ini dilakukan setiap tahun sekali untuk membekali remaja atau pengurus LDII. Tahun sebelumnya juga dilakukan di Lhokseumawe dan telah berturut-turut selama empat kali. (cmk)

Dinkes Aceh Singkil Latih Tenaga Ass.Entemologi PULAU BANYAK (Waspada) : Dinas Kesehatan Aceh Singkil melaksanakan pelatihan tenaga asisten entemologi, untuk masing- masing pusat kesehatan masyarakat (PKM) yang dilaksanakan di Kecamatan Pulau Banyak . Kadis Kesehatan Aceh Singkil Edy Widodo melalui Kasi Penanggulangan Penyakit Menular Munawarsyah, Rabu (28/ 8) di Pulau Banyak mengatakan, tujuan pelatihan tersebut adalah untuk meningkatkan sumber daya petugas di masing – masing puskesmas, dalam rangka mewujudkan eliminasi malaria Kabupaten Aceh Singkil tahun 2014. Di mana untuk pencapaian eliminasi malaria di Kabupaten Aceh Singkil khususnya Kecamatan Pulau Banyak, Munawarsyah mengatakan, dibutuhkan usaha dan tahapan kegiatan yang terintegrasi, baik kegiatan diagnosis terapi, penangulangan faktor resiko, surveilans kasus dan penyelidikan epidemiologi. (cdin)

LANGSA (Waspada): Badan Narkotika Nasional (BNN) Langsa melakukan tes urine kepada 871 mahasiswa semeter II Sekolah Tinggi Agama Islam Negeri ( STAIN) Zawiyah Cot Kala Langsa di aula kampus Jalan Kampus Merandeh Kota Langsa, Rabu (28/8) sekira pukul 09:00. Sebelumnya, 871 mahasiswa dites urine mendapatkan pencerahan dari Kepala BNN LangsaAKBPNavriYulenni,SH.MHuntukmemotivasi, tes urine yang dilakukan adalah kewajiban bagi warga kampus untuk memberantas peredaran dan penyalahgunaan narkoba di kampus. “Hal ini juga berkaitan dengan data BNN Pusat yang menyatakan, pengedar dan bandar narkoba memiliki pangsa pasar besar di kalangan mahasiswa dan pelajar sehingga untuk menghindari dan mencegahnya diperlukan pengenalan jenis narkoba dan cara pencegahannya serta dilakukan tes urine sebagai wujud bahwa kampus STAIN Cot Kala sudah siap untuk berperang melawan pengedar narkoba di kalangan kampus,” kata Navri. Dijelaskan Navri lagi, ada 165 jenis narkotika yang sudah masuk dalam Undang-undang Narkotika dan Psikotropika termasuk bahan zat adiktif, sedangkan Lembaga Narkotik Internasional mencatat ada 251 jenis nakotika dan zat adiktif yang beredar di dunia untuk menjadi menjajah generasi muda yang tidak siap berperang lawan narkotika. “Dari beberapa ratus jenis narkotika itu kesemuanya menyerang otak manusia dengan efek bermacam-macam model ketergantungan

sehingga jutaan sel syaraf otak bisa dilumpuhkan secara perlahan tapi pasti rusaknya otak kita berikut syarafnya. Dari analisis kejiwaan dan medis menyebutkan bahwa otak manusia hanya seberat 2 kilogram saja yang harusnya di jaga baikbaik bukan di racuni karena masalah sesaat dan melampiaskannya dengan terjun jadi pemakai narkoba yang berkelanjutan yang berakibat kita sendiri yang merusak organ penting itu,” sebutnya lagi. Dikatakan Navri, untuk mencari keakuratan hasil tes urine, BNN Langsa membagi mahasiswa ke dalam 4 kelompok yakni A terdiri dari 308 mahasiswa program studi (Muamalah, Ashwalul Syak Siah, Perbankkan Syariah). Untuk kelompok B terdiri dari 182 mahasiswa yang berasal dari program studi Bimbingan Konseling Islam. Kelompok C terdiri dari 204 mahasiswa dari program studi Pendidikan Matematika, Pendidikan Agama Islam. Kelompok D terdiri dari 177 Mahasiswa di tambah 150 Dosen dan Tata Usaha dimana mahasiswa di kelompok ini berasal dari program studi Pendidikan Bahasa Arab, Bahasa Inggris, Pendidikan guru Madrasah Ibtidaiyah,” kata AKBP Navri. Ketua STAIN Cot Kala Langsa Dr H Zulkarnaini, MA mengatakan, pihak civitas akademika STAIN Cot Kala memberikan apresiasi kepada Kepala BNN Langsa AKBP Navry Yulenni, SH. MH beserta rombongannya yang telah menjalin kerjasama selama ini dan tes urine mahasiswa ini sudah sejak tahun 2012 yang lalu dan bersifat rutin serta kontinu.(m43)

Ormas Islam Kecam Pemukulan Kadis SI BANDA ACEH (Waspada) : Sejumlah pimpinan Ormas Islam di Aceh mengecam oknumoknum yang telah menantang penegakan Syariat Islam dengan cara melakukan pemukulan terhadap Kadis Syariat Islam Kota Langsa. “Kami mengecam tindakan anarkis terhadap Kadis Syariat Islam Kota Langsa tersebut,” ungkap sejumlah pimpinan Ormas di Aceh dalam siaran pers diterima Waspada, Rabu (28/8). Para pimpinan ormas Islam Aceh yang mengecam tindakan itu masing-masing, Hasanuddin Yusuf Adan (Ketua DDA), M Iqbal (PII), Amwar Citra (IKAPDA), T Zulkhairi (RTA), M Fadhil Rahmi (IKAT Aceh), Yusran Hadi (MIUMIi) serta Basri Efendi dari (Pemuda De-

wan Dakwah). Hasanuddin Yusuf mengatakan, tindakan para pelaku anti syariat yang telah menantang penegakan Syariat Islam dengan melakukan pemukulan terhadap Ibrahim Latief, tidak bisa diterima. Yusran Hadi, Ketua MIUMI mengatakan, perlu dukungan penuh dalam bentuk aksi nyata dari pemerintah provinsi dan Pemko Langsa serta kepolisian dan semua pihak untuk membackup penerapan syariat. Kecaman senada juga dinyatakan IKAT Aceh yang menyebutkan, aksi anarkis terhadap Kadis SI Langsa harus ada kebijakan tegas dari wali kota. (b02)

Dukungan SI Langsa Datang Gubernur Diminta Ambil Sikap Soal Bendera Dari Lhokseumawe

IDI (Waspada): Guna menghindari pemahaman ditengahtengah masyarakat awam soal Bendera dan Lambang Aceh pasca pengesahan oleh DPR Aceh, Gubernur Aceh dr. H. Zaini Abdullah diminta ambil sikap. “Jika Gubernur Aceh dan DPR Aceh tidak mampu memperjuangkan bendera Aceh berkibar, lebih baik batalkan saja qanun Bendera dan Lambang Aceh. Sehingga masyarakat tidak lagi mengibarkannya. Ini harus diselesaikan, supaya masyarakat berada dalam posisi aman,” kata Ketua Fraksi Partai Aceh (PA) DPR-K Aceh Timur, Maimun Idris kepada Waspada Rabu (28/8) di Idi. Hal itu perlu disikapi Gubernur Aceh dan para pimpinan DPR Aceh, karena bendera dan lambing Aceh jelas keberadaannya di Aceh. “Jika regulasinya sudah ada, kenapa juga bendera itu tidak bisa dikibarkan. Persoalan Jakarta belum menge-

Ketua Fraksi Partai Aceh DPR Aceh, Maimun Idris, SE. sahkannya dengan berbagai alasan itu sah-sah saja, tapi inilah tugas DPR Aceh dan Gubernur Aceh memperjuangkannya, sehingga pengibarannya sah di Aceh,” sebut Maimun lagi. Ditambahkan lagi, awalnya bendera Bulan Bintang telah dikibarkan masyarakat berdasarkan penetapan Dewan Perwakilan Rakyat Aceh (DPRA). Namun menjelang peringatan Hari Ulang Tahun (HUT) RI Ke 68

bertepatan dengan 17 Agustus 2013 masyarakat dibantu aparat keamanan menurunkan seluruh bendera Bintang Bulan yang telah berkibar diseluruh Aceh. “Agar saling menghormati maka pada saat HUT RI kemarin masyarakat telah menurunkan bendera Aceh, bahkan rencana pengibaran Bintang Bulan pada 15 Agustus 2013 saat Peringatan 8 tahun usia MoU Helsinki juga kita batalkan.Kedua hal ini kita lakukan karena menghargai pemerintah, tapi kenapa sampai sekarangpun belum boleh kita kibarkan,” kata Maimun yang akrap disapa Stokhom itu. Menurut dia, Gubernur Aceh sudah seharusnya mengambilkebijakandankeputusan dengan wewenang dan kekuasaannyasoalbendera,se-babmasyarakat di seluruh Aceh belakanganterusterjadiperangmulut dengan aparat keamanan yang menurunkanbenderaAceh.(b24)

Wagub Hadiri Pengukuhan Pamong Praja IPDN

KASAT LANTAS Polres Langsa AKP M Junaeddy Jhony sedang mendengarkan salah seorang pelanggar menyanyikan lagu kebangsaan, Rabu (28/8)

WASPADA Kamis 29 Agustus 2013

BANDA ACEH (Waspada): Wakil Gubernur (Wagub) Aceh Muzakir Manaf menghadiri undangan mengikuti acara pengukuhan pamong praja muda Institut Pemerintahan Dalam Negeri (IPDN), Rabu (28/8) di Jatinangor, Kota Bandung, Jawa Barat. Acara itu dihadiri Presiden RI Susilo Bambang Yudhoyono (SBY) yang bertindak sebagai inspektur upacara. Sementara BupatiSimeulue,Riswandipercayakansebagaikomandanupacara pengukuhan pamong praja. Kepala Biro Humas Pemerintah Aceh Nurdin F Joes menginformasikan, penguku-

han lulusan IPDN angkatan ke20 itu berlangsung semarak karena dihadiri para gubernur seIndonesia, plus orangtua/wali. Turut mendampingiWagub Aceh, antara lain Kepala Badan Kepegawaian Pendidikan dan Pelatihan (BKPP) Aceh,TARasyid, serta hadir Ketua DPRA, Tgk H HasbiAbdullahbersamaistriyang ditempatkan di posisi VVIP. Wagub pada kesempatan itu menyempatkan diri bertemu calon purna muda IPDN asal Aceh. Kesempatan itu dimanfaatkan Wagub untuk bersilaturahmi dengan orangtua/wali peserta pendidikan IPDN.

Muzakir Manaf yang kerap disapa Mualem ini mengimbau calon pamong praja muda yang akan lulus dan yang masih belajar pendidikan agar mengedepankan disiplin, kecakapan, kesetiaan, serta dedikasi tinggi dalam mengambil peran tugas di lingkungan unit kerja nantinya. “Suatu saat saudara-saudara akan bekerja di daerah masing-masing. Bekerjalah dengan baik,” pesan Mualem. Dari data yang ada, peserta IPDN asal pendaftaran Aceh pada angkatan ke-20 berjumlah 72 orang. (b06)

Kehadiran Akademi Komunitas Pacu Kemajuan Kota Langsa LANGSA (Waspada): Kehadiran Akademi Komunitas (AK) menjadi pemacu kemajuan Kota Langsa dan ini sangat positif atas respon Pemko Langsa menerima program unggulan Kementrian Pendidikan dan Kebudayaan RI. Pemko Langsa sangat positif menerima program ini, karena dengan adanya sekolah ini akan dapat memacu kemajuan Kota Langsa. Demikian Direktur Politeknik Lhokseumawe, Ridwan di ruang rapat Wali Kota Langsa, Rabu, (28/8). Menurutnya, sesuai dengan UU No. 12 tahun 2012 tentang pendidikan nasional, maka Akademi Komunitas ini sebagai salah satu upaya menaikkan Angka Partisipasi Kasar (APK) pendidikan tinggi dengan mendirikan lebih kurang 20 akademi komunitas di seluruh kab/kota di Indonesia. Lanjutnya, Kota Langsa menjadi salah satu penerima program unggulan itu, sebagai upaya menjalankan amanat

Undang-undang Pendidikan Tinggi. “AK bertujuan penguatan pendidikan tinggi untuk mendongkrak AKP pendidikan Tinggi,” terang Ridwan. Ditambahkanya, untuk sementara waktu AK Langsa masih di bawah Politeknik Lhokseumawe, sampai batas waktu nanti bisa berdiri sendiri berubah menjadi Politeknik Langsa. Akademi Komunitas Langsa ini akan mulai membuka pendaftaran penerimaan mahasiswa baru sejaksekarangdikantorsekretariat yang ditunjuk Pemko Langsa. Untuk tenaga pengajar di Akedemi Komunitas Langsa itu 30 persen adalah dosen Politeknik Lhokseumawe, sementara sisanya adalah guru-guru SMK di Langsa yang sudah lulus sertifikasi yang akan kita buat nantinya. “Upaya ini kita harapkan agar, ke depan begitu AK langsa berdiri sendiri maka sudah banyak dosen putra daerah yang dapat mengajar nantinya. Keberadaan AK ini nantinya akan

membuka peluang dan mempermudah para calon mahasiswa karena tidak ada batasan umur yang bersekolah disini,” ujarnya. Wali Kota Tgk Usman Abdullah,SE dalam kesempatan yang sama mengaku bersyukur sekali atas berdirinya Akademi Komunitas di Langsa dan Pemko sangat berkomitmen untuk membangun AK ini menjadi politeknik. Bahkan, terangnya lebih lanjut, Pemko sudah menyiapkan 5 hektare lahan, untuk pengembangan AK ini agar berkembang maju. Sementara waktu berkaitan dengan fasilitas proses perkuliahan di kampus Akademi Komunitas akan dilaksanakandiSMKIIdanSMAPGRI. “Mulai besok sudah dibuka pendaftaran, untuk selanjutnya akan digelar tes bagi calon mahasiswa yang lebih kurang diterima 400 orang untuk dua jurusan yaitu las dan listrik,” imbuhnya. (m43)

LHOKSEUMAWE (Waspada): Lembaga Islam, termasuk pengurus Masjid Islamic Center (MIC) Lhokseumawe memberi dukungan kepada Kepala Dinas Syariat Islam Langsa atas kasus pengeroyokan, Minggu malam lalu. Ketua Umum MIC Lhokseumawe, Tgk Ramli M Amin, SAg kepada Waspada, Rabu (28/ 8) mengatakan, pihaknya siap memberi dukungan kepada Kadis Syariat Islam Ibrahim Latif sertaWilayatul Hisbah Kota Langsa. Mereka dikeroyok oleh dikeroyok sekumpulan pemuda mabuk ketika membubarkan pesta keyboard di Gampong Karang Anyar, Kecamatan Langsa Baro.

“Kami mengharapkan kepada pak Ibrahim Latif, tidak pernah gentar dengan cacian, dan ancaman itu warisan Rasul kepada penegak kebenaran. Sebagaimana firmannya, Kalau kamu membantu agama Allah, Allah akan membantu kamu, dan Allah akan mengokohkan pendirianmu,” ujar Tgk Ramli. Dia juga berharap kepada penegak hukum agar mengusut tuntas kasus berlabel premanisme anti syariat Islam, dan pendukung maksiat di bumi Serambi Mekkah. Selanjutnya dia mengimbau umat muslim di Aceh dan luar Aceh agar berdoa serta memberi dukungan kepada penegak syariat Islam. (cmk)

Mopen Parkir Di Kawasan Terlarang Ditilang BIREUEN (Waspada) : Dinas Perhubungan Komunikasi dan Informatika Bireuen Rabu (28/ 9) menurunkan petugas menertibkan mobil penumpang umum dan kendaraan pribadi yang masih membandel parkir di kawasan terlarang dalam kota Bireuen. Kadishub Bireuen Raden Yus Rusmadi ST, melalui Kabid Perhubungan Darat, Laut dan Udara Said Sulaiman,SE yang dikonfirmasi Waspada di kantornya, Rabu (28/8) membenarkan menurunkan petugas penertiban terhadap mopen umum dan mobil pribadi yang masih membandel parkir di kawasan terlarang. Pihak Dishub akan melakukan sosialiasi selama seminggu setelah itu akan diambil tindakan tegas tilang ditempat sesuai peraturan lalu lintas yang berlaku terhadap mopen umum dan mobil pribadi yang masih menmbandel parkir di kawasan terlarang. Dikatakan, kawasan terlarang dalam kota Bireuen yang sudah dipasang rambu lalu lintas dilarang parkir sebagai kawasan padat arus lalu lintas, jalan keluar terminal bus BIreuen, kawasan Simpang IV hingga depan simpang Telkom dan jalan T Hamzah Bendahara depan Pendopo Bupati hingga RSUD Dr Fauziah. Di jalan keluar terminal bus Bireuen selama ini sudah dijadikan terminal parkir mopen L300 trayek Bireuen – Banda Aceh – Takengon,

di kawasan Simpang IV hingga Simpang Telkom setiap hari parkir mopen umum labi-labi menaikkan dan menurunkan penumpang sangat berbahaya terhadap terjadinya kecelakaan bagi pengguna jalan. Sementara di kawasan jalan T Hamzah Bendahara depan Pendopo Bupati hingga RSUD Dr Fauziah selama ini parkir kendaraan-kendaraan pribadi yang berkunjung ke warung kopi masih parkir di ruas jalan terlarang. Padahal halaman warung kopi di kawasan warung kopi cukup luas tersedia. Di kawasan pasar pagi depan kantor Kodim, Korps Polisi Militer dan RSUD dr Fauziah masih cukup banyak kendaraan truk, pick up pengangkut barang sayur mayor dan barang lainnya parkir dikawasan terlarang akan terus ditertibkan. Sesuai surat peringatan terkahir Kadishub Bireuen No 551/233/2013 tanggal 15 Agustus 2013 sudah disampaikan kepada seluruh sopir dan perusahaaan angkutan penumpang umum di Bireuen untuk ditaati, setiap mopen umum wajib masuk terminal bus. Mopen umum L-300 dan labi-labi menaikkan dan menurunkan penumpang harus parkir di terminal bus. Sosialsi penertiban dilaksanakan hingga akhir Agustus, dan awal Septembr semua mopen umum, mobil pribadi masih membandel parkir dikawasan terlarantg akan ditilang sesuai dengan ketentuan yang yang berlaku, ujar Said Sulaiman. (b12)

Saiful Dilantik Jadi Pj Keuchik Gampong Blang LANGSA ( Waspada): Camat Langsa Kota, Muhammad Jamil Gade melantik dan mengambil sumpah jabatan Saiful sebagai Pj Keuchik Gampong Blang, Kecamatan Langsa Kota. Saiful menggantikan keuchik yang lama, Selmi Priadi, dimana yang bersangkutan maju sebagai calon legislatif 2014, di aula Kantor Camat Langsa Kota, Rabu (28/8). Jamil dalam sambutannya mengatakan, salah satu syarat untuk penetapan Daftar Calon Tetap (DCT) terhadap para keuchik yang mencalonkan diri sebagai Waspada/dede caleg pada pemilu 2014. CAMAT Langsa Kota Muhammad Jamil Gade sedang mengambil Salah satu persyaratan sumpah jabatan Pj.Geuchik Gampong Blang Saiful di Aula Kantor yang harus dipenuhi oleh Camat Langsa Kota keuchik dan perangkat gampong adalah menyerahkan surat pernyataan pengunduran diri sebagai 2014 tanggal 8 april 2014 serta Qanun Kota Langsa keuchik dan perangkat gampong apabila yang nomor 6 tahun 2010 tentang pemerin-tahan bersangkutan mencalonkan diri sebagai caleg Gampong,” paparnya. CamatLangsaKotaatasnamapemerintahKota baik tingkat DPRK, DPRA, DPR, DPD, tahun 2014. “Hal ini sesuai surat Gubernur No 274/11362 Langsa juga menyampaikan ucapan terima kasih tentang pernyataan pengunduran diri sebagai kepada keuchik yang lama dan selamat bertugas kepala desa dan perangkat desa pada pemilu pada Pj. Keuchik yang baru dilantik. (m43)

Waspada,kamis 29 agustus 2013  
Read more
Read more
Similar to
Popular now
Just for you